data_4ZTZ
# 
_entry.id   4ZTZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ZTZ         
WWPDB D_1000209899 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          4ZTU 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4ZTZ 
_pdbx_database_status.recvd_initial_deposition_date   2015-05-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Szymanski, M.R.' 1 
'Yin, Y.W.'       2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_id_ASTM           EMJODG 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            34 
_citation.language                  ? 
_citation.page_first                1959 
_citation.page_last                 ? 
_citation.title                     
;Structural basis for processivity and antiviral drug toxicity
in human mitochondrial DNA replicase
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.15252/embj.201591520 
_citation.pdbx_database_id_PubMed   26056153 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Szymanski, M.R.' 1 
primary 'Kuznestov, V.B.' 2 
primary 'Shumate, C.K.'   3 
primary 'Meng, Q.'        4 
primary 'Lee, Y.-S.'      5 
primary 'Patel, G.'       6 
primary 'Patel, S.S.'     7 
primary 'Yin, Y.W.'       8 
# 
_cell.entry_id           4ZTZ 
_cell.length_a           217.600 
_cell.length_b           217.600 
_cell.length_c           165.709 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4ZTZ 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase subunit gamma-1'                                                    138037.703 1 2.7.7.7 ? 
'UNP residues 30-1239' ? 
2 polymer     man 'DNA polymerase subunit gamma-2, mitochondrial'                                     53655.164  2 2.7.7.7 ? ? ? 
3 polymer     syn 'DNA (25-MER)'                                                                      8235.281   1 ?       ? ? ? 
4 polymer     syn 
;DNA (5'-D(P*AP*AP*GP*AP*CP*GP*AP*GP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*GP*TP*AP*C)-3')
;
7421.821   1 ?       ? ?                      ? 
5 non-polymer syn 'MAGNESIUM ION'                                                                     24.305     2 ?       ? ? ? 
6 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                                                  467.157    1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Mitochondrial DNA polymerase catalytic subunit,PolG-alpha'                                                         
2 'DNA polymerase gamma accessory 55 kDa subunit,p55,Mitochondrial DNA polymerase accessory subunit,MtPolB,PolG-beta' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MVPASDPSDGQRRRQQQQQQQQQQQQQPQQPQVLSSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQ
KHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVA
IPEERALVFAVAVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVG
HNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWL
DISSVNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGML
EMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPA
TASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPG
PSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQL
MPQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMENLRAAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCW
FFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRH
PDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFA
GMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAA
TKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSD
IPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYR
AALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTK
GSLEKRSQPGPAAALEHHHHHH
;
;MVPASDPSDGQRRRQQQQQQQQQQQQQPQQPQVLSSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQ
KHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVA
IPEERALVFAVAVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVG
HNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWL
DISSVNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGML
EMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPA
TASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPG
PSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQL
MPQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMENLRAAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCW
FFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRH
PDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFA
GMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAA
TKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSD
IPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYR
AALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTK
GSLEKRSQPGPAAALEHHHHHH
;
A   ? 
2 'polypeptide(L)'        no no  
;MDAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGV
ELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLREN
LLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWR
KFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDR
GMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSS
LEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNVAAALEHHHHHH
;
;MDAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGV
ELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLREN
LLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWR
KFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDR
GMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSS
LEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNVAAALEHHHHHH
;
B,C ? 
3 polydeoxyribonucleotide no no  
;(DG)(DC)(DG)(DA)(DT)(DA)(DC)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DC)(DT)(DC)
(DG)(DT)(DC)(DT)(DT)(DT)(DT)
;
GCGATACGGCACTGGCCCTCGTCTTTT T   ? 
4 polydeoxyribonucleotide no yes 
;(DA)(DA)(DA)(DA)(DG)(DA)(DC)(DG)(DA)(DG)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)
(DG)(DT)(DA)(DOC)
;
AAAAGACGAGGGCCAGTGCCGTAC P   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    VAL n 
1 3    PRO n 
1 4    ALA n 
1 5    SER n 
1 6    ASP n 
1 7    PRO n 
1 8    SER n 
1 9    ASP n 
1 10   GLY n 
1 11   GLN n 
1 12   ARG n 
1 13   ARG n 
1 14   ARG n 
1 15   GLN n 
1 16   GLN n 
1 17   GLN n 
1 18   GLN n 
1 19   GLN n 
1 20   GLN n 
1 21   GLN n 
1 22   GLN n 
1 23   GLN n 
1 24   GLN n 
1 25   GLN n 
1 26   GLN n 
1 27   GLN n 
1 28   PRO n 
1 29   GLN n 
1 30   GLN n 
1 31   PRO n 
1 32   GLN n 
1 33   VAL n 
1 34   LEU n 
1 35   SER n 
1 36   SER n 
1 37   GLU n 
1 38   GLY n 
1 39   GLY n 
1 40   GLN n 
1 41   LEU n 
1 42   ARG n 
1 43   HIS n 
1 44   ASN n 
1 45   PRO n 
1 46   LEU n 
1 47   ASP n 
1 48   ILE n 
1 49   GLN n 
1 50   MET n 
1 51   LEU n 
1 52   SER n 
1 53   ARG n 
1 54   GLY n 
1 55   LEU n 
1 56   HIS n 
1 57   GLU n 
1 58   GLN n 
1 59   ILE n 
1 60   PHE n 
1 61   GLY n 
1 62   GLN n 
1 63   GLY n 
1 64   GLY n 
1 65   GLU n 
1 66   MET n 
1 67   PRO n 
1 68   GLY n 
1 69   GLU n 
1 70   ALA n 
1 71   ALA n 
1 72   VAL n 
1 73   ARG n 
1 74   ARG n 
1 75   SER n 
1 76   VAL n 
1 77   GLU n 
1 78   HIS n 
1 79   LEU n 
1 80   GLN n 
1 81   LYS n 
1 82   HIS n 
1 83   GLY n 
1 84   LEU n 
1 85   TRP n 
1 86   GLY n 
1 87   GLN n 
1 88   PRO n 
1 89   ALA n 
1 90   VAL n 
1 91   PRO n 
1 92   LEU n 
1 93   PRO n 
1 94   ASP n 
1 95   VAL n 
1 96   GLU n 
1 97   LEU n 
1 98   ARG n 
1 99   LEU n 
1 100  PRO n 
1 101  PRO n 
1 102  LEU n 
1 103  TYR n 
1 104  GLY n 
1 105  ASP n 
1 106  ASN n 
1 107  LEU n 
1 108  ASP n 
1 109  GLN n 
1 110  HIS n 
1 111  PHE n 
1 112  ARG n 
1 113  LEU n 
1 114  LEU n 
1 115  ALA n 
1 116  GLN n 
1 117  LYS n 
1 118  GLN n 
1 119  SER n 
1 120  LEU n 
1 121  PRO n 
1 122  TYR n 
1 123  LEU n 
1 124  GLU n 
1 125  ALA n 
1 126  ALA n 
1 127  ASN n 
1 128  LEU n 
1 129  LEU n 
1 130  LEU n 
1 131  GLN n 
1 132  ALA n 
1 133  GLN n 
1 134  LEU n 
1 135  PRO n 
1 136  PRO n 
1 137  LYS n 
1 138  PRO n 
1 139  PRO n 
1 140  ALA n 
1 141  TRP n 
1 142  ALA n 
1 143  TRP n 
1 144  ALA n 
1 145  GLU n 
1 146  GLY n 
1 147  TRP n 
1 148  THR n 
1 149  ARG n 
1 150  TYR n 
1 151  GLY n 
1 152  PRO n 
1 153  GLU n 
1 154  GLY n 
1 155  GLU n 
1 156  ALA n 
1 157  VAL n 
1 158  PRO n 
1 159  VAL n 
1 160  ALA n 
1 161  ILE n 
1 162  PRO n 
1 163  GLU n 
1 164  GLU n 
1 165  ARG n 
1 166  ALA n 
1 167  LEU n 
1 168  VAL n 
1 169  PHE n 
1 170  ALA n 
1 171  VAL n 
1 172  ALA n 
1 173  VAL n 
1 174  CYS n 
1 175  LEU n 
1 176  ALA n 
1 177  GLU n 
1 178  GLY n 
1 179  THR n 
1 180  CYS n 
1 181  PRO n 
1 182  THR n 
1 183  LEU n 
1 184  ALA n 
1 185  VAL n 
1 186  ALA n 
1 187  ILE n 
1 188  SER n 
1 189  PRO n 
1 190  SER n 
1 191  ALA n 
1 192  TRP n 
1 193  TYR n 
1 194  SER n 
1 195  TRP n 
1 196  CYS n 
1 197  SER n 
1 198  GLN n 
1 199  ARG n 
1 200  LEU n 
1 201  VAL n 
1 202  GLU n 
1 203  GLU n 
1 204  ARG n 
1 205  TYR n 
1 206  SER n 
1 207  TRP n 
1 208  THR n 
1 209  SER n 
1 210  GLN n 
1 211  LEU n 
1 212  SER n 
1 213  PRO n 
1 214  ALA n 
1 215  ASP n 
1 216  LEU n 
1 217  ILE n 
1 218  PRO n 
1 219  LEU n 
1 220  GLU n 
1 221  VAL n 
1 222  PRO n 
1 223  THR n 
1 224  GLY n 
1 225  ALA n 
1 226  SER n 
1 227  SER n 
1 228  PRO n 
1 229  THR n 
1 230  GLN n 
1 231  ARG n 
1 232  ASP n 
1 233  TRP n 
1 234  GLN n 
1 235  GLU n 
1 236  GLN n 
1 237  LEU n 
1 238  VAL n 
1 239  VAL n 
1 240  GLY n 
1 241  HIS n 
1 242  ASN n 
1 243  VAL n 
1 244  SER n 
1 245  PHE n 
1 246  ASP n 
1 247  ARG n 
1 248  ALA n 
1 249  HIS n 
1 250  ILE n 
1 251  ARG n 
1 252  GLU n 
1 253  GLN n 
1 254  TYR n 
1 255  LEU n 
1 256  ILE n 
1 257  GLN n 
1 258  GLY n 
1 259  SER n 
1 260  ARG n 
1 261  MET n 
1 262  ARG n 
1 263  PHE n 
1 264  LEU n 
1 265  ASP n 
1 266  THR n 
1 267  MET n 
1 268  SER n 
1 269  MET n 
1 270  HIS n 
1 271  MET n 
1 272  ALA n 
1 273  ILE n 
1 274  SER n 
1 275  GLY n 
1 276  LEU n 
1 277  SER n 
1 278  SER n 
1 279  PHE n 
1 280  GLN n 
1 281  ARG n 
1 282  SER n 
1 283  LEU n 
1 284  TRP n 
1 285  ILE n 
1 286  ALA n 
1 287  ALA n 
1 288  LYS n 
1 289  GLN n 
1 290  GLY n 
1 291  LYS n 
1 292  HIS n 
1 293  LYS n 
1 294  VAL n 
1 295  GLN n 
1 296  PRO n 
1 297  PRO n 
1 298  THR n 
1 299  LYS n 
1 300  GLN n 
1 301  GLY n 
1 302  GLN n 
1 303  LYS n 
1 304  SER n 
1 305  GLN n 
1 306  ARG n 
1 307  LYS n 
1 308  ALA n 
1 309  ARG n 
1 310  ARG n 
1 311  GLY n 
1 312  PRO n 
1 313  ALA n 
1 314  ILE n 
1 315  SER n 
1 316  SER n 
1 317  TRP n 
1 318  ASP n 
1 319  TRP n 
1 320  LEU n 
1 321  ASP n 
1 322  ILE n 
1 323  SER n 
1 324  SER n 
1 325  VAL n 
1 326  ASN n 
1 327  SER n 
1 328  LEU n 
1 329  ALA n 
1 330  GLU n 
1 331  VAL n 
1 332  HIS n 
1 333  ARG n 
1 334  LEU n 
1 335  TYR n 
1 336  VAL n 
1 337  GLY n 
1 338  GLY n 
1 339  PRO n 
1 340  PRO n 
1 341  LEU n 
1 342  GLU n 
1 343  LYS n 
1 344  GLU n 
1 345  PRO n 
1 346  ARG n 
1 347  GLU n 
1 348  LEU n 
1 349  PHE n 
1 350  VAL n 
1 351  LYS n 
1 352  GLY n 
1 353  THR n 
1 354  MET n 
1 355  LYS n 
1 356  ASP n 
1 357  ILE n 
1 358  ARG n 
1 359  GLU n 
1 360  ASN n 
1 361  PHE n 
1 362  GLN n 
1 363  ASP n 
1 364  LEU n 
1 365  MET n 
1 366  GLN n 
1 367  TYR n 
1 368  CYS n 
1 369  ALA n 
1 370  GLN n 
1 371  ASP n 
1 372  VAL n 
1 373  TRP n 
1 374  ALA n 
1 375  THR n 
1 376  HIS n 
1 377  GLU n 
1 378  VAL n 
1 379  PHE n 
1 380  GLN n 
1 381  GLN n 
1 382  GLN n 
1 383  LEU n 
1 384  PRO n 
1 385  LEU n 
1 386  PHE n 
1 387  LEU n 
1 388  GLU n 
1 389  ARG n 
1 390  CYS n 
1 391  PRO n 
1 392  HIS n 
1 393  PRO n 
1 394  VAL n 
1 395  THR n 
1 396  LEU n 
1 397  ALA n 
1 398  GLY n 
1 399  MET n 
1 400  LEU n 
1 401  GLU n 
1 402  MET n 
1 403  GLY n 
1 404  VAL n 
1 405  SER n 
1 406  TYR n 
1 407  LEU n 
1 408  PRO n 
1 409  VAL n 
1 410  ASN n 
1 411  GLN n 
1 412  ASN n 
1 413  TRP n 
1 414  GLU n 
1 415  ARG n 
1 416  TYR n 
1 417  LEU n 
1 418  ALA n 
1 419  GLU n 
1 420  ALA n 
1 421  GLN n 
1 422  GLY n 
1 423  THR n 
1 424  TYR n 
1 425  GLU n 
1 426  GLU n 
1 427  LEU n 
1 428  GLN n 
1 429  ARG n 
1 430  GLU n 
1 431  MET n 
1 432  LYS n 
1 433  LYS n 
1 434  SER n 
1 435  LEU n 
1 436  MET n 
1 437  ASP n 
1 438  LEU n 
1 439  ALA n 
1 440  ASN n 
1 441  ASP n 
1 442  ALA n 
1 443  CYS n 
1 444  GLN n 
1 445  LEU n 
1 446  LEU n 
1 447  SER n 
1 448  GLY n 
1 449  GLU n 
1 450  ARG n 
1 451  TYR n 
1 452  LYS n 
1 453  GLU n 
1 454  ASP n 
1 455  PRO n 
1 456  TRP n 
1 457  LEU n 
1 458  TRP n 
1 459  ASP n 
1 460  LEU n 
1 461  GLU n 
1 462  TRP n 
1 463  ASP n 
1 464  LEU n 
1 465  GLN n 
1 466  GLU n 
1 467  PHE n 
1 468  LYS n 
1 469  GLN n 
1 470  LYS n 
1 471  LYS n 
1 472  ALA n 
1 473  LYS n 
1 474  LYS n 
1 475  VAL n 
1 476  LYS n 
1 477  LYS n 
1 478  GLU n 
1 479  PRO n 
1 480  ALA n 
1 481  THR n 
1 482  ALA n 
1 483  SER n 
1 484  LYS n 
1 485  LEU n 
1 486  PRO n 
1 487  ILE n 
1 488  GLU n 
1 489  GLY n 
1 490  ALA n 
1 491  GLY n 
1 492  ALA n 
1 493  PRO n 
1 494  GLY n 
1 495  ASP n 
1 496  PRO n 
1 497  MET n 
1 498  ASP n 
1 499  GLN n 
1 500  GLU n 
1 501  ASP n 
1 502  LEU n 
1 503  GLY n 
1 504  PRO n 
1 505  CYS n 
1 506  SER n 
1 507  GLU n 
1 508  GLU n 
1 509  GLU n 
1 510  GLU n 
1 511  PHE n 
1 512  GLN n 
1 513  GLN n 
1 514  ASP n 
1 515  VAL n 
1 516  MET n 
1 517  ALA n 
1 518  ARG n 
1 519  ALA n 
1 520  CYS n 
1 521  LEU n 
1 522  GLN n 
1 523  LYS n 
1 524  LEU n 
1 525  LYS n 
1 526  GLY n 
1 527  THR n 
1 528  THR n 
1 529  GLU n 
1 530  LEU n 
1 531  LEU n 
1 532  PRO n 
1 533  LYS n 
1 534  ARG n 
1 535  PRO n 
1 536  GLN n 
1 537  HIS n 
1 538  LEU n 
1 539  PRO n 
1 540  GLY n 
1 541  HIS n 
1 542  PRO n 
1 543  GLY n 
1 544  TRP n 
1 545  TYR n 
1 546  ARG n 
1 547  LYS n 
1 548  LEU n 
1 549  CYS n 
1 550  PRO n 
1 551  ARG n 
1 552  LEU n 
1 553  ASP n 
1 554  ASP n 
1 555  PRO n 
1 556  ALA n 
1 557  TRP n 
1 558  THR n 
1 559  PRO n 
1 560  GLY n 
1 561  PRO n 
1 562  SER n 
1 563  LEU n 
1 564  LEU n 
1 565  SER n 
1 566  LEU n 
1 567  GLN n 
1 568  MET n 
1 569  ARG n 
1 570  VAL n 
1 571  THR n 
1 572  PRO n 
1 573  LYS n 
1 574  LEU n 
1 575  MET n 
1 576  ALA n 
1 577  LEU n 
1 578  THR n 
1 579  TRP n 
1 580  ASP n 
1 581  GLY n 
1 582  PHE n 
1 583  PRO n 
1 584  LEU n 
1 585  HIS n 
1 586  TYR n 
1 587  SER n 
1 588  GLU n 
1 589  ARG n 
1 590  HIS n 
1 591  GLY n 
1 592  TRP n 
1 593  GLY n 
1 594  TYR n 
1 595  LEU n 
1 596  VAL n 
1 597  PRO n 
1 598  GLY n 
1 599  ARG n 
1 600  ARG n 
1 601  ASP n 
1 602  ASN n 
1 603  LEU n 
1 604  ALA n 
1 605  LYS n 
1 606  LEU n 
1 607  PRO n 
1 608  THR n 
1 609  GLY n 
1 610  THR n 
1 611  THR n 
1 612  LEU n 
1 613  GLU n 
1 614  SER n 
1 615  ALA n 
1 616  GLY n 
1 617  VAL n 
1 618  VAL n 
1 619  CYS n 
1 620  PRO n 
1 621  TYR n 
1 622  ARG n 
1 623  ALA n 
1 624  ILE n 
1 625  GLU n 
1 626  SER n 
1 627  LEU n 
1 628  TYR n 
1 629  ARG n 
1 630  LYS n 
1 631  HIS n 
1 632  CYS n 
1 633  LEU n 
1 634  GLU n 
1 635  GLN n 
1 636  GLY n 
1 637  LYS n 
1 638  GLN n 
1 639  GLN n 
1 640  LEU n 
1 641  MET n 
1 642  PRO n 
1 643  GLN n 
1 644  GLU n 
1 645  ALA n 
1 646  GLY n 
1 647  LEU n 
1 648  ALA n 
1 649  GLU n 
1 650  GLU n 
1 651  PHE n 
1 652  LEU n 
1 653  LEU n 
1 654  THR n 
1 655  ASP n 
1 656  ASN n 
1 657  SER n 
1 658  ALA n 
1 659  ILE n 
1 660  TRP n 
1 661  GLN n 
1 662  THR n 
1 663  VAL n 
1 664  GLU n 
1 665  GLU n 
1 666  LEU n 
1 667  ASP n 
1 668  TYR n 
1 669  LEU n 
1 670  GLU n 
1 671  VAL n 
1 672  GLU n 
1 673  ALA n 
1 674  GLU n 
1 675  ALA n 
1 676  LYS n 
1 677  MET n 
1 678  GLU n 
1 679  ASN n 
1 680  LEU n 
1 681  ARG n 
1 682  ALA n 
1 683  ALA n 
1 684  VAL n 
1 685  PRO n 
1 686  GLY n 
1 687  GLN n 
1 688  PRO n 
1 689  LEU n 
1 690  ALA n 
1 691  LEU n 
1 692  THR n 
1 693  ALA n 
1 694  ARG n 
1 695  GLY n 
1 696  GLY n 
1 697  PRO n 
1 698  LYS n 
1 699  ASP n 
1 700  THR n 
1 701  GLN n 
1 702  PRO n 
1 703  SER n 
1 704  TYR n 
1 705  HIS n 
1 706  HIS n 
1 707  GLY n 
1 708  ASN n 
1 709  GLY n 
1 710  PRO n 
1 711  TYR n 
1 712  ASN n 
1 713  ASP n 
1 714  VAL n 
1 715  ASP n 
1 716  ILE n 
1 717  PRO n 
1 718  GLY n 
1 719  CYS n 
1 720  TRP n 
1 721  PHE n 
1 722  PHE n 
1 723  LYS n 
1 724  LEU n 
1 725  PRO n 
1 726  HIS n 
1 727  LYS n 
1 728  ASP n 
1 729  GLY n 
1 730  ASN n 
1 731  SER n 
1 732  CYS n 
1 733  ASN n 
1 734  VAL n 
1 735  GLY n 
1 736  SER n 
1 737  PRO n 
1 738  PHE n 
1 739  ALA n 
1 740  LYS n 
1 741  ASP n 
1 742  PHE n 
1 743  LEU n 
1 744  PRO n 
1 745  LYS n 
1 746  MET n 
1 747  GLU n 
1 748  ASP n 
1 749  GLY n 
1 750  THR n 
1 751  LEU n 
1 752  GLN n 
1 753  ALA n 
1 754  GLY n 
1 755  PRO n 
1 756  GLY n 
1 757  GLY n 
1 758  ALA n 
1 759  SER n 
1 760  GLY n 
1 761  PRO n 
1 762  ARG n 
1 763  ALA n 
1 764  LEU n 
1 765  GLU n 
1 766  ILE n 
1 767  ASN n 
1 768  LYS n 
1 769  MET n 
1 770  ILE n 
1 771  SER n 
1 772  PHE n 
1 773  TRP n 
1 774  ARG n 
1 775  ASN n 
1 776  ALA n 
1 777  HIS n 
1 778  LYS n 
1 779  ARG n 
1 780  ILE n 
1 781  SER n 
1 782  SER n 
1 783  GLN n 
1 784  MET n 
1 785  VAL n 
1 786  VAL n 
1 787  TRP n 
1 788  LEU n 
1 789  PRO n 
1 790  ARG n 
1 791  SER n 
1 792  ALA n 
1 793  LEU n 
1 794  PRO n 
1 795  ARG n 
1 796  ALA n 
1 797  VAL n 
1 798  ILE n 
1 799  ARG n 
1 800  HIS n 
1 801  PRO n 
1 802  ASP n 
1 803  TYR n 
1 804  ASP n 
1 805  GLU n 
1 806  GLU n 
1 807  GLY n 
1 808  LEU n 
1 809  TYR n 
1 810  GLY n 
1 811  ALA n 
1 812  ILE n 
1 813  LEU n 
1 814  PRO n 
1 815  GLN n 
1 816  VAL n 
1 817  VAL n 
1 818  THR n 
1 819  ALA n 
1 820  GLY n 
1 821  THR n 
1 822  ILE n 
1 823  THR n 
1 824  ARG n 
1 825  ARG n 
1 826  ALA n 
1 827  VAL n 
1 828  GLU n 
1 829  PRO n 
1 830  THR n 
1 831  TRP n 
1 832  LEU n 
1 833  THR n 
1 834  ALA n 
1 835  SER n 
1 836  ASN n 
1 837  ALA n 
1 838  ARG n 
1 839  PRO n 
1 840  ASP n 
1 841  ARG n 
1 842  VAL n 
1 843  GLY n 
1 844  SER n 
1 845  GLU n 
1 846  LEU n 
1 847  LYS n 
1 848  ALA n 
1 849  MET n 
1 850  VAL n 
1 851  GLN n 
1 852  ALA n 
1 853  PRO n 
1 854  PRO n 
1 855  GLY n 
1 856  TYR n 
1 857  THR n 
1 858  LEU n 
1 859  VAL n 
1 860  GLY n 
1 861  ALA n 
1 862  ASP n 
1 863  VAL n 
1 864  ASP n 
1 865  SER n 
1 866  GLN n 
1 867  GLU n 
1 868  LEU n 
1 869  TRP n 
1 870  ILE n 
1 871  ALA n 
1 872  ALA n 
1 873  VAL n 
1 874  LEU n 
1 875  GLY n 
1 876  ASP n 
1 877  ALA n 
1 878  HIS n 
1 879  PHE n 
1 880  ALA n 
1 881  GLY n 
1 882  MET n 
1 883  HIS n 
1 884  GLY n 
1 885  CYS n 
1 886  THR n 
1 887  ALA n 
1 888  PHE n 
1 889  GLY n 
1 890  TRP n 
1 891  MET n 
1 892  THR n 
1 893  LEU n 
1 894  GLN n 
1 895  GLY n 
1 896  ARG n 
1 897  LYS n 
1 898  SER n 
1 899  ARG n 
1 900  GLY n 
1 901  THR n 
1 902  ASP n 
1 903  LEU n 
1 904  HIS n 
1 905  SER n 
1 906  LYS n 
1 907  THR n 
1 908  ALA n 
1 909  THR n 
1 910  THR n 
1 911  VAL n 
1 912  GLY n 
1 913  ILE n 
1 914  SER n 
1 915  ARG n 
1 916  GLU n 
1 917  HIS n 
1 918  ALA n 
1 919  LYS n 
1 920  ILE n 
1 921  PHE n 
1 922  ASN n 
1 923  TYR n 
1 924  GLY n 
1 925  ARG n 
1 926  ILE n 
1 927  TYR n 
1 928  GLY n 
1 929  ALA n 
1 930  GLY n 
1 931  GLN n 
1 932  PRO n 
1 933  PHE n 
1 934  ALA n 
1 935  GLU n 
1 936  ARG n 
1 937  LEU n 
1 938  LEU n 
1 939  MET n 
1 940  GLN n 
1 941  PHE n 
1 942  ASN n 
1 943  HIS n 
1 944  ARG n 
1 945  LEU n 
1 946  THR n 
1 947  GLN n 
1 948  GLN n 
1 949  GLU n 
1 950  ALA n 
1 951  ALA n 
1 952  GLU n 
1 953  LYS n 
1 954  ALA n 
1 955  GLN n 
1 956  GLN n 
1 957  MET n 
1 958  TYR n 
1 959  ALA n 
1 960  ALA n 
1 961  THR n 
1 962  LYS n 
1 963  GLY n 
1 964  LEU n 
1 965  ARG n 
1 966  TRP n 
1 967  TYR n 
1 968  ARG n 
1 969  LEU n 
1 970  SER n 
1 971  ASP n 
1 972  GLU n 
1 973  GLY n 
1 974  GLU n 
1 975  TRP n 
1 976  LEU n 
1 977  VAL n 
1 978  ARG n 
1 979  GLU n 
1 980  LEU n 
1 981  ASN n 
1 982  LEU n 
1 983  PRO n 
1 984  VAL n 
1 985  ASP n 
1 986  ARG n 
1 987  THR n 
1 988  GLU n 
1 989  GLY n 
1 990  GLY n 
1 991  TRP n 
1 992  ILE n 
1 993  SER n 
1 994  LEU n 
1 995  GLN n 
1 996  ASP n 
1 997  LEU n 
1 998  ARG n 
1 999  LYS n 
1 1000 VAL n 
1 1001 GLN n 
1 1002 ARG n 
1 1003 GLU n 
1 1004 THR n 
1 1005 ALA n 
1 1006 ARG n 
1 1007 LYS n 
1 1008 SER n 
1 1009 GLN n 
1 1010 TRP n 
1 1011 LYS n 
1 1012 LYS n 
1 1013 TRP n 
1 1014 GLU n 
1 1015 VAL n 
1 1016 VAL n 
1 1017 ALA n 
1 1018 GLU n 
1 1019 ARG n 
1 1020 ALA n 
1 1021 TRP n 
1 1022 LYS n 
1 1023 GLY n 
1 1024 GLY n 
1 1025 THR n 
1 1026 GLU n 
1 1027 SER n 
1 1028 GLU n 
1 1029 MET n 
1 1030 PHE n 
1 1031 ASN n 
1 1032 LYS n 
1 1033 LEU n 
1 1034 GLU n 
1 1035 SER n 
1 1036 ILE n 
1 1037 ALA n 
1 1038 THR n 
1 1039 SER n 
1 1040 ASP n 
1 1041 ILE n 
1 1042 PRO n 
1 1043 ARG n 
1 1044 THR n 
1 1045 PRO n 
1 1046 VAL n 
1 1047 LEU n 
1 1048 GLY n 
1 1049 CYS n 
1 1050 CYS n 
1 1051 ILE n 
1 1052 SER n 
1 1053 ARG n 
1 1054 ALA n 
1 1055 LEU n 
1 1056 GLU n 
1 1057 PRO n 
1 1058 SER n 
1 1059 ALA n 
1 1060 VAL n 
1 1061 GLN n 
1 1062 GLU n 
1 1063 GLU n 
1 1064 PHE n 
1 1065 MET n 
1 1066 THR n 
1 1067 SER n 
1 1068 ARG n 
1 1069 VAL n 
1 1070 ASN n 
1 1071 TRP n 
1 1072 VAL n 
1 1073 VAL n 
1 1074 GLN n 
1 1075 SER n 
1 1076 SER n 
1 1077 ALA n 
1 1078 VAL n 
1 1079 ASP n 
1 1080 TYR n 
1 1081 LEU n 
1 1082 HIS n 
1 1083 LEU n 
1 1084 MET n 
1 1085 LEU n 
1 1086 VAL n 
1 1087 ALA n 
1 1088 MET n 
1 1089 LYS n 
1 1090 TRP n 
1 1091 LEU n 
1 1092 PHE n 
1 1093 GLU n 
1 1094 GLU n 
1 1095 PHE n 
1 1096 ALA n 
1 1097 ILE n 
1 1098 ASP n 
1 1099 GLY n 
1 1100 ARG n 
1 1101 PHE n 
1 1102 CYS n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ILE n 
1 1106 HIS n 
1 1107 ASP n 
1 1108 GLU n 
1 1109 VAL n 
1 1110 ARG n 
1 1111 TYR n 
1 1112 LEU n 
1 1113 VAL n 
1 1114 ARG n 
1 1115 GLU n 
1 1116 GLU n 
1 1117 ASP n 
1 1118 ARG n 
1 1119 TYR n 
1 1120 ARG n 
1 1121 ALA n 
1 1122 ALA n 
1 1123 LEU n 
1 1124 ALA n 
1 1125 LEU n 
1 1126 GLN n 
1 1127 ILE n 
1 1128 THR n 
1 1129 ASN n 
1 1130 LEU n 
1 1131 LEU n 
1 1132 THR n 
1 1133 ARG n 
1 1134 CYS n 
1 1135 MET n 
1 1136 PHE n 
1 1137 ALA n 
1 1138 TYR n 
1 1139 LYS n 
1 1140 LEU n 
1 1141 GLY n 
1 1142 LEU n 
1 1143 ASN n 
1 1144 ASP n 
1 1145 LEU n 
1 1146 PRO n 
1 1147 GLN n 
1 1148 SER n 
1 1149 VAL n 
1 1150 ALA n 
1 1151 PHE n 
1 1152 PHE n 
1 1153 SER n 
1 1154 ALA n 
1 1155 VAL n 
1 1156 ASP n 
1 1157 ILE n 
1 1158 ASP n 
1 1159 ARG n 
1 1160 CYS n 
1 1161 LEU n 
1 1162 ARG n 
1 1163 LYS n 
1 1164 GLU n 
1 1165 VAL n 
1 1166 THR n 
1 1167 MET n 
1 1168 ASP n 
1 1169 CYS n 
1 1170 LYS n 
1 1171 THR n 
1 1172 PRO n 
1 1173 SER n 
1 1174 ASN n 
1 1175 PRO n 
1 1176 THR n 
1 1177 GLY n 
1 1178 MET n 
1 1179 GLU n 
1 1180 ARG n 
1 1181 ARG n 
1 1182 TYR n 
1 1183 GLY n 
1 1184 ILE n 
1 1185 PRO n 
1 1186 GLN n 
1 1187 GLY n 
1 1188 GLU n 
1 1189 ALA n 
1 1190 LEU n 
1 1191 ASP n 
1 1192 ILE n 
1 1193 TYR n 
1 1194 GLN n 
1 1195 ILE n 
1 1196 ILE n 
1 1197 GLU n 
1 1198 LEU n 
1 1199 THR n 
1 1200 LYS n 
1 1201 GLY n 
1 1202 SER n 
1 1203 LEU n 
1 1204 GLU n 
1 1205 LYS n 
1 1206 ARG n 
1 1207 SER n 
1 1208 GLN n 
1 1209 PRO n 
1 1210 GLY n 
1 1211 PRO n 
1 1212 ALA n 
1 1213 ALA n 
1 1214 ALA n 
1 1215 LEU n 
1 1216 GLU n 
1 1217 HIS n 
1 1218 HIS n 
1 1219 HIS n 
1 1220 HIS n 
1 1221 HIS n 
1 1222 HIS n 
2 1    MET n 
2 2    ASP n 
2 3    ALA n 
2 4    GLY n 
2 5    GLN n 
2 6    PRO n 
2 7    GLU n 
2 8    LEU n 
2 9    LEU n 
2 10   THR n 
2 11   GLU n 
2 12   ARG n 
2 13   SER n 
2 14   SER n 
2 15   PRO n 
2 16   LYS n 
2 17   GLY n 
2 18   GLY n 
2 19   HIS n 
2 20   VAL n 
2 21   LYS n 
2 22   SER n 
2 23   HIS n 
2 24   ALA n 
2 25   GLU n 
2 26   LEU n 
2 27   GLU n 
2 28   GLY n 
2 29   ASN n 
2 30   GLY n 
2 31   GLU n 
2 32   HIS n 
2 33   PRO n 
2 34   GLU n 
2 35   ALA n 
2 36   PRO n 
2 37   GLY n 
2 38   SER n 
2 39   GLY n 
2 40   GLU n 
2 41   GLY n 
2 42   SER n 
2 43   GLU n 
2 44   ALA n 
2 45   LEU n 
2 46   LEU n 
2 47   GLU n 
2 48   ILE n 
2 49   CYS n 
2 50   GLN n 
2 51   ARG n 
2 52   ARG n 
2 53   HIS n 
2 54   PHE n 
2 55   LEU n 
2 56   SER n 
2 57   GLY n 
2 58   SER n 
2 59   LYS n 
2 60   GLN n 
2 61   GLN n 
2 62   LEU n 
2 63   SER n 
2 64   ARG n 
2 65   ASP n 
2 66   SER n 
2 67   LEU n 
2 68   LEU n 
2 69   SER n 
2 70   GLY n 
2 71   CYS n 
2 72   HIS n 
2 73   PRO n 
2 74   GLY n 
2 75   PHE n 
2 76   GLY n 
2 77   PRO n 
2 78   LEU n 
2 79   GLY n 
2 80   VAL n 
2 81   GLU n 
2 82   LEU n 
2 83   ARG n 
2 84   LYS n 
2 85   ASN n 
2 86   LEU n 
2 87   ALA n 
2 88   ALA n 
2 89   GLU n 
2 90   TRP n 
2 91   TRP n 
2 92   THR n 
2 93   SER n 
2 94   VAL n 
2 95   VAL n 
2 96   VAL n 
2 97   PHE n 
2 98   ARG n 
2 99   GLU n 
2 100  GLN n 
2 101  VAL n 
2 102  PHE n 
2 103  PRO n 
2 104  VAL n 
2 105  ASP n 
2 106  ALA n 
2 107  LEU n 
2 108  HIS n 
2 109  HIS n 
2 110  LYS n 
2 111  PRO n 
2 112  GLY n 
2 113  PRO n 
2 114  LEU n 
2 115  LEU n 
2 116  PRO n 
2 117  GLY n 
2 118  ASP n 
2 119  SER n 
2 120  ALA n 
2 121  PHE n 
2 122  ARG n 
2 123  LEU n 
2 124  VAL n 
2 125  SER n 
2 126  ALA n 
2 127  GLU n 
2 128  THR n 
2 129  LEU n 
2 130  ARG n 
2 131  GLU n 
2 132  ILE n 
2 133  LEU n 
2 134  GLN n 
2 135  ASP n 
2 136  LYS n 
2 137  GLU n 
2 138  LEU n 
2 139  SER n 
2 140  LYS n 
2 141  GLU n 
2 142  GLN n 
2 143  LEU n 
2 144  VAL n 
2 145  ALA n 
2 146  PHE n 
2 147  LEU n 
2 148  GLU n 
2 149  ASN n 
2 150  VAL n 
2 151  LEU n 
2 152  LYS n 
2 153  THR n 
2 154  SER n 
2 155  GLY n 
2 156  LYS n 
2 157  LEU n 
2 158  ARG n 
2 159  GLU n 
2 160  ASN n 
2 161  LEU n 
2 162  LEU n 
2 163  HIS n 
2 164  GLY n 
2 165  ALA n 
2 166  LEU n 
2 167  GLU n 
2 168  HIS n 
2 169  TYR n 
2 170  VAL n 
2 171  ASN n 
2 172  CYS n 
2 173  LEU n 
2 174  ASP n 
2 175  LEU n 
2 176  VAL n 
2 177  ASN n 
2 178  LYS n 
2 179  ARG n 
2 180  LEU n 
2 181  PRO n 
2 182  TYR n 
2 183  GLY n 
2 184  LEU n 
2 185  ALA n 
2 186  GLN n 
2 187  ILE n 
2 188  GLY n 
2 189  VAL n 
2 190  CYS n 
2 191  PHE n 
2 192  HIS n 
2 193  PRO n 
2 194  VAL n 
2 195  PHE n 
2 196  ASP n 
2 197  THR n 
2 198  LYS n 
2 199  GLN n 
2 200  ILE n 
2 201  ARG n 
2 202  ASN n 
2 203  GLY n 
2 204  VAL n 
2 205  LYS n 
2 206  SER n 
2 207  ILE n 
2 208  GLY n 
2 209  GLU n 
2 210  LYS n 
2 211  THR n 
2 212  GLU n 
2 213  ALA n 
2 214  SER n 
2 215  LEU n 
2 216  VAL n 
2 217  TRP n 
2 218  PHE n 
2 219  THR n 
2 220  PRO n 
2 221  PRO n 
2 222  ARG n 
2 223  THR n 
2 224  SER n 
2 225  ASN n 
2 226  GLN n 
2 227  TRP n 
2 228  LEU n 
2 229  ASP n 
2 230  PHE n 
2 231  TRP n 
2 232  LEU n 
2 233  ARG n 
2 234  HIS n 
2 235  ARG n 
2 236  LEU n 
2 237  GLN n 
2 238  TRP n 
2 239  TRP n 
2 240  ARG n 
2 241  LYS n 
2 242  PHE n 
2 243  ALA n 
2 244  MET n 
2 245  SER n 
2 246  PRO n 
2 247  SER n 
2 248  ASN n 
2 249  PHE n 
2 250  SER n 
2 251  SER n 
2 252  SER n 
2 253  ASP n 
2 254  CYS n 
2 255  GLN n 
2 256  ASP n 
2 257  GLU n 
2 258  GLU n 
2 259  GLY n 
2 260  ARG n 
2 261  LYS n 
2 262  GLY n 
2 263  ASN n 
2 264  LYS n 
2 265  LEU n 
2 266  TYR n 
2 267  TYR n 
2 268  ASN n 
2 269  PHE n 
2 270  PRO n 
2 271  TRP n 
2 272  GLY n 
2 273  LYS n 
2 274  GLU n 
2 275  LEU n 
2 276  ILE n 
2 277  GLU n 
2 278  THR n 
2 279  LEU n 
2 280  TRP n 
2 281  ASN n 
2 282  LEU n 
2 283  GLY n 
2 284  ASP n 
2 285  HIS n 
2 286  GLU n 
2 287  LEU n 
2 288  LEU n 
2 289  HIS n 
2 290  MET n 
2 291  TYR n 
2 292  PRO n 
2 293  GLY n 
2 294  ASN n 
2 295  VAL n 
2 296  SER n 
2 297  LYS n 
2 298  LEU n 
2 299  HIS n 
2 300  GLY n 
2 301  ARG n 
2 302  ASP n 
2 303  GLY n 
2 304  ARG n 
2 305  LYS n 
2 306  ASN n 
2 307  VAL n 
2 308  VAL n 
2 309  PRO n 
2 310  CYS n 
2 311  VAL n 
2 312  LEU n 
2 313  SER n 
2 314  VAL n 
2 315  ASN n 
2 316  GLY n 
2 317  ASP n 
2 318  LEU n 
2 319  ASP n 
2 320  ARG n 
2 321  GLY n 
2 322  MET n 
2 323  LEU n 
2 324  ALA n 
2 325  TYR n 
2 326  LEU n 
2 327  TYR n 
2 328  ASP n 
2 329  SER n 
2 330  PHE n 
2 331  GLN n 
2 332  LEU n 
2 333  THR n 
2 334  GLU n 
2 335  ASN n 
2 336  SER n 
2 337  PHE n 
2 338  THR n 
2 339  ARG n 
2 340  LYS n 
2 341  LYS n 
2 342  ASN n 
2 343  LEU n 
2 344  HIS n 
2 345  ARG n 
2 346  LYS n 
2 347  VAL n 
2 348  LEU n 
2 349  LYS n 
2 350  LEU n 
2 351  HIS n 
2 352  PRO n 
2 353  CYS n 
2 354  LEU n 
2 355  ALA n 
2 356  PRO n 
2 357  ILE n 
2 358  LYS n 
2 359  VAL n 
2 360  ALA n 
2 361  LEU n 
2 362  ASP n 
2 363  VAL n 
2 364  GLY n 
2 365  ARG n 
2 366  GLY n 
2 367  PRO n 
2 368  THR n 
2 369  LEU n 
2 370  GLU n 
2 371  LEU n 
2 372  ARG n 
2 373  GLN n 
2 374  VAL n 
2 375  CYS n 
2 376  GLN n 
2 377  GLY n 
2 378  LEU n 
2 379  PHE n 
2 380  ASN n 
2 381  GLU n 
2 382  LEU n 
2 383  LEU n 
2 384  GLU n 
2 385  ASN n 
2 386  GLY n 
2 387  ILE n 
2 388  SER n 
2 389  VAL n 
2 390  TRP n 
2 391  PRO n 
2 392  GLY n 
2 393  TYR n 
2 394  LEU n 
2 395  GLU n 
2 396  THR n 
2 397  MET n 
2 398  GLN n 
2 399  SER n 
2 400  SER n 
2 401  LEU n 
2 402  GLU n 
2 403  GLN n 
2 404  LEU n 
2 405  TYR n 
2 406  SER n 
2 407  LYS n 
2 408  TYR n 
2 409  ASP n 
2 410  GLU n 
2 411  MET n 
2 412  SER n 
2 413  ILE n 
2 414  LEU n 
2 415  PHE n 
2 416  THR n 
2 417  VAL n 
2 418  LEU n 
2 419  VAL n 
2 420  THR n 
2 421  GLU n 
2 422  THR n 
2 423  THR n 
2 424  LEU n 
2 425  GLU n 
2 426  ASN n 
2 427  GLY n 
2 428  LEU n 
2 429  ILE n 
2 430  HIS n 
2 431  LEU n 
2 432  ARG n 
2 433  SER n 
2 434  ARG n 
2 435  ASP n 
2 436  THR n 
2 437  THR n 
2 438  MET n 
2 439  LYS n 
2 440  GLU n 
2 441  MET n 
2 442  MET n 
2 443  HIS n 
2 444  ILE n 
2 445  SER n 
2 446  LYS n 
2 447  LEU n 
2 448  LYS n 
2 449  ASP n 
2 450  PHE n 
2 451  LEU n 
2 452  ILE n 
2 453  LYS n 
2 454  TYR n 
2 455  ILE n 
2 456  SER n 
2 457  SER n 
2 458  ALA n 
2 459  LYS n 
2 460  ASN n 
2 461  VAL n 
2 462  ALA n 
2 463  ALA n 
2 464  ALA n 
2 465  LEU n 
2 466  GLU n 
2 467  HIS n 
2 468  HIS n 
2 469  HIS n 
2 470  HIS n 
2 471  HIS n 
2 472  HIS n 
3 1    DG  n 
3 2    DC  n 
3 3    DG  n 
3 4    DA  n 
3 5    DT  n 
3 6    DA  n 
3 7    DC  n 
3 8    DG  n 
3 9    DG  n 
3 10   DC  n 
3 11   DA  n 
3 12   DC  n 
3 13   DT  n 
3 14   DG  n 
3 15   DG  n 
3 16   DC  n 
3 17   DC  n 
3 18   DC  n 
3 19   DT  n 
3 20   DC  n 
3 21   DG  n 
3 22   DT  n 
3 23   DC  n 
3 24   DT  n 
3 25   DT  n 
3 26   DT  n 
3 27   DT  n 
4 1    DA  n 
4 2    DA  n 
4 3    DA  n 
4 4    DA  n 
4 5    DG  n 
4 6    DA  n 
4 7    DC  n 
4 8    DG  n 
4 9    DA  n 
4 10   DG  n 
4 11   DG  n 
4 12   DG  n 
4 13   DC  n 
4 14   DC  n 
4 15   DA  n 
4 16   DG  n 
4 17   DT  n 
4 18   DG  n 
4 19   DC  n 
4 20   DC  n 
4 21   DG  n 
4 22   DT  n 
4 23   DA  n 
4 24   DOC n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 1222 Human ? 'POLG, MDP1, POLG1, POLGA' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Insect cell expression vector pTIE1' 266783 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 472  Human ? 'POLG2, MTPOLB'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Insect cell expression vector pTIE1' 266783 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 27 'Lobariella soredians' ? 1283102 ? 
4 1 sample 1 24 'Lobariella soredians' ? 1283102 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPOG1_HUMAN P54098 ? 1 
;VPASDPSDGQRRRQQQQQQQQQQQQQPQQPQVLSSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQK
HGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAI
PEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGH
NVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLD
ISSVNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLE
MGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPAT
ASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGP
SLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLM
PQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMENLRAAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWF
FKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHP
DYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAG
MHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAAT
KGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDI
PRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRA
ALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKG
SLEKRSQPGP
;
30 
2 UNP DPOG2_HUMAN Q9UHN1 ? 2 
;DAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVE
LRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENL
LHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRK
FAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRG
MLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSL
EQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
;
26 
3 PDB 4ZTZ        4ZTZ   ? 3 ? 1  
4 PDB 4ZTZ        4ZTZ   ? 4 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ZTZ A 2 ? 1211 ? P54098 30 ? 1239 ? 30 1239 
2 2 4ZTZ B 2 ? 461  ? Q9UHN1 26 ? 485  ? 26 485  
3 2 4ZTZ C 2 ? 461  ? Q9UHN1 26 ? 485  ? 26 485  
4 3 4ZTZ T 1 ? 27   ? 4ZTZ   2  ? 28   ? 2  28   
5 4 4ZTZ P 1 ? 24   ? 4ZTZ   1  ? 24   ? 1  24   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ZTZ MET A 1    ? UNP P54098 ?   ?   'initiating methionine' 29   1  
1 4ZTZ ALA A 170  ? UNP P54098 ASP 198 conflict                198  2  
1 4ZTZ ALA A 172  ? UNP P54098 GLU 200 conflict                200  3  
1 4ZTZ ALA A 1212 ? UNP P54098 ?   ?   'expression tag'        1240 4  
1 4ZTZ ALA A 1213 ? UNP P54098 ?   ?   'expression tag'        1241 5  
1 4ZTZ ALA A 1214 ? UNP P54098 ?   ?   'expression tag'        1242 6  
1 4ZTZ LEU A 1215 ? UNP P54098 ?   ?   'expression tag'        1243 7  
1 4ZTZ GLU A 1216 ? UNP P54098 ?   ?   'expression tag'        1244 8  
1 4ZTZ HIS A 1217 ? UNP P54098 ?   ?   'expression tag'        1245 9  
1 4ZTZ HIS A 1218 ? UNP P54098 ?   ?   'expression tag'        1246 10 
1 4ZTZ HIS A 1219 ? UNP P54098 ?   ?   'expression tag'        1247 11 
1 4ZTZ HIS A 1220 ? UNP P54098 ?   ?   'expression tag'        1248 12 
1 4ZTZ HIS A 1221 ? UNP P54098 ?   ?   'expression tag'        1249 13 
1 4ZTZ HIS A 1222 ? UNP P54098 ?   ?   'expression tag'        1250 14 
2 4ZTZ MET B 1    ? UNP Q9UHN1 ?   ?   'initiating methionine' 25   15 
2 4ZTZ ALA B 462  ? UNP Q9UHN1 ?   ?   'expression tag'        486  16 
2 4ZTZ ALA B 463  ? UNP Q9UHN1 ?   ?   'expression tag'        487  17 
2 4ZTZ ALA B 464  ? UNP Q9UHN1 ?   ?   'expression tag'        488  18 
2 4ZTZ LEU B 465  ? UNP Q9UHN1 ?   ?   'expression tag'        489  19 
2 4ZTZ GLU B 466  ? UNP Q9UHN1 ?   ?   'expression tag'        490  20 
2 4ZTZ HIS B 467  ? UNP Q9UHN1 ?   ?   'expression tag'        491  21 
2 4ZTZ HIS B 468  ? UNP Q9UHN1 ?   ?   'expression tag'        492  22 
2 4ZTZ HIS B 469  ? UNP Q9UHN1 ?   ?   'expression tag'        493  23 
2 4ZTZ HIS B 470  ? UNP Q9UHN1 ?   ?   'expression tag'        494  24 
2 4ZTZ HIS B 471  ? UNP Q9UHN1 ?   ?   'expression tag'        495  25 
2 4ZTZ HIS B 472  ? UNP Q9UHN1 ?   ?   'expression tag'        496  26 
3 4ZTZ MET C 1    ? UNP Q9UHN1 ?   ?   'initiating methionine' 25   27 
3 4ZTZ ALA C 462  ? UNP Q9UHN1 ?   ?   'expression tag'        486  28 
3 4ZTZ ALA C 463  ? UNP Q9UHN1 ?   ?   'expression tag'        487  29 
3 4ZTZ ALA C 464  ? UNP Q9UHN1 ?   ?   'expression tag'        488  30 
3 4ZTZ LEU C 465  ? UNP Q9UHN1 ?   ?   'expression tag'        489  31 
3 4ZTZ GLU C 466  ? UNP Q9UHN1 ?   ?   'expression tag'        490  32 
3 4ZTZ HIS C 467  ? UNP Q9UHN1 ?   ?   'expression tag'        491  33 
3 4ZTZ HIS C 468  ? UNP Q9UHN1 ?   ?   'expression tag'        492  34 
3 4ZTZ HIS C 469  ? UNP Q9UHN1 ?   ?   'expression tag'        493  35 
3 4ZTZ HIS C 470  ? UNP Q9UHN1 ?   ?   'expression tag'        494  36 
3 4ZTZ HIS C 471  ? UNP Q9UHN1 ?   ?   'expression tag'        495  37 
3 4ZTZ HIS C 472  ? UNP Q9UHN1 ?   ?   'expression tag'        496  38 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"       ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P'  347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'   291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                          ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4ZTZ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.88 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.31 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG8000, KCl, CaCl2' 
_exptl_crystal_grow.pdbx_pH_range   5.5-6.6 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-10-10 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4ZTZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.442 
_reflns.d_resolution_low                 48.500 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       48718 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.800 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            2.0000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4ZTZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     48440 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.50 
_refine.ls_d_res_high                            3.442 
_refine.ls_percent_reflns_obs                    91.6 
_refine.ls_R_factor_obs                          0.281 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.280 
_refine.ls_R_factor_R_free                       0.320 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.050 
_refine.ls_number_reflns_R_free                  1975 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.550 
_refine.pdbx_overall_phase_error                 39.330 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13658 
_refine_hist.pdbx_number_atoms_nucleic_acid   963 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               14651 
_refine_hist.d_res_high                       3.442 
_refine_hist.d_res_low                        45.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 14845 'X-RAY DIFFRACTION' ? 
f_angle_d          2.119  ? ? 20320 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 21.151 ? ? 5556  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.098  ? ? 2198  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.012  ? ? 2444  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.4423 3.5284  2239 0.4088 62.00 0.4240 . . 95  . . . . 
'X-RAY DIFFRACTION' . 3.5284 3.6237  2572 0.3911 72.00 0.3759 . . 110 . . . . 
'X-RAY DIFFRACTION' . 3.6237 3.7303  2848 0.3845 79.00 0.4747 . . 120 . . . . 
'X-RAY DIFFRACTION' . 3.7303 3.8506  3156 0.3773 87.00 0.4443 . . 136 . . . . 
'X-RAY DIFFRACTION' . 3.8506 3.9882  3449 0.3516 96.00 0.3972 . . 146 . . . . 
'X-RAY DIFFRACTION' . 3.9882 4.1478  3520 0.3304 97.00 0.3462 . . 150 . . . . 
'X-RAY DIFFRACTION' . 4.1478 4.3364  3518 0.3244 97.00 0.4437 . . 148 . . . . 
'X-RAY DIFFRACTION' . 4.3364 4.5648  3520 0.3140 97.00 0.3293 . . 150 . . . . 
'X-RAY DIFFRACTION' . 4.5648 4.8505  3563 0.2840 98.00 0.3155 . . 146 . . . . 
'X-RAY DIFFRACTION' . 4.8505 5.2245  3580 0.2868 98.00 0.3892 . . 152 . . . . 
'X-RAY DIFFRACTION' . 5.2245 5.7494  3625 0.2940 99.00 0.3172 . . 152 . . . . 
'X-RAY DIFFRACTION' . 5.7494 6.5792  3661 0.2920 99.00 0.3474 . . 154 . . . . 
'X-RAY DIFFRACTION' . 6.5792 8.2809  3712 0.2653 99.00 0.2881 . . 158 . . . . 
'X-RAY DIFFRACTION' . 8.2809 45.4999 3780 0.2129 97.00 0.2493 . . 158 . . . . 
# 
_struct.entry_id                     4ZTZ 
_struct.title                        
'Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase' 
_struct.pdbx_descriptor              'DNA polymerase subunit gamma-1, DNA polymerase subunit gamma-2, mitochondrial/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4ZTZ 
_struct_keywords.text            'mitochondria, DNA polymerase, processivity, drug toxicity, DNA Binding Protein-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA Binding Protein/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 68   ? GLY A 83   ? GLY A 96   GLY A 111  1 ? 16 
HELX_P HELX_P2  AA2 ASN A 106  ? GLN A 131  ? ASN A 134  GLN A 159  1 ? 26 
HELX_P HELX_P3  AA3 PRO A 152  ? GLY A 154  ? PRO A 180  GLY A 182  5 ? 3  
HELX_P HELX_P4  AA4 LEU A 175  ? GLY A 178  ? LEU A 203  GLY A 206  5 ? 4  
HELX_P HELX_P5  AA5 VAL A 243  ? ALA A 248  ? VAL A 271  ALA A 276  1 ? 6  
HELX_P HELX_P6  AA6 HIS A 249  ? TYR A 254  ? HIS A 277  TYR A 282  5 ? 6  
HELX_P HELX_P7  AA7 THR A 266  ? GLY A 275  ? THR A 294  GLY A 303  1 ? 10 
HELX_P HELX_P8  AA8 SER A 277  ? ILE A 285  ? SER A 305  ILE A 313  1 ? 9  
HELX_P HELX_P9  AA9 ASP A 318  ? ILE A 322  ? ASP A 346  ILE A 350  5 ? 5  
HELX_P HELX_P10 AB1 SER A 327  ? VAL A 336  ? SER A 355  VAL A 364  1 ? 10 
HELX_P HELX_P11 AB2 GLU A 347  ? GLY A 352  ? GLU A 375  GLY A 380  1 ? 6  
HELX_P HELX_P12 AB3 MET A 354  ? GLU A 359  ? MET A 382  GLU A 387  1 ? 6  
HELX_P HELX_P13 AB4 ASN A 360  ? CYS A 390  ? ASN A 388  CYS A 418  1 ? 31 
HELX_P HELX_P14 AB5 HIS A 392  ? MET A 402  ? HIS A 420  MET A 430  1 ? 11 
HELX_P HELX_P15 AB6 GLN A 411  ? ALA A 442  ? GLN A 439  ALA A 470  1 ? 32 
HELX_P HELX_P16 AB7 GLU A 449  ? GLU A 453  ? GLU A 477  GLU A 481  5 ? 5  
HELX_P HELX_P17 AB8 GLN A 512  ? GLY A 526  ? GLN A 540  GLY A 554  1 ? 15 
HELX_P HELX_P18 AB9 PRO A 542  ? LEU A 548  ? PRO A 570  LEU A 576  1 ? 7  
HELX_P HELX_P19 AC1 VAL A 570  ? ALA A 576  ? VAL A 598  ALA A 604  1 ? 7  
HELX_P HELX_P20 AC2 ARG A 622  ? CYS A 632  ? ARG A 650  CYS A 660  1 ? 11 
HELX_P HELX_P21 AC3 ALA A 758  ? ILE A 770  ? ALA A 786  ILE A 798  1 ? 13 
HELX_P HELX_P22 AC4 ILE A 770  ? ASN A 775  ? ILE A 798  ASN A 803  1 ? 6  
HELX_P HELX_P23 AC5 ALA A 776  ? SER A 782  ? ALA A 804  SER A 810  1 ? 7  
HELX_P HELX_P24 AC6 PRO A 789  ? LEU A 793  ? PRO A 817  LEU A 821  5 ? 5  
HELX_P HELX_P25 AC7 PRO A 794  ? HIS A 800  ? PRO A 822  HIS A 828  1 ? 7  
HELX_P HELX_P26 AC8 THR A 830  ? ALA A 834  ? THR A 858  ALA A 862  5 ? 5  
HELX_P HELX_P27 AC9 GLU A 845  ? VAL A 850  ? GLU A 873  VAL A 878  5 ? 6  
HELX_P HELX_P28 AD1 GLN A 866  ? ALA A 880  ? GLN A 894  ALA A 908  1 ? 15 
HELX_P HELX_P29 AD2 PHE A 888  ? LEU A 893  ? PHE A 916  LEU A 921  1 ? 6  
HELX_P HELX_P30 AD3 ASP A 902  ? THR A 909  ? ASP A 930  THR A 937  1 ? 8  
HELX_P HELX_P31 AD4 ARG A 915  ? TYR A 927  ? ARG A 943  TYR A 955  1 ? 13 
HELX_P HELX_P32 AD5 GLY A 930  ? HIS A 943  ? GLY A 958  HIS A 971  1 ? 14 
HELX_P HELX_P33 AD6 LEU A 945  ? MET A 957  ? LEU A 973  MET A 985  1 ? 13 
HELX_P HELX_P34 AD7 MET A 1029 ? ALA A 1037 ? MET A 1057 ALA A 1065 1 ? 9  
HELX_P HELX_P35 AD8 PHE A 1064 ? GLU A 1094 ? PHE A 1092 GLU A 1122 1 ? 31 
HELX_P HELX_P36 AD9 ASP A 1117 ? LYS A 1139 ? ASP A 1145 LYS A 1167 1 ? 23 
HELX_P HELX_P37 AE1 LEU B 46   ? HIS B 53   ? LEU B 70   HIS B 77   1 ? 8  
HELX_P HELX_P38 AE2 SER B 63   ? GLY B 70   ? SER B 87   GLY B 94   1 ? 8  
HELX_P HELX_P39 AE3 GLY B 76   ? SER B 93   ? GLY B 100  SER B 117  1 ? 18 
HELX_P HELX_P40 AE4 LEU B 162  ? GLU B 167  ? LEU B 186  GLU B 191  1 ? 6  
HELX_P HELX_P41 AE5 HIS B 168  ? LEU B 175  ? HIS B 192  LEU B 199  1 ? 8  
HELX_P HELX_P42 AE6 PRO B 220  ? ARG B 222  ? PRO B 244  ARG B 246  5 ? 3  
HELX_P HELX_P43 AE7 THR B 223  ? LYS B 241  ? THR B 247  LYS B 265  1 ? 19 
HELX_P HELX_P44 AE8 SER B 245  ? SER B 247  ? SER B 269  SER B 271  5 ? 3  
HELX_P HELX_P45 AE9 ASP B 284  ? TYR B 291  ? ASP B 308  TYR B 315  1 ? 8  
HELX_P HELX_P46 AF1 ASN B 294  ? LEU B 298  ? ASN B 318  LEU B 322  5 ? 5  
HELX_P HELX_P47 AF2 LEU B 318  ? PHE B 330  ? LEU B 342  PHE B 354  1 ? 13 
HELX_P HELX_P48 AF3 GLN B 373  ? ASN B 385  ? GLN B 397  ASN B 409  1 ? 13 
HELX_P HELX_P49 AF4 SER B 400  ? GLU B 410  ? SER B 424  GLU B 434  1 ? 11 
HELX_P HELX_P50 AF5 GLU B 421  ? ASN B 426  ? GLU B 445  ASN B 450  1 ? 6  
HELX_P HELX_P51 AF6 ILE B 444  ? ASN B 460  ? ILE B 468  ASN B 484  1 ? 17 
HELX_P HELX_P52 AF7 SER C 63   ? SER C 69   ? SER C 87   SER C 93   1 ? 7  
HELX_P HELX_P53 AF8 GLY C 76   ? SER C 93   ? GLY C 100  SER C 117  1 ? 18 
HELX_P HELX_P54 AF9 LEU C 162  ? HIS C 168  ? LEU C 186  HIS C 192  1 ? 7  
HELX_P HELX_P55 AG1 HIS C 168  ? VAL C 176  ? HIS C 192  VAL C 200  1 ? 9  
HELX_P HELX_P56 AG2 PRO C 220  ? THR C 223  ? PRO C 244  THR C 247  5 ? 4  
HELX_P HELX_P57 AG3 SER C 224  ? PHE C 242  ? SER C 248  PHE C 266  1 ? 19 
HELX_P HELX_P58 AG4 SER C 245  ? SER C 247  ? SER C 269  SER C 271  5 ? 3  
HELX_P HELX_P59 AG5 LEU C 318  ? PHE C 330  ? LEU C 342  PHE C 354  1 ? 13 
HELX_P HELX_P60 AG6 THR C 368  ? ASN C 385  ? THR C 392  ASN C 409  1 ? 18 
HELX_P HELX_P61 AG7 LEU C 401  ? MET C 411  ? LEU C 425  MET C 435  1 ? 11 
HELX_P HELX_P62 AG8 GLU C 421  ? GLU C 425  ? GLU C 445  GLU C 449  5 ? 5  
HELX_P HELX_P63 AG9 LYS C 446  ? ALA C 458  ? LYS C 470  ALA C 482  1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale none ? A PHE 582  CD2   ? ? ? 1_555 A ILE 624 CG2   ? ? A PHE 610  A ILE 652  1_555 ? ? ? ? ? ? ?                
1.458 ? 
metalc1  metalc ?    ? A ASP 862  OD1   ? ? ? 1_555 G MG  .   MG    ? ? A ASP 890  A MG  4002 1_555 ? ? ? ? ? ? ?                
2.268 ? 
metalc2  metalc ?    ? A VAL 863  O     ? ? ? 1_555 G MG  .   MG    ? ? A VAL 891  A MG  4002 1_555 ? ? ? ? ? ? ?                
2.294 ? 
metalc3  metalc ?    ? A ASP 1107 OD1   ? ? ? 1_555 G MG  .   MG    ? ? A ASP 1135 A MG  4002 1_555 ? ? ? ? ? ? ?                
2.631 ? 
metalc4  metalc ?    ? A ASP 1107 OD2   ? ? ? 1_555 G MG  .   MG    ? ? A ASP 1135 A MG  4002 1_555 ? ? ? ? ? ? ?                
2.168 ? 
covale2  covale both ? E DA  23   "O3'" ? ? ? 1_555 E DOC 24  P     ? ? P DA  23   P DOC 24   1_555 ? ? ? ? ? ? ?                
1.607 ? 
metalc5  metalc ?    ? F MG  .    MG    ? ? ? 1_555 H DCP .   O1A   ? ? A MG  4001 A DCP 4003 1_555 ? ? ? ? ? ? ?                
2.052 ? 
metalc6  metalc ?    ? F MG  .    MG    ? ? ? 1_555 H DCP .   "O5'" ? ? A MG  4001 A DCP 4003 1_555 ? ? ? ? ? ? ?                
2.672 ? 
metalc7  metalc ?    ? G MG  .    MG    ? ? ? 1_555 H DCP .   O1A   ? ? A MG  4002 A DCP 4003 1_555 ? ? ? ? ? ? ?                
2.218 ? 
metalc8  metalc ?    ? G MG  .    MG    ? ? ? 1_555 H DCP .   O2G   ? ? A MG  4002 A DCP 4003 1_555 ? ? ? ? ? ? ?                
1.745 ? 
metalc9  metalc ?    ? G MG  .    MG    ? ? ? 1_555 H DCP .   O2B   ? ? A MG  4002 A DCP 4003 1_555 ? ? ? ? ? ? ?                
2.621 ? 
hydrog1  hydrog ?    ? D DA  4    N1    ? ? ? 1_555 E DOC 24  N4    ? ? T DA  5    P DOC 24   1_555 ? ? ? ? ? ? 'DA-DOC MISPAIR' ? 
? 
hydrog2  hydrog ?    ? D DT  5    N3    ? ? ? 1_555 E DA  23  N1    ? ? T DT  6    P DA  23   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog3  hydrog ?    ? D DT  5    O4    ? ? ? 1_555 E DA  23  N6    ? ? T DT  6    P DA  23   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog4  hydrog ?    ? D DA  6    N1    ? ? ? 1_555 E DT  22  N3    ? ? T DA  7    P DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog5  hydrog ?    ? D DA  6    N6    ? ? ? 1_555 E DT  22  O4    ? ? T DA  7    P DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog6  hydrog ?    ? D DC  7    O2    ? ? ? 1_555 E DG  21  N2    ? ? T DC  8    P DG  21   1_555 ? ? ? ? ? ? 'DC-DG PAIR'     ? 
? 
hydrog7  hydrog ?    ? D DG  8    N1    ? ? ? 1_555 E DC  20  N3    ? ? T DG  9    P DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog8  hydrog ?    ? D DG  8    N2    ? ? ? 1_555 E DC  20  O2    ? ? T DG  9    P DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog9  hydrog ?    ? D DG  8    O6    ? ? ? 1_555 E DC  20  N4    ? ? T DG  9    P DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog10 hydrog ?    ? D DG  9    N1    ? ? ? 1_555 E DC  19  N3    ? ? T DG  10   P DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog11 hydrog ?    ? D DG  9    N2    ? ? ? 1_555 E DC  19  O2    ? ? T DG  10   P DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog12 hydrog ?    ? D DG  9    O6    ? ? ? 1_555 E DC  19  N4    ? ? T DG  10   P DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog13 hydrog ?    ? D DC  10   N3    ? ? ? 1_555 E DG  18  N1    ? ? T DC  11   P DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog14 hydrog ?    ? D DC  10   N4    ? ? ? 1_555 E DG  18  O6    ? ? T DC  11   P DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog15 hydrog ?    ? D DC  10   O2    ? ? ? 1_555 E DG  18  N2    ? ? T DC  11   P DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog16 hydrog ?    ? D DA  11   N1    ? ? ? 1_555 E DT  17  N3    ? ? T DA  12   P DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog17 hydrog ?    ? D DA  11   N6    ? ? ? 1_555 E DT  17  O4    ? ? T DA  12   P DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog18 hydrog ?    ? D DC  12   N3    ? ? ? 1_555 E DG  16  N1    ? ? T DC  13   P DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog19 hydrog ?    ? D DC  12   N4    ? ? ? 1_555 E DG  16  O6    ? ? T DC  13   P DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog20 hydrog ?    ? D DC  12   O2    ? ? ? 1_555 E DG  16  N2    ? ? T DC  13   P DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog21 hydrog ?    ? D DT  13   N3    ? ? ? 1_555 E DA  15  N1    ? ? T DT  14   P DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog22 hydrog ?    ? D DT  13   O4    ? ? ? 1_555 E DA  15  N6    ? ? T DT  14   P DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog23 hydrog ?    ? D DG  14   N2    ? ? ? 1_555 E DC  14  O2    ? ? T DG  15   P DC  14   1_555 ? ? ? ? ? ? 'DG-DC PAIR'     ? 
? 
hydrog24 hydrog ?    ? D DG  15   N1    ? ? ? 1_555 E DC  13  N3    ? ? T DG  16   P DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog25 hydrog ?    ? D DG  15   N2    ? ? ? 1_555 E DC  13  O2    ? ? T DG  16   P DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog26 hydrog ?    ? D DG  15   O6    ? ? ? 1_555 E DC  13  N4    ? ? T DG  16   P DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog27 hydrog ?    ? D DC  16   N3    ? ? ? 1_555 E DG  12  N1    ? ? T DC  17   P DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog28 hydrog ?    ? D DC  16   N4    ? ? ? 1_555 E DG  12  O6    ? ? T DC  17   P DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog29 hydrog ?    ? D DC  16   O2    ? ? ? 1_555 E DG  12  N2    ? ? T DC  17   P DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog30 hydrog ?    ? D DC  17   N3    ? ? ? 1_555 E DG  11  N1    ? ? T DC  18   P DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog31 hydrog ?    ? D DC  17   N4    ? ? ? 1_555 E DG  11  O6    ? ? T DC  18   P DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog32 hydrog ?    ? D DC  17   O2    ? ? ? 1_555 E DG  11  N2    ? ? T DC  18   P DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog33 hydrog ?    ? D DC  18   N3    ? ? ? 1_555 E DG  10  N1    ? ? T DC  19   P DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog34 hydrog ?    ? D DC  18   N4    ? ? ? 1_555 E DG  10  O6    ? ? T DC  19   P DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog35 hydrog ?    ? D DC  18   O2    ? ? ? 1_555 E DG  10  N2    ? ? T DC  19   P DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog36 hydrog ?    ? D DT  19   N3    ? ? ? 1_555 E DA  9   N1    ? ? T DT  20   P DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog37 hydrog ?    ? D DT  19   O4    ? ? ? 1_555 E DA  9   N6    ? ? T DT  20   P DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog38 hydrog ?    ? D DC  20   N3    ? ? ? 1_555 E DG  8   N1    ? ? T DC  21   P DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog39 hydrog ?    ? D DC  20   N4    ? ? ? 1_555 E DG  8   O6    ? ? T DC  21   P DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog40 hydrog ?    ? D DC  20   O2    ? ? ? 1_555 E DG  8   N2    ? ? T DC  21   P DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog41 hydrog ?    ? D DG  21   N1    ? ? ? 1_555 E DC  7   N3    ? ? T DG  22   P DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog42 hydrog ?    ? D DG  21   N2    ? ? ? 1_555 E DC  7   O2    ? ? T DG  22   P DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog43 hydrog ?    ? D DG  21   O6    ? ? ? 1_555 E DC  7   N4    ? ? T DG  22   P DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog44 hydrog ?    ? D DT  22   N3    ? ? ? 1_555 E DA  6   N1    ? ? T DT  23   P DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog45 hydrog ?    ? D DT  22   O4    ? ? ? 1_555 E DA  6   N6    ? ? T DT  23   P DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog46 hydrog ?    ? D DC  23   N3    ? ? ? 1_555 E DG  5   N1    ? ? T DC  24   P DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog47 hydrog ?    ? D DC  23   N4    ? ? ? 1_555 E DG  5   O6    ? ? T DC  24   P DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog48 hydrog ?    ? D DC  23   O2    ? ? ? 1_555 E DG  5   N2    ? ? T DC  24   P DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog49 hydrog ?    ? D DT  24   N3    ? ? ? 1_555 E DA  4   N1    ? ? T DT  25   P DA  4    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog50 hydrog ?    ? D DT  24   O4    ? ? ? 1_555 E DA  4   N6    ? ? T DT  25   P DA  4    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog51 hydrog ?    ? D DT  25   N3    ? ? ? 1_555 E DA  3   N1    ? ? T DT  26   P DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
hydrog52 hydrog ?    ? D DT  25   O4    ? ? ? 1_555 E DA  3   N6    ? ? T DT  26   P DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  MET 50   A . ? MET 78   A LEU 51   A ? LEU 79   A 1 -1.83  
2  GLY 63   A . ? GLY 91   A GLY 64   A ? GLY 92   A 1 0.91   
3  GLU 65   A . ? GLU 93   A MET 66   A ? MET 94   A 1 5.69   
4  HIS 82   A . ? HIS 110  A GLY 83   A ? GLY 111  A 1 0.47   
5  GLY 104  A . ? GLY 132  A ASP 105  A ? ASP 133  A 1 -1.04  
6  GLY 178  A . ? GLY 206  A THR 179  A ? THR 207  A 1 0.86   
7  GLN 234  A . ? GLN 262  A GLU 235  A ? GLU 263  A 1 2.20   
8  GLY 258  A . ? GLY 286  A SER 259  A ? SER 287  A 1 -0.35  
9  SER 447  A . ? SER 475  A GLY 448  A ? GLY 476  A 1 -0.18  
10 PHE 467  A . ? PHE 495  A LYS 468  A ? LYS 496  A 1 -4.19  
11 LYS 474  A . ? LYS 502  A VAL 475  A ? VAL 503  A 1 4.49   
12 SER 565  A . ? SER 593  A LEU 566  A ? LEU 594  A 1 -7.28  
13 LEU 566  A . ? LEU 594  A GLN 567  A ? GLN 595  A 1 4.27   
14 SER 614  A . ? SER 642  A ALA 615  A ? ALA 643  A 1 -0.42  
15 TYR 711  A . ? TYR 739  A ASN 712  A ? ASN 740  A 1 3.17   
16 LEU 724  A . ? LEU 752  A PRO 725  A ? PRO 753  A 1 -5.44  
17 PRO 737  A . ? PRO 765  A PHE 738  A ? PHE 766  A 1 1.46   
18 THR 750  A . ? THR 778  A LEU 751  A ? LEU 779  A 1 3.56   
19 GLY 754  A . ? GLY 782  A PRO 755  A ? PRO 783  A 1 -0.44  
20 PRO 755  A . ? PRO 783  A GLY 756  A ? GLY 784  A 1 -0.35  
21 TYR 803  A . ? TYR 831  A ASP 804  A ? ASP 832  A 1 -3.07  
22 THR 821  A . ? THR 849  A ILE 822  A ? ILE 850  A 1 -8.38  
23 ILE 822  A . ? ILE 850  A THR 823  A ? THR 851  A 1 6.43   
24 ASP 864  A . ? ASP 892  A SER 865  A ? SER 893  A 1 -1.47  
25 THR 910  A . ? THR 938  A VAL 911  A ? VAL 939  A 1 2.56   
26 VAL 911  A . ? VAL 939  A GLY 912  A ? GLY 940  A 1 -1.16  
27 SER 914  A . ? SER 942  A ARG 915  A ? ARG 943  A 1 -1.31  
28 THR 961  A . ? THR 989  A LYS 962  A ? LYS 990  A 1 1.99   
29 PRO 1045 A . ? PRO 1073 A VAL 1046 A ? VAL 1074 A 1 -11.08 
30 VAL 1046 A . ? VAL 1074 A LEU 1047 A ? LEU 1075 A 1 -0.39  
31 LEU 1047 A . ? LEU 1075 A GLY 1048 A ? GLY 1076 A 1 -0.43  
32 GLN 1061 A . ? GLN 1089 A GLU 1062 A ? GLU 1090 A 1 7.46   
33 GLY 1141 A . ? GLY 1169 A LEU 1142 A ? LEU 1170 A 1 0.20   
34 GLN 1186 A . ? GLN 1214 A GLY 1187 A ? GLY 1215 A 1 -0.49  
35 LEU 180  B . ? LEU 204  B PRO 181  B ? PRO 205  B 1 7.03   
36 ARG 365  B . ? ARG 389  B GLY 366  B ? GLY 390  B 1 0.22   
37 GLY 366  B . ? GLY 390  B PRO 367  B ? PRO 391  B 1 -2.16  
38 LEU 369  B . ? LEU 393  B GLU 370  B ? GLU 394  B 1 0.67   
39 MET 397  B . ? MET 421  B GLN 398  B ? GLN 422  B 1 4.19   
40 HIS 72   C . ? HIS 96   C PRO 73   C ? PRO 97   C 1 24.89  
41 ARG 98   C . ? ARG 122  C GLU 99   C ? GLU 123  C 1 3.71   
42 PHE 269  C . ? PHE 293  C PRO 270  C ? PRO 294  C 1 1.81   
43 PRO 292  C . ? PRO 316  C GLY 293  C ? GLY 317  C 1 -1.49  
44 GLY 293  C . ? GLY 317  C ASN 294  C ? ASN 318  C 1 -0.09  
45 LEU 394  C . ? LEU 418  C GLU 395  C ? GLU 419  C 1 3.55   
46 GLU 395  C . ? GLU 419  C THR 396  C ? THR 420  C 1 6.69   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 3 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 7 ? 
AA7 ? 2 ? 
AA8 ? 5 ? 
AA9 ? 7 ? 
AB1 ? 2 ? 
AB2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA6 6 7 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AA9 5 6 ? anti-parallel 
AA9 6 7 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 156  ? VAL A 159  ? ALA A 184  VAL A 187  
AA1 2 GLY A 146  ? TYR A 150  ? GLY A 174  TYR A 178  
AA1 3 TRP A 192  ? CYS A 196  ? TRP A 220  CYS A 224  
AA1 4 PRO A 181  ? ILE A 187  ? PRO A 209  ILE A 215  
AA1 5 ALA A 170  ? VAL A 173  ? ALA A 198  VAL A 201  
AA2 1 ALA A 166  ? VAL A 168  ? ALA A 194  VAL A 196  
AA2 2 LEU A 237  ? GLY A 240  ? LEU A 265  GLY A 268  
AA2 3 ARG A 262  ? ASP A 265  ? ARG A 290  ASP A 293  
AA3 1 LEU A 407  ? ASN A 410  ? LEU A 435  ASN A 438  
AA3 2 TYR A 809  ? ILE A 812  ? TYR A 837  ILE A 840  
AA3 3 VAL A 786  ? TRP A 787  ? VAL A 814  TRP A 815  
AA4 1 VAL A 817  ? GLY A 820  ? VAL A 845  GLY A 848  
AA4 2 ARG A 825  ? VAL A 827  ? ARG A 853  VAL A 855  
AA5 1 CYS A 1102 ? ILE A 1105 ? CYS A 1130 ILE A 1133 
AA5 2 GLU A 1108 ? ARG A 1114 ? GLU A 1136 ARG A 1142 
AA5 3 TYR A 856  ? ASP A 862  ? TYR A 884  ASP A 890  
AA5 4 VAL A 1155 ? ASP A 1158 ? VAL A 1183 ASP A 1186 
AA6 1 VAL B 101  ? PRO B 103  ? VAL B 125  PRO B 127  
AA6 2 TYR B 182  ? VAL B 194  ? TYR B 206  VAL B 218  
AA6 3 SER B 206  ? THR B 219  ? SER B 230  THR B 243  
AA6 4 CYS B 310  ? ASP B 317  ? CYS B 334  ASP B 341  
AA6 5 GLY B 272  ? LEU B 282  ? GLY B 296  LEU B 306  
AA6 6 LYS B 261  ? PHE B 269  ? LYS B 285  PHE B 293  
AA6 7 PHE B 249  ? GLN B 255  ? PHE B 273  GLN B 279  
AA7 1 GLY B 300  ? ARG B 301  ? GLY B 324  ARG B 325  
AA7 2 ASN B 306  ? VAL B 307  ? ASN B 330  VAL B 331  
AA8 1 VAL B 389  ? PRO B 391  ? VAL B 413  PRO B 415  
AA8 2 VAL B 359  ? GLY B 364  ? VAL B 383  GLY B 388  
AA8 3 PHE B 415  ? THR B 420  ? PHE B 439  THR B 444  
AA8 4 LEU B 428  ? SER B 433  ? LEU B 452  SER B 457  
AA8 5 LYS B 439  ? HIS B 443  ? LYS B 463  HIS B 467  
AA9 1 VAL C 101  ? PRO C 103  ? VAL C 125  PRO C 127  
AA9 2 TYR C 182  ? VAL C 194  ? TYR C 206  VAL C 218  
AA9 3 SER C 206  ? THR C 219  ? SER C 230  THR C 243  
AA9 4 CYS C 310  ? ASP C 317  ? CYS C 334  ASP C 341  
AA9 5 GLU C 274  ? LEU C 282  ? GLU C 298  LEU C 306  
AA9 6 GLY C 262  ? TYR C 267  ? GLY C 286  TYR C 291  
AA9 7 PHE C 249  ? CYS C 254  ? PHE C 273  CYS C 278  
AB1 1 GLY C 300  ? ARG C 301  ? GLY C 324  ARG C 325  
AB1 2 ASN C 306  ? VAL C 307  ? ASN C 330  VAL C 331  
AB2 1 VAL C 389  ? PRO C 391  ? VAL C 413  PRO C 415  
AB2 2 VAL C 359  ? VAL C 363  ? VAL C 383  VAL C 387  
AB2 3 PHE C 415  ? VAL C 419  ? PHE C 439  VAL C 443  
AB2 4 LEU C 428  ? SER C 433  ? LEU C 452  SER C 457  
AB2 5 LYS C 439  ? HIS C 443  ? LYS C 463  HIS C 467  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 159  ? O VAL A 187  N TRP A 147  ? N TRP A 175  
AA1 2 3 N GLY A 146  ? N GLY A 174  O CYS A 196  ? O CYS A 224  
AA1 3 4 O TYR A 193  ? O TYR A 221  N ALA A 186  ? N ALA A 214  
AA1 4 5 O LEU A 183  ? O LEU A 211  N ALA A 172  ? N ALA A 200  
AA2 1 2 N LEU A 167  ? N LEU A 195  O VAL A 239  ? O VAL A 267  
AA2 2 3 N VAL A 238  ? N VAL A 266  O LEU A 264  ? O LEU A 292  
AA3 1 2 N VAL A 409  ? N VAL A 437  O GLY A 810  ? O GLY A 838  
AA3 2 3 O ALA A 811  ? O ALA A 839  N VAL A 786  ? N VAL A 814  
AA4 1 2 N GLY A 820  ? N GLY A 848  O ARG A 825  ? O ARG A 853  
AA5 1 2 N ILE A 1103 ? N ILE A 1131 O ARG A 1110 ? O ARG A 1138 
AA5 2 3 O TYR A 1111 ? O TYR A 1139 N VAL A 859  ? N VAL A 887  
AA5 3 4 N GLY A 860  ? N GLY A 888  O ASP A 1156 ? O ASP A 1184 
AA6 1 2 N PHE B 102  ? N PHE B 126  O GLY B 183  ? O GLY B 207  
AA6 2 3 N HIS B 192  ? N HIS B 216  O GLY B 208  ? O GLY B 232  
AA6 3 4 N THR B 219  ? N THR B 243  O CYS B 310  ? O CYS B 334  
AA6 4 5 O ASN B 315  ? O ASN B 339  N THR B 278  ? N THR B 302  
AA6 5 6 O LEU B 279  ? O LEU B 303  N ASN B 263  ? N ASN B 287  
AA6 6 7 O GLY B 262  ? O GLY B 286  N CYS B 254  ? N CYS B 278  
AA7 1 2 N GLY B 300  ? N GLY B 324  O VAL B 307  ? O VAL B 331  
AA8 1 2 O TRP B 390  ? O TRP B 414  N LEU B 361  ? N LEU B 385  
AA8 2 3 N GLY B 364  ? N GLY B 388  O VAL B 419  ? O VAL B 443  
AA8 3 4 N LEU B 418  ? N LEU B 442  O HIS B 430  ? O HIS B 454  
AA8 4 5 N ILE B 429  ? N ILE B 453  O MET B 442  ? O MET B 466  
AA9 1 2 N PHE C 102  ? N PHE C 126  O GLY C 183  ? O GLY C 207  
AA9 2 3 N GLN C 186  ? N GLN C 210  O SER C 214  ? O SER C 238  
AA9 3 4 N THR C 219  ? N THR C 243  O CYS C 310  ? O CYS C 334  
AA9 4 5 O ASP C 317  ? O ASP C 341  N ILE C 276  ? N ILE C 300  
AA9 5 6 O LEU C 279  ? O LEU C 303  N ASN C 263  ? N ASN C 287  
AA9 6 7 O GLY C 262  ? O GLY C 286  N CYS C 254  ? N CYS C 278  
AB1 1 2 N GLY C 300  ? N GLY C 324  O VAL C 307  ? O VAL C 331  
AB2 1 2 O TRP C 390  ? O TRP C 414  N VAL C 359  ? N VAL C 383  
AB2 2 3 N ALA C 360  ? N ALA C 384  O VAL C 417  ? O VAL C 441  
AB2 3 4 N LEU C 418  ? N LEU C 442  O HIS C 430  ? O HIS C 454  
AB2 4 5 N ILE C 429  ? N ILE C 453  O MET C 442  ? O MET C 466  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  4001 ? 4  'binding site for residue MG A 4001'                  
AC2 Software A MG  4002 ? 5  'binding site for residue MG A 4002'                  
AC3 Software A DCP 4003 ? 16 'binding site for residue DCP A 4003'                 
AC4 Software P DA  23   ? 12 'binding site for Di-nucleotide DA P 23 and DOC P 24' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP A 1107 ? ASP A 1135 . ? 1_555 ? 
2  AC1 4  MG  G .    ? MG  A 4002 . ? 1_555 ? 
3  AC1 4  DCP H .    ? DCP A 4003 . ? 1_555 ? 
4  AC1 4  DOC E 24   ? DOC P 24   . ? 1_555 ? 
5  AC2 5  ASP A 862  ? ASP A 890  . ? 1_555 ? 
6  AC2 5  VAL A 863  ? VAL A 891  . ? 1_555 ? 
7  AC2 5  ASP A 1107 ? ASP A 1135 . ? 1_555 ? 
8  AC2 5  MG  F .    ? MG  A 4001 . ? 1_555 ? 
9  AC2 5  DCP H .    ? DCP A 4003 . ? 1_555 ? 
10 AC3 16 ARG A 825  ? ARG A 853  . ? 1_555 ? 
11 AC3 16 ASP A 862  ? ASP A 890  . ? 1_555 ? 
12 AC3 16 VAL A 863  ? VAL A 891  . ? 1_555 ? 
13 AC3 16 ASP A 864  ? ASP A 892  . ? 1_555 ? 
14 AC3 16 SER A 865  ? SER A 893  . ? 1_555 ? 
15 AC3 16 GLN A 866  ? GLN A 894  . ? 1_555 ? 
16 AC3 16 GLU A 867  ? GLU A 895  . ? 1_555 ? 
17 AC3 16 HIS A 904  ? HIS A 932  . ? 1_555 ? 
18 AC3 16 LYS A 919  ? LYS A 947  . ? 1_555 ? 
19 AC3 16 TYR A 923  ? TYR A 951  . ? 1_555 ? 
20 AC3 16 ASP A 1107 ? ASP A 1135 . ? 1_555 ? 
21 AC3 16 MG  F .    ? MG  A 4001 . ? 1_555 ? 
22 AC3 16 MG  G .    ? MG  A 4002 . ? 1_555 ? 
23 AC3 16 DOC E 24   ? DOC P 24   . ? 1_555 ? 
24 AC3 16 DG  D 3    ? DG  T 4    . ? 1_555 ? 
25 AC3 16 DA  D 4    ? DA  T 5    . ? 1_555 ? 
26 AC4 12 ARG A 825  ? ARG A 853  . ? 1_555 ? 
27 AC4 12 LEU A 832  ? LEU A 860  . ? 1_555 ? 
28 AC4 12 ALA A 834  ? ALA A 862  . ? 1_555 ? 
29 AC4 12 ASN A 836  ? ASN A 864  . ? 1_555 ? 
30 AC4 12 ARG A 838  ? ARG A 866  . ? 1_555 ? 
31 AC4 12 HIS A 1106 ? HIS A 1134 . ? 1_555 ? 
32 AC4 12 MG  F .    ? MG  A 4001 . ? 1_555 ? 
33 AC4 12 DCP H .    ? DCP A 4003 . ? 1_555 ? 
34 AC4 12 DT  E 22   ? DT  P 22   . ? 1_555 ? 
35 AC4 12 DA  D 4    ? DA  T 5    . ? 1_555 ? 
36 AC4 12 DT  D 5    ? DT  T 6    . ? 1_555 ? 
37 AC4 12 DA  D 6    ? DA  T 7    . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ZTZ 
_atom_sites.fract_transf_matrix[1][1]   0.004594 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004594 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006030 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A 1 50   ? 33.940  61.780  -62.725 1.00 93.92  ? 78   MET A N     1 
ATOM   2     C  CA    . MET A 1 50   ? 35.083  62.680  -62.807 1.00 85.23  ? 78   MET A CA    1 
ATOM   3     C  C     . MET A 1 50   ? 35.685  62.917  -61.424 1.00 84.85  ? 78   MET A C     1 
ATOM   4     O  O     . MET A 1 50   ? 35.283  63.839  -60.716 1.00 90.15  ? 78   MET A O     1 
ATOM   5     C  CB    . MET A 1 50   ? 34.673  64.011  -63.447 1.00 90.48  ? 78   MET A CB    1 
ATOM   6     C  CG    . MET A 1 50   ? 35.832  64.949  -63.767 1.00 91.50  ? 78   MET A CG    1 
ATOM   7     S  SD    . MET A 1 50   ? 36.129  66.202  -62.502 1.00 91.70  ? 78   MET A SD    1 
ATOM   8     C  CE    . MET A 1 50   ? 34.545  67.036  -62.474 1.00 72.87  ? 78   MET A CE    1 
ATOM   9     N  N     . LEU A 1 51   ? 36.636  62.074  -61.031 1.00 71.07  ? 79   LEU A N     1 
ATOM   10    C  CA    . LEU A 1 51   ? 37.079  60.943  -61.838 1.00 70.04  ? 79   LEU A CA    1 
ATOM   11    C  C     . LEU A 1 51   ? 37.256  59.727  -60.933 1.00 90.70  ? 79   LEU A C     1 
ATOM   12    O  O     . LEU A 1 51   ? 36.905  59.778  -59.754 1.00 73.06  ? 79   LEU A O     1 
ATOM   13    C  CB    . LEU A 1 51   ? 38.386  61.278  -62.567 1.00 87.19  ? 79   LEU A CB    1 
ATOM   14    C  CG    . LEU A 1 51   ? 38.660  60.650  -63.939 1.00 91.23  ? 79   LEU A CG    1 
ATOM   15    C  CD1   . LEU A 1 51   ? 39.786  59.626  -63.862 1.00 84.61  ? 79   LEU A CD1   1 
ATOM   16    C  CD2   . LEU A 1 51   ? 37.399  60.026  -64.526 1.00 92.52  ? 79   LEU A CD2   1 
ATOM   17    N  N     . SER A 1 52   ? 37.791  58.643  -61.490 1.00 85.12  ? 80   SER A N     1 
ATOM   18    C  CA    . SER A 1 52   ? 38.087  57.425  -60.736 1.00 87.88  ? 80   SER A CA    1 
ATOM   19    C  C     . SER A 1 52   ? 36.892  56.923  -59.929 1.00 93.53  ? 80   SER A C     1 
ATOM   20    O  O     . SER A 1 52   ? 37.045  56.498  -58.783 1.00 90.02  ? 80   SER A O     1 
ATOM   21    C  CB    . SER A 1 52   ? 39.281  57.652  -59.803 1.00 77.69  ? 80   SER A CB    1 
ATOM   22    O  OG    . SER A 1 52   ? 40.461  57.921  -60.540 1.00 71.52  ? 80   SER A OG    1 
ATOM   23    N  N     . ARG A 1 53   ? 35.710  56.990  -60.536 1.00 81.26  ? 81   ARG A N     1 
ATOM   24    C  CA    . ARG A 1 53   ? 34.475  56.499  -59.926 1.00 70.21  ? 81   ARG A CA    1 
ATOM   25    C  C     . ARG A 1 53   ? 34.150  57.186  -58.600 1.00 84.16  ? 81   ARG A C     1 
ATOM   26    O  O     . ARG A 1 53   ? 33.679  56.542  -57.662 1.00 75.04  ? 81   ARG A O     1 
ATOM   27    C  CB    . ARG A 1 53   ? 34.555  54.983  -59.720 1.00 77.78  ? 81   ARG A CB    1 
ATOM   28    C  CG    . ARG A 1 53   ? 34.612  54.180  -61.009 1.00 71.81  ? 81   ARG A CG    1 
ATOM   29    C  CD    . ARG A 1 53   ? 35.591  53.019  -60.904 1.00 68.62  ? 81   ARG A CD    1 
ATOM   30    N  NE    . ARG A 1 53   ? 36.969  53.433  -61.163 1.00 71.40  ? 81   ARG A NE    1 
ATOM   31    C  CZ    . ARG A 1 53   ? 37.859  53.728  -60.221 1.00 71.40  ? 81   ARG A CZ    1 
ATOM   32    N  NH1   . ARG A 1 53   ? 37.527  53.655  -58.939 1.00 73.27  ? 81   ARG A NH1   1 
ATOM   33    N  NH2   . ARG A 1 53   ? 39.087  54.096  -60.562 1.00 71.24  ? 81   ARG A NH2   1 
ATOM   34    N  N     . GLY A 1 54   ? 34.402  58.490  -58.525 1.00 90.04  ? 82   GLY A N     1 
ATOM   35    C  CA    . GLY A 1 54   ? 34.021  59.264  -57.357 1.00 87.01  ? 82   GLY A CA    1 
ATOM   36    C  C     . GLY A 1 54   ? 35.118  60.088  -56.705 1.00 68.73  ? 82   GLY A C     1 
ATOM   37    O  O     . GLY A 1 54   ? 35.915  59.568  -55.923 1.00 75.85  ? 82   GLY A O     1 
ATOM   38    N  N     . LEU A 1 55   ? 35.154  61.378  -57.029 1.00 68.43  ? 83   LEU A N     1 
ATOM   39    C  CA    . LEU A 1 55   ? 36.024  62.330  -56.340 1.00 76.05  ? 83   LEU A CA    1 
ATOM   40    C  C     . LEU A 1 55   ? 35.533  63.756  -56.577 1.00 69.04  ? 83   LEU A C     1 
ATOM   41    O  O     . LEU A 1 55   ? 34.820  64.023  -57.543 1.00 68.17  ? 83   LEU A O     1 
ATOM   42    C  CB    . LEU A 1 55   ? 37.484  62.179  -56.793 1.00 84.66  ? 83   LEU A CB    1 
ATOM   43    C  CG    . LEU A 1 55   ? 37.988  62.734  -58.131 1.00 92.86  ? 83   LEU A CG    1 
ATOM   44    C  CD1   . LEU A 1 55   ? 38.485  64.171  -58.007 1.00 84.65  ? 83   LEU A CD1   1 
ATOM   45    C  CD2   . LEU A 1 55   ? 39.088  61.846  -58.694 1.00 85.00  ? 83   LEU A CD2   1 
ATOM   46    N  N     . HIS A 1 56   ? 35.918  64.668  -55.689 1.00 73.78  ? 84   HIS A N     1 
ATOM   47    C  CA    . HIS A 1 56   ? 35.556  66.075  -55.827 1.00 92.42  ? 84   HIS A CA    1 
ATOM   48    C  C     . HIS A 1 56   ? 36.789  66.960  -55.966 1.00 70.89  ? 84   HIS A C     1 
ATOM   49    O  O     . HIS A 1 56   ? 37.918  66.508  -55.769 1.00 75.48  ? 84   HIS A O     1 
ATOM   50    C  CB    . HIS A 1 56   ? 34.724  66.539  -54.630 1.00 93.55  ? 84   HIS A CB    1 
ATOM   51    C  CG    . HIS A 1 56   ? 33.303  66.069  -54.659 1.00 93.35  ? 84   HIS A CG    1 
ATOM   52    N  ND1   . HIS A 1 56   ? 32.737  65.476  -55.766 1.00 93.78  ? 84   HIS A ND1   1 
ATOM   53    C  CD2   . HIS A 1 56   ? 32.333  66.109  -53.715 1.00 81.65  ? 84   HIS A CD2   1 
ATOM   54    C  CE1   . HIS A 1 56   ? 31.479  65.170  -55.504 1.00 86.35  ? 84   HIS A CE1   1 
ATOM   55    N  NE2   . HIS A 1 56   ? 31.209  65.542  -54.266 1.00 92.34  ? 84   HIS A NE2   1 
ATOM   56    N  N     . GLU A 1 57   ? 36.563  68.224  -56.311 1.00 84.06  ? 85   GLU A N     1 
ATOM   57    C  CA    . GLU A 1 57   ? 37.635  69.209  -56.361 1.00 93.00  ? 85   GLU A CA    1 
ATOM   58    C  C     . GLU A 1 57   ? 38.201  69.421  -54.964 1.00 93.50  ? 85   GLU A C     1 
ATOM   59    O  O     . GLU A 1 57   ? 37.509  69.916  -54.074 1.00 91.86  ? 85   GLU A O     1 
ATOM   60    C  CB    . GLU A 1 57   ? 37.130  70.531  -56.946 1.00 90.76  ? 85   GLU A CB    1 
ATOM   61    C  CG    . GLU A 1 57   ? 38.100  71.697  -56.806 1.00 93.28  ? 85   GLU A CG    1 
ATOM   62    C  CD    . GLU A 1 57   ? 37.806  72.562  -55.593 1.00 81.60  ? 85   GLU A CD    1 
ATOM   63    O  OE1   . GLU A 1 57   ? 38.688  73.353  -55.198 1.00 91.96  ? 85   GLU A OE1   1 
ATOM   64    O  OE2   . GLU A 1 57   ? 36.693  72.453  -55.037 1.00 87.35  ? 85   GLU A OE2   1 
ATOM   65    N  N     . GLN A 1 58   ? 39.456  69.035  -54.769 1.00 90.82  ? 86   GLN A N     1 
ATOM   66    C  CA    . GLN A 1 58   ? 40.066  69.133  -53.452 1.00 91.59  ? 86   GLN A CA    1 
ATOM   67    C  C     . GLN A 1 58   ? 41.472  69.713  -53.518 1.00 90.62  ? 86   GLN A C     1 
ATOM   68    O  O     . GLN A 1 58   ? 42.163  69.600  -54.532 1.00 90.21  ? 86   GLN A O     1 
ATOM   69    C  CB    . GLN A 1 58   ? 40.094  67.759  -52.771 1.00 86.55  ? 86   GLN A CB    1 
ATOM   70    C  CG    . GLN A 1 58   ? 41.430  67.025  -52.851 1.00 86.48  ? 86   GLN A CG    1 
ATOM   71    C  CD    . GLN A 1 58   ? 41.758  66.536  -54.250 1.00 87.80  ? 86   GLN A CD    1 
ATOM   72    O  OE1   . GLN A 1 58   ? 40.869  66.341  -55.078 1.00 90.79  ? 86   GLN A OE1   1 
ATOM   73    N  NE2   . GLN A 1 58   ? 43.044  66.336  -54.518 1.00 90.54  ? 86   GLN A NE2   1 
ATOM   74    N  N     . ILE A 1 59   ? 41.880  70.349  -52.427 1.00 77.61  ? 87   ILE A N     1 
ATOM   75    C  CA    . ILE A 1 59   ? 43.240  70.839  -52.285 1.00 71.37  ? 87   ILE A CA    1 
ATOM   76    C  C     . ILE A 1 59   ? 43.818  70.235  -51.008 1.00 69.28  ? 87   ILE A C     1 
ATOM   77    O  O     . ILE A 1 59   ? 44.219  70.949  -50.088 1.00 69.03  ? 87   ILE A O     1 
ATOM   78    C  CB    . ILE A 1 59   ? 43.307  72.385  -52.240 1.00 73.16  ? 87   ILE A CB    1 
ATOM   79    C  CG1   . ILE A 1 59   ? 42.365  73.006  -53.278 1.00 76.47  ? 87   ILE A CG1   1 
ATOM   80    C  CG2   . ILE A 1 59   ? 44.731  72.870  -52.479 1.00 73.75  ? 87   ILE A CG2   1 
ATOM   81    C  CD1   . ILE A 1 59   ? 41.006  73.411  -52.734 1.00 73.18  ? 87   ILE A CD1   1 
ATOM   82    N  N     . PHE A 1 60   ? 43.835  68.906  -50.956 1.00 85.95  ? 88   PHE A N     1 
ATOM   83    C  CA    . PHE A 1 60   ? 44.340  68.181  -49.795 1.00 91.75  ? 88   PHE A CA    1 
ATOM   84    C  C     . PHE A 1 60   ? 45.538  67.315  -50.165 1.00 84.11  ? 88   PHE A C     1 
ATOM   85    O  O     . PHE A 1 60   ? 45.856  66.348  -49.473 1.00 84.09  ? 88   PHE A O     1 
ATOM   86    C  CB    . PHE A 1 60   ? 43.239  67.313  -49.182 1.00 84.05  ? 88   PHE A CB    1 
ATOM   87    C  CG    . PHE A 1 60   ? 42.080  68.098  -48.642 1.00 90.62  ? 88   PHE A CG    1 
ATOM   88    C  CD1   . PHE A 1 60   ? 42.265  69.379  -48.149 1.00 90.06  ? 88   PHE A CD1   1 
ATOM   89    C  CD2   . PHE A 1 60   ? 40.805  67.557  -48.629 1.00 92.95  ? 88   PHE A CD2   1 
ATOM   90    C  CE1   . PHE A 1 60   ? 41.201  70.106  -47.652 1.00 85.57  ? 88   PHE A CE1   1 
ATOM   91    C  CE2   . PHE A 1 60   ? 39.736  68.280  -48.133 1.00 93.55  ? 88   PHE A CE2   1 
ATOM   92    C  CZ    . PHE A 1 60   ? 39.935  69.556  -47.644 1.00 90.39  ? 88   PHE A CZ    1 
ATOM   93    N  N     . GLY A 1 61   ? 46.199  67.668  -51.262 1.00 92.44  ? 89   GLY A N     1 
ATOM   94    C  CA    . GLY A 1 61   ? 47.348  66.919  -51.732 1.00 90.91  ? 89   GLY A CA    1 
ATOM   95    C  C     . GLY A 1 61   ? 47.304  66.712  -53.232 1.00 84.47  ? 89   GLY A C     1 
ATOM   96    O  O     . GLY A 1 61   ? 46.366  66.112  -53.757 1.00 92.05  ? 89   GLY A O     1 
ATOM   97    N  N     . GLN A 1 62   ? 48.322  67.211  -53.924 1.00 86.59  ? 90   GLN A N     1 
ATOM   98    C  CA    . GLN A 1 62   ? 48.373  67.125  -55.378 1.00 90.78  ? 90   GLN A CA    1 
ATOM   99    C  C     . GLN A 1 62   ? 48.768  65.724  -55.841 1.00 86.34  ? 90   GLN A C     1 
ATOM   100   O  O     . GLN A 1 62   ? 48.337  65.267  -56.900 1.00 91.33  ? 90   GLN A O     1 
ATOM   101   C  CB    . GLN A 1 62   ? 49.346  68.166  -55.939 1.00 70.36  ? 90   GLN A CB    1 
ATOM   102   C  CG    . GLN A 1 62   ? 49.330  68.289  -57.456 1.00 70.95  ? 90   GLN A CG    1 
ATOM   103   C  CD    . GLN A 1 62   ? 48.021  68.843  -57.992 1.00 77.82  ? 90   GLN A CD    1 
ATOM   104   O  OE1   . GLN A 1 62   ? 47.253  69.474  -57.265 1.00 77.47  ? 90   GLN A OE1   1 
ATOM   105   N  NE2   . GLN A 1 62   ? 47.762  68.608  -59.273 1.00 75.59  ? 90   GLN A NE2   1 
ATOM   106   N  N     . GLY A 1 63   ? 49.583  65.043  -55.041 1.00 93.61  ? 91   GLY A N     1 
ATOM   107   C  CA    . GLY A 1 63   ? 50.006  63.691  -55.358 1.00 73.39  ? 91   GLY A CA    1 
ATOM   108   C  C     . GLY A 1 63   ? 50.121  62.814  -54.125 1.00 74.64  ? 91   GLY A C     1 
ATOM   109   O  O     . GLY A 1 63   ? 50.845  63.148  -53.187 1.00 75.19  ? 91   GLY A O     1 
ATOM   110   N  N     . GLY A 1 64   ? 49.412  61.688  -54.122 1.00 90.09  ? 92   GLY A N     1 
ATOM   111   C  CA    . GLY A 1 64   ? 48.577  61.286  -55.241 1.00 90.83  ? 92   GLY A CA    1 
ATOM   112   C  C     . GLY A 1 64   ? 48.750  59.813  -55.561 1.00 93.40  ? 92   GLY A C     1 
ATOM   113   O  O     . GLY A 1 64   ? 49.303  59.066  -54.755 1.00 91.59  ? 92   GLY A O     1 
ATOM   114   N  N     . GLU A 1 65   ? 48.266  59.400  -56.731 1.00 68.04  ? 93   GLU A N     1 
ATOM   115   C  CA    . GLU A 1 65   ? 48.438  58.032  -57.222 1.00 90.20  ? 93   GLU A CA    1 
ATOM   116   C  C     . GLU A 1 65   ? 49.916  57.627  -57.168 1.00 93.37  ? 93   GLU A C     1 
ATOM   117   O  O     . GLU A 1 65   ? 50.746  58.359  -57.706 1.00 43.06  ? 93   GLU A O     1 
ATOM   118   C  CB    . GLU A 1 65   ? 47.903  57.910  -58.653 1.00 91.53  ? 93   GLU A CB    1 
ATOM   119   C  CG    . GLU A 1 65   ? 46.671  57.025  -58.814 1.00 87.80  ? 93   GLU A CG    1 
ATOM   120   C  CD    . GLU A 1 65   ? 45.472  57.515  -58.023 1.00 90.16  ? 93   GLU A CD    1 
ATOM   121   O  OE1   . GLU A 1 65   ? 44.635  56.673  -57.632 1.00 91.02  ? 93   GLU A OE1   1 
ATOM   122   O  OE2   . GLU A 1 65   ? 45.358  58.738  -57.798 1.00 84.38  ? 93   GLU A OE2   1 
ATOM   123   N  N     . MET A 1 66   ? 50.290  56.499  -56.546 1.00 45.96  ? 94   MET A N     1 
ATOM   124   C  CA    . MET A 1 66   ? 49.444  55.442  -55.946 1.00 92.66  ? 94   MET A CA    1 
ATOM   125   C  C     . MET A 1 66   ? 48.394  54.815  -56.873 1.00 91.75  ? 94   MET A C     1 
ATOM   126   O  O     . MET A 1 66   ? 47.197  54.897  -56.596 1.00 87.70  ? 94   MET A O     1 
ATOM   127   C  CB    . MET A 1 66   ? 48.748  55.957  -54.675 1.00 48.66  ? 94   MET A CB    1 
ATOM   128   C  CG    . MET A 1 66   ? 49.669  56.126  -53.479 1.00 43.17  ? 94   MET A CG    1 
ATOM   129   S  SD    . MET A 1 66   ? 50.162  54.550  -52.760 1.00 66.29  ? 94   MET A SD    1 
ATOM   130   C  CE    . MET A 1 66   ? 48.573  53.907  -52.239 1.00 77.22  ? 94   MET A CE    1 
ATOM   131   N  N     . PRO A 1 67   ? 48.841  54.169  -57.966 1.00 75.32  ? 95   PRO A N     1 
ATOM   132   C  CA    . PRO A 1 67   ? 47.886  53.491  -58.848 1.00 72.02  ? 95   PRO A CA    1 
ATOM   133   C  C     . PRO A 1 67   ? 47.581  52.053  -58.413 1.00 69.35  ? 95   PRO A C     1 
ATOM   134   O  O     . PRO A 1 67   ? 46.415  51.720  -58.203 1.00 86.31  ? 95   PRO A O     1 
ATOM   135   C  CB    . PRO A 1 67   ? 48.591  53.518  -60.205 1.00 73.70  ? 95   PRO A CB    1 
ATOM   136   C  CG    . PRO A 1 67   ? 50.047  53.503  -59.872 1.00 92.08  ? 95   PRO A CG    1 
ATOM   137   C  CD    . PRO A 1 67   ? 50.211  54.145  -58.514 1.00 91.16  ? 95   PRO A CD    1 
ATOM   138   N  N     . GLY A 1 68   ? 48.612  51.222  -58.277 1.00 71.19  ? 96   GLY A N     1 
ATOM   139   C  CA    . GLY A 1 68   ? 48.436  49.829  -57.906 1.00 68.92  ? 96   GLY A CA    1 
ATOM   140   C  C     . GLY A 1 68   ? 47.681  49.048  -58.963 1.00 71.99  ? 96   GLY A C     1 
ATOM   141   O  O     . GLY A 1 68   ? 46.664  48.420  -58.671 1.00 71.00  ? 96   GLY A O     1 
ATOM   142   N  N     . GLU A 1 69   ? 48.192  49.083  -60.191 1.00 90.74  ? 97   GLU A N     1 
ATOM   143   C  CA    . GLU A 1 69   ? 47.517  48.496  -61.349 1.00 91.37  ? 97   GLU A CA    1 
ATOM   144   C  C     . GLU A 1 69   ? 47.188  47.013  -61.173 1.00 86.80  ? 97   GLU A C     1 
ATOM   145   O  O     . GLU A 1 69   ? 46.116  46.554  -61.575 1.00 90.31  ? 97   GLU A O     1 
ATOM   146   C  CB    . GLU A 1 69   ? 48.375  48.692  -62.600 1.00 81.64  ? 97   GLU A CB    1 
ATOM   147   C  CG    . GLU A 1 69   ? 48.757  50.142  -62.860 1.00 86.14  ? 97   GLU A CG    1 
ATOM   148   C  CD    . GLU A 1 69   ? 49.721  50.295  -64.019 1.00 81.00  ? 97   GLU A CD    1 
ATOM   149   O  OE1   . GLU A 1 69   ? 50.013  49.283  -64.689 1.00 86.17  ? 97   GLU A OE1   1 
ATOM   150   O  OE2   . GLU A 1 69   ? 50.190  51.428  -64.258 1.00 87.12  ? 97   GLU A OE2   1 
ATOM   151   N  N     . ALA A 1 70   ? 48.109  46.267  -60.574 1.00 87.77  ? 98   ALA A N     1 
ATOM   152   C  CA    . ALA A 1 70   ? 47.877  44.852  -60.307 1.00 93.26  ? 98   ALA A CA    1 
ATOM   153   C  C     . ALA A 1 70   ? 46.740  44.683  -59.305 1.00 87.32  ? 98   ALA A C     1 
ATOM   154   O  O     . ALA A 1 70   ? 45.851  43.846  -59.487 1.00 93.02  ? 98   ALA A O     1 
ATOM   155   C  CB    . ALA A 1 70   ? 49.146  44.190  -59.794 1.00 86.08  ? 98   ALA A CB    1 
ATOM   156   N  N     . ALA A 1 71   ? 46.772  45.495  -58.254 1.00 92.19  ? 99   ALA A N     1 
ATOM   157   C  CA    . ALA A 1 71   ? 45.759  45.447  -57.208 1.00 71.34  ? 99   ALA A CA    1 
ATOM   158   C  C     . ALA A 1 71   ? 44.381  45.824  -57.744 1.00 72.81  ? 99   ALA A C     1 
ATOM   159   O  O     . ALA A 1 71   ? 43.375  45.240  -57.341 1.00 70.60  ? 99   ALA A O     1 
ATOM   160   C  CB    . ALA A 1 71   ? 46.146  46.362  -56.056 1.00 70.49  ? 99   ALA A CB    1 
ATOM   161   N  N     . VAL A 1 72   ? 44.333  46.795  -58.652 1.00 90.08  ? 100  VAL A N     1 
ATOM   162   C  CA    . VAL A 1 72   ? 43.054  47.221  -59.208 1.00 75.31  ? 100  VAL A CA    1 
ATOM   163   C  C     . VAL A 1 72   ? 42.578  46.246  -60.280 1.00 72.63  ? 100  VAL A C     1 
ATOM   164   O  O     . VAL A 1 72   ? 41.389  46.191  -60.583 1.00 76.38  ? 100  VAL A O     1 
ATOM   165   C  CB    . VAL A 1 72   ? 43.112  48.652  -59.798 1.00 74.64  ? 100  VAL A CB    1 
ATOM   166   C  CG1   . VAL A 1 72   ? 43.710  49.622  -58.790 1.00 68.55  ? 100  VAL A CG1   1 
ATOM   167   C  CG2   . VAL A 1 72   ? 43.885  48.678  -61.106 1.00 72.88  ? 100  VAL A CG2   1 
ATOM   168   N  N     . ARG A 1 73   ? 43.498  45.471  -60.848 1.00 69.59  ? 101  ARG A N     1 
ATOM   169   C  CA    . ARG A 1 73   ? 43.100  44.416  -61.774 1.00 92.68  ? 101  ARG A CA    1 
ATOM   170   C  C     . ARG A 1 73   ? 42.478  43.280  -60.964 1.00 85.77  ? 101  ARG A C     1 
ATOM   171   O  O     . ARG A 1 73   ? 41.470  42.691  -61.370 1.00 85.27  ? 101  ARG A O     1 
ATOM   172   C  CB    . ARG A 1 73   ? 44.296  43.941  -62.620 1.00 87.27  ? 101  ARG A CB    1 
ATOM   173   C  CG    . ARG A 1 73   ? 44.801  42.516  -62.372 1.00 90.53  ? 101  ARG A CG    1 
ATOM   174   C  CD    . ARG A 1 73   ? 44.006  41.463  -63.144 1.00 81.14  ? 101  ARG A CD    1 
ATOM   175   N  NE    . ARG A 1 73   ? 43.894  41.774  -64.566 1.00 93.48  ? 101  ARG A NE    1 
ATOM   176   C  CZ    . ARG A 1 73   ? 43.221  41.030  -65.438 1.00 72.00  ? 101  ARG A CZ    1 
ATOM   177   N  NH1   . ARG A 1 73   ? 42.600  39.930  -65.032 1.00 70.37  ? 101  ARG A NH1   1 
ATOM   178   N  NH2   . ARG A 1 73   ? 43.167  41.384  -66.714 1.00 75.64  ? 101  ARG A NH2   1 
ATOM   179   N  N     . ARG A 1 74   ? 43.073  42.991  -59.808 1.00 85.45  ? 102  ARG A N     1 
ATOM   180   C  CA    . ARG A 1 74   ? 42.536  41.983  -58.902 1.00 93.33  ? 102  ARG A CA    1 
ATOM   181   C  C     . ARG A 1 74   ? 41.158  42.403  -58.406 1.00 90.56  ? 102  ARG A C     1 
ATOM   182   O  O     . ARG A 1 74   ? 40.228  41.595  -58.357 1.00 86.97  ? 102  ARG A O     1 
ATOM   183   C  CB    . ARG A 1 74   ? 43.485  41.761  -57.721 1.00 85.28  ? 102  ARG A CB    1 
ATOM   184   C  CG    . ARG A 1 74   ? 44.794  41.082  -58.093 1.00 92.72  ? 102  ARG A CG    1 
ATOM   185   C  CD    . ARG A 1 74   ? 44.627  39.574  -58.187 1.00 86.83  ? 102  ARG A CD    1 
ATOM   186   N  NE    . ARG A 1 74   ? 45.275  39.019  -59.372 1.00 87.88  ? 102  ARG A NE    1 
ATOM   187   C  CZ    . ARG A 1 74   ? 45.423  37.718  -59.601 1.00 84.71  ? 102  ARG A CZ    1 
ATOM   188   N  NH1   . ARG A 1 74   ? 44.980  36.832  -58.719 1.00 91.44  ? 102  ARG A NH1   1 
ATOM   189   N  NH2   . ARG A 1 74   ? 46.022  37.302  -60.709 1.00 92.05  ? 102  ARG A NH2   1 
ATOM   190   N  N     . SER A 1 75   ? 41.035  43.679  -58.056 1.00 90.17  ? 103  SER A N     1 
ATOM   191   C  CA    . SER A 1 75   ? 39.782  44.218  -57.544 1.00 86.27  ? 103  SER A CA    1 
ATOM   192   C  C     . SER A 1 75   ? 38.695  44.228  -58.613 1.00 90.70  ? 103  SER A C     1 
ATOM   193   O  O     . SER A 1 75   ? 37.556  43.863  -58.342 1.00 81.43  ? 103  SER A O     1 
ATOM   194   C  CB    . SER A 1 75   ? 39.987  45.632  -57.000 1.00 91.42  ? 103  SER A CB    1 
ATOM   195   O  OG    . SER A 1 75   ? 40.157  46.564  -58.053 1.00 87.36  ? 103  SER A OG    1 
ATOM   196   N  N     . VAL A 1 76   ? 39.048  44.652  -59.824 1.00 84.65  ? 104  VAL A N     1 
ATOM   197   C  CA    . VAL A 1 76   ? 38.089  44.695  -60.925 1.00 90.61  ? 104  VAL A CA    1 
ATOM   198   C  C     . VAL A 1 76   ? 37.619  43.291  -61.296 1.00 90.34  ? 104  VAL A C     1 
ATOM   199   O  O     . VAL A 1 76   ? 36.424  43.064  -61.496 1.00 87.43  ? 104  VAL A O     1 
ATOM   200   C  CB    . VAL A 1 76   ? 38.682  45.392  -62.172 1.00 77.29  ? 104  VAL A CB    1 
ATOM   201   C  CG1   . VAL A 1 76   ? 37.928  44.991  -63.433 1.00 72.77  ? 104  VAL A CG1   1 
ATOM   202   C  CG2   . VAL A 1 76   ? 38.660  46.902  -61.993 1.00 76.35  ? 104  VAL A CG2   1 
ATOM   203   N  N     . GLU A 1 77   ? 38.557  42.351  -61.373 1.00 92.48  ? 105  GLU A N     1 
ATOM   204   C  CA    . GLU A 1 77   ? 38.214  40.965  -61.676 1.00 72.11  ? 105  GLU A CA    1 
ATOM   205   C  C     . GLU A 1 77   ? 37.294  40.397  -60.596 1.00 90.47  ? 105  GLU A C     1 
ATOM   206   O  O     . GLU A 1 77   ? 36.295  39.732  -60.895 1.00 73.36  ? 105  GLU A O     1 
ATOM   207   C  CB    . GLU A 1 77   ? 39.478  40.112  -61.802 1.00 76.01  ? 105  GLU A CB    1 
ATOM   208   C  CG    . GLU A 1 77   ? 39.305  38.858  -62.645 1.00 76.27  ? 105  GLU A CG    1 
ATOM   209   C  CD    . GLU A 1 77   ? 39.109  39.167  -64.118 1.00 70.81  ? 105  GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1 77   ? 37.949  39.357  -64.540 1.00 70.38  ? 105  GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1 77   ? 40.117  39.220  -64.854 1.00 74.82  ? 105  GLU A OE2   1 
ATOM   212   N  N     . HIS A 1 78   ? 37.636  40.679  -59.341 1.00 81.83  ? 106  HIS A N     1 
ATOM   213   C  CA    . HIS A 1 78   ? 36.826  40.264  -58.200 1.00 92.49  ? 106  HIS A CA    1 
ATOM   214   C  C     . HIS A 1 78   ? 35.406  40.815  -58.282 1.00 90.40  ? 106  HIS A C     1 
ATOM   215   O  O     . HIS A 1 78   ? 34.436  40.088  -58.076 1.00 84.38  ? 106  HIS A O     1 
ATOM   216   C  CB    . HIS A 1 78   ? 37.483  40.712  -56.892 1.00 90.93  ? 106  HIS A CB    1 
ATOM   217   C  CG    . HIS A 1 78   ? 36.552  40.720  -55.719 1.00 71.57  ? 106  HIS A CG    1 
ATOM   218   N  ND1   . HIS A 1 78   ? 35.868  39.598  -55.303 1.00 74.75  ? 106  HIS A ND1   1 
ATOM   219   C  CD2   . HIS A 1 78   ? 36.193  41.714  -54.873 1.00 72.62  ? 106  HIS A CD2   1 
ATOM   220   C  CE1   . HIS A 1 78   ? 35.128  39.901  -54.251 1.00 70.12  ? 106  HIS A CE1   1 
ATOM   221   N  NE2   . HIS A 1 78   ? 35.307  41.179  -53.970 1.00 72.73  ? 106  HIS A NE2   1 
ATOM   222   N  N     . LEU A 1 79   ? 35.295  42.103  -58.592 1.00 75.02  ? 107  LEU A N     1 
ATOM   223   C  CA    . LEU A 1 79   ? 34.001  42.770  -58.681 1.00 74.41  ? 107  LEU A CA    1 
ATOM   224   C  C     . LEU A 1 79   ? 33.239  42.362  -59.937 1.00 81.87  ? 107  LEU A C     1 
ATOM   225   O  O     . LEU A 1 79   ? 32.046  42.631  -60.060 1.00 76.47  ? 107  LEU A O     1 
ATOM   226   C  CB    . LEU A 1 79   ? 34.180  44.290  -58.653 1.00 75.96  ? 107  LEU A CB    1 
ATOM   227   C  CG    . LEU A 1 79   ? 34.724  44.902  -57.361 1.00 75.84  ? 107  LEU A CG    1 
ATOM   228   C  CD1   . LEU A 1 79   ? 34.856  46.411  -57.498 1.00 69.45  ? 107  LEU A CD1   1 
ATOM   229   C  CD2   . LEU A 1 79   ? 33.840  44.542  -56.178 1.00 68.74  ? 107  LEU A CD2   1 
ATOM   230   N  N     . GLN A 1 80   ? 33.934  41.720  -60.871 1.00 90.34  ? 108  GLN A N     1 
ATOM   231   C  CA    . GLN A 1 80   ? 33.299  41.242  -62.092 1.00 90.38  ? 108  GLN A CA    1 
ATOM   232   C  C     . GLN A 1 80   ? 32.725  39.846  -61.887 1.00 72.57  ? 108  GLN A C     1 
ATOM   233   O  O     . GLN A 1 80   ? 31.632  39.540  -62.365 1.00 91.12  ? 108  GLN A O     1 
ATOM   234   C  CB    . GLN A 1 80   ? 34.291  41.240  -63.257 1.00 87.76  ? 108  GLN A CB    1 
ATOM   235   C  CG    . GLN A 1 80   ? 33.687  40.796  -64.582 1.00 87.77  ? 108  GLN A CG    1 
ATOM   236   C  CD    . GLN A 1 80   ? 34.684  40.835  -65.724 1.00 86.33  ? 108  GLN A CD    1 
ATOM   237   O  OE1   . GLN A 1 80   ? 35.827  41.256  -65.550 1.00 91.32  ? 108  GLN A OE1   1 
ATOM   238   N  NE2   . GLN A 1 80   ? 34.253  40.396  -66.901 1.00 87.77  ? 108  GLN A NE2   1 
ATOM   239   N  N     . LYS A 1 81   ? 33.464  39.002  -61.173 1.00 74.69  ? 109  LYS A N     1 
ATOM   240   C  CA    . LYS A 1 81   ? 33.009  37.640  -60.911 1.00 71.67  ? 109  LYS A CA    1 
ATOM   241   C  C     . LYS A 1 81   ? 32.035  37.600  -59.732 1.00 70.88  ? 109  LYS A C     1 
ATOM   242   O  O     . LYS A 1 81   ? 31.269  36.647  -59.579 1.00 81.99  ? 109  LYS A O     1 
ATOM   243   C  CB    . LYS A 1 81   ? 34.206  36.718  -60.653 1.00 90.30  ? 109  LYS A CB    1 
ATOM   244   C  CG    . LYS A 1 81   ? 33.854  35.241  -60.511 1.00 86.49  ? 109  LYS A CG    1 
ATOM   245   C  CD    . LYS A 1 81   ? 33.013  34.746  -61.681 1.00 91.13  ? 109  LYS A CD    1 
ATOM   246   C  CE    . LYS A 1 81   ? 33.811  34.715  -62.975 1.00 91.02  ? 109  LYS A CE    1 
ATOM   247   N  NZ    . LYS A 1 81   ? 34.932  33.737  -62.911 1.00 90.56  ? 109  LYS A NZ    1 
ATOM   248   N  N     . HIS A 1 82   ? 32.057  38.647  -58.912 1.00 75.33  ? 110  HIS A N     1 
ATOM   249   C  CA    . HIS A 1 82   ? 31.197  38.717  -57.728 1.00 75.11  ? 110  HIS A CA    1 
ATOM   250   C  C     . HIS A 1 82   ? 29.678  38.638  -58.008 1.00 71.73  ? 110  HIS A C     1 
ATOM   251   O  O     . HIS A 1 82   ? 29.000  37.842  -57.358 1.00 75.29  ? 110  HIS A O     1 
ATOM   252   C  CB    . HIS A 1 82   ? 31.509  39.986  -56.923 1.00 68.70  ? 110  HIS A CB    1 
ATOM   253   C  CG    . HIS A 1 82   ? 30.830  40.037  -55.590 1.00 71.66  ? 110  HIS A CG    1 
ATOM   254   N  ND1   . HIS A 1 82   ? 31.060  39.105  -54.602 1.00 91.63  ? 110  HIS A ND1   1 
ATOM   255   C  CD2   . HIS A 1 82   ? 29.927  40.908  -55.082 1.00 73.71  ? 110  HIS A CD2   1 
ATOM   256   C  CE1   . HIS A 1 82   ? 30.329  39.400  -53.542 1.00 92.88  ? 110  HIS A CE1   1 
ATOM   257   N  NE2   . HIS A 1 82   ? 29.631  40.489  -53.808 1.00 93.91  ? 110  HIS A NE2   1 
ATOM   258   N  N     . GLY A 1 83   ? 29.118  39.424  -58.937 1.00 74.18  ? 111  GLY A N     1 
ATOM   259   C  CA    . GLY A 1 83   ? 29.812  40.394  -59.769 1.00 75.18  ? 111  GLY A CA    1 
ATOM   260   C  C     . GLY A 1 83   ? 29.022  41.674  -59.970 1.00 84.00  ? 111  GLY A C     1 
ATOM   261   O  O     . GLY A 1 83   ? 27.814  41.640  -60.202 1.00 91.78  ? 111  GLY A O     1 
ATOM   262   N  N     . LEU A 1 84   ? 29.710  42.807  -59.877 1.00 81.74  ? 112  LEU A N     1 
ATOM   263   C  CA    . LEU A 1 84   ? 29.079  44.110  -60.059 1.00 72.78  ? 112  LEU A CA    1 
ATOM   264   C  C     . LEU A 1 84   ? 29.822  44.950  -61.094 1.00 69.00  ? 112  LEU A C     1 
ATOM   265   O  O     . LEU A 1 84   ? 30.882  45.507  -60.808 1.00 74.12  ? 112  LEU A O     1 
ATOM   266   C  CB    . LEU A 1 84   ? 29.010  44.872  -58.730 1.00 74.68  ? 112  LEU A CB    1 
ATOM   267   C  CG    . LEU A 1 84   ? 27.918  44.516  -57.716 1.00 70.01  ? 112  LEU A CG    1 
ATOM   268   C  CD1   . LEU A 1 84   ? 28.204  43.195  -57.020 1.00 74.61  ? 112  LEU A CD1   1 
ATOM   269   C  CD2   . LEU A 1 84   ? 27.777  45.628  -56.689 1.00 68.91  ? 112  LEU A CD2   1 
ATOM   270   N  N     . TRP A 1 85   ? 29.262  45.037  -62.297 1.00 87.11  ? 113  TRP A N     1 
ATOM   271   C  CA    . TRP A 1 85   ? 29.838  45.870  -63.348 1.00 81.13  ? 113  TRP A CA    1 
ATOM   272   C  C     . TRP A 1 85   ? 28.753  46.590  -64.140 1.00 74.12  ? 113  TRP A C     1 
ATOM   273   O  O     . TRP A 1 85   ? 28.913  46.858  -65.331 1.00 73.39  ? 113  TRP A O     1 
ATOM   274   C  CB    . TRP A 1 85   ? 30.708  45.033  -64.286 1.00 90.66  ? 113  TRP A CB    1 
ATOM   275   C  CG    . TRP A 1 85   ? 32.171  45.299  -64.120 1.00 90.84  ? 113  TRP A CG    1 
ATOM   276   C  CD1   . TRP A 1 85   ? 33.063  44.556  -63.405 1.00 85.69  ? 113  TRP A CD1   1 
ATOM   277   C  CD2   . TRP A 1 85   ? 32.911  46.394  -64.672 1.00 84.80  ? 113  TRP A CD2   1 
ATOM   278   N  NE1   . TRP A 1 85   ? 34.315  45.117  -63.482 1.00 81.34  ? 113  TRP A NE1   1 
ATOM   279   C  CE2   . TRP A 1 85   ? 34.249  46.247  -64.254 1.00 93.11  ? 113  TRP A CE2   1 
ATOM   280   C  CE3   . TRP A 1 85   ? 32.574  47.484  -65.481 1.00 90.21  ? 113  TRP A CE3   1 
ATOM   281   C  CZ2   . TRP A 1 85   ? 35.248  47.147  -64.618 1.00 90.62  ? 113  TRP A CZ2   1 
ATOM   282   C  CZ3   . TRP A 1 85   ? 33.567  48.376  -65.841 1.00 93.08  ? 113  TRP A CZ3   1 
ATOM   283   C  CH2   . TRP A 1 85   ? 34.888  48.202  -65.410 1.00 92.46  ? 113  TRP A CH2   1 
ATOM   284   N  N     . GLY A 1 86   ? 27.650  46.899  -63.469 1.00 75.68  ? 114  GLY A N     1 
ATOM   285   C  CA    . GLY A 1 86   ? 26.568  47.651  -64.075 1.00 77.22  ? 114  GLY A CA    1 
ATOM   286   C  C     . GLY A 1 86   ? 26.433  49.014  -63.428 1.00 93.61  ? 114  GLY A C     1 
ATOM   287   O  O     . GLY A 1 86   ? 25.478  49.273  -62.696 1.00 84.31  ? 114  GLY A O     1 
ATOM   288   N  N     . GLN A 1 87   ? 27.400  49.886  -63.698 1.00 40.63  ? 115  GLN A N     1 
ATOM   289   C  CA    . GLN A 1 87   ? 27.428  51.218  -63.103 1.00 48.11  ? 115  GLN A CA    1 
ATOM   290   C  C     . GLN A 1 87   ? 26.246  52.067  -63.565 1.00 49.78  ? 115  GLN A C     1 
ATOM   291   O  O     . GLN A 1 87   ? 25.888  52.056  -64.743 1.00 44.91  ? 115  GLN A O     1 
ATOM   292   C  CB    . GLN A 1 87   ? 28.750  51.926  -63.429 1.00 43.16  ? 115  GLN A CB    1 
ATOM   293   C  CG    . GLN A 1 87   ? 29.037  52.111  -64.917 1.00 90.83  ? 115  GLN A CG    1 
ATOM   294   C  CD    . GLN A 1 87   ? 29.571  50.854  -65.580 1.00 90.00  ? 115  GLN A CD    1 
ATOM   295   O  OE1   . GLN A 1 87   ? 29.830  49.850  -64.916 1.00 84.99  ? 115  GLN A OE1   1 
ATOM   296   N  NE2   . GLN A 1 87   ? 29.739  50.905  -66.896 1.00 40.66  ? 115  GLN A NE2   1 
ATOM   297   N  N     . PRO A 1 88   ? 25.629  52.801  -62.627 1.00 56.80  ? 116  PRO A N     1 
ATOM   298   C  CA    . PRO A 1 88   ? 24.482  53.664  -62.926 1.00 65.28  ? 116  PRO A CA    1 
ATOM   299   C  C     . PRO A 1 88   ? 24.889  54.956  -63.629 1.00 60.50  ? 116  PRO A C     1 
ATOM   300   O  O     . PRO A 1 88   ? 24.066  55.555  -64.323 1.00 68.30  ? 116  PRO A O     1 
ATOM   301   C  CB    . PRO A 1 88   ? 23.900  53.958  -61.541 1.00 68.86  ? 116  PRO A CB    1 
ATOM   302   C  CG    . PRO A 1 88   ? 25.075  53.885  -60.632 1.00 66.71  ? 116  PRO A CG    1 
ATOM   303   C  CD    . PRO A 1 88   ? 25.964  52.807  -61.191 1.00 65.24  ? 116  PRO A CD    1 
ATOM   304   N  N     . ALA A 1 89   ? 26.143  55.364  -63.444 1.00 44.80  ? 117  ALA A N     1 
ATOM   305   C  CA    . ALA A 1 89   ? 26.678  56.588  -64.038 1.00 73.88  ? 117  ALA A CA    1 
ATOM   306   C  C     . ALA A 1 89   ? 25.821  57.804  -63.696 1.00 74.30  ? 117  ALA A C     1 
ATOM   307   O  O     . ALA A 1 89   ? 25.306  58.483  -64.585 1.00 91.96  ? 117  ALA A O     1 
ATOM   308   C  CB    . ALA A 1 89   ? 26.805  56.435  -65.550 1.00 71.76  ? 117  ALA A CB    1 
ATOM   309   N  N     . VAL A 1 90   ? 25.674  58.070  -62.402 1.00 87.93  ? 118  VAL A N     1 
ATOM   310   C  CA    . VAL A 1 90   ? 24.887  59.205  -61.932 1.00 86.29  ? 118  VAL A CA    1 
ATOM   311   C  C     . VAL A 1 90   ? 25.732  60.153  -61.081 1.00 93.64  ? 118  VAL A C     1 
ATOM   312   O  O     . VAL A 1 90   ? 25.707  60.085  -59.851 1.00 91.91  ? 118  VAL A O     1 
ATOM   313   C  CB    . VAL A 1 90   ? 23.657  58.739  -61.123 1.00 81.13  ? 118  VAL A CB    1 
ATOM   314   C  CG1   . VAL A 1 90   ? 22.485  58.462  -62.051 1.00 86.30  ? 118  VAL A CG1   1 
ATOM   315   C  CG2   . VAL A 1 90   ? 23.995  57.504  -60.295 1.00 92.82  ? 118  VAL A CG2   1 
ATOM   316   N  N     . PRO A 1 91   ? 26.486  61.047  -61.741 1.00 85.93  ? 119  PRO A N     1 
ATOM   317   C  CA    . PRO A 1 91   ? 27.382  61.992  -61.064 1.00 85.39  ? 119  PRO A CA    1 
ATOM   318   C  C     . PRO A 1 91   ? 26.641  62.980  -60.165 1.00 92.73  ? 119  PRO A C     1 
ATOM   319   O  O     . PRO A 1 91   ? 25.763  63.702  -60.638 1.00 85.25  ? 119  PRO A O     1 
ATOM   320   C  CB    . PRO A 1 91   ? 28.060  62.729  -62.227 1.00 90.26  ? 119  PRO A CB    1 
ATOM   321   C  CG    . PRO A 1 91   ? 27.886  61.835  -63.410 1.00 92.86  ? 119  PRO A CG    1 
ATOM   322   C  CD    . PRO A 1 91   ? 26.562  61.174  -63.205 1.00 91.80  ? 119  PRO A CD    1 
ATOM   323   N  N     . LEU A 1 92   ? 26.995  63.005  -58.884 1.00 84.62  ? 120  LEU A N     1 
ATOM   324   C  CA    . LEU A 1 92   ? 26.424  63.969  -57.950 1.00 93.32  ? 120  LEU A CA    1 
ATOM   325   C  C     . LEU A 1 92   ? 26.979  65.362  -58.240 1.00 87.97  ? 120  LEU A C     1 
ATOM   326   O  O     . LEU A 1 92   ? 28.117  65.494  -58.692 1.00 92.74  ? 120  LEU A O     1 
ATOM   327   C  CB    . LEU A 1 92   ? 26.714  63.564  -56.500 1.00 93.38  ? 120  LEU A CB    1 
ATOM   328   C  CG    . LEU A 1 92   ? 25.786  62.538  -55.840 1.00 74.44  ? 120  LEU A CG    1 
ATOM   329   C  CD1   . LEU A 1 92   ? 25.968  61.151  -56.440 1.00 69.69  ? 120  LEU A CD1   1 
ATOM   330   C  CD2   . LEU A 1 92   ? 26.020  62.499  -54.336 1.00 68.21  ? 120  LEU A CD2   1 
ATOM   331   N  N     . PRO A 1 93   ? 26.173  66.407  -57.988 1.00 84.92  ? 121  PRO A N     1 
ATOM   332   C  CA    . PRO A 1 93   ? 26.601  67.786  -58.257 1.00 85.90  ? 121  PRO A CA    1 
ATOM   333   C  C     . PRO A 1 93   ? 27.827  68.194  -57.443 1.00 85.13  ? 121  PRO A C     1 
ATOM   334   O  O     . PRO A 1 93   ? 27.763  68.250  -56.215 1.00 84.47  ? 121  PRO A O     1 
ATOM   335   C  CB    . PRO A 1 93   ? 25.377  68.619  -57.854 1.00 90.44  ? 121  PRO A CB    1 
ATOM   336   C  CG    . PRO A 1 93   ? 24.607  67.745  -56.920 1.00 75.85  ? 121  PRO A CG    1 
ATOM   337   C  CD    . PRO A 1 93   ? 24.810  66.355  -57.433 1.00 75.53  ? 121  PRO A CD    1 
ATOM   338   N  N     . ASP A 1 94   ? 28.931  68.471  -58.131 1.00 76.04  ? 122  ASP A N     1 
ATOM   339   C  CA    . ASP A 1 94   ? 30.164  68.885  -57.471 1.00 70.15  ? 122  ASP A CA    1 
ATOM   340   C  C     . ASP A 1 94   ? 30.028  70.297  -56.911 1.00 75.42  ? 122  ASP A C     1 
ATOM   341   O  O     . ASP A 1 94   ? 29.349  71.142  -57.495 1.00 74.09  ? 122  ASP A O     1 
ATOM   342   C  CB    . ASP A 1 94   ? 31.344  68.809  -58.443 1.00 85.49  ? 122  ASP A CB    1 
ATOM   343   C  CG    . ASP A 1 94   ? 32.671  69.116  -57.774 1.00 81.09  ? 122  ASP A CG    1 
ATOM   344   O  OD1   . ASP A 1 94   ? 33.085  70.294  -57.779 1.00 85.45  ? 122  ASP A OD1   1 
ATOM   345   O  OD2   . ASP A 1 94   ? 33.301  68.177  -57.243 1.00 90.54  ? 122  ASP A OD2   1 
ATOM   346   N  N     . VAL A 1 95   ? 30.675  70.547  -55.778 1.00 77.86  ? 123  VAL A N     1 
ATOM   347   C  CA    . VAL A 1 95   ? 30.587  71.844  -55.116 1.00 77.82  ? 123  VAL A CA    1 
ATOM   348   C  C     . VAL A 1 95   ? 31.909  72.612  -55.186 1.00 92.79  ? 123  VAL A C     1 
ATOM   349   O  O     . VAL A 1 95   ? 32.968  72.085  -54.845 1.00 71.71  ? 123  VAL A O     1 
ATOM   350   C  CB    . VAL A 1 95   ? 30.154  71.685  -53.639 1.00 73.46  ? 123  VAL A CB    1 
ATOM   351   C  CG1   . VAL A 1 95   ? 30.938  70.568  -52.965 1.00 56.90  ? 123  VAL A CG1   1 
ATOM   352   C  CG2   . VAL A 1 95   ? 30.320  72.996  -52.884 1.00 71.77  ? 123  VAL A CG2   1 
ATOM   353   N  N     . GLU A 1 96   ? 31.836  73.859  -55.642 1.00 75.91  ? 124  GLU A N     1 
ATOM   354   C  CA    . GLU A 1 96   ? 33.014  74.714  -55.737 1.00 69.22  ? 124  GLU A CA    1 
ATOM   355   C  C     . GLU A 1 96   ? 32.942  75.863  -54.737 1.00 72.94  ? 124  GLU A C     1 
ATOM   356   O  O     . GLU A 1 96   ? 32.262  76.862  -54.974 1.00 77.71  ? 124  GLU A O     1 
ATOM   357   C  CB    . GLU A 1 96   ? 33.166  75.264  -57.158 1.00 90.99  ? 124  GLU A CB    1 
ATOM   358   C  CG    . GLU A 1 96   ? 33.417  74.203  -58.219 1.00 43.07  ? 124  GLU A CG    1 
ATOM   359   C  CD    . GLU A 1 96   ? 34.802  73.591  -58.123 1.00 42.92  ? 124  GLU A CD    1 
ATOM   360   O  OE1   . GLU A 1 96   ? 35.008  72.497  -58.689 1.00 43.03  ? 124  GLU A OE1   1 
ATOM   361   O  OE2   . GLU A 1 96   ? 35.686  74.206  -57.491 1.00 45.31  ? 124  GLU A OE2   1 
ATOM   362   N  N     . LEU A 1 97   ? 33.646  75.716  -53.619 1.00 70.90  ? 125  LEU A N     1 
ATOM   363   C  CA    . LEU A 1 97   ? 33.663  76.744  -52.584 1.00 86.59  ? 125  LEU A CA    1 
ATOM   364   C  C     . LEU A 1 97   ? 35.077  76.971  -52.057 1.00 93.18  ? 125  LEU A C     1 
ATOM   365   O  O     . LEU A 1 97   ? 35.908  76.062  -52.069 1.00 68.51  ? 125  LEU A O     1 
ATOM   366   C  CB    . LEU A 1 97   ? 32.725  76.370  -51.430 1.00 90.72  ? 125  LEU A CB    1 
ATOM   367   C  CG    . LEU A 1 97   ? 33.206  75.362  -50.379 1.00 66.72  ? 125  LEU A CG    1 
ATOM   368   C  CD1   . LEU A 1 97   ? 32.251  75.340  -49.196 1.00 64.03  ? 125  LEU A CD1   1 
ATOM   369   C  CD2   . LEU A 1 97   ? 33.355  73.966  -50.963 1.00 65.51  ? 125  LEU A CD2   1 
ATOM   370   N  N     . ARG A 1 98   ? 35.344  78.189  -51.596 1.00 91.52  ? 126  ARG A N     1 
ATOM   371   C  CA    . ARG A 1 98   ? 36.657  78.530  -51.063 1.00 84.48  ? 126  ARG A CA    1 
ATOM   372   C  C     . ARG A 1 98   ? 36.826  77.966  -49.658 1.00 68.78  ? 126  ARG A C     1 
ATOM   373   O  O     . ARG A 1 98   ? 36.264  78.487  -48.695 1.00 68.36  ? 126  ARG A O     1 
ATOM   374   C  CB    . ARG A 1 98   ? 36.861  80.048  -51.056 1.00 81.02  ? 126  ARG A CB    1 
ATOM   375   C  CG    . ARG A 1 98   ? 38.302  80.495  -50.822 1.00 92.12  ? 126  ARG A CG    1 
ATOM   376   C  CD    . ARG A 1 98   ? 39.145  80.410  -52.093 1.00 75.16  ? 126  ARG A CD    1 
ATOM   377   N  NE    . ARG A 1 98   ? 39.481  79.036  -52.458 1.00 72.04  ? 126  ARG A NE    1 
ATOM   378   C  CZ    . ARG A 1 98   ? 40.163  78.696  -53.547 1.00 76.73  ? 126  ARG A CZ    1 
ATOM   379   N  NH1   . ARG A 1 98   ? 40.586  79.631  -54.386 1.00 71.42  ? 126  ARG A NH1   1 
ATOM   380   N  NH2   . ARG A 1 98   ? 40.423  77.420  -53.797 1.00 73.95  ? 126  ARG A NH2   1 
ATOM   381   N  N     . LEU A 1 99   ? 37.606  76.895  -49.553 1.00 85.77  ? 127  LEU A N     1 
ATOM   382   C  CA    . LEU A 1 99   ? 37.820  76.209  -48.284 1.00 87.48  ? 127  LEU A CA    1 
ATOM   383   C  C     . LEU A 1 99   ? 38.572  77.082  -47.280 1.00 69.04  ? 127  LEU A C     1 
ATOM   384   O  O     . LEU A 1 99   ? 39.386  77.920  -47.668 1.00 84.27  ? 127  LEU A O     1 
ATOM   385   C  CB    . LEU A 1 99   ? 38.582  74.896  -48.512 1.00 84.05  ? 127  LEU A CB    1 
ATOM   386   C  CG    . LEU A 1 99   ? 40.106  74.937  -48.682 1.00 92.48  ? 127  LEU A CG    1 
ATOM   387   C  CD1   . LEU A 1 99   ? 40.674  73.525  -48.705 1.00 91.51  ? 127  LEU A CD1   1 
ATOM   388   C  CD2   . LEU A 1 99   ? 40.530  75.704  -49.928 1.00 90.73  ? 127  LEU A CD2   1 
ATOM   389   N  N     . PRO A 1 100  ? 38.285  76.894  -45.981 1.00 77.33  ? 128  PRO A N     1 
ATOM   390   C  CA    . PRO A 1 100  ? 38.994  77.571  -44.888 1.00 69.91  ? 128  PRO A CA    1 
ATOM   391   C  C     . PRO A 1 100  ? 40.497  77.297  -44.923 1.00 73.92  ? 128  PRO A C     1 
ATOM   392   O  O     . PRO A 1 100  ? 40.910  76.272  -45.466 1.00 77.69  ? 128  PRO A O     1 
ATOM   393   C  CB    . PRO A 1 100  ? 38.354  76.969  -43.632 1.00 71.59  ? 128  PRO A CB    1 
ATOM   394   C  CG    . PRO A 1 100  ? 36.997  76.557  -44.070 1.00 56.81  ? 128  PRO A CG    1 
ATOM   395   C  CD    . PRO A 1 100  ? 37.162  76.081  -45.482 1.00 74.94  ? 128  PRO A CD    1 
ATOM   396   N  N     . PRO A 1 101  ? 41.306  78.201  -44.348 1.00 70.93  ? 129  PRO A N     1 
ATOM   397   C  CA    . PRO A 1 101  ? 42.768  78.080  -44.398 1.00 76.82  ? 129  PRO A CA    1 
ATOM   398   C  C     . PRO A 1 101  ? 43.305  76.832  -43.700 1.00 69.47  ? 129  PRO A C     1 
ATOM   399   O  O     . PRO A 1 101  ? 42.915  76.534  -42.571 1.00 72.59  ? 129  PRO A O     1 
ATOM   400   C  CB    . PRO A 1 101  ? 43.248  79.347  -43.679 1.00 77.26  ? 129  PRO A CB    1 
ATOM   401   C  CG    . PRO A 1 101  ? 42.102  79.750  -42.814 1.00 73.04  ? 129  PRO A CG    1 
ATOM   402   C  CD    . PRO A 1 101  ? 40.881  79.397  -43.601 1.00 73.87  ? 129  PRO A CD    1 
ATOM   403   N  N     . LEU A 1 102  ? 44.194  76.115  -44.380 1.00 68.11  ? 130  LEU A N     1 
ATOM   404   C  CA    . LEU A 1 102  ? 44.871  74.962  -43.797 1.00 73.15  ? 130  LEU A CA    1 
ATOM   405   C  C     . LEU A 1 102  ? 46.240  75.386  -43.270 1.00 77.03  ? 130  LEU A C     1 
ATOM   406   O  O     . LEU A 1 102  ? 46.842  76.331  -43.780 1.00 90.96  ? 130  LEU A O     1 
ATOM   407   C  CB    . LEU A 1 102  ? 44.998  73.820  -44.822 1.00 69.19  ? 130  LEU A CB    1 
ATOM   408   C  CG    . LEU A 1 102  ? 45.944  73.820  -46.038 1.00 74.98  ? 130  LEU A CG    1 
ATOM   409   C  CD1   . LEU A 1 102  ? 45.986  75.158  -46.777 1.00 90.47  ? 130  LEU A CD1   1 
ATOM   410   C  CD2   . LEU A 1 102  ? 47.355  73.366  -45.668 1.00 73.17  ? 130  LEU A CD2   1 
ATOM   411   N  N     . TYR A 1 103  ? 46.728  74.690  -42.249 1.00 75.82  ? 131  TYR A N     1 
ATOM   412   C  CA    . TYR A 1 103  ? 47.962  75.091  -41.580 1.00 74.48  ? 131  TYR A CA    1 
ATOM   413   C  C     . TYR A 1 103  ? 49.168  74.264  -42.019 1.00 75.95  ? 131  TYR A C     1 
ATOM   414   O  O     . TYR A 1 103  ? 50.310  74.615  -41.722 1.00 77.74  ? 131  TYR A O     1 
ATOM   415   C  CB    . TYR A 1 103  ? 47.788  75.003  -40.062 1.00 71.97  ? 131  TYR A CB    1 
ATOM   416   C  CG    . TYR A 1 103  ? 46.792  76.000  -39.514 1.00 85.66  ? 131  TYR A CG    1 
ATOM   417   C  CD1   . TYR A 1 103  ? 47.209  77.237  -39.039 1.00 92.36  ? 131  TYR A CD1   1 
ATOM   418   C  CD2   . TYR A 1 103  ? 45.435  75.711  -39.482 1.00 81.08  ? 131  TYR A CD2   1 
ATOM   419   C  CE1   . TYR A 1 103  ? 46.302  78.155  -38.541 1.00 86.91  ? 131  TYR A CE1   1 
ATOM   420   C  CE2   . TYR A 1 103  ? 44.521  76.621  -38.987 1.00 93.71  ? 131  TYR A CE2   1 
ATOM   421   C  CZ    . TYR A 1 103  ? 44.960  77.841  -38.518 1.00 85.49  ? 131  TYR A CZ    1 
ATOM   422   O  OH    . TYR A 1 103  ? 44.052  78.750  -38.024 1.00 92.26  ? 131  TYR A OH    1 
ATOM   423   N  N     . GLY A 1 104  ? 48.912  73.168  -42.725 1.00 74.22  ? 132  GLY A N     1 
ATOM   424   C  CA    . GLY A 1 104  ? 49.981  72.337  -43.250 1.00 93.01  ? 132  GLY A CA    1 
ATOM   425   C  C     . GLY A 1 104  ? 50.601  71.421  -42.212 1.00 86.36  ? 132  GLY A C     1 
ATOM   426   O  O     . GLY A 1 104  ? 50.458  71.651  -41.011 1.00 84.72  ? 132  GLY A O     1 
ATOM   427   N  N     . ASP A 1 105  ? 51.290  70.376  -42.668 1.00 93.16  ? 133  ASP A N     1 
ATOM   428   C  CA    . ASP A 1 105  ? 51.436  70.092  -44.093 1.00 87.30  ? 133  ASP A CA    1 
ATOM   429   C  C     . ASP A 1 105  ? 50.236  69.311  -44.613 1.00 90.08  ? 133  ASP A C     1 
ATOM   430   O  O     . ASP A 1 105  ? 49.731  69.577  -45.704 1.00 84.50  ? 133  ASP A O     1 
ATOM   431   C  CB    . ASP A 1 105  ? 52.726  69.314  -44.357 1.00 85.58  ? 133  ASP A CB    1 
ATOM   432   C  CG    . ASP A 1 105  ? 53.957  70.040  -43.854 1.00 72.22  ? 133  ASP A CG    1 
ATOM   433   O  OD1   . ASP A 1 105  ? 55.045  69.843  -44.437 1.00 76.57  ? 133  ASP A OD1   1 
ATOM   434   O  OD2   . ASP A 1 105  ? 53.838  70.807  -42.876 1.00 74.18  ? 133  ASP A OD2   1 
ATOM   435   N  N     . ASN A 1 106  ? 49.786  68.343  -43.823 1.00 81.11  ? 134  ASN A N     1 
ATOM   436   C  CA    . ASN A 1 106  ? 48.573  67.602  -44.135 1.00 87.43  ? 134  ASN A CA    1 
ATOM   437   C  C     . ASN A 1 106  ? 47.441  68.020  -43.206 1.00 73.34  ? 134  ASN A C     1 
ATOM   438   O  O     . ASN A 1 106  ? 47.610  68.913  -42.375 1.00 68.29  ? 134  ASN A O     1 
ATOM   439   C  CB    . ASN A 1 106  ? 48.820  66.095  -44.035 1.00 81.22  ? 134  ASN A CB    1 
ATOM   440   C  CG    . ASN A 1 106  ? 49.523  65.699  -42.748 1.00 87.96  ? 134  ASN A CG    1 
ATOM   441   O  OD1   . ASN A 1 106  ? 49.539  66.454  -41.776 1.00 81.67  ? 134  ASN A OD1   1 
ATOM   442   N  ND2   . ASN A 1 106  ? 50.109  64.508  -42.739 1.00 85.59  ? 134  ASN A ND2   1 
ATOM   443   N  N     . LEU A 1 107  ? 46.287  67.378  -43.346 1.00 71.65  ? 135  LEU A N     1 
ATOM   444   C  CA    . LEU A 1 107  ? 45.160  67.670  -42.470 1.00 71.43  ? 135  LEU A CA    1 
ATOM   445   C  C     . LEU A 1 107  ? 45.363  66.994  -41.116 1.00 74.45  ? 135  LEU A C     1 
ATOM   446   O  O     . LEU A 1 107  ? 44.702  67.335  -40.132 1.00 75.83  ? 135  LEU A O     1 
ATOM   447   C  CB    . LEU A 1 107  ? 43.835  67.231  -43.106 1.00 69.86  ? 135  LEU A CB    1 
ATOM   448   C  CG    . LEU A 1 107  ? 43.516  65.750  -43.327 1.00 71.18  ? 135  LEU A CG    1 
ATOM   449   C  CD1   . LEU A 1 107  ? 42.030  65.591  -43.596 1.00 48.05  ? 135  LEU A CD1   1 
ATOM   450   C  CD2   . LEU A 1 107  ? 44.324  65.155  -44.473 1.00 74.03  ? 135  LEU A CD2   1 
ATOM   451   N  N     . ASP A 1 108  ? 46.289  66.040  -41.075 1.00 68.19  ? 136  ASP A N     1 
ATOM   452   C  CA    . ASP A 1 108  ? 46.672  65.388  -39.829 1.00 75.38  ? 136  ASP A CA    1 
ATOM   453   C  C     . ASP A 1 108  ? 47.276  66.399  -38.863 1.00 76.94  ? 136  ASP A C     1 
ATOM   454   O  O     . ASP A 1 108  ? 46.863  66.493  -37.707 1.00 68.72  ? 136  ASP A O     1 
ATOM   455   C  CB    . ASP A 1 108  ? 47.664  64.255  -40.095 1.00 74.53  ? 136  ASP A CB    1 
ATOM   456   C  CG    . ASP A 1 108  ? 48.220  63.654  -38.818 1.00 75.59  ? 136  ASP A CG    1 
ATOM   457   O  OD1   . ASP A 1 108  ? 47.458  63.523  -37.836 1.00 74.85  ? 136  ASP A OD1   1 
ATOM   458   O  OD2   . ASP A 1 108  ? 49.421  63.312  -38.795 1.00 68.45  ? 136  ASP A OD2   1 
ATOM   459   N  N     . GLN A 1 109  ? 48.255  67.156  -39.347 1.00 70.47  ? 137  GLN A N     1 
ATOM   460   C  CA    . GLN A 1 109  ? 48.891  68.190  -38.542 1.00 70.90  ? 137  GLN A CA    1 
ATOM   461   C  C     . GLN A 1 109  ? 47.936  69.351  -38.306 1.00 73.67  ? 137  GLN A C     1 
ATOM   462   O  O     . GLN A 1 109  ? 48.085  70.103  -37.347 1.00 69.67  ? 137  GLN A O     1 
ATOM   463   C  CB    . GLN A 1 109  ? 50.174  68.684  -39.212 1.00 74.20  ? 137  GLN A CB    1 
ATOM   464   C  CG    . GLN A 1 109  ? 51.272  67.638  -39.279 1.00 68.71  ? 137  GLN A CG    1 
ATOM   465   C  CD    . GLN A 1 109  ? 52.522  68.154  -39.957 1.00 70.09  ? 137  GLN A CD    1 
ATOM   466   O  OE1   . GLN A 1 109  ? 52.576  69.304  -40.394 1.00 68.01  ? 137  GLN A OE1   1 
ATOM   467   N  NE2   . GLN A 1 109  ? 53.538  67.304  -40.050 1.00 90.04  ? 137  GLN A NE2   1 
ATOM   468   N  N     . HIS A 1 110  ? 46.957  69.494  -39.193 1.00 73.28  ? 138  HIS A N     1 
ATOM   469   C  CA    . HIS A 1 110  ? 45.911  70.493  -39.022 1.00 75.93  ? 138  HIS A CA    1 
ATOM   470   C  C     . HIS A 1 110  ? 45.101  70.183  -37.767 1.00 73.32  ? 138  HIS A C     1 
ATOM   471   O  O     . HIS A 1 110  ? 45.073  70.976  -36.823 1.00 75.21  ? 138  HIS A O     1 
ATOM   472   C  CB    . HIS A 1 110  ? 45.006  70.538  -40.254 1.00 75.24  ? 138  HIS A CB    1 
ATOM   473   C  CG    . HIS A 1 110  ? 43.841  71.467  -40.119 1.00 71.08  ? 138  HIS A CG    1 
ATOM   474   N  ND1   . HIS A 1 110  ? 43.988  72.828  -39.960 1.00 77.67  ? 138  HIS A ND1   1 
ATOM   475   C  CD2   . HIS A 1 110  ? 42.507  71.232  -40.127 1.00 70.99  ? 138  HIS A CD2   1 
ATOM   476   C  CE1   . HIS A 1 110  ? 42.796  73.391  -39.872 1.00 68.47  ? 138  HIS A CE1   1 
ATOM   477   N  NE2   . HIS A 1 110  ? 41.880  72.444  -39.971 1.00 77.85  ? 138  HIS A NE2   1 
ATOM   478   N  N     . PHE A 1 111  ? 44.460  69.017  -37.758 1.00 71.91  ? 139  PHE A N     1 
ATOM   479   C  CA    . PHE A 1 111  ? 43.670  68.585  -36.609 1.00 70.69  ? 139  PHE A CA    1 
ATOM   480   C  C     . PHE A 1 111  ? 44.520  68.449  -35.350 1.00 70.73  ? 139  PHE A C     1 
ATOM   481   O  O     . PHE A 1 111  ? 44.035  68.670  -34.241 1.00 70.51  ? 139  PHE A O     1 
ATOM   482   C  CB    . PHE A 1 111  ? 42.970  67.257  -36.908 1.00 70.68  ? 139  PHE A CB    1 
ATOM   483   C  CG    . PHE A 1 111  ? 41.684  67.407  -37.670 1.00 68.83  ? 139  PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1 111  ? 40.477  67.517  -37.001 1.00 56.87  ? 139  PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1 111  ? 41.682  67.439  -39.054 1.00 73.93  ? 139  PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1 111  ? 39.292  67.653  -37.697 1.00 64.15  ? 139  PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1 111  ? 40.501  67.576  -39.757 1.00 77.89  ? 139  PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1 111  ? 39.304  67.683  -39.077 1.00 73.67  ? 139  PHE A CZ    1 
ATOM   489   N  N     . ARG A 1 112  ? 45.787  68.087  -35.526 1.00 77.10  ? 140  ARG A N     1 
ATOM   490   C  CA    . ARG A 1 112  ? 46.695  67.931  -34.395 1.00 68.47  ? 140  ARG A CA    1 
ATOM   491   C  C     . ARG A 1 112  ? 46.990  69.278  -33.742 1.00 65.53  ? 140  ARG A C     1 
ATOM   492   O  O     . ARG A 1 112  ? 46.904  69.414  -32.523 1.00 65.06  ? 140  ARG A O     1 
ATOM   493   C  CB    . ARG A 1 112  ? 47.997  67.262  -34.837 1.00 71.56  ? 140  ARG A CB    1 
ATOM   494   C  CG    . ARG A 1 112  ? 48.928  66.906  -33.691 1.00 70.65  ? 140  ARG A CG    1 
ATOM   495   C  CD    . ARG A 1 112  ? 50.169  66.193  -34.198 1.00 68.31  ? 140  ARG A CD    1 
ATOM   496   N  NE    . ARG A 1 112  ? 49.831  64.990  -34.952 1.00 72.22  ? 140  ARG A NE    1 
ATOM   497   C  CZ    . ARG A 1 112  ? 49.686  63.785  -34.411 1.00 56.83  ? 140  ARG A CZ    1 
ATOM   498   N  NH1   . ARG A 1 112  ? 49.851  63.617  -33.106 1.00 42.48  ? 140  ARG A NH1   1 
ATOM   499   N  NH2   . ARG A 1 112  ? 49.378  62.747  -35.176 1.00 67.46  ? 140  ARG A NH2   1 
ATOM   500   N  N     . LEU A 1 113  ? 47.332  70.270  -34.559 1.00 69.01  ? 141  LEU A N     1 
ATOM   501   C  CA    . LEU A 1 113  ? 47.618  71.608  -34.054 1.00 60.90  ? 141  LEU A CA    1 
ATOM   502   C  C     . LEU A 1 113  ? 46.367  72.260  -33.480 1.00 73.92  ? 141  LEU A C     1 
ATOM   503   O  O     . LEU A 1 113  ? 46.445  73.005  -32.504 1.00 73.29  ? 141  LEU A O     1 
ATOM   504   C  CB    . LEU A 1 113  ? 48.211  72.489  -35.155 1.00 65.80  ? 141  LEU A CB    1 
ATOM   505   C  CG    . LEU A 1 113  ? 49.668  72.198  -35.520 1.00 69.18  ? 141  LEU A CG    1 
ATOM   506   C  CD1   . LEU A 1 113  ? 50.168  73.179  -36.569 1.00 68.74  ? 141  LEU A CD1   1 
ATOM   507   C  CD2   . LEU A 1 113  ? 50.549  72.230  -34.278 1.00 68.59  ? 141  LEU A CD2   1 
ATOM   508   N  N     . LEU A 1 114  ? 45.218  71.982  -34.087 1.00 72.46  ? 142  LEU A N     1 
ATOM   509   C  CA    . LEU A 1 114  ? 43.949  72.479  -33.565 1.00 70.51  ? 142  LEU A CA    1 
ATOM   510   C  C     . LEU A 1 114  ? 43.683  71.906  -32.178 1.00 56.85  ? 142  LEU A C     1 
ATOM   511   O  O     . LEU A 1 114  ? 43.446  72.642  -31.221 1.00 70.19  ? 142  LEU A O     1 
ATOM   512   C  CB    . LEU A 1 114  ? 42.797  72.129  -34.507 1.00 67.70  ? 142  LEU A CB    1 
ATOM   513   C  CG    . LEU A 1 114  ? 42.731  72.895  -35.828 1.00 77.52  ? 142  LEU A CG    1 
ATOM   514   C  CD1   . LEU A 1 114  ? 41.574  72.391  -36.676 1.00 74.87  ? 142  LEU A CD1   1 
ATOM   515   C  CD2   . LEU A 1 114  ? 42.610  74.388  -35.573 1.00 68.22  ? 142  LEU A CD2   1 
ATOM   516   N  N     . ALA A 1 115  ? 43.738  70.583  -32.082 1.00 47.82  ? 143  ALA A N     1 
ATOM   517   C  CA    . ALA A 1 115  ? 43.482  69.888  -30.828 1.00 65.37  ? 143  ALA A CA    1 
ATOM   518   C  C     . ALA A 1 115  ? 44.470  70.298  -29.742 1.00 68.62  ? 143  ALA A C     1 
ATOM   519   O  O     . ALA A 1 115  ? 44.113  70.382  -28.567 1.00 69.59  ? 143  ALA A O     1 
ATOM   520   C  CB    . ALA A 1 115  ? 43.531  68.395  -31.044 1.00 64.09  ? 143  ALA A CB    1 
ATOM   521   N  N     . GLN A 1 116  ? 45.713  70.552  -30.141 1.00 73.45  ? 144  GLN A N     1 
ATOM   522   C  CA    . GLN A 1 116  ? 46.739  70.975  -29.198 1.00 66.66  ? 144  GLN A CA    1 
ATOM   523   C  C     . GLN A 1 116  ? 46.484  72.398  -28.712 1.00 67.64  ? 144  GLN A C     1 
ATOM   524   O  O     . GLN A 1 116  ? 46.562  72.669  -27.516 1.00 43.81  ? 144  GLN A O     1 
ATOM   525   C  CB    . GLN A 1 116  ? 48.132  70.868  -29.827 1.00 72.33  ? 144  GLN A CB    1 
ATOM   526   C  CG    . GLN A 1 116  ? 48.687  69.449  -29.865 1.00 74.03  ? 144  GLN A CG    1 
ATOM   527   C  CD    . GLN A 1 116  ? 50.067  69.372  -30.493 1.00 75.16  ? 144  GLN A CD    1 
ATOM   528   O  OE1   . GLN A 1 116  ? 50.617  70.379  -30.939 1.00 70.46  ? 144  GLN A OE1   1 
ATOM   529   N  NE2   . GLN A 1 116  ? 50.634  68.171  -30.529 1.00 55.02  ? 144  GLN A NE2   1 
ATOM   530   N  N     . LYS A 1 117  ? 46.165  73.301  -29.635 1.00 55.03  ? 145  LYS A N     1 
ATOM   531   C  CA    . LYS A 1 117  ? 45.934  74.698  -29.275 1.00 76.55  ? 145  LYS A CA    1 
ATOM   532   C  C     . LYS A 1 117  ? 44.624  74.860  -28.511 1.00 71.94  ? 145  LYS A C     1 
ATOM   533   O  O     . LYS A 1 117  ? 44.395  75.884  -27.868 1.00 73.66  ? 145  LYS A O     1 
ATOM   534   C  CB    . LYS A 1 117  ? 45.932  75.593  -30.518 1.00 75.80  ? 145  LYS A CB    1 
ATOM   535   C  CG    . LYS A 1 117  ? 44.670  75.504  -31.359 1.00 73.31  ? 145  LYS A CG    1 
ATOM   536   C  CD    . LYS A 1 117  ? 44.707  76.482  -32.523 1.00 69.58  ? 145  LYS A CD    1 
ATOM   537   C  CE    . LYS A 1 117  ? 44.758  77.921  -32.035 1.00 90.52  ? 145  LYS A CE    1 
ATOM   538   N  NZ    . LYS A 1 117  ? 43.565  78.272  -31.215 1.00 90.96  ? 145  LYS A NZ    1 
ATOM   539   N  N     . GLN A 1 118  ? 43.766  73.847  -28.584 1.00 68.94  ? 146  GLN A N     1 
ATOM   540   C  CA    . GLN A 1 118  ? 42.507  73.865  -27.848 1.00 40.57  ? 146  GLN A CA    1 
ATOM   541   C  C     . GLN A 1 118  ? 42.660  73.275  -26.449 1.00 64.66  ? 146  GLN A C     1 
ATOM   542   O  O     . GLN A 1 118  ? 41.951  73.667  -25.524 1.00 66.32  ? 146  GLN A O     1 
ATOM   543   C  CB    . GLN A 1 118  ? 41.426  73.103  -28.615 1.00 48.72  ? 146  GLN A CB    1 
ATOM   544   C  CG    . GLN A 1 118  ? 40.884  73.839  -29.828 1.00 56.85  ? 146  GLN A CG    1 
ATOM   545   C  CD    . GLN A 1 118  ? 39.937  72.987  -30.650 1.00 65.64  ? 146  GLN A CD    1 
ATOM   546   O  OE1   . GLN A 1 118  ? 39.644  71.845  -30.295 1.00 46.43  ? 146  GLN A OE1   1 
ATOM   547   N  NE2   . GLN A 1 118  ? 39.454  73.539  -31.757 1.00 72.05  ? 146  GLN A NE2   1 
ATOM   548   N  N     . SER A 1 119  ? 43.588  72.335  -26.298 1.00 70.17  ? 147  SER A N     1 
ATOM   549   C  CA    . SER A 1 119  ? 43.748  71.624  -25.033 1.00 73.96  ? 147  SER A CA    1 
ATOM   550   C  C     . SER A 1 119  ? 45.063  71.952  -24.329 1.00 69.38  ? 147  SER A C     1 
ATOM   551   O  O     . SER A 1 119  ? 45.410  71.322  -23.330 1.00 74.47  ? 147  SER A O     1 
ATOM   552   C  CB    . SER A 1 119  ? 43.651  70.112  -25.259 1.00 70.01  ? 147  SER A CB    1 
ATOM   553   O  OG    . SER A 1 119  ? 44.696  69.647  -26.096 1.00 70.23  ? 147  SER A OG    1 
ATOM   554   N  N     . LEU A 1 120  ? 45.790  72.937  -24.846 1.00 75.62  ? 148  LEU A N     1 
ATOM   555   C  CA    . LEU A 1 120  ? 47.064  73.332  -24.248 1.00 70.98  ? 148  LEU A CA    1 
ATOM   556   C  C     . LEU A 1 120  ? 46.916  73.956  -22.852 1.00 75.51  ? 148  LEU A C     1 
ATOM   557   O  O     . LEU A 1 120  ? 47.650  73.576  -21.939 1.00 71.94  ? 148  LEU A O     1 
ATOM   558   C  CB    . LEU A 1 120  ? 47.819  74.294  -25.174 1.00 66.94  ? 148  LEU A CB    1 
ATOM   559   C  CG    . LEU A 1 120  ? 49.211  74.736  -24.718 1.00 65.97  ? 148  LEU A CG    1 
ATOM   560   C  CD1   . LEU A 1 120  ? 50.204  74.644  -25.866 1.00 67.87  ? 148  LEU A CD1   1 
ATOM   561   C  CD2   . LEU A 1 120  ? 49.172  76.150  -24.158 1.00 69.18  ? 148  LEU A CD2   1 
ATOM   562   N  N     . PRO A 1 121  ? 45.985  74.918  -22.673 1.00 67.30  ? 149  PRO A N     1 
ATOM   563   C  CA    . PRO A 1 121  ? 45.888  75.495  -21.326 1.00 60.24  ? 149  PRO A CA    1 
ATOM   564   C  C     . PRO A 1 121  ? 45.432  74.482  -20.282 1.00 48.51  ? 149  PRO A C     1 
ATOM   565   O  O     . PRO A 1 121  ? 45.870  74.527  -19.130 1.00 70.41  ? 149  PRO A O     1 
ATOM   566   C  CB    . PRO A 1 121  ? 44.841  76.601  -21.490 1.00 46.47  ? 149  PRO A CB    1 
ATOM   567   C  CG    . PRO A 1 121  ? 44.839  76.918  -22.941 1.00 48.67  ? 149  PRO A CG    1 
ATOM   568   C  CD    . PRO A 1 121  ? 45.089  75.611  -23.618 1.00 44.38  ? 149  PRO A CD    1 
ATOM   569   N  N     . TYR A 1 122  ? 44.558  73.572  -20.691 1.00 49.29  ? 150  TYR A N     1 
ATOM   570   C  CA    . TYR A 1 122  ? 44.036  72.566  -19.783 1.00 45.39  ? 150  TYR A CA    1 
ATOM   571   C  C     . TYR A 1 122  ? 45.110  71.531  -19.462 1.00 55.25  ? 150  TYR A C     1 
ATOM   572   O  O     . TYR A 1 122  ? 45.165  71.014  -18.349 1.00 65.89  ? 150  TYR A O     1 
ATOM   573   C  CB    . TYR A 1 122  ? 42.791  71.911  -20.382 1.00 47.00  ? 150  TYR A CB    1 
ATOM   574   C  CG    . TYR A 1 122  ? 41.778  72.925  -20.864 1.00 46.32  ? 150  TYR A CG    1 
ATOM   575   C  CD1   . TYR A 1 122  ? 40.889  73.524  -19.980 1.00 40.36  ? 150  TYR A CD1   1 
ATOM   576   C  CD2   . TYR A 1 122  ? 41.724  73.300  -22.200 1.00 60.03  ? 150  TYR A CD2   1 
ATOM   577   C  CE1   . TYR A 1 122  ? 39.969  74.461  -20.416 1.00 47.38  ? 150  TYR A CE1   1 
ATOM   578   C  CE2   . TYR A 1 122  ? 40.808  74.234  -22.645 1.00 55.42  ? 150  TYR A CE2   1 
ATOM   579   C  CZ    . TYR A 1 122  ? 39.933  74.810  -21.750 1.00 47.39  ? 150  TYR A CZ    1 
ATOM   580   O  OH    . TYR A 1 122  ? 39.020  75.740  -22.193 1.00 42.64  ? 150  TYR A OH    1 
ATOM   581   N  N     . LEU A 1 123  ? 45.971  71.242  -20.432 1.00 46.80  ? 151  LEU A N     1 
ATOM   582   C  CA    . LEU A 1 123  ? 47.112  70.367  -20.186 1.00 48.52  ? 151  LEU A CA    1 
ATOM   583   C  C     . LEU A 1 123  ? 48.094  71.031  -19.230 1.00 43.34  ? 151  LEU A C     1 
ATOM   584   O  O     . LEU A 1 123  ? 48.673  70.372  -18.369 1.00 66.42  ? 151  LEU A O     1 
ATOM   585   C  CB    . LEU A 1 123  ? 47.814  69.998  -21.493 1.00 49.30  ? 151  LEU A CB    1 
ATOM   586   C  CG    . LEU A 1 123  ? 47.322  68.711  -22.155 1.00 41.92  ? 151  LEU A CG    1 
ATOM   587   C  CD1   . LEU A 1 123  ? 48.133  68.400  -23.404 1.00 40.11  ? 151  LEU A CD1   1 
ATOM   588   C  CD2   . LEU A 1 123  ? 47.388  67.558  -21.165 1.00 45.68  ? 151  LEU A CD2   1 
ATOM   589   N  N     . GLU A 1 124  ? 48.276  72.339  -19.388 1.00 42.71  ? 152  GLU A N     1 
ATOM   590   C  CA    . GLU A 1 124  ? 49.123  73.104  -18.481 1.00 46.47  ? 152  GLU A CA    1 
ATOM   591   C  C     . GLU A 1 124  ? 48.583  73.037  -17.059 1.00 56.30  ? 152  GLU A C     1 
ATOM   592   O  O     . GLU A 1 124  ? 49.333  72.798  -16.113 1.00 67.40  ? 152  GLU A O     1 
ATOM   593   C  CB    . GLU A 1 124  ? 49.231  74.561  -18.935 1.00 56.65  ? 152  GLU A CB    1 
ATOM   594   C  CG    . GLU A 1 124  ? 50.070  74.766  -20.184 1.00 73.67  ? 152  GLU A CG    1 
ATOM   595   C  CD    . GLU A 1 124  ? 50.206  76.228  -20.560 1.00 77.80  ? 152  GLU A CD    1 
ATOM   596   O  OE1   . GLU A 1 124  ? 49.455  77.058  -20.006 1.00 73.06  ? 152  GLU A OE1   1 
ATOM   597   O  OE2   . GLU A 1 124  ? 51.066  76.547  -21.408 1.00 69.48  ? 152  GLU A OE2   1 
ATOM   598   N  N     . ALA A 1 125  ? 47.277  73.241  -16.917 1.00 43.92  ? 153  ALA A N     1 
ATOM   599   C  CA    . ALA A 1 125  ? 46.627  73.182  -15.611 1.00 42.43  ? 153  ALA A CA    1 
ATOM   600   C  C     . ALA A 1 125  ? 46.733  71.785  -14.999 1.00 56.82  ? 153  ALA A C     1 
ATOM   601   O  O     . ALA A 1 125  ? 46.964  71.637  -13.795 1.00 55.53  ? 153  ALA A O     1 
ATOM   602   C  CB    . ALA A 1 125  ? 45.173  73.600  -15.732 1.00 49.61  ? 153  ALA A CB    1 
ATOM   603   N  N     . ALA A 1 126  ? 46.563  70.768  -15.838 1.00 47.70  ? 154  ALA A N     1 
ATOM   604   C  CA    . ALA A 1 126  ? 46.685  69.379  -15.414 1.00 49.01  ? 154  ALA A CA    1 
ATOM   605   C  C     . ALA A 1 126  ? 48.085  69.110  -14.882 1.00 67.13  ? 154  ALA A C     1 
ATOM   606   O  O     . ALA A 1 126  ? 48.259  68.458  -13.851 1.00 73.69  ? 154  ALA A O     1 
ATOM   607   C  CB    . ALA A 1 126  ? 46.366  68.441  -16.565 1.00 44.65  ? 154  ALA A CB    1 
ATOM   608   N  N     . ASN A 1 127  ? 49.081  69.624  -15.596 1.00 68.39  ? 155  ASN A N     1 
ATOM   609   C  CA    . ASN A 1 127  ? 50.468  69.502  -15.175 1.00 56.74  ? 155  ASN A CA    1 
ATOM   610   C  C     . ASN A 1 127  ? 50.716  70.260  -13.878 1.00 56.85  ? 155  ASN A C     1 
ATOM   611   O  O     . ASN A 1 127  ? 51.546  69.858  -13.064 1.00 75.14  ? 155  ASN A O     1 
ATOM   612   C  CB    . ASN A 1 127  ? 51.405  70.003  -16.273 1.00 69.04  ? 155  ASN A CB    1 
ATOM   613   C  CG    . ASN A 1 127  ? 51.321  69.166  -17.534 1.00 64.41  ? 155  ASN A CG    1 
ATOM   614   O  OD1   . ASN A 1 127  ? 51.056  67.965  -17.479 1.00 41.80  ? 155  ASN A OD1   1 
ATOM   615   N  ND2   . ASN A 1 127  ? 51.542  69.799  -18.680 1.00 56.52  ? 155  ASN A ND2   1 
ATOM   616   N  N     . LEU A 1 128  ? 49.989  71.358  -13.688 1.00 44.32  ? 156  LEU A N     1 
ATOM   617   C  CA    . LEU A 1 128  ? 50.063  72.112  -12.443 1.00 45.75  ? 156  LEU A CA    1 
ATOM   618   C  C     . LEU A 1 128  ? 49.481  71.293  -11.297 1.00 43.94  ? 156  LEU A C     1 
ATOM   619   O  O     . LEU A 1 128  ? 49.908  71.423  -10.151 1.00 45.27  ? 156  LEU A O     1 
ATOM   620   C  CB    . LEU A 1 128  ? 49.329  73.448  -12.566 1.00 46.35  ? 156  LEU A CB    1 
ATOM   621   C  CG    . LEU A 1 128  ? 49.966  74.495  -13.480 1.00 64.79  ? 156  LEU A CG    1 
ATOM   622   C  CD1   . LEU A 1 128  ? 49.188  75.803  -13.428 1.00 71.45  ? 156  LEU A CD1   1 
ATOM   623   C  CD2   . LEU A 1 128  ? 51.424  74.715  -13.109 1.00 56.19  ? 156  LEU A CD2   1 
ATOM   624   N  N     . LEU A 1 129  ? 48.503  70.450  -11.612 1.00 56.80  ? 157  LEU A N     1 
ATOM   625   C  CA    . LEU A 1 129  ? 47.938  69.543  -10.619 1.00 56.86  ? 157  LEU A CA    1 
ATOM   626   C  C     . LEU A 1 129  ? 48.880  68.372  -10.346 1.00 68.48  ? 157  LEU A C     1 
ATOM   627   O  O     . LEU A 1 129  ? 48.889  67.814  -9.248  1.00 45.71  ? 157  LEU A O     1 
ATOM   628   C  CB    . LEU A 1 129  ? 46.571  69.025  -11.074 1.00 46.60  ? 157  LEU A CB    1 
ATOM   629   C  CG    . LEU A 1 129  ? 45.398  70.002  -10.973 1.00 46.73  ? 157  LEU A CG    1 
ATOM   630   C  CD1   . LEU A 1 129  ? 44.130  69.380  -11.538 1.00 47.87  ? 157  LEU A CD1   1 
ATOM   631   C  CD2   . LEU A 1 129  ? 45.187  70.433  -9.530  1.00 46.78  ? 157  LEU A CD2   1 
ATOM   632   N  N     . LEU A 1 130  ? 49.673  68.005  -11.348 1.00 69.89  ? 158  LEU A N     1 
ATOM   633   C  CA    . LEU A 1 130  ? 50.592  66.878  -11.223 1.00 66.82  ? 158  LEU A CA    1 
ATOM   634   C  C     . LEU A 1 130  ? 51.788  67.198  -10.327 1.00 56.55  ? 158  LEU A C     1 
ATOM   635   O  O     . LEU A 1 130  ? 52.121  66.424  -9.429  1.00 67.43  ? 158  LEU A O     1 
ATOM   636   C  CB    . LEU A 1 130  ? 51.081  66.433  -12.604 1.00 40.99  ? 158  LEU A CB    1 
ATOM   637   C  CG    . LEU A 1 130  ? 50.422  65.177  -13.182 1.00 48.56  ? 158  LEU A CG    1 
ATOM   638   C  CD1   . LEU A 1 130  ? 48.908  65.315  -13.201 1.00 46.10  ? 158  LEU A CD1   1 
ATOM   639   C  CD2   . LEU A 1 130  ? 50.954  64.884  -14.577 1.00 48.96  ? 158  LEU A CD2   1 
ATOM   640   N  N     . GLN A 1 131  ? 52.429  68.336  -10.568 1.00 66.60  ? 159  GLN A N     1 
ATOM   641   C  CA    . GLN A 1 131  ? 53.597  68.731  -9.785  1.00 72.89  ? 159  GLN A CA    1 
ATOM   642   C  C     . GLN A 1 131  ? 53.197  69.464  -8.509  1.00 73.97  ? 159  GLN A C     1 
ATOM   643   O  O     . GLN A 1 131  ? 54.018  70.135  -7.883  1.00 71.52  ? 159  GLN A O     1 
ATOM   644   C  CB    . GLN A 1 131  ? 54.530  69.614  -10.616 1.00 68.54  ? 159  GLN A CB    1 
ATOM   645   C  CG    . GLN A 1 131  ? 53.904  70.924  -11.067 1.00 90.31  ? 159  GLN A CG    1 
ATOM   646   C  CD    . GLN A 1 131  ? 54.928  71.903  -11.605 1.00 86.22  ? 159  GLN A CD    1 
ATOM   647   O  OE1   . GLN A 1 131  ? 54.727  72.514  -12.655 1.00 87.82  ? 159  GLN A OE1   1 
ATOM   648   N  NE2   . GLN A 1 131  ? 56.030  72.063  -10.882 1.00 72.24  ? 159  GLN A NE2   1 
ATOM   649   N  N     . ALA A 1 132  ? 51.932  69.329  -8.127  1.00 76.50  ? 160  ALA A N     1 
ATOM   650   C  CA    . ALA A 1 132  ? 51.406  70.012  -6.953  1.00 64.72  ? 160  ALA A CA    1 
ATOM   651   C  C     . ALA A 1 132  ? 51.922  69.396  -5.657  1.00 55.63  ? 160  ALA A C     1 
ATOM   652   O  O     . ALA A 1 132  ? 51.704  68.215  -5.389  1.00 66.37  ? 160  ALA A O     1 
ATOM   653   C  CB    . ALA A 1 132  ? 49.887  69.992  -6.974  1.00 56.79  ? 160  ALA A CB    1 
ATOM   654   N  N     . GLN A 1 133  ? 52.609  70.205  -4.856  1.00 77.27  ? 161  GLN A N     1 
ATOM   655   C  CA    . GLN A 1 133  ? 53.037  69.780  -3.529  1.00 68.25  ? 161  GLN A CA    1 
ATOM   656   C  C     . GLN A 1 133  ? 51.915  70.050  -2.530  1.00 92.71  ? 161  GLN A C     1 
ATOM   657   O  O     . GLN A 1 133  ? 51.406  71.167  -2.437  1.00 93.36  ? 161  GLN A O     1 
ATOM   658   C  CB    . GLN A 1 133  ? 54.329  70.491  -3.124  1.00 84.65  ? 161  GLN A CB    1 
ATOM   659   C  CG    . GLN A 1 133  ? 55.555  70.004  -3.890  1.00 75.99  ? 161  GLN A CG    1 
ATOM   660   C  CD    . GLN A 1 133  ? 56.785  70.857  -3.647  1.00 77.60  ? 161  GLN A CD    1 
ATOM   661   O  OE1   . GLN A 1 133  ? 56.726  72.085  -3.716  1.00 74.30  ? 161  GLN A OE1   1 
ATOM   662   N  NE2   . GLN A 1 133  ? 57.908  70.208  -3.360  1.00 92.89  ? 161  GLN A NE2   1 
ATOM   663   N  N     . LEU A 1 134  ? 51.538  69.015  -1.785  1.00 70.38  ? 162  LEU A N     1 
ATOM   664   C  CA    . LEU A 1 134  ? 50.307  69.028  -0.999  1.00 76.72  ? 162  LEU A CA    1 
ATOM   665   C  C     . LEU A 1 134  ? 50.490  69.511  0.439   1.00 76.51  ? 162  LEU A C     1 
ATOM   666   O  O     . LEU A 1 134  ? 51.285  68.950  1.192   1.00 90.27  ? 162  LEU A O     1 
ATOM   667   C  CB    . LEU A 1 134  ? 49.695  67.621  -0.997  1.00 73.01  ? 162  LEU A CB    1 
ATOM   668   C  CG    . LEU A 1 134  ? 48.326  67.345  -0.359  1.00 74.62  ? 162  LEU A CG    1 
ATOM   669   C  CD1   . LEU A 1 134  ? 48.426  67.005  1.130   1.00 74.93  ? 162  LEU A CD1   1 
ATOM   670   C  CD2   . LEU A 1 134  ? 47.337  68.479  -0.615  1.00 69.53  ? 162  LEU A CD2   1 
ATOM   671   N  N     . PRO A 1 135  ? 49.747  70.563  0.819   1.00 85.59  ? 163  PRO A N     1 
ATOM   672   C  CA    . PRO A 1 135  ? 49.602  70.956  2.224   1.00 75.48  ? 163  PRO A CA    1 
ATOM   673   C  C     . PRO A 1 135  ? 48.548  70.096  2.919   1.00 74.52  ? 163  PRO A C     1 
ATOM   674   O  O     . PRO A 1 135  ? 47.508  69.818  2.323   1.00 69.59  ? 163  PRO A O     1 
ATOM   675   C  CB    . PRO A 1 135  ? 49.161  72.417  2.134   1.00 68.34  ? 163  PRO A CB    1 
ATOM   676   C  CG    . PRO A 1 135  ? 48.431  72.497  0.840   1.00 68.17  ? 163  PRO A CG    1 
ATOM   677   C  CD    . PRO A 1 135  ? 49.127  71.540  -0.094  1.00 68.58  ? 163  PRO A CD    1 
ATOM   678   N  N     . PRO A 1 136  ? 48.810  69.686  4.168   1.00 66.67  ? 164  PRO A N     1 
ATOM   679   C  CA    . PRO A 1 136  ? 47.962  68.724  4.884   1.00 56.82  ? 164  PRO A CA    1 
ATOM   680   C  C     . PRO A 1 136  ? 46.542  69.225  5.132   1.00 65.13  ? 164  PRO A C     1 
ATOM   681   O  O     . PRO A 1 136  ? 46.290  70.429  5.080   1.00 64.39  ? 164  PRO A O     1 
ATOM   682   C  CB    . PRO A 1 136  ? 48.702  68.526  6.210   1.00 64.18  ? 164  PRO A CB    1 
ATOM   683   C  CG    . PRO A 1 136  ? 49.486  69.775  6.392   1.00 68.54  ? 164  PRO A CG    1 
ATOM   684   C  CD    . PRO A 1 136  ? 49.906  70.188  5.013   1.00 56.66  ? 164  PRO A CD    1 
ATOM   685   N  N     . LYS A 1 137  ? 45.629  68.296  5.397   1.00 55.18  ? 165  LYS A N     1 
ATOM   686   C  CA    . LYS A 1 137  ? 44.244  68.637  5.700   1.00 69.90  ? 165  LYS A CA    1 
ATOM   687   C  C     . LYS A 1 137  ? 44.163  69.469  6.978   1.00 66.94  ? 165  LYS A C     1 
ATOM   688   O  O     . LYS A 1 137  ? 44.972  69.295  7.890   1.00 70.72  ? 165  LYS A O     1 
ATOM   689   C  CB    . LYS A 1 137  ? 43.394  67.368  5.836   1.00 44.85  ? 165  LYS A CB    1 
ATOM   690   C  CG    . LYS A 1 137  ? 43.276  66.555  4.555   1.00 43.48  ? 165  LYS A CG    1 
ATOM   691   C  CD    . LYS A 1 137  ? 42.449  65.291  4.757   1.00 56.36  ? 165  LYS A CD    1 
ATOM   692   C  CE    . LYS A 1 137  ? 43.105  64.343  5.753   1.00 76.95  ? 165  LYS A CE    1 
ATOM   693   N  NZ    . LYS A 1 137  ? 44.431  63.844  5.286   1.00 68.63  ? 165  LYS A NZ    1 
ATOM   694   N  N     . PRO A 1 138  ? 43.189  70.389  7.039   1.00 56.13  ? 166  PRO A N     1 
ATOM   695   C  CA    . PRO A 1 138  ? 42.948  71.221  8.223   1.00 55.13  ? 166  PRO A CA    1 
ATOM   696   C  C     . PRO A 1 138  ? 42.534  70.385  9.429   1.00 55.53  ? 166  PRO A C     1 
ATOM   697   O  O     . PRO A 1 138  ? 41.915  69.336  9.254   1.00 76.96  ? 166  PRO A O     1 
ATOM   698   C  CB    . PRO A 1 138  ? 41.803  72.141  7.785   1.00 60.13  ? 166  PRO A CB    1 
ATOM   699   C  CG    . PRO A 1 138  ? 41.810  72.092  6.298   1.00 48.07  ? 166  PRO A CG    1 
ATOM   700   C  CD    . PRO A 1 138  ? 42.274  70.726  5.936   1.00 69.17  ? 166  PRO A CD    1 
ATOM   701   N  N     . PRO A 1 139  ? 42.872  70.845  10.643  1.00 64.29  ? 167  PRO A N     1 
ATOM   702   C  CA    . PRO A 1 139  ? 42.490  70.148  11.875  1.00 65.12  ? 167  PRO A CA    1 
ATOM   703   C  C     . PRO A 1 139  ? 40.989  70.230  12.137  1.00 74.98  ? 167  PRO A C     1 
ATOM   704   O  O     . PRO A 1 139  ? 40.442  69.402  12.865  1.00 67.29  ? 167  PRO A O     1 
ATOM   705   C  CB    . PRO A 1 139  ? 43.276  70.894  12.956  1.00 75.16  ? 167  PRO A CB    1 
ATOM   706   C  CG    . PRO A 1 139  ? 43.468  72.261  12.395  1.00 70.24  ? 167  PRO A CG    1 
ATOM   707   C  CD    . PRO A 1 139  ? 43.653  72.064  10.917  1.00 71.92  ? 167  PRO A CD    1 
ATOM   708   N  N     . ALA A 1 140  ? 40.339  71.227  11.545  1.00 60.93  ? 168  ALA A N     1 
ATOM   709   C  CA    . ALA A 1 140  ? 38.901  71.411  11.696  1.00 56.18  ? 168  ALA A CA    1 
ATOM   710   C  C     . ALA A 1 140  ? 38.321  72.158  10.500  1.00 74.15  ? 168  ALA A C     1 
ATOM   711   O  O     . ALA A 1 140  ? 38.961  73.049  9.941   1.00 74.09  ? 168  ALA A O     1 
ATOM   712   C  CB    . ALA A 1 140  ? 38.594  72.154  12.987  1.00 64.81  ? 168  ALA A CB    1 
ATOM   713   N  N     . TRP A 1 141  ? 37.104  71.790  10.112  1.00 55.26  ? 169  TRP A N     1 
ATOM   714   C  CA    . TRP A 1 141  ? 36.434  72.413  8.975   1.00 46.99  ? 169  TRP A CA    1 
ATOM   715   C  C     . TRP A 1 141  ? 35.566  73.582  9.419   1.00 48.36  ? 169  TRP A C     1 
ATOM   716   O  O     . TRP A 1 141  ? 34.861  73.497  10.424  1.00 49.30  ? 169  TRP A O     1 
ATOM   717   C  CB    . TRP A 1 141  ? 35.587  71.383  8.229   1.00 47.21  ? 169  TRP A CB    1 
ATOM   718   C  CG    . TRP A 1 141  ? 36.367  70.183  7.810   1.00 43.80  ? 169  TRP A CG    1 
ATOM   719   C  CD1   . TRP A 1 141  ? 36.410  68.973  8.436   1.00 42.91  ? 169  TRP A CD1   1 
ATOM   720   C  CD2   . TRP A 1 141  ? 37.234  70.080  6.676   1.00 60.93  ? 169  TRP A CD2   1 
ATOM   721   N  NE1   . TRP A 1 141  ? 37.245  68.119  7.757   1.00 55.05  ? 169  TRP A NE1   1 
ATOM   722   C  CE2   . TRP A 1 141  ? 37.764  68.776  6.672   1.00 41.30  ? 169  TRP A CE2   1 
ATOM   723   C  CE3   . TRP A 1 141  ? 37.612  70.964  5.660   1.00 67.56  ? 169  TRP A CE3   1 
ATOM   724   C  CZ2   . TRP A 1 141  ? 38.651  68.335  5.695   1.00 40.39  ? 169  TRP A CZ2   1 
ATOM   725   C  CZ3   . TRP A 1 141  ? 38.492  70.523  4.691   1.00 49.07  ? 169  TRP A CZ3   1 
ATOM   726   C  CH2   . TRP A 1 141  ? 39.001  69.221  4.714   1.00 40.20  ? 169  TRP A CH2   1 
ATOM   727   N  N     . ALA A 1 142  ? 35.617  74.673  8.661   1.00 73.50  ? 170  ALA A N     1 
ATOM   728   C  CA    . ALA A 1 142  ? 34.864  75.874  9.001   1.00 71.08  ? 170  ALA A CA    1 
ATOM   729   C  C     . ALA A 1 142  ? 33.373  75.701  8.728   1.00 72.99  ? 170  ALA A C     1 
ATOM   730   O  O     . ALA A 1 142  ? 32.974  75.249  7.654   1.00 46.47  ? 170  ALA A O     1 
ATOM   731   C  CB    . ALA A 1 142  ? 35.405  77.070  8.235   1.00 55.24  ? 170  ALA A CB    1 
ATOM   732   N  N     . TRP A 1 143  ? 32.557  76.065  9.712   1.00 69.46  ? 171  TRP A N     1 
ATOM   733   C  CA    . TRP A 1 143  ? 31.108  75.985  9.584   1.00 70.38  ? 171  TRP A CA    1 
ATOM   734   C  C     . TRP A 1 143  ? 30.551  77.322  9.106   1.00 56.43  ? 171  TRP A C     1 
ATOM   735   O  O     . TRP A 1 143  ? 29.703  77.923  9.764   1.00 73.19  ? 171  TRP A O     1 
ATOM   736   C  CB    . TRP A 1 143  ? 30.474  75.587  10.920  1.00 77.08  ? 171  TRP A CB    1 
ATOM   737   C  CG    . TRP A 1 143  ? 29.091  75.015  10.801  1.00 75.41  ? 171  TRP A CG    1 
ATOM   738   C  CD1   . TRP A 1 143  ? 28.312  74.975  9.682   1.00 75.51  ? 171  TRP A CD1   1 
ATOM   739   C  CD2   . TRP A 1 143  ? 28.330  74.388  11.842  1.00 70.30  ? 171  TRP A CD2   1 
ATOM   740   N  NE1   . TRP A 1 143  ? 27.111  74.369  9.962   1.00 68.55  ? 171  TRP A NE1   1 
ATOM   741   C  CE2   . TRP A 1 143  ? 27.098  73.998  11.281  1.00 74.76  ? 171  TRP A CE2   1 
ATOM   742   C  CE3   . TRP A 1 143  ? 28.571  74.121  13.193  1.00 69.75  ? 171  TRP A CE3   1 
ATOM   743   C  CZ2   . TRP A 1 143  ? 26.109  73.356  12.024  1.00 71.19  ? 171  TRP A CZ2   1 
ATOM   744   C  CZ3   . TRP A 1 143  ? 27.588  73.483  13.929  1.00 71.56  ? 171  TRP A CZ3   1 
ATOM   745   C  CH2   . TRP A 1 143  ? 26.373  73.108  13.343  1.00 72.83  ? 171  TRP A CH2   1 
ATOM   746   N  N     . ALA A 1 144  ? 31.035  77.782  7.957   1.00 49.65  ? 172  ALA A N     1 
ATOM   747   C  CA    . ALA A 1 144  ? 30.642  79.083  7.429   1.00 60.87  ? 172  ALA A CA    1 
ATOM   748   C  C     . ALA A 1 144  ? 30.188  78.993  5.975   1.00 69.50  ? 172  ALA A C     1 
ATOM   749   O  O     . ALA A 1 144  ? 30.744  78.230  5.185   1.00 64.01  ? 172  ALA A O     1 
ATOM   750   C  CB    . ALA A 1 144  ? 31.790  80.070  7.562   1.00 56.12  ? 172  ALA A CB    1 
ATOM   751   N  N     . GLU A 1 145  ? 29.175  79.785  5.634   1.00 60.36  ? 173  GLU A N     1 
ATOM   752   C  CA    . GLU A 1 145  ? 28.622  79.820  4.284   1.00 47.85  ? 173  GLU A CA    1 
ATOM   753   C  C     . GLU A 1 145  ? 29.636  80.356  3.277   1.00 67.47  ? 173  GLU A C     1 
ATOM   754   O  O     . GLU A 1 145  ? 30.364  81.305  3.565   1.00 75.47  ? 173  GLU A O     1 
ATOM   755   C  CB    . GLU A 1 145  ? 27.351  80.674  4.261   1.00 65.08  ? 173  GLU A CB    1 
ATOM   756   C  CG    . GLU A 1 145  ? 26.717  80.835  2.890   1.00 71.12  ? 173  GLU A CG    1 
ATOM   757   C  CD    . GLU A 1 145  ? 25.523  81.769  2.909   1.00 74.42  ? 173  GLU A CD    1 
ATOM   758   O  OE1   . GLU A 1 145  ? 25.079  82.146  4.014   1.00 68.75  ? 173  GLU A OE1   1 
ATOM   759   O  OE2   . GLU A 1 145  ? 25.030  82.130  1.820   1.00 76.24  ? 173  GLU A OE2   1 
ATOM   760   N  N     . GLY A 1 146  ? 29.680  79.746  2.096   1.00 45.68  ? 174  GLY A N     1 
ATOM   761   C  CA    . GLY A 1 146  ? 30.607  80.169  1.061   1.00 45.70  ? 174  GLY A CA    1 
ATOM   762   C  C     . GLY A 1 146  ? 31.864  79.324  1.060   1.00 70.21  ? 174  GLY A C     1 
ATOM   763   O  O     . GLY A 1 146  ? 31.873  78.222  1.613   1.00 75.28  ? 174  GLY A O     1 
ATOM   764   N  N     . TRP A 1 147  ? 32.927  79.831  0.440   1.00 65.82  ? 175  TRP A N     1 
ATOM   765   C  CA    . TRP A 1 147  ? 34.175  79.081  0.387   1.00 64.22  ? 175  TRP A CA    1 
ATOM   766   C  C     . TRP A 1 147  ? 35.068  79.433  1.566   1.00 47.09  ? 175  TRP A C     1 
ATOM   767   O  O     . TRP A 1 147  ? 35.061  80.563  2.049   1.00 49.58  ? 175  TRP A O     1 
ATOM   768   C  CB    . TRP A 1 147  ? 34.916  79.341  -0.926  1.00 44.62  ? 175  TRP A CB    1 
ATOM   769   C  CG    . TRP A 1 147  ? 34.348  78.623  -2.107  1.00 42.10  ? 175  TRP A CG    1 
ATOM   770   C  CD1   . TRP A 1 147  ? 33.477  79.122  -3.029  1.00 41.81  ? 175  TRP A CD1   1 
ATOM   771   C  CD2   . TRP A 1 147  ? 34.618  77.273  -2.501  1.00 49.75  ? 175  TRP A CD2   1 
ATOM   772   N  NE1   . TRP A 1 147  ? 33.186  78.167  -3.972  1.00 49.40  ? 175  TRP A NE1   1 
ATOM   773   C  CE2   . TRP A 1 147  ? 33.874  77.022  -3.670  1.00 48.10  ? 175  TRP A CE2   1 
ATOM   774   C  CE3   . TRP A 1 147  ? 35.415  76.252  -1.976  1.00 49.07  ? 175  TRP A CE3   1 
ATOM   775   C  CZ2   . TRP A 1 147  ? 33.902  75.793  -4.323  1.00 45.81  ? 175  TRP A CZ2   1 
ATOM   776   C  CZ3   . TRP A 1 147  ? 35.442  75.032  -2.627  1.00 56.90  ? 175  TRP A CZ3   1 
ATOM   777   C  CH2   . TRP A 1 147  ? 34.690  74.813  -3.787  1.00 45.20  ? 175  TRP A CH2   1 
ATOM   778   N  N     . THR A 1 148  ? 35.826  78.452  2.038   1.00 64.03  ? 176  THR A N     1 
ATOM   779   C  CA    . THR A 1 148  ? 36.799  78.686  3.092   1.00 48.64  ? 176  THR A CA    1 
ATOM   780   C  C     . THR A 1 148  ? 38.164  78.181  2.650   1.00 48.52  ? 176  THR A C     1 
ATOM   781   O  O     . THR A 1 148  ? 38.342  76.991  2.378   1.00 64.81  ? 176  THR A O     1 
ATOM   782   C  CB    . THR A 1 148  ? 36.394  78.007  4.412   1.00 66.96  ? 176  THR A CB    1 
ATOM   783   O  OG1   . THR A 1 148  ? 36.253  76.597  4.204   1.00 68.25  ? 176  THR A OG1   1 
ATOM   784   C  CG2   . THR A 1 148  ? 35.077  78.574  4.918   1.00 49.19  ? 176  THR A CG2   1 
ATOM   785   N  N     . ARG A 1 149  ? 39.115  79.104  2.561   1.00 60.93  ? 177  ARG A N     1 
ATOM   786   C  CA    . ARG A 1 149  ? 40.479  78.786  2.167   1.00 55.42  ? 177  ARG A CA    1 
ATOM   787   C  C     . ARG A 1 149  ? 41.305  78.344  3.367   1.00 56.87  ? 177  ARG A C     1 
ATOM   788   O  O     . ARG A 1 149  ? 41.340  79.022  4.396   1.00 65.23  ? 177  ARG A O     1 
ATOM   789   C  CB    . ARG A 1 149  ? 41.135  79.994  1.493   1.00 56.68  ? 177  ARG A CB    1 
ATOM   790   C  CG    . ARG A 1 149  ? 42.656  79.998  1.553   1.00 73.08  ? 177  ARG A CG    1 
ATOM   791   C  CD    . ARG A 1 149  ? 43.261  78.985  0.600   1.00 75.66  ? 177  ARG A CD    1 
ATOM   792   N  NE    . ARG A 1 149  ? 43.768  79.616  -0.615  1.00 72.49  ? 177  ARG A NE    1 
ATOM   793   C  CZ    . ARG A 1 149  ? 45.014  80.055  -0.761  1.00 66.96  ? 177  ARG A CZ    1 
ATOM   794   N  NH1   . ARG A 1 149  ? 45.881  79.931  0.235   1.00 68.93  ? 177  ARG A NH1   1 
ATOM   795   N  NH2   . ARG A 1 149  ? 45.395  80.617  -1.900  1.00 67.71  ? 177  ARG A NH2   1 
ATOM   796   N  N     . TYR A 1 150  ? 41.959  77.195  3.227   1.00 55.60  ? 178  TYR A N     1 
ATOM   797   C  CA    . TYR A 1 150  ? 42.875  76.695  4.241   1.00 70.65  ? 178  TYR A CA    1 
ATOM   798   C  C     . TYR A 1 150  ? 44.295  76.673  3.692   1.00 72.28  ? 178  TYR A C     1 
ATOM   799   O  O     . TYR A 1 150  ? 44.643  75.800  2.894   1.00 69.73  ? 178  TYR A O     1 
ATOM   800   C  CB    . TYR A 1 150  ? 42.479  75.292  4.698   1.00 70.89  ? 178  TYR A CB    1 
ATOM   801   C  CG    . TYR A 1 150  ? 41.037  75.143  5.119   1.00 49.59  ? 178  TYR A CG    1 
ATOM   802   C  CD1   . TYR A 1 150  ? 40.077  74.701  4.219   1.00 46.86  ? 178  TYR A CD1   1 
ATOM   803   C  CD2   . TYR A 1 150  ? 40.638  75.420  6.420   1.00 55.17  ? 178  TYR A CD2   1 
ATOM   804   C  CE1   . TYR A 1 150  ? 38.759  74.551  4.598   1.00 45.79  ? 178  TYR A CE1   1 
ATOM   805   C  CE2   . TYR A 1 150  ? 39.319  75.272  6.809   1.00 70.72  ? 178  TYR A CE2   1 
ATOM   806   C  CZ    . TYR A 1 150  ? 38.384  74.837  5.893   1.00 47.40  ? 178  TYR A CZ    1 
ATOM   807   O  OH    . TYR A 1 150  ? 37.068  74.687  6.270   1.00 46.55  ? 178  TYR A OH    1 
ATOM   808   N  N     . GLY A 1 151  ? 45.107  77.634  4.120   1.00 71.35  ? 179  GLY A N     1 
ATOM   809   C  CA    . GLY A 1 151  ? 46.483  77.728  3.666   1.00 75.13  ? 179  GLY A CA    1 
ATOM   810   C  C     . GLY A 1 151  ? 47.480  77.307  4.728   1.00 92.06  ? 179  GLY A C     1 
ATOM   811   O  O     . GLY A 1 151  ? 47.664  76.115  4.973   1.00 75.45  ? 179  GLY A O     1 
ATOM   812   N  N     . PRO A 1 152  ? 48.134  78.289  5.366   1.00 77.01  ? 180  PRO A N     1 
ATOM   813   C  CA    . PRO A 1 152  ? 49.123  78.022  6.416   1.00 75.85  ? 180  PRO A CA    1 
ATOM   814   C  C     . PRO A 1 152  ? 48.493  77.428  7.674   1.00 75.91  ? 180  PRO A C     1 
ATOM   815   O  O     . PRO A 1 152  ? 47.668  78.081  8.315   1.00 70.19  ? 180  PRO A O     1 
ATOM   816   C  CB    . PRO A 1 152  ? 49.715  79.407  6.701   1.00 69.28  ? 180  PRO A CB    1 
ATOM   817   C  CG    . PRO A 1 152  ? 48.653  80.364  6.285   1.00 73.05  ? 180  PRO A CG    1 
ATOM   818   C  CD    . PRO A 1 152  ? 47.974  79.730  5.108   1.00 73.51  ? 180  PRO A CD    1 
ATOM   819   N  N     . GLU A 1 153  ? 48.879  76.197  8.001   1.00 91.15  ? 181  GLU A N     1 
ATOM   820   C  CA    . GLU A 1 153  ? 48.398  75.494  9.191   1.00 90.63  ? 181  GLU A CA    1 
ATOM   821   C  C     . GLU A 1 153  ? 46.879  75.325  9.201   1.00 69.21  ? 181  GLU A C     1 
ATOM   822   O  O     . GLU A 1 153  ? 46.274  75.139  10.256  1.00 76.88  ? 181  GLU A O     1 
ATOM   823   C  CB    . GLU A 1 153  ? 48.848  76.223  10.462  1.00 93.55  ? 181  GLU A CB    1 
ATOM   824   C  CG    . GLU A 1 153  ? 50.357  76.341  10.605  1.00 90.54  ? 181  GLU A CG    1 
ATOM   825   C  CD    . GLU A 1 153  ? 50.767  77.101  11.850  1.00 87.69  ? 181  GLU A CD    1 
ATOM   826   O  OE1   . GLU A 1 153  ? 49.873  77.537  12.605  1.00 90.80  ? 181  GLU A OE1   1 
ATOM   827   O  OE2   . GLU A 1 153  ? 51.985  77.264  12.074  1.00 85.94  ? 181  GLU A OE2   1 
ATOM   828   N  N     . GLY A 1 154  ? 46.272  75.387  8.020   1.00 73.80  ? 182  GLY A N     1 
ATOM   829   C  CA    . GLY A 1 154  ? 44.842  75.178  7.879   1.00 77.89  ? 182  GLY A CA    1 
ATOM   830   C  C     . GLY A 1 154  ? 43.976  76.229  8.549   1.00 70.64  ? 182  GLY A C     1 
ATOM   831   O  O     . GLY A 1 154  ? 42.941  75.905  9.132   1.00 70.07  ? 182  GLY A O     1 
ATOM   832   N  N     . GLU A 1 155  ? 44.395  77.489  8.470   1.00 72.38  ? 183  GLU A N     1 
ATOM   833   C  CA    . GLU A 1 155  ? 43.599  78.585  9.012   1.00 70.88  ? 183  GLU A CA    1 
ATOM   834   C  C     . GLU A 1 155  ? 42.378  78.823  8.133   1.00 60.86  ? 183  GLU A C     1 
ATOM   835   O  O     . GLU A 1 155  ? 42.410  78.551  6.935   1.00 68.85  ? 183  GLU A O     1 
ATOM   836   C  CB    . GLU A 1 155  ? 44.431  79.864  9.125   1.00 70.09  ? 183  GLU A CB    1 
ATOM   837   C  CG    . GLU A 1 155  ? 44.909  80.426  7.794   1.00 68.93  ? 183  GLU A CG    1 
ATOM   838   C  CD    . GLU A 1 155  ? 45.536  81.802  7.931   1.00 77.19  ? 183  GLU A CD    1 
ATOM   839   O  OE1   . GLU A 1 155  ? 45.500  82.368  9.044   1.00 91.28  ? 183  GLU A OE1   1 
ATOM   840   O  OE2   . GLU A 1 155  ? 46.065  82.319  6.924   1.00 75.06  ? 183  GLU A OE2   1 
ATOM   841   N  N     . ALA A 1 156  ? 41.303  79.330  8.729   1.00 55.22  ? 184  ALA A N     1 
ATOM   842   C  CA    . ALA A 1 156  ? 40.063  79.562  7.995   1.00 65.79  ? 184  ALA A CA    1 
ATOM   843   C  C     . ALA A 1 156  ? 40.008  80.973  7.413   1.00 60.91  ? 184  ALA A C     1 
ATOM   844   O  O     . ALA A 1 156  ? 39.854  81.951  8.145   1.00 56.58  ? 184  ALA A O     1 
ATOM   845   C  CB    . ALA A 1 156  ? 38.862  79.315  8.896   1.00 68.71  ? 184  ALA A CB    1 
ATOM   846   N  N     . VAL A 1 157  ? 40.132  81.070  6.093   1.00 69.57  ? 185  VAL A N     1 
ATOM   847   C  CA    . VAL A 1 157  ? 40.069  82.359  5.412   1.00 55.21  ? 185  VAL A CA    1 
ATOM   848   C  C     . VAL A 1 157  ? 38.827  82.451  4.527   1.00 73.64  ? 185  VAL A C     1 
ATOM   849   O  O     . VAL A 1 157  ? 38.773  81.830  3.469   1.00 68.62  ? 185  VAL A O     1 
ATOM   850   C  CB    . VAL A 1 157  ? 41.322  82.605  4.550   1.00 56.21  ? 185  VAL A CB    1 
ATOM   851   C  CG1   . VAL A 1 157  ? 41.224  83.946  3.840   1.00 76.30  ? 185  VAL A CG1   1 
ATOM   852   C  CG2   . VAL A 1 157  ? 42.576  82.539  5.406   1.00 64.67  ? 185  VAL A CG2   1 
ATOM   853   N  N     . PRO A 1 158  ? 37.823  83.227  4.967   1.00 60.13  ? 186  PRO A N     1 
ATOM   854   C  CA    . PRO A 1 158  ? 36.564  83.404  4.231   1.00 68.55  ? 186  PRO A CA    1 
ATOM   855   C  C     . PRO A 1 158  ? 36.779  83.923  2.812   1.00 68.36  ? 186  PRO A C     1 
ATOM   856   O  O     . PRO A 1 158  ? 37.314  85.014  2.625   1.00 55.04  ? 186  PRO A O     1 
ATOM   857   C  CB    . PRO A 1 158  ? 35.807  84.431  5.077   1.00 55.03  ? 186  PRO A CB    1 
ATOM   858   C  CG    . PRO A 1 158  ? 36.368  84.277  6.447   1.00 69.45  ? 186  PRO A CG    1 
ATOM   859   C  CD    . PRO A 1 158  ? 37.818  83.955  6.247   1.00 71.60  ? 186  PRO A CD    1 
ATOM   860   N  N     . VAL A 1 159  ? 36.367  83.134  1.826   1.00 75.78  ? 187  VAL A N     1 
ATOM   861   C  CA    . VAL A 1 159  ? 36.532  83.492  0.421   1.00 68.82  ? 187  VAL A CA    1 
ATOM   862   C  C     . VAL A 1 159  ? 35.233  83.243  -0.348  1.00 72.55  ? 187  VAL A C     1 
ATOM   863   O  O     . VAL A 1 159  ? 34.500  82.286  -0.067  1.00 68.99  ? 187  VAL A O     1 
ATOM   864   C  CB    . VAL A 1 159  ? 37.695  82.696  -0.230  1.00 65.29  ? 187  VAL A CB    1 
ATOM   865   C  CG1   . VAL A 1 159  ? 37.829  83.025  -1.708  1.00 56.60  ? 187  VAL A CG1   1 
ATOM   866   C  CG2   . VAL A 1 159  ? 39.005  82.982  0.487   1.00 66.30  ? 187  VAL A CG2   1 
ATOM   867   N  N     . ALA A 1 160  ? 34.940  84.120  -1.304  1.00 55.28  ? 188  ALA A N     1 
ATOM   868   C  CA    . ALA A 1 160  ? 33.773  83.959  -2.159  1.00 77.37  ? 188  ALA A CA    1 
ATOM   869   C  C     . ALA A 1 160  ? 34.053  82.970  -3.287  1.00 67.24  ? 188  ALA A C     1 
ATOM   870   O  O     . ALA A 1 160  ? 33.240  82.090  -3.565  1.00 56.54  ? 188  ALA A O     1 
ATOM   871   C  CB    . ALA A 1 160  ? 33.340  85.302  -2.725  1.00 75.19  ? 188  ALA A CB    1 
ATOM   872   N  N     . ILE A 1 161  ? 35.205  83.120  -3.935  1.00 67.35  ? 189  ILE A N     1 
ATOM   873   C  CA    . ILE A 1 161  ? 35.576  82.256  -5.055  1.00 68.63  ? 189  ILE A CA    1 
ATOM   874   C  C     . ILE A 1 161  ? 37.040  81.827  -4.986  1.00 68.63  ? 189  ILE A C     1 
ATOM   875   O  O     . ILE A 1 161  ? 37.935  82.669  -4.932  1.00 73.06  ? 189  ILE A O     1 
ATOM   876   C  CB    . ILE A 1 161  ? 35.325  82.954  -6.409  1.00 68.97  ? 189  ILE A CB    1 
ATOM   877   C  CG1   . ILE A 1 161  ? 33.825  83.154  -6.640  1.00 76.32  ? 189  ILE A CG1   1 
ATOM   878   C  CG2   . ILE A 1 161  ? 35.929  82.146  -7.548  1.00 46.66  ? 189  ILE A CG2   1 
ATOM   879   C  CD1   . ILE A 1 161  ? 33.496  83.953  -7.881  1.00 68.10  ? 189  ILE A CD1   1 
ATOM   880   N  N     . PRO A 1 162  ? 37.286  80.507  -4.992  1.00 69.69  ? 190  PRO A N     1 
ATOM   881   C  CA    . PRO A 1 162  ? 38.652  79.974  -4.971  1.00 48.71  ? 190  PRO A CA    1 
ATOM   882   C  C     . PRO A 1 162  ? 39.390  80.248  -6.278  1.00 56.19  ? 190  PRO A C     1 
ATOM   883   O  O     . PRO A 1 162  ? 39.260  79.486  -7.236  1.00 73.71  ? 190  PRO A O     1 
ATOM   884   C  CB    . PRO A 1 162  ? 38.438  78.472  -4.762  1.00 43.17  ? 190  PRO A CB    1 
ATOM   885   C  CG    . PRO A 1 162  ? 37.085  78.205  -5.318  1.00 45.43  ? 190  PRO A CG    1 
ATOM   886   C  CD    . PRO A 1 162  ? 36.274  79.437  -5.028  1.00 70.01  ? 190  PRO A CD    1 
ATOM   887   N  N     . GLU A 1 163  ? 40.155  81.334  -6.311  1.00 56.36  ? 191  GLU A N     1 
ATOM   888   C  CA    . GLU A 1 163  ? 40.873  81.728  -7.517  1.00 69.32  ? 191  GLU A CA    1 
ATOM   889   C  C     . GLU A 1 163  ? 42.062  80.811  -7.775  1.00 49.96  ? 191  GLU A C     1 
ATOM   890   O  O     . GLU A 1 163  ? 43.144  81.011  -7.227  1.00 56.00  ? 191  GLU A O     1 
ATOM   891   C  CB    . GLU A 1 163  ? 41.341  83.181  -7.411  1.00 76.02  ? 191  GLU A CB    1 
ATOM   892   C  CG    . GLU A 1 163  ? 41.986  83.718  -8.679  1.00 76.86  ? 191  GLU A CG    1 
ATOM   893   C  CD    . GLU A 1 163  ? 42.332  85.189  -8.578  1.00 90.15  ? 191  GLU A CD    1 
ATOM   894   O  OE1   . GLU A 1 163  ? 42.828  85.753  -9.576  1.00 92.37  ? 191  GLU A OE1   1 
ATOM   895   O  OE2   . GLU A 1 163  ? 42.107  85.782  -7.502  1.00 84.59  ? 191  GLU A OE2   1 
ATOM   896   N  N     . GLU A 1 164  ? 41.849  79.799  -8.610  1.00 60.63  ? 192  GLU A N     1 
ATOM   897   C  CA    . GLU A 1 164  ? 42.896  78.839  -8.940  1.00 46.73  ? 192  GLU A CA    1 
ATOM   898   C  C     . GLU A 1 164  ? 42.845  78.462  -10.418 1.00 45.47  ? 192  GLU A C     1 
ATOM   899   O  O     . GLU A 1 164  ? 41.779  78.472  -11.032 1.00 44.01  ? 192  GLU A O     1 
ATOM   900   C  CB    . GLU A 1 164  ? 42.767  77.582  -8.073  1.00 44.64  ? 192  GLU A CB    1 
ATOM   901   C  CG    . GLU A 1 164  ? 42.952  77.812  -6.578  1.00 45.99  ? 192  GLU A CG    1 
ATOM   902   C  CD    . GLU A 1 164  ? 44.410  77.937  -6.175  1.00 60.10  ? 192  GLU A CD    1 
ATOM   903   O  OE1   . GLU A 1 164  ? 44.676  78.188  -4.980  1.00 49.92  ? 192  GLU A OE1   1 
ATOM   904   O  OE2   . GLU A 1 164  ? 45.290  77.773  -7.046  1.00 48.92  ? 192  GLU A OE2   1 
ATOM   905   N  N     . ARG A 1 165  ? 44.002  78.134  -10.984 1.00 64.63  ? 193  ARG A N     1 
ATOM   906   C  CA    . ARG A 1 165  ? 44.074  77.682  -12.368 1.00 69.41  ? 193  ARG A CA    1 
ATOM   907   C  C     . ARG A 1 165  ? 43.362  76.347  -12.534 1.00 56.08  ? 193  ARG A C     1 
ATOM   908   O  O     . ARG A 1 165  ? 42.642  76.132  -13.507 1.00 66.07  ? 193  ARG A O     1 
ATOM   909   C  CB    . ARG A 1 165  ? 45.530  77.560  -12.822 1.00 75.14  ? 193  ARG A CB    1 
ATOM   910   C  CG    . ARG A 1 165  ? 46.183  78.877  -13.199 1.00 90.19  ? 193  ARG A CG    1 
ATOM   911   C  CD    . ARG A 1 165  ? 45.636  79.401  -14.517 1.00 90.05  ? 193  ARG A CD    1 
ATOM   912   N  NE    . ARG A 1 165  ? 45.750  78.414  -15.589 1.00 76.11  ? 193  ARG A NE    1 
ATOM   913   C  CZ    . ARG A 1 165  ? 46.851  78.210  -16.305 1.00 69.92  ? 193  ARG A CZ    1 
ATOM   914   N  NH1   . ARG A 1 165  ? 47.945  78.920  -16.064 1.00 71.08  ? 193  ARG A NH1   1 
ATOM   915   N  NH2   . ARG A 1 165  ? 46.860  77.291  -17.261 1.00 71.36  ? 193  ARG A NH2   1 
ATOM   916   N  N     . ALA A 1 166  ? 43.569  75.454  -11.571 1.00 45.96  ? 194  ALA A N     1 
ATOM   917   C  CA    . ALA A 1 166  ? 42.968  74.128  -11.610 1.00 42.93  ? 194  ALA A CA    1 
ATOM   918   C  C     . ALA A 1 166  ? 42.763  73.574  -10.206 1.00 47.44  ? 194  ALA A C     1 
ATOM   919   O  O     . ALA A 1 166  ? 43.480  73.937  -9.274  1.00 49.21  ? 194  ALA A O     1 
ATOM   920   C  CB    . ALA A 1 166  ? 43.828  73.182  -12.427 1.00 47.60  ? 194  ALA A CB    1 
ATOM   921   N  N     . LEU A 1 167  ? 41.779  72.691  -10.065 1.00 45.12  ? 195  LEU A N     1 
ATOM   922   C  CA    . LEU A 1 167  ? 41.510  72.045  -8.787  1.00 45.78  ? 195  LEU A CA    1 
ATOM   923   C  C     . LEU A 1 167  ? 40.698  70.766  -8.961  1.00 46.56  ? 195  LEU A C     1 
ATOM   924   O  O     . LEU A 1 167  ? 39.997  70.595  -9.959  1.00 47.96  ? 195  LEU A O     1 
ATOM   925   C  CB    . LEU A 1 167  ? 40.780  73.006  -7.840  1.00 49.61  ? 195  LEU A CB    1 
ATOM   926   C  CG    . LEU A 1 167  ? 39.796  74.043  -8.395  1.00 45.54  ? 195  LEU A CG    1 
ATOM   927   C  CD1   . LEU A 1 167  ? 38.628  73.401  -9.123  1.00 43.26  ? 195  LEU A CD1   1 
ATOM   928   C  CD2   . LEU A 1 167  ? 39.291  74.931  -7.271  1.00 46.87  ? 195  LEU A CD2   1 
ATOM   929   N  N     . VAL A 1 168  ? 40.809  69.864  -7.991  1.00 44.35  ? 196  VAL A N     1 
ATOM   930   C  CA    . VAL A 1 168  ? 39.941  68.696  -7.946  1.00 44.60  ? 196  VAL A CA    1 
ATOM   931   C  C     . VAL A 1 168  ? 38.659  69.107  -7.237  1.00 41.60  ? 196  VAL A C     1 
ATOM   932   O  O     . VAL A 1 168  ? 38.652  70.074  -6.474  1.00 69.78  ? 196  VAL A O     1 
ATOM   933   C  CB    . VAL A 1 168  ? 40.597  67.505  -7.222  1.00 65.87  ? 196  VAL A CB    1 
ATOM   934   C  CG1   . VAL A 1 168  ? 42.052  67.369  -7.638  1.00 65.71  ? 196  VAL A CG1   1 
ATOM   935   C  CG2   . VAL A 1 168  ? 40.493  67.669  -5.718  1.00 72.89  ? 196  VAL A CG2   1 
ATOM   936   N  N     . PHE A 1 169  ? 37.573  68.388  -7.488  1.00 91.48  ? 197  PHE A N     1 
ATOM   937   C  CA    . PHE A 1 169  ? 36.283  68.805  -6.960  1.00 91.25  ? 197  PHE A CA    1 
ATOM   938   C  C     . PHE A 1 169  ? 35.331  67.639  -6.728  1.00 87.80  ? 197  PHE A C     1 
ATOM   939   O  O     . PHE A 1 169  ? 35.237  66.728  -7.549  1.00 65.52  ? 197  PHE A O     1 
ATOM   940   C  CB    . PHE A 1 169  ? 35.633  69.812  -7.910  1.00 49.05  ? 197  PHE A CB    1 
ATOM   941   C  CG    . PHE A 1 169  ? 34.615  70.696  -7.252  1.00 56.89  ? 197  PHE A CG    1 
ATOM   942   C  CD1   . PHE A 1 169  ? 33.636  71.327  -8.001  1.00 91.85  ? 197  PHE A CD1   1 
ATOM   943   C  CD2   . PHE A 1 169  ? 34.648  70.907  -5.884  1.00 65.75  ? 197  PHE A CD2   1 
ATOM   944   C  CE1   . PHE A 1 169  ? 32.702  72.142  -7.395  1.00 92.68  ? 197  PHE A CE1   1 
ATOM   945   C  CE2   . PHE A 1 169  ? 33.717  71.722  -5.273  1.00 46.55  ? 197  PHE A CE2   1 
ATOM   946   C  CZ    . PHE A 1 169  ? 32.744  72.341  -6.029  1.00 93.66  ? 197  PHE A CZ    1 
ATOM   947   N  N     . ALA A 1 170  ? 34.626  67.677  -5.602  1.00 90.14  ? 198  ALA A N     1 
ATOM   948   C  CA    . ALA A 1 170  ? 33.560  66.721  -5.335  1.00 60.54  ? 198  ALA A CA    1 
ATOM   949   C  C     . ALA A 1 170  ? 32.471  67.371  -4.489  1.00 60.64  ? 198  ALA A C     1 
ATOM   950   O  O     . ALA A 1 170  ? 32.675  67.656  -3.310  1.00 60.46  ? 198  ALA A O     1 
ATOM   951   C  CB    . ALA A 1 170  ? 34.103  65.483  -4.647  1.00 68.65  ? 198  ALA A CB    1 
ATOM   952   N  N     . VAL A 1 171  ? 31.316  67.605  -5.103  1.00 60.98  ? 199  VAL A N     1 
ATOM   953   C  CA    . VAL A 1 171  ? 30.208  68.264  -4.422  1.00 56.36  ? 199  VAL A CA    1 
ATOM   954   C  C     . VAL A 1 171  ? 29.362  67.271  -3.636  1.00 87.69  ? 199  VAL A C     1 
ATOM   955   O  O     . VAL A 1 171  ? 29.282  66.093  -3.982  1.00 86.67  ? 199  VAL A O     1 
ATOM   956   C  CB    . VAL A 1 171  ? 29.296  69.019  -5.414  1.00 87.83  ? 199  VAL A CB    1 
ATOM   957   C  CG1   . VAL A 1 171  ? 30.079  70.092  -6.143  1.00 90.46  ? 199  VAL A CG1   1 
ATOM   958   C  CG2   . VAL A 1 171  ? 28.670  68.055  -6.403  1.00 69.50  ? 199  VAL A CG2   1 
ATOM   959   N  N     . ALA A 1 172  ? 28.738  67.759  -2.570  1.00 90.83  ? 200  ALA A N     1 
ATOM   960   C  CA    . ALA A 1 172  ? 27.832  66.951  -1.769  1.00 90.96  ? 200  ALA A CA    1 
ATOM   961   C  C     . ALA A 1 172  ? 26.433  67.542  -1.845  1.00 43.76  ? 200  ALA A C     1 
ATOM   962   O  O     . ALA A 1 172  ? 26.273  68.750  -2.002  1.00 76.20  ? 200  ALA A O     1 
ATOM   963   C  CB    . ALA A 1 172  ? 28.307  66.878  -0.331  1.00 92.18  ? 200  ALA A CB    1 
ATOM   964   N  N     . VAL A 1 173  ? 25.420  66.691  -1.738  1.00 40.64  ? 201  VAL A N     1 
ATOM   965   C  CA    . VAL A 1 173  ? 24.041  67.153  -1.827  1.00 91.83  ? 201  VAL A CA    1 
ATOM   966   C  C     . VAL A 1 173  ? 23.118  66.295  -0.968  1.00 92.46  ? 201  VAL A C     1 
ATOM   967   O  O     . VAL A 1 173  ? 23.112  65.069  -1.077  1.00 70.88  ? 201  VAL A O     1 
ATOM   968   C  CB    . VAL A 1 173  ? 23.546  67.155  -3.290  1.00 90.87  ? 201  VAL A CB    1 
ATOM   969   C  CG1   . VAL A 1 173  ? 23.980  65.887  -3.999  1.00 47.16  ? 201  VAL A CG1   1 
ATOM   970   C  CG2   . VAL A 1 173  ? 22.037  67.308  -3.347  1.00 41.36  ? 201  VAL A CG2   1 
ATOM   971   N  N     . CYS A 1 174  ? 22.353  66.948  -0.099  1.00 93.97  ? 202  CYS A N     1 
ATOM   972   C  CA    . CYS A 1 174  ? 21.385  66.245  0.730   1.00 45.50  ? 202  CYS A CA    1 
ATOM   973   C  C     . CYS A 1 174  ? 20.216  65.779  -0.126  1.00 42.74  ? 202  CYS A C     1 
ATOM   974   O  O     . CYS A 1 174  ? 19.405  66.585  -0.581  1.00 56.15  ? 202  CYS A O     1 
ATOM   975   C  CB    . CYS A 1 174  ? 20.894  67.136  1.871   1.00 44.37  ? 202  CYS A CB    1 
ATOM   976   S  SG    . CYS A 1 174  ? 19.771  66.315  3.028   1.00 49.53  ? 202  CYS A SG    1 
ATOM   977   N  N     . LEU A 1 175  ? 20.141  64.471  -0.342  1.00 93.97  ? 203  LEU A N     1 
ATOM   978   C  CA    . LEU A 1 175  ? 19.131  63.886  -1.214  1.00 93.77  ? 203  LEU A CA    1 
ATOM   979   C  C     . LEU A 1 175  ? 17.734  63.998  -0.610  1.00 44.60  ? 203  LEU A C     1 
ATOM   980   O  O     . LEU A 1 175  ? 16.737  63.997  -1.332  1.00 41.85  ? 203  LEU A O     1 
ATOM   981   C  CB    . LEU A 1 175  ? 19.468  62.421  -1.499  1.00 92.93  ? 203  LEU A CB    1 
ATOM   982   C  CG    . LEU A 1 175  ? 18.639  61.707  -2.565  1.00 92.61  ? 203  LEU A CG    1 
ATOM   983   C  CD1   . LEU A 1 175  ? 18.743  62.429  -3.899  1.00 91.58  ? 203  LEU A CD1   1 
ATOM   984   C  CD2   . LEU A 1 175  ? 19.081  60.260  -2.699  1.00 43.08  ? 203  LEU A CD2   1 
ATOM   985   N  N     . ALA A 1 176  ? 17.677  64.103  0.715   1.00 47.66  ? 204  ALA A N     1 
ATOM   986   C  CA    . ALA A 1 176  ? 16.413  64.174  1.445   1.00 44.86  ? 204  ALA A CA    1 
ATOM   987   C  C     . ALA A 1 176  ? 15.531  65.316  0.952   1.00 45.03  ? 204  ALA A C     1 
ATOM   988   O  O     . ALA A 1 176  ? 14.307  65.193  0.909   1.00 64.37  ? 204  ALA A O     1 
ATOM   989   C  CB    . ALA A 1 176  ? 16.677  64.320  2.936   1.00 47.38  ? 204  ALA A CB    1 
ATOM   990   N  N     . GLU A 1 177  ? 16.159  66.425  0.582   1.00 56.54  ? 205  GLU A N     1 
ATOM   991   C  CA    . GLU A 1 177  ? 15.438  67.555  0.011   1.00 65.78  ? 205  GLU A CA    1 
ATOM   992   C  C     . GLU A 1 177  ? 16.244  68.179  -1.121  1.00 64.76  ? 205  GLU A C     1 
ATOM   993   O  O     . GLU A 1 177  ? 16.369  69.400  -1.214  1.00 75.22  ? 205  GLU A O     1 
ATOM   994   C  CB    . GLU A 1 177  ? 15.120  68.596  1.088   1.00 77.05  ? 205  GLU A CB    1 
ATOM   995   C  CG    . GLU A 1 177  ? 16.297  68.979  1.969   1.00 71.24  ? 205  GLU A CG    1 
ATOM   996   C  CD    . GLU A 1 177  ? 15.919  70.004  3.021   1.00 73.27  ? 205  GLU A CD    1 
ATOM   997   O  OE1   . GLU A 1 177  ? 16.774  70.331  3.871   1.00 69.54  ? 205  GLU A OE1   1 
ATOM   998   O  OE2   . GLU A 1 177  ? 14.766  70.482  2.998   1.00 76.71  ? 205  GLU A OE2   1 
ATOM   999   N  N     . GLY A 1 178  ? 16.783  67.326  -1.986  1.00 55.48  ? 206  GLY A N     1 
ATOM   1000  C  CA    . GLY A 1 178  ? 17.591  67.773  -3.105  1.00 67.26  ? 206  GLY A CA    1 
ATOM   1001  C  C     . GLY A 1 178  ? 16.776  68.441  -4.196  1.00 73.18  ? 206  GLY A C     1 
ATOM   1002  O  O     . GLY A 1 178  ? 15.584  68.698  -4.023  1.00 69.29  ? 206  GLY A O     1 
ATOM   1003  N  N     . THR A 1 179  ? 17.418  68.722  -5.326  1.00 67.90  ? 207  THR A N     1 
ATOM   1004  C  CA    . THR A 1 179  ? 18.825  68.392  -5.522  1.00 69.29  ? 207  THR A CA    1 
ATOM   1005  C  C     . THR A 1 179  ? 19.711  69.627  -5.397  1.00 48.03  ? 207  THR A C     1 
ATOM   1006  O  O     . THR A 1 179  ? 20.384  70.021  -6.351  1.00 44.19  ? 207  THR A O     1 
ATOM   1007  C  CB    . THR A 1 179  ? 19.063  67.750  -6.895  1.00 56.59  ? 207  THR A CB    1 
ATOM   1008  O  OG1   . THR A 1 179  ? 18.717  68.686  -7.922  1.00 46.32  ? 207  THR A OG1   1 
ATOM   1009  C  CG2   . THR A 1 179  ? 18.217  66.495  -7.049  1.00 70.03  ? 207  THR A CG2   1 
ATOM   1010  N  N     . CYS A 1 180  ? 19.709  70.233  -4.215  1.00 46.77  ? 208  CYS A N     1 
ATOM   1011  C  CA    . CYS A 1 180  ? 20.509  71.424  -3.968  1.00 41.34  ? 208  CYS A CA    1 
ATOM   1012  C  C     . CYS A 1 180  ? 21.759  71.082  -3.166  1.00 48.28  ? 208  CYS A C     1 
ATOM   1013  O  O     . CYS A 1 180  ? 21.670  70.410  -2.139  1.00 48.99  ? 208  CYS A O     1 
ATOM   1014  C  CB    . CYS A 1 180  ? 19.682  72.479  -3.232  1.00 46.71  ? 208  CYS A CB    1 
ATOM   1015  S  SG    . CYS A 1 180  ? 20.557  74.022  -2.897  1.00 42.84  ? 208  CYS A SG    1 
ATOM   1016  N  N     . PRO A 1 181  ? 22.929  71.547  -3.638  1.00 41.83  ? 209  PRO A N     1 
ATOM   1017  C  CA    . PRO A 1 181  ? 24.221  71.323  -2.980  1.00 40.20  ? 209  PRO A CA    1 
ATOM   1018  C  C     . PRO A 1 181  ? 24.189  71.679  -1.498  1.00 41.71  ? 209  PRO A C     1 
ATOM   1019  O  O     . PRO A 1 181  ? 23.440  72.570  -1.102  1.00 67.91  ? 209  PRO A O     1 
ATOM   1020  C  CB    . PRO A 1 181  ? 25.164  72.257  -3.739  1.00 40.37  ? 209  PRO A CB    1 
ATOM   1021  C  CG    . PRO A 1 181  ? 24.561  72.375  -5.086  1.00 93.78  ? 209  PRO A CG    1 
ATOM   1022  C  CD    . PRO A 1 181  ? 23.074  72.339  -4.872  1.00 69.90  ? 209  PRO A CD    1 
ATOM   1023  N  N     . THR A 1 182  ? 24.987  70.986  -0.693  1.00 41.49  ? 210  THR A N     1 
ATOM   1024  C  CA    . THR A 1 182  ? 25.032  71.245  0.740   1.00 43.03  ? 210  THR A CA    1 
ATOM   1025  C  C     . THR A 1 182  ? 26.470  71.376  1.237   1.00 43.39  ? 210  THR A C     1 
ATOM   1026  O  O     . THR A 1 182  ? 26.753  72.162  2.140   1.00 45.06  ? 210  THR A O     1 
ATOM   1027  C  CB    . THR A 1 182  ? 24.313  70.139  1.532   1.00 43.01  ? 210  THR A CB    1 
ATOM   1028  O  OG1   . THR A 1 182  ? 24.772  68.856  1.090   1.00 43.93  ? 210  THR A OG1   1 
ATOM   1029  C  CG2   . THR A 1 182  ? 22.814  70.227  1.316   1.00 43.41  ? 210  THR A CG2   1 
ATOM   1030  N  N     . LEU A 1 183  ? 27.373  70.604  0.640   1.00 56.94  ? 211  LEU A N     1 
ATOM   1031  C  CA    . LEU A 1 183  ? 28.788  70.651  0.993   1.00 42.40  ? 211  LEU A CA    1 
ATOM   1032  C  C     . LEU A 1 183  ? 29.661  70.526  -0.246  1.00 41.20  ? 211  LEU A C     1 
ATOM   1033  O  O     . LEU A 1 183  ? 29.192  70.114  -1.307  1.00 46.15  ? 211  LEU A O     1 
ATOM   1034  C  CB    . LEU A 1 183  ? 29.143  69.539  1.984   1.00 42.45  ? 211  LEU A CB    1 
ATOM   1035  C  CG    . LEU A 1 183  ? 28.579  69.627  3.401   1.00 44.02  ? 211  LEU A CG    1 
ATOM   1036  C  CD1   . LEU A 1 183  ? 29.010  68.422  4.217   1.00 44.06  ? 211  LEU A CD1   1 
ATOM   1037  C  CD2   . LEU A 1 183  ? 29.022  70.913  4.070   1.00 67.44  ? 211  LEU A CD2   1 
ATOM   1038  N  N     . ALA A 1 184  ? 30.934  70.878  -0.099  1.00 41.92  ? 212  ALA A N     1 
ATOM   1039  C  CA    . ALA A 1 184  ? 31.911  70.715  -1.168  1.00 41.08  ? 212  ALA A CA    1 
ATOM   1040  C  C     . ALA A 1 184  ? 33.330  70.856  -0.629  1.00 45.86  ? 212  ALA A C     1 
ATOM   1041  O  O     . ALA A 1 184  ? 33.577  71.611  0.310   1.00 44.00  ? 212  ALA A O     1 
ATOM   1042  C  CB    . ALA A 1 184  ? 31.664  71.724  -2.279  1.00 41.13  ? 212  ALA A CB    1 
ATOM   1043  N  N     . VAL A 1 185  ? 34.257  70.110  -1.220  1.00 43.23  ? 213  VAL A N     1 
ATOM   1044  C  CA    . VAL A 1 185  ? 35.672  70.234  -0.891  1.00 42.63  ? 213  VAL A CA    1 
ATOM   1045  C  C     . VAL A 1 185  ? 36.477  70.285  -2.183  1.00 42.10  ? 213  VAL A C     1 
ATOM   1046  O  O     . VAL A 1 185  ? 36.197  69.547  -3.127  1.00 44.07  ? 213  VAL A O     1 
ATOM   1047  C  CB    . VAL A 1 185  ? 36.168  69.067  -0.006  1.00 42.67  ? 213  VAL A CB    1 
ATOM   1048  C  CG1   . VAL A 1 185  ? 37.660  69.190  0.262   1.00 44.12  ? 213  VAL A CG1   1 
ATOM   1049  C  CG2   . VAL A 1 185  ? 35.404  69.027  1.305   1.00 47.69  ? 213  VAL A CG2   1 
ATOM   1050  N  N     . ALA A 1 186  ? 37.464  71.170  -2.233  1.00 43.72  ? 214  ALA A N     1 
ATOM   1051  C  CA    . ALA A 1 186  ? 38.301  71.297  -3.417  1.00 44.82  ? 214  ALA A CA    1 
ATOM   1052  C  C     . ALA A 1 186  ? 39.730  71.643  -3.033  1.00 46.78  ? 214  ALA A C     1 
ATOM   1053  O  O     . ALA A 1 186  ? 39.975  72.656  -2.380  1.00 73.05  ? 214  ALA A O     1 
ATOM   1054  C  CB    . ALA A 1 186  ? 37.733  72.349  -4.358  1.00 49.05  ? 214  ALA A CB    1 
ATOM   1055  N  N     . ILE A 1 187  ? 40.675  70.798  -3.430  1.00 45.29  ? 215  ILE A N     1 
ATOM   1056  C  CA    . ILE A 1 187  ? 42.077  71.079  -3.158  1.00 56.34  ? 215  ILE A CA    1 
ATOM   1057  C  C     . ILE A 1 187  ? 42.729  71.692  -4.387  1.00 46.80  ? 215  ILE A C     1 
ATOM   1058  O  O     . ILE A 1 187  ? 42.299  71.462  -5.518  1.00 46.41  ? 215  ILE A O     1 
ATOM   1059  C  CB    . ILE A 1 187  ? 42.855  69.815  -2.730  1.00 49.60  ? 215  ILE A CB    1 
ATOM   1060  C  CG1   . ILE A 1 187  ? 43.296  68.998  -3.944  1.00 46.00  ? 215  ILE A CG1   1 
ATOM   1061  C  CG2   . ILE A 1 187  ? 42.021  68.976  -1.786  1.00 46.21  ? 215  ILE A CG2   1 
ATOM   1062  C  CD1   . ILE A 1 187  ? 44.025  67.728  -3.581  1.00 40.72  ? 215  ILE A CD1   1 
ATOM   1063  N  N     . SER A 1 188  ? 43.764  72.487  -4.151  1.00 66.14  ? 216  SER A N     1 
ATOM   1064  C  CA    . SER A 1 188  ? 44.465  73.173  -5.221  1.00 71.04  ? 216  SER A CA    1 
ATOM   1065  C  C     . SER A 1 188  ? 45.966  72.957  -5.069  1.00 70.48  ? 216  SER A C     1 
ATOM   1066  O  O     . SER A 1 188  ? 46.427  72.565  -3.996  1.00 70.53  ? 216  SER A O     1 
ATOM   1067  C  CB    . SER A 1 188  ? 44.124  74.665  -5.206  1.00 70.37  ? 216  SER A CB    1 
ATOM   1068  O  OG    . SER A 1 188  ? 44.508  75.266  -3.982  1.00 71.31  ? 216  SER A OG    1 
ATOM   1069  N  N     . PRO A 1 189  ? 46.736  73.202  -6.142  1.00 69.63  ? 217  PRO A N     1 
ATOM   1070  C  CA    . PRO A 1 189  ? 48.198  73.100  -6.049  1.00 76.96  ? 217  PRO A CA    1 
ATOM   1071  C  C     . PRO A 1 189  ? 48.803  74.028  -4.993  1.00 76.68  ? 217  PRO A C     1 
ATOM   1072  O  O     . PRO A 1 189  ? 49.975  73.880  -4.649  1.00 77.21  ? 217  PRO A O     1 
ATOM   1073  C  CB    . PRO A 1 189  ? 48.662  73.499  -7.451  1.00 70.20  ? 217  PRO A CB    1 
ATOM   1074  C  CG    . PRO A 1 189  ? 47.525  73.133  -8.335  1.00 56.93  ? 217  PRO A CG    1 
ATOM   1075  C  CD    . PRO A 1 189  ? 46.288  73.408  -7.531  1.00 60.45  ? 217  PRO A CD    1 
ATOM   1076  N  N     . SER A 1 190  ? 48.006  74.965  -4.487  1.00 75.31  ? 218  SER A N     1 
ATOM   1077  C  CA    . SER A 1 190  ? 48.467  75.911  -3.479  1.00 56.05  ? 218  SER A CA    1 
ATOM   1078  C  C     . SER A 1 190  ? 47.969  75.548  -2.081  1.00 66.38  ? 218  SER A C     1 
ATOM   1079  O  O     . SER A 1 190  ? 48.762  75.407  -1.152  1.00 64.62  ? 218  SER A O     1 
ATOM   1080  C  CB    . SER A 1 190  ? 48.017  77.329  -3.839  1.00 60.63  ? 218  SER A CB    1 
ATOM   1081  O  OG    . SER A 1 190  ? 48.432  77.679  -5.148  1.00 64.88  ? 218  SER A OG    1 
ATOM   1082  N  N     . ALA A 1 191  ? 46.655  75.397  -1.936  1.00 69.68  ? 219  ALA A N     1 
ATOM   1083  C  CA    . ALA A 1 191  ? 46.061  75.160  -0.623  1.00 71.41  ? 219  ALA A CA    1 
ATOM   1084  C  C     . ALA A 1 191  ? 44.722  74.426  -0.710  1.00 71.14  ? 219  ALA A C     1 
ATOM   1085  O  O     . ALA A 1 191  ? 44.371  73.878  -1.755  1.00 73.67  ? 219  ALA A O     1 
ATOM   1086  C  CB    . ALA A 1 191  ? 45.890  76.477  0.111   1.00 71.12  ? 219  ALA A CB    1 
ATOM   1087  N  N     . TRP A 1 192  ? 43.980  74.420  0.395   1.00 64.21  ? 220  TRP A N     1 
ATOM   1088  C  CA    . TRP A 1 192  ? 42.699  73.715  0.453   1.00 45.92  ? 220  TRP A CA    1 
ATOM   1089  C  C     . TRP A 1 192  ? 41.506  74.667  0.416   1.00 56.47  ? 220  TRP A C     1 
ATOM   1090  O  O     . TRP A 1 192  ? 41.643  75.861  0.675   1.00 73.49  ? 220  TRP A O     1 
ATOM   1091  C  CB    . TRP A 1 192  ? 42.626  72.850  1.714   1.00 55.73  ? 220  TRP A CB    1 
ATOM   1092  C  CG    . TRP A 1 192  ? 43.295  71.517  1.574   1.00 68.81  ? 220  TRP A CG    1 
ATOM   1093  C  CD1   . TRP A 1 192  ? 44.633  71.278  1.466   1.00 74.04  ? 220  TRP A CD1   1 
ATOM   1094  C  CD2   . TRP A 1 192  ? 42.654  70.236  1.539   1.00 68.28  ? 220  TRP A CD2   1 
ATOM   1095  N  NE1   . TRP A 1 192  ? 44.866  69.928  1.359   1.00 70.90  ? 220  TRP A NE1   1 
ATOM   1096  C  CE2   . TRP A 1 192  ? 43.667  69.266  1.402   1.00 41.55  ? 220  TRP A CE2   1 
ATOM   1097  C  CE3   . TRP A 1 192  ? 41.322  69.815  1.607   1.00 47.97  ? 220  TRP A CE3   1 
ATOM   1098  C  CZ2   . TRP A 1 192  ? 43.391  67.903  1.332   1.00 49.89  ? 220  TRP A CZ2   1 
ATOM   1099  C  CZ3   . TRP A 1 192  ? 41.050  68.461  1.538   1.00 46.22  ? 220  TRP A CZ3   1 
ATOM   1100  C  CH2   . TRP A 1 192  ? 42.080  67.521  1.402   1.00 60.49  ? 220  TRP A CH2   1 
ATOM   1101  N  N     . TYR A 1 193  ? 40.335  74.125  0.094   1.00 42.02  ? 221  TYR A N     1 
ATOM   1102  C  CA    . TYR A 1 193  ? 39.099  74.901  0.065   1.00 41.82  ? 221  TYR A CA    1 
ATOM   1103  C  C     . TYR A 1 193  ? 37.902  74.051  0.483   1.00 42.18  ? 221  TYR A C     1 
ATOM   1104  O  O     . TYR A 1 193  ? 37.796  72.886  0.094   1.00 40.30  ? 221  TYR A O     1 
ATOM   1105  C  CB    . TYR A 1 193  ? 38.845  75.478  -1.330  1.00 41.19  ? 221  TYR A CB    1 
ATOM   1106  C  CG    . TYR A 1 193  ? 39.841  76.517  -1.789  1.00 56.64  ? 221  TYR A CG    1 
ATOM   1107  C  CD1   . TYR A 1 193  ? 39.713  77.846  -1.406  1.00 55.05  ? 221  TYR A CD1   1 
ATOM   1108  C  CD2   . TYR A 1 193  ? 40.896  76.174  -2.624  1.00 43.33  ? 221  TYR A CD2   1 
ATOM   1109  C  CE1   . TYR A 1 193  ? 40.616  78.801  -1.831  1.00 67.09  ? 221  TYR A CE1   1 
ATOM   1110  C  CE2   . TYR A 1 193  ? 41.803  77.123  -3.055  1.00 45.58  ? 221  TYR A CE2   1 
ATOM   1111  C  CZ    . TYR A 1 193  ? 41.658  78.434  -2.655  1.00 47.95  ? 221  TYR A CZ    1 
ATOM   1112  O  OH    . TYR A 1 193  ? 42.557  79.383  -3.081  1.00 60.47  ? 221  TYR A OH    1 
ATOM   1113  N  N     . SER A 1 194  ? 36.998  74.635  1.265   1.00 40.76  ? 222  SER A N     1 
ATOM   1114  C  CA    . SER A 1 194  ? 35.760  73.944  1.622   1.00 49.30  ? 222  SER A CA    1 
ATOM   1115  C  C     . SER A 1 194  ? 34.548  74.865  1.492   1.00 49.61  ? 222  SER A C     1 
ATOM   1116  O  O     . SER A 1 194  ? 34.457  75.893  2.163   1.00 41.67  ? 222  SER A O     1 
ATOM   1117  C  CB    . SER A 1 194  ? 35.842  73.381  3.043   1.00 40.14  ? 222  SER A CB    1 
ATOM   1118  O  OG    . SER A 1 194  ? 35.738  74.406  4.012   1.00 42.45  ? 222  SER A OG    1 
ATOM   1119  N  N     . TRP A 1 195  ? 33.617  74.484  0.624   1.00 47.76  ? 223  TRP A N     1 
ATOM   1120  C  CA    . TRP A 1 195  ? 32.430  75.288  0.366   1.00 43.07  ? 223  TRP A CA    1 
ATOM   1121  C  C     . TRP A 1 195  ? 31.193  74.758  1.082   1.00 47.57  ? 223  TRP A C     1 
ATOM   1122  O  O     . TRP A 1 195  ? 30.822  73.596  0.923   1.00 45.84  ? 223  TRP A O     1 
ATOM   1123  C  CB    . TRP A 1 195  ? 32.155  75.359  -1.135  1.00 47.76  ? 223  TRP A CB    1 
ATOM   1124  C  CG    . TRP A 1 195  ? 30.920  76.128  -1.475  1.00 47.13  ? 223  TRP A CG    1 
ATOM   1125  C  CD1   . TRP A 1 195  ? 30.750  77.477  -1.394  1.00 49.17  ? 223  TRP A CD1   1 
ATOM   1126  C  CD2   . TRP A 1 195  ? 29.683  75.595  -1.957  1.00 45.70  ? 223  TRP A CD2   1 
ATOM   1127  N  NE1   . TRP A 1 195  ? 29.481  77.818  -1.792  1.00 48.95  ? 223  TRP A NE1   1 
ATOM   1128  C  CE2   . TRP A 1 195  ? 28.806  76.680  -2.143  1.00 46.98  ? 223  TRP A CE2   1 
ATOM   1129  C  CE3   . TRP A 1 195  ? 29.231  74.305  -2.250  1.00 66.30  ? 223  TRP A CE3   1 
ATOM   1130  C  CZ2   . TRP A 1 195  ? 27.504  76.516  -2.607  1.00 46.31  ? 223  TRP A CZ2   1 
ATOM   1131  C  CZ3   . TRP A 1 195  ? 27.939  74.144  -2.710  1.00 41.86  ? 223  TRP A CZ3   1 
ATOM   1132  C  CH2   . TRP A 1 195  ? 27.092  75.243  -2.886  1.00 44.33  ? 223  TRP A CH2   1 
ATOM   1133  N  N     . CYS A 1 196  ? 30.556  75.620  1.868   1.00 44.49  ? 224  CYS A N     1 
ATOM   1134  C  CA    . CYS A 1 196  ? 29.290  75.274  2.502   1.00 49.21  ? 224  CYS A CA    1 
ATOM   1135  C  C     . CYS A 1 196  ? 28.148  76.058  1.870   1.00 49.50  ? 224  CYS A C     1 
ATOM   1136  O  O     . CYS A 1 196  ? 28.291  77.242  1.565   1.00 65.77  ? 224  CYS A O     1 
ATOM   1137  C  CB    . CYS A 1 196  ? 29.336  75.540  4.008   1.00 41.19  ? 224  CYS A CB    1 
ATOM   1138  S  SG    . CYS A 1 196  ? 30.231  74.301  4.964   1.00 49.12  ? 224  CYS A SG    1 
ATOM   1139  N  N     . SER A 1 197  ? 27.017  75.389  1.677   1.00 48.38  ? 225  SER A N     1 
ATOM   1140  C  CA    . SER A 1 197  ? 25.841  76.025  1.101   1.00 44.02  ? 225  SER A CA    1 
ATOM   1141  C  C     . SER A 1 197  ? 25.113  76.873  2.135   1.00 60.29  ? 225  SER A C     1 
ATOM   1142  O  O     . SER A 1 197  ? 25.522  76.944  3.293   1.00 64.98  ? 225  SER A O     1 
ATOM   1143  C  CB    . SER A 1 197  ? 24.894  74.975  0.525   1.00 66.77  ? 225  SER A CB    1 
ATOM   1144  O  OG    . SER A 1 197  ? 25.545  74.198  -0.462  1.00 71.76  ? 225  SER A OG    1 
ATOM   1145  N  N     . GLN A 1 198  ? 24.021  77.501  1.712   1.00 69.16  ? 226  GLN A N     1 
ATOM   1146  C  CA    . GLN A 1 198  ? 23.263  78.399  2.575   1.00 44.17  ? 226  GLN A CA    1 
ATOM   1147  C  C     . GLN A 1 198  ? 22.457  77.630  3.622   1.00 76.83  ? 226  GLN A C     1 
ATOM   1148  O  O     . GLN A 1 198  ? 21.752  78.225  4.438   1.00 46.41  ? 226  GLN A O     1 
ATOM   1149  C  CB    . GLN A 1 198  ? 22.338  79.277  1.731   1.00 45.05  ? 226  GLN A CB    1 
ATOM   1150  C  CG    . GLN A 1 198  ? 21.969  80.607  2.362   1.00 67.14  ? 226  GLN A CG    1 
ATOM   1151  C  CD    . GLN A 1 198  ? 21.160  81.479  1.425   1.00 56.13  ? 226  GLN A CD    1 
ATOM   1152  O  OE1   . GLN A 1 198  ? 20.687  81.017  0.386   1.00 47.49  ? 226  GLN A OE1   1 
ATOM   1153  N  NE2   . GLN A 1 198  ? 21.003  82.748  1.783   1.00 73.86  ? 226  GLN A NE2   1 
ATOM   1154  N  N     . ARG A 1 199  ? 22.569  76.305  3.598   1.00 73.68  ? 227  ARG A N     1 
ATOM   1155  C  CA    . ARG A 1 199  ? 21.883  75.459  4.567   1.00 69.81  ? 227  ARG A CA    1 
ATOM   1156  C  C     . ARG A 1 199  ? 22.663  75.379  5.876   1.00 74.19  ? 227  ARG A C     1 
ATOM   1157  O  O     . ARG A 1 199  ? 23.096  74.304  6.293   1.00 42.90  ? 227  ARG A O     1 
ATOM   1158  C  CB    . ARG A 1 199  ? 21.661  74.054  4.003   1.00 75.71  ? 227  ARG A CB    1 
ATOM   1159  C  CG    . ARG A 1 199  ? 20.606  73.968  2.908   1.00 75.52  ? 227  ARG A CG    1 
ATOM   1160  C  CD    . ARG A 1 199  ? 21.176  74.298  1.536   1.00 75.89  ? 227  ARG A CD    1 
ATOM   1161  N  NE    . ARG A 1 199  ? 20.816  75.641  1.090   1.00 72.93  ? 227  ARG A NE    1 
ATOM   1162  C  CZ    . ARG A 1 199  ? 21.175  76.159  -0.081  1.00 84.66  ? 227  ARG A CZ    1 
ATOM   1163  N  NH1   . ARG A 1 199  ? 20.798  77.387  -0.410  1.00 90.23  ? 227  ARG A NH1   1 
ATOM   1164  N  NH2   . ARG A 1 199  ? 21.908  75.447  -0.926  1.00 87.88  ? 227  ARG A NH2   1 
ATOM   1165  N  N     . LEU A 1 200  ? 22.848  76.531  6.511   1.00 72.75  ? 228  LEU A N     1 
ATOM   1166  C  CA    . LEU A 1 200  ? 23.476  76.604  7.823   1.00 70.89  ? 228  LEU A CA    1 
ATOM   1167  C  C     . LEU A 1 200  ? 22.506  77.214  8.824   1.00 71.07  ? 228  LEU A C     1 
ATOM   1168  O  O     . LEU A 1 200  ? 22.720  77.152  10.034  1.00 69.91  ? 228  LEU A O     1 
ATOM   1169  C  CB    . LEU A 1 200  ? 24.769  77.421  7.768   1.00 56.07  ? 228  LEU A CB    1 
ATOM   1170  C  CG    . LEU A 1 200  ? 26.074  76.651  7.554   1.00 76.86  ? 228  LEU A CG    1 
ATOM   1171  C  CD1   . LEU A 1 200  ? 26.031  75.823  6.282   1.00 73.03  ? 228  LEU A CD1   1 
ATOM   1172  C  CD2   . LEU A 1 200  ? 27.254  77.608  7.529   1.00 77.40  ? 228  LEU A CD2   1 
ATOM   1173  N  N     . VAL A 1 201  ? 21.436  77.806  8.305   1.00 60.62  ? 229  VAL A N     1 
ATOM   1174  C  CA    . VAL A 1 201  ? 20.403  78.397  9.143   1.00 77.46  ? 229  VAL A CA    1 
ATOM   1175  C  C     . VAL A 1 201  ? 19.081  77.662  8.935   1.00 68.20  ? 229  VAL A C     1 
ATOM   1176  O  O     . VAL A 1 201  ? 18.663  77.427  7.801   1.00 69.07  ? 229  VAL A O     1 
ATOM   1177  C  CB    . VAL A 1 201  ? 20.226  79.902  8.843   1.00 77.41  ? 229  VAL A CB    1 
ATOM   1178  C  CG1   . VAL A 1 201  ? 19.183  80.515  9.766   1.00 77.86  ? 229  VAL A CG1   1 
ATOM   1179  C  CG2   . VAL A 1 201  ? 21.556  80.630  8.982   1.00 76.15  ? 229  VAL A CG2   1 
ATOM   1180  N  N     . GLU A 1 202  ? 18.435  77.288  10.035  1.00 90.01  ? 230  GLU A N     1 
ATOM   1181  C  CA    . GLU A 1 202  ? 17.170  76.564  9.972   1.00 86.44  ? 230  GLU A CA    1 
ATOM   1182  C  C     . GLU A 1 202  ? 16.026  77.462  9.514   1.00 81.09  ? 230  GLU A C     1 
ATOM   1183  O  O     . GLU A 1 202  ? 15.542  78.304  10.271  1.00 86.99  ? 230  GLU A O     1 
ATOM   1184  C  CB    . GLU A 1 202  ? 16.834  75.948  11.333  1.00 70.19  ? 230  GLU A CB    1 
ATOM   1185  C  CG    . GLU A 1 202  ? 17.666  74.724  11.692  1.00 69.94  ? 230  GLU A CG    1 
ATOM   1186  C  CD    . GLU A 1 202  ? 17.295  73.498  10.876  1.00 73.02  ? 230  GLU A CD    1 
ATOM   1187  O  OE1   . GLU A 1 202  ? 16.218  73.499  10.243  1.00 69.11  ? 230  GLU A OE1   1 
ATOM   1188  O  OE2   . GLU A 1 202  ? 18.083  72.529  10.868  1.00 75.99  ? 230  GLU A OE2   1 
ATOM   1189  N  N     . GLU A 1 203  ? 15.601  77.275  8.269   1.00 73.99  ? 231  GLU A N     1 
ATOM   1190  C  CA    . GLU A 1 203  ? 14.475  78.021  7.721   1.00 75.89  ? 231  GLU A CA    1 
ATOM   1191  C  C     . GLU A 1 203  ? 13.497  77.085  7.021   1.00 76.71  ? 231  GLU A C     1 
ATOM   1192  O  O     . GLU A 1 203  ? 13.752  75.886  6.897   1.00 76.49  ? 231  GLU A O     1 
ATOM   1193  C  CB    . GLU A 1 203  ? 14.959  79.093  6.741   1.00 77.80  ? 231  GLU A CB    1 
ATOM   1194  C  CG    . GLU A 1 203  ? 15.836  80.169  7.357   1.00 84.06  ? 231  GLU A CG    1 
ATOM   1195  C  CD    . GLU A 1 203  ? 16.217  81.243  6.357   1.00 85.84  ? 231  GLU A CD    1 
ATOM   1196  O  OE1   . GLU A 1 203  ? 15.737  81.177  5.205   1.00 91.73  ? 231  GLU A OE1   1 
ATOM   1197  O  OE2   . GLU A 1 203  ? 16.995  82.150  6.720   1.00 90.09  ? 231  GLU A OE2   1 
ATOM   1198  N  N     . ARG A 1 204  ? 12.376  77.635  6.568   1.00 73.29  ? 232  ARG A N     1 
ATOM   1199  C  CA    . ARG A 1 204  ? 11.434  76.875  5.758   1.00 64.88  ? 232  ARG A CA    1 
ATOM   1200  C  C     . ARG A 1 204  ? 11.637  77.234  4.290   1.00 69.10  ? 232  ARG A C     1 
ATOM   1201  O  O     . ARG A 1 204  ? 10.794  77.888  3.676   1.00 64.76  ? 232  ARG A O     1 
ATOM   1202  C  CB    . ARG A 1 204  ? 9.992   77.149  6.193   1.00 67.66  ? 232  ARG A CB    1 
ATOM   1203  C  CG    . ARG A 1 204  ? 9.764   77.029  7.694   1.00 69.67  ? 232  ARG A CG    1 
ATOM   1204  C  CD    . ARG A 1 204  ? 8.485   76.263  8.023   1.00 55.06  ? 232  ARG A CD    1 
ATOM   1205  N  NE    . ARG A 1 204  ? 7.308   76.801  7.347   1.00 56.69  ? 232  ARG A NE    1 
ATOM   1206  C  CZ    . ARG A 1 204  ? 6.711   76.221  6.310   1.00 55.74  ? 232  ARG A CZ    1 
ATOM   1207  N  NH1   . ARG A 1 204  ? 7.182   75.079  5.828   1.00 72.86  ? 232  ARG A NH1   1 
ATOM   1208  N  NH2   . ARG A 1 204  ? 5.645   76.779  5.755   1.00 56.58  ? 232  ARG A NH2   1 
ATOM   1209  N  N     . TYR A 1 205  ? 12.769  76.800  3.741   1.00 73.45  ? 233  TYR A N     1 
ATOM   1210  C  CA    . TYR A 1 205  ? 13.187  77.166  2.389   1.00 68.43  ? 233  TYR A CA    1 
ATOM   1211  C  C     . TYR A 1 205  ? 12.197  76.767  1.303   1.00 71.54  ? 233  TYR A C     1 
ATOM   1212  O  O     . TYR A 1 205  ? 11.416  75.830  1.464   1.00 68.99  ? 233  TYR A O     1 
ATOM   1213  C  CB    . TYR A 1 205  ? 14.551  76.544  2.071   1.00 69.18  ? 233  TYR A CB    1 
ATOM   1214  C  CG    . TYR A 1 205  ? 15.723  77.423  2.433   1.00 65.38  ? 233  TYR A CG    1 
ATOM   1215  C  CD1   . TYR A 1 205  ? 16.154  78.423  1.571   1.00 64.21  ? 233  TYR A CD1   1 
ATOM   1216  C  CD2   . TYR A 1 205  ? 16.397  77.258  3.635   1.00 47.66  ? 233  TYR A CD2   1 
ATOM   1217  C  CE1   . TYR A 1 205  ? 17.222  79.235  1.895   1.00 48.12  ? 233  TYR A CE1   1 
ATOM   1218  C  CE2   . TYR A 1 205  ? 17.466  78.065  3.968   1.00 48.25  ? 233  TYR A CE2   1 
ATOM   1219  C  CZ    . TYR A 1 205  ? 17.874  79.052  3.095   1.00 48.50  ? 233  TYR A CZ    1 
ATOM   1220  O  OH    . TYR A 1 205  ? 18.939  79.859  3.420   1.00 56.72  ? 233  TYR A OH    1 
ATOM   1221  N  N     . SER A 1 206  ? 12.245  77.497  0.194   1.00 68.05  ? 234  SER A N     1 
ATOM   1222  C  CA    . SER A 1 206  ? 11.455  77.175  -0.984  1.00 76.61  ? 234  SER A CA    1 
ATOM   1223  C  C     . SER A 1 206  ? 12.391  76.938  -2.162  1.00 77.44  ? 234  SER A C     1 
ATOM   1224  O  O     . SER A 1 206  ? 13.078  77.856  -2.614  1.00 46.53  ? 234  SER A O     1 
ATOM   1225  C  CB    . SER A 1 206  ? 10.464  78.294  -1.300  1.00 93.52  ? 234  SER A CB    1 
ATOM   1226  O  OG    . SER A 1 206  ? 11.142  79.516  -1.534  1.00 84.99  ? 234  SER A OG    1 
ATOM   1227  N  N     . TRP A 1 207  ? 12.421  75.704  -2.652  1.00 76.07  ? 235  TRP A N     1 
ATOM   1228  C  CA    . TRP A 1 207  ? 13.369  75.326  -3.692  1.00 69.90  ? 235  TRP A CA    1 
ATOM   1229  C  C     . TRP A 1 207  ? 12.751  75.366  -5.085  1.00 77.24  ? 235  TRP A C     1 
ATOM   1230  O  O     . TRP A 1 207  ? 11.976  74.487  -5.461  1.00 67.89  ? 235  TRP A O     1 
ATOM   1231  C  CB    . TRP A 1 207  ? 13.941  73.932  -3.411  1.00 90.71  ? 235  TRP A CB    1 
ATOM   1232  C  CG    . TRP A 1 207  ? 14.648  73.830  -2.086  1.00 87.19  ? 235  TRP A CG    1 
ATOM   1233  C  CD1   . TRP A 1 207  ? 14.339  72.993  -1.052  1.00 86.87  ? 235  TRP A CD1   1 
ATOM   1234  C  CD2   . TRP A 1 207  ? 15.774  74.605  -1.650  1.00 84.29  ? 235  TRP A CD2   1 
ATOM   1235  N  NE1   . TRP A 1 207  ? 15.206  73.193  -0.004  1.00 93.25  ? 235  TRP A NE1   1 
ATOM   1236  C  CE2   . TRP A 1 207  ? 16.096  74.178  -0.346  1.00 91.66  ? 235  TRP A CE2   1 
ATOM   1237  C  CE3   . TRP A 1 207  ? 16.542  75.616  -2.238  1.00 69.37  ? 235  TRP A CE3   1 
ATOM   1238  C  CZ2   . TRP A 1 207  ? 17.152  74.728  0.379   1.00 72.70  ? 235  TRP A CZ2   1 
ATOM   1239  C  CZ3   . TRP A 1 207  ? 17.589  76.160  -1.516  1.00 45.57  ? 235  TRP A CZ3   1 
ATOM   1240  C  CH2   . TRP A 1 207  ? 17.884  75.715  -0.222  1.00 56.38  ? 235  TRP A CH2   1 
ATOM   1241  N  N     . THR A 1 208  ? 13.101  76.400  -5.842  1.00 68.31  ? 236  THR A N     1 
ATOM   1242  C  CA    . THR A 1 208  ? 12.714  76.498  -7.241  1.00 69.46  ? 236  THR A CA    1 
ATOM   1243  C  C     . THR A 1 208  ? 13.984  76.476  -8.088  1.00 87.43  ? 236  THR A C     1 
ATOM   1244  O  O     . THR A 1 208  ? 13.994  76.925  -9.235  1.00 86.24  ? 236  THR A O     1 
ATOM   1245  C  CB    . THR A 1 208  ? 11.898  77.776  -7.525  1.00 84.42  ? 236  THR A CB    1 
ATOM   1246  O  OG1   . THR A 1 208  ? 11.123  78.118  -6.369  1.00 86.18  ? 236  THR A OG1   1 
ATOM   1247  C  CG2   . THR A 1 208  ? 10.966  77.569  -8.713  1.00 92.25  ? 236  THR A CG2   1 
ATOM   1248  N  N     . SER A 1 209  ? 15.051  75.945  -7.495  1.00 91.40  ? 237  SER A N     1 
ATOM   1249  C  CA    . SER A 1 209  ? 16.364  75.833  -8.132  1.00 68.20  ? 237  SER A CA    1 
ATOM   1250  C  C     . SER A 1 209  ? 16.866  77.172  -8.663  1.00 76.07  ? 237  SER A C     1 
ATOM   1251  O  O     . SER A 1 209  ? 16.938  77.389  -9.873  1.00 48.56  ? 237  SER A O     1 
ATOM   1252  C  CB    . SER A 1 209  ? 16.332  74.799  -9.261  1.00 90.70  ? 237  SER A CB    1 
ATOM   1253  O  OG    . SER A 1 209  ? 15.542  75.243  -10.350 1.00 87.55  ? 237  SER A OG    1 
ATOM   1254  N  N     . GLN A 1 210  ? 17.212  78.067  -7.744  1.00 73.59  ? 238  GLN A N     1 
ATOM   1255  C  CA    . GLN A 1 210  ? 17.785  79.359  -8.096  1.00 69.43  ? 238  GLN A CA    1 
ATOM   1256  C  C     . GLN A 1 210  ? 19.268  79.204  -8.406  1.00 75.44  ? 238  GLN A C     1 
ATOM   1257  O  O     . GLN A 1 210  ? 19.757  78.091  -8.597  1.00 45.90  ? 238  GLN A O     1 
ATOM   1258  C  CB    . GLN A 1 210  ? 17.580  80.363  -6.960  1.00 87.80  ? 238  GLN A CB    1 
ATOM   1259  C  CG    . GLN A 1 210  ? 18.136  79.897  -5.621  1.00 86.98  ? 238  GLN A CG    1 
ATOM   1260  C  CD    . GLN A 1 210  ? 17.828  80.858  -4.490  1.00 77.38  ? 238  GLN A CD    1 
ATOM   1261  O  OE1   . GLN A 1 210  ? 17.234  81.915  -4.701  1.00 70.20  ? 238  GLN A OE1   1 
ATOM   1262  N  NE2   . GLN A 1 210  ? 18.232  80.494  -3.278  1.00 73.63  ? 238  GLN A NE2   1 
ATOM   1263  N  N     . LEU A 1 211  ? 19.989  80.318  -8.451  1.00 72.26  ? 239  LEU A N     1 
ATOM   1264  C  CA    . LEU A 1 211  ? 21.436  80.255  -8.608  1.00 68.08  ? 239  LEU A CA    1 
ATOM   1265  C  C     . LEU A 1 211  ? 22.082  80.024  -7.247  1.00 48.16  ? 239  LEU A C     1 
ATOM   1266  O  O     . LEU A 1 211  ? 22.822  80.866  -6.736  1.00 41.81  ? 239  LEU A O     1 
ATOM   1267  C  CB    . LEU A 1 211  ? 21.975  81.523  -9.267  1.00 67.03  ? 239  LEU A CB    1 
ATOM   1268  C  CG    . LEU A 1 211  ? 22.040  81.445  -10.795 1.00 68.38  ? 239  LEU A CG    1 
ATOM   1269  C  CD1   . LEU A 1 211  ? 22.844  80.230  -11.221 1.00 49.30  ? 239  LEU A CD1   1 
ATOM   1270  C  CD2   . LEU A 1 211  ? 20.653  81.401  -11.411 1.00 56.88  ? 239  LEU A CD2   1 
ATOM   1271  N  N     . SER A 1 212  ? 21.769  78.867  -6.672  1.00 44.41  ? 240  SER A N     1 
ATOM   1272  C  CA    . SER A 1 212  ? 22.301  78.437  -5.383  1.00 49.61  ? 240  SER A CA    1 
ATOM   1273  C  C     . SER A 1 212  ? 23.485  77.451  -5.475  1.00 64.10  ? 240  SER A C     1 
ATOM   1274  O  O     . SER A 1 212  ? 24.299  77.401  -4.551  1.00 46.73  ? 240  SER A O     1 
ATOM   1275  C  CB    . SER A 1 212  ? 21.181  77.817  -4.543  1.00 60.73  ? 240  SER A CB    1 
ATOM   1276  O  OG    . SER A 1 212  ? 21.658  77.440  -3.265  1.00 70.30  ? 240  SER A OG    1 
ATOM   1277  N  N     . PRO A 1 213  ? 23.572  76.645  -6.560  1.00 55.88  ? 241  PRO A N     1 
ATOM   1278  C  CA    . PRO A 1 213  ? 24.801  75.875  -6.785  1.00 55.51  ? 241  PRO A CA    1 
ATOM   1279  C  C     . PRO A 1 213  ? 26.105  76.662  -6.620  1.00 60.47  ? 241  PRO A C     1 
ATOM   1280  O  O     . PRO A 1 213  ? 26.117  77.890  -6.708  1.00 46.03  ? 241  PRO A O     1 
ATOM   1281  C  CB    . PRO A 1 213  ? 24.636  75.408  -8.228  1.00 41.63  ? 241  PRO A CB    1 
ATOM   1282  C  CG    . PRO A 1 213  ? 23.179  75.139  -8.332  1.00 42.00  ? 241  PRO A CG    1 
ATOM   1283  C  CD    . PRO A 1 213  ? 22.485  76.138  -7.423  1.00 47.14  ? 241  PRO A CD    1 
ATOM   1284  N  N     . ALA A 1 214  ? 27.192  75.932  -6.387  1.00 69.25  ? 242  ALA A N     1 
ATOM   1285  C  CA    . ALA A 1 214  ? 28.483  76.517  -6.037  1.00 66.65  ? 242  ALA A CA    1 
ATOM   1286  C  C     . ALA A 1 214  ? 29.043  77.439  -7.115  1.00 68.63  ? 242  ALA A C     1 
ATOM   1287  O  O     . ALA A 1 214  ? 28.977  77.137  -8.306  1.00 65.18  ? 242  ALA A O     1 
ATOM   1288  C  CB    . ALA A 1 214  ? 29.486  75.410  -5.727  1.00 42.91  ? 242  ALA A CB    1 
ATOM   1289  N  N     . ASP A 1 215  ? 29.593  78.567  -6.678  1.00 47.33  ? 243  ASP A N     1 
ATOM   1290  C  CA    . ASP A 1 215  ? 30.283  79.496  -7.564  1.00 48.70  ? 243  ASP A CA    1 
ATOM   1291  C  C     . ASP A 1 215  ? 31.750  79.107  -7.687  1.00 56.00  ? 243  ASP A C     1 
ATOM   1292  O  O     . ASP A 1 215  ? 32.425  78.892  -6.680  1.00 55.90  ? 243  ASP A O     1 
ATOM   1293  C  CB    . ASP A 1 215  ? 30.154  80.924  -7.043  1.00 56.42  ? 243  ASP A CB    1 
ATOM   1294  C  CG    . ASP A 1 215  ? 30.430  81.024  -5.558  1.00 76.94  ? 243  ASP A CG    1 
ATOM   1295  O  OD1   . ASP A 1 215  ? 30.236  80.013  -4.849  1.00 40.95  ? 243  ASP A OD1   1 
ATOM   1296  O  OD2   . ASP A 1 215  ? 30.839  82.111  -5.099  1.00 74.12  ? 243  ASP A OD2   1 
ATOM   1297  N  N     . LEU A 1 216  ? 32.246  79.019  -8.916  1.00 49.73  ? 244  LEU A N     1 
ATOM   1298  C  CA    . LEU A 1 216  ? 33.597  78.521  -9.139  1.00 55.83  ? 244  LEU A CA    1 
ATOM   1299  C  C     . LEU A 1 216  ? 34.378  79.359  -10.149 1.00 64.99  ? 244  LEU A C     1 
ATOM   1300  O  O     . LEU A 1 216  ? 35.604  79.448  -10.076 1.00 40.26  ? 244  LEU A O     1 
ATOM   1301  C  CB    . LEU A 1 216  ? 33.545  77.065  -9.606  1.00 45.04  ? 244  LEU A CB    1 
ATOM   1302  C  CG    . LEU A 1 216  ? 34.759  76.197  -9.274  1.00 44.44  ? 244  LEU A CG    1 
ATOM   1303  C  CD1   . LEU A 1 216  ? 34.838  75.943  -7.777  1.00 44.69  ? 244  LEU A CD1   1 
ATOM   1304  C  CD2   . LEU A 1 216  ? 34.712  74.889  -10.040 1.00 42.18  ? 244  LEU A CD2   1 
ATOM   1305  N  N     . ILE A 1 217  ? 33.666  79.969  -11.090 1.00 48.42  ? 245  ILE A N     1 
ATOM   1306  C  CA    . ILE A 1 217  ? 34.309  80.731  -12.154 1.00 66.17  ? 245  ILE A CA    1 
ATOM   1307  C  C     . ILE A 1 217  ? 34.645  82.147  -11.685 1.00 72.11  ? 245  ILE A C     1 
ATOM   1308  O  O     . ILE A 1 217  ? 33.921  82.724  -10.871 1.00 69.95  ? 245  ILE A O     1 
ATOM   1309  C  CB    . ILE A 1 217  ? 33.416  80.778  -13.425 1.00 70.95  ? 245  ILE A CB    1 
ATOM   1310  C  CG1   . ILE A 1 217  ? 34.151  80.163  -14.617 1.00 72.98  ? 245  ILE A CG1   1 
ATOM   1311  C  CG2   . ILE A 1 217  ? 32.962  82.198  -13.749 1.00 70.32  ? 245  ILE A CG2   1 
ATOM   1312  C  CD1   . ILE A 1 217  ? 33.363  80.210  -15.904 1.00 74.75  ? 245  ILE A CD1   1 
ATOM   1313  N  N     . PRO A 1 218  ? 35.771  82.696  -12.171 1.00 72.87  ? 246  PRO A N     1 
ATOM   1314  C  CA    . PRO A 1 218  ? 36.163  84.077  -11.882 1.00 77.31  ? 246  PRO A CA    1 
ATOM   1315  C  C     . PRO A 1 218  ? 35.612  85.058  -12.914 1.00 73.81  ? 246  PRO A C     1 
ATOM   1316  O  O     . PRO A 1 218  ? 35.381  84.675  -14.061 1.00 84.27  ? 246  PRO A O     1 
ATOM   1317  C  CB    . PRO A 1 218  ? 37.687  84.017  -11.948 1.00 77.05  ? 246  PRO A CB    1 
ATOM   1318  C  CG    . PRO A 1 218  ? 37.951  82.988  -12.994 1.00 73.70  ? 246  PRO A CG    1 
ATOM   1319  C  CD    . PRO A 1 218  ? 36.835  81.968  -12.884 1.00 77.53  ? 246  PRO A CD    1 
ATOM   1320  N  N     . LEU A 1 219  ? 35.408  86.306  -12.511 1.00 72.10  ? 247  LEU A N     1 
ATOM   1321  C  CA    . LEU A 1 219  ? 34.899  87.322  -13.426 1.00 87.70  ? 247  LEU A CA    1 
ATOM   1322  C  C     . LEU A 1 219  ? 36.039  88.003  -14.178 1.00 73.44  ? 247  LEU A C     1 
ATOM   1323  O  O     . LEU A 1 219  ? 37.161  88.091  -13.678 1.00 92.30  ? 247  LEU A O     1 
ATOM   1324  C  CB    . LEU A 1 219  ? 34.049  88.365  -12.680 1.00 93.90  ? 247  LEU A CB    1 
ATOM   1325  C  CG    . LEU A 1 219  ? 34.312  88.824  -11.235 1.00 68.92  ? 247  LEU A CG    1 
ATOM   1326  C  CD1   . LEU A 1 219  ? 33.850  87.788  -10.208 1.00 75.44  ? 247  LEU A CD1   1 
ATOM   1327  C  CD2   . LEU A 1 219  ? 35.768  89.216  -10.995 1.00 70.74  ? 247  LEU A CD2   1 
ATOM   1328  N  N     . GLU A 1 220  ? 35.748  88.472  -15.387 1.00 71.26  ? 248  GLU A N     1 
ATOM   1329  C  CA    . GLU A 1 220  ? 36.739  89.176  -16.194 1.00 71.66  ? 248  GLU A CA    1 
ATOM   1330  C  C     . GLU A 1 220  ? 36.774  90.657  -15.834 1.00 69.81  ? 248  GLU A C     1 
ATOM   1331  O  O     . GLU A 1 220  ? 37.828  91.202  -15.505 1.00 76.98  ? 248  GLU A O     1 
ATOM   1332  C  CB    . GLU A 1 220  ? 36.444  89.001  -17.685 1.00 70.98  ? 248  GLU A CB    1 
ATOM   1333  C  CG    . GLU A 1 220  ? 37.387  89.771  -18.600 1.00 77.48  ? 248  GLU A CG    1 
ATOM   1334  C  CD    . GLU A 1 220  ? 38.820  89.280  -18.515 1.00 68.37  ? 248  GLU A CD    1 
ATOM   1335  O  OE1   . GLU A 1 220  ? 39.025  88.087  -18.207 1.00 84.65  ? 248  GLU A OE1   1 
ATOM   1336  O  OE2   . GLU A 1 220  ? 39.742  90.088  -18.754 1.00 76.99  ? 248  GLU A OE2   1 
ATOM   1337  N  N     . VAL A 1 221  ? 35.614  91.303  -15.899 1.00 92.06  ? 249  VAL A N     1 
ATOM   1338  C  CA    . VAL A 1 221  ? 35.500  92.713  -15.546 1.00 90.43  ? 249  VAL A CA    1 
ATOM   1339  C  C     . VAL A 1 221  ? 34.420  92.925  -14.491 1.00 81.73  ? 249  VAL A C     1 
ATOM   1340  O  O     . VAL A 1 221  ? 33.453  92.168  -14.417 1.00 81.27  ? 249  VAL A O     1 
ATOM   1341  C  CB    . VAL A 1 221  ? 35.182  93.584  -16.778 1.00 68.12  ? 249  VAL A CB    1 
ATOM   1342  C  CG1   . VAL A 1 221  ? 34.911  95.021  -16.357 1.00 70.52  ? 249  VAL A CG1   1 
ATOM   1343  C  CG2   . VAL A 1 221  ? 36.322  93.521  -17.783 1.00 69.35  ? 249  VAL A CG2   1 
ATOM   1344  N  N     . GLN A 1 234  ? 44.586  79.586  -20.211 1.00 81.54  ? 262  GLN A N     1 
ATOM   1345  C  CA    . GLN A 1 234  ? 43.485  80.274  -19.551 1.00 81.71  ? 262  GLN A CA    1 
ATOM   1346  C  C     . GLN A 1 234  ? 42.128  79.698  -19.965 1.00 76.35  ? 262  GLN A C     1 
ATOM   1347  O  O     . GLN A 1 234  ? 41.900  79.400  -21.139 1.00 72.06  ? 262  GLN A O     1 
ATOM   1348  C  CB    . GLN A 1 234  ? 43.548  81.778  -19.845 1.00 87.07  ? 262  GLN A CB    1 
ATOM   1349  C  CG    . GLN A 1 234  ? 43.539  82.163  -21.315 1.00 84.36  ? 262  GLN A CG    1 
ATOM   1350  C  CD    . GLN A 1 234  ? 43.722  83.656  -21.509 1.00 91.64  ? 262  GLN A CD    1 
ATOM   1351  O  OE1   . GLN A 1 234  ? 44.034  84.380  -20.563 1.00 81.79  ? 262  GLN A OE1   1 
ATOM   1352  N  NE2   . GLN A 1 234  ? 43.529  84.124  -22.737 1.00 84.58  ? 262  GLN A NE2   1 
ATOM   1353  N  N     . GLU A 1 235  ? 41.233  79.539  -18.993 1.00 77.49  ? 263  GLU A N     1 
ATOM   1354  C  CA    . GLU A 1 235  ? 41.511  79.938  -17.615 1.00 72.05  ? 263  GLU A CA    1 
ATOM   1355  C  C     . GLU A 1 235  ? 41.425  78.782  -16.623 1.00 73.03  ? 263  GLU A C     1 
ATOM   1356  O  O     . GLU A 1 235  ? 42.289  78.637  -15.755 1.00 70.38  ? 263  GLU A O     1 
ATOM   1357  C  CB    . GLU A 1 235  ? 40.550  81.050  -17.181 1.00 75.49  ? 263  GLU A CB    1 
ATOM   1358  C  CG    . GLU A 1 235  ? 40.976  82.454  -17.587 1.00 77.06  ? 263  GLU A CG    1 
ATOM   1359  C  CD    . GLU A 1 235  ? 42.202  82.937  -16.828 1.00 81.90  ? 263  GLU A CD    1 
ATOM   1360  O  OE1   . GLU A 1 235  ? 42.907  83.833  -17.340 1.00 76.85  ? 263  GLU A OE1   1 
ATOM   1361  O  OE2   . GLU A 1 235  ? 42.456  82.427  -15.716 1.00 87.30  ? 263  GLU A OE2   1 
ATOM   1362  N  N     . GLN A 1 236  ? 40.388  77.962  -16.753 1.00 41.02  ? 264  GLN A N     1 
ATOM   1363  C  CA    . GLN A 1 236  ? 40.058  76.994  -15.714 1.00 69.97  ? 264  GLN A CA    1 
ATOM   1364  C  C     . GLN A 1 236  ? 40.157  75.534  -16.149 1.00 65.85  ? 264  GLN A C     1 
ATOM   1365  O  O     . GLN A 1 236  ? 40.113  75.218  -17.337 1.00 72.38  ? 264  GLN A O     1 
ATOM   1366  C  CB    . GLN A 1 236  ? 38.645  77.266  -15.193 1.00 68.65  ? 264  GLN A CB    1 
ATOM   1367  C  CG    . GLN A 1 236  ? 38.487  78.576  -14.437 1.00 56.76  ? 264  GLN A CG    1 
ATOM   1368  C  CD    . GLN A 1 236  ? 38.689  78.413  -12.942 1.00 77.39  ? 264  GLN A CD    1 
ATOM   1369  O  OE1   . GLN A 1 236  ? 38.222  79.229  -12.150 1.00 41.47  ? 264  GLN A OE1   1 
ATOM   1370  N  NE2   . GLN A 1 236  ? 39.386  77.352  -12.548 1.00 69.13  ? 264  GLN A NE2   1 
ATOM   1371  N  N     . LEU A 1 237  ? 40.290  74.653  -15.163 1.00 45.32  ? 265  LEU A N     1 
ATOM   1372  C  CA    . LEU A 1 237  ? 40.222  73.211  -15.375 1.00 43.12  ? 265  LEU A CA    1 
ATOM   1373  C  C     . LEU A 1 237  ? 39.817  72.509  -14.085 1.00 46.86  ? 265  LEU A C     1 
ATOM   1374  O  O     . LEU A 1 237  ? 40.487  72.636  -13.060 1.00 42.85  ? 265  LEU A O     1 
ATOM   1375  C  CB    . LEU A 1 237  ? 41.556  72.653  -15.866 1.00 56.50  ? 265  LEU A CB    1 
ATOM   1376  C  CG    . LEU A 1 237  ? 41.599  71.121  -15.881 1.00 41.54  ? 265  LEU A CG    1 
ATOM   1377  C  CD1   . LEU A 1 237  ? 40.721  70.554  -16.991 1.00 40.14  ? 265  LEU A CD1   1 
ATOM   1378  C  CD2   . LEU A 1 237  ? 43.024  70.608  -15.996 1.00 65.70  ? 265  LEU A CD2   1 
ATOM   1379  N  N     . VAL A 1 238  ? 38.716  71.769  -14.139 1.00 44.63  ? 266  VAL A N     1 
ATOM   1380  C  CA    . VAL A 1 238  ? 38.206  71.092  -12.955 1.00 49.36  ? 266  VAL A CA    1 
ATOM   1381  C  C     . VAL A 1 238  ? 38.149  69.586  -13.166 1.00 43.96  ? 266  VAL A C     1 
ATOM   1382  O  O     . VAL A 1 238  ? 37.398  69.098  -14.010 1.00 47.64  ? 266  VAL A O     1 
ATOM   1383  C  CB    . VAL A 1 238  ? 36.803  71.603  -12.576 1.00 92.46  ? 266  VAL A CB    1 
ATOM   1384  C  CG1   . VAL A 1 238  ? 36.320  70.929  -11.302 1.00 91.65  ? 266  VAL A CG1   1 
ATOM   1385  C  CG2   . VAL A 1 238  ? 36.814  73.113  -12.415 1.00 40.43  ? 266  VAL A CG2   1 
ATOM   1386  N  N     . VAL A 1 239  ? 38.948  68.852  -12.399 1.00 46.09  ? 267  VAL A N     1 
ATOM   1387  C  CA    . VAL A 1 239  ? 38.946  67.398  -12.480 1.00 44.85  ? 267  VAL A CA    1 
ATOM   1388  C  C     . VAL A 1 239  ? 38.120  66.800  -11.344 1.00 47.23  ? 267  VAL A C     1 
ATOM   1389  O  O     . VAL A 1 239  ? 37.900  67.445  -10.318 1.00 42.68  ? 267  VAL A O     1 
ATOM   1390  C  CB    . VAL A 1 239  ? 40.378  66.818  -12.437 1.00 41.67  ? 267  VAL A CB    1 
ATOM   1391  C  CG1   . VAL A 1 239  ? 41.258  67.491  -13.479 1.00 44.80  ? 267  VAL A CG1   1 
ATOM   1392  C  CG2   . VAL A 1 239  ? 40.976  66.965  -11.052 1.00 45.40  ? 267  VAL A CG2   1 
ATOM   1393  N  N     . GLY A 1 240  ? 37.657  65.569  -11.537 1.00 85.56  ? 268  GLY A N     1 
ATOM   1394  C  CA    . GLY A 1 240  ? 36.874  64.885  -10.526 1.00 84.93  ? 268  GLY A CA    1 
ATOM   1395  C  C     . GLY A 1 240  ? 36.353  63.536  -10.984 1.00 48.67  ? 268  GLY A C     1 
ATOM   1396  O  O     . GLY A 1 240  ? 36.270  63.263  -12.182 1.00 81.09  ? 268  GLY A O     1 
ATOM   1397  N  N     . HIS A 1 241  ? 36.010  62.686  -10.022 1.00 49.96  ? 269  HIS A N     1 
ATOM   1398  C  CA    . HIS A 1 241  ? 35.399  61.397  -10.320 1.00 42.08  ? 269  HIS A CA    1 
ATOM   1399  C  C     . HIS A 1 241  ? 33.916  61.610  -10.596 1.00 40.73  ? 269  HIS A C     1 
ATOM   1400  O  O     . HIS A 1 241  ? 33.183  62.082  -9.725  1.00 47.74  ? 269  HIS A O     1 
ATOM   1401  C  CB    . HIS A 1 241  ? 35.605  60.417  -9.164  1.00 92.37  ? 269  HIS A CB    1 
ATOM   1402  C  CG    . HIS A 1 241  ? 35.430  58.981  -9.550  1.00 42.06  ? 269  HIS A CG    1 
ATOM   1403  N  ND1   . HIS A 1 241  ? 36.227  58.360  -10.487 1.00 90.33  ? 269  HIS A ND1   1 
ATOM   1404  C  CD2   . HIS A 1 241  ? 34.550  58.044  -9.124  1.00 46.01  ? 269  HIS A CD2   1 
ATOM   1405  C  CE1   . HIS A 1 241  ? 35.845  57.103  -10.623 1.00 41.70  ? 269  HIS A CE1   1 
ATOM   1406  N  NE2   . HIS A 1 241  ? 34.830  56.885  -9.807  1.00 49.21  ? 269  HIS A NE2   1 
ATOM   1407  N  N     . ASN A 1 242  ? 33.487  61.257  -11.806 1.00 91.59  ? 270  ASN A N     1 
ATOM   1408  C  CA    . ASN A 1 242  ? 32.164  61.624  -12.309 1.00 44.98  ? 270  ASN A CA    1 
ATOM   1409  C  C     . ASN A 1 242  ? 31.987  63.134  -12.203 1.00 43.16  ? 270  ASN A C     1 
ATOM   1410  O  O     . ASN A 1 242  ? 31.111  63.627  -11.492 1.00 42.47  ? 270  ASN A O     1 
ATOM   1411  C  CB    . ASN A 1 242  ? 31.056  60.887  -11.553 1.00 43.50  ? 270  ASN A CB    1 
ATOM   1412  C  CG    . ASN A 1 242  ? 29.694  61.062  -12.197 1.00 40.37  ? 270  ASN A CG    1 
ATOM   1413  O  OD1   . ASN A 1 242  ? 29.591  61.422  -13.369 1.00 46.51  ? 270  ASN A OD1   1 
ATOM   1414  N  ND2   . ASN A 1 242  ? 28.640  60.809  -11.430 1.00 48.41  ? 270  ASN A ND2   1 
ATOM   1415  N  N     . VAL A 1 243  ? 32.840  63.858  -12.920 1.00 43.76  ? 271  VAL A N     1 
ATOM   1416  C  CA    . VAL A 1 243  ? 32.954  65.305  -12.782 1.00 48.74  ? 271  VAL A CA    1 
ATOM   1417  C  C     . VAL A 1 243  ? 31.717  66.041  -13.298 1.00 48.70  ? 271  VAL A C     1 
ATOM   1418  O  O     . VAL A 1 243  ? 31.470  67.184  -12.922 1.00 46.99  ? 271  VAL A O     1 
ATOM   1419  C  CB    . VAL A 1 243  ? 34.214  65.825  -13.518 1.00 48.51  ? 271  VAL A CB    1 
ATOM   1420  C  CG1   . VAL A 1 243  ? 34.018  65.777  -15.029 1.00 47.64  ? 271  VAL A CG1   1 
ATOM   1421  C  CG2   . VAL A 1 243  ? 34.577  67.231  -13.057 1.00 40.04  ? 271  VAL A CG2   1 
ATOM   1422  N  N     . SER A 1 244  ? 30.934  65.379  -14.144 1.00 44.89  ? 272  SER A N     1 
ATOM   1423  C  CA    . SER A 1 244  ? 29.748  65.994  -14.732 1.00 42.68  ? 272  SER A CA    1 
ATOM   1424  C  C     . SER A 1 244  ? 28.707  66.346  -13.673 1.00 48.01  ? 272  SER A C     1 
ATOM   1425  O  O     . SER A 1 244  ? 28.033  67.376  -13.764 1.00 47.56  ? 272  SER A O     1 
ATOM   1426  C  CB    . SER A 1 244  ? 29.140  65.065  -15.781 1.00 41.80  ? 272  SER A CB    1 
ATOM   1427  O  OG    . SER A 1 244  ? 30.058  64.821  -16.831 1.00 68.92  ? 272  SER A OG    1 
ATOM   1428  N  N     . PHE A 1 245  ? 28.585  65.482  -12.670 1.00 90.12  ? 273  PHE A N     1 
ATOM   1429  C  CA    . PHE A 1 245  ? 27.674  65.711  -11.555 1.00 90.62  ? 273  PHE A CA    1 
ATOM   1430  C  C     . PHE A 1 245  ? 28.080  66.949  -10.763 1.00 71.80  ? 273  PHE A C     1 
ATOM   1431  O  O     . PHE A 1 245  ? 27.229  67.722  -10.323 1.00 68.76  ? 273  PHE A O     1 
ATOM   1432  C  CB    . PHE A 1 245  ? 27.635  64.488  -10.637 1.00 90.24  ? 273  PHE A CB    1 
ATOM   1433  C  CG    . PHE A 1 245  ? 26.804  64.680  -9.401  1.00 90.95  ? 273  PHE A CG    1 
ATOM   1434  C  CD1   . PHE A 1 245  ? 25.435  64.487  -9.436  1.00 56.04  ? 273  PHE A CD1   1 
ATOM   1435  C  CD2   . PHE A 1 245  ? 27.393  65.040  -8.200  1.00 81.58  ? 273  PHE A CD2   1 
ATOM   1436  C  CE1   . PHE A 1 245  ? 24.667  64.658  -8.301  1.00 66.85  ? 273  PHE A CE1   1 
ATOM   1437  C  CE2   . PHE A 1 245  ? 26.631  65.212  -7.062  1.00 84.39  ? 273  PHE A CE2   1 
ATOM   1438  C  CZ    . PHE A 1 245  ? 25.267  65.020  -7.114  1.00 47.46  ? 273  PHE A CZ    1 
ATOM   1439  N  N     . ASP A 1 246  ? 29.384  67.128  -10.582 1.00 40.01  ? 274  ASP A N     1 
ATOM   1440  C  CA    . ASP A 1 246  ? 29.901  68.282  -9.858  1.00 45.35  ? 274  ASP A CA    1 
ATOM   1441  C  C     . ASP A 1 246  ? 29.712  69.550  -10.685 1.00 49.66  ? 274  ASP A C     1 
ATOM   1442  O  O     . ASP A 1 246  ? 29.379  70.609  -10.153 1.00 69.10  ? 274  ASP A O     1 
ATOM   1443  C  CB    . ASP A 1 246  ? 31.377  68.080  -9.507  1.00 48.73  ? 274  ASP A CB    1 
ATOM   1444  C  CG    . ASP A 1 246  ? 31.644  66.725  -8.878  1.00 43.83  ? 274  ASP A CG    1 
ATOM   1445  O  OD1   . ASP A 1 246  ? 31.335  66.548  -7.681  1.00 41.64  ? 274  ASP A OD1   1 
ATOM   1446  O  OD2   . ASP A 1 246  ? 32.167  65.836  -9.583  1.00 55.30  ? 274  ASP A OD2   1 
ATOM   1447  N  N     . ARG A 1 247  ? 29.926  69.425  -11.992 1.00 85.42  ? 275  ARG A N     1 
ATOM   1448  C  CA    . ARG A 1 247  ? 29.704  70.513  -12.938 1.00 86.29  ? 275  ARG A CA    1 
ATOM   1449  C  C     . ARG A 1 247  ? 28.255  70.976  -12.897 1.00 90.31  ? 275  ARG A C     1 
ATOM   1450  O  O     . ARG A 1 247  ? 27.969  72.170  -13.004 1.00 90.05  ? 275  ARG A O     1 
ATOM   1451  C  CB    . ARG A 1 247  ? 30.079  70.070  -14.354 1.00 85.68  ? 275  ARG A CB    1 
ATOM   1452  C  CG    . ARG A 1 247  ? 29.283  70.746  -15.462 1.00 86.25  ? 275  ARG A CG    1 
ATOM   1453  C  CD    . ARG A 1 247  ? 29.591  70.112  -16.808 1.00 67.31  ? 275  ARG A CD    1 
ATOM   1454  N  NE    . ARG A 1 247  ? 28.689  70.567  -17.862 1.00 86.13  ? 275  ARG A NE    1 
ATOM   1455  C  CZ    . ARG A 1 247  ? 28.828  71.713  -18.518 1.00 87.53  ? 275  ARG A CZ    1 
ATOM   1456  N  NH1   . ARG A 1 247  ? 29.827  72.532  -18.219 1.00 45.83  ? 275  ARG A NH1   1 
ATOM   1457  N  NH2   . ARG A 1 247  ? 27.967  72.043  -19.469 1.00 90.12  ? 275  ARG A NH2   1 
ATOM   1458  N  N     . ALA A 1 248  ? 27.346  70.020  -12.730 1.00 40.48  ? 276  ALA A N     1 
ATOM   1459  C  CA    . ALA A 1 248  ? 25.922  70.317  -12.638 1.00 86.34  ? 276  ALA A CA    1 
ATOM   1460  C  C     . ALA A 1 248  ? 25.609  71.215  -11.442 1.00 87.58  ? 276  ALA A C     1 
ATOM   1461  O  O     . ALA A 1 248  ? 24.583  71.893  -11.418 1.00 90.59  ? 276  ALA A O     1 
ATOM   1462  C  CB    . ALA A 1 248  ? 25.123  69.030  -12.553 1.00 40.25  ? 276  ALA A CB    1 
ATOM   1463  N  N     . HIS A 1 249  ? 26.496  71.217  -10.452 1.00 87.69  ? 277  HIS A N     1 
ATOM   1464  C  CA    . HIS A 1 249  ? 26.311  72.037  -9.261  1.00 91.01  ? 277  HIS A CA    1 
ATOM   1465  C  C     . HIS A 1 249  ? 27.212  73.271  -9.287  1.00 92.36  ? 277  HIS A C     1 
ATOM   1466  O  O     . HIS A 1 249  ? 27.610  73.779  -8.239  1.00 93.38  ? 277  HIS A O     1 
ATOM   1467  C  CB    . HIS A 1 249  ? 26.582  71.220  -7.994  1.00 40.83  ? 277  HIS A CB    1 
ATOM   1468  C  CG    . HIS A 1 249  ? 25.622  70.088  -7.779  1.00 48.06  ? 277  HIS A CG    1 
ATOM   1469  N  ND1   . HIS A 1 249  ? 24.772  69.633  -8.762  1.00 43.90  ? 277  HIS A ND1   1 
ATOM   1470  C  CD2   . HIS A 1 249  ? 25.382  69.322  -6.689  1.00 49.03  ? 277  HIS A CD2   1 
ATOM   1471  C  CE1   . HIS A 1 249  ? 24.050  68.633  -8.288  1.00 45.26  ? 277  HIS A CE1   1 
ATOM   1472  N  NE2   . HIS A 1 249  ? 24.399  68.424  -7.033  1.00 46.54  ? 277  HIS A NE2   1 
ATOM   1473  N  N     . ILE A 1 250  ? 27.532  73.747  -10.488 1.00 44.52  ? 278  ILE A N     1 
ATOM   1474  C  CA    . ILE A 1 250  ? 28.306  74.975  -10.652 1.00 46.46  ? 278  ILE A CA    1 
ATOM   1475  C  C     . ILE A 1 250  ? 27.392  76.130  -11.054 1.00 45.73  ? 278  ILE A C     1 
ATOM   1476  O  O     . ILE A 1 250  ? 26.573  75.999  -11.963 1.00 56.54  ? 278  ILE A O     1 
ATOM   1477  C  CB    . ILE A 1 250  ? 29.421  74.815  -11.704 1.00 49.54  ? 278  ILE A CB    1 
ATOM   1478  C  CG1   . ILE A 1 250  ? 30.386  73.702  -11.294 1.00 65.93  ? 278  ILE A CG1   1 
ATOM   1479  C  CG2   . ILE A 1 250  ? 30.180  76.121  -11.883 1.00 56.01  ? 278  ILE A CG2   1 
ATOM   1480  C  CD1   . ILE A 1 250  ? 31.099  73.964  -9.991  1.00 68.29  ? 278  ILE A CD1   1 
ATOM   1481  N  N     . ARG A 1 251  ? 27.543  77.261  -10.372 1.00 45.96  ? 279  ARG A N     1 
ATOM   1482  C  CA    . ARG A 1 251  ? 26.655  78.405  -10.549 1.00 46.05  ? 279  ARG A CA    1 
ATOM   1483  C  C     . ARG A 1 251  ? 26.689  78.997  -11.959 1.00 44.35  ? 279  ARG A C     1 
ATOM   1484  O  O     . ARG A 1 251  ? 25.646  79.313  -12.530 1.00 45.49  ? 279  ARG A O     1 
ATOM   1485  C  CB    . ARG A 1 251  ? 27.007  79.494  -9.532  1.00 60.20  ? 279  ARG A CB    1 
ATOM   1486  C  CG    . ARG A 1 251  ? 26.009  80.635  -9.464  1.00 49.74  ? 279  ARG A CG    1 
ATOM   1487  C  CD    . ARG A 1 251  ? 26.560  81.803  -8.659  1.00 45.47  ? 279  ARG A CD    1 
ATOM   1488  N  NE    . ARG A 1 251  ? 26.918  81.417  -7.297  1.00 41.91  ? 279  ARG A NE    1 
ATOM   1489  C  CZ    . ARG A 1 251  ? 26.110  81.534  -6.249  1.00 56.35  ? 279  ARG A CZ    1 
ATOM   1490  N  NH1   . ARG A 1 251  ? 24.890  82.029  -6.402  1.00 68.87  ? 279  ARG A NH1   1 
ATOM   1491  N  NH2   . ARG A 1 251  ? 26.522  81.158  -5.045  1.00 56.49  ? 279  ARG A NH2   1 
ATOM   1492  N  N     . GLU A 1 252  ? 27.886  79.143  -12.517 1.00 48.48  ? 280  GLU A N     1 
ATOM   1493  C  CA    . GLU A 1 252  ? 28.059  79.890  -13.762 1.00 60.56  ? 280  GLU A CA    1 
ATOM   1494  C  C     . GLU A 1 252  ? 28.004  79.025  -15.020 1.00 44.09  ? 280  GLU A C     1 
ATOM   1495  O  O     . GLU A 1 252  ? 28.184  79.529  -16.129 1.00 43.92  ? 280  GLU A O     1 
ATOM   1496  C  CB    . GLU A 1 252  ? 29.387  80.654  -13.736 1.00 60.53  ? 280  GLU A CB    1 
ATOM   1497  C  CG    . GLU A 1 252  ? 29.489  81.712  -12.645 1.00 65.42  ? 280  GLU A CG    1 
ATOM   1498  C  CD    . GLU A 1 252  ? 29.926  81.142  -11.308 1.00 65.73  ? 280  GLU A CD    1 
ATOM   1499  O  OE1   . GLU A 1 252  ? 29.815  81.859  -10.291 1.00 68.71  ? 280  GLU A OE1   1 
ATOM   1500  O  OE2   . GLU A 1 252  ? 30.386  79.981  -11.275 1.00 65.17  ? 280  GLU A OE2   1 
ATOM   1501  N  N     . GLN A 1 253  ? 27.755  77.731  -14.856 1.00 43.81  ? 281  GLN A N     1 
ATOM   1502  C  CA    . GLN A 1 253  ? 27.753  76.824  -16.000 1.00 42.37  ? 281  GLN A CA    1 
ATOM   1503  C  C     . GLN A 1 253  ? 26.410  76.806  -16.722 1.00 42.23  ? 281  GLN A C     1 
ATOM   1504  O  O     . GLN A 1 253  ? 26.311  76.320  -17.849 1.00 41.88  ? 281  GLN A O     1 
ATOM   1505  C  CB    . GLN A 1 253  ? 28.126  75.407  -15.559 1.00 40.06  ? 281  GLN A CB    1 
ATOM   1506  C  CG    . GLN A 1 253  ? 29.616  75.201  -15.338 1.00 56.19  ? 281  GLN A CG    1 
ATOM   1507  C  CD    . GLN A 1 253  ? 30.423  75.348  -16.615 1.00 49.22  ? 281  GLN A CD    1 
ATOM   1508  O  OE1   . GLN A 1 253  ? 29.917  75.118  -17.713 1.00 64.78  ? 281  GLN A OE1   1 
ATOM   1509  N  NE2   . GLN A 1 253  ? 31.685  75.734  -16.475 1.00 56.64  ? 281  GLN A NE2   1 
ATOM   1510  N  N     . TYR A 1 254  ? 25.384  77.348  -16.075 1.00 48.28  ? 282  TYR A N     1 
ATOM   1511  C  CA    . TYR A 1 254  ? 24.030  77.315  -16.622 1.00 47.35  ? 282  TYR A CA    1 
ATOM   1512  C  C     . TYR A 1 254  ? 23.747  78.482  -17.562 1.00 45.93  ? 282  TYR A C     1 
ATOM   1513  O  O     . TYR A 1 254  ? 22.723  78.499  -18.245 1.00 46.46  ? 282  TYR A O     1 
ATOM   1514  C  CB    . TYR A 1 254  ? 23.005  77.297  -15.486 1.00 44.01  ? 282  TYR A CB    1 
ATOM   1515  C  CG    . TYR A 1 254  ? 22.943  75.975  -14.758 1.00 45.00  ? 282  TYR A CG    1 
ATOM   1516  C  CD1   . TYR A 1 254  ? 22.036  74.996  -15.138 1.00 41.38  ? 282  TYR A CD1   1 
ATOM   1517  C  CD2   . TYR A 1 254  ? 23.800  75.701  -13.700 1.00 43.60  ? 282  TYR A CD2   1 
ATOM   1518  C  CE1   . TYR A 1 254  ? 21.977  73.784  -14.480 1.00 43.31  ? 282  TYR A CE1   1 
ATOM   1519  C  CE2   . TYR A 1 254  ? 23.750  74.489  -13.036 1.00 40.28  ? 282  TYR A CE2   1 
ATOM   1520  C  CZ    . TYR A 1 254  ? 22.837  73.536  -13.432 1.00 41.42  ? 282  TYR A CZ    1 
ATOM   1521  O  OH    . TYR A 1 254  ? 22.782  72.329  -12.778 1.00 48.07  ? 282  TYR A OH    1 
ATOM   1522  N  N     . LEU A 1 255  ? 24.657  79.451  -17.598 1.00 47.39  ? 283  LEU A N     1 
ATOM   1523  C  CA    . LEU A 1 255  ? 24.500  80.624  -18.454 1.00 49.79  ? 283  LEU A CA    1 
ATOM   1524  C  C     . LEU A 1 255  ? 24.433  80.232  -19.927 1.00 43.22  ? 283  LEU A C     1 
ATOM   1525  O  O     . LEU A 1 255  ? 25.014  79.227  -20.335 1.00 55.87  ? 283  LEU A O     1 
ATOM   1526  C  CB    . LEU A 1 255  ? 25.646  81.615  -18.227 1.00 43.85  ? 283  LEU A CB    1 
ATOM   1527  C  CG    . LEU A 1 255  ? 25.518  82.604  -17.063 1.00 65.35  ? 283  LEU A CG    1 
ATOM   1528  C  CD1   . LEU A 1 255  ? 25.533  81.897  -15.716 1.00 69.89  ? 283  LEU A CD1   1 
ATOM   1529  C  CD2   . LEU A 1 255  ? 26.619  83.653  -17.129 1.00 67.58  ? 283  LEU A CD2   1 
ATOM   1530  N  N     . ILE A 1 256  ? 23.716  81.026  -20.716 1.00 47.12  ? 284  ILE A N     1 
ATOM   1531  C  CA    . ILE A 1 256  ? 23.570  80.768  -22.146 1.00 45.98  ? 284  ILE A CA    1 
ATOM   1532  C  C     . ILE A 1 256  ? 24.926  80.836  -22.846 1.00 55.86  ? 284  ILE A C     1 
ATOM   1533  O  O     . ILE A 1 256  ? 25.264  79.971  -23.654 1.00 73.25  ? 284  ILE A O     1 
ATOM   1534  C  CB    . ILE A 1 256  ? 22.592  81.769  -22.814 1.00 60.15  ? 284  ILE A CB    1 
ATOM   1535  C  CG1   . ILE A 1 256  ? 21.137  81.390  -22.519 1.00 47.68  ? 284  ILE A CG1   1 
ATOM   1536  C  CG2   . ILE A 1 256  ? 22.802  81.808  -24.319 1.00 60.80  ? 284  ILE A CG2   1 
ATOM   1537  C  CD1   . ILE A 1 256  ? 20.644  81.814  -21.154 1.00 48.62  ? 284  ILE A CD1   1 
ATOM   1538  N  N     . GLN A 1 257  ? 25.704  81.862  -22.518 1.00 76.14  ? 285  GLN A N     1 
ATOM   1539  C  CA    . GLN A 1 257  ? 27.028  82.041  -23.102 1.00 74.06  ? 285  GLN A CA    1 
ATOM   1540  C  C     . GLN A 1 257  ? 28.080  81.211  -22.369 1.00 74.42  ? 285  GLN A C     1 
ATOM   1541  O  O     . GLN A 1 257  ? 27.749  80.357  -21.547 1.00 72.10  ? 285  GLN A O     1 
ATOM   1542  C  CB    . GLN A 1 257  ? 27.424  83.520  -23.090 1.00 75.76  ? 285  GLN A CB    1 
ATOM   1543  C  CG    . GLN A 1 257  ? 27.451  84.162  -21.707 1.00 77.66  ? 285  GLN A CG    1 
ATOM   1544  C  CD    . GLN A 1 257  ? 26.076  84.590  -21.224 1.00 76.52  ? 285  GLN A CD    1 
ATOM   1545  O  OE1   . GLN A 1 257  ? 25.065  84.329  -21.876 1.00 75.73  ? 285  GLN A OE1   1 
ATOM   1546  N  NE2   . GLN A 1 257  ? 26.035  85.255  -20.075 1.00 84.15  ? 285  GLN A NE2   1 
ATOM   1547  N  N     . GLY A 1 258  ? 29.349  81.470  -22.672 1.00 90.90  ? 286  GLY A N     1 
ATOM   1548  C  CA    . GLY A 1 258  ? 30.446  80.738  -22.064 1.00 81.33  ? 286  GLY A CA    1 
ATOM   1549  C  C     . GLY A 1 258  ? 30.655  79.387  -22.722 1.00 87.33  ? 286  GLY A C     1 
ATOM   1550  O  O     . GLY A 1 258  ? 29.973  79.058  -23.692 1.00 91.02  ? 286  GLY A O     1 
ATOM   1551  N  N     . SER A 1 259  ? 31.595  78.600  -22.205 1.00 72.50  ? 287  SER A N     1 
ATOM   1552  C  CA    . SER A 1 259  ? 32.411  78.993  -21.061 1.00 68.48  ? 287  SER A CA    1 
ATOM   1553  C  C     . SER A 1 259  ? 33.857  78.539  -21.241 1.00 76.01  ? 287  SER A C     1 
ATOM   1554  O  O     . SER A 1 259  ? 34.139  77.627  -22.018 1.00 72.87  ? 287  SER A O     1 
ATOM   1555  C  CB    . SER A 1 259  ? 31.838  78.414  -19.766 1.00 72.75  ? 287  SER A CB    1 
ATOM   1556  O  OG    . SER A 1 259  ? 32.631  78.784  -18.652 1.00 48.09  ? 287  SER A OG    1 
ATOM   1557  N  N     . ARG A 1 260  ? 34.768  79.177  -20.514 1.00 68.38  ? 288  ARG A N     1 
ATOM   1558  C  CA    . ARG A 1 260  ? 36.185  78.843  -20.595 1.00 73.54  ? 288  ARG A CA    1 
ATOM   1559  C  C     . ARG A 1 260  ? 36.510  77.582  -19.799 1.00 73.38  ? 288  ARG A C     1 
ATOM   1560  O  O     . ARG A 1 260  ? 37.385  76.805  -20.179 1.00 75.82  ? 288  ARG A O     1 
ATOM   1561  C  CB    . ARG A 1 260  ? 37.039  80.011  -20.095 1.00 68.01  ? 288  ARG A CB    1 
ATOM   1562  C  CG    . ARG A 1 260  ? 36.954  81.270  -20.948 1.00 70.95  ? 288  ARG A CG    1 
ATOM   1563  C  CD    . ARG A 1 260  ? 38.003  81.281  -22.054 1.00 75.77  ? 288  ARG A CD    1 
ATOM   1564  N  NE    . ARG A 1 260  ? 37.773  80.249  -23.062 1.00 71.80  ? 288  ARG A NE    1 
ATOM   1565  C  CZ    . ARG A 1 260  ? 38.548  80.059  -24.125 1.00 85.40  ? 288  ARG A CZ    1 
ATOM   1566  N  NH1   . ARG A 1 260  ? 39.608  80.832  -24.323 1.00 81.96  ? 288  ARG A NH1   1 
ATOM   1567  N  NH2   . ARG A 1 260  ? 38.265  79.096  -24.992 1.00 86.76  ? 288  ARG A NH2   1 
ATOM   1568  N  N     . MET A 1 261  ? 35.798  77.387  -18.694 1.00 65.10  ? 289  MET A N     1 
ATOM   1569  C  CA    . MET A 1 261  ? 36.038  76.250  -17.812 1.00 42.26  ? 289  MET A CA    1 
ATOM   1570  C  C     . MET A 1 261  ? 35.615  74.927  -18.442 1.00 67.66  ? 289  MET A C     1 
ATOM   1571  O  O     . MET A 1 261  ? 34.462  74.757  -18.836 1.00 55.97  ? 289  MET A O     1 
ATOM   1572  C  CB    . MET A 1 261  ? 35.303  76.444  -16.483 1.00 44.12  ? 289  MET A CB    1 
ATOM   1573  C  CG    . MET A 1 261  ? 35.428  75.267  -15.528 1.00 42.29  ? 289  MET A CG    1 
ATOM   1574  S  SD    . MET A 1 261  ? 34.476  75.475  -14.012 1.00 42.12  ? 289  MET A SD    1 
ATOM   1575  C  CE    . MET A 1 261  ? 35.283  76.894  -13.282 1.00 44.93  ? 289  MET A CE    1 
ATOM   1576  N  N     . ARG A 1 262  ? 36.557  73.993  -18.535 1.00 47.90  ? 290  ARG A N     1 
ATOM   1577  C  CA    . ARG A 1 262  ? 36.253  72.639  -18.988 1.00 47.65  ? 290  ARG A CA    1 
ATOM   1578  C  C     . ARG A 1 262  ? 36.489  71.643  -17.859 1.00 44.13  ? 290  ARG A C     1 
ATOM   1579  O  O     . ARG A 1 262  ? 36.971  72.012  -16.788 1.00 41.95  ? 290  ARG A O     1 
ATOM   1580  C  CB    . ARG A 1 262  ? 37.095  72.268  -20.210 1.00 66.34  ? 290  ARG A CB    1 
ATOM   1581  C  CG    . ARG A 1 262  ? 36.895  73.187  -21.402 1.00 55.02  ? 290  ARG A CG    1 
ATOM   1582  C  CD    . ARG A 1 262  ? 35.450  73.211  -21.866 1.00 42.47  ? 290  ARG A CD    1 
ATOM   1583  N  NE    . ARG A 1 262  ? 35.247  74.191  -22.927 1.00 43.01  ? 290  ARG A NE    1 
ATOM   1584  C  CZ    . ARG A 1 262  ? 35.423  73.940  -24.220 1.00 66.91  ? 290  ARG A CZ    1 
ATOM   1585  N  NH1   . ARG A 1 262  ? 35.803  72.733  -24.617 1.00 69.47  ? 290  ARG A NH1   1 
ATOM   1586  N  NH2   . ARG A 1 262  ? 35.219  74.895  -25.117 1.00 67.06  ? 290  ARG A NH2   1 
ATOM   1587  N  N     . PHE A 1 263  ? 36.156  70.380  -18.101 1.00 90.64  ? 291  PHE A N     1 
ATOM   1588  C  CA    . PHE A 1 263  ? 36.223  69.372  -17.049 1.00 48.55  ? 291  PHE A CA    1 
ATOM   1589  C  C     . PHE A 1 263  ? 36.932  68.096  -17.494 1.00 43.27  ? 291  PHE A C     1 
ATOM   1590  O  O     . PHE A 1 263  ? 36.838  67.688  -18.652 1.00 46.49  ? 291  PHE A O     1 
ATOM   1591  C  CB    . PHE A 1 263  ? 34.814  69.037  -16.554 1.00 44.23  ? 291  PHE A CB    1 
ATOM   1592  C  CG    . PHE A 1 263  ? 34.081  70.213  -15.971 1.00 42.98  ? 291  PHE A CG    1 
ATOM   1593  C  CD1   . PHE A 1 263  ? 34.137  70.476  -14.612 1.00 49.51  ? 291  PHE A CD1   1 
ATOM   1594  C  CD2   . PHE A 1 263  ? 33.337  71.056  -16.780 1.00 41.65  ? 291  PHE A CD2   1 
ATOM   1595  C  CE1   . PHE A 1 263  ? 33.465  71.557  -14.072 1.00 56.08  ? 291  PHE A CE1   1 
ATOM   1596  C  CE2   . PHE A 1 263  ? 32.665  72.138  -16.246 1.00 46.29  ? 291  PHE A CE2   1 
ATOM   1597  C  CZ    . PHE A 1 263  ? 32.729  72.389  -14.890 1.00 60.02  ? 291  PHE A CZ    1 
ATOM   1598  N  N     . LEU A 1 264  ? 37.643  67.475  -16.557 1.00 40.58  ? 292  LEU A N     1 
ATOM   1599  C  CA    . LEU A 1 264  ? 38.331  66.211  -16.804 1.00 41.84  ? 292  LEU A CA    1 
ATOM   1600  C  C     . LEU A 1 264  ? 37.814  65.150  -15.835 1.00 84.53  ? 292  LEU A C     1 
ATOM   1601  O  O     . LEU A 1 264  ? 37.750  65.381  -14.630 1.00 84.78  ? 292  LEU A O     1 
ATOM   1602  C  CB    . LEU A 1 264  ? 39.844  66.380  -16.653 1.00 44.16  ? 292  LEU A CB    1 
ATOM   1603  C  CG    . LEU A 1 264  ? 40.752  65.732  -17.702 1.00 43.18  ? 292  LEU A CG    1 
ATOM   1604  C  CD1   . LEU A 1 264  ? 40.384  64.273  -17.936 1.00 69.35  ? 292  LEU A CD1   1 
ATOM   1605  C  CD2   . LEU A 1 264  ? 40.715  66.515  -19.003 1.00 92.87  ? 292  LEU A CD2   1 
ATOM   1606  N  N     . ASP A 1 265  ? 37.447  63.986  -16.361 1.00 81.48  ? 293  ASP A N     1 
ATOM   1607  C  CA    . ASP A 1 265  ? 36.826  62.954  -15.537 1.00 45.92  ? 293  ASP A CA    1 
ATOM   1608  C  C     . ASP A 1 265  ? 37.755  61.760  -15.329 1.00 41.63  ? 293  ASP A C     1 
ATOM   1609  O  O     . ASP A 1 265  ? 38.177  61.117  -16.289 1.00 56.76  ? 293  ASP A O     1 
ATOM   1610  C  CB    . ASP A 1 265  ? 35.511  62.497  -16.172 1.00 41.48  ? 293  ASP A CB    1 
ATOM   1611  C  CG    . ASP A 1 265  ? 34.515  61.985  -15.151 1.00 43.77  ? 293  ASP A CG    1 
ATOM   1612  O  OD1   . ASP A 1 265  ? 33.311  62.285  -15.297 1.00 64.05  ? 293  ASP A OD1   1 
ATOM   1613  O  OD2   . ASP A 1 265  ? 34.934  61.288  -14.204 1.00 45.34  ? 293  ASP A OD2   1 
ATOM   1614  N  N     . THR A 1 266  ? 38.066  61.466  -14.069 1.00 86.93  ? 294  THR A N     1 
ATOM   1615  C  CA    . THR A 1 266  ? 38.969  60.366  -13.738 1.00 92.46  ? 294  THR A CA    1 
ATOM   1616  C  C     . THR A 1 266  ? 38.326  59.009  -14.001 1.00 86.57  ? 294  THR A C     1 
ATOM   1617  O  O     . THR A 1 266  ? 39.019  58.019  -14.229 1.00 87.48  ? 294  THR A O     1 
ATOM   1618  C  CB    . THR A 1 266  ? 39.420  60.425  -12.265 1.00 93.70  ? 294  THR A CB    1 
ATOM   1619  O  OG1   . THR A 1 266  ? 38.278  60.327  -11.406 1.00 43.02  ? 294  THR A OG1   1 
ATOM   1620  C  CG2   . THR A 1 266  ? 40.153  61.725  -11.982 1.00 42.41  ? 294  THR A CG2   1 
ATOM   1621  N  N     . MET A 1 267  ? 36.999  58.969  -13.959 1.00 92.46  ? 295  MET A N     1 
ATOM   1622  C  CA    . MET A 1 267  ? 36.254  57.749  -14.246 1.00 91.74  ? 295  MET A CA    1 
ATOM   1623  C  C     . MET A 1 267  ? 36.363  57.402  -15.727 1.00 42.17  ? 295  MET A C     1 
ATOM   1624  O  O     . MET A 1 267  ? 36.709  56.276  -16.096 1.00 56.80  ? 295  MET A O     1 
ATOM   1625  C  CB    . MET A 1 267  ? 34.788  57.913  -13.839 1.00 81.97  ? 295  MET A CB    1 
ATOM   1626  C  CG    . MET A 1 267  ? 33.912  56.704  -14.119 1.00 42.88  ? 295  MET A CG    1 
ATOM   1627  S  SD    . MET A 1 267  ? 32.175  57.028  -13.754 1.00 46.52  ? 295  MET A SD    1 
ATOM   1628  C  CE    . MET A 1 267  ? 32.254  57.372  -11.999 1.00 40.85  ? 295  MET A CE    1 
ATOM   1629  N  N     . SER A 1 268  ? 36.069  58.388  -16.567 1.00 46.37  ? 296  SER A N     1 
ATOM   1630  C  CA    . SER A 1 268  ? 36.164  58.234  -18.013 1.00 46.18  ? 296  SER A CA    1 
ATOM   1631  C  C     . SER A 1 268  ? 37.599  57.933  -18.430 1.00 49.20  ? 296  SER A C     1 
ATOM   1632  O  O     . SER A 1 268  ? 37.848  57.124  -19.328 1.00 60.04  ? 296  SER A O     1 
ATOM   1633  C  CB    . SER A 1 268  ? 35.663  59.496  -18.714 1.00 90.10  ? 296  SER A CB    1 
ATOM   1634  O  OG    . SER A 1 268  ? 36.532  60.589  -18.483 1.00 92.99  ? 296  SER A OG    1 
ATOM   1635  N  N     . MET A 1 269  ? 38.538  58.593  -17.762 1.00 90.10  ? 297  MET A N     1 
ATOM   1636  C  CA    . MET A 1 269  ? 39.955  58.396  -18.026 1.00 47.55  ? 297  MET A CA    1 
ATOM   1637  C  C     . MET A 1 269  ? 40.371  56.972  -17.657 1.00 81.34  ? 297  MET A C     1 
ATOM   1638  O  O     . MET A 1 269  ? 41.136  56.334  -18.380 1.00 81.96  ? 297  MET A O     1 
ATOM   1639  C  CB    . MET A 1 269  ? 40.783  59.426  -17.255 1.00 45.93  ? 297  MET A CB    1 
ATOM   1640  C  CG    . MET A 1 269  ? 42.140  59.723  -17.862 1.00 85.43  ? 297  MET A CG    1 
ATOM   1641  S  SD    . MET A 1 269  ? 42.698  61.392  -17.471 1.00 68.70  ? 297  MET A SD    1 
ATOM   1642  C  CE    . MET A 1 269  ? 42.536  61.394  -15.688 1.00 65.88  ? 297  MET A CE    1 
ATOM   1643  N  N     . HIS A 1 270  ? 39.854  56.478  -16.534 1.00 90.08  ? 298  HIS A N     1 
ATOM   1644  C  CA    . HIS A 1 270  ? 40.076  55.093  -16.130 1.00 42.86  ? 298  HIS A CA    1 
ATOM   1645  C  C     . HIS A 1 270  ? 39.508  54.135  -17.162 1.00 42.64  ? 298  HIS A C     1 
ATOM   1646  O  O     . HIS A 1 270  ? 40.074  53.073  -17.424 1.00 46.50  ? 298  HIS A O     1 
ATOM   1647  C  CB    . HIS A 1 270  ? 39.444  54.804  -14.769 1.00 81.14  ? 298  HIS A CB    1 
ATOM   1648  C  CG    . HIS A 1 270  ? 39.179  53.350  -14.529 1.00 93.98  ? 298  HIS A CG    1 
ATOM   1649  N  ND1   . HIS A 1 270  ? 37.910  52.812  -14.541 1.00 56.98  ? 298  HIS A ND1   1 
ATOM   1650  C  CD2   . HIS A 1 270  ? 40.021  52.317  -14.288 1.00 41.62  ? 298  HIS A CD2   1 
ATOM   1651  C  CE1   . HIS A 1 270  ? 37.981  51.514  -14.307 1.00 56.09  ? 298  HIS A CE1   1 
ATOM   1652  N  NE2   . HIS A 1 270  ? 39.251  51.188  -14.150 1.00 43.12  ? 298  HIS A NE2   1 
ATOM   1653  N  N     . MET A 1 271  ? 38.375  54.517  -17.739 1.00 44.54  ? 299  MET A N     1 
ATOM   1654  C  CA    . MET A 1 271  ? 37.737  53.701  -18.758 1.00 43.37  ? 299  MET A CA    1 
ATOM   1655  C  C     . MET A 1 271  ? 38.587  53.648  -20.023 1.00 42.78  ? 299  MET A C     1 
ATOM   1656  O  O     . MET A 1 271  ? 38.637  52.625  -20.707 1.00 90.74  ? 299  MET A O     1 
ATOM   1657  C  CB    . MET A 1 271  ? 36.350  54.243  -19.082 1.00 46.33  ? 299  MET A CB    1 
ATOM   1658  C  CG    . MET A 1 271  ? 35.422  53.202  -19.649 1.00 68.84  ? 299  MET A CG    1 
ATOM   1659  S  SD    . MET A 1 271  ? 34.769  52.117  -18.367 1.00 41.50  ? 299  MET A SD    1 
ATOM   1660  C  CE    . MET A 1 271  ? 33.379  53.095  -17.801 1.00 84.32  ? 299  MET A CE    1 
ATOM   1661  N  N     . ALA A 1 272  ? 39.252  54.757  -20.329 1.00 44.85  ? 300  ALA A N     1 
ATOM   1662  C  CA    . ALA A 1 272  ? 40.108  54.830  -21.508 1.00 47.97  ? 300  ALA A CA    1 
ATOM   1663  C  C     . ALA A 1 272  ? 41.404  54.050  -21.308 1.00 46.22  ? 300  ALA A C     1 
ATOM   1664  O  O     . ALA A 1 272  ? 41.887  53.381  -22.222 1.00 60.56  ? 300  ALA A O     1 
ATOM   1665  C  CB    . ALA A 1 272  ? 40.414  56.280  -21.850 1.00 81.66  ? 300  ALA A CB    1 
ATOM   1666  N  N     . ILE A 1 273  ? 41.964  54.141  -20.106 1.00 46.98  ? 301  ILE A N     1 
ATOM   1667  C  CA    . ILE A 1 273  ? 43.217  53.466  -19.792 1.00 44.93  ? 301  ILE A CA    1 
ATOM   1668  C  C     . ILE A 1 273  ? 43.005  51.975  -19.556 1.00 47.09  ? 301  ILE A C     1 
ATOM   1669  O  O     . ILE A 1 273  ? 43.397  51.145  -20.377 1.00 46.55  ? 301  ILE A O     1 
ATOM   1670  C  CB    . ILE A 1 273  ? 43.889  54.086  -18.553 1.00 86.85  ? 301  ILE A CB    1 
ATOM   1671  C  CG1   . ILE A 1 273  ? 44.189  55.566  -18.797 1.00 44.13  ? 301  ILE A CG1   1 
ATOM   1672  C  CG2   . ILE A 1 273  ? 45.163  53.335  -18.203 1.00 90.55  ? 301  ILE A CG2   1 
ATOM   1673  C  CD1   . ILE A 1 273  ? 44.723  56.289  -17.585 1.00 41.23  ? 301  ILE A CD1   1 
ATOM   1674  N  N     . SER A 1 274  ? 42.374  51.644  -18.435 1.00 49.11  ? 302  SER A N     1 
ATOM   1675  C  CA    . SER A 1 274  ? 42.171  50.253  -18.052 1.00 64.22  ? 302  SER A CA    1 
ATOM   1676  C  C     . SER A 1 274  ? 40.703  49.967  -17.755 1.00 72.78  ? 302  SER A C     1 
ATOM   1677  O  O     . SER A 1 274  ? 40.330  49.714  -16.609 1.00 71.97  ? 302  SER A O     1 
ATOM   1678  C  CB    . SER A 1 274  ? 43.032  49.910  -16.834 1.00 77.48  ? 302  SER A CB    1 
ATOM   1679  O  OG    . SER A 1 274  ? 42.892  48.549  -16.472 1.00 77.68  ? 302  SER A OG    1 
ATOM   1680  N  N     . GLY A 1 275  ? 39.874  50.008  -18.792 1.00 67.90  ? 303  GLY A N     1 
ATOM   1681  C  CA    . GLY A 1 275  ? 38.456  49.743  -18.639 1.00 47.04  ? 303  GLY A CA    1 
ATOM   1682  C  C     . GLY A 1 275  ? 38.106  48.312  -18.992 1.00 84.58  ? 303  GLY A C     1 
ATOM   1683  O  O     . GLY A 1 275  ? 38.901  47.607  -19.611 1.00 85.54  ? 303  GLY A O     1 
ATOM   1684  N  N     . LEU A 1 276  ? 36.912  47.882  -18.594 1.00 40.10  ? 304  LEU A N     1 
ATOM   1685  C  CA    . LEU A 1 276  ? 36.432  46.536  -18.895 1.00 46.80  ? 304  LEU A CA    1 
ATOM   1686  C  C     . LEU A 1 276  ? 34.940  46.538  -19.227 1.00 44.57  ? 304  LEU A C     1 
ATOM   1687  O  O     . LEU A 1 276  ? 34.198  47.412  -18.779 1.00 65.91  ? 304  LEU A O     1 
ATOM   1688  C  CB    . LEU A 1 276  ? 36.714  45.585  -17.725 1.00 43.40  ? 304  LEU A CB    1 
ATOM   1689  C  CG    . LEU A 1 276  ? 36.876  46.142  -16.307 1.00 47.06  ? 304  LEU A CG    1 
ATOM   1690  C  CD1   . LEU A 1 276  ? 35.615  46.835  -15.817 1.00 67.06  ? 304  LEU A CD1   1 
ATOM   1691  C  CD2   . LEU A 1 276  ? 37.280  45.030  -15.350 1.00 46.17  ? 304  LEU A CD2   1 
ATOM   1692  N  N     . SER A 1 277  ? 34.510  45.558  -20.016 1.00 48.14  ? 305  SER A N     1 
ATOM   1693  C  CA    . SER A 1 277  ? 33.112  45.459  -20.426 1.00 64.73  ? 305  SER A CA    1 
ATOM   1694  C  C     . SER A 1 277  ? 32.217  45.066  -19.255 1.00 75.61  ? 305  SER A C     1 
ATOM   1695  O  O     . SER A 1 277  ? 32.703  44.629  -18.213 1.00 69.93  ? 305  SER A O     1 
ATOM   1696  C  CB    . SER A 1 277  ? 32.955  44.449  -21.566 1.00 65.21  ? 305  SER A CB    1 
ATOM   1697  O  OG    . SER A 1 277  ? 33.325  43.145  -21.153 1.00 43.95  ? 305  SER A OG    1 
ATOM   1698  N  N     . SER A 1 278  ? 30.909  45.225  -19.435 1.00 75.24  ? 306  SER A N     1 
ATOM   1699  C  CA    . SER A 1 278  ? 29.943  44.882  -18.398 1.00 76.26  ? 306  SER A CA    1 
ATOM   1700  C  C     . SER A 1 278  ? 29.983  43.391  -18.087 1.00 60.46  ? 306  SER A C     1 
ATOM   1701  O  O     . SER A 1 278  ? 29.865  42.983  -16.928 1.00 66.14  ? 306  SER A O     1 
ATOM   1702  C  CB    . SER A 1 278  ? 28.533  45.299  -18.820 1.00 69.27  ? 306  SER A CB    1 
ATOM   1703  O  OG    . SER A 1 278  ? 28.172  44.696  -20.050 1.00 84.49  ? 306  SER A OG    1 
ATOM   1704  N  N     . PHE A 1 279  ? 30.154  42.583  -19.129 1.00 66.66  ? 307  PHE A N     1 
ATOM   1705  C  CA    . PHE A 1 279  ? 30.282  41.141  -18.970 1.00 56.00  ? 307  PHE A CA    1 
ATOM   1706  C  C     . PHE A 1 279  ? 31.493  40.813  -18.107 1.00 56.83  ? 307  PHE A C     1 
ATOM   1707  O  O     . PHE A 1 279  ? 31.487  39.843  -17.349 1.00 56.15  ? 307  PHE A O     1 
ATOM   1708  C  CB    . PHE A 1 279  ? 30.395  40.453  -20.332 1.00 70.30  ? 307  PHE A CB    1 
ATOM   1709  C  CG    . PHE A 1 279  ? 30.603  38.968  -20.245 1.00 74.31  ? 307  PHE A CG    1 
ATOM   1710  C  CD1   . PHE A 1 279  ? 29.537  38.120  -19.998 1.00 72.11  ? 307  PHE A CD1   1 
ATOM   1711  C  CD2   . PHE A 1 279  ? 31.864  38.420  -20.415 1.00 76.45  ? 307  PHE A CD2   1 
ATOM   1712  C  CE1   . PHE A 1 279  ? 29.725  36.753  -19.918 1.00 73.88  ? 307  PHE A CE1   1 
ATOM   1713  C  CE2   . PHE A 1 279  ? 32.058  37.055  -20.337 1.00 70.48  ? 307  PHE A CE2   1 
ATOM   1714  C  CZ    . PHE A 1 279  ? 30.988  36.220  -20.088 1.00 76.81  ? 307  PHE A CZ    1 
ATOM   1715  N  N     . GLN A 1 280  ? 32.532  41.632  -18.228 1.00 65.34  ? 308  GLN A N     1 
ATOM   1716  C  CA    . GLN A 1 280  ? 33.719  41.485  -17.400 1.00 66.51  ? 308  GLN A CA    1 
ATOM   1717  C  C     . GLN A 1 280  ? 33.440  41.942  -15.974 1.00 60.97  ? 308  GLN A C     1 
ATOM   1718  O  O     . GLN A 1 280  ? 33.870  41.298  -15.019 1.00 60.88  ? 308  GLN A O     1 
ATOM   1719  C  CB    . GLN A 1 280  ? 34.890  42.271  -17.989 1.00 67.29  ? 308  GLN A CB    1 
ATOM   1720  C  CG    . GLN A 1 280  ? 35.501  41.637  -19.225 1.00 56.65  ? 308  GLN A CG    1 
ATOM   1721  C  CD    . GLN A 1 280  ? 36.659  42.441  -19.776 1.00 56.36  ? 308  GLN A CD    1 
ATOM   1722  O  OE1   . GLN A 1 280  ? 36.475  43.548  -20.282 1.00 60.89  ? 308  GLN A OE1   1 
ATOM   1723  N  NE2   . GLN A 1 280  ? 37.863  41.891  -19.676 1.00 49.78  ? 308  GLN A NE2   1 
ATOM   1724  N  N     . ARG A 1 281  ? 32.717  43.051  -15.841 1.00 56.44  ? 309  ARG A N     1 
ATOM   1725  C  CA    . ARG A 1 281  ? 32.349  43.580  -14.530 1.00 40.85  ? 309  ARG A CA    1 
ATOM   1726  C  C     . ARG A 1 281  ? 31.576  42.545  -13.724 1.00 48.36  ? 309  ARG A C     1 
ATOM   1727  O  O     . ARG A 1 281  ? 31.737  42.445  -12.507 1.00 45.51  ? 309  ARG A O     1 
ATOM   1728  C  CB    . ARG A 1 281  ? 31.509  44.853  -14.666 1.00 86.64  ? 309  ARG A CB    1 
ATOM   1729  C  CG    . ARG A 1 281  ? 32.186  45.996  -15.399 1.00 85.25  ? 309  ARG A CG    1 
ATOM   1730  C  CD    . ARG A 1 281  ? 31.378  47.280  -15.268 1.00 48.12  ? 309  ARG A CD    1 
ATOM   1731  N  NE    . ARG A 1 281  ? 31.927  48.369  -16.070 1.00 49.04  ? 309  ARG A NE    1 
ATOM   1732  C  CZ    . ARG A 1 281  ? 31.449  48.740  -17.253 1.00 49.85  ? 309  ARG A CZ    1 
ATOM   1733  N  NH1   . ARG A 1 281  ? 30.404  48.113  -17.775 1.00 48.77  ? 309  ARG A NH1   1 
ATOM   1734  N  NH2   . ARG A 1 281  ? 32.013  49.742  -17.914 1.00 47.70  ? 309  ARG A NH2   1 
ATOM   1735  N  N     . SER A 1 282  ? 30.736  41.780  -14.415 1.00 48.99  ? 310  SER A N     1 
ATOM   1736  C  CA    . SER A 1 282  ? 29.907  40.768  -13.769 1.00 60.22  ? 310  SER A CA    1 
ATOM   1737  C  C     . SER A 1 282  ? 30.752  39.706  -13.070 1.00 67.61  ? 310  SER A C     1 
ATOM   1738  O  O     . SER A 1 282  ? 30.497  39.364  -11.915 1.00 46.83  ? 310  SER A O     1 
ATOM   1739  C  CB    . SER A 1 282  ? 28.976  40.110  -14.790 1.00 73.96  ? 310  SER A CB    1 
ATOM   1740  O  OG    . SER A 1 282  ? 29.712  39.496  -15.834 1.00 72.62  ? 310  SER A OG    1 
ATOM   1741  N  N     . LEU A 1 283  ? 31.760  39.192  -13.767 1.00 64.80  ? 311  LEU A N     1 
ATOM   1742  C  CA    . LEU A 1 283  ? 32.607  38.147  -13.202 1.00 71.43  ? 311  LEU A CA    1 
ATOM   1743  C  C     . LEU A 1 283  ? 33.838  38.722  -12.505 1.00 65.60  ? 311  LEU A C     1 
ATOM   1744  O  O     . LEU A 1 283  ? 34.632  37.983  -11.922 1.00 64.88  ? 311  LEU A O     1 
ATOM   1745  C  CB    . LEU A 1 283  ? 33.021  37.148  -14.289 1.00 56.82  ? 311  LEU A CB    1 
ATOM   1746  C  CG    . LEU A 1 283  ? 33.336  37.679  -15.689 1.00 60.59  ? 311  LEU A CG    1 
ATOM   1747  C  CD1   . LEU A 1 283  ? 34.746  38.232  -15.761 1.00 64.45  ? 311  LEU A CD1   1 
ATOM   1748  C  CD2   . LEU A 1 283  ? 33.130  36.589  -16.729 1.00 49.21  ? 311  LEU A CD2   1 
ATOM   1749  N  N     . TRP A 1 284  ? 33.990  40.041  -12.562 1.00 56.47  ? 312  TRP A N     1 
ATOM   1750  C  CA    . TRP A 1 284  ? 35.053  40.712  -11.824 1.00 69.65  ? 312  TRP A CA    1 
ATOM   1751  C  C     . TRP A 1 284  ? 34.658  40.822  -10.358 1.00 56.68  ? 312  TRP A C     1 
ATOM   1752  O  O     . TRP A 1 284  ? 35.460  40.558  -9.463  1.00 71.54  ? 312  TRP A O     1 
ATOM   1753  C  CB    . TRP A 1 284  ? 35.335  42.099  -12.404 1.00 55.53  ? 312  TRP A CB    1 
ATOM   1754  C  CG    . TRP A 1 284  ? 36.545  42.768  -11.829 1.00 42.26  ? 312  TRP A CG    1 
ATOM   1755  C  CD1   . TRP A 1 284  ? 37.801  42.784  -12.361 1.00 48.64  ? 312  TRP A CD1   1 
ATOM   1756  C  CD2   . TRP A 1 284  ? 36.615  43.523  -10.613 1.00 92.90  ? 312  TRP A CD2   1 
ATOM   1757  N  NE1   . TRP A 1 284  ? 38.649  43.501  -11.552 1.00 45.38  ? 312  TRP A NE1   1 
ATOM   1758  C  CE2   . TRP A 1 284  ? 37.945  43.965  -10.472 1.00 93.07  ? 312  TRP A CE2   1 
ATOM   1759  C  CE3   . TRP A 1 284  ? 35.682  43.868  -9.630  1.00 40.95  ? 312  TRP A CE3   1 
ATOM   1760  C  CZ2   . TRP A 1 284  ? 38.365  44.733  -9.388  1.00 48.04  ? 312  TRP A CZ2   1 
ATOM   1761  C  CZ3   . TRP A 1 284  ? 36.101  44.630  -8.555  1.00 93.79  ? 312  TRP A CZ3   1 
ATOM   1762  C  CH2   . TRP A 1 284  ? 37.430  45.055  -8.443  1.00 40.89  ? 312  TRP A CH2   1 
ATOM   1763  N  N     . ILE A 1 285  ? 33.410  41.215  -10.125 1.00 60.67  ? 313  ILE A N     1 
ATOM   1764  C  CA    . ILE A 1 285  ? 32.879  41.327  -8.773  1.00 60.92  ? 313  ILE A CA    1 
ATOM   1765  C  C     . ILE A 1 285  ? 32.510  39.950  -8.229  1.00 74.16  ? 313  ILE A C     1 
ATOM   1766  O  O     . ILE A 1 285  ? 32.308  39.779  -7.026  1.00 69.41  ? 313  ILE A O     1 
ATOM   1767  C  CB    . ILE A 1 285  ? 31.646  42.250  -8.725  1.00 55.28  ? 313  ILE A CB    1 
ATOM   1768  C  CG1   . ILE A 1 285  ? 30.501  41.661  -9.552  1.00 71.82  ? 313  ILE A CG1   1 
ATOM   1769  C  CG2   . ILE A 1 285  ? 32.003  43.640  -9.229  1.00 65.42  ? 313  ILE A CG2   1 
ATOM   1770  C  CD1   . ILE A 1 285  ? 29.249  42.512  -9.555  1.00 77.00  ? 313  ILE A CD1   1 
ATOM   1771  N  N     . ALA A 1 286  ? 32.428  38.970  -9.125  1.00 75.37  ? 314  ALA A N     1 
ATOM   1772  C  CA    . ALA A 1 286  ? 32.142  37.594  -8.736  1.00 71.78  ? 314  ALA A CA    1 
ATOM   1773  C  C     . ALA A 1 286  ? 33.351  36.973  -8.047  1.00 77.62  ? 314  ALA A C     1 
ATOM   1774  O  O     . ALA A 1 286  ? 33.233  35.962  -7.353  1.00 74.56  ? 314  ALA A O     1 
ATOM   1775  C  CB    . ALA A 1 286  ? 31.736  36.770  -9.945  1.00 76.46  ? 314  ALA A CB    1 
ATOM   1776  N  N     . ALA A 1 287  ? 34.514  37.583  -8.247  1.00 77.60  ? 315  ALA A N     1 
ATOM   1777  C  CA    . ALA A 1 287  ? 35.732  37.156  -7.571  1.00 65.33  ? 315  ALA A CA    1 
ATOM   1778  C  C     . ALA A 1 287  ? 35.653  37.480  -6.083  1.00 72.45  ? 315  ALA A C     1 
ATOM   1779  O  O     . ALA A 1 287  ? 36.280  38.429  -5.611  1.00 60.62  ? 315  ALA A O     1 
ATOM   1780  C  CB    . ALA A 1 287  ? 36.948  37.816  -8.198  1.00 48.89  ? 315  ALA A CB    1 
ATOM   1781  N  N     . LYS A 1 288  ? 34.875  36.688  -5.352  1.00 75.59  ? 316  LYS A N     1 
ATOM   1782  C  CA    . LYS A 1 288  ? 34.676  36.908  -3.924  1.00 69.66  ? 316  LYS A CA    1 
ATOM   1783  C  C     . LYS A 1 288  ? 34.220  35.627  -3.229  1.00 68.02  ? 316  LYS A C     1 
ATOM   1784  O  O     . LYS A 1 288  ? 33.799  34.670  -3.879  1.00 77.87  ? 316  LYS A O     1 
ATOM   1785  C  CB    . LYS A 1 288  ? 33.659  38.030  -3.694  1.00 73.40  ? 316  LYS A CB    1 
ATOM   1786  C  CG    . LYS A 1 288  ? 33.340  38.308  -2.231  1.00 72.08  ? 316  LYS A CG    1 
ATOM   1787  C  CD    . LYS A 1 288  ? 31.980  37.749  -1.818  1.00 68.74  ? 316  LYS A CD    1 
ATOM   1788  C  CE    . LYS A 1 288  ? 30.834  38.682  -2.198  1.00 68.77  ? 316  LYS A CE    1 
ATOM   1789  N  NZ    . LYS A 1 288  ? 30.543  38.704  -3.659  1.00 90.75  ? 316  LYS A NZ    1 
ATOM   1790  N  N     . ALA A 1 313  ? 37.500  29.459  -21.006 1.00 87.70  ? 341  ALA A N     1 
ATOM   1791  C  CA    . ALA A 1 313  ? 37.861  30.232  -19.824 1.00 85.10  ? 341  ALA A CA    1 
ATOM   1792  C  C     . ALA A 1 313  ? 39.090  29.644  -19.137 1.00 90.39  ? 341  ALA A C     1 
ATOM   1793  O  O     . ALA A 1 313  ? 39.123  29.507  -17.914 1.00 87.03  ? 341  ALA A O     1 
ATOM   1794  C  CB    . ALA A 1 313  ? 36.690  30.294  -18.855 1.00 81.49  ? 341  ALA A CB    1 
ATOM   1795  N  N     . ILE A 1 314  ? 40.098  29.300  -19.932 1.00 85.13  ? 342  ILE A N     1 
ATOM   1796  C  CA    . ILE A 1 314  ? 41.332  28.725  -19.407 1.00 92.20  ? 342  ILE A CA    1 
ATOM   1797  C  C     . ILE A 1 314  ? 42.237  29.807  -18.818 1.00 84.19  ? 342  ILE A C     1 
ATOM   1798  O  O     . ILE A 1 314  ? 42.735  29.669  -17.700 1.00 92.89  ? 342  ILE A O     1 
ATOM   1799  C  CB    . ILE A 1 314  ? 42.093  27.936  -20.501 1.00 41.01  ? 342  ILE A CB    1 
ATOM   1800  C  CG1   . ILE A 1 314  ? 43.550  27.701  -20.093 1.00 92.10  ? 342  ILE A CG1   1 
ATOM   1801  C  CG2   . ILE A 1 314  ? 42.014  28.653  -21.842 1.00 40.95  ? 342  ILE A CG2   1 
ATOM   1802  C  CD1   . ILE A 1 314  ? 43.720  26.716  -18.955 1.00 91.66  ? 342  ILE A CD1   1 
ATOM   1803  N  N     . SER A 1 315  ? 42.440  30.884  -19.569 1.00 92.70  ? 343  SER A N     1 
ATOM   1804  C  CA    . SER A 1 315  ? 43.249  32.005  -19.105 1.00 74.12  ? 343  SER A CA    1 
ATOM   1805  C  C     . SER A 1 315  ? 42.432  33.290  -19.102 1.00 68.58  ? 343  SER A C     1 
ATOM   1806  O  O     . SER A 1 315  ? 42.874  34.320  -19.609 1.00 91.95  ? 343  SER A O     1 
ATOM   1807  C  CB    . SER A 1 315  ? 44.492  32.174  -19.980 1.00 75.45  ? 343  SER A CB    1 
ATOM   1808  O  OG    . SER A 1 315  ? 45.270  33.277  -19.551 1.00 74.31  ? 343  SER A OG    1 
ATOM   1809  N  N     . SER A 1 316  ? 41.236  33.222  -18.527 1.00 77.77  ? 344  SER A N     1 
ATOM   1810  C  CA    . SER A 1 316  ? 40.333  34.366  -18.514 1.00 84.40  ? 344  SER A CA    1 
ATOM   1811  C  C     . SER A 1 316  ? 40.411  35.138  -17.200 1.00 90.18  ? 344  SER A C     1 
ATOM   1812  O  O     . SER A 1 316  ? 39.670  36.099  -16.993 1.00 85.84  ? 344  SER A O     1 
ATOM   1813  C  CB    . SER A 1 316  ? 38.894  33.910  -18.771 1.00 93.56  ? 344  SER A CB    1 
ATOM   1814  O  OG    . SER A 1 316  ? 38.487  32.930  -17.831 1.00 81.43  ? 344  SER A OG    1 
ATOM   1815  N  N     . TRP A 1 317  ? 41.311  34.718  -16.316 1.00 68.78  ? 345  TRP A N     1 
ATOM   1816  C  CA    . TRP A 1 317  ? 41.449  35.360  -15.012 1.00 86.47  ? 345  TRP A CA    1 
ATOM   1817  C  C     . TRP A 1 317  ? 42.809  36.039  -14.850 1.00 69.94  ? 345  TRP A C     1 
ATOM   1818  O  O     . TRP A 1 317  ? 43.245  36.308  -13.731 1.00 76.00  ? 345  TRP A O     1 
ATOM   1819  C  CB    . TRP A 1 317  ? 41.242  34.343  -13.884 1.00 81.91  ? 345  TRP A CB    1 
ATOM   1820  C  CG    . TRP A 1 317  ? 39.835  33.820  -13.764 1.00 73.64  ? 345  TRP A CG    1 
ATOM   1821  C  CD1   . TRP A 1 317  ? 38.966  33.549  -14.782 1.00 77.03  ? 345  TRP A CD1   1 
ATOM   1822  C  CD2   . TRP A 1 317  ? 39.135  33.513  -12.551 1.00 74.11  ? 345  TRP A CD2   1 
ATOM   1823  N  NE1   . TRP A 1 317  ? 37.774  33.089  -14.280 1.00 77.24  ? 345  TRP A NE1   1 
ATOM   1824  C  CE2   . TRP A 1 317  ? 37.851  33.058  -12.912 1.00 72.96  ? 345  TRP A CE2   1 
ATOM   1825  C  CE3   . TRP A 1 317  ? 39.471  33.576  -11.195 1.00 72.23  ? 345  TRP A CE3   1 
ATOM   1826  C  CZ2   . TRP A 1 317  ? 36.904  32.669  -11.967 1.00 69.13  ? 345  TRP A CZ2   1 
ATOM   1827  C  CZ3   . TRP A 1 317  ? 38.529  33.190  -10.258 1.00 73.47  ? 345  TRP A CZ3   1 
ATOM   1828  C  CH2   . TRP A 1 317  ? 37.260  32.742  -10.649 1.00 72.50  ? 345  TRP A CH2   1 
ATOM   1829  N  N     . ASP A 1 318  ? 43.472  36.316  -15.969 1.00 68.73  ? 346  ASP A N     1 
ATOM   1830  C  CA    . ASP A 1 318  ? 44.781  36.966  -15.943 1.00 68.88  ? 346  ASP A CA    1 
ATOM   1831  C  C     . ASP A 1 318  ? 44.663  38.487  -15.879 1.00 76.43  ? 346  ASP A C     1 
ATOM   1832  O  O     . ASP A 1 318  ? 45.526  39.162  -15.316 1.00 56.23  ? 346  ASP A O     1 
ATOM   1833  C  CB    . ASP A 1 318  ? 45.604  36.558  -17.168 1.00 71.00  ? 346  ASP A CB    1 
ATOM   1834  C  CG    . ASP A 1 318  ? 46.428  35.307  -16.930 1.00 69.49  ? 346  ASP A CG    1 
ATOM   1835  O  OD1   . ASP A 1 318  ? 45.892  34.193  -17.110 1.00 85.95  ? 346  ASP A OD1   1 
ATOM   1836  O  OD2   . ASP A 1 318  ? 47.616  35.439  -16.566 1.00 77.65  ? 346  ASP A OD2   1 
ATOM   1837  N  N     . TRP A 1 319  ? 43.593  39.020  -16.457 1.00 75.10  ? 347  TRP A N     1 
ATOM   1838  C  CA    . TRP A 1 319  ? 43.366  40.462  -16.485 1.00 55.54  ? 347  TRP A CA    1 
ATOM   1839  C  C     . TRP A 1 319  ? 42.643  40.947  -15.232 1.00 48.42  ? 347  TRP A C     1 
ATOM   1840  O  O     . TRP A 1 319  ? 42.336  42.132  -15.101 1.00 60.15  ? 347  TRP A O     1 
ATOM   1841  C  CB    . TRP A 1 319  ? 42.560  40.845  -17.726 1.00 68.76  ? 347  TRP A CB    1 
ATOM   1842  C  CG    . TRP A 1 319  ? 41.280  40.076  -17.857 1.00 68.05  ? 347  TRP A CG    1 
ATOM   1843  C  CD1   . TRP A 1 319  ? 41.082  38.933  -18.574 1.00 74.06  ? 347  TRP A CD1   1 
ATOM   1844  C  CD2   . TRP A 1 319  ? 40.023  40.388  -17.244 1.00 77.32  ? 347  TRP A CD2   1 
ATOM   1845  N  NE1   . TRP A 1 319  ? 39.779  38.516  -18.450 1.00 69.33  ? 347  TRP A NE1   1 
ATOM   1846  C  CE2   . TRP A 1 319  ? 39.108  39.392  -17.638 1.00 69.08  ? 347  TRP A CE2   1 
ATOM   1847  C  CE3   . TRP A 1 319  ? 39.581  41.415  -16.403 1.00 68.56  ? 347  TRP A CE3   1 
ATOM   1848  C  CZ2   . TRP A 1 319  ? 37.780  39.393  -17.221 1.00 73.00  ? 347  TRP A CZ2   1 
ATOM   1849  C  CZ3   . TRP A 1 319  ? 38.262  41.412  -15.989 1.00 70.51  ? 347  TRP A CZ3   1 
ATOM   1850  C  CH2   . TRP A 1 319  ? 37.378  40.408  -16.397 1.00 68.94  ? 347  TRP A CH2   1 
ATOM   1851  N  N     . LEU A 1 320  ? 42.375  40.023  -14.316 1.00 42.30  ? 348  LEU A N     1 
ATOM   1852  C  CA    . LEU A 1 320  ? 41.584  40.311  -13.125 1.00 44.75  ? 348  LEU A CA    1 
ATOM   1853  C  C     . LEU A 1 320  ? 42.249  41.331  -12.201 1.00 72.72  ? 348  LEU A C     1 
ATOM   1854  O  O     . LEU A 1 320  ? 41.567  42.084  -11.504 1.00 60.05  ? 348  LEU A O     1 
ATOM   1855  C  CB    . LEU A 1 320  ? 41.314  39.014  -12.357 1.00 60.75  ? 348  LEU A CB    1 
ATOM   1856  C  CG    . LEU A 1 320  ? 40.339  39.080  -11.181 1.00 56.48  ? 348  LEU A CG    1 
ATOM   1857  C  CD1   . LEU A 1 320  ? 38.955  39.494  -11.657 1.00 64.61  ? 348  LEU A CD1   1 
ATOM   1858  C  CD2   . LEU A 1 320  ? 40.286  37.742  -10.458 1.00 77.58  ? 348  LEU A CD2   1 
ATOM   1859  N  N     . ASP A 1 321  ? 43.578  41.357  -12.201 1.00 74.29  ? 349  ASP A N     1 
ATOM   1860  C  CA    . ASP A 1 321  ? 44.322  42.229  -11.297 1.00 71.71  ? 349  ASP A CA    1 
ATOM   1861  C  C     . ASP A 1 321  ? 44.934  43.432  -12.010 1.00 56.51  ? 349  ASP A C     1 
ATOM   1862  O  O     . ASP A 1 321  ? 45.562  44.280  -11.378 1.00 77.03  ? 349  ASP A O     1 
ATOM   1863  C  CB    . ASP A 1 321  ? 45.421  41.437  -10.586 1.00 77.13  ? 349  ASP A CB    1 
ATOM   1864  C  CG    . ASP A 1 321  ? 44.867  40.443  -9.587  1.00 74.53  ? 349  ASP A CG    1 
ATOM   1865  O  OD1   . ASP A 1 321  ? 43.877  40.777  -8.903  1.00 70.93  ? 349  ASP A OD1   1 
ATOM   1866  O  OD2   . ASP A 1 321  ? 45.420  39.328  -9.486  1.00 72.64  ? 349  ASP A OD2   1 
ATOM   1867  N  N     . ILE A 1 322  ? 44.748  43.505  -13.323 1.00 55.32  ? 350  ILE A N     1 
ATOM   1868  C  CA    . ILE A 1 322  ? 45.312  44.599  -14.104 1.00 45.76  ? 350  ILE A CA    1 
ATOM   1869  C  C     . ILE A 1 322  ? 44.255  45.665  -14.383 1.00 71.07  ? 350  ILE A C     1 
ATOM   1870  O  O     . ILE A 1 322  ? 44.569  46.764  -14.839 1.00 74.08  ? 350  ILE A O     1 
ATOM   1871  C  CB    . ILE A 1 322  ? 45.908  44.090  -15.435 1.00 66.17  ? 350  ILE A CB    1 
ATOM   1872  C  CG1   . ILE A 1 322  ? 46.957  45.068  -15.971 1.00 55.90  ? 350  ILE A CG1   1 
ATOM   1873  C  CG2   . ILE A 1 322  ? 44.809  43.840  -16.455 1.00 42.26  ? 350  ILE A CG2   1 
ATOM   1874  C  CD1   . ILE A 1 322  ? 47.695  44.563  -17.192 1.00 76.00  ? 350  ILE A CD1   1 
ATOM   1875  N  N     . SER A 1 323  ? 42.999  45.335  -14.097 1.00 75.52  ? 351  SER A N     1 
ATOM   1876  C  CA    . SER A 1 323  ? 41.899  46.272  -14.297 1.00 67.42  ? 351  SER A CA    1 
ATOM   1877  C  C     . SER A 1 323  ? 40.977  46.296  -13.085 1.00 67.92  ? 351  SER A C     1 
ATOM   1878  O  O     . SER A 1 323  ? 41.176  45.548  -12.128 1.00 55.70  ? 351  SER A O     1 
ATOM   1879  C  CB    . SER A 1 323  ? 41.107  45.912  -15.554 1.00 76.74  ? 351  SER A CB    1 
ATOM   1880  O  OG    . SER A 1 323  ? 40.071  46.851  -15.786 1.00 74.64  ? 351  SER A OG    1 
ATOM   1881  N  N     . SER A 1 324  ? 39.965  47.158  -13.134 1.00 65.12  ? 352  SER A N     1 
ATOM   1882  C  CA    . SER A 1 324  ? 39.026  47.292  -12.027 1.00 56.55  ? 352  SER A CA    1 
ATOM   1883  C  C     . SER A 1 324  ? 37.717  47.944  -12.461 1.00 70.91  ? 352  SER A C     1 
ATOM   1884  O  O     . SER A 1 324  ? 37.610  48.477  -13.566 1.00 70.52  ? 352  SER A O     1 
ATOM   1885  C  CB    . SER A 1 324  ? 39.655  48.101  -10.892 1.00 65.59  ? 352  SER A CB    1 
ATOM   1886  O  OG    . SER A 1 324  ? 38.729  48.301  -9.840  1.00 65.40  ? 352  SER A OG    1 
ATOM   1887  N  N     . VAL A 1 325  ? 36.725  47.895  -11.578 1.00 71.34  ? 353  VAL A N     1 
ATOM   1888  C  CA    . VAL A 1 325  ? 35.436  48.522  -11.831 1.00 65.55  ? 353  VAL A CA    1 
ATOM   1889  C  C     . VAL A 1 325  ? 35.579  50.036  -11.658 1.00 66.91  ? 353  VAL A C     1 
ATOM   1890  O  O     . VAL A 1 325  ? 36.581  50.510  -11.122 1.00 74.50  ? 353  VAL A O     1 
ATOM   1891  C  CB    . VAL A 1 325  ? 34.345  47.959  -10.892 1.00 64.34  ? 353  VAL A CB    1 
ATOM   1892  C  CG1   . VAL A 1 325  ? 34.403  48.636  -9.533  1.00 55.08  ? 353  VAL A CG1   1 
ATOM   1893  C  CG2   . VAL A 1 325  ? 32.962  48.105  -11.515 1.00 73.10  ? 353  VAL A CG2   1 
ATOM   1894  N  N     . ASN A 1 326  ? 34.584  50.792  -12.113 1.00 45.04  ? 354  ASN A N     1 
ATOM   1895  C  CA    . ASN A 1 326  ? 34.687  52.249  -12.169 1.00 86.86  ? 354  ASN A CA    1 
ATOM   1896  C  C     . ASN A 1 326  ? 34.481  52.954  -10.830 1.00 93.44  ? 354  ASN A C     1 
ATOM   1897  O  O     . ASN A 1 326  ? 34.493  54.184  -10.769 1.00 69.97  ? 354  ASN A O     1 
ATOM   1898  C  CB    . ASN A 1 326  ? 33.686  52.799  -13.184 1.00 69.31  ? 354  ASN A CB    1 
ATOM   1899  C  CG    . ASN A 1 326  ? 33.753  52.078  -14.513 1.00 67.07  ? 354  ASN A CG    1 
ATOM   1900  O  OD1   . ASN A 1 326  ? 32.751  51.556  -14.999 1.00 76.58  ? 354  ASN A OD1   1 
ATOM   1901  N  ND2   . ASN A 1 326  ? 34.940  52.041  -15.106 1.00 55.94  ? 354  ASN A ND2   1 
ATOM   1902  N  N     . SER A 1 327  ? 34.287  52.180  -9.766  1.00 42.60  ? 355  SER A N     1 
ATOM   1903  C  CA    . SER A 1 327  ? 34.114  52.744  -8.430  1.00 42.91  ? 355  SER A CA    1 
ATOM   1904  C  C     . SER A 1 327  ? 35.350  53.531  -8.010  1.00 91.66  ? 355  SER A C     1 
ATOM   1905  O  O     . SER A 1 327  ? 36.466  53.181  -8.386  1.00 43.44  ? 355  SER A O     1 
ATOM   1906  C  CB    . SER A 1 327  ? 33.824  51.638  -7.412  1.00 67.73  ? 355  SER A CB    1 
ATOM   1907  O  OG    . SER A 1 327  ? 33.738  52.163  -6.099  1.00 75.74  ? 355  SER A OG    1 
ATOM   1908  N  N     . LEU A 1 328  ? 35.149  54.593  -7.235  1.00 84.05  ? 356  LEU A N     1 
ATOM   1909  C  CA    . LEU A 1 328  ? 36.261  55.435  -6.803  1.00 48.14  ? 356  LEU A CA    1 
ATOM   1910  C  C     . LEU A 1 328  ? 37.224  54.675  -5.896  1.00 45.67  ? 356  LEU A C     1 
ATOM   1911  O  O     . LEU A 1 328  ? 38.442  54.779  -6.043  1.00 48.49  ? 356  LEU A O     1 
ATOM   1912  C  CB    . LEU A 1 328  ? 35.750  56.686  -6.086  1.00 42.59  ? 356  LEU A CB    1 
ATOM   1913  C  CG    . LEU A 1 328  ? 36.841  57.631  -5.571  1.00 45.59  ? 356  LEU A CG    1 
ATOM   1914  C  CD1   . LEU A 1 328  ? 37.699  58.144  -6.719  1.00 85.26  ? 356  LEU A CD1   1 
ATOM   1915  C  CD2   . LEU A 1 328  ? 36.240  58.787  -4.788  1.00 45.71  ? 356  LEU A CD2   1 
ATOM   1916  N  N     . ALA A 1 329  ? 36.672  53.910  -4.959  1.00 48.60  ? 357  ALA A N     1 
ATOM   1917  C  CA    . ALA A 1 329  ? 37.481  53.113  -4.045  1.00 43.38  ? 357  ALA A CA    1 
ATOM   1918  C  C     . ALA A 1 329  ? 38.298  52.076  -4.806  1.00 41.68  ? 357  ALA A C     1 
ATOM   1919  O  O     . ALA A 1 329  ? 39.471  51.846  -4.505  1.00 55.82  ? 357  ALA A O     1 
ATOM   1920  C  CB    . ALA A 1 329  ? 36.597  52.435  -3.010  1.00 43.04  ? 357  ALA A CB    1 
ATOM   1921  N  N     . GLU A 1 330  ? 37.670  51.460  -5.801  1.00 40.46  ? 358  GLU A N     1 
ATOM   1922  C  CA    . GLU A 1 330  ? 38.311  50.412  -6.583  1.00 42.86  ? 358  GLU A CA    1 
ATOM   1923  C  C     . GLU A 1 330  ? 39.337  50.975  -7.561  1.00 56.96  ? 358  GLU A C     1 
ATOM   1924  O  O     . GLU A 1 330  ? 40.412  50.400  -7.744  1.00 72.46  ? 358  GLU A O     1 
ATOM   1925  C  CB    . GLU A 1 330  ? 37.258  49.599  -7.336  1.00 45.34  ? 358  GLU A CB    1 
ATOM   1926  C  CG    . GLU A 1 330  ? 36.302  48.843  -6.428  1.00 55.99  ? 358  GLU A CG    1 
ATOM   1927  C  CD    . GLU A 1 330  ? 36.993  47.751  -5.634  1.00 56.85  ? 358  GLU A CD    1 
ATOM   1928  O  OE1   . GLU A 1 330  ? 38.019  47.223  -6.111  1.00 48.65  ? 358  GLU A OE1   1 
ATOM   1929  O  OE2   . GLU A 1 330  ? 36.509  47.421  -4.530  1.00 66.57  ? 358  GLU A OE2   1 
ATOM   1930  N  N     . VAL A 1 331  ? 39.007  52.101  -8.185  1.00 86.52  ? 359  VAL A N     1 
ATOM   1931  C  CA    . VAL A 1 331  ? 39.911  52.719  -9.146  1.00 86.34  ? 359  VAL A CA    1 
ATOM   1932  C  C     . VAL A 1 331  ? 41.114  53.317  -8.409  1.00 47.08  ? 359  VAL A C     1 
ATOM   1933  O  O     . VAL A 1 331  ? 42.214  53.408  -8.963  1.00 46.17  ? 359  VAL A O     1 
ATOM   1934  C  CB    . VAL A 1 331  ? 39.186  53.798  -9.998  1.00 84.96  ? 359  VAL A CB    1 
ATOM   1935  C  CG1   . VAL A 1 331  ? 38.935  55.062  -9.196  1.00 84.88  ? 359  VAL A CG1   1 
ATOM   1936  C  CG2   . VAL A 1 331  ? 39.984  54.117  -11.244 1.00 43.63  ? 359  VAL A CG2   1 
ATOM   1937  N  N     . HIS A 1 332  ? 40.905  53.694  -7.149  1.00 90.06  ? 360  HIS A N     1 
ATOM   1938  C  CA    . HIS A 1 332  ? 41.990  54.176  -6.301  1.00 91.52  ? 360  HIS A CA    1 
ATOM   1939  C  C     . HIS A 1 332  ? 42.845  53.005  -5.836  1.00 56.47  ? 360  HIS A C     1 
ATOM   1940  O  O     . HIS A 1 332  ? 44.068  53.110  -5.757  1.00 64.53  ? 360  HIS A O     1 
ATOM   1941  C  CB    . HIS A 1 332  ? 41.442  54.946  -5.097  1.00 91.73  ? 360  HIS A CB    1 
ATOM   1942  C  CG    . HIS A 1 332  ? 42.497  55.406  -4.139  1.00 93.46  ? 360  HIS A CG    1 
ATOM   1943  N  ND1   . HIS A 1 332  ? 42.934  54.632  -3.086  1.00 43.88  ? 360  HIS A ND1   1 
ATOM   1944  C  CD2   . HIS A 1 332  ? 43.196  56.563  -4.071  1.00 42.64  ? 360  HIS A CD2   1 
ATOM   1945  C  CE1   . HIS A 1 332  ? 43.861  55.291  -2.413  1.00 60.84  ? 360  HIS A CE1   1 
ATOM   1946  N  NE2   . HIS A 1 332  ? 44.038  56.465  -2.990  1.00 48.34  ? 360  HIS A NE2   1 
ATOM   1947  N  N     . ARG A 1 333  ? 42.195  51.885  -5.534  1.00 46.70  ? 361  ARG A N     1 
ATOM   1948  C  CA    . ARG A 1 333  ? 42.908  50.674  -5.148  1.00 47.99  ? 361  ARG A CA    1 
ATOM   1949  C  C     . ARG A 1 333  ? 43.702  50.131  -6.331  1.00 44.12  ? 361  ARG A C     1 
ATOM   1950  O  O     . ARG A 1 333  ? 44.649  49.364  -6.158  1.00 56.48  ? 361  ARG A O     1 
ATOM   1951  C  CB    . ARG A 1 333  ? 41.935  49.612  -4.630  1.00 47.95  ? 361  ARG A CB    1 
ATOM   1952  C  CG    . ARG A 1 333  ? 42.600  48.486  -3.854  1.00 70.04  ? 361  ARG A CG    1 
ATOM   1953  C  CD    . ARG A 1 333  ? 41.614  47.376  -3.530  1.00 74.06  ? 361  ARG A CD    1 
ATOM   1954  N  NE    . ARG A 1 333  ? 41.167  46.676  -4.731  1.00 68.48  ? 361  ARG A NE    1 
ATOM   1955  C  CZ    . ARG A 1 333  ? 41.798  45.636  -5.267  1.00 85.03  ? 361  ARG A CZ    1 
ATOM   1956  N  NH1   . ARG A 1 333  ? 42.909  45.174  -4.710  1.00 87.39  ? 361  ARG A NH1   1 
ATOM   1957  N  NH2   . ARG A 1 333  ? 41.320  45.059  -6.361  1.00 86.54  ? 361  ARG A NH2   1 
ATOM   1958  N  N     . LEU A 1 334  ? 43.312  50.538  -7.536  1.00 44.01  ? 362  LEU A N     1 
ATOM   1959  C  CA    . LEU A 1 334  ? 43.987  50.094  -8.749  1.00 93.65  ? 362  LEU A CA    1 
ATOM   1960  C  C     . LEU A 1 334  ? 45.162  50.994  -9.123  1.00 40.27  ? 362  LEU A C     1 
ATOM   1961  O  O     . LEU A 1 334  ? 46.279  50.514  -9.309  1.00 46.21  ? 362  LEU A O     1 
ATOM   1962  C  CB    . LEU A 1 334  ? 43.003  50.028  -9.918  1.00 91.97  ? 362  LEU A CB    1 
ATOM   1963  C  CG    . LEU A 1 334  ? 43.600  49.520  -11.232 1.00 92.19  ? 362  LEU A CG    1 
ATOM   1964  C  CD1   . LEU A 1 334  ? 43.984  48.053  -11.113 1.00 47.99  ? 362  LEU A CD1   1 
ATOM   1965  C  CD2   . LEU A 1 334  ? 42.640  49.737  -12.391 1.00 48.75  ? 362  LEU A CD2   1 
ATOM   1966  N  N     . TYR A 1 335  ? 44.912  52.296  -9.235  1.00 93.35  ? 363  TYR A N     1 
ATOM   1967  C  CA    . TYR A 1 335  ? 45.936  53.222  -9.718  1.00 40.02  ? 363  TYR A CA    1 
ATOM   1968  C  C     . TYR A 1 335  ? 46.866  53.732  -8.619  1.00 41.76  ? 363  TYR A C     1 
ATOM   1969  O  O     . TYR A 1 335  ? 48.017  54.076  -8.887  1.00 43.14  ? 363  TYR A O     1 
ATOM   1970  C  CB    . TYR A 1 335  ? 45.284  54.411  -10.423 1.00 49.96  ? 363  TYR A CB    1 
ATOM   1971  C  CG    . TYR A 1 335  ? 44.711  54.082  -11.781 1.00 44.08  ? 363  TYR A CG    1 
ATOM   1972  C  CD1   . TYR A 1 335  ? 43.402  53.645  -11.915 1.00 87.88  ? 363  TYR A CD1   1 
ATOM   1973  C  CD2   . TYR A 1 335  ? 45.480  54.210  -12.931 1.00 49.81  ? 363  TYR A CD2   1 
ATOM   1974  C  CE1   . TYR A 1 335  ? 42.873  53.343  -13.153 1.00 44.47  ? 363  TYR A CE1   1 
ATOM   1975  C  CE2   . TYR A 1 335  ? 44.958  53.911  -14.177 1.00 56.10  ? 363  TYR A CE2   1 
ATOM   1976  C  CZ    . TYR A 1 335  ? 43.653  53.479  -14.281 1.00 40.23  ? 363  TYR A CZ    1 
ATOM   1977  O  OH    . TYR A 1 335  ? 43.122  53.178  -15.515 1.00 42.93  ? 363  TYR A OH    1 
ATOM   1978  N  N     . VAL A 1 336  ? 46.367  53.793  -7.390  1.00 41.87  ? 364  VAL A N     1 
ATOM   1979  C  CA    . VAL A 1 336  ? 47.187  54.231  -6.264  1.00 43.69  ? 364  VAL A CA    1 
ATOM   1980  C  C     . VAL A 1 336  ? 47.644  53.028  -5.446  1.00 45.30  ? 364  VAL A C     1 
ATOM   1981  O  O     . VAL A 1 336  ? 48.801  52.951  -5.028  1.00 47.36  ? 364  VAL A O     1 
ATOM   1982  C  CB    . VAL A 1 336  ? 46.427  55.216  -5.357  1.00 43.59  ? 364  VAL A CB    1 
ATOM   1983  C  CG1   . VAL A 1 336  ? 47.290  55.628  -4.172  1.00 45.29  ? 364  VAL A CG1   1 
ATOM   1984  C  CG2   . VAL A 1 336  ? 45.992  56.433  -6.154  1.00 41.86  ? 364  VAL A CG2   1 
ATOM   1985  N  N     . GLY A 1 337  ? 46.728  52.091  -5.225  1.00 48.06  ? 365  GLY A N     1 
ATOM   1986  C  CA    . GLY A 1 337  ? 47.052  50.848  -4.552  1.00 74.76  ? 365  GLY A CA    1 
ATOM   1987  C  C     . GLY A 1 337  ? 47.424  51.011  -3.093  1.00 69.61  ? 365  GLY A C     1 
ATOM   1988  O  O     . GLY A 1 337  ? 48.054  50.132  -2.505  1.00 75.68  ? 365  GLY A O     1 
ATOM   1989  N  N     . GLY A 1 338  ? 47.037  52.137  -2.504  1.00 47.41  ? 366  GLY A N     1 
ATOM   1990  C  CA    . GLY A 1 338  ? 47.301  52.383  -1.099  1.00 49.11  ? 366  GLY A CA    1 
ATOM   1991  C  C     . GLY A 1 338  ? 46.309  51.657  -0.213  1.00 56.38  ? 366  GLY A C     1 
ATOM   1992  O  O     . GLY A 1 338  ? 45.691  50.681  -0.638  1.00 65.33  ? 366  GLY A O     1 
ATOM   1993  N  N     . PRO A 1 339  ? 46.149  52.129  1.031   1.00 65.11  ? 367  PRO A N     1 
ATOM   1994  C  CA    . PRO A 1 339  ? 45.160  51.559  1.951   1.00 64.85  ? 367  PRO A CA    1 
ATOM   1995  C  C     . PRO A 1 339  ? 43.736  51.825  1.469   1.00 70.26  ? 367  PRO A C     1 
ATOM   1996  O  O     . PRO A 1 339  ? 43.490  52.860  0.849   1.00 75.25  ? 367  PRO A O     1 
ATOM   1997  C  CB    . PRO A 1 339  ? 45.445  52.286  3.268   1.00 67.75  ? 367  PRO A CB    1 
ATOM   1998  C  CG    . PRO A 1 339  ? 46.066  53.575  2.853   1.00 69.24  ? 367  PRO A CG    1 
ATOM   1999  C  CD    . PRO A 1 339  ? 46.882  53.255  1.635   1.00 60.72  ? 367  PRO A CD    1 
ATOM   2000  N  N     . PRO A 1 340  ? 42.808  50.897  1.748   1.00 70.37  ? 368  PRO A N     1 
ATOM   2001  C  CA    . PRO A 1 340  ? 41.419  51.034  1.299   1.00 56.61  ? 368  PRO A CA    1 
ATOM   2002  C  C     . PRO A 1 340  ? 40.726  52.235  1.934   1.00 70.33  ? 368  PRO A C     1 
ATOM   2003  O  O     . PRO A 1 340  ? 40.705  52.356  3.159   1.00 55.70  ? 368  PRO A O     1 
ATOM   2004  C  CB    . PRO A 1 340  ? 40.771  49.724  1.757   1.00 72.52  ? 368  PRO A CB    1 
ATOM   2005  C  CG    . PRO A 1 340  ? 41.612  49.268  2.899   1.00 70.02  ? 368  PRO A CG    1 
ATOM   2006  C  CD    . PRO A 1 340  ? 43.011  49.681  2.553   1.00 68.87  ? 368  PRO A CD    1 
ATOM   2007  N  N     . LEU A 1 341  ? 40.173  53.114  1.104   1.00 70.46  ? 369  LEU A N     1 
ATOM   2008  C  CA    . LEU A 1 341  ? 39.482  54.296  1.602   1.00 74.00  ? 369  LEU A CA    1 
ATOM   2009  C  C     . LEU A 1 341  ? 38.121  53.918  2.178   1.00 68.59  ? 369  LEU A C     1 
ATOM   2010  O  O     . LEU A 1 341  ? 37.374  53.141  1.582   1.00 69.36  ? 369  LEU A O     1 
ATOM   2011  C  CB    . LEU A 1 341  ? 39.332  55.343  0.493   1.00 64.88  ? 369  LEU A CB    1 
ATOM   2012  C  CG    . LEU A 1 341  ? 38.638  54.947  -0.812  1.00 40.87  ? 369  LEU A CG    1 
ATOM   2013  C  CD1   . LEU A 1 341  ? 37.163  55.318  -0.782  1.00 65.19  ? 369  LEU A CD1   1 
ATOM   2014  C  CD2   . LEU A 1 341  ? 39.331  55.592  -2.002  1.00 92.50  ? 369  LEU A CD2   1 
ATOM   2015  N  N     . GLU A 1 342  ? 37.810  54.466  3.348   1.00 73.77  ? 370  GLU A N     1 
ATOM   2016  C  CA    . GLU A 1 342  ? 36.564  54.151  4.034   1.00 72.83  ? 370  GLU A CA    1 
ATOM   2017  C  C     . GLU A 1 342  ? 35.394  54.905  3.415   1.00 74.59  ? 370  GLU A C     1 
ATOM   2018  O  O     . GLU A 1 342  ? 35.521  56.075  3.052   1.00 72.27  ? 370  GLU A O     1 
ATOM   2019  C  CB    . GLU A 1 342  ? 36.677  54.481  5.524   1.00 68.90  ? 370  GLU A CB    1 
ATOM   2020  C  CG    . GLU A 1 342  ? 35.456  54.096  6.345   1.00 87.96  ? 370  GLU A CG    1 
ATOM   2021  C  CD    . GLU A 1 342  ? 35.589  54.482  7.805   1.00 86.60  ? 370  GLU A CD    1 
ATOM   2022  O  OE1   . GLU A 1 342  ? 36.598  55.126  8.161   1.00 87.53  ? 370  GLU A OE1   1 
ATOM   2023  O  OE2   . GLU A 1 342  ? 34.685  54.141  8.597   1.00 91.25  ? 370  GLU A OE2   1 
ATOM   2024  N  N     . LYS A 1 343  ? 34.258  54.228  3.291   1.00 69.13  ? 371  LYS A N     1 
ATOM   2025  C  CA    . LYS A 1 343  ? 33.052  54.858  2.771   1.00 70.91  ? 371  LYS A CA    1 
ATOM   2026  C  C     . LYS A 1 343  ? 32.047  55.068  3.900   1.00 76.31  ? 371  LYS A C     1 
ATOM   2027  O  O     . LYS A 1 343  ? 32.074  54.352  4.901   1.00 72.10  ? 371  LYS A O     1 
ATOM   2028  C  CB    . LYS A 1 343  ? 32.439  54.012  1.654   1.00 68.56  ? 371  LYS A CB    1 
ATOM   2029  C  CG    . LYS A 1 343  ? 31.628  54.812  0.648   1.00 77.68  ? 371  LYS A CG    1 
ATOM   2030  C  CD    . LYS A 1 343  ? 32.494  55.858  -0.042  1.00 73.13  ? 371  LYS A CD    1 
ATOM   2031  C  CE    . LYS A 1 343  ? 31.687  56.683  -1.033  1.00 69.60  ? 371  LYS A CE    1 
ATOM   2032  N  NZ    . LYS A 1 343  ? 32.532  57.684  -1.742  1.00 65.08  ? 371  LYS A NZ    1 
ATOM   2033  N  N     . GLU A 1 344  ? 31.171  56.056  3.737   1.00 69.28  ? 372  GLU A N     1 
ATOM   2034  C  CA    . GLU A 1 344  ? 30.167  56.375  4.747   1.00 71.65  ? 372  GLU A CA    1 
ATOM   2035  C  C     . GLU A 1 344  ? 29.238  55.191  5.000   1.00 77.41  ? 372  GLU A C     1 
ATOM   2036  O  O     . GLU A 1 344  ? 28.470  54.801  4.121   1.00 92.07  ? 372  GLU A O     1 
ATOM   2037  C  CB    . GLU A 1 344  ? 29.355  57.602  4.326   1.00 76.99  ? 372  GLU A CB    1 
ATOM   2038  C  CG    . GLU A 1 344  ? 28.265  58.000  5.309   1.00 72.43  ? 372  GLU A CG    1 
ATOM   2039  C  CD    . GLU A 1 344  ? 28.818  58.479  6.637   1.00 70.82  ? 372  GLU A CD    1 
ATOM   2040  O  OE1   . GLU A 1 344  ? 28.092  58.395  7.650   1.00 77.42  ? 372  GLU A OE1   1 
ATOM   2041  O  OE2   . GLU A 1 344  ? 29.976  58.946  6.669   1.00 71.91  ? 372  GLU A OE2   1 
ATOM   2042  N  N     . PRO A 1 345  ? 29.308  54.616  6.211   1.00 72.77  ? 373  PRO A N     1 
ATOM   2043  C  CA    . PRO A 1 345  ? 28.544  53.418  6.576   1.00 71.56  ? 373  PRO A CA    1 
ATOM   2044  C  C     . PRO A 1 345  ? 27.053  53.689  6.762   1.00 77.43  ? 373  PRO A C     1 
ATOM   2045  O  O     . PRO A 1 345  ? 26.246  52.762  6.677   1.00 69.43  ? 373  PRO A O     1 
ATOM   2046  C  CB    . PRO A 1 345  ? 29.185  52.992  7.898   1.00 66.65  ? 373  PRO A CB    1 
ATOM   2047  C  CG    . PRO A 1 345  ? 29.674  54.260  8.489   1.00 64.39  ? 373  PRO A CG    1 
ATOM   2048  C  CD    . PRO A 1 345  ? 30.131  55.105  7.331   1.00 71.13  ? 373  PRO A CD    1 
ATOM   2049  N  N     . ARG A 1 346  ? 26.695  54.943  7.013   1.00 66.93  ? 374  ARG A N     1 
ATOM   2050  C  CA    . ARG A 1 346  ? 25.301  55.304  7.241   1.00 55.67  ? 374  ARG A CA    1 
ATOM   2051  C  C     . ARG A 1 346  ? 24.641  55.848  5.978   1.00 43.74  ? 374  ARG A C     1 
ATOM   2052  O  O     . ARG A 1 346  ? 23.416  55.973  5.922   1.00 42.89  ? 374  ARG A O     1 
ATOM   2053  C  CB    . ARG A 1 346  ? 25.194  56.333  8.367   1.00 55.61  ? 374  ARG A CB    1 
ATOM   2054  C  CG    . ARG A 1 346  ? 25.701  55.842  9.712   1.00 67.96  ? 374  ARG A CG    1 
ATOM   2055  C  CD    . ARG A 1 346  ? 25.661  56.951  10.752  1.00 70.56  ? 374  ARG A CD    1 
ATOM   2056  N  NE    . ARG A 1 346  ? 24.313  57.479  10.939  1.00 68.24  ? 374  ARG A NE    1 
ATOM   2057  C  CZ    . ARG A 1 346  ? 24.010  58.477  11.762  1.00 76.03  ? 374  ARG A CZ    1 
ATOM   2058  N  NH1   . ARG A 1 346  ? 24.961  59.061  12.478  1.00 76.82  ? 374  ARG A NH1   1 
ATOM   2059  N  NH2   . ARG A 1 346  ? 22.755  58.893  11.869  1.00 68.04  ? 374  ARG A NH2   1 
ATOM   2060  N  N     . GLU A 1 347  ? 25.460  56.162  4.975   1.00 49.93  ? 375  GLU A N     1 
ATOM   2061  C  CA    . GLU A 1 347  ? 24.987  56.761  3.727   1.00 46.04  ? 375  GLU A CA    1 
ATOM   2062  C  C     . GLU A 1 347  ? 24.116  57.979  4.016   1.00 60.58  ? 375  GLU A C     1 
ATOM   2063  O  O     . GLU A 1 347  ? 23.032  58.130  3.456   1.00 64.97  ? 375  GLU A O     1 
ATOM   2064  C  CB    . GLU A 1 347  ? 24.217  55.736  2.891   1.00 42.39  ? 375  GLU A CB    1 
ATOM   2065  C  CG    . GLU A 1 347  ? 25.068  54.579  2.387   1.00 49.84  ? 375  GLU A CG    1 
ATOM   2066  C  CD    . GLU A 1 347  ? 24.261  53.544  1.626   1.00 56.77  ? 375  GLU A CD    1 
ATOM   2067  O  OE1   . GLU A 1 347  ? 23.038  53.444  1.866   1.00 68.43  ? 375  GLU A OE1   1 
ATOM   2068  O  OE2   . GLU A 1 347  ? 24.848  52.831  0.786   1.00 56.86  ? 375  GLU A OE2   1 
ATOM   2069  N  N     . LEU A 1 348  ? 24.615  58.844  4.893   1.00 55.36  ? 376  LEU A N     1 
ATOM   2070  C  CA    . LEU A 1 348  ? 23.835  59.937  5.462   1.00 43.77  ? 376  LEU A CA    1 
ATOM   2071  C  C     . LEU A 1 348  ? 23.303  60.931  4.430   1.00 42.67  ? 376  LEU A C     1 
ATOM   2072  O  O     . LEU A 1 348  ? 22.255  61.542  4.638   1.00 45.07  ? 376  LEU A O     1 
ATOM   2073  C  CB    . LEU A 1 348  ? 24.678  60.679  6.499   1.00 44.81  ? 376  LEU A CB    1 
ATOM   2074  C  CG    . LEU A 1 348  ? 24.042  60.884  7.874   1.00 46.99  ? 376  LEU A CG    1 
ATOM   2075  C  CD1   . LEU A 1 348  ? 23.471  59.579  8.398   1.00 48.09  ? 376  LEU A CD1   1 
ATOM   2076  C  CD2   . LEU A 1 348  ? 25.064  61.447  8.847   1.00 49.94  ? 376  LEU A CD2   1 
ATOM   2077  N  N     . PHE A 1 349  ? 24.017  61.092  3.322   1.00 56.56  ? 377  PHE A N     1 
ATOM   2078  C  CA    . PHE A 1 349  ? 23.621  62.067  2.310   1.00 65.43  ? 377  PHE A CA    1 
ATOM   2079  C  C     . PHE A 1 349  ? 22.433  61.597  1.479   1.00 64.64  ? 377  PHE A C     1 
ATOM   2080  O  O     . PHE A 1 349  ? 21.742  62.408  0.863   1.00 64.00  ? 377  PHE A O     1 
ATOM   2081  C  CB    . PHE A 1 349  ? 24.799  62.396  1.389   1.00 67.21  ? 377  PHE A CB    1 
ATOM   2082  C  CG    . PHE A 1 349  ? 25.708  63.461  1.930   1.00 47.84  ? 377  PHE A CG    1 
ATOM   2083  C  CD1   . PHE A 1 349  ? 26.889  63.127  2.573   1.00 56.10  ? 377  PHE A CD1   1 
ATOM   2084  C  CD2   . PHE A 1 349  ? 25.376  64.799  1.804   1.00 45.29  ? 377  PHE A CD2   1 
ATOM   2085  C  CE1   . PHE A 1 349  ? 27.725  64.109  3.074   1.00 60.21  ? 377  PHE A CE1   1 
ATOM   2086  C  CE2   . PHE A 1 349  ? 26.206  65.784  2.303   1.00 42.40  ? 377  PHE A CE2   1 
ATOM   2087  C  CZ    . PHE A 1 349  ? 27.382  65.439  2.939   1.00 40.35  ? 377  PHE A CZ    1 
ATOM   2088  N  N     . VAL A 1 350  ? 22.190  60.291  1.464   1.00 56.24  ? 378  VAL A N     1 
ATOM   2089  C  CA    . VAL A 1 350  ? 21.090  59.743  0.677   1.00 47.92  ? 378  VAL A CA    1 
ATOM   2090  C  C     . VAL A 1 350  ? 20.034  59.075  1.552   1.00 47.85  ? 378  VAL A C     1 
ATOM   2091  O  O     . VAL A 1 350  ? 18.902  58.865  1.118   1.00 48.84  ? 378  VAL A O     1 
ATOM   2092  C  CB    . VAL A 1 350  ? 21.596  58.723  -0.365  1.00 45.58  ? 378  VAL A CB    1 
ATOM   2093  C  CG1   . VAL A 1 350  ? 22.568  59.388  -1.327  1.00 49.77  ? 378  VAL A CG1   1 
ATOM   2094  C  CG2   . VAL A 1 350  ? 22.247  57.534  0.321   1.00 92.93  ? 378  VAL A CG2   1 
ATOM   2095  N  N     . LYS A 1 351  ? 20.406  58.751  2.786   1.00 47.67  ? 379  LYS A N     1 
ATOM   2096  C  CA    . LYS A 1 351  ? 19.518  58.026  3.688   1.00 55.79  ? 379  LYS A CA    1 
ATOM   2097  C  C     . LYS A 1 351  ? 18.993  58.928  4.801   1.00 48.10  ? 379  LYS A C     1 
ATOM   2098  O  O     . LYS A 1 351  ? 17.916  58.690  5.350   1.00 55.27  ? 379  LYS A O     1 
ATOM   2099  C  CB    . LYS A 1 351  ? 20.245  56.819  4.290   1.00 69.67  ? 379  LYS A CB    1 
ATOM   2100  C  CG    . LYS A 1 351  ? 19.338  55.805  4.967   1.00 70.41  ? 379  LYS A CG    1 
ATOM   2101  C  CD    . LYS A 1 351  ? 18.532  55.019  3.946   1.00 72.97  ? 379  LYS A CD    1 
ATOM   2102  C  CE    . LYS A 1 351  ? 19.442  54.240  3.008   1.00 76.01  ? 379  LYS A CE    1 
ATOM   2103  N  NZ    . LYS A 1 351  ? 18.669  53.457  2.005   1.00 71.65  ? 379  LYS A NZ    1 
ATOM   2104  N  N     . GLY A 1 352  ? 19.755  59.966  5.128   1.00 45.80  ? 380  GLY A N     1 
ATOM   2105  C  CA    . GLY A 1 352  ? 19.414  60.833  6.240   1.00 47.47  ? 380  GLY A CA    1 
ATOM   2106  C  C     . GLY A 1 352  ? 18.898  62.198  5.832   1.00 47.37  ? 380  GLY A C     1 
ATOM   2107  O  O     . GLY A 1 352  ? 18.973  62.585  4.666   1.00 45.87  ? 380  GLY A O     1 
ATOM   2108  N  N     . THR A 1 353  ? 18.371  62.931  6.807   1.00 49.18  ? 381  THR A N     1 
ATOM   2109  C  CA    . THR A 1 353  ? 17.847  64.268  6.567   1.00 44.14  ? 381  THR A CA    1 
ATOM   2110  C  C     . THR A 1 353  ? 18.937  65.316  6.743   1.00 48.75  ? 381  THR A C     1 
ATOM   2111  O  O     . THR A 1 353  ? 20.107  64.983  6.920   1.00 68.06  ? 381  THR A O     1 
ATOM   2112  C  CB    . THR A 1 353  ? 16.676  64.595  7.513   1.00 71.23  ? 381  THR A CB    1 
ATOM   2113  O  OG1   . THR A 1 353  ? 17.118  64.504  8.874   1.00 56.41  ? 381  THR A OG1   1 
ATOM   2114  C  CG2   . THR A 1 353  ? 15.526  63.625  7.293   1.00 75.40  ? 381  THR A CG2   1 
ATOM   2115  N  N     . MET A 1 354  ? 18.546  66.584  6.695   1.00 49.91  ? 382  MET A N     1 
ATOM   2116  C  CA    . MET A 1 354  ? 19.485  67.679  6.898   1.00 40.01  ? 382  MET A CA    1 
ATOM   2117  C  C     . MET A 1 354  ? 19.874  67.777  8.372   1.00 69.55  ? 382  MET A C     1 
ATOM   2118  O  O     . MET A 1 354  ? 20.945  68.281  8.710   1.00 69.82  ? 382  MET A O     1 
ATOM   2119  C  CB    . MET A 1 354  ? 18.878  68.999  6.414   1.00 60.10  ? 382  MET A CB    1 
ATOM   2120  C  CG    . MET A 1 354  ? 19.849  70.169  6.391   1.00 66.58  ? 382  MET A CG    1 
ATOM   2121  S  SD    . MET A 1 354  ? 21.076  70.037  5.079   1.00 48.24  ? 382  MET A SD    1 
ATOM   2122  C  CE    . MET A 1 354  ? 20.039  70.220  3.631   1.00 47.34  ? 382  MET A CE    1 
ATOM   2123  N  N     . LYS A 1 355  ? 18.996  67.282  9.240   1.00 65.73  ? 383  LYS A N     1 
ATOM   2124  C  CA    . LYS A 1 355  ? 19.214  67.324  10.684  1.00 65.74  ? 383  LYS A CA    1 
ATOM   2125  C  C     . LYS A 1 355  ? 20.443  66.527  11.111  1.00 56.13  ? 383  LYS A C     1 
ATOM   2126  O  O     . LYS A 1 355  ? 21.332  67.052  11.782  1.00 64.17  ? 383  LYS A O     1 
ATOM   2127  C  CB    . LYS A 1 355  ? 17.977  66.800  11.420  1.00 74.52  ? 383  LYS A CB    1 
ATOM   2128  C  CG    . LYS A 1 355  ? 18.170  66.616  12.919  1.00 68.63  ? 383  LYS A CG    1 
ATOM   2129  C  CD    . LYS A 1 355  ? 16.987  65.890  13.544  1.00 76.42  ? 383  LYS A CD    1 
ATOM   2130  C  CE    . LYS A 1 355  ? 17.223  65.602  15.018  1.00 68.53  ? 383  LYS A CE    1 
ATOM   2131  N  NZ    . LYS A 1 355  ? 16.104  64.822  15.617  1.00 68.35  ? 383  LYS A NZ    1 
ATOM   2132  N  N     . ASP A 1 356  ? 20.493  65.258  10.719  1.00 55.90  ? 384  ASP A N     1 
ATOM   2133  C  CA    . ASP A 1 356  ? 21.585  64.378  11.124  1.00 56.65  ? 384  ASP A CA    1 
ATOM   2134  C  C     . ASP A 1 356  ? 22.862  64.625  10.323  1.00 55.76  ? 384  ASP A C     1 
ATOM   2135  O  O     . ASP A 1 356  ? 23.880  63.972  10.551  1.00 69.92  ? 384  ASP A O     1 
ATOM   2136  C  CB    . ASP A 1 356  ? 21.161  62.913  11.000  1.00 55.24  ? 384  ASP A CB    1 
ATOM   2137  C  CG    . ASP A 1 356  ? 20.375  62.639  9.735   1.00 64.64  ? 384  ASP A CG    1 
ATOM   2138  O  OD1   . ASP A 1 356  ? 19.624  63.533  9.294   1.00 69.34  ? 384  ASP A OD1   1 
ATOM   2139  O  OD2   . ASP A 1 356  ? 20.505  61.526  9.183   1.00 69.17  ? 384  ASP A OD2   1 
ATOM   2140  N  N     . ILE A 1 357  ? 22.808  65.569  9.388   1.00 67.35  ? 385  ILE A N     1 
ATOM   2141  C  CA    . ILE A 1 357  ? 23.998  65.967  8.646   1.00 48.62  ? 385  ILE A CA    1 
ATOM   2142  C  C     . ILE A 1 357  ? 24.801  66.984  9.452   1.00 66.31  ? 385  ILE A C     1 
ATOM   2143  O  O     . ILE A 1 357  ? 26.023  66.880  9.558   1.00 68.41  ? 385  ILE A O     1 
ATOM   2144  C  CB    . ILE A 1 357  ? 23.641  66.553  7.266   1.00 47.65  ? 385  ILE A CB    1 
ATOM   2145  C  CG1   . ILE A 1 357  ? 23.234  65.430  6.310   1.00 46.04  ? 385  ILE A CG1   1 
ATOM   2146  C  CG2   . ILE A 1 357  ? 24.813  67.328  6.686   1.00 46.89  ? 385  ILE A CG2   1 
ATOM   2147  C  CD1   . ILE A 1 357  ? 22.911  65.902  4.909   1.00 49.01  ? 385  ILE A CD1   1 
ATOM   2148  N  N     . ARG A 1 358  ? 24.104  67.956  10.033  1.00 66.28  ? 386  ARG A N     1 
ATOM   2149  C  CA    . ARG A 1 358  ? 24.748  68.967  10.865  1.00 69.90  ? 386  ARG A CA    1 
ATOM   2150  C  C     . ARG A 1 358  ? 25.353  68.341  12.118  1.00 69.35  ? 386  ARG A C     1 
ATOM   2151  O  O     . ARG A 1 358  ? 26.369  68.814  12.630  1.00 68.57  ? 386  ARG A O     1 
ATOM   2152  C  CB    . ARG A 1 358  ? 23.751  70.061  11.253  1.00 56.51  ? 386  ARG A CB    1 
ATOM   2153  C  CG    . ARG A 1 358  ? 23.160  70.822  10.075  1.00 56.04  ? 386  ARG A CG    1 
ATOM   2154  C  CD    . ARG A 1 358  ? 22.311  71.990  10.551  1.00 76.02  ? 386  ARG A CD    1 
ATOM   2155  N  NE    . ARG A 1 358  ? 21.731  72.744  9.443   1.00 73.94  ? 386  ARG A NE    1 
ATOM   2156  C  CZ    . ARG A 1 358  ? 20.517  72.528  8.948   1.00 73.52  ? 386  ARG A CZ    1 
ATOM   2157  N  NH1   . ARG A 1 358  ? 19.750  71.577  9.462   1.00 70.98  ? 386  ARG A NH1   1 
ATOM   2158  N  NH2   . ARG A 1 358  ? 20.069  73.264  7.939   1.00 75.80  ? 386  ARG A NH2   1 
ATOM   2159  N  N     . GLU A 1 359  ? 24.724  67.276  12.606  1.00 67.27  ? 387  GLU A N     1 
ATOM   2160  C  CA    . GLU A 1 359  ? 25.217  66.561  13.777  1.00 77.73  ? 387  GLU A CA    1 
ATOM   2161  C  C     . GLU A 1 359  ? 26.549  65.880  13.480  1.00 69.28  ? 387  GLU A C     1 
ATOM   2162  O  O     . GLU A 1 359  ? 27.390  65.725  14.366  1.00 71.40  ? 387  GLU A O     1 
ATOM   2163  C  CB    . GLU A 1 359  ? 24.191  65.527  14.246  1.00 70.57  ? 387  GLU A CB    1 
ATOM   2164  C  CG    . GLU A 1 359  ? 22.826  66.110  14.574  1.00 73.31  ? 387  GLU A CG    1 
ATOM   2165  C  CD    . GLU A 1 359  ? 21.818  65.047  14.964  1.00 81.68  ? 387  GLU A CD    1 
ATOM   2166  O  OE1   . GLU A 1 359  ? 22.195  63.857  15.018  1.00 93.35  ? 387  GLU A OE1   1 
ATOM   2167  O  OE2   . GLU A 1 359  ? 20.648  65.402  15.218  1.00 90.52  ? 387  GLU A OE2   1 
ATOM   2168  N  N     . ASN A 1 360  ? 26.732  65.476  12.228  1.00 67.32  ? 388  ASN A N     1 
ATOM   2169  C  CA    . ASN A 1 360  ? 27.961  64.820  11.802  1.00 55.44  ? 388  ASN A CA    1 
ATOM   2170  C  C     . ASN A 1 360  ? 28.649  65.591  10.680  1.00 77.48  ? 388  ASN A C     1 
ATOM   2171  O  O     . ASN A 1 360  ? 29.200  64.999  9.753   1.00 49.72  ? 388  ASN A O     1 
ATOM   2172  C  CB    . ASN A 1 360  ? 27.669  63.388  11.355  1.00 69.06  ? 388  ASN A CB    1 
ATOM   2173  C  CG    . ASN A 1 360  ? 26.903  62.598  12.399  1.00 73.49  ? 388  ASN A CG    1 
ATOM   2174  O  OD1   . ASN A 1 360  ? 25.804  62.108  12.140  1.00 69.40  ? 388  ASN A OD1   1 
ATOM   2175  N  ND2   . ASN A 1 360  ? 27.480  62.474  13.588  1.00 76.40  ? 388  ASN A ND2   1 
ATOM   2176  N  N     . PHE A 1 361  ? 28.612  66.917  10.781  1.00 71.78  ? 389  PHE A N     1 
ATOM   2177  C  CA    . PHE A 1 361  ? 29.162  67.802  9.757   1.00 69.92  ? 389  PHE A CA    1 
ATOM   2178  C  C     . PHE A 1 361  ? 30.663  67.614  9.552   1.00 55.07  ? 389  PHE A C     1 
ATOM   2179  O  O     . PHE A 1 361  ? 31.130  67.463  8.420   1.00 66.33  ? 389  PHE A O     1 
ATOM   2180  C  CB    . PHE A 1 361  ? 28.866  69.260  10.118  1.00 56.42  ? 389  PHE A CB    1 
ATOM   2181  C  CG    . PHE A 1 361  ? 29.701  70.256  9.365   1.00 65.44  ? 389  PHE A CG    1 
ATOM   2182  C  CD1   . PHE A 1 361  ? 29.451  70.524  8.030   1.00 45.10  ? 389  PHE A CD1   1 
ATOM   2183  C  CD2   . PHE A 1 361  ? 30.730  70.935  9.998   1.00 60.82  ? 389  PHE A CD2   1 
ATOM   2184  C  CE1   . PHE A 1 361  ? 30.218  71.443  7.338   1.00 40.74  ? 389  PHE A CE1   1 
ATOM   2185  C  CE2   . PHE A 1 361  ? 31.499  71.854  9.312   1.00 65.77  ? 389  PHE A CE2   1 
ATOM   2186  C  CZ    . PHE A 1 361  ? 31.242  72.109  7.980   1.00 67.15  ? 389  PHE A CZ    1 
ATOM   2187  N  N     . GLN A 1 362  ? 31.410  67.630  10.650  1.00 42.83  ? 390  GLN A N     1 
ATOM   2188  C  CA    . GLN A 1 362  ? 32.862  67.518  10.596  1.00 43.17  ? 390  GLN A CA    1 
ATOM   2189  C  C     . GLN A 1 362  ? 33.293  66.230  9.902   1.00 68.29  ? 390  GLN A C     1 
ATOM   2190  O  O     . GLN A 1 362  ? 34.173  66.236  9.036   1.00 66.43  ? 390  GLN A O     1 
ATOM   2191  C  CB    . GLN A 1 362  ? 33.451  67.577  12.007  1.00 48.21  ? 390  GLN A CB    1 
ATOM   2192  C  CG    . GLN A 1 362  ? 34.814  68.239  12.082  1.00 68.38  ? 390  GLN A CG    1 
ATOM   2193  C  CD    . GLN A 1 362  ? 34.743  69.738  11.864  1.00 55.66  ? 390  GLN A CD    1 
ATOM   2194  O  OE1   . GLN A 1 362  ? 35.695  70.352  11.384  1.00 66.82  ? 390  GLN A OE1   1 
ATOM   2195  N  NE2   . GLN A 1 362  ? 33.614  70.336  12.224  1.00 48.24  ? 390  GLN A NE2   1 
ATOM   2196  N  N     . ASP A 1 363  ? 32.653  65.129  10.281  1.00 67.31  ? 391  ASP A N     1 
ATOM   2197  C  CA    . ASP A 1 363  ? 32.977  63.821  9.731   1.00 56.82  ? 391  ASP A CA    1 
ATOM   2198  C  C     . ASP A 1 363  ? 32.671  63.751  8.237   1.00 48.78  ? 391  ASP A C     1 
ATOM   2199  O  O     . ASP A 1 363  ? 33.482  63.254  7.461   1.00 56.88  ? 391  ASP A O     1 
ATOM   2200  C  CB    . ASP A 1 363  ? 32.217  62.727  10.482  1.00 68.87  ? 391  ASP A CB    1 
ATOM   2201  C  CG    . ASP A 1 363  ? 32.405  62.817  11.984  1.00 68.54  ? 391  ASP A CG    1 
ATOM   2202  O  OD1   . ASP A 1 363  ? 31.525  63.389  12.661  1.00 68.63  ? 391  ASP A OD1   1 
ATOM   2203  O  OD2   . ASP A 1 363  ? 33.436  62.322  12.488  1.00 74.23  ? 391  ASP A OD2   1 
ATOM   2204  N  N     . LEU A 1 364  ? 31.505  64.254  7.840   1.00 45.64  ? 392  LEU A N     1 
ATOM   2205  C  CA    . LEU A 1 364  ? 31.109  64.251  6.433   1.00 44.90  ? 392  LEU A CA    1 
ATOM   2206  C  C     . LEU A 1 364  ? 32.063  65.087  5.586   1.00 65.34  ? 392  LEU A C     1 
ATOM   2207  O  O     . LEU A 1 364  ? 32.455  64.681  4.487   1.00 60.77  ? 392  LEU A O     1 
ATOM   2208  C  CB    . LEU A 1 364  ? 29.678  64.765  6.275   1.00 44.66  ? 392  LEU A CB    1 
ATOM   2209  C  CG    . LEU A 1 364  ? 28.574  63.866  6.835   1.00 45.05  ? 392  LEU A CG    1 
ATOM   2210  C  CD1   . LEU A 1 364  ? 27.212  64.509  6.648   1.00 45.52  ? 392  LEU A CD1   1 
ATOM   2211  C  CD2   . LEU A 1 364  ? 28.615  62.494  6.181   1.00 64.05  ? 392  LEU A CD2   1 
ATOM   2212  N  N     . MET A 1 365  ? 32.431  66.255  6.105   1.00 45.75  ? 393  MET A N     1 
ATOM   2213  C  CA    . MET A 1 365  ? 33.439  67.095  5.468   1.00 45.81  ? 393  MET A CA    1 
ATOM   2214  C  C     . MET A 1 365  ? 34.745  66.326  5.301   1.00 65.73  ? 393  MET A C     1 
ATOM   2215  O  O     . MET A 1 365  ? 35.390  66.390  4.249   1.00 69.21  ? 393  MET A O     1 
ATOM   2216  C  CB    . MET A 1 365  ? 33.675  68.367  6.284   1.00 47.86  ? 393  MET A CB    1 
ATOM   2217  C  CG    . MET A 1 365  ? 32.949  69.594  5.759   1.00 46.48  ? 393  MET A CG    1 
ATOM   2218  S  SD    . MET A 1 365  ? 33.652  70.186  4.208   1.00 40.35  ? 393  MET A SD    1 
ATOM   2219  C  CE    . MET A 1 365  ? 32.608  71.599  3.875   1.00 47.31  ? 393  MET A CE    1 
ATOM   2220  N  N     . GLN A 1 366  ? 35.122  65.591  6.345   1.00 55.78  ? 394  GLN A N     1 
ATOM   2221  C  CA    . GLN A 1 366  ? 36.340  64.790  6.320   1.00 47.21  ? 394  GLN A CA    1 
ATOM   2222  C  C     . GLN A 1 366  ? 36.283  63.738  5.215   1.00 45.25  ? 394  GLN A C     1 
ATOM   2223  O  O     . GLN A 1 366  ? 37.248  63.557  4.471   1.00 64.25  ? 394  GLN A O     1 
ATOM   2224  C  CB    . GLN A 1 366  ? 36.572  64.123  7.678   1.00 48.97  ? 394  GLN A CB    1 
ATOM   2225  C  CG    . GLN A 1 366  ? 37.883  63.364  7.784   1.00 68.69  ? 394  GLN A CG    1 
ATOM   2226  C  CD    . GLN A 1 366  ? 39.096  64.272  7.712   1.00 56.76  ? 394  GLN A CD    1 
ATOM   2227  O  OE1   . GLN A 1 366  ? 39.014  65.464  8.007   1.00 41.97  ? 394  GLN A OE1   1 
ATOM   2228  N  NE2   . GLN A 1 366  ? 40.232  63.710  7.316   1.00 72.49  ? 394  GLN A NE2   1 
ATOM   2229  N  N     . TYR A 1 367  ? 35.146  63.056  5.108   1.00 44.21  ? 395  TYR A N     1 
ATOM   2230  C  CA    . TYR A 1 367  ? 34.940  62.049  4.070   1.00 48.29  ? 395  TYR A CA    1 
ATOM   2231  C  C     . TYR A 1 367  ? 35.034  62.653  2.674   1.00 42.06  ? 395  TYR A C     1 
ATOM   2232  O  O     . TYR A 1 367  ? 35.647  62.071  1.777   1.00 43.30  ? 395  TYR A O     1 
ATOM   2233  C  CB    . TYR A 1 367  ? 33.583  61.362  4.243   1.00 42.16  ? 395  TYR A CB    1 
ATOM   2234  C  CG    . TYR A 1 367  ? 33.580  60.221  5.235   1.00 43.14  ? 395  TYR A CG    1 
ATOM   2235  C  CD1   . TYR A 1 367  ? 34.063  58.968  4.882   1.00 42.84  ? 395  TYR A CD1   1 
ATOM   2236  C  CD2   . TYR A 1 367  ? 33.079  60.391  6.519   1.00 44.72  ? 395  TYR A CD2   1 
ATOM   2237  C  CE1   . TYR A 1 367  ? 34.057  57.920  5.783   1.00 46.76  ? 395  TYR A CE1   1 
ATOM   2238  C  CE2   . TYR A 1 367  ? 33.069  59.351  7.426   1.00 46.29  ? 395  TYR A CE2   1 
ATOM   2239  C  CZ    . TYR A 1 367  ? 33.559  58.118  7.054   1.00 49.49  ? 395  TYR A CZ    1 
ATOM   2240  O  OH    . TYR A 1 367  ? 33.549  57.080  7.957   1.00 47.26  ? 395  TYR A OH    1 
ATOM   2241  N  N     . CYS A 1 368  ? 34.419  63.819  2.494   1.00 40.93  ? 396  CYS A N     1 
ATOM   2242  C  CA    . CYS A 1 368  ? 34.473  64.511  1.211   1.00 43.62  ? 396  CYS A CA    1 
ATOM   2243  C  C     . CYS A 1 368  ? 35.916  64.856  0.850   1.00 40.41  ? 396  CYS A C     1 
ATOM   2244  O  O     . CYS A 1 368  ? 36.339  64.702  -0.301  1.00 93.43  ? 396  CYS A O     1 
ATOM   2245  C  CB    . CYS A 1 368  ? 33.615  65.777  1.243   1.00 40.16  ? 396  CYS A CB    1 
ATOM   2246  S  SG    . CYS A 1 368  ? 33.363  66.544  -0.375  1.00 48.88  ? 396  CYS A SG    1 
ATOM   2247  N  N     . ALA A 1 369  ? 36.669  65.313  1.846   1.00 42.20  ? 397  ALA A N     1 
ATOM   2248  C  CA    . ALA A 1 369  ? 38.084  65.617  1.659   1.00 46.70  ? 397  ALA A CA    1 
ATOM   2249  C  C     . ALA A 1 369  ? 38.862  64.370  1.247   1.00 42.69  ? 397  ALA A C     1 
ATOM   2250  O  O     . ALA A 1 369  ? 39.735  64.426  0.378   1.00 42.57  ? 397  ALA A O     1 
ATOM   2251  C  CB    . ALA A 1 369  ? 38.668  66.208  2.924   1.00 60.79  ? 397  ALA A CB    1 
ATOM   2252  N  N     . GLN A 1 370  ? 38.541  63.245  1.876   1.00 42.62  ? 398  GLN A N     1 
ATOM   2253  C  CA    . GLN A 1 370  ? 39.173  61.979  1.529   1.00 46.88  ? 398  GLN A CA    1 
ATOM   2254  C  C     . GLN A 1 370  ? 38.867  61.614  0.079   1.00 43.14  ? 398  GLN A C     1 
ATOM   2255  O  O     . GLN A 1 370  ? 39.732  61.111  -0.643  1.00 68.68  ? 398  GLN A O     1 
ATOM   2256  C  CB    . GLN A 1 370  ? 38.712  60.868  2.475   1.00 49.85  ? 398  GLN A CB    1 
ATOM   2257  C  CG    . GLN A 1 370  ? 39.166  61.062  3.914   1.00 67.66  ? 398  GLN A CG    1 
ATOM   2258  C  CD    . GLN A 1 370  ? 38.600  60.017  4.856   1.00 65.56  ? 398  GLN A CD    1 
ATOM   2259  O  OE1   . GLN A 1 370  ? 37.933  59.074  4.428   1.00 67.94  ? 398  GLN A OE1   1 
ATOM   2260  N  NE2   . GLN A 1 370  ? 38.861  60.181  6.148   1.00 47.48  ? 398  GLN A NE2   1 
ATOM   2261  N  N     . ASP A 1 371  ? 37.637  61.888  -0.345  1.00 93.11  ? 399  ASP A N     1 
ATOM   2262  C  CA    . ASP A 1 371  ? 37.233  61.623  -1.721  1.00 46.34  ? 399  ASP A CA    1 
ATOM   2263  C  C     . ASP A 1 371  ? 38.008  62.480  -2.719  1.00 47.37  ? 399  ASP A C     1 
ATOM   2264  O  O     . ASP A 1 371  ? 38.509  61.967  -3.721  1.00 41.50  ? 399  ASP A O     1 
ATOM   2265  C  CB    . ASP A 1 371  ? 35.730  61.849  -1.895  1.00 93.63  ? 399  ASP A CB    1 
ATOM   2266  C  CG    . ASP A 1 371  ? 34.902  60.686  -1.381  1.00 49.06  ? 399  ASP A CG    1 
ATOM   2267  O  OD1   . ASP A 1 371  ? 35.277  60.093  -0.348  1.00 56.87  ? 399  ASP A OD1   1 
ATOM   2268  O  OD2   . ASP A 1 371  ? 33.877  60.361  -2.016  1.00 40.64  ? 399  ASP A OD2   1 
ATOM   2269  N  N     . VAL A 1 372  ? 38.112  63.781  -2.453  1.00 43.16  ? 400  VAL A N     1 
ATOM   2270  C  CA    . VAL A 1 372  ? 38.810  64.666  -3.382  1.00 45.72  ? 400  VAL A CA    1 
ATOM   2271  C  C     . VAL A 1 372  ? 40.309  64.372  -3.389  1.00 56.59  ? 400  VAL A C     1 
ATOM   2272  O  O     . VAL A 1 372  ? 40.989  64.603  -4.390  1.00 56.54  ? 400  VAL A O     1 
ATOM   2273  C  CB    . VAL A 1 372  ? 38.578  66.163  -3.054  1.00 93.47  ? 400  VAL A CB    1 
ATOM   2274  C  CG1   . VAL A 1 372  ? 37.097  66.452  -2.923  1.00 47.83  ? 400  VAL A CG1   1 
ATOM   2275  C  CG2   . VAL A 1 372  ? 39.313  66.575  -1.795  1.00 41.45  ? 400  VAL A CG2   1 
ATOM   2276  N  N     . TRP A 1 373  ? 40.815  63.845  -2.278  1.00 56.02  ? 401  TRP A N     1 
ATOM   2277  C  CA    . TRP A 1 373  ? 42.224  63.487  -2.180  1.00 44.64  ? 401  TRP A CA    1 
ATOM   2278  C  C     . TRP A 1 373  ? 42.519  62.237  -3.002  1.00 47.17  ? 401  TRP A C     1 
ATOM   2279  O  O     . TRP A 1 373  ? 43.467  62.208  -3.796  1.00 40.41  ? 401  TRP A O     1 
ATOM   2280  C  CB    . TRP A 1 373  ? 42.623  63.273  -0.719  1.00 56.70  ? 401  TRP A CB    1 
ATOM   2281  C  CG    . TRP A 1 373  ? 44.010  62.743  -0.544  1.00 72.37  ? 401  TRP A CG    1 
ATOM   2282  C  CD1   . TRP A 1 373  ? 44.374  61.596  0.099   1.00 77.07  ? 401  TRP A CD1   1 
ATOM   2283  C  CD2   . TRP A 1 373  ? 45.223  63.334  -1.027  1.00 72.32  ? 401  TRP A CD2   1 
ATOM   2284  N  NE1   . TRP A 1 373  ? 45.738  61.439  0.052   1.00 72.43  ? 401  TRP A NE1   1 
ATOM   2285  C  CE2   . TRP A 1 373  ? 46.282  62.493  -0.634  1.00 77.15  ? 401  TRP A CE2   1 
ATOM   2286  C  CE3   . TRP A 1 373  ? 45.517  64.494  -1.751  1.00 74.09  ? 401  TRP A CE3   1 
ATOM   2287  C  CZ2   . TRP A 1 373  ? 47.611  62.774  -0.941  1.00 69.54  ? 401  TRP A CZ2   1 
ATOM   2288  C  CZ3   . TRP A 1 373  ? 46.834  64.769  -2.056  1.00 73.07  ? 401  TRP A CZ3   1 
ATOM   2289  C  CH2   . TRP A 1 373  ? 47.866  63.914  -1.650  1.00 70.73  ? 401  TRP A CH2   1 
ATOM   2290  N  N     . ALA A 1 374  ? 41.696  61.210  -2.806  1.00 43.56  ? 402  ALA A N     1 
ATOM   2291  C  CA    . ALA A 1 374  ? 41.811  59.974  -3.570  1.00 93.28  ? 402  ALA A CA    1 
ATOM   2292  C  C     . ALA A 1 374  ? 41.675  60.255  -5.061  1.00 92.01  ? 402  ALA A C     1 
ATOM   2293  O  O     . ALA A 1 374  ? 42.442  59.737  -5.874  1.00 92.10  ? 402  ALA A O     1 
ATOM   2294  C  CB    . ALA A 1 374  ? 40.763  58.972  -3.118  1.00 40.19  ? 402  ALA A CB    1 
ATOM   2295  N  N     . THR A 1 375  ? 40.701  61.088  -5.412  1.00 91.03  ? 403  THR A N     1 
ATOM   2296  C  CA    . THR A 1 375  ? 40.491  61.478  -6.799  1.00 41.38  ? 403  THR A CA    1 
ATOM   2297  C  C     . THR A 1 375  ? 41.706  62.226  -7.341  1.00 92.08  ? 403  THR A C     1 
ATOM   2298  O  O     . THR A 1 375  ? 42.107  62.024  -8.488  1.00 40.58  ? 403  THR A O     1 
ATOM   2299  C  CB    . THR A 1 375  ? 39.235  62.355  -6.955  1.00 45.03  ? 403  THR A CB    1 
ATOM   2300  O  OG1   . THR A 1 375  ? 38.101  61.668  -6.409  1.00 49.72  ? 403  THR A OG1   1 
ATOM   2301  C  CG2   . THR A 1 375  ? 38.976  62.661  -8.422  1.00 86.22  ? 403  THR A CG2   1 
ATOM   2302  N  N     . HIS A 1 376  ? 42.291  63.084  -6.510  1.00 43.87  ? 404  HIS A N     1 
ATOM   2303  C  CA    . HIS A 1 376  ? 43.493  63.818  -6.892  1.00 49.28  ? 404  HIS A CA    1 
ATOM   2304  C  C     . HIS A 1 376  ? 44.629  62.865  -7.247  1.00 55.98  ? 404  HIS A C     1 
ATOM   2305  O  O     . HIS A 1 376  ? 45.248  62.987  -8.308  1.00 48.98  ? 404  HIS A O     1 
ATOM   2306  C  CB    . HIS A 1 376  ? 43.936  64.757  -5.770  1.00 60.42  ? 404  HIS A CB    1 
ATOM   2307  C  CG    . HIS A 1 376  ? 45.186  65.519  -6.081  1.00 68.20  ? 404  HIS A CG    1 
ATOM   2308  N  ND1   . HIS A 1 376  ? 46.178  65.735  -5.149  1.00 70.56  ? 404  HIS A ND1   1 
ATOM   2309  C  CD2   . HIS A 1 376  ? 45.603  66.119  -7.220  1.00 72.55  ? 404  HIS A CD2   1 
ATOM   2310  C  CE1   . HIS A 1 376  ? 47.154  66.434  -5.701  1.00 70.07  ? 404  HIS A CE1   1 
ATOM   2311  N  NE2   . HIS A 1 376  ? 46.829  66.680  -6.958  1.00 73.73  ? 404  HIS A NE2   1 
ATOM   2312  N  N     . GLU A 1 377  ? 44.892  61.916  -6.352  1.00 60.65  ? 405  GLU A N     1 
ATOM   2313  C  CA    . GLU A 1 377  ? 45.924  60.906  -6.576  1.00 42.16  ? 405  GLU A CA    1 
ATOM   2314  C  C     . GLU A 1 377  ? 45.672  60.115  -7.859  1.00 40.75  ? 405  GLU A C     1 
ATOM   2315  O  O     . GLU A 1 377  ? 46.556  59.998  -8.719  1.00 41.43  ? 405  GLU A O     1 
ATOM   2316  C  CB    . GLU A 1 377  ? 45.999  59.949  -5.385  1.00 42.82  ? 405  GLU A CB    1 
ATOM   2317  C  CG    . GLU A 1 377  ? 46.446  60.595  -4.085  1.00 64.34  ? 405  GLU A CG    1 
ATOM   2318  C  CD    . GLU A 1 377  ? 46.477  59.611  -2.931  1.00 65.58  ? 405  GLU A CD    1 
ATOM   2319  O  OE1   . GLU A 1 377  ? 45.745  58.601  -2.991  1.00 65.88  ? 405  GLU A OE1   1 
ATOM   2320  O  OE2   . GLU A 1 377  ? 47.237  59.844  -1.967  1.00 69.39  ? 405  GLU A OE2   1 
ATOM   2321  N  N     . VAL A 1 378  ? 44.459  59.579  -7.974  1.00 65.00  ? 406  VAL A N     1 
ATOM   2322  C  CA    . VAL A 1 378  ? 44.057  58.809  -9.146  1.00 64.12  ? 406  VAL A CA    1 
ATOM   2323  C  C     . VAL A 1 378  ? 44.317  59.593  -10.428 1.00 65.42  ? 406  VAL A C     1 
ATOM   2324  O  O     . VAL A 1 378  ? 44.896  59.063  -11.374 1.00 44.89  ? 406  VAL A O     1 
ATOM   2325  C  CB    . VAL A 1 378  ? 42.568  58.410  -9.075  1.00 90.02  ? 406  VAL A CB    1 
ATOM   2326  C  CG1   . VAL A 1 378  ? 42.091  57.877  -10.412 1.00 86.81  ? 406  VAL A CG1   1 
ATOM   2327  C  CG2   . VAL A 1 378  ? 42.349  57.376  -7.984  1.00 90.35  ? 406  VAL A CG2   1 
ATOM   2328  N  N     . PHE A 1 379  ? 43.908  60.859  -10.442 1.00 66.07  ? 407  PHE A N     1 
ATOM   2329  C  CA    . PHE A 1 379  ? 44.150  61.734  -11.586 1.00 48.64  ? 407  PHE A CA    1 
ATOM   2330  C  C     . PHE A 1 379  ? 45.638  61.870  -11.880 1.00 44.42  ? 407  PHE A C     1 
ATOM   2331  O  O     . PHE A 1 379  ? 46.061  61.779  -13.036 1.00 47.46  ? 407  PHE A O     1 
ATOM   2332  C  CB    . PHE A 1 379  ? 43.546  63.119  -11.347 1.00 42.07  ? 407  PHE A CB    1 
ATOM   2333  C  CG    . PHE A 1 379  ? 43.956  64.143  -12.369 1.00 43.34  ? 407  PHE A CG    1 
ATOM   2334  C  CD1   . PHE A 1 379  ? 43.368  64.162  -13.624 1.00 46.67  ? 407  PHE A CD1   1 
ATOM   2335  C  CD2   . PHE A 1 379  ? 44.925  65.090  -12.075 1.00 41.02  ? 407  PHE A CD2   1 
ATOM   2336  C  CE1   . PHE A 1 379  ? 43.742  65.103  -14.568 1.00 48.68  ? 407  PHE A CE1   1 
ATOM   2337  C  CE2   . PHE A 1 379  ? 45.303  66.033  -13.014 1.00 46.36  ? 407  PHE A CE2   1 
ATOM   2338  C  CZ    . PHE A 1 379  ? 44.709  66.039  -14.262 1.00 47.11  ? 407  PHE A CZ    1 
ATOM   2339  N  N     . GLN A 1 380  ? 46.422  62.094  -10.828 1.00 44.71  ? 408  GLN A N     1 
ATOM   2340  C  CA    . GLN A 1 380  ? 47.865  62.251  -10.970 1.00 49.15  ? 408  GLN A CA    1 
ATOM   2341  C  C     . GLN A 1 380  ? 48.501  61.039  -11.632 1.00 49.20  ? 408  GLN A C     1 
ATOM   2342  O  O     . GLN A 1 380  ? 49.410  61.176  -12.450 1.00 64.59  ? 408  GLN A O     1 
ATOM   2343  C  CB    . GLN A 1 380  ? 48.523  62.496  -9.611  1.00 56.30  ? 408  GLN A CB    1 
ATOM   2344  C  CG    . GLN A 1 380  ? 48.466  63.936  -9.139  1.00 68.22  ? 408  GLN A CG    1 
ATOM   2345  C  CD    . GLN A 1 380  ? 49.339  64.178  -7.925  1.00 64.55  ? 408  GLN A CD    1 
ATOM   2346  O  OE1   . GLN A 1 380  ? 49.862  63.238  -7.326  1.00 60.49  ? 408  GLN A OE1   1 
ATOM   2347  N  NE2   . GLN A 1 380  ? 49.506  65.443  -7.558  1.00 70.29  ? 408  GLN A NE2   1 
ATOM   2348  N  N     . GLN A 1 381  ? 48.019  59.852  -11.282 1.00 69.76  ? 409  GLN A N     1 
ATOM   2349  C  CA    . GLN A 1 381  ? 48.595  58.631  -11.833 1.00 56.75  ? 409  GLN A CA    1 
ATOM   2350  C  C     . GLN A 1 381  ? 47.993  58.269  -13.194 1.00 40.44  ? 409  GLN A C     1 
ATOM   2351  O  O     . GLN A 1 381  ? 48.580  57.502  -13.956 1.00 45.35  ? 409  GLN A O     1 
ATOM   2352  C  CB    . GLN A 1 381  ? 48.415  57.471  -10.850 1.00 67.32  ? 409  GLN A CB    1 
ATOM   2353  C  CG    . GLN A 1 381  ? 49.291  56.267  -11.147 1.00 76.44  ? 409  GLN A CG    1 
ATOM   2354  C  CD    . GLN A 1 381  ? 50.767  56.617  -11.181 1.00 69.43  ? 409  GLN A CD    1 
ATOM   2355  O  OE1   . GLN A 1 381  ? 51.234  57.465  -10.420 1.00 74.35  ? 409  GLN A OE1   1 
ATOM   2356  N  NE2   . GLN A 1 381  ? 51.508  55.968  -12.072 1.00 70.57  ? 409  GLN A NE2   1 
ATOM   2357  N  N     . GLN A 1 382  ? 46.831  58.832  -13.504 1.00 42.35  ? 410  GLN A N     1 
ATOM   2358  C  CA    . GLN A 1 382  ? 46.133  58.495  -14.741 1.00 42.73  ? 410  GLN A CA    1 
ATOM   2359  C  C     . GLN A 1 382  ? 46.535  59.376  -15.918 1.00 40.14  ? 410  GLN A C     1 
ATOM   2360  O  O     . GLN A 1 382  ? 46.705  58.882  -17.032 1.00 44.91  ? 410  GLN A O     1 
ATOM   2361  C  CB    . GLN A 1 382  ? 44.620  58.583  -14.543 1.00 90.29  ? 410  GLN A CB    1 
ATOM   2362  C  CG    . GLN A 1 382  ? 44.004  57.359  -13.902 1.00 87.55  ? 410  GLN A CG    1 
ATOM   2363  C  CD    . GLN A 1 382  ? 42.495  57.442  -13.841 1.00 46.93  ? 410  GLN A CD    1 
ATOM   2364  O  OE1   . GLN A 1 382  ? 41.899  58.434  -14.261 1.00 47.83  ? 410  GLN A OE1   1 
ATOM   2365  N  NE2   . GLN A 1 382  ? 41.866  56.400  -13.316 1.00 68.20  ? 410  GLN A NE2   1 
ATOM   2366  N  N     . LEU A 1 383  ? 46.672  60.676  -15.670 1.00 93.39  ? 411  LEU A N     1 
ATOM   2367  C  CA    . LEU A 1 383  ? 46.957  61.642  -16.732 1.00 40.12  ? 411  LEU A CA    1 
ATOM   2368  C  C     . LEU A 1 383  ? 48.142  61.242  -17.631 1.00 69.03  ? 411  LEU A C     1 
ATOM   2369  O  O     . LEU A 1 383  ? 48.014  61.280  -18.855 1.00 41.44  ? 411  LEU A O     1 
ATOM   2370  C  CB    . LEU A 1 383  ? 47.190  63.035  -16.127 1.00 43.87  ? 411  LEU A CB    1 
ATOM   2371  C  CG    . LEU A 1 383  ? 47.145  64.267  -17.040 1.00 41.99  ? 411  LEU A CG    1 
ATOM   2372  C  CD1   . LEU A 1 383  ? 48.505  64.568  -17.653 1.00 40.61  ? 411  LEU A CD1   1 
ATOM   2373  C  CD2   . LEU A 1 383  ? 46.095  64.093  -18.125 1.00 40.37  ? 411  LEU A CD2   1 
ATOM   2374  N  N     . PRO A 1 384  ? 49.293  60.851  -17.042 1.00 64.28  ? 412  PRO A N     1 
ATOM   2375  C  CA    . PRO A 1 384  ? 50.377  60.449  -17.947 1.00 46.74  ? 412  PRO A CA    1 
ATOM   2376  C  C     . PRO A 1 384  ? 50.096  59.121  -18.648 1.00 42.62  ? 412  PRO A C     1 
ATOM   2377  O  O     . PRO A 1 384  ? 50.489  58.945  -19.803 1.00 66.71  ? 412  PRO A O     1 
ATOM   2378  C  CB    . PRO A 1 384  ? 51.584  60.329  -17.015 1.00 47.53  ? 412  PRO A CB    1 
ATOM   2379  C  CG    . PRO A 1 384  ? 50.997  60.016  -15.690 1.00 43.66  ? 412  PRO A CG    1 
ATOM   2380  C  CD    . PRO A 1 384  ? 49.721  60.797  -15.631 1.00 48.27  ? 412  PRO A CD    1 
ATOM   2381  N  N     . LEU A 1 385  ? 49.427  58.204  -17.953 1.00 42.49  ? 413  LEU A N     1 
ATOM   2382  C  CA    . LEU A 1 385  ? 49.045  56.926  -18.544 1.00 41.62  ? 413  LEU A CA    1 
ATOM   2383  C  C     . LEU A 1 385  ? 48.105  57.144  -19.720 1.00 47.91  ? 413  LEU A C     1 
ATOM   2384  O  O     . LEU A 1 385  ? 48.269  56.537  -20.778 1.00 41.58  ? 413  LEU A O     1 
ATOM   2385  C  CB    . LEU A 1 385  ? 48.384  56.017  -17.505 1.00 40.59  ? 413  LEU A CB    1 
ATOM   2386  C  CG    . LEU A 1 385  ? 49.261  54.960  -16.832 1.00 60.24  ? 413  LEU A CG    1 
ATOM   2387  C  CD1   . LEU A 1 385  ? 50.365  55.605  -16.005 1.00 73.90  ? 413  LEU A CD1   1 
ATOM   2388  C  CD2   . LEU A 1 385  ? 48.415  54.030  -15.975 1.00 40.94  ? 413  LEU A CD2   1 
ATOM   2389  N  N     . PHE A 1 386  ? 47.121  58.016  -19.527 1.00 43.98  ? 414  PHE A N     1 
ATOM   2390  C  CA    . PHE A 1 386  ? 46.170  58.345  -20.579 1.00 91.88  ? 414  PHE A CA    1 
ATOM   2391  C  C     . PHE A 1 386  ? 46.861  59.046  -21.743 1.00 41.32  ? 414  PHE A C     1 
ATOM   2392  O  O     . PHE A 1 386  ? 46.554  58.781  -22.905 1.00 46.35  ? 414  PHE A O     1 
ATOM   2393  C  CB    . PHE A 1 386  ? 45.044  59.221  -20.030 1.00 93.66  ? 414  PHE A CB    1 
ATOM   2394  C  CG    . PHE A 1 386  ? 44.103  59.730  -21.085 1.00 93.79  ? 414  PHE A CG    1 
ATOM   2395  C  CD1   . PHE A 1 386  ? 44.252  61.005  -21.609 1.00 90.60  ? 414  PHE A CD1   1 
ATOM   2396  C  CD2   . PHE A 1 386  ? 43.072  58.933  -21.555 1.00 87.74  ? 414  PHE A CD2   1 
ATOM   2397  C  CE1   . PHE A 1 386  ? 43.392  61.474  -22.579 1.00 44.80  ? 414  PHE A CE1   1 
ATOM   2398  C  CE2   . PHE A 1 386  ? 42.208  59.398  -22.525 1.00 44.12  ? 414  PHE A CE2   1 
ATOM   2399  C  CZ    . PHE A 1 386  ? 42.368  60.670  -23.038 1.00 46.54  ? 414  PHE A CZ    1 
ATOM   2400  N  N     . LEU A 1 387  ? 47.790  59.943  -21.423 1.00 40.79  ? 415  LEU A N     1 
ATOM   2401  C  CA    . LEU A 1 387  ? 48.553  60.653  -22.444 1.00 42.46  ? 415  LEU A CA    1 
ATOM   2402  C  C     . LEU A 1 387  ? 49.381  59.681  -23.276 1.00 49.56  ? 415  LEU A C     1 
ATOM   2403  O  O     . LEU A 1 387  ? 49.581  59.887  -24.473 1.00 44.32  ? 415  LEU A O     1 
ATOM   2404  C  CB    . LEU A 1 387  ? 49.460  61.707  -21.807 1.00 45.66  ? 415  LEU A CB    1 
ATOM   2405  C  CG    . LEU A 1 387  ? 49.011  63.162  -21.947 1.00 44.12  ? 415  LEU A CG    1 
ATOM   2406  C  CD1   . LEU A 1 387  ? 47.603  63.346  -21.411 1.00 42.38  ? 415  LEU A CD1   1 
ATOM   2407  C  CD2   . LEU A 1 387  ? 49.983  64.094  -21.237 1.00 77.19  ? 415  LEU A CD2   1 
ATOM   2408  N  N     . GLU A 1 388  ? 49.857  58.618  -22.634 1.00 66.65  ? 416  GLU A N     1 
ATOM   2409  C  CA    . GLU A 1 388  ? 50.616  57.586  -23.329 1.00 56.26  ? 416  GLU A CA    1 
ATOM   2410  C  C     . GLU A 1 388  ? 49.711  56.730  -24.209 1.00 48.62  ? 416  GLU A C     1 
ATOM   2411  O  O     . GLU A 1 388  ? 50.026  56.464  -25.369 1.00 44.31  ? 416  GLU A O     1 
ATOM   2412  C  CB    . GLU A 1 388  ? 51.359  56.698  -22.329 1.00 73.05  ? 416  GLU A CB    1 
ATOM   2413  C  CG    . GLU A 1 388  ? 52.038  55.493  -22.962 1.00 74.19  ? 416  GLU A CG    1 
ATOM   2414  C  CD    . GLU A 1 388  ? 52.608  54.538  -21.932 1.00 73.13  ? 416  GLU A CD    1 
ATOM   2415  O  OE1   . GLU A 1 388  ? 52.903  53.380  -22.295 1.00 75.16  ? 416  GLU A OE1   1 
ATOM   2416  O  OE2   . GLU A 1 388  ? 52.760  54.944  -20.761 1.00 68.61  ? 416  GLU A OE2   1 
ATOM   2417  N  N     . ARG A 1 389  ? 48.583  56.305  -23.647 1.00 47.08  ? 417  ARG A N     1 
ATOM   2418  C  CA    . ARG A 1 389  ? 47.668  55.407  -24.343 1.00 49.43  ? 417  ARG A CA    1 
ATOM   2419  C  C     . ARG A 1 389  ? 46.839  56.129  -25.401 1.00 40.99  ? 417  ARG A C     1 
ATOM   2420  O  O     . ARG A 1 389  ? 46.465  55.541  -26.415 1.00 43.09  ? 417  ARG A O     1 
ATOM   2421  C  CB    . ARG A 1 389  ? 46.746  54.709  -23.342 1.00 44.04  ? 417  ARG A CB    1 
ATOM   2422  C  CG    . ARG A 1 389  ? 47.481  53.829  -22.345 1.00 60.58  ? 417  ARG A CG    1 
ATOM   2423  C  CD    . ARG A 1 389  ? 46.542  52.840  -21.677 1.00 47.16  ? 417  ARG A CD    1 
ATOM   2424  N  NE    . ARG A 1 389  ? 46.183  51.741  -22.568 1.00 49.45  ? 417  ARG A NE    1 
ATOM   2425  C  CZ    . ARG A 1 389  ? 46.837  50.585  -22.627 1.00 56.57  ? 417  ARG A CZ    1 
ATOM   2426  N  NH1   . ARG A 1 389  ? 47.886  50.375  -21.844 1.00 75.66  ? 417  ARG A NH1   1 
ATOM   2427  N  NH2   . ARG A 1 389  ? 46.443  49.639  -23.468 1.00 68.43  ? 417  ARG A NH2   1 
ATOM   2428  N  N     . CYS A 1 390  ? 46.553  57.404  -25.161 1.00 40.81  ? 418  CYS A N     1 
ATOM   2429  C  CA    . CYS A 1 390  ? 45.846  58.226  -26.136 1.00 42.18  ? 418  CYS A CA    1 
ATOM   2430  C  C     . CYS A 1 390  ? 46.700  59.432  -26.518 1.00 66.35  ? 418  CYS A C     1 
ATOM   2431  O  O     . CYS A 1 390  ? 46.426  60.552  -26.088 1.00 56.43  ? 418  CYS A O     1 
ATOM   2432  C  CB    . CYS A 1 390  ? 44.494  58.676  -25.581 1.00 48.60  ? 418  CYS A CB    1 
ATOM   2433  S  SG    . CYS A 1 390  ? 43.382  57.317  -25.128 1.00 64.85  ? 418  CYS A SG    1 
ATOM   2434  N  N     . PRO A 1 391  ? 47.739  59.202  -27.338 1.00 68.18  ? 419  PRO A N     1 
ATOM   2435  C  CA    . PRO A 1 391  ? 48.751  60.215  -27.659 1.00 69.32  ? 419  PRO A CA    1 
ATOM   2436  C  C     . PRO A 1 391  ? 48.213  61.371  -28.496 1.00 74.47  ? 419  PRO A C     1 
ATOM   2437  O  O     . PRO A 1 391  ? 48.679  62.501  -28.348 1.00 76.96  ? 419  PRO A O     1 
ATOM   2438  C  CB    . PRO A 1 391  ? 49.797  59.421  -28.445 1.00 76.43  ? 419  PRO A CB    1 
ATOM   2439  C  CG    . PRO A 1 391  ? 49.027  58.321  -29.074 1.00 64.74  ? 419  PRO A CG    1 
ATOM   2440  C  CD    . PRO A 1 391  ? 47.970  57.946  -28.075 1.00 69.62  ? 419  PRO A CD    1 
ATOM   2441  N  N     . HIS A 1 392  ? 47.248  61.091  -29.365 1.00 66.66  ? 420  HIS A N     1 
ATOM   2442  C  CA    . HIS A 1 392  ? 46.691  62.120  -30.233 1.00 68.00  ? 420  HIS A CA    1 
ATOM   2443  C  C     . HIS A 1 392  ? 45.832  63.089  -29.426 1.00 65.77  ? 420  HIS A C     1 
ATOM   2444  O  O     . HIS A 1 392  ? 44.964  62.668  -28.660 1.00 68.40  ? 420  HIS A O     1 
ATOM   2445  C  CB    . HIS A 1 392  ? 45.873  61.486  -31.358 1.00 48.50  ? 420  HIS A CB    1 
ATOM   2446  C  CG    . HIS A 1 392  ? 45.948  62.232  -32.654 1.00 45.28  ? 420  HIS A CG    1 
ATOM   2447  N  ND1   . HIS A 1 392  ? 45.276  63.415  -32.873 1.00 45.82  ? 420  HIS A ND1   1 
ATOM   2448  C  CD2   . HIS A 1 392  ? 46.614  61.960  -33.801 1.00 41.88  ? 420  HIS A CD2   1 
ATOM   2449  C  CE1   . HIS A 1 392  ? 45.528  63.841  -34.098 1.00 43.00  ? 420  HIS A CE1   1 
ATOM   2450  N  NE2   . HIS A 1 392  ? 46.336  62.976  -34.683 1.00 49.51  ? 420  HIS A NE2   1 
ATOM   2451  N  N     . PRO A 1 393  ? 46.077  64.396  -29.594 1.00 60.22  ? 421  PRO A N     1 
ATOM   2452  C  CA    . PRO A 1 393  ? 45.390  65.445  -28.831 1.00 60.94  ? 421  PRO A CA    1 
ATOM   2453  C  C     . PRO A 1 393  ? 43.915  65.592  -29.198 1.00 56.10  ? 421  PRO A C     1 
ATOM   2454  O  O     . PRO A 1 393  ? 43.155  66.191  -28.433 1.00 70.39  ? 421  PRO A O     1 
ATOM   2455  C  CB    . PRO A 1 393  ? 46.168  66.709  -29.203 1.00 73.29  ? 421  PRO A CB    1 
ATOM   2456  C  CG    . PRO A 1 393  ? 46.716  66.418  -30.557 1.00 68.09  ? 421  PRO A CG    1 
ATOM   2457  C  CD    . PRO A 1 393  ? 47.053  64.957  -30.544 1.00 46.41  ? 421  PRO A CD    1 
ATOM   2458  N  N     . VAL A 1 394  ? 43.525  65.061  -30.354 1.00 56.51  ? 422  VAL A N     1 
ATOM   2459  C  CA    . VAL A 1 394  ? 42.134  65.123  -30.798 1.00 55.21  ? 422  VAL A CA    1 
ATOM   2460  C  C     . VAL A 1 394  ? 41.219  64.447  -29.784 1.00 41.55  ? 422  VAL A C     1 
ATOM   2461  O  O     . VAL A 1 394  ? 40.135  64.944  -29.486 1.00 67.68  ? 422  VAL A O     1 
ATOM   2462  C  CB    . VAL A 1 394  ? 41.952  64.470  -32.187 1.00 41.95  ? 422  VAL A CB    1 
ATOM   2463  C  CG1   . VAL A 1 394  ? 40.483  64.207  -32.474 1.00 40.61  ? 422  VAL A CG1   1 
ATOM   2464  C  CG2   . VAL A 1 394  ? 42.554  65.354  -33.268 1.00 49.15  ? 422  VAL A CG2   1 
ATOM   2465  N  N     . THR A 1 395  ? 41.672  63.323  -29.240 1.00 92.54  ? 423  THR A N     1 
ATOM   2466  C  CA    . THR A 1 395  ? 40.917  62.611  -28.217 1.00 42.48  ? 423  THR A CA    1 
ATOM   2467  C  C     . THR A 1 395  ? 40.785  63.458  -26.954 1.00 90.40  ? 423  THR A C     1 
ATOM   2468  O  O     . THR A 1 395  ? 39.740  63.465  -26.306 1.00 47.64  ? 423  THR A O     1 
ATOM   2469  C  CB    . THR A 1 395  ? 41.576  61.264  -27.864 1.00 44.51  ? 423  THR A CB    1 
ATOM   2470  O  OG1   . THR A 1 395  ? 41.709  60.469  -29.048 1.00 45.00  ? 423  THR A OG1   1 
ATOM   2471  C  CG2   . THR A 1 395  ? 40.737  60.506  -26.844 1.00 47.22  ? 423  THR A CG2   1 
ATOM   2472  N  N     . LEU A 1 396  ? 41.846  64.183  -26.618 1.00 91.75  ? 424  LEU A N     1 
ATOM   2473  C  CA    . LEU A 1 396  ? 41.865  64.998  -25.409 1.00 56.46  ? 424  LEU A CA    1 
ATOM   2474  C  C     . LEU A 1 396  ? 40.902  66.177  -25.518 1.00 68.31  ? 424  LEU A C     1 
ATOM   2475  O  O     . LEU A 1 396  ? 40.026  66.348  -24.671 1.00 74.22  ? 424  LEU A O     1 
ATOM   2476  C  CB    . LEU A 1 396  ? 43.281  65.502  -25.127 1.00 68.93  ? 424  LEU A CB    1 
ATOM   2477  C  CG    . LEU A 1 396  ? 43.750  65.520  -23.670 1.00 64.10  ? 424  LEU A CG    1 
ATOM   2478  C  CD1   . LEU A 1 396  ? 45.194  65.986  -23.596 1.00 56.76  ? 424  LEU A CD1   1 
ATOM   2479  C  CD2   . LEU A 1 396  ? 42.857  66.392  -22.795 1.00 93.02  ? 424  LEU A CD2   1 
ATOM   2480  N  N     . ALA A 1 397  ? 41.073  66.990  -26.557 1.00 56.35  ? 425  ALA A N     1 
ATOM   2481  C  CA    . ALA A 1 397  ? 40.222  68.160  -26.758 1.00 55.68  ? 425  ALA A CA    1 
ATOM   2482  C  C     . ALA A 1 397  ? 38.775  67.741  -26.999 1.00 65.29  ? 425  ALA A C     1 
ATOM   2483  O  O     . ALA A 1 397  ? 37.836  68.404  -26.548 1.00 66.83  ? 425  ALA A O     1 
ATOM   2484  C  CB    . ALA A 1 397  ? 40.735  68.996  -27.916 1.00 73.39  ? 425  ALA A CB    1 
ATOM   2485  N  N     . GLY A 1 398  ? 38.608  66.633  -27.715 1.00 66.01  ? 426  GLY A N     1 
ATOM   2486  C  CA    . GLY A 1 398  ? 37.299  66.058  -27.954 1.00 90.31  ? 426  GLY A CA    1 
ATOM   2487  C  C     . GLY A 1 398  ? 36.624  65.706  -26.646 1.00 44.65  ? 426  GLY A C     1 
ATOM   2488  O  O     . GLY A 1 398  ? 35.461  66.034  -26.438 1.00 56.54  ? 426  GLY A O     1 
ATOM   2489  N  N     . MET A 1 399  ? 37.364  65.048  -25.758 1.00 44.76  ? 427  MET A N     1 
ATOM   2490  C  CA    . MET A 1 399  ? 36.849  64.706  -24.435 1.00 93.37  ? 427  MET A CA    1 
ATOM   2491  C  C     . MET A 1 399  ? 36.584  65.953  -23.600 1.00 43.29  ? 427  MET A C     1 
ATOM   2492  O  O     . MET A 1 399  ? 35.733  65.948  -22.711 1.00 40.43  ? 427  MET A O     1 
ATOM   2493  C  CB    . MET A 1 399  ? 37.822  63.785  -23.698 1.00 90.31  ? 427  MET A CB    1 
ATOM   2494  C  CG    . MET A 1 399  ? 37.748  62.331  -24.129 1.00 46.22  ? 427  MET A CG    1 
ATOM   2495  S  SD    . MET A 1 399  ? 38.969  61.312  -23.284 1.00 66.20  ? 427  MET A SD    1 
ATOM   2496  C  CE    . MET A 1 399  ? 38.556  61.643  -21.573 1.00 56.40  ? 427  MET A CE    1 
ATOM   2497  N  N     . LEU A 1 400  ? 37.318  67.021  -23.887 1.00 90.21  ? 428  LEU A N     1 
ATOM   2498  C  CA    . LEU A 1 400  ? 37.131  68.277  -23.176 1.00 42.67  ? 428  LEU A CA    1 
ATOM   2499  C  C     . LEU A 1 400  ? 35.808  68.929  -23.555 1.00 43.43  ? 428  LEU A C     1 
ATOM   2500  O  O     . LEU A 1 400  ? 35.064  69.382  -22.687 1.00 48.75  ? 428  LEU A O     1 
ATOM   2501  C  CB    . LEU A 1 400  ? 38.292  69.232  -23.455 1.00 41.29  ? 428  LEU A CB    1 
ATOM   2502  C  CG    . LEU A 1 400  ? 39.576  68.932  -22.682 1.00 92.27  ? 428  LEU A CG    1 
ATOM   2503  C  CD1   . LEU A 1 400  ? 40.688  69.877  -23.097 1.00 46.48  ? 428  LEU A CD1   1 
ATOM   2504  C  CD2   . LEU A 1 400  ? 39.313  69.032  -21.190 1.00 91.70  ? 428  LEU A CD2   1 
ATOM   2505  N  N     . GLU A 1 401  ? 35.514  68.969  -24.852 1.00 56.66  ? 429  GLU A N     1 
ATOM   2506  C  CA    . GLU A 1 401  ? 34.282  69.596  -25.321 1.00 65.66  ? 429  GLU A CA    1 
ATOM   2507  C  C     . GLU A 1 401  ? 33.075  68.684  -25.122 1.00 43.52  ? 429  GLU A C     1 
ATOM   2508  O  O     . GLU A 1 401  ? 31.943  69.151  -25.011 1.00 44.50  ? 429  GLU A O     1 
ATOM   2509  C  CB    . GLU A 1 401  ? 34.402  69.987  -26.795 1.00 76.71  ? 429  GLU A CB    1 
ATOM   2510  C  CG    . GLU A 1 401  ? 33.257  70.856  -27.291 1.00 77.90  ? 429  GLU A CG    1 
ATOM   2511  C  CD    . GLU A 1 401  ? 33.318  71.112  -28.781 1.00 77.34  ? 429  GLU A CD    1 
ATOM   2512  O  OE1   . GLU A 1 401  ? 34.179  70.507  -29.453 1.00 76.55  ? 429  GLU A OE1   1 
ATOM   2513  O  OE2   . GLU A 1 401  ? 32.504  71.917  -29.279 1.00 69.84  ? 429  GLU A OE2   1 
ATOM   2514  N  N     . MET A 1 402  ? 33.323  67.380  -25.068 1.00 40.31  ? 430  MET A N     1 
ATOM   2515  C  CA    . MET A 1 402  ? 32.252  66.400  -24.928 1.00 41.67  ? 430  MET A CA    1 
ATOM   2516  C  C     . MET A 1 402  ? 31.754  66.321  -23.486 1.00 65.02  ? 430  MET A C     1 
ATOM   2517  O  O     . MET A 1 402  ? 30.869  65.527  -23.166 1.00 67.13  ? 430  MET A O     1 
ATOM   2518  C  CB    . MET A 1 402  ? 32.735  65.027  -25.398 1.00 46.64  ? 430  MET A CB    1 
ATOM   2519  C  CG    . MET A 1 402  ? 31.642  64.087  -25.871 1.00 56.60  ? 430  MET A CG    1 
ATOM   2520  S  SD    . MET A 1 402  ? 32.334  62.672  -26.747 1.00 49.78  ? 430  MET A SD    1 
ATOM   2521  C  CE    . MET A 1 402  ? 33.523  62.088  -25.545 1.00 81.01  ? 430  MET A CE    1 
ATOM   2522  N  N     . GLY A 1 403  ? 32.323  67.152  -22.618 1.00 64.48  ? 431  GLY A N     1 
ATOM   2523  C  CA    . GLY A 1 403  ? 31.965  67.143  -21.213 1.00 56.57  ? 431  GLY A CA    1 
ATOM   2524  C  C     . GLY A 1 403  ? 31.244  68.398  -20.763 1.00 46.55  ? 431  GLY A C     1 
ATOM   2525  O  O     . GLY A 1 403  ? 30.885  68.527  -19.593 1.00 66.34  ? 431  GLY A O     1 
ATOM   2526  N  N     . VAL A 1 404  ? 31.028  69.325  -21.691 1.00 43.23  ? 432  VAL A N     1 
ATOM   2527  C  CA    . VAL A 1 404  ? 30.363  70.583  -21.369 1.00 42.54  ? 432  VAL A CA    1 
ATOM   2528  C  C     . VAL A 1 404  ? 29.049  70.759  -22.131 1.00 48.47  ? 432  VAL A C     1 
ATOM   2529  O  O     . VAL A 1 404  ? 28.763  71.835  -22.657 1.00 90.85  ? 432  VAL A O     1 
ATOM   2530  C  CB    . VAL A 1 404  ? 31.278  71.792  -21.655 1.00 90.72  ? 432  VAL A CB    1 
ATOM   2531  C  CG1   . VAL A 1 404  ? 32.334  71.919  -20.570 1.00 48.52  ? 432  VAL A CG1   1 
ATOM   2532  C  CG2   . VAL A 1 404  ? 31.930  71.662  -23.024 1.00 91.23  ? 432  VAL A CG2   1 
ATOM   2533  N  N     . SER A 1 405  ? 28.249  69.698  -22.173 1.00 86.23  ? 433  SER A N     1 
ATOM   2534  C  CA    . SER A 1 405  ? 26.963  69.735  -22.857 1.00 49.07  ? 433  SER A CA    1 
ATOM   2535  C  C     . SER A 1 405  ? 25.978  70.661  -22.144 1.00 43.41  ? 433  SER A C     1 
ATOM   2536  O  O     . SER A 1 405  ? 26.137  70.952  -20.960 1.00 67.24  ? 433  SER A O     1 
ATOM   2537  C  CB    . SER A 1 405  ? 26.385  68.324  -22.974 1.00 41.08  ? 433  SER A CB    1 
ATOM   2538  O  OG    . SER A 1 405  ? 26.507  67.624  -21.749 1.00 66.04  ? 433  SER A OG    1 
ATOM   2539  N  N     . TYR A 1 406  ? 24.961  71.118  -22.870 1.00 42.70  ? 434  TYR A N     1 
ATOM   2540  C  CA    . TYR A 1 406  ? 24.056  72.144  -22.360 1.00 91.94  ? 434  TYR A CA    1 
ATOM   2541  C  C     . TYR A 1 406  ? 22.658  72.016  -22.965 1.00 43.14  ? 434  TYR A C     1 
ATOM   2542  O  O     . TYR A 1 406  ? 22.491  72.103  -24.182 1.00 93.41  ? 434  TYR A O     1 
ATOM   2543  C  CB    . TYR A 1 406  ? 24.641  73.531  -22.648 1.00 93.63  ? 434  TYR A CB    1 
ATOM   2544  C  CG    . TYR A 1 406  ? 23.813  74.700  -22.158 1.00 47.40  ? 434  TYR A CG    1 
ATOM   2545  C  CD1   . TYR A 1 406  ? 23.959  75.187  -20.867 1.00 41.49  ? 434  TYR A CD1   1 
ATOM   2546  C  CD2   . TYR A 1 406  ? 22.907  75.335  -22.998 1.00 49.89  ? 434  TYR A CD2   1 
ATOM   2547  C  CE1   . TYR A 1 406  ? 23.213  76.260  -20.418 1.00 43.23  ? 434  TYR A CE1   1 
ATOM   2548  C  CE2   . TYR A 1 406  ? 22.157  76.409  -22.560 1.00 55.33  ? 434  TYR A CE2   1 
ATOM   2549  C  CZ    . TYR A 1 406  ? 22.315  76.868  -21.270 1.00 65.07  ? 434  TYR A CZ    1 
ATOM   2550  O  OH    . TYR A 1 406  ? 21.570  77.937  -20.829 1.00 69.16  ? 434  TYR A OH    1 
ATOM   2551  N  N     . LEU A 1 407  ? 21.655  71.813  -22.114 1.00 44.02  ? 435  LEU A N     1 
ATOM   2552  C  CA    . LEU A 1 407  ? 20.283  71.668  -22.590 1.00 42.15  ? 435  LEU A CA    1 
ATOM   2553  C  C     . LEU A 1 407  ? 19.375  72.783  -22.080 1.00 49.95  ? 435  LEU A C     1 
ATOM   2554  O  O     . LEU A 1 407  ? 18.980  72.778  -20.918 1.00 42.57  ? 435  LEU A O     1 
ATOM   2555  C  CB    . LEU A 1 407  ? 19.718  70.309  -22.177 1.00 55.41  ? 435  LEU A CB    1 
ATOM   2556  C  CG    . LEU A 1 407  ? 20.419  69.090  -22.776 1.00 43.16  ? 435  LEU A CG    1 
ATOM   2557  C  CD1   . LEU A 1 407  ? 19.759  67.810  -22.296 1.00 69.38  ? 435  LEU A CD1   1 
ATOM   2558  C  CD2   . LEU A 1 407  ? 20.411  69.163  -24.293 1.00 41.92  ? 435  LEU A CD2   1 
ATOM   2559  N  N     . PRO A 1 408  ? 19.033  73.738  -22.958 1.00 49.45  ? 436  PRO A N     1 
ATOM   2560  C  CA    . PRO A 1 408  ? 18.174  74.877  -22.613 1.00 40.71  ? 436  PRO A CA    1 
ATOM   2561  C  C     . PRO A 1 408  ? 16.693  74.506  -22.553 1.00 44.73  ? 436  PRO A C     1 
ATOM   2562  O  O     . PRO A 1 408  ? 16.185  73.852  -23.464 1.00 68.53  ? 436  PRO A O     1 
ATOM   2563  C  CB    . PRO A 1 408  ? 18.437  75.862  -23.751 1.00 44.15  ? 436  PRO A CB    1 
ATOM   2564  C  CG    . PRO A 1 408  ? 18.766  74.991  -24.915 1.00 47.70  ? 436  PRO A CG    1 
ATOM   2565  C  CD    . PRO A 1 408  ? 19.516  73.814  -24.349 1.00 60.62  ? 436  PRO A CD    1 
ATOM   2566  N  N     . VAL A 1 409  ? 16.013  74.923  -21.489 1.00 49.87  ? 437  VAL A N     1 
ATOM   2567  C  CA    . VAL A 1 409  ? 14.594  74.625  -21.320 1.00 45.62  ? 437  VAL A CA    1 
ATOM   2568  C  C     . VAL A 1 409  ? 13.826  75.794  -20.709 1.00 66.02  ? 437  VAL A C     1 
ATOM   2569  O  O     . VAL A 1 409  ? 14.401  76.837  -20.387 1.00 46.74  ? 437  VAL A O     1 
ATOM   2570  C  CB    . VAL A 1 409  ? 14.375  73.381  -20.432 1.00 41.19  ? 437  VAL A CB    1 
ATOM   2571  C  CG1   . VAL A 1 409  ? 14.724  72.104  -21.188 1.00 47.82  ? 437  VAL A CG1   1 
ATOM   2572  C  CG2   . VAL A 1 409  ? 15.193  73.493  -19.159 1.00 49.89  ? 437  VAL A CG2   1 
ATOM   2573  N  N     . ASN A 1 410  ? 12.520  75.600  -20.547 1.00 69.08  ? 438  ASN A N     1 
ATOM   2574  C  CA    . ASN A 1 410  ? 11.638  76.621  -19.994 1.00 56.17  ? 438  ASN A CA    1 
ATOM   2575  C  C     . ASN A 1 410  ? 10.506  76.002  -19.177 1.00 67.64  ? 438  ASN A C     1 
ATOM   2576  O  O     . ASN A 1 410  ? 10.587  74.841  -18.780 1.00 68.36  ? 438  ASN A O     1 
ATOM   2577  C  CB    . ASN A 1 410  ? 11.073  77.488  -21.118 1.00 44.16  ? 438  ASN A CB    1 
ATOM   2578  C  CG    . ASN A 1 410  ? 10.777  76.691  -22.371 1.00 44.38  ? 438  ASN A CG    1 
ATOM   2579  O  OD1   . ASN A 1 410  ? 10.566  75.480  -22.315 1.00 43.05  ? 438  ASN A OD1   1 
ATOM   2580  N  ND2   . ASN A 1 410  ? 10.771  77.367  -23.514 1.00 56.46  ? 438  ASN A ND2   1 
ATOM   2581  N  N     . GLN A 1 411  ? 9.451   76.774  -18.931 1.00 49.71  ? 439  GLN A N     1 
ATOM   2582  C  CA    . GLN A 1 411  ? 8.312   76.301  -18.143 1.00 56.06  ? 439  GLN A CA    1 
ATOM   2583  C  C     . GLN A 1 411  ? 7.608   75.130  -18.829 1.00 44.96  ? 439  GLN A C     1 
ATOM   2584  O  O     . GLN A 1 411  ? 6.935   74.313  -18.180 1.00 56.48  ? 439  GLN A O     1 
ATOM   2585  C  CB    . GLN A 1 411  ? 7.321   77.443  -17.892 1.00 75.85  ? 439  GLN A CB    1 
ATOM   2586  C  CG    . GLN A 1 411  ? 6.661   78.007  -19.148 1.00 77.02  ? 439  GLN A CG    1 
ATOM   2587  C  CD    . GLN A 1 411  ? 7.569   78.934  -19.940 1.00 76.61  ? 439  GLN A CD    1 
ATOM   2588  O  OE1   . GLN A 1 411  ? 8.618   79.359  -19.456 1.00 68.76  ? 439  GLN A OE1   1 
ATOM   2589  N  NE2   . GLN A 1 411  ? 7.166   79.250  -21.165 1.00 69.98  ? 439  GLN A NE2   1 
ATOM   2590  N  N     . ASN A 1 412  ? 7.779   75.054  -20.146 1.00 43.03  ? 440  ASN A N     1 
ATOM   2591  C  CA    . ASN A 1 412  ? 7.245   73.956  -20.939 1.00 42.54  ? 440  ASN A CA    1 
ATOM   2592  C  C     . ASN A 1 412  ? 7.738   72.608  -20.431 1.00 45.37  ? 440  ASN A C     1 
ATOM   2593  O  O     . ASN A 1 412  ? 7.072   71.593  -20.603 1.00 44.20  ? 440  ASN A O     1 
ATOM   2594  C  CB    . ASN A 1 412  ? 7.619   74.131  -22.411 1.00 41.02  ? 440  ASN A CB    1 
ATOM   2595  C  CG    . ASN A 1 412  ? 7.037   75.393  -23.013 1.00 55.11  ? 440  ASN A CG    1 
ATOM   2596  O  OD1   . ASN A 1 412  ? 5.974   75.858  -22.601 1.00 47.93  ? 440  ASN A OD1   1 
ATOM   2597  N  ND2   . ASN A 1 412  ? 7.732   75.956  -23.995 1.00 48.35  ? 440  ASN A ND2   1 
ATOM   2598  N  N     . TRP A 1 413  ? 8.911   72.610  -19.805 1.00 55.53  ? 441  TRP A N     1 
ATOM   2599  C  CA    . TRP A 1 413  ? 9.441   71.419  -19.159 1.00 48.56  ? 441  TRP A CA    1 
ATOM   2600  C  C     . TRP A 1 413  ? 8.526   70.967  -18.025 1.00 72.38  ? 441  TRP A C     1 
ATOM   2601  O  O     . TRP A 1 413  ? 8.145   69.796  -17.947 1.00 74.06  ? 441  TRP A O     1 
ATOM   2602  C  CB    . TRP A 1 413  ? 10.851  71.679  -18.625 1.00 43.50  ? 441  TRP A CB    1 
ATOM   2603  C  CG    . TRP A 1 413  ? 11.394  70.546  -17.819 1.00 48.17  ? 441  TRP A CG    1 
ATOM   2604  C  CD1   . TRP A 1 413  ? 11.442  70.453  -16.458 1.00 49.44  ? 441  TRP A CD1   1 
ATOM   2605  C  CD2   . TRP A 1 413  ? 11.955  69.333  -18.325 1.00 48.49  ? 441  TRP A CD2   1 
ATOM   2606  N  NE1   . TRP A 1 413  ? 12.005  69.256  -16.087 1.00 40.49  ? 441  TRP A NE1   1 
ATOM   2607  C  CE2   . TRP A 1 413  ? 12.328  68.550  -17.215 1.00 49.98  ? 441  TRP A CE2   1 
ATOM   2608  C  CE3   . TRP A 1 413  ? 12.180  68.832  -19.610 1.00 47.79  ? 441  TRP A CE3   1 
ATOM   2609  C  CZ2   . TRP A 1 413  ? 12.912  67.295  -17.352 1.00 40.80  ? 441  TRP A CZ2   1 
ATOM   2610  C  CZ3   . TRP A 1 413  ? 12.760  67.591  -19.744 1.00 48.66  ? 441  TRP A CZ3   1 
ATOM   2611  C  CH2   . TRP A 1 413  ? 13.120  66.834  -18.622 1.00 40.16  ? 441  TRP A CH2   1 
ATOM   2612  N  N     . GLU A 1 414  ? 8.177   71.906  -17.151 1.00 46.03  ? 442  GLU A N     1 
ATOM   2613  C  CA    . GLU A 1 414  ? 7.327   71.606  -16.006 1.00 40.51  ? 442  GLU A CA    1 
ATOM   2614  C  C     . GLU A 1 414  ? 5.950   71.152  -16.479 1.00 40.14  ? 442  GLU A C     1 
ATOM   2615  O  O     . GLU A 1 414  ? 5.392   70.172  -15.965 1.00 45.22  ? 442  GLU A O     1 
ATOM   2616  C  CB    . GLU A 1 414  ? 7.210   72.825  -15.088 1.00 67.14  ? 442  GLU A CB    1 
ATOM   2617  C  CG    . GLU A 1 414  ? 6.886   72.489  -13.639 1.00 69.75  ? 442  GLU A CG    1 
ATOM   2618  C  CD    . GLU A 1 414  ? 8.040   71.809  -12.921 1.00 71.06  ? 442  GLU A CD    1 
ATOM   2619  O  OE1   . GLU A 1 414  ? 9.202   72.000  -13.341 1.00 74.81  ? 442  GLU A OE1   1 
ATOM   2620  O  OE2   . GLU A 1 414  ? 7.787   71.082  -11.937 1.00 70.12  ? 442  GLU A OE2   1 
ATOM   2621  N  N     . ARG A 1 415  ? 5.413   71.861  -17.471 1.00 56.42  ? 443  ARG A N     1 
ATOM   2622  C  CA    . ARG A 1 415  ? 4.130   71.484  -18.065 1.00 69.97  ? 443  ARG A CA    1 
ATOM   2623  C  C     . ARG A 1 415  ? 4.183   70.069  -18.639 1.00 67.28  ? 443  ARG A C     1 
ATOM   2624  O  O     . ARG A 1 415  ? 3.243   69.285  -18.480 1.00 64.21  ? 443  ARG A O     1 
ATOM   2625  C  CB    . ARG A 1 415  ? 3.725   72.478  -19.158 1.00 77.58  ? 443  ARG A CB    1 
ATOM   2626  C  CG    . ARG A 1 415  ? 2.895   73.659  -18.669 1.00 85.05  ? 443  ARG A CG    1 
ATOM   2627  C  CD    . ARG A 1 415  ? 3.697   74.595  -17.778 1.00 87.75  ? 443  ARG A CD    1 
ATOM   2628  N  NE    . ARG A 1 415  ? 2.896   75.726  -17.318 1.00 93.26  ? 443  ARG A NE    1 
ATOM   2629  C  CZ    . ARG A 1 415  ? 2.774   76.872  -17.979 1.00 93.02  ? 443  ARG A CZ    1 
ATOM   2630  N  NH1   . ARG A 1 415  ? 3.403   77.044  -19.134 1.00 71.98  ? 443  ARG A NH1   1 
ATOM   2631  N  NH2   . ARG A 1 415  ? 2.023   77.847  -17.486 1.00 93.95  ? 443  ARG A NH2   1 
ATOM   2632  N  N     . TYR A 1 416  ? 5.292   69.754  -19.301 1.00 67.04  ? 444  TYR A N     1 
ATOM   2633  C  CA    . TYR A 1 416  ? 5.519   68.429  -19.868 1.00 65.84  ? 444  TYR A CA    1 
ATOM   2634  C  C     . TYR A 1 416  ? 5.504   67.361  -18.784 1.00 43.75  ? 444  TYR A C     1 
ATOM   2635  O  O     . TYR A 1 416  ? 4.870   66.318  -18.942 1.00 43.59  ? 444  TYR A O     1 
ATOM   2636  C  CB    . TYR A 1 416  ? 6.850   68.391  -20.627 1.00 43.04  ? 444  TYR A CB    1 
ATOM   2637  C  CG    . TYR A 1 416  ? 7.383   66.997  -20.872 1.00 43.79  ? 444  TYR A CG    1 
ATOM   2638  C  CD1   . TYR A 1 416  ? 6.841   66.188  -21.862 1.00 76.87  ? 444  TYR A CD1   1 
ATOM   2639  C  CD2   . TYR A 1 416  ? 8.436   66.492  -20.118 1.00 45.28  ? 444  TYR A CD2   1 
ATOM   2640  C  CE1   . TYR A 1 416  ? 7.327   64.913  -22.089 1.00 74.14  ? 444  TYR A CE1   1 
ATOM   2641  C  CE2   . TYR A 1 416  ? 8.928   65.218  -20.338 1.00 46.13  ? 444  TYR A CE2   1 
ATOM   2642  C  CZ    . TYR A 1 416  ? 8.370   64.434  -21.325 1.00 69.54  ? 444  TYR A CZ    1 
ATOM   2643  O  OH    . TYR A 1 416  ? 8.854   63.165  -21.550 1.00 46.57  ? 444  TYR A OH    1 
ATOM   2644  N  N     . LEU A 1 417  ? 6.207   67.628  -17.687 1.00 46.59  ? 445  LEU A N     1 
ATOM   2645  C  CA    . LEU A 1 417  ? 6.241   66.708  -16.555 1.00 49.09  ? 445  LEU A CA    1 
ATOM   2646  C  C     . LEU A 1 417  ? 4.839   66.450  -16.012 1.00 48.71  ? 445  LEU A C     1 
ATOM   2647  O  O     . LEU A 1 417  ? 4.431   65.295  -15.841 1.00 65.28  ? 445  LEU A O     1 
ATOM   2648  C  CB    . LEU A 1 417  ? 7.141   67.255  -15.444 1.00 47.82  ? 445  LEU A CB    1 
ATOM   2649  C  CG    . LEU A 1 417  ? 8.570   66.709  -15.370 1.00 43.21  ? 445  LEU A CG    1 
ATOM   2650  C  CD1   . LEU A 1 417  ? 9.298   66.889  -16.692 1.00 46.22  ? 445  LEU A CD1   1 
ATOM   2651  C  CD2   . LEU A 1 417  ? 9.340   67.367  -14.234 1.00 55.98  ? 445  LEU A CD2   1 
ATOM   2652  N  N     . ALA A 1 418  ? 4.104   67.530  -15.757 1.00 49.50  ? 446  ALA A N     1 
ATOM   2653  C  CA    . ALA A 1 418  ? 2.752   67.427  -15.213 1.00 44.52  ? 446  ALA A CA    1 
ATOM   2654  C  C     . ALA A 1 418  ? 1.818   66.629  -16.125 1.00 43.47  ? 446  ALA A C     1 
ATOM   2655  O  O     . ALA A 1 418  ? 1.128   65.711  -15.671 1.00 43.64  ? 446  ALA A O     1 
ATOM   2656  C  CB    . ALA A 1 418  ? 2.182   68.812  -14.964 1.00 49.16  ? 446  ALA A CB    1 
ATOM   2657  N  N     . GLU A 1 419  ? 1.805   66.977  -17.409 1.00 42.48  ? 447  GLU A N     1 
ATOM   2658  C  CA    . GLU A 1 419  ? 0.917   66.322  -18.366 1.00 46.42  ? 447  GLU A CA    1 
ATOM   2659  C  C     . GLU A 1 419  ? 1.272   64.850  -18.572 1.00 42.20  ? 447  GLU A C     1 
ATOM   2660  O  O     . GLU A 1 419  ? 0.388   63.990  -18.602 1.00 48.08  ? 447  GLU A O     1 
ATOM   2661  C  CB    . GLU A 1 419  ? 0.942   67.058  -19.707 1.00 60.09  ? 447  GLU A CB    1 
ATOM   2662  C  CG    . GLU A 1 419  ? 0.268   68.423  -19.678 1.00 60.58  ? 447  GLU A CG    1 
ATOM   2663  C  CD    . GLU A 1 419  ? -1.222  68.334  -19.401 1.00 69.63  ? 447  GLU A CD    1 
ATOM   2664  O  OE1   . GLU A 1 419  ? -1.842  67.320  -19.784 1.00 73.46  ? 447  GLU A OE1   1 
ATOM   2665  O  OE2   . GLU A 1 419  ? -1.773  69.279  -18.797 1.00 75.09  ? 447  GLU A OE2   1 
ATOM   2666  N  N     . ALA A 1 420  ? 2.562   64.565  -18.713 1.00 43.01  ? 448  ALA A N     1 
ATOM   2667  C  CA    . ALA A 1 420  ? 3.020   63.194  -18.912 1.00 43.87  ? 448  ALA A CA    1 
ATOM   2668  C  C     . ALA A 1 420  ? 2.684   62.321  -17.708 1.00 44.81  ? 448  ALA A C     1 
ATOM   2669  O  O     . ALA A 1 420  ? 2.160   61.213  -17.861 1.00 56.60  ? 448  ALA A O     1 
ATOM   2670  C  CB    . ALA A 1 420  ? 4.514   63.165  -19.184 1.00 40.66  ? 448  ALA A CB    1 
ATOM   2671  N  N     . GLN A 1 421  ? 2.981   62.822  -16.512 1.00 45.43  ? 449  GLN A N     1 
ATOM   2672  C  CA    . GLN A 1 421  ? 2.681   62.077  -15.294 1.00 46.35  ? 449  GLN A CA    1 
ATOM   2673  C  C     . GLN A 1 421  ? 1.177   61.876  -15.144 1.00 47.51  ? 449  GLN A C     1 
ATOM   2674  O  O     . GLN A 1 421  ? 0.726   60.833  -14.669 1.00 56.51  ? 449  GLN A O     1 
ATOM   2675  C  CB    . GLN A 1 421  ? 3.245   62.791  -14.065 1.00 67.88  ? 449  GLN A CB    1 
ATOM   2676  C  CG    . GLN A 1 421  ? 3.100   62.000  -12.771 1.00 65.05  ? 449  GLN A CG    1 
ATOM   2677  C  CD    . GLN A 1 421  ? 3.874   60.693  -12.788 1.00 74.35  ? 449  GLN A CD    1 
ATOM   2678  O  OE1   . GLN A 1 421  ? 4.878   60.558  -13.488 1.00 60.96  ? 449  GLN A OE1   1 
ATOM   2679  N  NE2   . GLN A 1 421  ? 3.405   59.720  -12.014 1.00 71.53  ? 449  GLN A NE2   1 
ATOM   2680  N  N     . GLY A 1 422  ? 0.406   62.878  -15.558 1.00 60.84  ? 450  GLY A N     1 
ATOM   2681  C  CA    . GLY A 1 422  ? -1.042  62.778  -15.543 1.00 55.06  ? 450  GLY A CA    1 
ATOM   2682  C  C     . GLY A 1 422  ? -1.549  61.658  -16.433 1.00 43.36  ? 450  GLY A C     1 
ATOM   2683  O  O     . GLY A 1 422  ? -2.325  60.808  -15.991 1.00 43.63  ? 450  GLY A O     1 
ATOM   2684  N  N     . THR A 1 423  ? -1.106  61.658  -17.688 1.00 42.96  ? 451  THR A N     1 
ATOM   2685  C  CA    . THR A 1 423  ? -1.496  60.626  -18.645 1.00 42.92  ? 451  THR A CA    1 
ATOM   2686  C  C     . THR A 1 423  ? -1.113  59.237  -18.143 1.00 45.97  ? 451  THR A C     1 
ATOM   2687  O  O     . THR A 1 423  ? -1.918  58.300  -18.194 1.00 44.51  ? 451  THR A O     1 
ATOM   2688  C  CB    . THR A 1 423  ? -0.846  60.855  -20.023 1.00 42.52  ? 451  THR A CB    1 
ATOM   2689  O  OG1   . THR A 1 423  ? -1.211  62.147  -20.521 1.00 41.30  ? 451  THR A OG1   1 
ATOM   2690  C  CG2   . THR A 1 423  ? -1.298  59.790  -21.008 1.00 40.85  ? 451  THR A CG2   1 
ATOM   2691  N  N     . TYR A 1 424  ? 0.119   59.116  -17.655 1.00 65.74  ? 452  TYR A N     1 
ATOM   2692  C  CA    . TYR A 1 424  ? 0.607   57.859  -17.097 1.00 49.93  ? 452  TYR A CA    1 
ATOM   2693  C  C     . TYR A 1 424  ? -0.289  57.368  -15.963 1.00 64.55  ? 452  TYR A C     1 
ATOM   2694  O  O     . TYR A 1 424  ? -0.698  56.204  -15.945 1.00 69.12  ? 452  TYR A O     1 
ATOM   2695  C  CB    . TYR A 1 424  ? 2.045   58.021  -16.602 1.00 47.78  ? 452  TYR A CB    1 
ATOM   2696  C  CG    . TYR A 1 424  ? 2.586   56.817  -15.863 1.00 49.44  ? 452  TYR A CG    1 
ATOM   2697  C  CD1   . TYR A 1 424  ? 2.595   56.778  -14.474 1.00 40.15  ? 452  TYR A CD1   1 
ATOM   2698  C  CD2   . TYR A 1 424  ? 3.091   55.722  -16.553 1.00 40.44  ? 452  TYR A CD2   1 
ATOM   2699  C  CE1   . TYR A 1 424  ? 3.089   55.681  -13.794 1.00 41.72  ? 452  TYR A CE1   1 
ATOM   2700  C  CE2   . TYR A 1 424  ? 3.587   54.621  -15.880 1.00 42.09  ? 452  TYR A CE2   1 
ATOM   2701  C  CZ    . TYR A 1 424  ? 3.583   54.606  -14.501 1.00 42.70  ? 452  TYR A CZ    1 
ATOM   2702  O  OH    . TYR A 1 424  ? 4.076   53.515  -13.825 1.00 44.40  ? 452  TYR A OH    1 
ATOM   2703  N  N     . GLU A 1 425  ? -0.596  58.259  -15.024 1.00 44.08  ? 453  GLU A N     1 
ATOM   2704  C  CA    . GLU A 1 425  ? -1.445  57.908  -13.890 1.00 46.94  ? 453  GLU A CA    1 
ATOM   2705  C  C     . GLU A 1 425  ? -2.846  57.508  -14.338 1.00 49.93  ? 453  GLU A C     1 
ATOM   2706  O  O     . GLU A 1 425  ? -3.471  56.642  -13.729 1.00 55.60  ? 453  GLU A O     1 
ATOM   2707  C  CB    . GLU A 1 425  ? -1.526  59.068  -12.894 1.00 46.70  ? 453  GLU A CB    1 
ATOM   2708  C  CG    . GLU A 1 425  ? -0.265  59.265  -12.069 1.00 74.72  ? 453  GLU A CG    1 
ATOM   2709  C  CD    . GLU A 1 425  ? -0.413  60.354  -11.025 1.00 74.57  ? 453  GLU A CD    1 
ATOM   2710  O  OE1   . GLU A 1 425  ? 0.555   60.593  -10.271 1.00 68.01  ? 453  GLU A OE1   1 
ATOM   2711  O  OE2   . GLU A 1 425  ? -1.497  60.971  -10.957 1.00 72.39  ? 453  GLU A OE2   1 
ATOM   2712  N  N     . GLU A 1 426  ? -3.334  58.135  -15.404 1.00 60.12  ? 454  GLU A N     1 
ATOM   2713  C  CA    . GLU A 1 426  ? -4.658  57.815  -15.929 1.00 49.63  ? 454  GLU A CA    1 
ATOM   2714  C  C     . GLU A 1 426  ? -4.697  56.422  -16.549 1.00 45.16  ? 454  GLU A C     1 
ATOM   2715  O  O     . GLU A 1 426  ? -5.537  55.596  -16.183 1.00 45.31  ? 454  GLU A O     1 
ATOM   2716  C  CB    . GLU A 1 426  ? -5.099  58.858  -16.959 1.00 69.07  ? 454  GLU A CB    1 
ATOM   2717  C  CG    . GLU A 1 426  ? -5.454  60.210  -16.360 1.00 76.85  ? 454  GLU A CG    1 
ATOM   2718  C  CD    . GLU A 1 426  ? -6.629  60.137  -15.403 1.00 68.83  ? 454  GLU A CD    1 
ATOM   2719  O  OE1   . GLU A 1 426  ? -6.674  60.947  -14.454 1.00 92.19  ? 454  GLU A OE1   1 
ATOM   2720  O  OE2   . GLU A 1 426  ? -7.512  59.275  -15.603 1.00 85.00  ? 454  GLU A OE2   1 
ATOM   2721  N  N     . LEU A 1 427  ? -3.788  56.163  -17.485 1.00 45.50  ? 455  LEU A N     1 
ATOM   2722  C  CA    . LEU A 1 427  ? -3.729  54.861  -18.144 1.00 46.47  ? 455  LEU A CA    1 
ATOM   2723  C  C     . LEU A 1 427  ? -3.479  53.738  -17.136 1.00 46.57  ? 455  LEU A C     1 
ATOM   2724  O  O     . LEU A 1 427  ? -4.098  52.670  -17.213 1.00 55.24  ? 455  LEU A O     1 
ATOM   2725  C  CB    . LEU A 1 427  ? -2.648  54.857  -19.226 1.00 46.75  ? 455  LEU A CB    1 
ATOM   2726  C  CG    . LEU A 1 427  ? -2.945  55.718  -20.456 1.00 45.47  ? 455  LEU A CG    1 
ATOM   2727  C  CD1   . LEU A 1 427  ? -1.805  55.660  -21.458 1.00 45.87  ? 455  LEU A CD1   1 
ATOM   2728  C  CD2   . LEU A 1 427  ? -4.245  55.278  -21.104 1.00 45.14  ? 455  LEU A CD2   1 
ATOM   2729  N  N     . GLN A 1 428  ? -2.582  53.988  -16.186 1.00 40.48  ? 456  GLN A N     1 
ATOM   2730  C  CA    . GLN A 1 428  ? -2.308  53.022  -15.127 1.00 41.57  ? 456  GLN A CA    1 
ATOM   2731  C  C     . GLN A 1 428  ? -3.549  52.801  -14.268 1.00 41.33  ? 456  GLN A C     1 
ATOM   2732  O  O     . GLN A 1 428  ? -3.817  51.682  -13.828 1.00 40.70  ? 456  GLN A O     1 
ATOM   2733  C  CB    . GLN A 1 428  ? -1.140  53.483  -14.253 1.00 64.03  ? 456  GLN A CB    1 
ATOM   2734  C  CG    . GLN A 1 428  ? -0.751  52.485  -13.171 1.00 68.74  ? 456  GLN A CG    1 
ATOM   2735  C  CD    . GLN A 1 428  ? 0.306   53.022  -12.226 1.00 69.42  ? 456  GLN A CD    1 
ATOM   2736  O  OE1   . GLN A 1 428  ? 0.734   54.170  -12.340 1.00 68.10  ? 456  GLN A OE1   1 
ATOM   2737  N  NE2   . GLN A 1 428  ? 0.732   52.190  -11.282 1.00 72.49  ? 456  GLN A NE2   1 
ATOM   2738  N  N     . ARG A 1 429  ? -4.304  53.872  -14.035 1.00 48.33  ? 457  ARG A N     1 
ATOM   2739  C  CA    . ARG A 1 429  ? -5.542  53.782  -13.267 1.00 55.24  ? 457  ARG A CA    1 
ATOM   2740  C  C     . ARG A 1 429  ? -6.557  52.889  -13.971 1.00 64.95  ? 457  ARG A C     1 
ATOM   2741  O  O     . ARG A 1 429  ? -7.196  52.051  -13.338 1.00 69.26  ? 457  ARG A O     1 
ATOM   2742  C  CB    . ARG A 1 429  ? -6.140  55.170  -13.035 1.00 56.61  ? 457  ARG A CB    1 
ATOM   2743  C  CG    . ARG A 1 429  ? -7.462  55.160  -12.284 1.00 72.46  ? 457  ARG A CG    1 
ATOM   2744  C  CD    . ARG A 1 429  ? -8.141  56.519  -12.345 1.00 71.80  ? 457  ARG A CD    1 
ATOM   2745  N  NE    . ARG A 1 429  ? -8.335  56.963  -13.722 1.00 68.62  ? 457  ARG A NE    1 
ATOM   2746  C  CZ    . ARG A 1 429  ? -9.367  56.612  -14.483 1.00 69.43  ? 457  ARG A CZ    1 
ATOM   2747  N  NH1   . ARG A 1 429  ? -10.307 55.809  -14.002 1.00 69.55  ? 457  ARG A NH1   1 
ATOM   2748  N  NH2   . ARG A 1 429  ? -9.460  57.064  -15.727 1.00 71.67  ? 457  ARG A NH2   1 
ATOM   2749  N  N     . GLU A 1 430  ? -6.700  53.072  -15.281 1.00 47.69  ? 458  GLU A N     1 
ATOM   2750  C  CA    . GLU A 1 430  ? -7.611  52.254  -16.079 1.00 42.44  ? 458  GLU A CA    1 
ATOM   2751  C  C     . GLU A 1 430  ? -7.207  50.783  -16.065 1.00 49.33  ? 458  GLU A C     1 
ATOM   2752  O  O     . GLU A 1 430  ? -8.026  49.901  -15.774 1.00 67.61  ? 458  GLU A O     1 
ATOM   2753  C  CB    . GLU A 1 430  ? -7.661  52.765  -17.520 1.00 46.84  ? 458  GLU A CB    1 
ATOM   2754  C  CG    . GLU A 1 430  ? -8.343  51.816  -18.491 1.00 47.39  ? 458  GLU A CG    1 
ATOM   2755  C  CD    . GLU A 1 430  ? -8.325  52.329  -19.918 1.00 69.39  ? 458  GLU A CD    1 
ATOM   2756  O  OE1   . GLU A 1 430  ? -8.005  53.519  -20.122 1.00 64.96  ? 458  GLU A OE1   1 
ATOM   2757  O  OE2   . GLU A 1 430  ? -8.631  51.540  -20.837 1.00 56.67  ? 458  GLU A OE2   1 
ATOM   2758  N  N     . MET A 1 431  ? -5.941  50.531  -16.386 1.00 40.14  ? 459  MET A N     1 
ATOM   2759  C  CA    . MET A 1 431  ? -5.395  49.178  -16.397 1.00 65.68  ? 459  MET A CA    1 
ATOM   2760  C  C     . MET A 1 431  ? -5.606  48.468  -15.062 1.00 48.87  ? 459  MET A C     1 
ATOM   2761  O  O     . MET A 1 431  ? -6.157  47.365  -15.011 1.00 49.79  ? 459  MET A O     1 
ATOM   2762  C  CB    . MET A 1 431  ? -3.905  49.217  -16.734 1.00 66.15  ? 459  MET A CB    1 
ATOM   2763  C  CG    . MET A 1 431  ? -3.198  47.884  -16.603 1.00 44.73  ? 459  MET A CG    1 
ATOM   2764  S  SD    . MET A 1 431  ? -1.409  48.089  -16.590 1.00 90.37  ? 459  MET A SD    1 
ATOM   2765  C  CE    . MET A 1 431  ? -1.184  49.010  -15.070 1.00 86.03  ? 459  MET A CE    1 
ATOM   2766  N  N     . LYS A 1 432  ? -5.173  49.114  -13.983 1.00 44.08  ? 460  LYS A N     1 
ATOM   2767  C  CA    . LYS A 1 432  ? -5.295  48.539  -12.649 1.00 56.47  ? 460  LYS A CA    1 
ATOM   2768  C  C     . LYS A 1 432  ? -6.755  48.376  -12.242 1.00 56.10  ? 460  LYS A C     1 
ATOM   2769  O  O     . LYS A 1 432  ? -7.087  47.480  -11.473 1.00 43.90  ? 460  LYS A O     1 
ATOM   2770  C  CB    . LYS A 1 432  ? -4.553  49.396  -11.621 1.00 43.23  ? 460  LYS A CB    1 
ATOM   2771  C  CG    . LYS A 1 432  ? -3.039  49.363  -11.764 1.00 44.52  ? 460  LYS A CG    1 
ATOM   2772  C  CD    . LYS A 1 432  ? -2.364  49.006  -10.449 1.00 65.99  ? 460  LYS A CD    1 
ATOM   2773  C  CE    . LYS A 1 432  ? -2.723  49.995  -9.353  1.00 68.52  ? 460  LYS A CE    1 
ATOM   2774  N  NZ    . LYS A 1 432  ? -2.068  49.653  -8.059  1.00 55.05  ? 460  LYS A NZ    1 
ATOM   2775  N  N     . LYS A 1 433  ? -7.622  49.239  -12.763 1.00 69.55  ? 461  LYS A N     1 
ATOM   2776  C  CA    . LYS A 1 433  ? -9.051  49.149  -12.481 1.00 72.12  ? 461  LYS A CA    1 
ATOM   2777  C  C     . LYS A 1 433  ? -9.631  47.881  -13.094 1.00 56.34  ? 461  LYS A C     1 
ATOM   2778  O  O     . LYS A 1 433  ? -10.323 47.108  -12.424 1.00 64.68  ? 461  LYS A O     1 
ATOM   2779  C  CB    . LYS A 1 433  ? -9.789  50.378  -13.017 1.00 73.31  ? 461  LYS A CB    1 
ATOM   2780  C  CG    . LYS A 1 433  ? -11.137 50.638  -12.364 1.00 71.62  ? 461  LYS A CG    1 
ATOM   2781  C  CD    . LYS A 1 433  ? -10.969 51.043  -10.909 1.00 73.64  ? 461  LYS A CD    1 
ATOM   2782  C  CE    . LYS A 1 433  ? -12.301 51.413  -10.277 1.00 76.66  ? 461  LYS A CE    1 
ATOM   2783  N  NZ    . LYS A 1 433  ? -12.135 51.867  -8.868  1.00 76.22  ? 461  LYS A NZ    1 
ATOM   2784  N  N     . SER A 1 434  ? -9.339  47.671  -14.375 1.00 42.11  ? 462  SER A N     1 
ATOM   2785  C  CA    . SER A 1 434  ? -9.819  46.488  -15.078 1.00 43.28  ? 462  SER A CA    1 
ATOM   2786  C  C     . SER A 1 434  ? -9.264  45.211  -14.453 1.00 45.19  ? 462  SER A C     1 
ATOM   2787  O  O     . SER A 1 434  ? -10.008 44.266  -14.172 1.00 46.11  ? 462  SER A O     1 
ATOM   2788  C  CB    . SER A 1 434  ? -9.442  46.555  -16.559 1.00 43.28  ? 462  SER A CB    1 
ATOM   2789  O  OG    . SER A 1 434  ? -9.902  45.407  -17.252 1.00 56.77  ? 462  SER A OG    1 
ATOM   2790  N  N     . LEU A 1 435  ? -7.955  45.193  -14.226 1.00 65.39  ? 463  LEU A N     1 
ATOM   2791  C  CA    . LEU A 1 435  ? -7.296  44.017  -13.668 1.00 47.80  ? 463  LEU A CA    1 
ATOM   2792  C  C     . LEU A 1 435  ? -7.772  43.694  -12.253 1.00 48.09  ? 463  LEU A C     1 
ATOM   2793  O  O     . LEU A 1 435  ? -7.936  42.526  -11.903 1.00 64.76  ? 463  LEU A O     1 
ATOM   2794  C  CB    . LEU A 1 435  ? -5.780  44.206  -13.674 1.00 48.39  ? 463  LEU A CB    1 
ATOM   2795  C  CG    . LEU A 1 435  ? -5.023  43.514  -14.808 1.00 49.73  ? 463  LEU A CG    1 
ATOM   2796  C  CD1   . LEU A 1 435  ? -5.497  44.014  -16.163 1.00 64.21  ? 463  LEU A CD1   1 
ATOM   2797  C  CD2   . LEU A 1 435  ? -3.530  43.727  -14.646 1.00 67.38  ? 463  LEU A CD2   1 
ATOM   2798  N  N     . MET A 1 436  ? -7.997  44.723  -11.441 1.00 46.71  ? 464  MET A N     1 
ATOM   2799  C  CA    . MET A 1 436  ? -8.474  44.501  -10.080 1.00 46.93  ? 464  MET A CA    1 
ATOM   2800  C  C     . MET A 1 436  ? -9.939  44.085  -10.108 1.00 46.69  ? 464  MET A C     1 
ATOM   2801  O  O     . MET A 1 436  ? -10.418 43.418  -9.193  1.00 48.51  ? 464  MET A O     1 
ATOM   2802  C  CB    . MET A 1 436  ? -8.283  45.749  -9.212  1.00 66.45  ? 464  MET A CB    1 
ATOM   2803  C  CG    . MET A 1 436  ? -9.348  46.819  -9.389  1.00 75.55  ? 464  MET A CG    1 
ATOM   2804  S  SD    . MET A 1 436  ? -8.850  48.421  -8.727  1.00 41.31  ? 464  MET A SD    1 
ATOM   2805  C  CE    . MET A 1 436  ? -8.571  48.013  -7.006  1.00 43.77  ? 464  MET A CE    1 
ATOM   2806  N  N     . ASP A 1 437  ? -10.646 44.477  -11.165 1.00 70.59  ? 465  ASP A N     1 
ATOM   2807  C  CA    . ASP A 1 437  ? -12.016 44.020  -11.363 1.00 69.06  ? 465  ASP A CA    1 
ATOM   2808  C  C     . ASP A 1 437  ? -12.025 42.523  -11.647 1.00 60.47  ? 465  ASP A C     1 
ATOM   2809  O  O     . ASP A 1 437  ? -12.798 41.770  -11.047 1.00 48.36  ? 465  ASP A O     1 
ATOM   2810  C  CB    . ASP A 1 437  ? -12.687 44.787  -12.503 1.00 64.94  ? 465  ASP A CB    1 
ATOM   2811  C  CG    . ASP A 1 437  ? -14.020 44.188  -12.902 1.00 64.29  ? 465  ASP A CG    1 
ATOM   2812  O  OD1   . ASP A 1 437  ? -14.055 43.413  -13.881 1.00 67.00  ? 465  ASP A OD1   1 
ATOM   2813  O  OD2   . ASP A 1 437  ? -15.033 44.491  -12.236 1.00 64.17  ? 465  ASP A OD2   1 
ATOM   2814  N  N     . LEU A 1 438  ? -11.154 42.097  -12.560 1.00 75.25  ? 466  LEU A N     1 
ATOM   2815  C  CA    . LEU A 1 438  ? -11.004 40.677  -12.869 1.00 60.75  ? 466  LEU A CA    1 
ATOM   2816  C  C     . LEU A 1 438  ? -10.557 39.890  -11.639 1.00 56.10  ? 466  LEU A C     1 
ATOM   2817  O  O     . LEU A 1 438  ? -10.964 38.746  -11.443 1.00 56.65  ? 466  LEU A O     1 
ATOM   2818  C  CB    . LEU A 1 438  ? -10.008 40.471  -14.013 1.00 55.60  ? 466  LEU A CB    1 
ATOM   2819  C  CG    . LEU A 1 438  ? -10.562 40.417  -15.439 1.00 55.57  ? 466  LEU A CG    1 
ATOM   2820  C  CD1   . LEU A 1 438  ? -11.624 39.335  -15.556 1.00 72.90  ? 466  LEU A CD1   1 
ATOM   2821  C  CD2   . LEU A 1 438  ? -11.115 41.764  -15.879 1.00 77.85  ? 466  LEU A CD2   1 
ATOM   2822  N  N     . ALA A 1 439  ? -9.724  40.514  -10.812 1.00 66.31  ? 467  ALA A N     1 
ATOM   2823  C  CA    . ALA A 1 439  ? -9.228  39.879  -9.594  1.00 56.82  ? 467  ALA A CA    1 
ATOM   2824  C  C     . ALA A 1 439  ? -10.291 39.856  -8.498  1.00 56.32  ? 467  ALA A C     1 
ATOM   2825  O  O     . ALA A 1 439  ? -10.194 39.085  -7.544  1.00 56.54  ? 467  ALA A O     1 
ATOM   2826  C  CB    . ALA A 1 439  ? -7.977  40.589  -9.100  1.00 56.55  ? 467  ALA A CB    1 
ATOM   2827  N  N     . ASN A 1 440  ? -11.303 40.707  -8.635  1.00 64.71  ? 468  ASN A N     1 
ATOM   2828  C  CA    . ASN A 1 440  ? -12.390 40.755  -7.664  1.00 55.35  ? 468  ASN A CA    1 
ATOM   2829  C  C     . ASN A 1 440  ? -13.515 39.782  -8.000  1.00 75.00  ? 468  ASN A C     1 
ATOM   2830  O  O     . ASN A 1 440  ? -14.055 39.119  -7.114  1.00 69.88  ? 468  ASN A O     1 
ATOM   2831  C  CB    . ASN A 1 440  ? -12.952 42.175  -7.558  1.00 47.97  ? 468  ASN A CB    1 
ATOM   2832  C  CG    . ASN A 1 440  ? -12.096 43.078  -6.692  1.00 47.37  ? 468  ASN A CG    1 
ATOM   2833  O  OD1   . ASN A 1 440  ? -11.459 42.624  -5.742  1.00 68.44  ? 468  ASN A OD1   1 
ATOM   2834  N  ND2   . ASN A 1 440  ? -12.079 44.366  -7.016  1.00 45.82  ? 468  ASN A ND2   1 
ATOM   2835  N  N     . ASP A 1 441  ? -13.866 39.697  -9.279  1.00 70.74  ? 469  ASP A N     1 
ATOM   2836  C  CA    . ASP A 1 441  ? -14.967 38.837  -9.704  1.00 74.90  ? 469  ASP A CA    1 
ATOM   2837  C  C     . ASP A 1 441  ? -14.561 37.368  -9.796  1.00 68.49  ? 469  ASP A C     1 
ATOM   2838  O  O     . ASP A 1 441  ? -15.411 36.493  -9.959  1.00 73.13  ? 469  ASP A O     1 
ATOM   2839  C  CB    . ASP A 1 441  ? -15.522 39.308  -11.050 1.00 68.49  ? 469  ASP A CB    1 
ATOM   2840  C  CG    . ASP A 1 441  ? -16.442 40.506  -10.912 1.00 71.14  ? 469  ASP A CG    1 
ATOM   2841  O  OD1   . ASP A 1 441  ? -17.069 40.651  -9.842  1.00 69.02  ? 469  ASP A OD1   1 
ATOM   2842  O  OD2   . ASP A 1 441  ? -16.540 41.298  -11.873 1.00 76.30  ? 469  ASP A OD2   1 
ATOM   2843  N  N     . ALA A 1 442  ? -13.264 37.099  -9.689  1.00 71.26  ? 470  ALA A N     1 
ATOM   2844  C  CA    . ALA A 1 442  ? -12.767 35.729  -9.747  1.00 74.62  ? 470  ALA A CA    1 
ATOM   2845  C  C     . ALA A 1 442  ? -12.522 35.177  -8.347  1.00 70.60  ? 470  ALA A C     1 
ATOM   2846  O  O     . ALA A 1 442  ? -12.240 33.992  -8.173  1.00 77.91  ? 470  ALA A O     1 
ATOM   2847  C  CB    . ALA A 1 442  ? -11.493 35.661  -10.573 1.00 71.94  ? 470  ALA A CB    1 
ATOM   2848  N  N     . CYS A 1 443  ? -12.639 36.049  -7.351  1.00 70.26  ? 471  CYS A N     1 
ATOM   2849  C  CA    . CYS A 1 443  ? -12.391 35.680  -5.963  1.00 55.14  ? 471  CYS A CA    1 
ATOM   2850  C  C     . CYS A 1 443  ? -13.603 34.977  -5.354  1.00 67.61  ? 471  CYS A C     1 
ATOM   2851  O  O     . CYS A 1 443  ? -13.527 34.417  -4.259  1.00 68.90  ? 471  CYS A O     1 
ATOM   2852  C  CB    . CYS A 1 443  ? -12.029 36.927  -5.149  1.00 60.45  ? 471  CYS A CB    1 
ATOM   2853  S  SG    . CYS A 1 443  ? -11.507 36.626  -3.445  1.00 66.69  ? 471  CYS A SG    1 
ATOM   2854  N  N     . GLN A 1 444  ? -14.716 34.996  -6.079  1.00 69.42  ? 472  GLN A N     1 
ATOM   2855  C  CA    . GLN A 1 444  ? -15.982 34.494  -5.558  1.00 72.94  ? 472  GLN A CA    1 
ATOM   2856  C  C     . GLN A 1 444  ? -16.091 32.972  -5.602  1.00 64.04  ? 472  GLN A C     1 
ATOM   2857  O  O     . GLN A 1 444  ? -16.861 32.384  -4.844  1.00 74.36  ? 472  GLN A O     1 
ATOM   2858  C  CB    . GLN A 1 444  ? -17.150 35.114  -6.329  1.00 72.76  ? 472  GLN A CB    1 
ATOM   2859  C  CG    . GLN A 1 444  ? -17.213 34.723  -7.797  1.00 71.30  ? 472  GLN A CG    1 
ATOM   2860  C  CD    . GLN A 1 444  ? -18.299 35.465  -8.548  1.00 69.62  ? 472  GLN A CD    1 
ATOM   2861  O  OE1   . GLN A 1 444  ? -18.732 36.539  -8.132  1.00 73.82  ? 472  GLN A OE1   1 
ATOM   2862  N  NE2   . GLN A 1 444  ? -18.749 34.894  -9.660  1.00 71.09  ? 472  GLN A NE2   1 
ATOM   2863  N  N     . LEU A 1 445  ? -15.323 32.333  -6.480  1.00 64.26  ? 473  LEU A N     1 
ATOM   2864  C  CA    . LEU A 1 445  ? -15.421 30.884  -6.647  1.00 70.45  ? 473  LEU A CA    1 
ATOM   2865  C  C     . LEU A 1 445  ? -14.560 30.118  -5.642  1.00 68.55  ? 473  LEU A C     1 
ATOM   2866  O  O     . LEU A 1 445  ? -13.980 29.082  -5.966  1.00 68.23  ? 473  LEU A O     1 
ATOM   2867  C  CB    . LEU A 1 445  ? -15.052 30.483  -8.080  1.00 65.48  ? 473  LEU A CB    1 
ATOM   2868  C  CG    . LEU A 1 445  ? -13.905 31.194  -8.802  1.00 64.86  ? 473  LEU A CG    1 
ATOM   2869  C  CD1   . LEU A 1 445  ? -12.549 30.709  -8.319  1.00 77.23  ? 473  LEU A CD1   1 
ATOM   2870  C  CD2   . LEU A 1 445  ? -14.037 31.005  -10.305 1.00 65.53  ? 473  LEU A CD2   1 
ATOM   2871  N  N     . LEU A 1 446  ? -14.488 30.636  -4.421  1.00 69.62  ? 474  LEU A N     1 
ATOM   2872  C  CA    . LEU A 1 446  ? -13.825 29.940  -3.326  1.00 75.83  ? 474  LEU A CA    1 
ATOM   2873  C  C     . LEU A 1 446  ? -14.835 29.033  -2.632  1.00 74.60  ? 474  LEU A C     1 
ATOM   2874  O  O     . LEU A 1 446  ? -14.486 27.970  -2.119  1.00 73.45  ? 474  LEU A O     1 
ATOM   2875  C  CB    . LEU A 1 446  ? -13.216 30.942  -2.339  1.00 77.31  ? 474  LEU A CB    1 
ATOM   2876  C  CG    . LEU A 1 446  ? -12.371 30.434  -1.163  1.00 74.49  ? 474  LEU A CG    1 
ATOM   2877  C  CD1   . LEU A 1 446  ? -13.221 30.126  0.070   1.00 69.55  ? 474  LEU A CD1   1 
ATOM   2878  C  CD2   . LEU A 1 446  ? -11.524 29.232  -1.566  1.00 75.21  ? 474  LEU A CD2   1 
ATOM   2879  N  N     . SER A 1 447  ? -16.091 29.465  -2.625  1.00 68.33  ? 475  SER A N     1 
ATOM   2880  C  CA    . SER A 1 447  ? -17.168 28.696  -2.018  1.00 68.09  ? 475  SER A CA    1 
ATOM   2881  C  C     . SER A 1 447  ? -18.060 28.074  -3.088  1.00 75.70  ? 475  SER A C     1 
ATOM   2882  O  O     . SER A 1 447  ? -18.694 28.787  -3.868  1.00 70.03  ? 475  SER A O     1 
ATOM   2883  C  CB    . SER A 1 447  ? -17.999 29.580  -1.085  1.00 77.32  ? 475  SER A CB    1 
ATOM   2884  O  OG    . SER A 1 447  ? -19.064 28.849  -0.502  1.00 69.29  ? 475  SER A OG    1 
ATOM   2885  N  N     . GLY A 1 448  ? -18.103 26.746  -3.127  1.00 70.75  ? 476  GLY A N     1 
ATOM   2886  C  CA    . GLY A 1 448  ? -17.341 25.922  -2.206  1.00 76.22  ? 476  GLY A CA    1 
ATOM   2887  C  C     . GLY A 1 448  ? -16.434 24.943  -2.924  1.00 73.27  ? 476  GLY A C     1 
ATOM   2888  O  O     . GLY A 1 448  ? -16.908 23.986  -3.539  1.00 73.37  ? 476  GLY A O     1 
ATOM   2889  N  N     . GLU A 1 449  ? -15.129 25.194  -2.848  1.00 71.42  ? 477  GLU A N     1 
ATOM   2890  C  CA    . GLU A 1 449  ? -14.112 24.342  -3.465  1.00 75.95  ? 477  GLU A CA    1 
ATOM   2891  C  C     . GLU A 1 449  ? -14.321 24.184  -4.971  1.00 68.71  ? 477  GLU A C     1 
ATOM   2892  O  O     . GLU A 1 449  ? -13.926 23.177  -5.558  1.00 76.37  ? 477  GLU A O     1 
ATOM   2893  C  CB    . GLU A 1 449  ? -14.089 22.964  -2.794  1.00 90.68  ? 477  GLU A CB    1 
ATOM   2894  C  CG    . GLU A 1 449  ? -13.929 23.008  -1.281  1.00 93.23  ? 477  GLU A CG    1 
ATOM   2895  C  CD    . GLU A 1 449  ? -12.583 23.556  -0.848  1.00 70.13  ? 477  GLU A CD    1 
ATOM   2896  O  OE1   . GLU A 1 449  ? -11.596 23.367  -1.589  1.00 68.64  ? 477  GLU A OE1   1 
ATOM   2897  O  OE2   . GLU A 1 449  ? -12.514 24.179  0.232   1.00 71.16  ? 477  GLU A OE2   1 
ATOM   2898  N  N     . ARG A 1 450  ? -14.940 25.185  -5.590  1.00 74.36  ? 478  ARG A N     1 
ATOM   2899  C  CA    . ARG A 1 450  ? -15.217 25.149  -7.021  1.00 69.20  ? 478  ARG A CA    1 
ATOM   2900  C  C     . ARG A 1 450  ? -14.070 25.749  -7.828  1.00 73.54  ? 478  ARG A C     1 
ATOM   2901  O  O     . ARG A 1 450  ? -14.133 25.818  -9.056  1.00 75.75  ? 478  ARG A O     1 
ATOM   2902  C  CB    . ARG A 1 450  ? -16.520 25.890  -7.334  1.00 68.77  ? 478  ARG A CB    1 
ATOM   2903  C  CG    . ARG A 1 450  ? -16.590 27.297  -6.758  1.00 70.63  ? 478  ARG A CG    1 
ATOM   2904  C  CD    . ARG A 1 450  ? -17.776 28.082  -7.307  1.00 75.50  ? 478  ARG A CD    1 
ATOM   2905  N  NE    . ARG A 1 450  ? -19.058 27.441  -7.027  1.00 68.31  ? 478  ARG A NE    1 
ATOM   2906  C  CZ    . ARG A 1 450  ? -19.774 26.776  -7.928  1.00 77.68  ? 478  ARG A CZ    1 
ATOM   2907  N  NH1   . ARG A 1 450  ? -19.335 26.663  -9.174  1.00 74.82  ? 478  ARG A NH1   1 
ATOM   2908  N  NH2   . ARG A 1 450  ? -20.931 26.226  -7.584  1.00 72.54  ? 478  ARG A NH2   1 
ATOM   2909  N  N     . TYR A 1 451  ? -13.023 26.182  -7.132  1.00 72.05  ? 479  TYR A N     1 
ATOM   2910  C  CA    . TYR A 1 451  ? -11.863 26.779  -7.786  1.00 75.51  ? 479  TYR A CA    1 
ATOM   2911  C  C     . TYR A 1 451  ? -11.021 25.722  -8.492  1.00 73.48  ? 479  TYR A C     1 
ATOM   2912  O  O     . TYR A 1 451  ? -10.229 26.036  -9.381  1.00 69.11  ? 479  TYR A O     1 
ATOM   2913  C  CB    . TYR A 1 451  ? -11.008 27.544  -6.773  1.00 72.57  ? 479  TYR A CB    1 
ATOM   2914  C  CG    . TYR A 1 451  ? -10.584 26.734  -5.565  1.00 77.18  ? 479  TYR A CG    1 
ATOM   2915  C  CD1   . TYR A 1 451  ? -11.283 26.821  -4.367  1.00 76.12  ? 479  TYR A CD1   1 
ATOM   2916  C  CD2   . TYR A 1 451  ? -9.483  25.888  -5.619  1.00 70.38  ? 479  TYR A CD2   1 
ATOM   2917  C  CE1   . TYR A 1 451  ? -10.899 26.087  -3.260  1.00 70.52  ? 479  TYR A CE1   1 
ATOM   2918  C  CE2   . TYR A 1 451  ? -9.091  25.151  -4.518  1.00 70.54  ? 479  TYR A CE2   1 
ATOM   2919  C  CZ    . TYR A 1 451  ? -9.803  25.254  -3.341  1.00 70.55  ? 479  TYR A CZ    1 
ATOM   2920  O  OH    . TYR A 1 451  ? -9.418  24.522  -2.242  1.00 90.23  ? 479  TYR A OH    1 
ATOM   2921  N  N     . LYS A 1 452  ? -11.195 24.470  -8.084  1.00 69.12  ? 480  LYS A N     1 
ATOM   2922  C  CA    . LYS A 1 452  ? -10.459 23.360  -8.672  1.00 73.37  ? 480  LYS A CA    1 
ATOM   2923  C  C     . LYS A 1 452  ? -10.893 23.126  -10.115 1.00 74.24  ? 480  LYS A C     1 
ATOM   2924  O  O     . LYS A 1 452  ? -10.107 22.672  -10.946 1.00 76.22  ? 480  LYS A O     1 
ATOM   2925  C  CB    . LYS A 1 452  ? -10.659 22.090  -7.844  1.00 75.91  ? 480  LYS A CB    1 
ATOM   2926  C  CG    . LYS A 1 452  ? -10.366 22.265  -6.362  1.00 75.14  ? 480  LYS A CG    1 
ATOM   2927  C  CD    . LYS A 1 452  ? -10.696 21.004  -5.578  1.00 76.69  ? 480  LYS A CD    1 
ATOM   2928  C  CE    . LYS A 1 452  ? -10.475 21.206  -4.087  1.00 70.32  ? 480  LYS A CE    1 
ATOM   2929  N  NZ    . LYS A 1 452  ? -9.062  21.558  -3.776  1.00 76.93  ? 480  LYS A NZ    1 
ATOM   2930  N  N     . GLU A 1 453  ? -12.151 23.445  -10.405 1.00 71.83  ? 481  GLU A N     1 
ATOM   2931  C  CA    . GLU A 1 453  ? -12.696 23.276  -11.747 1.00 85.36  ? 481  GLU A CA    1 
ATOM   2932  C  C     . GLU A 1 453  ? -12.161 24.346  -12.694 1.00 91.12  ? 481  GLU A C     1 
ATOM   2933  O  O     . GLU A 1 453  ? -12.128 24.150  -13.909 1.00 90.64  ? 481  GLU A O     1 
ATOM   2934  C  CB    . GLU A 1 453  ? -14.225 23.318  -11.713 1.00 20.00  ? 481  GLU A CB    1 
ATOM   2935  C  CG    . GLU A 1 453  ? -14.863 22.141  -10.993 1.00 20.00  ? 481  GLU A CG    1 
ATOM   2936  C  CD    . GLU A 1 453  ? -16.374 22.255  -10.918 1.00 20.00  ? 481  GLU A CD    1 
ATOM   2937  O  OE1   . GLU A 1 453  ? -16.908 23.333  -11.255 1.00 20.00  ? 481  GLU A OE1   1 
ATOM   2938  O  OE2   . GLU A 1 453  ? -17.028 21.268  -10.519 1.00 20.00  ? 481  GLU A OE2   1 
ATOM   2939  N  N     . ASP A 1 454  ? -11.747 25.477  -12.131 1.00 90.97  ? 482  ASP A N     1 
ATOM   2940  C  CA    . ASP A 1 454  ? -11.180 26.567  -12.919 1.00 76.38  ? 482  ASP A CA    1 
ATOM   2941  C  C     . ASP A 1 454  ? -9.837  26.158  -13.518 1.00 76.75  ? 482  ASP A C     1 
ATOM   2942  O  O     . ASP A 1 454  ? -8.892  25.862  -12.787 1.00 74.56  ? 482  ASP A O     1 
ATOM   2943  C  CB    . ASP A 1 454  ? -11.017 27.823  -12.061 1.00 20.00  ? 482  ASP A CB    1 
ATOM   2944  C  CG    . ASP A 1 454  ? -12.344 28.470  -11.716 1.00 20.00  ? 482  ASP A CG    1 
ATOM   2945  O  OD1   . ASP A 1 454  ? -13.358 28.128  -12.360 1.00 20.00  ? 482  ASP A OD1   1 
ATOM   2946  O  OD2   . ASP A 1 454  ? -12.469 29.328  -10.817 1.00 20.00  ? 482  ASP A OD2   1 
ATOM   2947  N  N     . PRO A 1 455  ? -9.750  26.145  -14.857 1.00 68.18  ? 483  PRO A N     1 
ATOM   2948  C  CA    . PRO A 1 455  ? -8.553  25.700  -15.580 1.00 72.09  ? 483  PRO A CA    1 
ATOM   2949  C  C     . PRO A 1 455  ? -7.409  26.713  -15.565 1.00 70.40  ? 483  PRO A C     1 
ATOM   2950  O  O     . PRO A 1 455  ? -6.376  26.469  -16.189 1.00 71.95  ? 483  PRO A O     1 
ATOM   2951  C  CB    . PRO A 1 455  ? -9.070  25.497  -17.006 1.00 73.00  ? 483  PRO A CB    1 
ATOM   2952  C  CG    . PRO A 1 455  ? -10.181 26.471  -17.131 1.00 75.88  ? 483  PRO A CG    1 
ATOM   2953  C  CD    . PRO A 1 455  ? -10.840 26.519  -15.778 1.00 68.60  ? 483  PRO A CD    1 
ATOM   2954  N  N     . TRP A 1 456  ? -7.590  27.829  -14.868 1.00 74.38  ? 484  TRP A N     1 
ATOM   2955  C  CA    . TRP A 1 456  ? -6.554  28.854  -14.791 1.00 75.73  ? 484  TRP A CA    1 
ATOM   2956  C  C     . TRP A 1 456  ? -6.115  29.124  -13.356 1.00 74.95  ? 484  TRP A C     1 
ATOM   2957  O  O     . TRP A 1 456  ? -4.955  29.446  -13.107 1.00 75.01  ? 484  TRP A O     1 
ATOM   2958  C  CB    . TRP A 1 456  ? -7.040  30.159  -15.424 1.00 72.75  ? 484  TRP A CB    1 
ATOM   2959  C  CG    . TRP A 1 456  ? -6.957  30.199  -16.919 1.00 73.27  ? 484  TRP A CG    1 
ATOM   2960  C  CD1   . TRP A 1 456  ? -5.833  30.371  -17.673 1.00 73.90  ? 484  TRP A CD1   1 
ATOM   2961  C  CD2   . TRP A 1 456  ? -8.047  30.092  -17.842 1.00 73.23  ? 484  TRP A CD2   1 
ATOM   2962  N  NE1   . TRP A 1 456  ? -6.154  30.368  -19.008 1.00 74.25  ? 484  TRP A NE1   1 
ATOM   2963  C  CE2   . TRP A 1 456  ? -7.507  30.198  -19.139 1.00 73.88  ? 484  TRP A CE2   1 
ATOM   2964  C  CE3   . TRP A 1 456  ? -9.425  29.912  -17.699 1.00 72.80  ? 484  TRP A CE3   1 
ATOM   2965  C  CZ2   . TRP A 1 456  ? -8.297  30.129  -20.285 1.00 74.13  ? 484  TRP A CZ2   1 
ATOM   2966  C  CZ3   . TRP A 1 456  ? -10.207 29.843  -18.837 1.00 73.08  ? 484  TRP A CZ3   1 
ATOM   2967  C  CH2   . TRP A 1 456  ? -9.641  29.952  -20.113 1.00 73.75  ? 484  TRP A CH2   1 
ATOM   2968  N  N     . LEU A 1 457  ? -7.045  28.994  -12.416 1.00 74.30  ? 485  LEU A N     1 
ATOM   2969  C  CA    . LEU A 1 457  ? -6.786  29.372  -11.030 1.00 73.30  ? 485  LEU A CA    1 
ATOM   2970  C  C     . LEU A 1 457  ? -6.872  28.180  -10.082 1.00 74.63  ? 485  LEU A C     1 
ATOM   2971  O  O     . LEU A 1 457  ? -7.889  27.985  -9.415  1.00 69.03  ? 485  LEU A O     1 
ATOM   2972  C  CB    . LEU A 1 457  ? -7.774  30.452  -10.585 1.00 70.28  ? 485  LEU A CB    1 
ATOM   2973  C  CG    . LEU A 1 457  ? -8.323  31.392  -11.661 1.00 68.28  ? 485  LEU A CG    1 
ATOM   2974  C  CD1   . LEU A 1 457  ? -9.450  32.239  -11.093 1.00 65.80  ? 485  LEU A CD1   1 
ATOM   2975  C  CD2   . LEU A 1 457  ? -7.228  32.275  -12.243 1.00 70.93  ? 485  LEU A CD2   1 
ATOM   2976  N  N     . TRP A 1 458  ? -5.807  27.388  -10.015 1.00 73.12  ? 486  TRP A N     1 
ATOM   2977  C  CA    . TRP A 1 458  ? -5.786  26.234  -9.123  1.00 68.40  ? 486  TRP A CA    1 
ATOM   2978  C  C     . TRP A 1 458  ? -4.394  25.966  -8.555  1.00 69.03  ? 486  TRP A C     1 
ATOM   2979  O  O     . TRP A 1 458  ? -4.217  25.068  -7.731  1.00 75.13  ? 486  TRP A O     1 
ATOM   2980  C  CB    . TRP A 1 458  ? -6.307  24.991  -9.850  1.00 72.99  ? 486  TRP A CB    1 
ATOM   2981  C  CG    . TRP A 1 458  ? -5.590  24.693  -11.129 1.00 74.69  ? 486  TRP A CG    1 
ATOM   2982  C  CD1   . TRP A 1 458  ? -5.904  25.157  -12.372 1.00 73.81  ? 486  TRP A CD1   1 
ATOM   2983  C  CD2   . TRP A 1 458  ? -4.438  23.858  -11.291 1.00 77.68  ? 486  TRP A CD2   1 
ATOM   2984  N  NE1   . TRP A 1 458  ? -5.018  24.666  -13.299 1.00 76.04  ? 486  TRP A NE1   1 
ATOM   2985  C  CE2   . TRP A 1 458  ? -4.106  23.867  -12.661 1.00 68.46  ? 486  TRP A CE2   1 
ATOM   2986  C  CE3   . TRP A 1 458  ? -3.651  23.108  -10.412 1.00 69.85  ? 486  TRP A CE3   1 
ATOM   2987  C  CZ2   . TRP A 1 458  ? -3.025  23.153  -13.171 1.00 75.54  ? 486  TRP A CZ2   1 
ATOM   2988  C  CZ3   . TRP A 1 458  ? -2.578  22.401  -10.920 1.00 77.92  ? 486  TRP A CZ3   1 
ATOM   2989  C  CH2   . TRP A 1 458  ? -2.275  22.428  -12.287 1.00 73.24  ? 486  TRP A CH2   1 
ATOM   2990  N  N     . ASP A 1 459  ? -3.410  26.748  -8.989  1.00 71.13  ? 487  ASP A N     1 
ATOM   2991  C  CA    . ASP A 1 459  ? -2.043  26.594  -8.501  1.00 77.50  ? 487  ASP A CA    1 
ATOM   2992  C  C     . ASP A 1 459  ? -1.843  27.303  -7.168  1.00 71.57  ? 487  ASP A C     1 
ATOM   2993  O  O     . ASP A 1 459  ? -1.063  26.861  -6.325  1.00 77.76  ? 487  ASP A O     1 
ATOM   2994  C  CB    . ASP A 1 459  ? -1.034  27.142  -9.513  1.00 75.14  ? 487  ASP A CB    1 
ATOM   2995  C  CG    . ASP A 1 459  ? -1.349  26.735  -10.935 1.00 70.53  ? 487  ASP A CG    1 
ATOM   2996  O  OD1   . ASP A 1 459  ? -2.131  25.782  -11.128 1.00 74.09  ? 487  ASP A OD1   1 
ATOM   2997  O  OD2   . ASP A 1 459  ? -0.805  27.369  -11.862 1.00 73.99  ? 487  ASP A OD2   1 
ATOM   2998  N  N     . LEU A 1 460  ? -2.556  28.410  -6.990  1.00 74.27  ? 488  LEU A N     1 
ATOM   2999  C  CA    . LEU A 1 460  ? -2.322  29.306  -5.864  1.00 75.06  ? 488  LEU A CA    1 
ATOM   3000  C  C     . LEU A 1 460  ? -2.890  28.774  -4.546  1.00 73.18  ? 488  LEU A C     1 
ATOM   3001  O  O     . LEU A 1 460  ? -3.284  27.613  -4.448  1.00 69.81  ? 488  LEU A O     1 
ATOM   3002  C  CB    . LEU A 1 460  ? -2.882  30.707  -6.172  1.00 75.46  ? 488  LEU A CB    1 
ATOM   3003  C  CG    . LEU A 1 460  ? -4.340  31.044  -6.538  1.00 87.98  ? 488  LEU A CG    1 
ATOM   3004  C  CD1   . LEU A 1 460  ? -4.864  30.294  -7.766  1.00 90.34  ? 488  LEU A CD1   1 
ATOM   3005  C  CD2   . LEU A 1 460  ? -5.280  30.869  -5.357  1.00 93.12  ? 488  LEU A CD2   1 
ATOM   3006  N  N     . GLU A 1 461  ? -2.931  29.646  -3.544  1.00 71.79  ? 489  GLU A N     1 
ATOM   3007  C  CA    . GLU A 1 461  ? -3.185  29.249  -2.162  1.00 68.38  ? 489  GLU A CA    1 
ATOM   3008  C  C     . GLU A 1 461  ? -4.634  28.854  -1.873  1.00 77.12  ? 489  GLU A C     1 
ATOM   3009  O  O     . GLU A 1 461  ? -4.901  27.723  -1.463  1.00 74.62  ? 489  GLU A O     1 
ATOM   3010  C  CB    . GLU A 1 461  ? -2.773  30.383  -1.219  1.00 77.27  ? 489  GLU A CB    1 
ATOM   3011  C  CG    . GLU A 1 461  ? -1.759  31.355  -1.813  1.00 69.58  ? 489  GLU A CG    1 
ATOM   3012  C  CD    . GLU A 1 461  ? -0.431  30.700  -2.148  1.00 69.60  ? 489  GLU A CD    1 
ATOM   3013  O  OE1   . GLU A 1 461  ? 0.121   29.989  -1.282  1.00 76.26  ? 489  GLU A OE1   1 
ATOM   3014  O  OE2   . GLU A 1 461  ? 0.057   30.892  -3.281  1.00 73.00  ? 489  GLU A OE2   1 
ATOM   3015  N  N     . TRP A 1 462  ? -5.556  29.794  -2.079  1.00 72.37  ? 490  TRP A N     1 
ATOM   3016  C  CA    . TRP A 1 462  ? -6.960  29.629  -1.696  1.00 71.52  ? 490  TRP A CA    1 
ATOM   3017  C  C     . TRP A 1 462  ? -7.095  29.314  -0.207  1.00 71.12  ? 490  TRP A C     1 
ATOM   3018  O  O     . TRP A 1 462  ? -7.849  28.423  0.182   1.00 71.26  ? 490  TRP A O     1 
ATOM   3019  C  CB    . TRP A 1 462  ? -7.638  28.528  -2.521  1.00 73.07  ? 490  TRP A CB    1 
ATOM   3020  C  CG    . TRP A 1 462  ? -7.826  28.864  -3.969  1.00 72.37  ? 490  TRP A CG    1 
ATOM   3021  C  CD1   . TRP A 1 462  ? -7.278  28.217  -5.038  1.00 69.66  ? 490  TRP A CD1   1 
ATOM   3022  C  CD2   . TRP A 1 462  ? -8.624  29.925  -4.509  1.00 76.45  ? 490  TRP A CD2   1 
ATOM   3023  N  NE1   . TRP A 1 462  ? -7.684  28.810  -6.210  1.00 72.85  ? 490  TRP A NE1   1 
ATOM   3024  C  CE2   . TRP A 1 462  ? -8.511  29.861  -5.912  1.00 70.15  ? 490  TRP A CE2   1 
ATOM   3025  C  CE3   . TRP A 1 462  ? -9.423  30.923  -3.942  1.00 76.65  ? 490  TRP A CE3   1 
ATOM   3026  C  CZ2   . TRP A 1 462  ? -9.164  30.757  -6.755  1.00 68.09  ? 490  TRP A CZ2   1 
ATOM   3027  C  CZ3   . TRP A 1 462  ? -10.071 31.812  -4.780  1.00 65.37  ? 490  TRP A CZ3   1 
ATOM   3028  C  CH2   . TRP A 1 462  ? -9.937  31.723  -6.171  1.00 65.72  ? 490  TRP A CH2   1 
ATOM   3029  N  N     . ASP A 1 463  ? -6.363  30.054  0.621   1.00 72.87  ? 491  ASP A N     1 
ATOM   3030  C  CA    . ASP A 1 463  ? -6.360  29.819  2.061   1.00 77.81  ? 491  ASP A CA    1 
ATOM   3031  C  C     . ASP A 1 463  ? -7.544  30.482  2.756   1.00 76.49  ? 491  ASP A C     1 
ATOM   3032  O  O     . ASP A 1 463  ? -8.073  31.488  2.284   1.00 68.57  ? 491  ASP A O     1 
ATOM   3033  C  CB    . ASP A 1 463  ? -5.055  30.323  2.679   1.00 72.43  ? 491  ASP A CB    1 
ATOM   3034  C  CG    . ASP A 1 463  ? -3.832  29.658  2.083   1.00 74.43  ? 491  ASP A CG    1 
ATOM   3035  O  OD1   . ASP A 1 463  ? -3.949  28.505  1.616   1.00 92.79  ? 491  ASP A OD1   1 
ATOM   3036  O  OD2   . ASP A 1 463  ? -2.754  30.288  2.083   1.00 74.80  ? 491  ASP A OD2   1 
ATOM   3037  N  N     . LEU A 1 464  ? -7.952  29.908  3.882   1.00 91.35  ? 492  LEU A N     1 
ATOM   3038  C  CA    . LEU A 1 464  ? -9.010  30.481  4.703   1.00 91.36  ? 492  LEU A CA    1 
ATOM   3039  C  C     . LEU A 1 464  ? -8.557  30.493  6.159   1.00 76.52  ? 492  LEU A C     1 
ATOM   3040  O  O     . LEU A 1 464  ? -8.608  29.472  6.844   1.00 69.60  ? 492  LEU A O     1 
ATOM   3041  C  CB    . LEU A 1 464  ? -10.314 29.694  4.539   1.00 69.63  ? 492  LEU A CB    1 
ATOM   3042  C  CG    . LEU A 1 464  ? -11.621 30.318  5.045   1.00 68.82  ? 492  LEU A CG    1 
ATOM   3043  C  CD1   . LEU A 1 464  ? -11.852 30.037  6.526   1.00 72.83  ? 492  LEU A CD1   1 
ATOM   3044  C  CD2   . LEU A 1 464  ? -11.643 31.816  4.772   1.00 71.75  ? 492  LEU A CD2   1 
ATOM   3045  N  N     . GLN A 1 465  ? -8.109  31.655  6.623   1.00 85.19  ? 493  GLN A N     1 
ATOM   3046  C  CA    . GLN A 1 465  ? -7.543  31.778  7.960   1.00 72.82  ? 493  GLN A CA    1 
ATOM   3047  C  C     . GLN A 1 465  ? -8.471  32.538  8.905   1.00 75.26  ? 493  GLN A C     1 
ATOM   3048  O  O     . GLN A 1 465  ? -9.231  33.408  8.480   1.00 72.34  ? 493  GLN A O     1 
ATOM   3049  C  CB    . GLN A 1 465  ? -6.180  32.470  7.891   1.00 76.57  ? 493  GLN A CB    1 
ATOM   3050  C  CG    . GLN A 1 465  ? -5.241  31.908  6.827   1.00 71.26  ? 493  GLN A CG    1 
ATOM   3051  C  CD    . GLN A 1 465  ? -4.727  30.516  7.154   1.00 77.71  ? 493  GLN A CD    1 
ATOM   3052  O  OE1   . GLN A 1 465  ? -3.620  30.359  7.669   1.00 77.59  ? 493  GLN A OE1   1 
ATOM   3053  N  NE2   . GLN A 1 465  ? -5.523  29.499  6.843   1.00 87.32  ? 493  GLN A NE2   1 
ATOM   3054  N  N     . GLU A 1 466  ? -8.401  32.198  10.188  1.00 74.82  ? 494  GLU A N     1 
ATOM   3055  C  CA    . GLU A 1 466  ? -9.218  32.847  11.208  1.00 92.15  ? 494  GLU A CA    1 
ATOM   3056  C  C     . GLU A 1 466  ? -8.538  32.765  12.573  1.00 87.28  ? 494  GLU A C     1 
ATOM   3057  O  O     . GLU A 1 466  ? -8.984  32.041  13.463  1.00 86.91  ? 494  GLU A O     1 
ATOM   3058  C  CB    . GLU A 1 466  ? -10.614 32.218  11.256  1.00 90.17  ? 494  GLU A CB    1 
ATOM   3059  C  CG    . GLU A 1 466  ? -10.632 30.707  11.065  1.00 87.97  ? 494  GLU A CG    1 
ATOM   3060  C  CD    . GLU A 1 466  ? -12.031 30.163  10.840  1.00 87.52  ? 494  GLU A CD    1 
ATOM   3061  O  OE1   . GLU A 1 466  ? -12.999 30.947  10.933  1.00 84.18  ? 494  GLU A OE1   1 
ATOM   3062  O  OE2   . GLU A 1 466  ? -12.162 28.951  10.566  1.00 84.71  ? 494  GLU A OE2   1 
ATOM   3063  N  N     . PHE A 1 467  ? -7.454  33.520  12.725  1.00 91.69  ? 495  PHE A N     1 
ATOM   3064  C  CA    . PHE A 1 467  ? -6.640  33.493  13.937  1.00 75.24  ? 495  PHE A CA    1 
ATOM   3065  C  C     . PHE A 1 467  ? -6.465  34.909  14.499  1.00 68.83  ? 495  PHE A C     1 
ATOM   3066  O  O     . PHE A 1 467  ? -6.478  35.869  13.729  1.00 77.03  ? 495  PHE A O     1 
ATOM   3067  C  CB    . PHE A 1 467  ? -5.269  32.873  13.639  1.00 76.23  ? 495  PHE A CB    1 
ATOM   3068  C  CG    . PHE A 1 467  ? -5.312  31.723  12.673  1.00 90.75  ? 495  PHE A CG    1 
ATOM   3069  C  CD1   . PHE A 1 467  ? -4.677  31.814  11.446  1.00 86.22  ? 495  PHE A CD1   1 
ATOM   3070  C  CD2   . PHE A 1 467  ? -5.978  30.551  12.992  1.00 86.13  ? 495  PHE A CD2   1 
ATOM   3071  C  CE1   . PHE A 1 467  ? -4.706  30.760  10.554  1.00 91.25  ? 495  PHE A CE1   1 
ATOM   3072  C  CE2   . PHE A 1 467  ? -6.012  29.492  12.101  1.00 85.96  ? 495  PHE A CE2   1 
ATOM   3073  C  CZ    . PHE A 1 467  ? -5.375  29.599  10.880  1.00 90.21  ? 495  PHE A CZ    1 
ATOM   3074  N  N     . LYS A 1 468  ? -6.308  35.068  15.816  1.00 75.58  ? 496  LYS A N     1 
ATOM   3075  C  CA    . LYS A 1 468  ? -6.371  34.003  16.820  1.00 73.65  ? 496  LYS A CA    1 
ATOM   3076  C  C     . LYS A 1 468  ? -6.835  34.610  18.142  1.00 68.62  ? 496  LYS A C     1 
ATOM   3077  O  O     . LYS A 1 468  ? -7.094  35.811  18.216  1.00 73.10  ? 496  LYS A O     1 
ATOM   3078  C  CB    . LYS A 1 468  ? -5.010  33.324  17.006  1.00 75.91  ? 496  LYS A CB    1 
ATOM   3079  C  CG    . LYS A 1 468  ? -5.091  31.853  17.394  1.00 85.35  ? 496  LYS A CG    1 
ATOM   3080  C  CD    . LYS A 1 468  ? -4.065  31.004  16.648  1.00 81.84  ? 496  LYS A CD    1 
ATOM   3081  C  CE    . LYS A 1 468  ? -2.665  31.126  17.238  1.00 85.12  ? 496  LYS A CE    1 
ATOM   3082  N  NZ    . LYS A 1 468  ? -1.975  32.398  16.881  1.00 85.46  ? 496  LYS A NZ    1 
ATOM   3083  N  N     . GLN A 1 469  ? -6.928  33.787  19.184  1.00 69.49  ? 497  GLN A N     1 
ATOM   3084  C  CA    . GLN A 1 469  ? -7.261  34.280  20.518  1.00 84.71  ? 497  GLN A CA    1 
ATOM   3085  C  C     . GLN A 1 469  ? -6.756  33.361  21.625  1.00 91.85  ? 497  GLN A C     1 
ATOM   3086  O  O     . GLN A 1 469  ? -6.659  32.147  21.447  1.00 91.53  ? 497  GLN A O     1 
ATOM   3087  C  CB    . GLN A 1 469  ? -8.772  34.471  20.666  1.00 90.76  ? 497  GLN A CB    1 
ATOM   3088  C  CG    . GLN A 1 469  ? -9.220  35.908  20.481  1.00 93.07  ? 497  GLN A CG    1 
ATOM   3089  C  CD    . GLN A 1 469  ? -8.225  36.894  21.059  1.00 84.82  ? 497  GLN A CD    1 
ATOM   3090  O  OE1   . GLN A 1 469  ? -7.968  36.902  22.264  1.00 86.55  ? 497  GLN A OE1   1 
ATOM   3091  N  NE2   . GLN A 1 469  ? -7.647  37.723  20.198  1.00 86.61  ? 497  GLN A NE2   1 
ATOM   3092  N  N     . LYS A 1 470  ? -6.437  33.957  22.770  1.00 87.41  ? 498  LYS A N     1 
ATOM   3093  C  CA    . LYS A 1 470  ? -6.010  33.201  23.940  1.00 86.84  ? 498  LYS A CA    1 
ATOM   3094  C  C     . LYS A 1 470  ? -6.991  33.405  25.090  1.00 85.62  ? 498  LYS A C     1 
ATOM   3095  O  O     . LYS A 1 470  ? -7.461  34.518  25.328  1.00 87.52  ? 498  LYS A O     1 
ATOM   3096  C  CB    . LYS A 1 470  ? -4.595  33.608  24.358  1.00 86.62  ? 498  LYS A CB    1 
ATOM   3097  C  CG    . LYS A 1 470  ? -3.563  33.445  23.254  1.00 73.42  ? 498  LYS A CG    1 
ATOM   3098  C  CD    . LYS A 1 470  ? -3.619  32.050  22.646  1.00 71.42  ? 498  LYS A CD    1 
ATOM   3099  C  CE    . LYS A 1 470  ? -3.170  30.986  23.636  1.00 71.17  ? 498  LYS A CE    1 
ATOM   3100  N  NZ    . LYS A 1 470  ? -3.256  29.619  23.051  1.00 76.81  ? 498  LYS A NZ    1 
ATOM   3101  N  N     . LYS A 1 471  ? -7.296  32.323  25.798  1.00 90.12  ? 499  LYS A N     1 
ATOM   3102  C  CA    . LYS A 1 471  ? -8.332  32.343  26.824  1.00 69.70  ? 499  LYS A CA    1 
ATOM   3103  C  C     . LYS A 1 471  ? -7.924  33.113  28.078  1.00 90.52  ? 499  LYS A C     1 
ATOM   3104  O  O     . LYS A 1 471  ? -6.798  32.994  28.561  1.00 69.80  ? 499  LYS A O     1 
ATOM   3105  C  CB    . LYS A 1 471  ? -8.730  30.909  27.192  1.00 75.64  ? 499  LYS A CB    1 
ATOM   3106  C  CG    . LYS A 1 471  ? -7.601  29.895  27.082  1.00 73.89  ? 499  LYS A CG    1 
ATOM   3107  C  CD    . LYS A 1 471  ? -6.821  29.771  28.378  1.00 76.59  ? 499  LYS A CD    1 
ATOM   3108  C  CE    . LYS A 1 471  ? -7.671  29.140  29.468  1.00 70.50  ? 499  LYS A CE    1 
ATOM   3109  N  NZ    . LYS A 1 471  ? -6.889  28.897  30.711  1.00 76.78  ? 499  LYS A NZ    1 
ATOM   3110  N  N     . ALA A 1 472  ? -8.858  33.910  28.589  1.00 81.97  ? 500  ALA A N     1 
ATOM   3111  C  CA    . ALA A 1 472  ? -8.658  34.659  29.824  1.00 90.51  ? 500  ALA A CA    1 
ATOM   3112  C  C     . ALA A 1 472  ? -9.954  34.719  30.629  1.00 91.97  ? 500  ALA A C     1 
ATOM   3113  O  O     . ALA A 1 472  ? -9.931  34.914  31.844  1.00 86.86  ? 500  ALA A O     1 
ATOM   3114  C  CB    . ALA A 1 472  ? -8.150  36.061  29.522  1.00 76.95  ? 500  ALA A CB    1 
ATOM   3115  N  N     . LYS A 1 473  ? -11.082 34.549  29.944  1.00 85.25  ? 501  LYS A N     1 
ATOM   3116  C  CA    . LYS A 1 473  ? -12.390 34.543  30.597  1.00 87.53  ? 501  LYS A CA    1 
ATOM   3117  C  C     . LYS A 1 473  ? -12.821 33.126  30.967  1.00 91.93  ? 501  LYS A C     1 
ATOM   3118  O  O     . LYS A 1 473  ? -12.507 32.168  30.261  1.00 81.50  ? 501  LYS A O     1 
ATOM   3119  C  CB    . LYS A 1 473  ? -13.443 35.203  29.703  1.00 73.63  ? 501  LYS A CB    1 
ATOM   3120  C  CG    . LYS A 1 473  ? -13.408 36.721  29.737  1.00 74.81  ? 501  LYS A CG    1 
ATOM   3121  C  CD    . LYS A 1 473  ? -13.808 37.246  31.108  1.00 72.49  ? 501  LYS A CD    1 
ATOM   3122  C  CE    . LYS A 1 473  ? -12.989 38.466  31.500  1.00 70.77  ? 501  LYS A CE    1 
ATOM   3123  N  NZ    . LYS A 1 473  ? -13.119 39.577  30.518  1.00 87.05  ? 501  LYS A NZ    1 
ATOM   3124  N  N     . LYS A 1 474  ? -13.558 33.013  32.068  1.00 92.82  ? 502  LYS A N     1 
ATOM   3125  C  CA    . LYS A 1 474  ? -13.861 31.725  32.686  1.00 84.30  ? 502  LYS A CA    1 
ATOM   3126  C  C     . LYS A 1 474  ? -15.082 31.866  33.614  1.00 81.73  ? 502  LYS A C     1 
ATOM   3127  O  O     . LYS A 1 474  ? -15.380 32.981  34.044  1.00 87.36  ? 502  LYS A O     1 
ATOM   3128  C  CB    . LYS A 1 474  ? -12.625 31.224  33.444  1.00 70.36  ? 502  LYS A CB    1 
ATOM   3129  C  CG    . LYS A 1 474  ? -11.755 30.265  32.639  1.00 76.68  ? 502  LYS A CG    1 
ATOM   3130  C  CD    . LYS A 1 474  ? -10.767 29.524  33.520  1.00 86.50  ? 502  LYS A CD    1 
ATOM   3131  C  CE    . LYS A 1 474  ? -9.987  28.495  32.716  1.00 90.14  ? 502  LYS A CE    1 
ATOM   3132  N  NZ    . LYS A 1 474  ? -10.891 27.556  31.996  1.00 81.82  ? 502  LYS A NZ    1 
ATOM   3133  N  N     . VAL A 1 475  ? -15.798 30.781  33.933  1.00 90.08  ? 503  VAL A N     1 
ATOM   3134  C  CA    . VAL A 1 475  ? -15.477 29.405  33.548  1.00 93.82  ? 503  VAL A CA    1 
ATOM   3135  C  C     . VAL A 1 475  ? -16.733 28.545  33.365  1.00 90.57  ? 503  VAL A C     1 
ATOM   3136  O  O     . VAL A 1 475  ? -17.774 28.810  33.970  1.00 86.62  ? 503  VAL A O     1 
ATOM   3137  C  CB    . VAL A 1 475  ? -14.563 28.727  34.614  1.00 73.17  ? 503  VAL A CB    1 
ATOM   3138  C  CG1   . VAL A 1 475  ? -15.333 28.453  35.899  1.00 77.99  ? 503  VAL A CG1   1 
ATOM   3139  C  CG2   . VAL A 1 475  ? -13.923 27.454  34.070  1.00 74.45  ? 503  VAL A CG2   1 
ATOM   3140  N  N     . LYS A 1 476  ? -16.627 27.538  32.501  1.00 91.07  ? 504  LYS A N     1 
ATOM   3141  C  CA    . LYS A 1 476  ? -17.569 26.418  32.440  1.00 72.65  ? 504  LYS A CA    1 
ATOM   3142  C  C     . LYS A 1 476  ? -19.026 26.795  32.160  1.00 69.18  ? 504  LYS A C     1 
ATOM   3143  O  O     . LYS A 1 476  ? -19.933 26.331  32.850  1.00 77.92  ? 504  LYS A O     1 
ATOM   3144  C  CB    . LYS A 1 476  ? -17.503 25.621  33.748  1.00 76.52  ? 504  LYS A CB    1 
ATOM   3145  C  CG    . LYS A 1 476  ? -17.804 24.139  33.589  1.00 73.80  ? 504  LYS A CG    1 
ATOM   3146  C  CD    . LYS A 1 476  ? -18.082 23.485  34.930  1.00 70.55  ? 504  LYS A CD    1 
ATOM   3147  C  CE    . LYS A 1 476  ? -19.339 24.056  35.566  1.00 71.95  ? 504  LYS A CE    1 
ATOM   3148  N  NZ    . LYS A 1 476  ? -19.666 23.381  36.852  1.00 92.61  ? 504  LYS A NZ    1 
ATOM   3149  N  N     . LYS A 1 477  ? -19.241 27.627  31.148  1.00 74.15  ? 505  LYS A N     1 
ATOM   3150  C  CA    . LYS A 1 477  ? -20.585 27.912  30.646  1.00 72.67  ? 505  LYS A CA    1 
ATOM   3151  C  C     . LYS A 1 477  ? -20.496 28.393  29.204  1.00 87.81  ? 505  LYS A C     1 
ATOM   3152  O  O     . LYS A 1 477  ? -19.630 29.199  28.867  1.00 90.38  ? 505  LYS A O     1 
ATOM   3153  C  CB    . LYS A 1 477  ? -21.301 28.952  31.514  1.00 73.78  ? 505  LYS A CB    1 
ATOM   3154  C  CG    . LYS A 1 477  ? -22.231 28.352  32.563  1.00 92.05  ? 505  LYS A CG    1 
ATOM   3155  C  CD    . LYS A 1 477  ? -23.149 27.303  31.948  1.00 91.39  ? 505  LYS A CD    1 
ATOM   3156  C  CE    . LYS A 1 477  ? -23.977 26.590  33.006  1.00 81.37  ? 505  LYS A CE    1 
ATOM   3157  N  NZ    . LYS A 1 477  ? -24.801 25.496  32.419  1.00 81.63  ? 505  LYS A NZ    1 
ATOM   3158  N  N     . GLU A 1 478  ? -21.391 27.894  28.355  1.00 86.89  ? 506  GLU A N     1 
ATOM   3159  C  CA    . GLU A 1 478  ? -21.328 28.189  26.927  1.00 87.93  ? 506  GLU A CA    1 
ATOM   3160  C  C     . GLU A 1 478  ? -21.610 29.668  26.642  1.00 46.54  ? 506  GLU A C     1 
ATOM   3161  O  O     . GLU A 1 478  ? -22.642 30.207  27.047  1.00 48.28  ? 506  GLU A O     1 
ATOM   3162  C  CB    . GLU A 1 478  ? -22.295 27.284  26.143  1.00 86.99  ? 506  GLU A CB    1 
ATOM   3163  C  CG    . GLU A 1 478  ? -23.789 27.530  26.359  1.00 92.27  ? 506  GLU A CG    1 
ATOM   3164  C  CD    . GLU A 1 478  ? -24.276 27.127  27.738  1.00 87.86  ? 506  GLU A CD    1 
ATOM   3165  O  OE1   . GLU A 1 478  ? -23.549 26.394  28.441  1.00 92.09  ? 506  GLU A OE1   1 
ATOM   3166  O  OE2   . GLU A 1 478  ? -25.390 27.546  28.119  1.00 87.79  ? 506  GLU A OE2   1 
ATOM   3167  N  N     . PRO A 1 479  ? -20.660 30.339  25.974  1.00 40.90  ? 507  PRO A N     1 
ATOM   3168  C  CA    . PRO A 1 479  ? -20.802 31.745  25.592  1.00 48.62  ? 507  PRO A CA    1 
ATOM   3169  C  C     . PRO A 1 479  ? -21.237 31.918  24.138  1.00 45.92  ? 507  PRO A C     1 
ATOM   3170  O  O     . PRO A 1 479  ? -21.479 33.043  23.699  1.00 49.61  ? 507  PRO A O     1 
ATOM   3171  C  CB    . PRO A 1 479  ? -19.393 32.290  25.801  1.00 49.51  ? 507  PRO A CB    1 
ATOM   3172  C  CG    . PRO A 1 479  ? -18.517 31.131  25.422  1.00 49.22  ? 507  PRO A CG    1 
ATOM   3173  C  CD    . PRO A 1 479  ? -19.278 29.864  25.779  1.00 41.18  ? 507  PRO A CD    1 
ATOM   3174  N  N     . ALA A 1 480  ? -21.333 30.812  23.407  1.00 41.95  ? 508  ALA A N     1 
ATOM   3175  C  CA    . ALA A 1 480  ? -21.641 30.856  21.982  1.00 93.55  ? 508  ALA A CA    1 
ATOM   3176  C  C     . ALA A 1 480  ? -23.130 31.066  21.721  1.00 49.23  ? 508  ALA A C     1 
ATOM   3177  O  O     . ALA A 1 480  ? -23.521 31.495  20.636  1.00 91.14  ? 508  ALA A O     1 
ATOM   3178  C  CB    . ALA A 1 480  ? -21.164 29.581  21.303  1.00 91.80  ? 508  ALA A CB    1 
ATOM   3179  N  N     . THR A 1 481  ? -23.958 30.762  22.716  1.00 48.61  ? 509  THR A N     1 
ATOM   3180  C  CA    . THR A 1 481  ? -25.400 30.932  22.579  1.00 42.42  ? 509  THR A CA    1 
ATOM   3181  C  C     . THR A 1 481  ? -25.917 32.002  23.535  1.00 90.99  ? 509  THR A C     1 
ATOM   3182  O  O     . THR A 1 481  ? -27.088 32.379  23.485  1.00 84.51  ? 509  THR A O     1 
ATOM   3183  C  CB    . THR A 1 481  ? -26.156 29.615  22.838  1.00 46.42  ? 509  THR A CB    1 
ATOM   3184  O  OG1   . THR A 1 481  ? -27.500 29.728  22.353  1.00 41.97  ? 509  THR A OG1   1 
ATOM   3185  C  CG2   . THR A 1 481  ? -26.181 29.295  24.323  1.00 46.46  ? 509  THR A CG2   1 
ATOM   3186  N  N     . ALA A 1 482  ? -25.035 32.490  24.401  1.00 81.85  ? 510  ALA A N     1 
ATOM   3187  C  CA    . ALA A 1 482  ? -25.396 33.522  25.366  1.00 77.15  ? 510  ALA A CA    1 
ATOM   3188  C  C     . ALA A 1 482  ? -24.863 34.884  24.938  1.00 71.21  ? 510  ALA A C     1 
ATOM   3189  O  O     . ALA A 1 482  ? -23.652 35.088  24.847  1.00 69.77  ? 510  ALA A O     1 
ATOM   3190  C  CB    . ALA A 1 482  ? -24.876 33.159  26.749  1.00 68.15  ? 510  ALA A CB    1 
ATOM   3191  N  N     . LEU A 1 502  ? -42.737 44.016  17.302  1.00 84.64  ? 530  LEU A N     1 
ATOM   3192  C  CA    . LEU A 1 502  ? -43.716 44.565  16.371  1.00 85.98  ? 530  LEU A CA    1 
ATOM   3193  C  C     . LEU A 1 502  ? -44.503 45.703  17.014  1.00 85.25  ? 530  LEU A C     1 
ATOM   3194  O  O     . LEU A 1 502  ? -45.395 46.279  16.393  1.00 92.02  ? 530  LEU A O     1 
ATOM   3195  C  CB    . LEU A 1 502  ? -44.676 43.475  15.882  1.00 76.51  ? 530  LEU A CB    1 
ATOM   3196  C  CG    . LEU A 1 502  ? -44.144 42.387  14.941  1.00 75.26  ? 530  LEU A CG    1 
ATOM   3197  C  CD1   . LEU A 1 502  ? -43.296 43.004  13.839  1.00 71.69  ? 530  LEU A CD1   1 
ATOM   3198  C  CD2   . LEU A 1 502  ? -43.357 41.317  15.692  1.00 73.28  ? 530  LEU A CD2   1 
ATOM   3199  N  N     . GLY A 1 503  ? -44.166 46.021  18.260  1.00 70.39  ? 531  GLY A N     1 
ATOM   3200  C  CA    . GLY A 1 503  ? -44.854 47.064  19.000  1.00 72.77  ? 531  GLY A CA    1 
ATOM   3201  C  C     . GLY A 1 503  ? -44.675 48.447  18.403  1.00 72.95  ? 531  GLY A C     1 
ATOM   3202  O  O     . GLY A 1 503  ? -43.549 48.893  18.186  1.00 71.06  ? 531  GLY A O     1 
ATOM   3203  N  N     . PRO A 1 504  ? -45.794 49.136  18.131  1.00 70.51  ? 532  PRO A N     1 
ATOM   3204  C  CA    . PRO A 1 504  ? -45.803 50.481  17.551  1.00 70.38  ? 532  PRO A CA    1 
ATOM   3205  C  C     . PRO A 1 504  ? -45.926 51.590  18.598  1.00 72.97  ? 532  PRO A C     1 
ATOM   3206  O  O     . PRO A 1 504  ? -46.848 51.569  19.413  1.00 75.31  ? 532  PRO A O     1 
ATOM   3207  C  CB    . PRO A 1 504  ? -47.037 50.451  16.647  1.00 71.65  ? 532  PRO A CB    1 
ATOM   3208  C  CG    . PRO A 1 504  ? -47.938 49.370  17.239  1.00 76.68  ? 532  PRO A CG    1 
ATOM   3209  C  CD    . PRO A 1 504  ? -47.159 48.610  18.286  1.00 74.98  ? 532  PRO A CD    1 
ATOM   3210  N  N     . CYS A 1 505  ? -45.007 52.552  18.563  1.00 90.26  ? 533  CYS A N     1 
ATOM   3211  C  CA    . CYS A 1 505  ? -45.019 53.656  19.518  1.00 91.77  ? 533  CYS A CA    1 
ATOM   3212  C  C     . CYS A 1 505  ? -44.222 54.858  19.013  1.00 91.13  ? 533  CYS A C     1 
ATOM   3213  O  O     . CYS A 1 505  ? -43.818 54.905  17.852  1.00 92.14  ? 533  CYS A O     1 
ATOM   3214  C  CB    . CYS A 1 505  ? -44.466 53.196  20.869  1.00 81.61  ? 533  CYS A CB    1 
ATOM   3215  S  SG    . CYS A 1 505  ? -44.481 54.466  22.156  1.00 85.60  ? 533  CYS A SG    1 
ATOM   3216  N  N     . SER A 1 506  ? -44.004 55.826  19.899  1.00 92.60  ? 534  SER A N     1 
ATOM   3217  C  CA    . SER A 1 506  ? -43.247 57.031  19.575  1.00 70.31  ? 534  SER A CA    1 
ATOM   3218  C  C     . SER A 1 506  ? -42.736 57.713  20.838  1.00 92.66  ? 534  SER A C     1 
ATOM   3219  O  O     . SER A 1 506  ? -43.310 58.702  21.293  1.00 72.94  ? 534  SER A O     1 
ATOM   3220  C  CB    . SER A 1 506  ? -44.105 58.010  18.772  1.00 77.26  ? 534  SER A CB    1 
ATOM   3221  O  OG    . SER A 1 506  ? -43.479 59.279  18.690  1.00 67.59  ? 534  SER A OG    1 
ATOM   3222  N  N     . GLU A 1 507  ? -41.653 57.186  21.399  1.00 90.67  ? 535  GLU A N     1 
ATOM   3223  C  CA    . GLU A 1 507  ? -41.124 57.704  22.655  1.00 68.69  ? 535  GLU A CA    1 
ATOM   3224  C  C     . GLU A 1 507  ? -39.798 58.433  22.456  1.00 74.68  ? 535  GLU A C     1 
ATOM   3225  O  O     . GLU A 1 507  ? -38.963 58.019  21.652  1.00 71.82  ? 535  GLU A O     1 
ATOM   3226  C  CB    . GLU A 1 507  ? -40.954 56.568  23.666  1.00 74.46  ? 535  GLU A CB    1 
ATOM   3227  C  CG    . GLU A 1 507  ? -40.758 57.039  25.096  1.00 77.56  ? 535  GLU A CG    1 
ATOM   3228  C  CD    . GLU A 1 507  ? -41.892 57.925  25.575  1.00 93.35  ? 535  GLU A CD    1 
ATOM   3229  O  OE1   . GLU A 1 507  ? -41.713 59.161  25.598  1.00 86.27  ? 535  GLU A OE1   1 
ATOM   3230  O  OE2   . GLU A 1 507  ? -42.963 57.387  25.928  1.00 90.79  ? 535  GLU A OE2   1 
ATOM   3231  N  N     . GLU A 1 508  ? -39.615 59.523  23.195  1.00 74.71  ? 536  GLU A N     1 
ATOM   3232  C  CA    . GLU A 1 508  ? -38.399 60.324  23.100  1.00 84.92  ? 536  GLU A CA    1 
ATOM   3233  C  C     . GLU A 1 508  ? -37.993 60.868  24.467  1.00 68.36  ? 536  GLU A C     1 
ATOM   3234  O  O     . GLU A 1 508  ? -37.013 61.605  24.586  1.00 73.12  ? 536  GLU A O     1 
ATOM   3235  C  CB    . GLU A 1 508  ? -38.593 61.476  22.110  1.00 85.11  ? 536  GLU A CB    1 
ATOM   3236  C  CG    . GLU A 1 508  ? -39.260 62.714  22.700  1.00 84.71  ? 536  GLU A CG    1 
ATOM   3237  C  CD    . GLU A 1 508  ? -40.635 62.434  23.273  1.00 93.42  ? 536  GLU A CD    1 
ATOM   3238  O  OE1   . GLU A 1 508  ? -41.371 61.610  22.690  1.00 90.68  ? 536  GLU A OE1   1 
ATOM   3239  O  OE2   . GLU A 1 508  ? -40.978 63.036  24.312  1.00 75.04  ? 536  GLU A OE2   1 
ATOM   3240  N  N     . GLU A 1 509  ? -38.750 60.490  25.495  1.00 71.53  ? 537  GLU A N     1 
ATOM   3241  C  CA    . GLU A 1 509  ? -38.502 60.948  26.861  1.00 73.72  ? 537  GLU A CA    1 
ATOM   3242  C  C     . GLU A 1 509  ? -37.107 60.558  27.344  1.00 77.14  ? 537  GLU A C     1 
ATOM   3243  O  O     . GLU A 1 509  ? -36.552 61.185  28.246  1.00 75.11  ? 537  GLU A O     1 
ATOM   3244  C  CB    . GLU A 1 509  ? -39.562 60.386  27.812  1.00 76.95  ? 537  GLU A CB    1 
ATOM   3245  C  CG    . GLU A 1 509  ? -39.511 58.874  27.979  1.00 77.50  ? 537  GLU A CG    1 
ATOM   3246  C  CD    . GLU A 1 509  ? -40.696 58.329  28.753  1.00 75.69  ? 537  GLU A CD    1 
ATOM   3247  O  OE1   . GLU A 1 509  ? -40.723 57.109  29.020  1.00 73.34  ? 537  GLU A OE1   1 
ATOM   3248  O  OE2   . GLU A 1 509  ? -41.603 59.119  29.090  1.00 76.57  ? 537  GLU A OE2   1 
ATOM   3249  N  N     . GLU A 1 510  ? -36.550 59.515  26.737  1.00 69.80  ? 538  GLU A N     1 
ATOM   3250  C  CA    . GLU A 1 510  ? -35.193 59.080  27.035  1.00 92.71  ? 538  GLU A CA    1 
ATOM   3251  C  C     . GLU A 1 510  ? -34.211 59.785  26.106  1.00 90.30  ? 538  GLU A C     1 
ATOM   3252  O  O     . GLU A 1 510  ? -33.612 59.162  25.229  1.00 90.90  ? 538  GLU A O     1 
ATOM   3253  C  CB    . GLU A 1 510  ? -35.080 57.563  26.897  1.00 91.51  ? 538  GLU A CB    1 
ATOM   3254  C  CG    . GLU A 1 510  ? -36.090 56.802  27.742  1.00 90.93  ? 538  GLU A CG    1 
ATOM   3255  C  CD    . GLU A 1 510  ? -36.437 55.446  27.162  1.00 92.60  ? 538  GLU A CD    1 
ATOM   3256  O  OE1   . GLU A 1 510  ? -35.739 55.001  26.227  1.00 92.31  ? 538  GLU A OE1   1 
ATOM   3257  O  OE2   . GLU A 1 510  ? -37.413 54.829  27.637  1.00 93.92  ? 538  GLU A OE2   1 
ATOM   3258  N  N     . PHE A 1 511  ? -34.062 61.091  26.307  1.00 92.04  ? 539  PHE A N     1 
ATOM   3259  C  CA    . PHE A 1 511  ? -33.218 61.925  25.458  1.00 93.26  ? 539  PHE A CA    1 
ATOM   3260  C  C     . PHE A 1 511  ? -31.760 61.476  25.473  1.00 81.30  ? 539  PHE A C     1 
ATOM   3261  O  O     . PHE A 1 511  ? -31.078 61.511  24.448  1.00 90.34  ? 539  PHE A O     1 
ATOM   3262  C  CB    . PHE A 1 511  ? -33.306 63.391  25.896  1.00 90.26  ? 539  PHE A CB    1 
ATOM   3263  C  CG    . PHE A 1 511  ? -34.686 63.981  25.788  1.00 90.54  ? 539  PHE A CG    1 
ATOM   3264  C  CD1   . PHE A 1 511  ? -35.593 63.855  26.829  1.00 92.02  ? 539  PHE A CD1   1 
ATOM   3265  C  CD2   . PHE A 1 511  ? -35.072 64.672  24.652  1.00 87.05  ? 539  PHE A CD2   1 
ATOM   3266  C  CE1   . PHE A 1 511  ? -36.860 64.399  26.734  1.00 81.90  ? 539  PHE A CE1   1 
ATOM   3267  C  CE2   . PHE A 1 511  ? -36.338 65.220  24.552  1.00 81.19  ? 539  PHE A CE2   1 
ATOM   3268  C  CZ    . PHE A 1 511  ? -37.233 65.083  25.594  1.00 77.25  ? 539  PHE A CZ    1 
ATOM   3269  N  N     . GLN A 1 512  ? -31.289 61.051  26.640  1.00 90.32  ? 540  GLN A N     1 
ATOM   3270  C  CA    . GLN A 1 512  ? -29.884 60.707  26.819  1.00 86.66  ? 540  GLN A CA    1 
ATOM   3271  C  C     . GLN A 1 512  ? -29.628 59.202  26.830  1.00 84.35  ? 540  GLN A C     1 
ATOM   3272  O  O     . GLN A 1 512  ? -28.627 58.745  27.378  1.00 91.42  ? 540  GLN A O     1 
ATOM   3273  C  CB    . GLN A 1 512  ? -29.353 61.332  28.112  1.00 87.58  ? 540  GLN A CB    1 
ATOM   3274  C  CG    . GLN A 1 512  ? -30.360 61.355  29.256  1.00 90.60  ? 540  GLN A CG    1 
ATOM   3275  C  CD    . GLN A 1 512  ? -30.762 59.968  29.720  1.00 85.01  ? 540  GLN A CD    1 
ATOM   3276  O  OE1   . GLN A 1 512  ? -29.916 59.099  29.926  1.00 90.71  ? 540  GLN A OE1   1 
ATOM   3277  N  NE2   . GLN A 1 512  ? -32.063 59.754  29.883  1.00 84.01  ? 540  GLN A NE2   1 
ATOM   3278  N  N     . GLN A 1 513  ? -30.530 58.430  26.233  1.00 74.63  ? 541  GLN A N     1 
ATOM   3279  C  CA    . GLN A 1 513  ? -30.302 56.997  26.101  1.00 76.32  ? 541  GLN A CA    1 
ATOM   3280  C  C     . GLN A 1 513  ? -29.325 56.756  24.958  1.00 73.42  ? 541  GLN A C     1 
ATOM   3281  O  O     . GLN A 1 513  ? -28.690 55.703  24.872  1.00 76.74  ? 541  GLN A O     1 
ATOM   3282  C  CB    . GLN A 1 513  ? -31.609 56.242  25.857  1.00 72.55  ? 541  GLN A CB    1 
ATOM   3283  C  CG    . GLN A 1 513  ? -32.096 56.287  24.418  1.00 74.92  ? 541  GLN A CG    1 
ATOM   3284  C  CD    . GLN A 1 513  ? -32.780 55.001  23.999  1.00 76.83  ? 541  GLN A CD    1 
ATOM   3285  O  OE1   . GLN A 1 513  ? -32.988 54.102  24.813  1.00 90.38  ? 541  GLN A OE1   1 
ATOM   3286  N  NE2   . GLN A 1 513  ? -33.128 54.904  22.721  1.00 68.82  ? 541  GLN A NE2   1 
ATOM   3287  N  N     . ASP A 1 514  ? -29.212 57.747  24.080  1.00 76.51  ? 542  ASP A N     1 
ATOM   3288  C  CA    . ASP A 1 514  ? -28.272 57.692  22.971  1.00 87.30  ? 542  ASP A CA    1 
ATOM   3289  C  C     . ASP A 1 514  ? -26.837 57.775  23.478  1.00 81.45  ? 542  ASP A C     1 
ATOM   3290  O  O     . ASP A 1 514  ? -25.944 57.116  22.945  1.00 87.81  ? 542  ASP A O     1 
ATOM   3291  C  CB    . ASP A 1 514  ? -28.556 58.819  21.975  1.00 93.17  ? 542  ASP A CB    1 
ATOM   3292  C  CG    . ASP A 1 514  ? -27.296 59.533  21.528  1.00 87.51  ? 542  ASP A CG    1 
ATOM   3293  O  OD1   . ASP A 1 514  ? -26.973 60.588  22.113  1.00 86.96  ? 542  ASP A OD1   1 
ATOM   3294  O  OD2   . ASP A 1 514  ? -26.629 59.039  20.595  1.00 90.09  ? 542  ASP A OD2   1 
ATOM   3295  N  N     . VAL A 1 515  ? -26.621 58.582  24.513  1.00 90.05  ? 543  VAL A N     1 
ATOM   3296  C  CA    . VAL A 1 515  ? -25.298 58.697  25.117  1.00 92.07  ? 543  VAL A CA    1 
ATOM   3297  C  C     . VAL A 1 515  ? -25.047 57.496  26.024  1.00 91.43  ? 543  VAL A C     1 
ATOM   3298  O  O     . VAL A 1 515  ? -23.908 57.202  26.383  1.00 87.23  ? 543  VAL A O     1 
ATOM   3299  C  CB    . VAL A 1 515  ? -25.136 60.011  25.917  1.00 81.56  ? 543  VAL A CB    1 
ATOM   3300  C  CG1   . VAL A 1 515  ? -25.861 61.150  25.215  1.00 81.63  ? 543  VAL A CG1   1 
ATOM   3301  C  CG2   . VAL A 1 515  ? -25.644 59.850  27.343  1.00 85.07  ? 543  VAL A CG2   1 
ATOM   3302  N  N     . MET A 1 516  ? -26.124 56.804  26.385  1.00 90.25  ? 544  MET A N     1 
ATOM   3303  C  CA    . MET A 1 516  ? -26.025 55.563  27.142  1.00 90.19  ? 544  MET A CA    1 
ATOM   3304  C  C     . MET A 1 516  ? -25.513 54.455  26.231  1.00 87.22  ? 544  MET A C     1 
ATOM   3305  O  O     . MET A 1 516  ? -24.589 53.718  26.582  1.00 90.61  ? 544  MET A O     1 
ATOM   3306  C  CB    . MET A 1 516  ? -27.380 55.185  27.741  1.00 86.78  ? 544  MET A CB    1 
ATOM   3307  C  CG    . MET A 1 516  ? -27.397 53.851  28.467  1.00 81.03  ? 544  MET A CG    1 
ATOM   3308  S  SD    . MET A 1 516  ? -29.073 53.292  28.830  1.00 84.36  ? 544  MET A SD    1 
ATOM   3309  C  CE    . MET A 1 516  ? -29.701 54.679  29.774  1.00 70.73  ? 544  MET A CE    1 
ATOM   3310  N  N     . ALA A 1 517  ? -26.121 54.351  25.052  1.00 81.01  ? 545  ALA A N     1 
ATOM   3311  C  CA    . ALA A 1 517  ? -25.696 53.382  24.049  1.00 73.70  ? 545  ALA A CA    1 
ATOM   3312  C  C     . ALA A 1 517  ? -24.306 53.726  23.523  1.00 87.21  ? 545  ALA A C     1 
ATOM   3313  O  O     . ALA A 1 517  ? -23.527 52.838  23.174  1.00 92.54  ? 545  ALA A O     1 
ATOM   3314  C  CB    . ALA A 1 517  ? -26.699 53.325  22.909  1.00 76.27  ? 545  ALA A CB    1 
ATOM   3315  N  N     . ARG A 1 518  ? -24.003 55.019  23.468  1.00 90.24  ? 546  ARG A N     1 
ATOM   3316  C  CA    . ARG A 1 518  ? -22.683 55.486  23.058  1.00 91.17  ? 546  ARG A CA    1 
ATOM   3317  C  C     . ARG A 1 518  ? -21.620 55.090  24.078  1.00 91.53  ? 546  ARG A C     1 
ATOM   3318  O  O     . ARG A 1 518  ? -20.573 54.537  23.722  1.00 93.36  ? 546  ARG A O     1 
ATOM   3319  C  CB    . ARG A 1 518  ? -22.685 57.003  22.867  1.00 84.28  ? 546  ARG A CB    1 
ATOM   3320  C  CG    . ARG A 1 518  ? -21.298 57.618  22.785  1.00 91.33  ? 546  ARG A CG    1 
ATOM   3321  C  CD    . ARG A 1 518  ? -21.367 59.136  22.761  1.00 92.78  ? 546  ARG A CD    1 
ATOM   3322  N  NE    . ARG A 1 518  ? -21.967 59.637  21.529  1.00 81.70  ? 546  ARG A NE    1 
ATOM   3323  C  CZ    . ARG A 1 518  ? -21.272 60.009  20.460  1.00 91.62  ? 546  ARG A CZ    1 
ATOM   3324  N  NH1   . ARG A 1 518  ? -19.947 59.940  20.471  1.00 87.96  ? 546  ARG A NH1   1 
ATOM   3325  N  NH2   . ARG A 1 518  ? -21.899 60.453  19.380  1.00 81.14  ? 546  ARG A NH2   1 
ATOM   3326  N  N     . ALA A 1 519  ? -21.896 55.381  25.346  1.00 85.40  ? 547  ALA A N     1 
ATOM   3327  C  CA    . ALA A 1 519  ? -20.986 55.034  26.431  1.00 85.96  ? 547  ALA A CA    1 
ATOM   3328  C  C     . ALA A 1 519  ? -20.769 53.527  26.483  1.00 86.02  ? 547  ALA A C     1 
ATOM   3329  O  O     . ALA A 1 519  ? -19.646 53.062  26.672  1.00 72.43  ? 547  ALA A O     1 
ATOM   3330  C  CB    . ALA A 1 519  ? -21.520 55.542  27.761  1.00 93.22  ? 547  ALA A CB    1 
ATOM   3331  N  N     . CYS A 1 520  ? -21.847 52.770  26.305  1.00 87.84  ? 548  CYS A N     1 
ATOM   3332  C  CA    . CYS A 1 520  ? -21.759 51.315  26.271  1.00 81.85  ? 548  CYS A CA    1 
ATOM   3333  C  C     . CYS A 1 520  ? -20.908 50.852  25.091  1.00 81.12  ? 548  CYS A C     1 
ATOM   3334  O  O     . CYS A 1 520  ? -20.137 49.897  25.205  1.00 92.66  ? 548  CYS A O     1 
ATOM   3335  C  CB    . CYS A 1 520  ? -23.154 50.692  26.194  1.00 84.66  ? 548  CYS A CB    1 
ATOM   3336  S  SG    . CYS A 1 520  ? -23.467 49.749  24.684  1.00 68.45  ? 548  CYS A SG    1 
ATOM   3337  N  N     . LEU A 1 521  ? -21.050 51.541  23.962  1.00 73.67  ? 549  LEU A N     1 
ATOM   3338  C  CA    . LEU A 1 521  ? -20.280 51.227  22.762  1.00 76.82  ? 549  LEU A CA    1 
ATOM   3339  C  C     . LEU A 1 521  ? -18.784 51.423  22.982  1.00 72.40  ? 549  LEU A C     1 
ATOM   3340  O  O     . LEU A 1 521  ? -17.980 50.563  22.626  1.00 69.02  ? 549  LEU A O     1 
ATOM   3341  C  CB    . LEU A 1 521  ? -20.746 52.087  21.584  1.00 69.66  ? 549  LEU A CB    1 
ATOM   3342  C  CG    . LEU A 1 521  ? -19.840 52.091  20.349  1.00 56.16  ? 549  LEU A CG    1 
ATOM   3343  C  CD1   . LEU A 1 521  ? -19.823 50.729  19.670  1.00 55.43  ? 549  LEU A CD1   1 
ATOM   3344  C  CD2   . LEU A 1 521  ? -20.260 53.179  19.373  1.00 64.66  ? 549  LEU A CD2   1 
ATOM   3345  N  N     . GLN A 1 522  ? -18.415 52.559  23.567  1.00 73.27  ? 550  GLN A N     1 
ATOM   3346  C  CA    . GLN A 1 522  ? -17.008 52.857  23.815  1.00 93.33  ? 550  GLN A CA    1 
ATOM   3347  C  C     . GLN A 1 522  ? -16.424 51.922  24.872  1.00 92.91  ? 550  GLN A C     1 
ATOM   3348  O  O     . GLN A 1 522  ? -15.312 51.406  24.718  1.00 84.44  ? 550  GLN A O     1 
ATOM   3349  C  CB    . GLN A 1 522  ? -16.838 54.315  24.244  1.00 85.54  ? 550  GLN A CB    1 
ATOM   3350  C  CG    . GLN A 1 522  ? -15.392 54.775  24.327  1.00 85.92  ? 550  GLN A CG    1 
ATOM   3351  C  CD    . GLN A 1 522  ? -15.272 56.246  24.672  1.00 76.16  ? 550  GLN A CD    1 
ATOM   3352  O  OE1   . GLN A 1 522  ? -16.247 56.883  25.071  1.00 75.77  ? 550  GLN A OE1   1 
ATOM   3353  N  NE2   . GLN A 1 522  ? -14.073 56.795  24.517  1.00 69.07  ? 550  GLN A NE2   1 
ATOM   3354  N  N     . LYS A 1 523  ? -17.186 51.705  25.941  1.00 74.81  ? 551  LYS A N     1 
ATOM   3355  C  CA    . LYS A 1 523  ? -16.770 50.814  27.020  1.00 70.20  ? 551  LYS A CA    1 
ATOM   3356  C  C     . LYS A 1 523  ? -16.596 49.382  26.523  1.00 93.93  ? 551  LYS A C     1 
ATOM   3357  O  O     . LYS A 1 523  ? -15.764 48.637  27.039  1.00 73.53  ? 551  LYS A O     1 
ATOM   3358  C  CB    . LYS A 1 523  ? -17.781 50.860  28.169  1.00 74.99  ? 551  LYS A CB    1 
ATOM   3359  C  CG    . LYS A 1 523  ? -17.721 52.140  28.994  1.00 75.46  ? 551  LYS A CG    1 
ATOM   3360  C  CD    . LYS A 1 523  ? -18.983 52.359  29.827  1.00 70.56  ? 551  LYS A CD    1 
ATOM   3361  C  CE    . LYS A 1 523  ? -19.138 51.324  30.934  1.00 77.79  ? 551  LYS A CE    1 
ATOM   3362  N  NZ    . LYS A 1 523  ? -19.845 50.091  30.485  1.00 74.56  ? 551  LYS A NZ    1 
ATOM   3363  N  N     . LEU A 1 524  ? -17.382 49.000  25.520  1.00 93.15  ? 552  LEU A N     1 
ATOM   3364  C  CA    . LEU A 1 524  ? -17.226 47.693  24.889  1.00 71.10  ? 552  LEU A CA    1 
ATOM   3365  C  C     . LEU A 1 524  ? -16.006 47.683  23.975  1.00 75.30  ? 552  LEU A C     1 
ATOM   3366  O  O     . LEU A 1 524  ? -15.292 46.685  23.878  1.00 73.07  ? 552  LEU A O     1 
ATOM   3367  C  CB    . LEU A 1 524  ? -18.483 47.319  24.098  1.00 73.92  ? 552  LEU A CB    1 
ATOM   3368  C  CG    . LEU A 1 524  ? -18.411 46.075  23.208  1.00 70.15  ? 552  LEU A CG    1 
ATOM   3369  C  CD1   . LEU A 1 524  ? -19.663 45.234  23.369  1.00 76.18  ? 552  LEU A CD1   1 
ATOM   3370  C  CD2   . LEU A 1 524  ? -18.218 46.460  21.746  1.00 75.58  ? 552  LEU A CD2   1 
ATOM   3371  N  N     . LYS A 1 525  ? -15.778 48.809  23.307  1.00 72.21  ? 553  LYS A N     1 
ATOM   3372  C  CA    . LYS A 1 525  ? -14.680 48.947  22.360  1.00 75.41  ? 553  LYS A CA    1 
ATOM   3373  C  C     . LYS A 1 525  ? -13.313 48.830  23.030  1.00 77.75  ? 553  LYS A C     1 
ATOM   3374  O  O     . LYS A 1 525  ? -12.430 48.124  22.540  1.00 72.99  ? 553  LYS A O     1 
ATOM   3375  C  CB    . LYS A 1 525  ? -14.785 50.288  21.630  1.00 90.41  ? 553  LYS A CB    1 
ATOM   3376  C  CG    . LYS A 1 525  ? -13.555 50.652  20.821  1.00 93.58  ? 553  LYS A CG    1 
ATOM   3377  C  CD    . LYS A 1 525  ? -13.394 49.746  19.614  1.00 81.96  ? 553  LYS A CD    1 
ATOM   3378  C  CE    . LYS A 1 525  ? -12.000 49.871  19.029  1.00 90.07  ? 553  LYS A CE    1 
ATOM   3379  N  NZ    . LYS A 1 525  ? -11.944 49.409  17.616  1.00 87.60  ? 553  LYS A NZ    1 
ATOM   3380  N  N     . GLY A 1 526  ? -13.145 49.519  24.154  1.00 71.90  ? 554  GLY A N     1 
ATOM   3381  C  CA    . GLY A 1 526  ? -11.852 49.597  24.812  1.00 68.86  ? 554  GLY A CA    1 
ATOM   3382  C  C     . GLY A 1 526  ? -11.336 48.319  25.452  1.00 90.11  ? 554  GLY A C     1 
ATOM   3383  O  O     . GLY A 1 526  ? -10.206 48.283  25.938  1.00 91.29  ? 554  GLY A O     1 
ATOM   3384  N  N     . THR A 1 527  ? -12.150 47.267  25.450  1.00 93.53  ? 555  THR A N     1 
ATOM   3385  C  CA    . THR A 1 527  ? -11.795 46.032  26.146  1.00 71.66  ? 555  THR A CA    1 
ATOM   3386  C  C     . THR A 1 527  ? -11.201 44.959  25.236  1.00 71.42  ? 555  THR A C     1 
ATOM   3387  O  O     . THR A 1 527  ? -10.584 44.009  25.714  1.00 77.35  ? 555  THR A O     1 
ATOM   3388  C  CB    . THR A 1 527  ? -13.019 45.421  26.856  1.00 68.13  ? 555  THR A CB    1 
ATOM   3389  O  OG1   . THR A 1 527  ? -14.025 45.098  25.888  1.00 71.58  ? 555  THR A OG1   1 
ATOM   3390  C  CG2   . THR A 1 527  ? -13.589 46.395  27.873  1.00 74.69  ? 555  THR A CG2   1 
ATOM   3391  N  N     . THR A 1 528  ? -11.389 45.108  23.930  1.00 75.53  ? 556  THR A N     1 
ATOM   3392  C  CA    . THR A 1 528  ? -11.001 44.062  22.990  1.00 92.67  ? 556  THR A CA    1 
ATOM   3393  C  C     . THR A 1 528  ? -9.566  44.225  22.489  1.00 92.82  ? 556  THR A C     1 
ATOM   3394  O  O     . THR A 1 528  ? -8.970  43.277  21.982  1.00 87.95  ? 556  THR A O     1 
ATOM   3395  C  CB    . THR A 1 528  ? -11.953 44.029  21.775  1.00 93.13  ? 556  THR A CB    1 
ATOM   3396  O  OG1   . THR A 1 528  ? -13.301 44.234  22.214  1.00 90.92  ? 556  THR A OG1   1 
ATOM   3397  C  CG2   . THR A 1 528  ? -11.858 42.697  21.041  1.00 91.23  ? 556  THR A CG2   1 
ATOM   3398  N  N     . GLU A 1 529  ? -9.009  45.422  22.653  1.00 85.11  ? 557  GLU A N     1 
ATOM   3399  C  CA    . GLU A 1 529  ? -7.726  45.766  22.041  1.00 92.78  ? 557  GLU A CA    1 
ATOM   3400  C  C     . GLU A 1 529  ? -6.558  44.876  22.475  1.00 70.16  ? 557  GLU A C     1 
ATOM   3401  O  O     . GLU A 1 529  ? -5.661  44.600  21.678  1.00 73.66  ? 557  GLU A O     1 
ATOM   3402  C  CB    . GLU A 1 529  ? -7.382  47.229  22.333  1.00 93.38  ? 557  GLU A CB    1 
ATOM   3403  C  CG    . GLU A 1 529  ? -6.151  47.729  21.590  1.00 87.66  ? 557  GLU A CG    1 
ATOM   3404  C  CD    . GLU A 1 529  ? -5.918  49.215  21.770  1.00 84.60  ? 557  GLU A CD    1 
ATOM   3405  O  OE1   . GLU A 1 529  ? -4.944  49.739  21.188  1.00 71.82  ? 557  GLU A OE1   1 
ATOM   3406  O  OE2   . GLU A 1 529  ? -6.708  49.859  22.490  1.00 92.98  ? 557  GLU A OE2   1 
ATOM   3407  N  N     . LEU A 1 530  ? -6.563  44.423  23.725  1.00 74.37  ? 558  LEU A N     1 
ATOM   3408  C  CA    . LEU A 1 530  ? -5.439  43.633  24.224  1.00 70.44  ? 558  LEU A CA    1 
ATOM   3409  C  C     . LEU A 1 530  ? -5.553  42.161  23.823  1.00 72.77  ? 558  LEU A C     1 
ATOM   3410  O  O     . LEU A 1 530  ? -4.664  41.363  24.120  1.00 73.90  ? 558  LEU A O     1 
ATOM   3411  C  CB    . LEU A 1 530  ? -5.306  43.775  25.752  1.00 84.57  ? 558  LEU A CB    1 
ATOM   3412  C  CG    . LEU A 1 530  ? -6.172  43.056  26.801  1.00 93.45  ? 558  LEU A CG    1 
ATOM   3413  C  CD1   . LEU A 1 530  ? -7.645  43.019  26.424  1.00 86.82  ? 558  LEU A CD1   1 
ATOM   3414  C  CD2   . LEU A 1 530  ? -5.650  41.656  27.138  1.00 86.92  ? 558  LEU A CD2   1 
ATOM   3415  N  N     . LEU A 1 531  ? -6.635  41.805  23.136  1.00 90.49  ? 559  LEU A N     1 
ATOM   3416  C  CA    . LEU A 1 531  ? -6.791  40.439  22.643  1.00 81.59  ? 559  LEU A CA    1 
ATOM   3417  C  C     . LEU A 1 531  ? -5.888  40.166  21.430  1.00 81.92  ? 559  LEU A C     1 
ATOM   3418  O  O     . LEU A 1 531  ? -5.168  39.168  21.419  1.00 69.23  ? 559  LEU A O     1 
ATOM   3419  C  CB    . LEU A 1 531  ? -8.257  40.139  22.302  1.00 92.74  ? 559  LEU A CB    1 
ATOM   3420  C  CG    . LEU A 1 531  ? -9.177  39.709  23.446  1.00 81.09  ? 559  LEU A CG    1 
ATOM   3421  C  CD1   . LEU A 1 531  ? -9.568  40.896  24.304  1.00 84.93  ? 559  LEU A CD1   1 
ATOM   3422  C  CD2   . LEU A 1 531  ? -10.418 39.022  22.899  1.00 92.90  ? 559  LEU A CD2   1 
ATOM   3423  N  N     . PRO A 1 532  ? -5.914  41.038  20.402  1.00 76.01  ? 560  PRO A N     1 
ATOM   3424  C  CA    . PRO A 1 532  ? -4.935  40.800  19.341  1.00 76.99  ? 560  PRO A CA    1 
ATOM   3425  C  C     . PRO A 1 532  ? -3.676  41.634  19.559  1.00 76.42  ? 560  PRO A C     1 
ATOM   3426  O  O     . PRO A 1 532  ? -3.677  42.533  20.400  1.00 77.19  ? 560  PRO A O     1 
ATOM   3427  C  CB    . PRO A 1 532  ? -5.679  41.236  18.069  1.00 75.29  ? 560  PRO A CB    1 
ATOM   3428  C  CG    . PRO A 1 532  ? -6.987  41.889  18.547  1.00 75.90  ? 560  PRO A CG    1 
ATOM   3429  C  CD    . PRO A 1 532  ? -6.839  42.115  20.016  1.00 71.47  ? 560  PRO A CD    1 
ATOM   3430  N  N     . LYS A 1 533  ? -2.616  41.342  18.812  1.00 76.83  ? 561  LYS A N     1 
ATOM   3431  C  CA    . LYS A 1 533  ? -1.356  42.054  18.986  1.00 81.65  ? 561  LYS A CA    1 
ATOM   3432  C  C     . LYS A 1 533  ? -1.039  42.950  17.795  1.00 73.62  ? 561  LYS A C     1 
ATOM   3433  O  O     . LYS A 1 533  ? -1.152  44.173  17.877  1.00 75.09  ? 561  LYS A O     1 
ATOM   3434  C  CB    . LYS A 1 533  ? -0.211  41.066  19.205  1.00 81.27  ? 561  LYS A CB    1 
ATOM   3435  C  CG    . LYS A 1 533  ? 1.097   41.719  19.612  1.00 91.11  ? 561  LYS A CG    1 
ATOM   3436  C  CD    . LYS A 1 533  ? 1.046   42.217  21.047  1.00 91.11  ? 561  LYS A CD    1 
ATOM   3437  C  CE    . LYS A 1 533  ? 2.404   42.729  21.498  1.00 76.04  ? 561  LYS A CE    1 
ATOM   3438  N  NZ    . LYS A 1 533  ? 2.400   43.143  22.927  1.00 70.29  ? 561  LYS A NZ    1 
ATOM   3439  N  N     . ARG A 1 534  ? -0.639  42.329  16.691  1.00 90.13  ? 562  ARG A N     1 
ATOM   3440  C  CA    . ARG A 1 534  ? -0.259  43.059  15.488  1.00 85.43  ? 562  ARG A CA    1 
ATOM   3441  C  C     . ARG A 1 534  ? -1.270  42.823  14.369  1.00 86.75  ? 562  ARG A C     1 
ATOM   3442  O  O     . ARG A 1 534  ? -1.603  41.679  14.064  1.00 84.45  ? 562  ARG A O     1 
ATOM   3443  C  CB    . ARG A 1 534  ? 1.140   42.638  15.032  1.00 85.54  ? 562  ARG A CB    1 
ATOM   3444  C  CG    . ARG A 1 534  ? 1.785   43.577  14.026  1.00 84.11  ? 562  ARG A CG    1 
ATOM   3445  C  CD    . ARG A 1 534  ? 2.146   44.906  14.672  1.00 90.47  ? 562  ARG A CD    1 
ATOM   3446  N  NE    . ARG A 1 534  ? 3.007   45.723  13.822  1.00 87.77  ? 562  ARG A NE    1 
ATOM   3447  C  CZ    . ARG A 1 534  ? 2.567   46.666  12.994  1.00 87.76  ? 562  ARG A CZ    1 
ATOM   3448  N  NH1   . ARG A 1 534  ? 1.269   46.916  12.900  1.00 90.55  ? 562  ARG A NH1   1 
ATOM   3449  N  NH2   . ARG A 1 534  ? 3.427   47.360  12.260  1.00 87.83  ? 562  ARG A NH2   1 
ATOM   3450  N  N     . PRO A 1 535  ? -1.765  43.908  13.755  1.00 68.63  ? 563  PRO A N     1 
ATOM   3451  C  CA    . PRO A 1 535  ? -2.728  43.798  12.654  1.00 72.49  ? 563  PRO A CA    1 
ATOM   3452  C  C     . PRO A 1 535  ? -2.133  43.131  11.415  1.00 76.89  ? 563  PRO A C     1 
ATOM   3453  O  O     . PRO A 1 535  ? -1.259  43.702  10.764  1.00 77.19  ? 563  PRO A O     1 
ATOM   3454  C  CB    . PRO A 1 535  ? -3.098  45.257  12.363  1.00 68.61  ? 563  PRO A CB    1 
ATOM   3455  C  CG    . PRO A 1 535  ? -1.950  46.054  12.883  1.00 72.24  ? 563  PRO A CG    1 
ATOM   3456  C  CD    . PRO A 1 535  ? -1.462  45.311  14.088  1.00 68.99  ? 563  PRO A CD    1 
ATOM   3457  N  N     . GLN A 1 536  ? -2.607  41.929  11.102  1.00 91.12  ? 564  GLN A N     1 
ATOM   3458  C  CA    . GLN A 1 536  ? -2.145  41.202  9.924   1.00 87.00  ? 564  GLN A CA    1 
ATOM   3459  C  C     . GLN A 1 536  ? -3.039  41.486  8.723   1.00 85.21  ? 564  GLN A C     1 
ATOM   3460  O  O     . GLN A 1 536  ? -4.091  42.112  8.856   1.00 86.37  ? 564  GLN A O     1 
ATOM   3461  C  CB    . GLN A 1 536  ? -2.101  39.697  10.197  1.00 85.35  ? 564  GLN A CB    1 
ATOM   3462  C  CG    . GLN A 1 536  ? -3.417  39.107  10.685  1.00 90.33  ? 564  GLN A CG    1 
ATOM   3463  C  CD    . GLN A 1 536  ? -3.595  39.242  12.184  1.00 86.51  ? 564  GLN A CD    1 
ATOM   3464  O  OE1   . GLN A 1 536  ? -2.619  39.287  12.934  1.00 90.84  ? 564  GLN A OE1   1 
ATOM   3465  N  NE2   . GLN A 1 536  ? -4.844  39.313  12.629  1.00 87.96  ? 564  GLN A NE2   1 
ATOM   3466  N  N     . HIS A 1 537  ? -2.616  41.024  7.551   1.00 68.39  ? 565  HIS A N     1 
ATOM   3467  C  CA    . HIS A 1 537  ? -3.402  41.208  6.338   1.00 72.41  ? 565  HIS A CA    1 
ATOM   3468  C  C     . HIS A 1 537  ? -4.685  40.392  6.419   1.00 72.50  ? 565  HIS A C     1 
ATOM   3469  O  O     . HIS A 1 537  ? -4.756  39.419  7.168   1.00 70.03  ? 565  HIS A O     1 
ATOM   3470  C  CB    . HIS A 1 537  ? -2.596  40.814  5.101   1.00 69.56  ? 565  HIS A CB    1 
ATOM   3471  C  CG    . HIS A 1 537  ? -2.599  41.855  4.025   1.00 74.30  ? 565  HIS A CG    1 
ATOM   3472  N  ND1   . HIS A 1 537  ? -2.101  41.622  2.762   1.00 76.15  ? 565  HIS A ND1   1 
ATOM   3473  C  CD2   . HIS A 1 537  ? -3.037  43.136  4.028   1.00 70.38  ? 565  HIS A CD2   1 
ATOM   3474  C  CE1   . HIS A 1 537  ? -2.234  42.715  2.031   1.00 75.53  ? 565  HIS A CE1   1 
ATOM   3475  N  NE2   . HIS A 1 537  ? -2.799  43.648  2.776   1.00 73.26  ? 565  HIS A NE2   1 
ATOM   3476  N  N     . LEU A 1 538  ? -5.690  40.797  5.645   1.00 68.21  ? 566  LEU A N     1 
ATOM   3477  C  CA    . LEU A 1 538  ? -7.014  40.176  5.687   1.00 68.38  ? 566  LEU A CA    1 
ATOM   3478  C  C     . LEU A 1 538  ? -6.963  38.666  5.449   1.00 73.73  ? 566  LEU A C     1 
ATOM   3479  O  O     . LEU A 1 538  ? -6.661  38.211  4.347   1.00 66.29  ? 566  LEU A O     1 
ATOM   3480  C  CB    . LEU A 1 538  ? -7.962  40.837  4.670   1.00 70.00  ? 566  LEU A CB    1 
ATOM   3481  C  CG    . LEU A 1 538  ? -7.505  41.596  3.410   1.00 74.29  ? 566  LEU A CG    1 
ATOM   3482  C  CD1   . LEU A 1 538  ? -6.953  42.985  3.740   1.00 74.11  ? 566  LEU A CD1   1 
ATOM   3483  C  CD2   . LEU A 1 538  ? -6.524  40.802  2.546   1.00 73.55  ? 566  LEU A CD2   1 
ATOM   3484  N  N     . PRO A 1 539  ? -7.260  37.885  6.500   1.00 66.49  ? 567  PRO A N     1 
ATOM   3485  C  CA    . PRO A 1 539  ? -7.203  36.421  6.461   1.00 56.48  ? 567  PRO A CA    1 
ATOM   3486  C  C     . PRO A 1 539  ? -8.429  35.791  5.807   1.00 56.03  ? 567  PRO A C     1 
ATOM   3487  O  O     . PRO A 1 539  ? -8.356  34.650  5.349   1.00 72.14  ? 567  PRO A O     1 
ATOM   3488  C  CB    . PRO A 1 539  ? -7.127  36.045  7.940   1.00 56.63  ? 567  PRO A CB    1 
ATOM   3489  C  CG    . PRO A 1 539  ? -7.894  37.120  8.619   1.00 56.28  ? 567  PRO A CG    1 
ATOM   3490  C  CD    . PRO A 1 539  ? -7.635  38.382  7.836   1.00 60.42  ? 567  PRO A CD    1 
ATOM   3491  N  N     . GLY A 1 540  ? -9.539  36.522  5.770   1.00 67.64  ? 568  GLY A N     1 
ATOM   3492  C  CA    . GLY A 1 540  ? -10.762 36.017  5.173   1.00 72.72  ? 568  GLY A CA    1 
ATOM   3493  C  C     . GLY A 1 540  ? -10.612 35.772  3.685   1.00 71.65  ? 568  GLY A C     1 
ATOM   3494  O  O     . GLY A 1 540  ? -11.194 34.836  3.136   1.00 75.39  ? 568  GLY A O     1 
ATOM   3495  N  N     . HIS A 1 541  ? -9.821  36.617  3.033   1.00 71.17  ? 569  HIS A N     1 
ATOM   3496  C  CA    . HIS A 1 541  ? -9.583  36.508  1.598   1.00 73.04  ? 569  HIS A CA    1 
ATOM   3497  C  C     . HIS A 1 541  ? -8.434  35.545  1.308   1.00 55.06  ? 569  HIS A C     1 
ATOM   3498  O  O     . HIS A 1 541  ? -7.509  35.427  2.110   1.00 56.13  ? 569  HIS A O     1 
ATOM   3499  C  CB    . HIS A 1 541  ? -9.288  37.889  1.006   1.00 70.57  ? 569  HIS A CB    1 
ATOM   3500  C  CG    . HIS A 1 541  ? -10.364 38.898  1.264   1.00 69.12  ? 569  HIS A CG    1 
ATOM   3501  N  ND1   . HIS A 1 541  ? -10.573 39.462  2.504   1.00 71.61  ? 569  HIS A ND1   1 
ATOM   3502  C  CD2   . HIS A 1 541  ? -11.294 39.440  0.442   1.00 66.00  ? 569  HIS A CD2   1 
ATOM   3503  C  CE1   . HIS A 1 541  ? -11.584 40.309  2.435   1.00 71.32  ? 569  HIS A CE1   1 
ATOM   3504  N  NE2   . HIS A 1 541  ? -12.039 40.315  1.194   1.00 74.26  ? 569  HIS A NE2   1 
ATOM   3505  N  N     . PRO A 1 542  ? -8.495  34.845  0.162   1.00 55.80  ? 570  PRO A N     1 
ATOM   3506  C  CA    . PRO A 1 542  ? -7.462  33.883  -0.246  1.00 56.99  ? 570  PRO A CA    1 
ATOM   3507  C  C     . PRO A 1 542  ? -6.064  34.497  -0.330  1.00 70.60  ? 570  PRO A C     1 
ATOM   3508  O  O     . PRO A 1 542  ? -5.936  35.710  -0.490  1.00 76.21  ? 570  PRO A O     1 
ATOM   3509  C  CB    . PRO A 1 542  ? -7.936  33.428  -1.628  1.00 64.18  ? 570  PRO A CB    1 
ATOM   3510  C  CG    . PRO A 1 542  ? -9.405  33.637  -1.608  1.00 56.78  ? 570  PRO A CG    1 
ATOM   3511  C  CD    . PRO A 1 542  ? -9.624  34.870  -0.785  1.00 60.81  ? 570  PRO A CD    1 
ATOM   3512  N  N     . GLY A 1 543  ? -5.037  33.657  -0.231  1.00 66.32  ? 571  GLY A N     1 
ATOM   3513  C  CA    . GLY A 1 543  ? -3.657  34.114  -0.211  1.00 66.81  ? 571  GLY A CA    1 
ATOM   3514  C  C     . GLY A 1 543  ? -3.230  34.890  -1.443  1.00 70.19  ? 571  GLY A C     1 
ATOM   3515  O  O     . GLY A 1 543  ? -2.521  35.896  -1.339  1.00 76.35  ? 571  GLY A O     1 
ATOM   3516  N  N     . TRP A 1 544  ? -3.660  34.421  -2.611  1.00 65.89  ? 572  TRP A N     1 
ATOM   3517  C  CA    . TRP A 1 544  ? -3.359  35.098  -3.867  1.00 72.55  ? 572  TRP A CA    1 
ATOM   3518  C  C     . TRP A 1 544  ? -3.946  36.503  -3.866  1.00 73.44  ? 572  TRP A C     1 
ATOM   3519  O  O     . TRP A 1 544  ? -3.422  37.408  -4.513  1.00 74.81  ? 572  TRP A O     1 
ATOM   3520  C  CB    . TRP A 1 544  ? -3.905  34.307  -5.055  1.00 76.22  ? 572  TRP A CB    1 
ATOM   3521  C  CG    . TRP A 1 544  ? -5.378  34.493  -5.268  1.00 69.60  ? 572  TRP A CG    1 
ATOM   3522  C  CD1   . TRP A 1 544  ? -6.388  33.886  -4.583  1.00 68.62  ? 572  TRP A CD1   1 
ATOM   3523  C  CD2   . TRP A 1 544  ? -6.005  35.353  -6.228  1.00 76.41  ? 572  TRP A CD2   1 
ATOM   3524  N  NE1   . TRP A 1 544  ? -7.605  34.309  -5.058  1.00 71.93  ? 572  TRP A NE1   1 
ATOM   3525  C  CE2   . TRP A 1 544  ? -7.398  35.211  -6.067  1.00 77.82  ? 572  TRP A CE2   1 
ATOM   3526  C  CE3   . TRP A 1 544  ? -5.525  36.228  -7.207  1.00 73.35  ? 572  TRP A CE3   1 
ATOM   3527  C  CZ2   . TRP A 1 544  ? -8.314  35.910  -6.850  1.00 70.72  ? 572  TRP A CZ2   1 
ATOM   3528  C  CZ3   . TRP A 1 544  ? -6.437  36.921  -7.982  1.00 76.48  ? 572  TRP A CZ3   1 
ATOM   3529  C  CH2   . TRP A 1 544  ? -7.815  36.758  -7.799  1.00 77.18  ? 572  TRP A CH2   1 
ATOM   3530  N  N     . TYR A 1 545  ? -5.041  36.673  -3.133  1.00 70.19  ? 573  TYR A N     1 
ATOM   3531  C  CA    . TYR A 1 545  ? -5.702  37.964  -3.026  1.00 70.31  ? 573  TYR A CA    1 
ATOM   3532  C  C     . TYR A 1 545  ? -5.032  38.814  -1.949  1.00 67.53  ? 573  TYR A C     1 
ATOM   3533  O  O     . TYR A 1 545  ? -5.003  40.040  -2.046  1.00 72.31  ? 573  TYR A O     1 
ATOM   3534  C  CB    . TYR A 1 545  ? -7.190  37.779  -2.722  1.00 56.31  ? 573  TYR A CB    1 
ATOM   3535  C  CG    . TYR A 1 545  ? -8.030  39.011  -2.967  1.00 60.03  ? 573  TYR A CG    1 
ATOM   3536  C  CD1   . TYR A 1 545  ? -8.342  39.878  -1.930  1.00 64.49  ? 573  TYR A CD1   1 
ATOM   3537  C  CD2   . TYR A 1 545  ? -8.511  39.306  -4.237  1.00 56.16  ? 573  TYR A CD2   1 
ATOM   3538  C  CE1   . TYR A 1 545  ? -9.110  41.004  -2.148  1.00 66.50  ? 573  TYR A CE1   1 
ATOM   3539  C  CE2   . TYR A 1 545  ? -9.280  40.430  -4.465  1.00 60.16  ? 573  TYR A CE2   1 
ATOM   3540  C  CZ    . TYR A 1 545  ? -9.576  41.276  -3.417  1.00 69.73  ? 573  TYR A CZ    1 
ATOM   3541  O  OH    . TYR A 1 545  ? -10.341 42.397  -3.633  1.00 64.11  ? 573  TYR A OH    1 
ATOM   3542  N  N     . ARG A 1 546  ? -4.491  38.155  -0.926  1.00 66.48  ? 574  ARG A N     1 
ATOM   3543  C  CA    . ARG A 1 546  ? -3.748  38.849  0.121   1.00 69.95  ? 574  ARG A CA    1 
ATOM   3544  C  C     . ARG A 1 546  ? -2.495  39.495  -0.454  1.00 69.99  ? 574  ARG A C     1 
ATOM   3545  O  O     . ARG A 1 546  ? -2.231  40.675  -0.223  1.00 68.81  ? 574  ARG A O     1 
ATOM   3546  C  CB    . ARG A 1 546  ? -3.361  37.893  1.252   1.00 70.80  ? 574  ARG A CB    1 
ATOM   3547  C  CG    . ARG A 1 546  ? -4.530  37.234  1.961   1.00 71.61  ? 574  ARG A CG    1 
ATOM   3548  C  CD    . ARG A 1 546  ? -4.066  36.520  3.222   1.00 70.98  ? 574  ARG A CD    1 
ATOM   3549  N  NE    . ARG A 1 546  ? -5.114  35.681  3.794   1.00 77.67  ? 574  ARG A NE    1 
ATOM   3550  C  CZ    . ARG A 1 546  ? -5.155  34.357  3.680   1.00 68.39  ? 574  ARG A CZ    1 
ATOM   3551  N  NH1   . ARG A 1 546  ? -4.199  33.716  3.022   1.00 76.43  ? 574  ARG A NH1   1 
ATOM   3552  N  NH2   . ARG A 1 546  ? -6.150  33.674  4.229   1.00 85.92  ? 574  ARG A NH2   1 
ATOM   3553  N  N     . LYS A 1 547  ? -1.726  38.711  -1.206  1.00 70.49  ? 575  LYS A N     1 
ATOM   3554  C  CA    . LYS A 1 547  ? -0.500  39.204  -1.828  1.00 71.91  ? 575  LYS A CA    1 
ATOM   3555  C  C     . LYS A 1 547  ? -0.807  40.303  -2.844  1.00 70.42  ? 575  LYS A C     1 
ATOM   3556  O  O     . LYS A 1 547  ? 0.019   41.182  -3.097  1.00 69.11  ? 575  LYS A O     1 
ATOM   3557  C  CB    . LYS A 1 547  ? 0.257   38.055  -2.500  1.00 70.34  ? 575  LYS A CB    1 
ATOM   3558  C  CG    . LYS A 1 547  ? 1.608   38.445  -3.086  1.00 68.93  ? 575  LYS A CG    1 
ATOM   3559  C  CD    . LYS A 1 547  ? 2.269   37.273  -3.796  1.00 77.35  ? 575  LYS A CD    1 
ATOM   3560  C  CE    . LYS A 1 547  ? 2.537   36.123  -2.838  1.00 73.16  ? 575  LYS A CE    1 
ATOM   3561  N  NZ    . LYS A 1 547  ? 3.212   34.979  -3.513  1.00 72.64  ? 575  LYS A NZ    1 
ATOM   3562  N  N     . LEU A 1 548  ? -2.008  40.252  -3.411  1.00 66.72  ? 576  LEU A N     1 
ATOM   3563  C  CA    . LEU A 1 548  ? -2.425  41.211  -4.426  1.00 66.52  ? 576  LEU A CA    1 
ATOM   3564  C  C     . LEU A 1 548  ? -3.076  42.442  -3.794  1.00 69.92  ? 576  LEU A C     1 
ATOM   3565  O  O     . LEU A 1 548  ? -3.823  43.165  -4.450  1.00 72.40  ? 576  LEU A O     1 
ATOM   3566  C  CB    . LEU A 1 548  ? -3.389  40.546  -5.413  1.00 66.37  ? 576  LEU A CB    1 
ATOM   3567  C  CG    . LEU A 1 548  ? -3.352  41.034  -6.862  1.00 65.41  ? 576  LEU A CG    1 
ATOM   3568  C  CD1   . LEU A 1 548  ? -1.960  40.864  -7.448  1.00 66.61  ? 576  LEU A CD1   1 
ATOM   3569  C  CD2   . LEU A 1 548  ? -4.379  40.295  -7.702  1.00 65.53  ? 576  LEU A CD2   1 
ATOM   3570  N  N     . CYS A 1 549  ? -2.787  42.671  -2.516  1.00 55.04  ? 577  CYS A N     1 
ATOM   3571  C  CA    . CYS A 1 549  ? -3.323  43.822  -1.794  1.00 64.16  ? 577  CYS A CA    1 
ATOM   3572  C  C     . CYS A 1 549  ? -2.231  44.538  -1.008  1.00 56.18  ? 577  CYS A C     1 
ATOM   3573  O  O     . CYS A 1 549  ? -1.266  43.914  -0.572  1.00 75.45  ? 577  CYS A O     1 
ATOM   3574  C  CB    . CYS A 1 549  ? -4.446  43.391  -0.845  1.00 66.26  ? 577  CYS A CB    1 
ATOM   3575  S  SG    . CYS A 1 549  ? -6.028  43.041  -1.643  1.00 69.56  ? 577  CYS A SG    1 
ATOM   3576  N  N     . PRO A 1 550  ? -2.379  45.860  -0.830  1.00 71.14  ? 578  PRO A N     1 
ATOM   3577  C  CA    . PRO A 1 550  ? -1.451  46.636  -0.002  1.00 65.27  ? 578  PRO A CA    1 
ATOM   3578  C  C     . PRO A 1 550  ? -1.714  46.437  1.489   1.00 65.66  ? 578  PRO A C     1 
ATOM   3579  O  O     . PRO A 1 550  ? -2.858  46.214  1.885   1.00 56.46  ? 578  PRO A O     1 
ATOM   3580  C  CB    . PRO A 1 550  ? -1.736  48.078  -0.422  1.00 55.44  ? 578  PRO A CB    1 
ATOM   3581  C  CG    . PRO A 1 550  ? -3.162  48.059  -0.838  1.00 66.20  ? 578  PRO A CG    1 
ATOM   3582  C  CD    . PRO A 1 550  ? -3.379  46.720  -1.488  1.00 69.16  ? 578  PRO A CD    1 
ATOM   3583  N  N     . ARG A 1 551  ? -0.662  46.517  2.298   1.00 73.47  ? 579  ARG A N     1 
ATOM   3584  C  CA    . ARG A 1 551  ? -0.776  46.329  3.741   1.00 68.76  ? 579  ARG A CA    1 
ATOM   3585  C  C     . ARG A 1 551  ? -1.652  47.414  4.370   1.00 73.41  ? 579  ARG A C     1 
ATOM   3586  O  O     . ARG A 1 551  ? -1.694  48.544  3.885   1.00 71.50  ? 579  ARG A O     1 
ATOM   3587  C  CB    . ARG A 1 551  ? 0.614   46.322  4.382   1.00 68.98  ? 579  ARG A CB    1 
ATOM   3588  C  CG    . ARG A 1 551  ? 0.632   45.953  5.855   1.00 87.11  ? 579  ARG A CG    1 
ATOM   3589  C  CD    . ARG A 1 551  ? 0.086   44.555  6.084   1.00 92.79  ? 579  ARG A CD    1 
ATOM   3590  N  NE    . ARG A 1 551  ? 0.030   44.224  7.504   1.00 70.34  ? 579  ARG A NE    1 
ATOM   3591  C  CZ    . ARG A 1 551  ? 1.039   43.696  8.188   1.00 68.95  ? 579  ARG A CZ    1 
ATOM   3592  N  NH1   . ARG A 1 551  ? 2.189   43.437  7.582   1.00 70.51  ? 579  ARG A NH1   1 
ATOM   3593  N  NH2   . ARG A 1 551  ? 0.900   43.428  9.479   1.00 69.24  ? 579  ARG A NH2   1 
ATOM   3594  N  N     . LEU A 1 552  ? -2.351  47.062  5.445   1.00 72.65  ? 580  LEU A N     1 
ATOM   3595  C  CA    . LEU A 1 552  ? -3.260  47.991  6.112   1.00 73.59  ? 580  LEU A CA    1 
ATOM   3596  C  C     . LEU A 1 552  ? -2.506  49.148  6.764   1.00 77.17  ? 580  LEU A C     1 
ATOM   3597  O  O     . LEU A 1 552  ? -2.939  50.298  6.690   1.00 74.62  ? 580  LEU A O     1 
ATOM   3598  C  CB    . LEU A 1 552  ? -4.103  47.249  7.156   1.00 73.82  ? 580  LEU A CB    1 
ATOM   3599  C  CG    . LEU A 1 552  ? -5.326  47.953  7.760   1.00 71.23  ? 580  LEU A CG    1 
ATOM   3600  C  CD1   . LEU A 1 552  ? -4.962  48.786  8.986   1.00 74.11  ? 580  LEU A CD1   1 
ATOM   3601  C  CD2   . LEU A 1 552  ? -6.026  48.812  6.714   1.00 71.09  ? 580  LEU A CD2   1 
ATOM   3602  N  N     . ASP A 1 553  ? -1.381  48.842  7.403   1.00 77.05  ? 581  ASP A N     1 
ATOM   3603  C  CA    . ASP A 1 553  ? -0.596  49.866  8.085   1.00 72.49  ? 581  ASP A CA    1 
ATOM   3604  C  C     . ASP A 1 553  ? 0.398   50.538  7.140   1.00 76.86  ? 581  ASP A C     1 
ATOM   3605  O  O     . ASP A 1 553  ? 1.455   51.004  7.566   1.00 74.28  ? 581  ASP A O     1 
ATOM   3606  C  CB    . ASP A 1 553  ? 0.137   49.267  9.292   1.00 84.89  ? 581  ASP A CB    1 
ATOM   3607  C  CG    . ASP A 1 553  ? 0.954   48.035  8.937   1.00 85.30  ? 581  ASP A CG    1 
ATOM   3608  O  OD1   . ASP A 1 553  ? 0.801   47.006  9.628   1.00 92.40  ? 581  ASP A OD1   1 
ATOM   3609  O  OD2   . ASP A 1 553  ? 1.762   48.094  7.986   1.00 85.48  ? 581  ASP A OD2   1 
ATOM   3610  N  N     . ASP A 1 554  ? 0.051   50.586  5.858   1.00 68.18  ? 582  ASP A N     1 
ATOM   3611  C  CA    . ASP A 1 554  ? 0.897   51.223  4.859   1.00 72.98  ? 582  ASP A CA    1 
ATOM   3612  C  C     . ASP A 1 554  ? 0.402   52.634  4.558   1.00 76.04  ? 582  ASP A C     1 
ATOM   3613  O  O     . ASP A 1 554  ? -0.786  52.837  4.308   1.00 75.04  ? 582  ASP A O     1 
ATOM   3614  C  CB    . ASP A 1 554  ? 0.937   50.390  3.577   1.00 68.95  ? 582  ASP A CB    1 
ATOM   3615  C  CG    . ASP A 1 554  ? 1.950   50.908  2.576   1.00 77.83  ? 582  ASP A CG    1 
ATOM   3616  O  OD1   . ASP A 1 554  ? 3.085   50.388  2.558   1.00 76.18  ? 582  ASP A OD1   1 
ATOM   3617  O  OD2   . ASP A 1 554  ? 1.614   51.834  1.809   1.00 73.42  ? 582  ASP A OD2   1 
ATOM   3618  N  N     . PRO A 1 555  ? 1.316   53.616  4.587   1.00 70.47  ? 583  PRO A N     1 
ATOM   3619  C  CA    . PRO A 1 555  ? 0.992   55.026  4.337   1.00 77.86  ? 583  PRO A CA    1 
ATOM   3620  C  C     . PRO A 1 555  ? 0.384   55.269  2.956   1.00 68.28  ? 583  PRO A C     1 
ATOM   3621  O  O     . PRO A 1 555  ? -0.366  56.229  2.780   1.00 70.07  ? 583  PRO A O     1 
ATOM   3622  C  CB    . PRO A 1 555  ? 2.351   55.723  4.459   1.00 77.64  ? 583  PRO A CB    1 
ATOM   3623  C  CG    . PRO A 1 555  ? 3.161   54.820  5.324   1.00 75.24  ? 583  PRO A CG    1 
ATOM   3624  C  CD    . PRO A 1 555  ? 2.730   53.434  4.955   1.00 74.35  ? 583  PRO A CD    1 
ATOM   3625  N  N     . ALA A 1 556  ? 0.704   54.409  1.994   1.00 69.56  ? 584  ALA A N     1 
ATOM   3626  C  CA    . ALA A 1 556  ? 0.190   54.557  0.636   1.00 49.54  ? 584  ALA A CA    1 
ATOM   3627  C  C     . ALA A 1 556  ? -0.896  53.529  0.336   1.00 55.22  ? 584  ALA A C     1 
ATOM   3628  O  O     . ALA A 1 556  ? -0.940  52.960  -0.755  1.00 48.38  ? 584  ALA A O     1 
ATOM   3629  C  CB    . ALA A 1 556  ? 1.323   54.439  -0.372  1.00 49.76  ? 584  ALA A CB    1 
ATOM   3630  N  N     . TRP A 1 557  ? -1.776  53.301  1.307   1.00 66.52  ? 585  TRP A N     1 
ATOM   3631  C  CA    . TRP A 1 557  ? -2.825  52.295  1.170   1.00 66.31  ? 585  TRP A CA    1 
ATOM   3632  C  C     . TRP A 1 557  ? -3.922  52.732  0.207   1.00 66.56  ? 585  TRP A C     1 
ATOM   3633  O  O     . TRP A 1 557  ? -4.496  53.813  0.346   1.00 66.20  ? 585  TRP A O     1 
ATOM   3634  C  CB    . TRP A 1 557  ? -3.437  51.970  2.536   1.00 70.37  ? 585  TRP A CB    1 
ATOM   3635  C  CG    . TRP A 1 557  ? -4.483  50.891  2.491   1.00 77.28  ? 585  TRP A CG    1 
ATOM   3636  C  CD1   . TRP A 1 557  ? -4.277  49.545  2.588   1.00 69.79  ? 585  TRP A CD1   1 
ATOM   3637  C  CD2   . TRP A 1 557  ? -5.898  51.068  2.344   1.00 68.72  ? 585  TRP A CD2   1 
ATOM   3638  N  NE1   . TRP A 1 557  ? -5.473  48.874  2.508   1.00 69.57  ? 585  TRP A NE1   1 
ATOM   3639  C  CE2   . TRP A 1 557  ? -6.484  49.787  2.358   1.00 69.48  ? 585  TRP A CE2   1 
ATOM   3640  C  CE3   . TRP A 1 557  ? -6.725  52.186  2.200   1.00 66.09  ? 585  TRP A CE3   1 
ATOM   3641  C  CZ2   . TRP A 1 557  ? -7.858  49.593  2.233   1.00 65.58  ? 585  TRP A CZ2   1 
ATOM   3642  C  CZ3   . TRP A 1 557  ? -8.090  51.991  2.076   1.00 55.91  ? 585  TRP A CZ3   1 
ATOM   3643  C  CH2   . TRP A 1 557  ? -8.642  50.705  2.095   1.00 65.48  ? 585  TRP A CH2   1 
ATOM   3644  N  N     . THR A 1 558  ? -4.205  51.880  -0.772  1.00 65.40  ? 586  THR A N     1 
ATOM   3645  C  CA    . THR A 1 558  ? -5.298  52.109  -1.707  1.00 48.75  ? 586  THR A CA    1 
ATOM   3646  C  C     . THR A 1 558  ? -6.321  50.984  -1.578  1.00 67.16  ? 586  THR A C     1 
ATOM   3647  O  O     . THR A 1 558  ? -5.951  49.827  -1.372  1.00 70.43  ? 586  THR A O     1 
ATOM   3648  C  CB    . THR A 1 558  ? -4.791  52.200  -3.159  1.00 67.96  ? 586  THR A CB    1 
ATOM   3649  O  OG1   . THR A 1 558  ? -3.966  51.066  -3.451  1.00 68.09  ? 586  THR A OG1   1 
ATOM   3650  C  CG2   . THR A 1 558  ? -3.978  53.468  -3.353  1.00 44.05  ? 586  THR A CG2   1 
ATOM   3651  N  N     . PRO A 1 559  ? -7.615  51.320  -1.693  1.00 67.28  ? 587  PRO A N     1 
ATOM   3652  C  CA    . PRO A 1 559  ? -8.682  50.340  -1.465  1.00 47.08  ? 587  PRO A CA    1 
ATOM   3653  C  C     . PRO A 1 559  ? -8.680  49.217  -2.495  1.00 49.16  ? 587  PRO A C     1 
ATOM   3654  O  O     . PRO A 1 559  ? -8.216  49.408  -3.620  1.00 44.08  ? 587  PRO A O     1 
ATOM   3655  C  CB    . PRO A 1 559  ? -9.957  51.180  -1.578  1.00 60.74  ? 587  PRO A CB    1 
ATOM   3656  C  CG    . PRO A 1 559  ? -9.578  52.310  -2.464  1.00 56.33  ? 587  PRO A CG    1 
ATOM   3657  C  CD    . PRO A 1 559  ? -8.151  52.623  -2.122  1.00 72.27  ? 587  PRO A CD    1 
ATOM   3658  N  N     . GLY A 1 560  ? -9.194  48.056  -2.101  1.00 64.99  ? 588  GLY A N     1 
ATOM   3659  C  CA    . GLY A 1 560  ? -9.272  46.912  -2.989  1.00 55.75  ? 588  GLY A CA    1 
ATOM   3660  C  C     . GLY A 1 560  ? -7.912  46.328  -3.313  1.00 69.45  ? 588  GLY A C     1 
ATOM   3661  O  O     . GLY A 1 560  ? -6.912  46.690  -2.691  1.00 60.68  ? 588  GLY A O     1 
ATOM   3662  N  N     . PRO A 1 561  ? -7.867  45.414  -4.292  1.00 73.58  ? 589  PRO A N     1 
ATOM   3663  C  CA    . PRO A 1 561  ? -6.611  44.791  -4.716  1.00 49.01  ? 589  PRO A CA    1 
ATOM   3664  C  C     . PRO A 1 561  ? -5.783  45.716  -5.600  1.00 77.07  ? 589  PRO A C     1 
ATOM   3665  O  O     . PRO A 1 561  ? -6.125  45.941  -6.760  1.00 74.07  ? 589  PRO A O     1 
ATOM   3666  C  CB    . PRO A 1 561  ? -7.079  43.557  -5.492  1.00 49.88  ? 589  PRO A CB    1 
ATOM   3667  C  CG    . PRO A 1 561  ? -8.411  43.940  -6.029  1.00 74.35  ? 589  PRO A CG    1 
ATOM   3668  C  CD    . PRO A 1 561  ? -9.027  44.888  -5.032  1.00 73.63  ? 589  PRO A CD    1 
ATOM   3669  N  N     . SER A 1 562  ? -4.708  46.259  -5.042  1.00 72.32  ? 590  SER A N     1 
ATOM   3670  C  CA    . SER A 1 562  ? -3.797  47.097  -5.808  1.00 68.98  ? 590  SER A CA    1 
ATOM   3671  C  C     . SER A 1 562  ? -2.628  46.259  -6.301  1.00 72.65  ? 590  SER A C     1 
ATOM   3672  O  O     . SER A 1 562  ? -2.673  45.029  -6.238  1.00 71.84  ? 590  SER A O     1 
ATOM   3673  C  CB    . SER A 1 562  ? -3.300  48.270  -4.965  1.00 67.70  ? 590  SER A CB    1 
ATOM   3674  O  OG    . SER A 1 562  ? -4.381  49.078  -4.532  1.00 75.60  ? 590  SER A OG    1 
ATOM   3675  N  N     . LEU A 1 563  ? -1.589  46.928  -6.794  1.00 68.37  ? 591  LEU A N     1 
ATOM   3676  C  CA    . LEU A 1 563  ? -0.372  46.263  -7.250  1.00 66.38  ? 591  LEU A CA    1 
ATOM   3677  C  C     . LEU A 1 563  ? -0.642  45.292  -8.399  1.00 60.55  ? 591  LEU A C     1 
ATOM   3678  O  O     . LEU A 1 563  ? 0.028   44.267  -8.528  1.00 72.52  ? 591  LEU A O     1 
ATOM   3679  C  CB    . LEU A 1 563  ? 0.298   45.524  -6.086  1.00 67.76  ? 591  LEU A CB    1 
ATOM   3680  C  CG    . LEU A 1 563  ? 0.437   46.315  -4.784  1.00 56.90  ? 591  LEU A CG    1 
ATOM   3681  C  CD1   . LEU A 1 563  ? 0.845   45.405  -3.636  1.00 64.93  ? 591  LEU A CD1   1 
ATOM   3682  C  CD2   . LEU A 1 563  ? 1.435   47.451  -4.952  1.00 73.59  ? 591  LEU A CD2   1 
ATOM   3683  N  N     . LEU A 1 564  ? -1.626  45.621  -9.233  1.00 48.86  ? 592  LEU A N     1 
ATOM   3684  C  CA    . LEU A 1 564  ? -1.961  44.791  -10.387 1.00 69.84  ? 592  LEU A CA    1 
ATOM   3685  C  C     . LEU A 1 564  ? -1.008  45.079  -11.543 1.00 48.70  ? 592  LEU A C     1 
ATOM   3686  O  O     . LEU A 1 564  ? -0.578  46.216  -11.738 1.00 72.70  ? 592  LEU A O     1 
ATOM   3687  C  CB    . LEU A 1 564  ? -3.412  45.018  -10.823 1.00 76.85  ? 592  LEU A CB    1 
ATOM   3688  C  CG    . LEU A 1 564  ? -4.508  44.131  -10.215 1.00 66.88  ? 592  LEU A CG    1 
ATOM   3689  C  CD1   . LEU A 1 564  ? -4.427  42.712  -10.739 1.00 42.57  ? 592  LEU A CD1   1 
ATOM   3690  C  CD2   . LEU A 1 564  ? -4.461  44.130  -8.700  1.00 65.57  ? 592  LEU A CD2   1 
ATOM   3691  N  N     . SER A 1 565  ? -0.694  44.041  -12.310 1.00 49.87  ? 593  SER A N     1 
ATOM   3692  C  CA    . SER A 1 565  ? 0.362   44.106  -13.311 1.00 49.48  ? 593  SER A CA    1 
ATOM   3693  C  C     . SER A 1 565  ? 0.293   42.865  -14.217 1.00 71.40  ? 593  SER A C     1 
ATOM   3694  O  O     . SER A 1 565  ? -0.256  41.860  -13.779 1.00 74.12  ? 593  SER A O     1 
ATOM   3695  C  CB    . SER A 1 565  ? 1.723   44.208  -12.613 1.00 48.43  ? 593  SER A CB    1 
ATOM   3696  O  OG    . SER A 1 565  ? 1.889   45.471  -11.991 1.00 73.87  ? 593  SER A OG    1 
ATOM   3697  N  N     . LEU A 1 566  ? 0.793   42.879  -15.462 1.00 69.09  ? 594  LEU A N     1 
ATOM   3698  C  CA    . LEU A 1 566  ? 1.330   44.014  -16.237 1.00 73.76  ? 594  LEU A CA    1 
ATOM   3699  C  C     . LEU A 1 566  ? 2.487   44.798  -15.600 1.00 68.00  ? 594  LEU A C     1 
ATOM   3700  O  O     . LEU A 1 566  ? 2.322   45.967  -15.253 1.00 85.72  ? 594  LEU A O     1 
ATOM   3701  C  CB    . LEU A 1 566  ? 0.193   44.986  -16.585 1.00 75.32  ? 594  LEU A CB    1 
ATOM   3702  C  CG    . LEU A 1 566  ? -0.703  44.682  -17.793 1.00 71.45  ? 594  LEU A CG    1 
ATOM   3703  C  CD1   . LEU A 1 566  ? 0.120   44.616  -19.065 1.00 75.01  ? 594  LEU A CD1   1 
ATOM   3704  C  CD2   . LEU A 1 566  ? -1.509  43.404  -17.613 1.00 77.66  ? 594  LEU A CD2   1 
ATOM   3705  N  N     . GLN A 1 567  ? 3.652   44.168  -15.449 1.00 77.99  ? 595  GLN A N     1 
ATOM   3706  C  CA    . GLN A 1 567  ? 3.901   42.815  -15.938 1.00 69.70  ? 595  GLN A CA    1 
ATOM   3707  C  C     . GLN A 1 567  ? 4.090   41.808  -14.803 1.00 69.66  ? 595  GLN A C     1 
ATOM   3708  O  O     . GLN A 1 567  ? 5.206   41.361  -14.540 1.00 70.18  ? 595  GLN A O     1 
ATOM   3709  C  CB    . GLN A 1 567  ? 5.130   42.799  -16.850 1.00 77.20  ? 595  GLN A CB    1 
ATOM   3710  C  CG    . GLN A 1 567  ? 4.978   43.614  -18.126 1.00 71.31  ? 595  GLN A CG    1 
ATOM   3711  C  CD    . GLN A 1 567  ? 5.232   45.095  -17.919 1.00 77.85  ? 595  GLN A CD    1 
ATOM   3712  O  OE1   . GLN A 1 567  ? 4.791   45.927  -18.712 1.00 70.48  ? 595  GLN A OE1   1 
ATOM   3713  N  NE2   . GLN A 1 567  ? 5.953   45.430  -16.856 1.00 86.91  ? 595  GLN A NE2   1 
ATOM   3714  N  N     . MET A 1 568  ? 2.996   41.450  -14.139 1.00 75.36  ? 596  MET A N     1 
ATOM   3715  C  CA    . MET A 1 568  ? 3.019   40.428  -13.097 1.00 69.39  ? 596  MET A CA    1 
ATOM   3716  C  C     . MET A 1 568  ? 2.783   39.061  -13.734 1.00 72.86  ? 596  MET A C     1 
ATOM   3717  O  O     . MET A 1 568  ? 2.573   38.967  -14.943 1.00 70.07  ? 596  MET A O     1 
ATOM   3718  C  CB    . MET A 1 568  ? 1.965   40.722  -12.027 1.00 72.68  ? 596  MET A CB    1 
ATOM   3719  C  CG    . MET A 1 568  ? 2.358   40.360  -10.605 1.00 72.73  ? 596  MET A CG    1 
ATOM   3720  S  SD    . MET A 1 568  ? 1.399   41.287  -9.387  1.00 40.74  ? 596  MET A SD    1 
ATOM   3721  C  CE    . MET A 1 568  ? 1.814   40.410  -7.881  1.00 85.02  ? 596  MET A CE    1 
ATOM   3722  N  N     . ARG A 1 569  ? 2.813   38.007  -12.927 1.00 73.35  ? 597  ARG A N     1 
ATOM   3723  C  CA    . ARG A 1 569  ? 2.720   36.649  -13.456 1.00 73.62  ? 597  ARG A CA    1 
ATOM   3724  C  C     . ARG A 1 569  ? 1.410   35.951  -13.105 1.00 75.48  ? 597  ARG A C     1 
ATOM   3725  O  O     . ARG A 1 569  ? 1.065   34.930  -13.700 1.00 74.78  ? 597  ARG A O     1 
ATOM   3726  C  CB    . ARG A 1 569  ? 3.899   35.813  -12.959 1.00 75.32  ? 597  ARG A CB    1 
ATOM   3727  C  CG    . ARG A 1 569  ? 5.012   35.656  -13.981 1.00 75.94  ? 597  ARG A CG    1 
ATOM   3728  C  CD    . ARG A 1 569  ? 6.345   35.373  -13.314 1.00 72.67  ? 597  ARG A CD    1 
ATOM   3729  N  NE    . ARG A 1 569  ? 6.248   34.321  -12.307 1.00 76.24  ? 597  ARG A NE    1 
ATOM   3730  C  CZ    . ARG A 1 569  ? 7.278   33.874  -11.597 1.00 70.41  ? 597  ARG A CZ    1 
ATOM   3731  N  NH1   . ARG A 1 569  ? 8.487   34.384  -11.790 1.00 76.91  ? 597  ARG A NH1   1 
ATOM   3732  N  NH2   . ARG A 1 569  ? 7.103   32.915  -10.699 1.00 77.58  ? 597  ARG A NH2   1 
ATOM   3733  N  N     . VAL A 1 570  ? 0.682   36.503  -12.142 1.00 70.14  ? 598  VAL A N     1 
ATOM   3734  C  CA    . VAL A 1 570  ? -0.592  35.928  -11.729 1.00 65.68  ? 598  VAL A CA    1 
ATOM   3735  C  C     . VAL A 1 570  ? -1.724  36.395  -12.636 1.00 56.83  ? 598  VAL A C     1 
ATOM   3736  O  O     . VAL A 1 570  ? -2.512  35.591  -13.147 1.00 60.70  ? 598  VAL A O     1 
ATOM   3737  C  CB    . VAL A 1 570  ? -0.923  36.298  -10.273 1.00 55.82  ? 598  VAL A CB    1 
ATOM   3738  C  CG1   . VAL A 1 570  ? -2.345  35.882  -9.923  1.00 91.92  ? 598  VAL A CG1   1 
ATOM   3739  C  CG2   . VAL A 1 570  ? 0.083   35.661  -9.325  1.00 69.17  ? 598  VAL A CG2   1 
ATOM   3740  N  N     . THR A 1 571  ? -1.783  37.704  -12.847 1.00 60.31  ? 599  THR A N     1 
ATOM   3741  C  CA    . THR A 1 571  ? -2.867  38.315  -13.607 1.00 69.86  ? 599  THR A CA    1 
ATOM   3742  C  C     . THR A 1 571  ? -2.982  37.929  -15.100 1.00 71.98  ? 599  THR A C     1 
ATOM   3743  O  O     . THR A 1 571  ? -4.098  37.882  -15.617 1.00 73.41  ? 599  THR A O     1 
ATOM   3744  C  CB    . THR A 1 571  ? -2.784  39.847  -13.506 1.00 76.26  ? 599  THR A CB    1 
ATOM   3745  O  OG1   . THR A 1 571  ? -1.827  40.346  -14.447 1.00 72.28  ? 599  THR A OG1   1 
ATOM   3746  C  CG2   . THR A 1 571  ? -2.370  40.251  -12.096 1.00 76.53  ? 599  THR A CG2   1 
ATOM   3747  N  N     . PRO A 1 572  ? -1.856  37.663  -15.805 1.00 72.53  ? 600  PRO A N     1 
ATOM   3748  C  CA    . PRO A 1 572  ? -2.069  37.241  -17.198 1.00 70.79  ? 600  PRO A CA    1 
ATOM   3749  C  C     . PRO A 1 572  ? -2.687  35.852  -17.321 1.00 60.23  ? 600  PRO A C     1 
ATOM   3750  O  O     . PRO A 1 572  ? -3.482  35.606  -18.225 1.00 43.69  ? 600  PRO A O     1 
ATOM   3751  C  CB    . PRO A 1 572  ? -0.656  37.247  -17.784 1.00 76.72  ? 600  PRO A CB    1 
ATOM   3752  C  CG    . PRO A 1 572  ? 0.227   37.002  -16.621 1.00 75.27  ? 600  PRO A CG    1 
ATOM   3753  C  CD    . PRO A 1 572  ? -0.417  37.759  -15.494 1.00 69.94  ? 600  PRO A CD    1 
ATOM   3754  N  N     . LYS A 1 573  ? -2.312  34.950  -16.423 1.00 69.26  ? 601  LYS A N     1 
ATOM   3755  C  CA    . LYS A 1 573  ? -2.906  33.622  -16.401 1.00 69.87  ? 601  LYS A CA    1 
ATOM   3756  C  C     . LYS A 1 573  ? -4.317  33.714  -15.835 1.00 73.93  ? 601  LYS A C     1 
ATOM   3757  O  O     . LYS A 1 573  ? -5.164  32.857  -16.085 1.00 77.22  ? 601  LYS A O     1 
ATOM   3758  C  CB    . LYS A 1 573  ? -2.054  32.659  -15.573 1.00 90.66  ? 601  LYS A CB    1 
ATOM   3759  C  CG    . LYS A 1 573  ? -2.548  31.224  -15.584 1.00 90.11  ? 601  LYS A CG    1 
ATOM   3760  C  CD    . LYS A 1 573  ? -1.661  30.330  -14.743 1.00 91.32  ? 601  LYS A CD    1 
ATOM   3761  C  CE    . LYS A 1 573  ? -2.216  28.921  -14.684 1.00 81.69  ? 601  LYS A CE    1 
ATOM   3762  N  NZ    . LYS A 1 573  ? -1.304  28.006  -13.952 1.00 91.85  ? 601  LYS A NZ    1 
ATOM   3763  N  N     . LEU A 1 574  ? -4.560  34.778  -15.081 1.00 74.37  ? 602  LEU A N     1 
ATOM   3764  C  CA    . LEU A 1 574  ? -5.849  34.997  -14.437 1.00 70.41  ? 602  LEU A CA    1 
ATOM   3765  C  C     . LEU A 1 574  ? -6.995  35.250  -15.426 1.00 71.44  ? 602  LEU A C     1 
ATOM   3766  O  O     . LEU A 1 574  ? -8.160  35.032  -15.094 1.00 69.39  ? 602  LEU A O     1 
ATOM   3767  C  CB    . LEU A 1 574  ? -5.723  36.165  -13.449 1.00 69.93  ? 602  LEU A CB    1 
ATOM   3768  C  CG    . LEU A 1 574  ? -6.938  36.921  -12.911 1.00 47.55  ? 602  LEU A CG    1 
ATOM   3769  C  CD1   . LEU A 1 574  ? -6.686  37.359  -11.481 1.00 86.71  ? 602  LEU A CD1   1 
ATOM   3770  C  CD2   . LEU A 1 574  ? -7.228  38.129  -13.782 1.00 85.17  ? 602  LEU A CD2   1 
ATOM   3771  N  N     . MET A 1 575  ? -6.674  35.687  -16.641 1.00 66.10  ? 603  MET A N     1 
ATOM   3772  C  CA    . MET A 1 575  ? -7.720  36.118  -17.569 1.00 69.46  ? 603  MET A CA    1 
ATOM   3773  C  C     . MET A 1 575  ? -7.579  35.617  -19.011 1.00 76.11  ? 603  MET A C     1 
ATOM   3774  O  O     . MET A 1 575  ? -8.577  35.468  -19.715 1.00 72.54  ? 603  MET A O     1 
ATOM   3775  C  CB    . MET A 1 575  ? -7.786  37.648  -17.588 1.00 90.51  ? 603  MET A CB    1 
ATOM   3776  C  CG    . MET A 1 575  ? -6.472  38.315  -17.971 1.00 91.42  ? 603  MET A CG    1 
ATOM   3777  S  SD    . MET A 1 575  ? -6.628  40.082  -18.301 1.00 56.26  ? 603  MET A SD    1 
ATOM   3778  C  CE    . MET A 1 575  ? -7.663  40.065  -19.762 1.00 71.36  ? 603  MET A CE    1 
ATOM   3779  N  N     . ALA A 1 576  ? -6.352  35.360  -19.451 1.00 71.34  ? 604  ALA A N     1 
ATOM   3780  C  CA    . ALA A 1 576  ? -6.089  35.158  -20.876 1.00 75.58  ? 604  ALA A CA    1 
ATOM   3781  C  C     . ALA A 1 576  ? -6.275  33.721  -21.360 1.00 73.28  ? 604  ALA A C     1 
ATOM   3782  O  O     . ALA A 1 576  ? -5.970  32.764  -20.647 1.00 73.34  ? 604  ALA A O     1 
ATOM   3783  C  CB    . ALA A 1 576  ? -4.680  35.631  -21.210 1.00 74.67  ? 604  ALA A CB    1 
ATOM   3784  N  N     . LEU A 1 577  ? -6.780  33.588  -22.585 1.00 68.57  ? 605  LEU A N     1 
ATOM   3785  C  CA    . LEU A 1 577  ? -6.788  32.312  -23.294 1.00 90.08  ? 605  LEU A CA    1 
ATOM   3786  C  C     . LEU A 1 577  ? -5.423  32.116  -23.944 1.00 69.84  ? 605  LEU A C     1 
ATOM   3787  O  O     . LEU A 1 577  ? -4.731  33.088  -24.247 1.00 70.79  ? 605  LEU A O     1 
ATOM   3788  C  CB    . LEU A 1 577  ? -7.906  32.259  -24.340 1.00 69.86  ? 605  LEU A CB    1 
ATOM   3789  C  CG    . LEU A 1 577  ? -9.283  31.744  -23.902 1.00 76.68  ? 605  LEU A CG    1 
ATOM   3790  C  CD1   . LEU A 1 577  ? -9.867  32.580  -22.772 1.00 68.32  ? 605  LEU A CD1   1 
ATOM   3791  C  CD2   . LEU A 1 577  ? -10.240 31.703  -25.086 1.00 72.60  ? 605  LEU A CD2   1 
ATOM   3792  N  N     . THR A 1 578  ? -5.035  30.864  -24.163 1.00 68.60  ? 606  THR A N     1 
ATOM   3793  C  CA    . THR A 1 578  ? -3.637  30.557  -24.454 1.00 90.19  ? 606  THR A CA    1 
ATOM   3794  C  C     . THR A 1 578  ? -3.376  29.825  -25.767 1.00 77.80  ? 606  THR A C     1 
ATOM   3795  O  O     . THR A 1 578  ? -3.330  28.594  -25.789 1.00 81.88  ? 606  THR A O     1 
ATOM   3796  C  CB    . THR A 1 578  ? -3.032  29.704  -23.326 1.00 92.08  ? 606  THR A CB    1 
ATOM   3797  O  OG1   . THR A 1 578  ? -3.475  28.347  -23.457 1.00 85.19  ? 606  THR A OG1   1 
ATOM   3798  C  CG2   . THR A 1 578  ? -3.459  30.241  -21.971 1.00 81.80  ? 606  THR A CG2   1 
ATOM   3799  N  N     . TRP A 1 579  ? -3.187  30.587  -26.843 1.00 71.31  ? 607  TRP A N     1 
ATOM   3800  C  CA    . TRP A 1 579  ? -2.710  30.051  -28.122 1.00 70.85  ? 607  TRP A CA    1 
ATOM   3801  C  C     . TRP A 1 579  ? -3.452  28.804  -28.594 1.00 75.80  ? 607  TRP A C     1 
ATOM   3802  O  O     . TRP A 1 579  ? -2.862  27.727  -28.677 1.00 72.93  ? 607  TRP A O     1 
ATOM   3803  C  CB    . TRP A 1 579  ? -1.214  29.732  -28.029 1.00 76.42  ? 607  TRP A CB    1 
ATOM   3804  C  CG    . TRP A 1 579  ? -0.326  30.918  -28.229 1.00 66.72  ? 607  TRP A CG    1 
ATOM   3805  C  CD1   . TRP A 1 579  ? -0.159  31.970  -27.377 1.00 76.51  ? 607  TRP A CD1   1 
ATOM   3806  C  CD2   . TRP A 1 579  ? 0.530   31.171  -29.351 1.00 69.51  ? 607  TRP A CD2   1 
ATOM   3807  N  NE1   . TRP A 1 579  ? 0.741   32.866  -27.901 1.00 68.51  ? 607  TRP A NE1   1 
ATOM   3808  C  CE2   . TRP A 1 579  ? 1.180   32.398  -29.112 1.00 67.06  ? 607  TRP A CE2   1 
ATOM   3809  C  CE3   . TRP A 1 579  ? 0.808   30.480  -30.534 1.00 66.79  ? 607  TRP A CE3   1 
ATOM   3810  C  CZ2   . TRP A 1 579  ? 2.089   32.950  -30.012 1.00 71.91  ? 607  TRP A CZ2   1 
ATOM   3811  C  CZ3   . TRP A 1 579  ? 1.712   31.030  -31.427 1.00 74.30  ? 607  TRP A CZ3   1 
ATOM   3812  C  CH2   . TRP A 1 579  ? 2.342   32.252  -31.160 1.00 69.28  ? 607  TRP A CH2   1 
ATOM   3813  N  N     . ASP A 1 580  ? -4.739  28.954  -28.896 1.00 71.84  ? 608  ASP A N     1 
ATOM   3814  C  CA    . ASP A 1 580  ? -5.593  27.836  -29.301 1.00 90.13  ? 608  ASP A CA    1 
ATOM   3815  C  C     . ASP A 1 580  ? -5.604  26.733  -28.242 1.00 75.00  ? 608  ASP A C     1 
ATOM   3816  O  O     . ASP A 1 580  ? -5.809  25.560  -28.553 1.00 92.17  ? 608  ASP A O     1 
ATOM   3817  C  CB    . ASP A 1 580  ? -5.141  27.270  -30.651 1.00 85.77  ? 608  ASP A CB    1 
ATOM   3818  C  CG    . ASP A 1 580  ? -4.945  28.349  -31.698 1.00 86.03  ? 608  ASP A CG    1 
ATOM   3819  O  OD1   . ASP A 1 580  ? -5.699  29.345  -31.674 1.00 90.23  ? 608  ASP A OD1   1 
ATOM   3820  O  OD2   . ASP A 1 580  ? -4.037  28.203  -32.543 1.00 91.20  ? 608  ASP A OD2   1 
ATOM   3821  N  N     . GLY A 1 581  ? -5.375  27.125  -26.993 1.00 69.73  ? 609  GLY A N     1 
ATOM   3822  C  CA    . GLY A 1 581  ? -5.386  26.207  -25.869 1.00 73.37  ? 609  GLY A CA    1 
ATOM   3823  C  C     . GLY A 1 581  ? -6.029  26.661  -24.574 1.00 69.80  ? 609  GLY A C     1 
ATOM   3824  O  O     . GLY A 1 581  ? -6.401  27.827  -24.441 1.00 70.49  ? 609  GLY A O     1 
ATOM   3825  N  N     . PHE A 1 582  ? -6.156  25.753  -23.614 1.00 76.10  ? 610  PHE A N     1 
ATOM   3826  C  CA    . PHE A 1 582  ? -6.579  26.053  -22.272 1.00 68.50  ? 610  PHE A CA    1 
ATOM   3827  C  C     . PHE A 1 582  ? -5.757  26.870  -21.191 1.00 92.70  ? 610  PHE A C     1 
ATOM   3828  O  O     . PHE A 1 582  ? -5.860  28.081  -21.020 1.00 84.24  ? 610  PHE A O     1 
ATOM   3829  C  CB    . PHE A 1 582  ? -7.089  24.719  -21.725 1.00 20.00  ? 610  PHE A CB    1 
ATOM   3830  C  CG    . PHE A 1 582  ? -6.001  23.718  -21.458 1.00 20.00  ? 610  PHE A CG    1 
ATOM   3831  C  CD1   . PHE A 1 582  ? -5.353  23.688  -20.235 1.00 20.00  ? 610  PHE A CD1   1 
ATOM   3832  C  CD2   . PHE A 1 582  ? -5.627  22.806  -22.431 1.00 20.00  ? 610  PHE A CD2   1 
ATOM   3833  C  CE1   . PHE A 1 582  ? -4.354  22.766  -19.986 1.00 20.00  ? 610  PHE A CE1   1 
ATOM   3834  C  CE2   . PHE A 1 582  ? -4.627  21.884  -22.188 1.00 20.00  ? 610  PHE A CE2   1 
ATOM   3835  C  CZ    . PHE A 1 582  ? -3.989  21.863  -20.964 1.00 20.00  ? 610  PHE A CZ    1 
ATOM   3836  N  N     . PRO A 1 583  ? -4.742  26.161  -20.661 1.00 71.79  ? 611  PRO A N     1 
ATOM   3837  C  CA    . PRO A 1 583  ? -3.885  26.915  -19.745 1.00 91.90  ? 611  PRO A CA    1 
ATOM   3838  C  C     . PRO A 1 583  ? -2.521  27.498  -20.111 1.00 91.03  ? 611  PRO A C     1 
ATOM   3839  O  O     . PRO A 1 583  ? -1.829  26.998  -20.997 1.00 81.24  ? 611  PRO A O     1 
ATOM   3840  C  CB    . PRO A 1 583  ? -3.704  25.654  -18.897 1.00 74.36  ? 611  PRO A CB    1 
ATOM   3841  C  CG    . PRO A 1 583  ? -3.784  24.498  -19.902 1.00 73.31  ? 611  PRO A CG    1 
ATOM   3842  C  CD    . PRO A 1 583  ? -4.301  25.046  -21.219 1.00 76.94  ? 611  PRO A CD    1 
ATOM   3843  N  N     . LEU A 1 584  ? -2.151  28.567  -19.416 1.00 77.15  ? 612  LEU A N     1 
ATOM   3844  C  CA    . LEU A 1 584  ? -0.789  29.076  -19.449 1.00 64.77  ? 612  LEU A CA    1 
ATOM   3845  C  C     . LEU A 1 584  ? -0.070  28.515  -18.230 1.00 74.56  ? 612  LEU A C     1 
ATOM   3846  O  O     . LEU A 1 584  ? -0.717  28.011  -17.313 1.00 72.23  ? 612  LEU A O     1 
ATOM   3847  C  CB    . LEU A 1 584  ? -0.774  30.606  -19.447 1.00 64.92  ? 612  LEU A CB    1 
ATOM   3848  C  CG    . LEU A 1 584  ? -0.069  31.317  -20.605 1.00 67.68  ? 612  LEU A CG    1 
ATOM   3849  C  CD1   . LEU A 1 584  ? 0.195   30.367  -21.762 1.00 75.57  ? 612  LEU A CD1   1 
ATOM   3850  C  CD2   . LEU A 1 584  ? -0.892  32.507  -21.072 1.00 49.57  ? 612  LEU A CD2   1 
ATOM   3851  N  N     . HIS A 1 585  ? 1.256   28.586  -18.212 1.00 56.36  ? 613  HIS A N     1 
ATOM   3852  C  CA    . HIS A 1 585  ? 2.004   28.068  -17.072 1.00 56.90  ? 613  HIS A CA    1 
ATOM   3853  C  C     . HIS A 1 585  ? 3.401   28.666  -16.980 1.00 55.08  ? 613  HIS A C     1 
ATOM   3854  O  O     . HIS A 1 585  ? 3.872   29.317  -17.911 1.00 42.75  ? 613  HIS A O     1 
ATOM   3855  C  CB    . HIS A 1 585  ? 2.098   26.542  -17.143 1.00 49.64  ? 613  HIS A CB    1 
ATOM   3856  C  CG    . HIS A 1 585  ? 1.595   25.850  -15.915 1.00 56.28  ? 613  HIS A CG    1 
ATOM   3857  N  ND1   . HIS A 1 585  ? 0.279   25.914  -15.511 1.00 70.26  ? 613  HIS A ND1   1 
ATOM   3858  C  CD2   . HIS A 1 585  ? 2.232   25.082  -15.001 1.00 71.90  ? 613  HIS A CD2   1 
ATOM   3859  C  CE1   . HIS A 1 585  ? 0.127   25.213  -14.402 1.00 75.29  ? 613  HIS A CE1   1 
ATOM   3860  N  NE2   . HIS A 1 585  ? 1.297   24.698  -14.071 1.00 68.74  ? 613  HIS A NE2   1 
ATOM   3861  N  N     . TYR A 1 586  ? 4.059   28.435  -15.848 1.00 70.78  ? 614  TYR A N     1 
ATOM   3862  C  CA    . TYR A 1 586  ? 5.410   28.938  -15.633 1.00 74.27  ? 614  TYR A CA    1 
ATOM   3863  C  C     . TYR A 1 586  ? 6.220   27.995  -14.742 1.00 70.65  ? 614  TYR A C     1 
ATOM   3864  O  O     . TYR A 1 586  ? 5.680   27.370  -13.827 1.00 74.89  ? 614  TYR A O     1 
ATOM   3865  C  CB    . TYR A 1 586  ? 5.368   30.341  -15.017 1.00 72.66  ? 614  TYR A CB    1 
ATOM   3866  C  CG    . TYR A 1 586  ? 6.722   31.017  -14.939 1.00 75.57  ? 614  TYR A CG    1 
ATOM   3867  C  CD1   . TYR A 1 586  ? 7.285   31.613  -16.059 1.00 68.86  ? 614  TYR A CD1   1 
ATOM   3868  C  CD2   . TYR A 1 586  ? 7.433   31.062  -13.748 1.00 74.59  ? 614  TYR A CD2   1 
ATOM   3869  C  CE1   . TYR A 1 586  ? 8.520   32.231  -15.999 1.00 70.34  ? 614  TYR A CE1   1 
ATOM   3870  C  CE2   . TYR A 1 586  ? 8.673   31.678  -13.676 1.00 77.29  ? 614  TYR A CE2   1 
ATOM   3871  C  CZ    . TYR A 1 586  ? 9.210   32.262  -14.806 1.00 70.24  ? 614  TYR A CZ    1 
ATOM   3872  O  OH    . TYR A 1 586  ? 10.439  32.879  -14.750 1.00 75.06  ? 614  TYR A OH    1 
ATOM   3873  N  N     . SER A 1 587  ? 7.516   27.897  -15.023 1.00 76.69  ? 615  SER A N     1 
ATOM   3874  C  CA    . SER A 1 587  ? 8.428   27.077  -14.233 1.00 72.54  ? 615  SER A CA    1 
ATOM   3875  C  C     . SER A 1 587  ? 9.859   27.548  -14.453 1.00 72.72  ? 615  SER A C     1 
ATOM   3876  O  O     . SER A 1 587  ? 10.509  28.054  -13.537 1.00 71.15  ? 615  SER A O     1 
ATOM   3877  C  CB    . SER A 1 587  ? 8.289   25.598  -14.600 1.00 72.20  ? 615  SER A CB    1 
ATOM   3878  O  OG    . SER A 1 587  ? 9.192   24.800  -13.856 1.00 73.47  ? 615  SER A OG    1 
ATOM   3879  N  N     . GLU A 1 588  ? 10.340  27.364  -15.678 1.00 92.44  ? 616  GLU A N     1 
ATOM   3880  C  CA    . GLU A 1 588  ? 11.631  27.891  -16.099 1.00 85.32  ? 616  GLU A CA    1 
ATOM   3881  C  C     . GLU A 1 588  ? 11.388  28.918  -17.191 1.00 91.11  ? 616  GLU A C     1 
ATOM   3882  O  O     . GLU A 1 588  ? 12.262  29.718  -17.528 1.00 68.01  ? 616  GLU A O     1 
ATOM   3883  C  CB    . GLU A 1 588  ? 12.545  26.775  -16.607 1.00 90.60  ? 616  GLU A CB    1 
ATOM   3884  C  CG    . GLU A 1 588  ? 12.208  25.396  -16.069 1.00 84.53  ? 616  GLU A CG    1 
ATOM   3885  C  CD    . GLU A 1 588  ? 12.413  25.281  -14.573 1.00 87.34  ? 616  GLU A CD    1 
ATOM   3886  O  OE1   . GLU A 1 588  ? 11.778  24.401  -13.955 1.00 75.01  ? 616  GLU A OE1   1 
ATOM   3887  O  OE2   . GLU A 1 588  ? 13.210  26.065  -14.016 1.00 70.11  ? 616  GLU A OE2   1 
ATOM   3888  N  N     . ARG A 1 589  ? 10.181  28.875  -17.742 1.00 85.65  ? 617  ARG A N     1 
ATOM   3889  C  CA    . ARG A 1 589  ? 9.769   29.785  -18.798 1.00 68.87  ? 617  ARG A CA    1 
ATOM   3890  C  C     . ARG A 1 589  ? 8.250   29.784  -18.891 1.00 70.57  ? 617  ARG A C     1 
ATOM   3891  O  O     . ARG A 1 589  ? 7.603   28.784  -18.579 1.00 73.46  ? 617  ARG A O     1 
ATOM   3892  C  CB    . ARG A 1 589  ? 10.394  29.391  -20.142 1.00 70.04  ? 617  ARG A CB    1 
ATOM   3893  C  CG    . ARG A 1 589  ? 10.136  27.951  -20.564 1.00 73.11  ? 617  ARG A CG    1 
ATOM   3894  C  CD    . ARG A 1 589  ? 11.226  27.012  -20.069 1.00 75.79  ? 617  ARG A CD    1 
ATOM   3895  N  NE    . ARG A 1 589  ? 10.806  25.615  -20.120 1.00 73.73  ? 617  ARG A NE    1 
ATOM   3896  C  CZ    . ARG A 1 589  ? 10.068  25.027  -19.183 1.00 91.23  ? 617  ARG A CZ    1 
ATOM   3897  N  NH1   . ARG A 1 589  ? 9.665   25.715  -18.123 1.00 85.24  ? 617  ARG A NH1   1 
ATOM   3898  N  NH2   . ARG A 1 589  ? 9.728   23.751  -19.308 1.00 87.56  ? 617  ARG A NH2   1 
ATOM   3899  N  N     . HIS A 1 590  ? 7.681   30.907  -19.317 1.00 68.51  ? 618  HIS A N     1 
ATOM   3900  C  CA    . HIS A 1 590  ? 6.232   31.028  -19.418 1.00 65.06  ? 618  HIS A CA    1 
ATOM   3901  C  C     . HIS A 1 590  ? 5.711   30.286  -20.647 1.00 66.23  ? 618  HIS A C     1 
ATOM   3902  O  O     . HIS A 1 590  ? 6.412   29.451  -21.217 1.00 48.46  ? 618  HIS A O     1 
ATOM   3903  C  CB    . HIS A 1 590  ? 5.818   32.500  -19.468 1.00 66.32  ? 618  HIS A CB    1 
ATOM   3904  C  CG    . HIS A 1 590  ? 4.583   32.804  -18.679 1.00 74.89  ? 618  HIS A CG    1 
ATOM   3905  N  ND1   . HIS A 1 590  ? 4.566   32.820  -17.301 1.00 69.81  ? 618  HIS A ND1   1 
ATOM   3906  C  CD2   . HIS A 1 590  ? 3.322   33.099  -19.074 1.00 69.52  ? 618  HIS A CD2   1 
ATOM   3907  C  CE1   . HIS A 1 590  ? 3.349   33.115  -16.881 1.00 64.68  ? 618  HIS A CE1   1 
ATOM   3908  N  NE2   . HIS A 1 590  ? 2.575   33.289  -17.937 1.00 64.71  ? 618  HIS A NE2   1 
ATOM   3909  N  N     . GLY A 1 591  ? 4.478   30.588  -21.044 1.00 60.68  ? 619  GLY A N     1 
ATOM   3910  C  CA    . GLY A 1 591  ? 3.883   29.974  -22.218 1.00 68.20  ? 619  GLY A CA    1 
ATOM   3911  C  C     . GLY A 1 591  ? 4.719   30.227  -23.457 1.00 76.84  ? 619  GLY A C     1 
ATOM   3912  O  O     . GLY A 1 591  ? 4.896   31.374  -23.868 1.00 70.61  ? 619  GLY A O     1 
ATOM   3913  N  N     . TRP A 1 592  ? 5.236   29.151  -24.044 1.00 75.89  ? 620  TRP A N     1 
ATOM   3914  C  CA    . TRP A 1 592  ? 6.164   29.241  -25.170 1.00 74.86  ? 620  TRP A CA    1 
ATOM   3915  C  C     . TRP A 1 592  ? 5.620   30.051  -26.345 1.00 75.54  ? 620  TRP A C     1 
ATOM   3916  O  O     . TRP A 1 592  ? 4.433   29.989  -26.663 1.00 73.58  ? 620  TRP A O     1 
ATOM   3917  C  CB    . TRP A 1 592  ? 6.548   27.837  -25.644 1.00 69.96  ? 620  TRP A CB    1 
ATOM   3918  C  CG    . TRP A 1 592  ? 5.437   26.833  -25.551 1.00 68.95  ? 620  TRP A CG    1 
ATOM   3919  C  CD1   . TRP A 1 592  ? 4.409   26.661  -26.432 1.00 68.56  ? 620  TRP A CD1   1 
ATOM   3920  C  CD2   . TRP A 1 592  ? 5.253   25.850  -24.524 1.00 76.78  ? 620  TRP A CD2   1 
ATOM   3921  N  NE1   . TRP A 1 592  ? 3.593   25.637  -26.013 1.00 91.73  ? 620  TRP A NE1   1 
ATOM   3922  C  CE2   . TRP A 1 592  ? 4.090   25.123  -24.845 1.00 86.83  ? 620  TRP A CE2   1 
ATOM   3923  C  CE3   . TRP A 1 592  ? 5.958   25.518  -23.362 1.00 73.30  ? 620  TRP A CE3   1 
ATOM   3924  C  CZ2   . TRP A 1 592  ? 3.616   24.083  -24.047 1.00 69.09  ? 620  TRP A CZ2   1 
ATOM   3925  C  CZ3   . TRP A 1 592  ? 5.485   24.485  -22.572 1.00 69.50  ? 620  TRP A CZ3   1 
ATOM   3926  C  CH2   . TRP A 1 592  ? 4.326   23.780  -22.917 1.00 70.21  ? 620  TRP A CH2   1 
ATOM   3927  N  N     . GLY A 1 593  ? 6.503   30.815  -26.980 1.00 64.45  ? 621  GLY A N     1 
ATOM   3928  C  CA    . GLY A 1 593  ? 6.130   31.645  -28.111 1.00 43.48  ? 621  GLY A CA    1 
ATOM   3929  C  C     . GLY A 1 593  ? 7.338   32.106  -28.904 1.00 71.89  ? 621  GLY A C     1 
ATOM   3930  O  O     . GLY A 1 593  ? 8.135   31.289  -29.366 1.00 69.77  ? 621  GLY A O     1 
ATOM   3931  N  N     . TYR A 1 594  ? 7.475   33.419  -29.060 1.00 70.13  ? 622  TYR A N     1 
ATOM   3932  C  CA    . TYR A 1 594  ? 8.584   33.989  -29.820 1.00 77.76  ? 622  TYR A CA    1 
ATOM   3933  C  C     . TYR A 1 594  ? 9.605   34.646  -28.898 1.00 72.37  ? 622  TYR A C     1 
ATOM   3934  O  O     . TYR A 1 594  ? 9.300   35.640  -28.236 1.00 77.26  ? 622  TYR A O     1 
ATOM   3935  C  CB    . TYR A 1 594  ? 8.074   35.012  -30.838 1.00 92.84  ? 622  TYR A CB    1 
ATOM   3936  C  CG    . TYR A 1 594  ? 6.956   34.512  -31.726 1.00 43.36  ? 622  TYR A CG    1 
ATOM   3937  C  CD1   . TYR A 1 594  ? 5.949   35.368  -32.152 1.00 45.45  ? 622  TYR A CD1   1 
ATOM   3938  C  CD2   . TYR A 1 594  ? 6.912   33.189  -32.145 1.00 46.40  ? 622  TYR A CD2   1 
ATOM   3939  C  CE1   . TYR A 1 594  ? 4.925   34.920  -32.964 1.00 43.79  ? 622  TYR A CE1   1 
ATOM   3940  C  CE2   . TYR A 1 594  ? 5.891   32.731  -32.958 1.00 44.55  ? 622  TYR A CE2   1 
ATOM   3941  C  CZ    . TYR A 1 594  ? 4.901   33.601  -33.364 1.00 40.33  ? 622  TYR A CZ    1 
ATOM   3942  O  OH    . TYR A 1 594  ? 3.884   33.150  -34.174 1.00 44.20  ? 622  TYR A OH    1 
ATOM   3943  N  N     . LEU A 1 595  ? 10.813  34.087  -28.869 1.00 76.75  ? 623  LEU A N     1 
ATOM   3944  C  CA    . LEU A 1 595  ? 11.905  34.601  -28.043 1.00 72.31  ? 623  LEU A CA    1 
ATOM   3945  C  C     . LEU A 1 595  ? 11.496  34.744  -26.579 1.00 66.30  ? 623  LEU A C     1 
ATOM   3946  O  O     . LEU A 1 595  ? 11.835  35.730  -25.923 1.00 42.67  ? 623  LEU A O     1 
ATOM   3947  C  CB    . LEU A 1 595  ? 12.409  35.947  -28.580 1.00 73.67  ? 623  LEU A CB    1 
ATOM   3948  C  CG    . LEU A 1 595  ? 13.114  35.953  -29.940 1.00 67.02  ? 623  LEU A CG    1 
ATOM   3949  C  CD1   . LEU A 1 595  ? 12.114  36.068  -31.085 1.00 46.71  ? 623  LEU A CD1   1 
ATOM   3950  C  CD2   . LEU A 1 595  ? 14.153  37.068  -30.008 1.00 64.64  ? 623  LEU A CD2   1 
ATOM   3951  N  N     . ASN A 1 602  ? 11.733  10.613  -40.269 1.00 87.89  ? 630  ASN A N     1 
ATOM   3952  C  CA    . ASN A 1 602  ? 12.155  11.720  -39.428 1.00 68.54  ? 630  ASN A CA    1 
ATOM   3953  C  C     . ASN A 1 602  ? 11.012  12.198  -38.551 1.00 76.37  ? 630  ASN A C     1 
ATOM   3954  O  O     . ASN A 1 602  ? 10.628  13.365  -38.596 1.00 71.70  ? 630  ASN A O     1 
ATOM   3955  C  CB    . ASN A 1 602  ? 12.674  12.869  -40.288 1.00 20.00  ? 630  ASN A CB    1 
ATOM   3956  C  CG    . ASN A 1 602  ? 11.591  13.488  -41.140 1.00 20.00  ? 630  ASN A CG    1 
ATOM   3957  O  OD1   . ASN A 1 602  ? 10.404  13.307  -40.883 1.00 20.00  ? 630  ASN A OD1   1 
ATOM   3958  N  ND2   . ASN A 1 602  ? 11.996  14.226  -42.164 1.00 20.00  ? 630  ASN A ND2   1 
ATOM   3959  N  N     . LEU A 1 603  ? 10.468  11.289  -37.750 1.00 69.59  ? 631  LEU A N     1 
ATOM   3960  C  CA    . LEU A 1 603  ? 9.364   11.632  -36.868 1.00 69.12  ? 631  LEU A CA    1 
ATOM   3961  C  C     . LEU A 1 603  ? 9.824   11.660  -35.424 1.00 71.10  ? 631  LEU A C     1 
ATOM   3962  O  O     . LEU A 1 603  ? 10.406  10.703  -34.924 1.00 68.35  ? 631  LEU A O     1 
ATOM   3963  C  CB    . LEU A 1 603  ? 8.212   10.641  -37.033 1.00 20.00  ? 631  LEU A CB    1 
ATOM   3964  C  CG    . LEU A 1 603  ? 7.683   10.460  -38.456 1.00 20.00  ? 631  LEU A CG    1 
ATOM   3965  C  CD1   . LEU A 1 603  ? 6.165   10.543  -38.484 1.00 20.00  ? 631  LEU A CD1   1 
ATOM   3966  C  CD2   . LEU A 1 603  ? 8.304   11.484  -39.394 1.00 20.00  ? 631  LEU A CD2   1 
ATOM   3967  N  N     . ALA A 1 604  ? 9.552   12.775  -34.761 1.00 68.22  ? 632  ALA A N     1 
ATOM   3968  C  CA    . ALA A 1 604  ? 9.934   12.951  -33.374 1.00 74.45  ? 632  ALA A CA    1 
ATOM   3969  C  C     . ALA A 1 604  ? 8.743   12.721  -32.466 1.00 87.60  ? 632  ALA A C     1 
ATOM   3970  O  O     . ALA A 1 604  ? 7.705   13.364  -32.610 1.00 81.57  ? 632  ALA A O     1 
ATOM   3971  C  CB    . ALA A 1 604  ? 10.508  14.339  -33.159 1.00 20.00  ? 632  ALA A CB    1 
ATOM   3972  N  N     . LYS A 1 605  ? 8.897   11.798  -31.526 1.00 81.05  ? 633  LYS A N     1 
ATOM   3973  C  CA    . LYS A 1 605  ? 7.801   11.494  -30.589 1.00 86.93  ? 633  LYS A CA    1 
ATOM   3974  C  C     . LYS A 1 605  ? 8.153   11.380  -29.096 1.00 91.95  ? 633  LYS A C     1 
ATOM   3975  O  O     . LYS A 1 605  ? 9.302   11.149  -28.734 1.00 93.45  ? 633  LYS A O     1 
ATOM   3976  C  CB    . LYS A 1 605  ? 7.096   10.209  -31.025 1.00 20.00  ? 633  LYS A CB    1 
ATOM   3977  C  CG    . LYS A 1 605  ? 7.488   9.756   -32.412 1.00 20.00  ? 633  LYS A CG    1 
ATOM   3978  C  CD    . LYS A 1 605  ? 7.368   10.907  -33.382 1.00 20.00  ? 633  LYS A CD    1 
ATOM   3979  C  CE    . LYS A 1 605  ? 8.335   10.777  -34.532 1.00 20.00  ? 633  LYS A CE    1 
ATOM   3980  N  NZ    . LYS A 1 605  ? 7.758   11.464  -35.711 1.00 20.00  ? 633  LYS A NZ    1 
ATOM   3981  N  N     . LEU A 1 606  ? 7.141   11.544  -28.240 1.00 46.78  ? 634  LEU A N     1 
ATOM   3982  C  CA    . LEU A 1 606  ? 7.313   11.452  -26.785 1.00 41.00  ? 634  LEU A CA    1 
ATOM   3983  C  C     . LEU A 1 606  ? 6.154   10.762  -26.035 1.00 43.11  ? 634  LEU A C     1 
ATOM   3984  O  O     . LEU A 1 606  ? 5.019   10.741  -26.505 1.00 48.29  ? 634  LEU A O     1 
ATOM   3985  C  CB    . LEU A 1 606  ? 7.638   12.814  -26.181 1.00 20.00  ? 634  LEU A CB    1 
ATOM   3986  C  CG    . LEU A 1 606  ? 9.051   12.838  -25.595 1.00 20.00  ? 634  LEU A CG    1 
ATOM   3987  C  CD1   . LEU A 1 606  ? 9.625   14.241  -25.552 1.00 20.00  ? 634  LEU A CD1   1 
ATOM   3988  C  CD2   . LEU A 1 606  ? 9.079   12.193  -24.219 1.00 20.00  ? 634  LEU A CD2   1 
ATOM   3989  N  N     . PRO A 1 607  ? 6.470   10.208  -24.866 1.00 93.89  ? 635  PRO A N     1 
ATOM   3990  C  CA    . PRO A 1 607  ? 5.538   9.471   -23.991 1.00 86.92  ? 635  PRO A CA    1 
ATOM   3991  C  C     . PRO A 1 607  ? 4.483   10.245  -23.188 1.00 73.43  ? 635  PRO A C     1 
ATOM   3992  O  O     . PRO A 1 607  ? 4.576   11.457  -23.059 1.00 85.87  ? 635  PRO A O     1 
ATOM   3993  C  CB    . PRO A 1 607  ? 6.487   8.770   -23.018 1.00 20.00  ? 635  PRO A CB    1 
ATOM   3994  C  CG    . PRO A 1 607  ? 7.655   9.685   -22.927 1.00 20.00  ? 635  PRO A CG    1 
ATOM   3995  C  CD    . PRO A 1 607  ? 7.828   10.264  -24.299 1.00 20.00  ? 635  PRO A CD    1 
ATOM   3996  N  N     . THR A 1 608  ? 3.491   9.516   -22.664 1.00 86.69  ? 636  THR A N     1 
ATOM   3997  C  CA    . THR A 1 608  ? 2.389   10.064  -21.855 1.00 91.24  ? 636  THR A CA    1 
ATOM   3998  C  C     . THR A 1 608  ? 2.230   9.293   -20.539 1.00 93.62  ? 636  THR A C     1 
ATOM   3999  O  O     . THR A 1 608  ? 2.637   8.143   -20.455 1.00 90.24  ? 636  THR A O     1 
ATOM   4000  C  CB    . THR A 1 608  ? 1.047   9.969   -22.588 1.00 20.00  ? 636  THR A CB    1 
ATOM   4001  O  OG1   . THR A 1 608  ? 0.097   9.287   -21.756 1.00 20.00  ? 636  THR A OG1   1 
ATOM   4002  C  CG2   . THR A 1 608  ? 1.210   9.216   -23.890 1.00 20.00  ? 636  THR A CG2   1 
ATOM   4003  N  N     . GLY A 1 609  ? 1.647   9.910   -19.510 1.00 90.13  ? 637  GLY A N     1 
ATOM   4004  C  CA    . GLY A 1 609  ? 1.478   9.210   -18.248 1.00 76.10  ? 637  GLY A CA    1 
ATOM   4005  C  C     . GLY A 1 609  ? 0.543   9.828   -17.223 1.00 69.94  ? 637  GLY A C     1 
ATOM   4006  O  O     . GLY A 1 609  ? 0.679   11.000  -16.877 1.00 71.77  ? 637  GLY A O     1 
ATOM   4007  N  N     . THR A 1 610  ? -0.404  9.033   -16.732 1.00 76.84  ? 638  THR A N     1 
ATOM   4008  C  CA    . THR A 1 610  ? -1.360  9.487   -15.724 1.00 77.63  ? 638  THR A CA    1 
ATOM   4009  C  C     . THR A 1 610  ? -1.465  8.487   -14.583 1.00 85.56  ? 638  THR A C     1 
ATOM   4010  O  O     . THR A 1 610  ? -1.693  7.305   -14.817 1.00 86.24  ? 638  THR A O     1 
ATOM   4011  C  CB    . THR A 1 610  ? -2.757  9.622   -16.307 1.00 20.00  ? 638  THR A CB    1 
ATOM   4012  O  OG1   . THR A 1 610  ? -2.664  9.883   -17.710 1.00 20.00  ? 638  THR A OG1   1 
ATOM   4013  C  CG2   . THR A 1 610  ? -3.501  10.744  -15.626 1.00 20.00  ? 638  THR A CG2   1 
ATOM   4014  N  N     . THR A 1 611  ? -1.364  8.968   -13.339 1.00 93.59  ? 639  THR A N     1 
ATOM   4015  C  CA    . THR A 1 611  ? -1.481  8.106   -12.144 1.00 90.69  ? 639  THR A CA    1 
ATOM   4016  C  C     . THR A 1 611  ? -1.920  8.837   -10.858 1.00 90.84  ? 639  THR A C     1 
ATOM   4017  O  O     . THR A 1 611  ? -1.845  10.055  -10.790 1.00 68.36  ? 639  THR A O     1 
ATOM   4018  C  CB    . THR A 1 611  ? -0.197  7.328   -11.873 1.00 20.00  ? 639  THR A CB    1 
ATOM   4019  O  OG1   . THR A 1 611  ? 0.349   6.872   -13.117 1.00 20.00  ? 639  THR A OG1   1 
ATOM   4020  C  CG2   . THR A 1 611  ? -0.496  6.135   -10.989 1.00 20.00  ? 639  THR A CG2   1 
ATOM   4021  N  N     . LEU A 1 612  ? -2.370  8.093   -9.846  1.00 92.53  ? 640  LEU A N     1 
ATOM   4022  C  CA    . LEU A 1 612  ? -2.817  8.696   -8.579  1.00 85.67  ? 640  LEU A CA    1 
ATOM   4023  C  C     . LEU A 1 612  ? -2.104  8.206   -7.304  1.00 76.31  ? 640  LEU A C     1 
ATOM   4024  O  O     . LEU A 1 612  ? -2.004  7.004   -7.066  1.00 84.79  ? 640  LEU A O     1 
ATOM   4025  C  CB    . LEU A 1 612  ? -4.324  8.493   -8.413  1.00 20.00  ? 640  LEU A CB    1 
ATOM   4026  C  CG    . LEU A 1 612  ? -4.765  7.412   -7.421  1.00 20.00  ? 640  LEU A CG    1 
ATOM   4027  C  CD1   . LEU A 1 612  ? -4.590  6.024   -8.009  1.00 20.00  ? 640  LEU A CD1   1 
ATOM   4028  C  CD2   . LEU A 1 612  ? -4.022  7.539   -6.104  1.00 20.00  ? 640  LEU A CD2   1 
ATOM   4029  N  N     . GLU A 1 613  ? -1.622  9.140   -6.484  1.00 76.61  ? 641  GLU A N     1 
ATOM   4030  C  CA    . GLU A 1 613  ? -0.928  8.799   -5.235  1.00 76.63  ? 641  GLU A CA    1 
ATOM   4031  C  C     . GLU A 1 613  ? -1.360  9.658   -4.038  1.00 76.03  ? 641  GLU A C     1 
ATOM   4032  O  O     . GLU A 1 613  ? -1.982  9.167   -3.096  1.00 72.88  ? 641  GLU A O     1 
ATOM   4033  C  CB    . GLU A 1 613  ? 0.587   8.924   -5.414  1.00 20.00  ? 641  GLU A CB    1 
ATOM   4034  C  CG    . GLU A 1 613  ? 1.147   10.282  -5.001  1.00 20.00  ? 641  GLU A CG    1 
ATOM   4035  C  CD    . GLU A 1 613  ? 2.164   10.193  -3.877  1.00 20.00  ? 641  GLU A CD    1 
ATOM   4036  O  OE1   . GLU A 1 613  ? 2.457   11.235  -3.253  1.00 20.00  ? 641  GLU A OE1   1 
ATOM   4037  O  OE2   . GLU A 1 613  ? 2.673   9.084   -3.618  1.00 20.00  ? 641  GLU A OE2   1 
ATOM   4038  N  N     . SER A 1 614  ? -1.017  10.943  -4.093  1.00 71.44  ? 642  SER A N     1 
ATOM   4039  C  CA    . SER A 1 614  ? -1.346  11.908  -3.041  1.00 70.96  ? 642  SER A CA    1 
ATOM   4040  C  C     . SER A 1 614  ? -0.235  12.082  -2.006  1.00 90.64  ? 642  SER A C     1 
ATOM   4041  O  O     . SER A 1 614  ? 0.627   11.218  -1.860  1.00 72.77  ? 642  SER A O     1 
ATOM   4042  C  CB    . SER A 1 614  ? -2.643  11.515  -2.336  1.00 20.00  ? 642  SER A CB    1 
ATOM   4043  O  OG    . SER A 1 614  ? -2.826  12.295  -1.167  1.00 20.00  ? 642  SER A OG    1 
ATOM   4044  N  N     . ALA A 1 615  ? -0.268  13.203  -1.286  1.00 76.00  ? 643  ALA A N     1 
ATOM   4045  C  CA    . ALA A 1 615  ? -1.304  14.216  -1.481  1.00 84.08  ? 643  ALA A CA    1 
ATOM   4046  C  C     . ALA A 1 615  ? -0.743  15.471  -2.147  1.00 70.27  ? 643  ALA A C     1 
ATOM   4047  O  O     . ALA A 1 615  ? 0.149   16.134  -1.621  1.00 92.86  ? 643  ALA A O     1 
ATOM   4048  C  CB    . ALA A 1 615  ? -1.961  14.570  -0.154  1.00 84.26  ? 643  ALA A CB    1 
ATOM   4049  N  N     . GLY A 1 616  ? -1.292  15.788  -3.311  1.00 75.59  ? 644  GLY A N     1 
ATOM   4050  C  CA    . GLY A 1 616  ? -0.881  16.940  -4.085  1.00 68.24  ? 644  GLY A CA    1 
ATOM   4051  C  C     . GLY A 1 616  ? -2.101  17.623  -4.661  1.00 70.05  ? 644  GLY A C     1 
ATOM   4052  O  O     . GLY A 1 616  ? -3.161  17.011  -4.773  1.00 69.63  ? 644  GLY A O     1 
ATOM   4053  N  N     . VAL A 1 617  ? -1.953  18.893  -5.020  1.00 87.99  ? 645  VAL A N     1 
ATOM   4054  C  CA    . VAL A 1 617  ? -3.048  19.683  -5.590  1.00 90.85  ? 645  VAL A CA    1 
ATOM   4055  C  C     . VAL A 1 617  ? -3.657  18.967  -6.784  1.00 70.96  ? 645  VAL A C     1 
ATOM   4056  O  O     . VAL A 1 617  ? -2.960  18.485  -7.665  1.00 69.70  ? 645  VAL A O     1 
ATOM   4057  C  CB    . VAL A 1 617  ? -2.550  21.030  -6.071  1.00 85.96  ? 645  VAL A CB    1 
ATOM   4058  C  CG1   . VAL A 1 617  ? -2.485  21.043  -7.583  1.00 91.62  ? 645  VAL A CG1   1 
ATOM   4059  C  CG2   . VAL A 1 617  ? -3.444  22.127  -5.549  1.00 77.65  ? 645  VAL A CG2   1 
ATOM   4060  N  N     . VAL A 1 618  ? -4.976  18.913  -6.808  1.00 77.98  ? 646  VAL A N     1 
ATOM   4061  C  CA    . VAL A 1 618  ? -5.702  18.237  -7.850  1.00 72.31  ? 646  VAL A CA    1 
ATOM   4062  C  C     . VAL A 1 618  ? -5.569  19.034  -9.105  1.00 68.23  ? 646  VAL A C     1 
ATOM   4063  O  O     . VAL A 1 618  ? -5.468  20.246  -9.050  1.00 84.37  ? 646  VAL A O     1 
ATOM   4064  C  CB    . VAL A 1 618  ? -7.182  18.208  -7.538  1.00 73.36  ? 646  VAL A CB    1 
ATOM   4065  C  CG1   . VAL A 1 618  ? -7.541  19.396  -6.662  1.00 68.11  ? 646  VAL A CG1   1 
ATOM   4066  C  CG2   . VAL A 1 618  ? -7.973  18.244  -8.832  1.00 69.02  ? 646  VAL A CG2   1 
ATOM   4067  N  N     . CYS A 1 619  ? -5.573  18.363  -10.243 1.00 90.04  ? 647  CYS A N     1 
ATOM   4068  C  CA    . CYS A 1 619  ? -5.481  19.079  -11.496 1.00 85.83  ? 647  CYS A CA    1 
ATOM   4069  C  C     . CYS A 1 619  ? -6.656  18.657  -12.341 1.00 70.16  ? 647  CYS A C     1 
ATOM   4070  O  O     . CYS A 1 619  ? -7.168  17.555  -12.189 1.00 74.62  ? 647  CYS A O     1 
ATOM   4071  C  CB    . CYS A 1 619  ? -4.201  18.815  -12.250 1.00 86.33  ? 647  CYS A CB    1 
ATOM   4072  S  SG    . CYS A 1 619  ? -4.330  19.594  -13.858 1.00 68.18  ? 647  CYS A SG    1 
ATOM   4073  N  N     . PRO A 1 620  ? -7.092  19.539  -13.226 1.00 40.67  ? 648  PRO A N     1 
ATOM   4074  C  CA    . PRO A 1 620  ? -8.231  19.256  -14.089 1.00 41.57  ? 648  PRO A CA    1 
ATOM   4075  C  C     . PRO A 1 620  ? -7.836  19.321  -15.540 1.00 93.88  ? 648  PRO A C     1 
ATOM   4076  O  O     . PRO A 1 620  ? -7.236  20.304  -15.960 1.00 90.22  ? 648  PRO A O     1 
ATOM   4077  C  CB    . PRO A 1 620  ? -9.146  20.429  -13.797 1.00 48.06  ? 648  PRO A CB    1 
ATOM   4078  C  CG    . PRO A 1 620  ? -8.188  21.563  -13.534 1.00 46.60  ? 648  PRO A CG    1 
ATOM   4079  C  CD    . PRO A 1 620  ? -6.845  20.979  -13.150 1.00 42.55  ? 648  PRO A CD    1 
ATOM   4080  N  N     . TYR A 1 621  ? -8.169  18.283  -16.291 1.00 72.49  ? 649  TYR A N     1 
ATOM   4081  C  CA    . TYR A 1 621  ? -7.843  18.233  -17.701 1.00 85.85  ? 649  TYR A CA    1 
ATOM   4082  C  C     . TYR A 1 621  ? -9.071  18.099  -18.571 1.00 85.52  ? 649  TYR A C     1 
ATOM   4083  O  O     . TYR A 1 621  ? -8.959  17.654  -19.704 1.00 77.06  ? 649  TYR A O     1 
ATOM   4084  C  CB    . TYR A 1 621  ? -6.882  17.077  -17.981 1.00 20.00  ? 649  TYR A CB    1 
ATOM   4085  C  CG    . TYR A 1 621  ? -6.560  16.888  -19.447 1.00 20.00  ? 649  TYR A CG    1 
ATOM   4086  C  CD1   . TYR A 1 621  ? -5.664  17.731  -20.094 1.00 20.00  ? 649  TYR A CD1   1 
ATOM   4087  C  CD2   . TYR A 1 621  ? -7.150  15.868  -20.180 1.00 20.00  ? 649  TYR A CD2   1 
ATOM   4088  C  CE1   . TYR A 1 621  ? -5.367  17.562  -21.433 1.00 20.00  ? 649  TYR A CE1   1 
ATOM   4089  C  CE2   . TYR A 1 621  ? -6.858  15.691  -21.520 1.00 20.00  ? 649  TYR A CE2   1 
ATOM   4090  C  CZ    . TYR A 1 621  ? -5.967  16.540  -22.141 1.00 20.00  ? 649  TYR A CZ    1 
ATOM   4091  O  OH    . TYR A 1 621  ? -5.674  16.371  -23.475 1.00 20.00  ? 649  TYR A OH    1 
ATOM   4092  N  N     . ARG A 1 622  ? -10.249 18.453  -18.077 1.00 68.27  ? 650  ARG A N     1 
ATOM   4093  C  CA    . ARG A 1 622  ? -11.372 18.267  -18.948 1.00 70.32  ? 650  ARG A CA    1 
ATOM   4094  C  C     . ARG A 1 622  ? -11.769 19.640  -19.448 1.00 85.31  ? 650  ARG A C     1 
ATOM   4095  O  O     . ARG A 1 622  ? -11.954 19.872  -20.642 1.00 87.99  ? 650  ARG A O     1 
ATOM   4096  C  CB    . ARG A 1 622  ? -12.497 17.599  -18.171 1.00 74.50  ? 650  ARG A CB    1 
ATOM   4097  C  CG    . ARG A 1 622  ? -12.004 16.878  -16.920 1.00 71.64  ? 650  ARG A CG    1 
ATOM   4098  C  CD    . ARG A 1 622  ? -12.343 15.395  -16.956 1.00 70.58  ? 650  ARG A CD    1 
ATOM   4099  N  NE    . ARG A 1 622  ? -12.212 14.771  -15.642 1.00 73.75  ? 650  ARG A NE    1 
ATOM   4100  C  CZ    . ARG A 1 622  ? -13.066 14.947  -14.638 1.00 72.31  ? 650  ARG A CZ    1 
ATOM   4101  N  NH1   . ARG A 1 622  ? -14.124 15.730  -14.788 1.00 70.49  ? 650  ARG A NH1   1 
ATOM   4102  N  NH2   . ARG A 1 622  ? -12.859 14.336  -13.482 1.00 73.62  ? 650  ARG A NH2   1 
ATOM   4103  N  N     . ALA A 1 623  ? -11.876 20.560  -18.503 1.00 87.87  ? 651  ALA A N     1 
ATOM   4104  C  CA    . ALA A 1 623  ? -12.261 21.928  -18.820 1.00 87.53  ? 651  ALA A CA    1 
ATOM   4105  C  C     . ALA A 1 623  ? -11.362 22.484  -19.916 1.00 70.11  ? 651  ALA A C     1 
ATOM   4106  O  O     . ALA A 1 623  ? -11.772 23.349  -20.687 1.00 76.61  ? 651  ALA A O     1 
ATOM   4107  C  CB    . ALA A 1 623  ? -12.196 22.805  -17.579 1.00 72.03  ? 651  ALA A CB    1 
ATOM   4108  N  N     . ILE A 1 624  ? -10.134 21.979  -19.976 1.00 76.15  ? 652  ILE A N     1 
ATOM   4109  C  CA    . ILE A 1 624  ? -9.187  22.367  -21.014 1.00 70.39  ? 652  ILE A CA    1 
ATOM   4110  C  C     . ILE A 1 624  ? -9.652  21.878  -22.381 1.00 90.77  ? 652  ILE A C     1 
ATOM   4111  O  O     . ILE A 1 624  ? -9.725  22.650  -23.339 1.00 76.03  ? 652  ILE A O     1 
ATOM   4112  C  CB    . ILE A 1 624  ? -7.779  21.810  -20.727 1.00 73.57  ? 652  ILE A CB    1 
ATOM   4113  C  CG1   . ILE A 1 624  ? -7.275  22.302  -19.369 1.00 68.06  ? 652  ILE A CG1   1 
ATOM   4114  C  CG2   . ILE A 1 624  ? -6.811  22.197  -21.836 1.00 76.53  ? 652  ILE A CG2   1 
ATOM   4115  C  CD1   . ILE A 1 624  ? -5.933  21.730  -18.974 1.00 70.18  ? 652  ILE A CD1   1 
ATOM   4116  N  N     . GLU A 1 625  ? -9.969  20.589  -22.461 1.00 75.01  ? 653  GLU A N     1 
ATOM   4117  C  CA    . GLU A 1 625  ? -10.412 19.984  -23.710 1.00 77.48  ? 653  GLU A CA    1 
ATOM   4118  C  C     . GLU A 1 625  ? -11.735 20.594  -24.159 1.00 90.01  ? 653  GLU A C     1 
ATOM   4119  O  O     . GLU A 1 625  ? -11.943 20.838  -25.347 1.00 74.99  ? 653  GLU A O     1 
ATOM   4120  C  CB    . GLU A 1 625  ? -10.544 18.466  -23.555 1.00 86.48  ? 653  GLU A CB    1 
ATOM   4121  C  CG    . GLU A 1 625  ? -10.353 17.678  -24.847 1.00 92.26  ? 653  GLU A CG    1 
ATOM   4122  C  CD    . GLU A 1 625  ? -11.551 17.758  -25.776 1.00 86.35  ? 653  GLU A CD    1 
ATOM   4123  O  OE1   . GLU A 1 625  ? -12.686 17.902  -25.276 1.00 93.73  ? 653  GLU A OE1   1 
ATOM   4124  O  OE2   . GLU A 1 625  ? -11.355 17.676  -27.007 1.00 70.74  ? 653  GLU A OE2   1 
ATOM   4125  N  N     . SER A 1 626  ? -12.624 20.845  -23.202 1.00 92.33  ? 654  SER A N     1 
ATOM   4126  C  CA    . SER A 1 626  ? -13.911 21.461  -23.506 1.00 77.87  ? 654  SER A CA    1 
ATOM   4127  C  C     . SER A 1 626  ? -13.720 22.896  -23.985 1.00 91.40  ? 654  SER A C     1 
ATOM   4128  O  O     . SER A 1 626  ? -14.447 23.370  -24.859 1.00 74.46  ? 654  SER A O     1 
ATOM   4129  C  CB    . SER A 1 626  ? -14.830 21.429  -22.284 1.00 76.08  ? 654  SER A CB    1 
ATOM   4130  O  OG    . SER A 1 626  ? -14.336 22.264  -21.252 1.00 90.02  ? 654  SER A OG    1 
ATOM   4131  N  N     . LEU A 1 627  ? -12.737 23.581  -23.407 1.00 92.79  ? 655  LEU A N     1 
ATOM   4132  C  CA    . LEU A 1 627  ? -12.401 24.939  -23.818 1.00 77.94  ? 655  LEU A CA    1 
ATOM   4133  C  C     . LEU A 1 627  ? -11.891 24.922  -25.252 1.00 81.22  ? 655  LEU A C     1 
ATOM   4134  O  O     . LEU A 1 627  ? -12.206 25.810  -26.045 1.00 74.19  ? 655  LEU A O     1 
ATOM   4135  C  CB    . LEU A 1 627  ? -11.351 25.549  -22.884 1.00 68.21  ? 655  LEU A CB    1 
ATOM   4136  C  CG    . LEU A 1 627  ? -11.423 27.050  -22.585 1.00 72.06  ? 655  LEU A CG    1 
ATOM   4137  C  CD1   . LEU A 1 627  ? -11.100 27.892  -23.812 1.00 68.60  ? 655  LEU A CD1   1 
ATOM   4138  C  CD2   . LEU A 1 627  ? -12.792 27.415  -22.026 1.00 72.89  ? 655  LEU A CD2   1 
ATOM   4139  N  N     . TYR A 1 628  ? -11.102 23.904  -25.579 1.00 72.21  ? 656  TYR A N     1 
ATOM   4140  C  CA    . TYR A 1 628  ? -10.601 23.737  -26.936 1.00 72.51  ? 656  TYR A CA    1 
ATOM   4141  C  C     . TYR A 1 628  ? -11.756 23.466  -27.894 1.00 74.97  ? 656  TYR A C     1 
ATOM   4142  O  O     . TYR A 1 628  ? -11.751 23.933  -29.032 1.00 69.11  ? 656  TYR A O     1 
ATOM   4143  C  CB    . TYR A 1 628  ? -9.575  22.604  -27.001 1.00 75.96  ? 656  TYR A CB    1 
ATOM   4144  C  CG    . TYR A 1 628  ? -8.917  22.458  -28.354 1.00 76.48  ? 656  TYR A CG    1 
ATOM   4145  C  CD1   . TYR A 1 628  ? -9.434  21.595  -29.311 1.00 77.84  ? 656  TYR A CD1   1 
ATOM   4146  C  CD2   . TYR A 1 628  ? -7.780  23.185  -28.675 1.00 72.99  ? 656  TYR A CD2   1 
ATOM   4147  C  CE1   . TYR A 1 628  ? -8.837  21.460  -30.549 1.00 73.60  ? 656  TYR A CE1   1 
ATOM   4148  C  CE2   . TYR A 1 628  ? -7.175  23.058  -29.911 1.00 73.85  ? 656  TYR A CE2   1 
ATOM   4149  C  CZ    . TYR A 1 628  ? -7.708  22.193  -30.843 1.00 77.72  ? 656  TYR A CZ    1 
ATOM   4150  O  OH    . TYR A 1 628  ? -7.110  22.061  -32.076 1.00 69.58  ? 656  TYR A OH    1 
ATOM   4151  N  N     . ARG A 1 629  ? -12.741 22.707  -27.423 1.00 70.87  ? 657  ARG A N     1 
ATOM   4152  C  CA    . ARG A 1 629  ? -13.936 22.426  -28.209 1.00 68.74  ? 657  ARG A CA    1 
ATOM   4153  C  C     . ARG A 1 629  ? -14.700 23.710  -28.510 1.00 90.30  ? 657  ARG A C     1 
ATOM   4154  O  O     . ARG A 1 629  ? -15.102 23.952  -29.648 1.00 91.15  ? 657  ARG A O     1 
ATOM   4155  C  CB    . ARG A 1 629  ? -14.844 21.434  -27.478 1.00 93.33  ? 657  ARG A CB    1 
ATOM   4156  C  CG    . ARG A 1 629  ? -14.297 20.017  -27.402 1.00 84.06  ? 657  ARG A CG    1 
ATOM   4157  C  CD    . ARG A 1 629  ? -14.242 19.369  -28.775 1.00 85.03  ? 657  ARG A CD    1 
ATOM   4158  N  NE    . ARG A 1 629  ? -13.781 17.985  -28.706 1.00 87.90  ? 657  ARG A NE    1 
ATOM   4159  C  CZ    . ARG A 1 629  ? -14.577 16.943  -28.489 1.00 84.09  ? 657  ARG A CZ    1 
ATOM   4160  N  NH1   . ARG A 1 629  ? -15.879 17.126  -28.316 1.00 71.33  ? 657  ARG A NH1   1 
ATOM   4161  N  NH2   . ARG A 1 629  ? -14.071 15.718  -28.442 1.00 92.52  ? 657  ARG A NH2   1 
ATOM   4162  N  N     . LYS A 1 630  ? -14.891 24.531  -27.482 1.00 91.27  ? 658  LYS A N     1 
ATOM   4163  C  CA    . LYS A 1 630  ? -15.586 25.804  -27.632 1.00 84.76  ? 658  LYS A CA    1 
ATOM   4164  C  C     . LYS A 1 630  ? -14.810 26.742  -28.550 1.00 87.98  ? 658  LYS A C     1 
ATOM   4165  O  O     . LYS A 1 630  ? -15.396 27.541  -29.280 1.00 85.58  ? 658  LYS A O     1 
ATOM   4166  C  CB    . LYS A 1 630  ? -15.805 26.460  -26.265 1.00 85.79  ? 658  LYS A CB    1 
ATOM   4167  C  CG    . LYS A 1 630  ? -16.538 27.795  -26.320 1.00 93.45  ? 658  LYS A CG    1 
ATOM   4168  C  CD    . LYS A 1 630  ? -16.739 28.397  -24.933 1.00 90.14  ? 658  LYS A CD    1 
ATOM   4169  C  CE    . LYS A 1 630  ? -18.039 27.928  -24.288 1.00 85.08  ? 658  LYS A CE    1 
ATOM   4170  N  NZ    . LYS A 1 630  ? -18.044 26.476  -23.958 1.00 90.44  ? 658  LYS A NZ    1 
ATOM   4171  N  N     . HIS A 1 631  ? -13.486 26.633  -28.514 1.00 70.53  ? 659  HIS A N     1 
ATOM   4172  C  CA    . HIS A 1 631  ? -12.625 27.481  -29.328 1.00 87.07  ? 659  HIS A CA    1 
ATOM   4173  C  C     . HIS A 1 631  ? -12.737 27.139  -30.811 1.00 86.24  ? 659  HIS A C     1 
ATOM   4174  O  O     . HIS A 1 631  ? -12.777 28.030  -31.660 1.00 71.97  ? 659  HIS A O     1 
ATOM   4175  C  CB    . HIS A 1 631  ? -11.171 27.360  -28.873 1.00 87.43  ? 659  HIS A CB    1 
ATOM   4176  C  CG    . HIS A 1 631  ? -10.212 28.154  -29.703 1.00 90.13  ? 659  HIS A CG    1 
ATOM   4177  N  ND1   . HIS A 1 631  ? -10.271 29.527  -29.799 1.00 93.98  ? 659  HIS A ND1   1 
ATOM   4178  C  CD2   . HIS A 1 631  ? -9.175  27.766  -30.482 1.00 90.29  ? 659  HIS A CD2   1 
ATOM   4179  C  CE1   . HIS A 1 631  ? -9.309  29.953  -30.598 1.00 87.53  ? 659  HIS A CE1   1 
ATOM   4180  N  NE2   . HIS A 1 631  ? -8.629  28.904  -31.026 1.00 87.37  ? 659  HIS A NE2   1 
ATOM   4181  N  N     . CYS A 1 632  ? -12.789 25.847  -31.118 1.00 87.26  ? 660  CYS A N     1 
ATOM   4182  C  CA    . CYS A 1 632  ? -12.877 25.396  -32.501 1.00 93.31  ? 660  CYS A CA    1 
ATOM   4183  C  C     . CYS A 1 632  ? -14.327 25.242  -32.949 1.00 72.86  ? 660  CYS A C     1 
ATOM   4184  O  O     . CYS A 1 632  ? -14.599 24.683  -34.012 1.00 86.60  ? 660  CYS A O     1 
ATOM   4185  C  CB    . CYS A 1 632  ? -12.133 24.072  -32.681 1.00 93.22  ? 660  CYS A CB    1 
ATOM   4186  S  SG    . CYS A 1 632  ? -12.841 22.690  -31.757 1.00 74.67  ? 660  CYS A SG    1 
ATOM   4187  N  N     . LEU A 1 633  ? -15.254 25.739  -32.136 1.00 90.81  ? 661  LEU A N     1 
ATOM   4188  C  CA    . LEU A 1 633  ? -16.675 25.648  -32.450 1.00 42.15  ? 661  LEU A CA    1 
ATOM   4189  C  C     . LEU A 1 633  ? -17.019 26.562  -33.622 1.00 48.02  ? 661  LEU A C     1 
ATOM   4190  O  O     . LEU A 1 633  ? -17.952 26.294  -34.379 1.00 49.83  ? 661  LEU A O     1 
ATOM   4191  C  CB    . LEU A 1 633  ? -17.520 26.002  -31.220 1.00 44.41  ? 661  LEU A CB    1 
ATOM   4192  C  CG    . LEU A 1 633  ? -19.018 25.675  -31.214 1.00 44.54  ? 661  LEU A CG    1 
ATOM   4193  C  CD1   . LEU A 1 633  ? -19.852 26.810  -31.800 1.00 45.10  ? 661  LEU A CD1   1 
ATOM   4194  C  CD2   . LEU A 1 633  ? -19.291 24.371  -31.952 1.00 48.93  ? 661  LEU A CD2   1 
ATOM   4195  N  N     . GLU A 1 634  ? -16.254 27.639  -33.765 1.00 81.60  ? 662  GLU A N     1 
ATOM   4196  C  CA    . GLU A 1 634  ? -16.458 28.590  -34.851 1.00 75.47  ? 662  GLU A CA    1 
ATOM   4197  C  C     . GLU A 1 634  ? -16.145 27.964  -36.206 1.00 72.89  ? 662  GLU A C     1 
ATOM   4198  O  O     . GLU A 1 634  ? -15.360 27.021  -36.299 1.00 70.43  ? 662  GLU A O     1 
ATOM   4199  C  CB    . GLU A 1 634  ? -15.600 29.839  -34.629 1.00 92.26  ? 662  GLU A CB    1 
ATOM   4200  C  CG    . GLU A 1 634  ? -14.163 29.551  -34.212 1.00 81.50  ? 662  GLU A CG    1 
ATOM   4201  C  CD    . GLU A 1 634  ? -13.283 29.125  -35.373 1.00 90.20  ? 662  GLU A CD    1 
ATOM   4202  O  OE1   . GLU A 1 634  ? -12.292 28.402  -35.135 1.00 90.43  ? 662  GLU A OE1   1 
ATOM   4203  O  OE2   . GLU A 1 634  ? -13.578 29.517  -36.521 1.00 87.13  ? 662  GLU A OE2   1 
ATOM   4204  N  N     . PRO A 1 710  ? -0.291  15.431  -26.219 1.00 90.49  ? 738  PRO A N     1 
ATOM   4205  C  CA    . PRO A 1 710  ? 1.004   15.830  -26.781 1.00 90.21  ? 738  PRO A CA    1 
ATOM   4206  C  C     . PRO A 1 710  ? 0.989   15.856  -28.307 1.00 85.85  ? 738  PRO A C     1 
ATOM   4207  O  O     . PRO A 1 710  ? 1.618   16.721  -28.917 1.00 84.79  ? 738  PRO A O     1 
ATOM   4208  C  CB    . PRO A 1 710  ? 1.957   14.749  -26.263 1.00 87.46  ? 738  PRO A CB    1 
ATOM   4209  C  CG    . PRO A 1 710  ? 1.320   14.264  -25.006 1.00 87.10  ? 738  PRO A CG    1 
ATOM   4210  C  CD    . PRO A 1 710  ? -0.159  14.325  -25.254 1.00 85.78  ? 738  PRO A CD    1 
ATOM   4211  N  N     . TYR A 1 711  ? 0.272   14.912  -28.908 1.00 93.15  ? 739  TYR A N     1 
ATOM   4212  C  CA    . TYR A 1 711  ? 0.185   14.804  -30.361 1.00 74.40  ? 739  TYR A CA    1 
ATOM   4213  C  C     . TYR A 1 711  ? -1.229  14.418  -30.793 1.00 70.06  ? 739  TYR A C     1 
ATOM   4214  O  O     . TYR A 1 711  ? -1.892  13.638  -30.109 1.00 68.56  ? 739  TYR A O     1 
ATOM   4215  C  CB    . TYR A 1 711  ? 1.198   13.780  -30.879 1.00 70.68  ? 739  TYR A CB    1 
ATOM   4216  C  CG    . TYR A 1 711  ? 2.635   14.204  -30.690 1.00 77.00  ? 739  TYR A CG    1 
ATOM   4217  C  CD1   . TYR A 1 711  ? 3.260   15.035  -31.610 1.00 76.23  ? 739  TYR A CD1   1 
ATOM   4218  C  CD2   . TYR A 1 711  ? 3.366   13.776  -29.590 1.00 70.98  ? 739  TYR A CD2   1 
ATOM   4219  C  CE1   . TYR A 1 711  ? 4.572   15.427  -31.441 1.00 90.57  ? 739  TYR A CE1   1 
ATOM   4220  C  CE2   . TYR A 1 711  ? 4.677   14.162  -29.413 1.00 74.49  ? 739  TYR A CE2   1 
ATOM   4221  C  CZ    . TYR A 1 711  ? 5.275   14.988  -30.340 1.00 92.51  ? 739  TYR A CZ    1 
ATOM   4222  O  OH    . TYR A 1 711  ? 6.585   15.373  -30.165 1.00 72.30  ? 739  TYR A OH    1 
ATOM   4223  N  N     . ASN A 1 712  ? -1.688  14.949  -31.926 1.00 72.21  ? 740  ASN A N     1 
ATOM   4224  C  CA    . ASN A 1 712  ? -0.885  15.813  -32.788 1.00 71.32  ? 740  ASN A CA    1 
ATOM   4225  C  C     . ASN A 1 712  ? -1.097  17.289  -32.459 1.00 71.27  ? 740  ASN A C     1 
ATOM   4226  O  O     . ASN A 1 712  ? -1.281  17.646  -31.295 1.00 76.71  ? 740  ASN A O     1 
ATOM   4227  C  CB    . ASN A 1 712  ? -1.217  15.537  -34.259 1.00 76.41  ? 740  ASN A CB    1 
ATOM   4228  C  CG    . ASN A 1 712  ? -0.072  15.882  -35.197 1.00 77.74  ? 740  ASN A CG    1 
ATOM   4229  O  OD1   . ASN A 1 712  ? -0.073  16.934  -35.837 1.00 69.39  ? 740  ASN A OD1   1 
ATOM   4230  N  ND2   . ASN A 1 712  ? 0.913   14.995  -35.282 1.00 77.27  ? 740  ASN A ND2   1 
ATOM   4231  N  N     . ASP A 1 713  ? -1.064  18.136  -33.487 1.00 74.83  ? 741  ASP A N     1 
ATOM   4232  C  CA    . ASP A 1 713  ? -1.270  19.576  -33.341 1.00 92.78  ? 741  ASP A CA    1 
ATOM   4233  C  C     . ASP A 1 713  ? -0.264  20.208  -32.379 1.00 90.35  ? 741  ASP A C     1 
ATOM   4234  O  O     . ASP A 1 713  ? -0.647  20.898  -31.433 1.00 90.65  ? 741  ASP A O     1 
ATOM   4235  C  CB    . ASP A 1 713  ? -2.695  19.867  -32.864 1.00 86.71  ? 741  ASP A CB    1 
ATOM   4236  C  CG    . ASP A 1 713  ? -3.732  19.032  -33.587 1.00 91.48  ? 741  ASP A CG    1 
ATOM   4237  O  OD1   . ASP A 1 713  ? -4.704  18.596  -32.935 1.00 85.99  ? 741  ASP A OD1   1 
ATOM   4238  O  OD2   . ASP A 1 713  ? -3.573  18.808  -34.805 1.00 81.34  ? 741  ASP A OD2   1 
ATOM   4239  N  N     . VAL A 1 714  ? 1.021   19.975  -32.630 1.00 92.96  ? 742  VAL A N     1 
ATOM   4240  C  CA    . VAL A 1 714  ? 2.074   20.471  -31.749 1.00 92.61  ? 742  VAL A CA    1 
ATOM   4241  C  C     . VAL A 1 714  ? 3.001   21.451  -32.462 1.00 92.09  ? 742  VAL A C     1 
ATOM   4242  O  O     . VAL A 1 714  ? 3.512   22.390  -31.852 1.00 90.04  ? 742  VAL A O     1 
ATOM   4243  C  CB    . VAL A 1 714  ? 2.916   19.315  -31.178 1.00 20.00  ? 742  VAL A CB    1 
ATOM   4244  C  CG1   . VAL A 1 714  ? 4.075   19.856  -30.355 1.00 20.00  ? 742  VAL A CG1   1 
ATOM   4245  C  CG2   . VAL A 1 714  ? 2.048   18.386  -30.342 1.00 20.00  ? 742  VAL A CG2   1 
ATOM   4246  N  N     . ASP A 1 715  ? 3.217   21.226  -33.753 1.00 74.77  ? 743  ASP A N     1 
ATOM   4247  C  CA    . ASP A 1 715  ? 4.119   22.062  -34.538 1.00 72.74  ? 743  ASP A CA    1 
ATOM   4248  C  C     . ASP A 1 715  ? 3.524   23.442  -34.810 1.00 84.36  ? 743  ASP A C     1 
ATOM   4249  O  O     . ASP A 1 715  ? 3.966   24.437  -34.238 1.00 87.03  ? 743  ASP A O     1 
ATOM   4250  C  CB    . ASP A 1 715  ? 4.471   21.374  -35.859 1.00 74.44  ? 743  ASP A CB    1 
ATOM   4251  C  CG    . ASP A 1 715  ? 3.845   19.998  -35.984 1.00 68.23  ? 743  ASP A CG    1 
ATOM   4252  O  OD1   . ASP A 1 715  ? 2.678   19.833  -35.569 1.00 76.24  ? 743  ASP A OD1   1 
ATOM   4253  O  OD2   . ASP A 1 715  ? 4.522   19.082  -36.494 1.00 86.68  ? 743  ASP A OD2   1 
ATOM   4254  N  N     . ILE A 1 716  ? 2.521   23.498  -35.682 1.00 43.51  ? 744  ILE A N     1 
ATOM   4255  C  CA    . ILE A 1 716  ? 1.896   24.771  -36.044 1.00 64.46  ? 744  ILE A CA    1 
ATOM   4256  C  C     . ILE A 1 716  ? 0.579   25.062  -35.290 1.00 56.72  ? 744  ILE A C     1 
ATOM   4257  O  O     . ILE A 1 716  ? 0.329   26.215  -34.931 1.00 56.37  ? 744  ILE A O     1 
ATOM   4258  C  CB    . ILE A 1 716  ? 1.667   24.860  -37.590 1.00 46.41  ? 744  ILE A CB    1 
ATOM   4259  C  CG1   . ILE A 1 716  ? 0.432   25.702  -37.928 1.00 41.87  ? 744  ILE A CG1   1 
ATOM   4260  C  CG2   . ILE A 1 716  ? 1.588   23.476  -38.224 1.00 56.45  ? 744  ILE A CG2   1 
ATOM   4261  C  CD1   . ILE A 1 716  ? 0.277   25.996  -39.406 1.00 42.68  ? 744  ILE A CD1   1 
ATOM   4262  N  N     . PRO A 1 717  ? -0.260  24.038  -35.023 1.00 45.61  ? 745  PRO A N     1 
ATOM   4263  C  CA    . PRO A 1 717  ? -1.411  24.389  -34.180 1.00 40.81  ? 745  PRO A CA    1 
ATOM   4264  C  C     . PRO A 1 717  ? -1.023  24.549  -32.709 1.00 81.24  ? 745  PRO A C     1 
ATOM   4265  O  O     . PRO A 1 717  ? 0.165   24.573  -32.388 1.00 90.66  ? 745  PRO A O     1 
ATOM   4266  C  CB    . PRO A 1 717  ? -2.363  23.199  -34.363 1.00 43.18  ? 745  PRO A CB    1 
ATOM   4267  C  CG    . PRO A 1 717  ? -1.865  22.472  -35.575 1.00 40.68  ? 745  PRO A CG    1 
ATOM   4268  C  CD    . PRO A 1 717  ? -0.390  22.670  -35.554 1.00 42.14  ? 745  PRO A CD    1 
ATOM   4269  N  N     . GLY A 1 718  ? -2.013  24.650  -31.827 1.00 81.36  ? 746  GLY A N     1 
ATOM   4270  C  CA    . GLY A 1 718  ? -1.747  24.813  -30.409 1.00 84.37  ? 746  GLY A CA    1 
ATOM   4271  C  C     . GLY A 1 718  ? -2.626  23.955  -29.518 1.00 90.30  ? 746  GLY A C     1 
ATOM   4272  O  O     . GLY A 1 718  ? -3.833  23.853  -29.737 1.00 74.13  ? 746  GLY A O     1 
ATOM   4273  N  N     . CYS A 1 719  ? -2.013  23.340  -28.510 1.00 81.00  ? 747  CYS A N     1 
ATOM   4274  C  CA    . CYS A 1 719  ? -2.733  22.516  -27.541 1.00 86.86  ? 747  CYS A CA    1 
ATOM   4275  C  C     . CYS A 1 719  ? -1.885  22.266  -26.298 1.00 90.48  ? 747  CYS A C     1 
ATOM   4276  O  O     . CYS A 1 719  ? -0.660  22.390  -26.335 1.00 92.95  ? 747  CYS A O     1 
ATOM   4277  C  CB    . CYS A 1 719  ? -3.150  21.182  -28.165 1.00 91.37  ? 747  CYS A CB    1 
ATOM   4278  S  SG    . CYS A 1 719  ? -4.017  20.063  -27.035 1.00 43.67  ? 747  CYS A SG    1 
ATOM   4279  N  N     . TRP A 1 720  ? -2.542  21.912  -25.198 1.00 70.12  ? 748  TRP A N     1 
ATOM   4280  C  CA    . TRP A 1 720  ? -1.844  21.615  -23.953 1.00 69.38  ? 748  TRP A CA    1 
ATOM   4281  C  C     . TRP A 1 720  ? -2.108  20.176  -23.528 1.00 84.96  ? 748  TRP A C     1 
ATOM   4282  O  O     . TRP A 1 720  ? -3.208  19.654  -23.713 1.00 92.48  ? 748  TRP A O     1 
ATOM   4283  C  CB    . TRP A 1 720  ? -2.268  22.585  -22.849 1.00 73.20  ? 748  TRP A CB    1 
ATOM   4284  C  CG    . TRP A 1 720  ? -1.165  23.497  -22.384 1.00 69.46  ? 748  TRP A CG    1 
ATOM   4285  C  CD1   . TRP A 1 720  ? -0.519  23.456  -21.181 1.00 70.26  ? 748  TRP A CD1   1 
ATOM   4286  C  CD2   . TRP A 1 720  ? -0.580  24.582  -23.117 1.00 72.78  ? 748  TRP A CD2   1 
ATOM   4287  N  NE1   . TRP A 1 720  ? 0.429   24.450  -21.120 1.00 72.21  ? 748  TRP A NE1   1 
ATOM   4288  C  CE2   . TRP A 1 720  ? 0.412   25.154  -22.295 1.00 77.74  ? 748  TRP A CE2   1 
ATOM   4289  C  CE3   . TRP A 1 720  ? -0.799  25.126  -24.386 1.00 73.89  ? 748  TRP A CE3   1 
ATOM   4290  C  CZ2   . TRP A 1 720  ? 1.184   26.243  -22.702 1.00 68.28  ? 748  TRP A CZ2   1 
ATOM   4291  C  CZ3   . TRP A 1 720  ? -0.031  26.206  -24.789 1.00 77.96  ? 748  TRP A CZ3   1 
ATOM   4292  C  CH2   . TRP A 1 720  ? 0.947   26.753  -23.949 1.00 75.97  ? 748  TRP A CH2   1 
ATOM   4293  N  N     . PHE A 1 721  ? -1.092  19.539  -22.957 1.00 73.53  ? 749  PHE A N     1 
ATOM   4294  C  CA    . PHE A 1 721  ? -1.197  18.141  -22.558 1.00 68.16  ? 749  PHE A CA    1 
ATOM   4295  C  C     . PHE A 1 721  ? -1.968  17.977  -21.257 1.00 70.06  ? 749  PHE A C     1 
ATOM   4296  O  O     . PHE A 1 721  ? -3.001  18.613  -21.047 1.00 71.70  ? 749  PHE A O     1 
ATOM   4297  C  CB    . PHE A 1 721  ? 0.193   17.521  -22.418 1.00 75.93  ? 749  PHE A CB    1 
ATOM   4298  C  CG    . PHE A 1 721  ? 1.219   18.457  -21.850 1.00 70.59  ? 749  PHE A CG    1 
ATOM   4299  C  CD1   . PHE A 1 721  ? 2.094   19.129  -22.687 1.00 77.61  ? 749  PHE A CD1   1 
ATOM   4300  C  CD2   . PHE A 1 721  ? 1.310   18.667  -20.484 1.00 75.37  ? 749  PHE A CD2   1 
ATOM   4301  C  CE1   . PHE A 1 721  ? 3.040   19.991  -22.174 1.00 68.54  ? 749  PHE A CE1   1 
ATOM   4302  C  CE2   . PHE A 1 721  ? 2.257   19.531  -19.966 1.00 81.40  ? 749  PHE A CE2   1 
ATOM   4303  C  CZ    . PHE A 1 721  ? 3.122   20.192  -20.812 1.00 84.78  ? 749  PHE A CZ    1 
ATOM   4304  N  N     . PHE A 1 722  ? -1.456  17.115  -20.386 1.00 93.13  ? 750  PHE A N     1 
ATOM   4305  C  CA    . PHE A 1 722  ? -2.119  16.845  -19.124 1.00 77.75  ? 750  PHE A CA    1 
ATOM   4306  C  C     . PHE A 1 722  ? -1.240  17.224  -17.942 1.00 90.46  ? 750  PHE A C     1 
ATOM   4307  O  O     . PHE A 1 722  ? -1.611  18.063  -17.124 1.00 90.07  ? 750  PHE A O     1 
ATOM   4308  C  CB    . PHE A 1 722  ? -2.515  15.371  -19.036 1.00 90.45  ? 750  PHE A CB    1 
ATOM   4309  C  CG    . PHE A 1 722  ? -3.850  15.147  -18.398 1.00 84.06  ? 750  PHE A CG    1 
ATOM   4310  C  CD1   . PHE A 1 722  ? -4.006  15.267  -17.028 1.00 85.02  ? 750  PHE A CD1   1 
ATOM   4311  C  CD2   . PHE A 1 722  ? -4.951  14.817  -19.168 1.00 69.80  ? 750  PHE A CD2   1 
ATOM   4312  C  CE1   . PHE A 1 722  ? -5.239  15.060  -16.436 1.00 75.45  ? 750  PHE A CE1   1 
ATOM   4313  C  CE2   . PHE A 1 722  ? -6.185  14.608  -18.585 1.00 75.27  ? 750  PHE A CE2   1 
ATOM   4314  C  CZ    . PHE A 1 722  ? -6.331  14.727  -17.217 1.00 71.58  ? 750  PHE A CZ    1 
ATOM   4315  N  N     . LYS A 1 723  ? -0.076  16.592  -17.851 1.00 76.43  ? 751  LYS A N     1 
ATOM   4316  C  CA    . LYS A 1 723  ? 0.804   16.776  -16.705 1.00 73.68  ? 751  LYS A CA    1 
ATOM   4317  C  C     . LYS A 1 723  ? 2.241   17.107  -17.119 1.00 74.82  ? 751  LYS A C     1 
ATOM   4318  O  O     . LYS A 1 723  ? 2.615   18.274  -17.213 1.00 90.19  ? 751  LYS A O     1 
ATOM   4319  C  CB    . LYS A 1 723  ? 0.798   15.519  -15.830 1.00 74.40  ? 751  LYS A CB    1 
ATOM   4320  C  CG    . LYS A 1 723  ? -0.410  14.612  -16.044 1.00 84.62  ? 751  LYS A CG    1 
ATOM   4321  C  CD    . LYS A 1 723  ? -0.939  14.037  -14.742 1.00 90.23  ? 751  LYS A CD    1 
ATOM   4322  C  CE    . LYS A 1 723  ? -1.873  15.010  -14.030 1.00 93.30  ? 751  LYS A CE    1 
ATOM   4323  N  NZ    . LYS A 1 723  ? -1.146  16.105  -13.334 1.00 86.85  ? 751  LYS A NZ    1 
ATOM   4324  N  N     . LEU A 1 724  ? 3.023   16.059  -17.370 1.00 41.06  ? 752  LEU A N     1 
ATOM   4325  C  CA    . LEU A 1 724  ? 4.460   16.143  -17.655 1.00 68.62  ? 752  LEU A CA    1 
ATOM   4326  C  C     . LEU A 1 724  ? 5.197   16.989  -16.570 1.00 43.34  ? 752  LEU A C     1 
ATOM   4327  O  O     . LEU A 1 724  ? 5.421   16.455  -15.483 1.00 46.12  ? 752  LEU A O     1 
ATOM   4328  C  CB    . LEU A 1 724  ? 4.681   16.624  -19.095 1.00 64.61  ? 752  LEU A CB    1 
ATOM   4329  C  CG    . LEU A 1 724  ? 4.420   15.635  -20.232 1.00 55.57  ? 752  LEU A CG    1 
ATOM   4330  C  CD1   . LEU A 1 724  ? 5.520   15.732  -21.276 1.00 64.23  ? 752  LEU A CD1   1 
ATOM   4331  C  CD2   . LEU A 1 724  ? 4.303   14.212  -19.709 1.00 69.03  ? 752  LEU A CD2   1 
ATOM   4332  N  N     . PRO A 1 725  ? 5.587   18.272  -16.807 1.00 43.31  ? 753  PRO A N     1 
ATOM   4333  C  CA    . PRO A 1 725  ? 5.660   19.297  -17.863 1.00 87.95  ? 753  PRO A CA    1 
ATOM   4334  C  C     . PRO A 1 725  ? 7.017   19.338  -18.575 1.00 92.08  ? 753  PRO A C     1 
ATOM   4335  O  O     . PRO A 1 725  ? 8.068   19.306  -17.929 1.00 87.15  ? 753  PRO A O     1 
ATOM   4336  C  CB    . PRO A 1 725  ? 5.405   20.593  -17.101 1.00 93.15  ? 753  PRO A CB    1 
ATOM   4337  C  CG    . PRO A 1 725  ? 5.993   20.352  -15.772 1.00 85.46  ? 753  PRO A CG    1 
ATOM   4338  C  CD    . PRO A 1 725  ? 5.923   18.865  -15.497 1.00 90.92  ? 753  PRO A CD    1 
ATOM   4339  N  N     . HIS A 1 726  ? 6.981   19.403  -19.904 1.00 86.55  ? 754  HIS A N     1 
ATOM   4340  C  CA    . HIS A 1 726  ? 8.193   19.527  -20.712 1.00 87.28  ? 754  HIS A CA    1 
ATOM   4341  C  C     . HIS A 1 726  ? 7.961   20.346  -21.980 1.00 90.71  ? 754  HIS A C     1 
ATOM   4342  O  O     . HIS A 1 726  ? 6.855   20.826  -22.229 1.00 48.39  ? 754  HIS A O     1 
ATOM   4343  C  CB    . HIS A 1 726  ? 8.735   18.146  -21.075 1.00 86.13  ? 754  HIS A CB    1 
ATOM   4344  C  CG    . HIS A 1 726  ? 9.295   17.399  -19.908 1.00 87.25  ? 754  HIS A CG    1 
ATOM   4345  N  ND1   . HIS A 1 726  ? 8.597   16.412  -19.249 1.00 92.24  ? 754  HIS A ND1   1 
ATOM   4346  C  CD2   . HIS A 1 726  ? 10.482  17.514  -19.262 1.00 87.33  ? 754  HIS A CD2   1 
ATOM   4347  C  CE1   . HIS A 1 726  ? 9.331   15.939  -18.257 1.00 45.40  ? 754  HIS A CE1   1 
ATOM   4348  N  NE2   . HIS A 1 726  ? 10.480  16.594  -18.245 1.00 46.45  ? 754  HIS A NE2   1 
ATOM   4349  N  N     . LYS A 1 727  ? 9.017   20.504  -22.774 1.00 90.48  ? 755  LYS A N     1 
ATOM   4350  C  CA    . LYS A 1 727  ? 8.961   21.318  -23.985 1.00 74.97  ? 755  LYS A CA    1 
ATOM   4351  C  C     . LYS A 1 727  ? 7.971   20.757  -24.999 1.00 71.04  ? 755  LYS A C     1 
ATOM   4352  O  O     . LYS A 1 727  ? 6.863   21.274  -25.143 1.00 70.15  ? 755  LYS A O     1 
ATOM   4353  C  CB    . LYS A 1 727  ? 10.348  21.432  -24.621 1.00 68.10  ? 755  LYS A CB    1 
ATOM   4354  C  CG    . LYS A 1 727  ? 11.321  22.310  -23.851 1.00 92.65  ? 755  LYS A CG    1 
ATOM   4355  C  CD    . LYS A 1 727  ? 11.774  23.489  -24.696 1.00 86.60  ? 755  LYS A CD    1 
ATOM   4356  C  CE    . LYS A 1 727  ? 12.331  23.025  -26.035 1.00 90.80  ? 755  LYS A CE    1 
ATOM   4357  N  NZ    . LYS A 1 727  ? 12.703  24.164  -26.918 1.00 81.62  ? 755  LYS A NZ    1 
ATOM   4358  N  N     . ASP A 1 728  ? 8.389   19.706  -25.701 1.00 90.19  ? 756  ASP A N     1 
ATOM   4359  C  CA    . ASP A 1 728  ? 7.541   18.999  -26.661 1.00 87.58  ? 756  ASP A CA    1 
ATOM   4360  C  C     . ASP A 1 728  ? 7.078   19.875  -27.827 1.00 90.91  ? 756  ASP A C     1 
ATOM   4361  O  O     . ASP A 1 728  ? 5.945   19.747  -28.289 1.00 90.57  ? 756  ASP A O     1 
ATOM   4362  C  CB    . ASP A 1 728  ? 6.317   18.407  -25.956 1.00 91.19  ? 756  ASP A CB    1 
ATOM   4363  C  CG    . ASP A 1 728  ? 6.659   17.787  -24.618 1.00 72.07  ? 756  ASP A CG    1 
ATOM   4364  O  OD1   . ASP A 1 728  ? 7.813   17.342  -24.441 1.00 76.18  ? 756  ASP A OD1   1 
ATOM   4365  O  OD2   . ASP A 1 728  ? 5.772   17.746  -23.741 1.00 84.12  ? 756  ASP A OD2   1 
ATOM   4366  N  N     . GLY A 1 729  ? 7.953   20.756  -28.303 1.00 93.89  ? 757  GLY A N     1 
ATOM   4367  C  CA    . GLY A 1 729  ? 7.658   21.555  -29.480 1.00 90.73  ? 757  GLY A CA    1 
ATOM   4368  C  C     . GLY A 1 729  ? 7.758   23.054  -29.282 1.00 81.19  ? 757  GLY A C     1 
ATOM   4369  O  O     . GLY A 1 729  ? 6.816   23.791  -29.568 1.00 76.33  ? 757  GLY A O     1 
ATOM   4370  N  N     . ASN A 1 730  ? 8.906   23.509  -28.794 1.00 70.93  ? 758  ASN A N     1 
ATOM   4371  C  CA    . ASN A 1 730  ? 9.138   24.936  -28.591 1.00 75.96  ? 758  ASN A CA    1 
ATOM   4372  C  C     . ASN A 1 730  ? 10.284  25.437  -29.464 1.00 74.89  ? 758  ASN A C     1 
ATOM   4373  O  O     . ASN A 1 730  ? 11.243  24.708  -29.717 1.00 77.18  ? 758  ASN A O     1 
ATOM   4374  C  CB    . ASN A 1 730  ? 9.426   25.226  -27.117 1.00 71.26  ? 758  ASN A CB    1 
ATOM   4375  C  CG    . ASN A 1 730  ? 8.312   24.749  -26.205 1.00 87.38  ? 758  ASN A CG    1 
ATOM   4376  O  OD1   . ASN A 1 730  ? 7.177   24.549  -26.645 1.00 90.53  ? 758  ASN A OD1   1 
ATOM   4377  N  ND2   . ASN A 1 730  ? 8.625   24.568  -24.929 1.00 87.03  ? 758  ASN A ND2   1 
ATOM   4378  N  N     . SER A 1 731  ? 10.182  26.678  -29.929 1.00 77.54  ? 759  SER A N     1 
ATOM   4379  C  CA    . SER A 1 731  ? 11.215  27.254  -30.783 1.00 76.07  ? 759  SER A CA    1 
ATOM   4380  C  C     . SER A 1 731  ? 12.193  28.102  -29.975 1.00 86.96  ? 759  SER A C     1 
ATOM   4381  O  O     . SER A 1 731  ? 13.408  27.971  -30.121 1.00 73.99  ? 759  SER A O     1 
ATOM   4382  C  CB    . SER A 1 731  ? 10.585  28.098  -31.893 1.00 20.00  ? 759  SER A CB    1 
ATOM   4383  O  OG    . SER A 1 731  ? 9.894   29.212  -31.357 1.00 20.00  ? 759  SER A OG    1 
ATOM   4384  N  N     . CYS A 1 732  ? 11.655  28.969  -29.123 1.00 87.58  ? 760  CYS A N     1 
ATOM   4385  C  CA    . CYS A 1 732  ? 12.482  29.837  -28.293 1.00 74.98  ? 760  CYS A CA    1 
ATOM   4386  C  C     . CYS A 1 732  ? 13.177  29.046  -27.192 1.00 74.20  ? 760  CYS A C     1 
ATOM   4387  O  O     . CYS A 1 732  ? 12.643  28.054  -26.695 1.00 74.34  ? 760  CYS A O     1 
ATOM   4388  C  CB    . CYS A 1 732  ? 11.639  30.958  -27.683 1.00 20.00  ? 760  CYS A CB    1 
ATOM   4389  S  SG    . CYS A 1 732  ? 12.578  32.149  -26.701 1.00 20.00  ? 760  CYS A SG    1 
ATOM   4390  N  N     . ASN A 1 733  ? 14.372  29.490  -26.815 1.00 76.59  ? 761  ASN A N     1 
ATOM   4391  C  CA    . ASN A 1 733  ? 15.153  28.808  -25.791 1.00 84.82  ? 761  ASN A CA    1 
ATOM   4392  C  C     . ASN A 1 733  ? 15.240  29.609  -24.496 1.00 87.95  ? 761  ASN A C     1 
ATOM   4393  O  O     . ASN A 1 733  ? 16.180  29.440  -23.719 1.00 87.70  ? 761  ASN A O     1 
ATOM   4394  C  CB    . ASN A 1 733  ? 16.566  28.514  -26.302 1.00 92.83  ? 761  ASN A CB    1 
ATOM   4395  C  CG    . ASN A 1 733  ? 16.714  28.761  -27.791 1.00 71.50  ? 761  ASN A CG    1 
ATOM   4396  O  OD1   . ASN A 1 733  ? 15.796  28.506  -28.571 1.00 73.30  ? 761  ASN A OD1   1 
ATOM   4397  N  ND2   . ASN A 1 733  ? 17.876  29.263  -28.194 1.00 93.56  ? 761  ASN A ND2   1 
ATOM   4398  N  N     . VAL A 1 734  ? 14.262  30.479  -24.262 1.00 92.24  ? 762  VAL A N     1 
ATOM   4399  C  CA    . VAL A 1 734  ? 14.294  31.340  -23.085 1.00 77.64  ? 762  VAL A CA    1 
ATOM   4400  C  C     . VAL A 1 734  ? 12.927  31.481  -22.411 1.00 72.40  ? 762  VAL A C     1 
ATOM   4401  O  O     . VAL A 1 734  ? 12.808  31.308  -21.197 1.00 71.89  ? 762  VAL A O     1 
ATOM   4402  C  CB    . VAL A 1 734  ? 14.843  32.746  -23.444 1.00 69.15  ? 762  VAL A CB    1 
ATOM   4403  C  CG1   . VAL A 1 734  ? 14.317  33.207  -24.800 1.00 74.53  ? 762  VAL A CG1   1 
ATOM   4404  C  CG2   . VAL A 1 734  ? 14.520  33.755  -22.348 1.00 74.37  ? 762  VAL A CG2   1 
ATOM   4405  N  N     . GLY A 1 735  ? 11.898  31.783  -23.196 1.00 72.75  ? 763  GLY A N     1 
ATOM   4406  C  CA    . GLY A 1 735  ? 10.573  32.016  -22.651 1.00 74.43  ? 763  GLY A CA    1 
ATOM   4407  C  C     . GLY A 1 735  ? 10.271  33.500  -22.564 1.00 75.78  ? 763  GLY A C     1 
ATOM   4408  O  O     . GLY A 1 735  ? 11.138  34.328  -22.846 1.00 72.76  ? 763  GLY A O     1 
ATOM   4409  N  N     . SER A 1 736  ? 9.047   33.840  -22.169 1.00 90.98  ? 764  SER A N     1 
ATOM   4410  C  CA    . SER A 1 736  ? 8.630   35.237  -22.138 1.00 84.01  ? 764  SER A CA    1 
ATOM   4411  C  C     . SER A 1 736  ? 7.418   35.486  -21.243 1.00 84.22  ? 764  SER A C     1 
ATOM   4412  O  O     . SER A 1 736  ? 6.277   35.318  -21.677 1.00 72.00  ? 764  SER A O     1 
ATOM   4413  C  CB    . SER A 1 736  ? 8.323   35.720  -23.558 1.00 85.66  ? 764  SER A CB    1 
ATOM   4414  O  OG    . SER A 1 736  ? 7.336   34.907  -24.168 1.00 72.12  ? 764  SER A OG    1 
ATOM   4415  N  N     . PRO A 1 737  ? 7.664   35.882  -19.984 1.00 92.71  ? 765  PRO A N     1 
ATOM   4416  C  CA    . PRO A 1 737  ? 6.620   36.323  -19.058 1.00 74.83  ? 765  PRO A CA    1 
ATOM   4417  C  C     . PRO A 1 737  ? 6.631   37.841  -18.859 1.00 73.35  ? 765  PRO A C     1 
ATOM   4418  O  O     . PRO A 1 737  ? 7.532   38.354  -18.195 1.00 77.09  ? 765  PRO A O     1 
ATOM   4419  C  CB    . PRO A 1 737  ? 6.992   35.602  -17.761 1.00 90.34  ? 765  PRO A CB    1 
ATOM   4420  C  CG    . PRO A 1 737  ? 8.506   35.377  -17.862 1.00 77.88  ? 765  PRO A CG    1 
ATOM   4421  C  CD    . PRO A 1 737  ? 8.943   35.701  -19.280 1.00 69.04  ? 765  PRO A CD    1 
ATOM   4422  N  N     . PHE A 1 738  ? 5.648   38.550  -19.410 1.00 71.75  ? 766  PHE A N     1 
ATOM   4423  C  CA    . PHE A 1 738  ? 4.554   37.946  -20.162 1.00 75.36  ? 766  PHE A CA    1 
ATOM   4424  C  C     . PHE A 1 738  ? 4.535   38.474  -21.596 1.00 68.58  ? 766  PHE A C     1 
ATOM   4425  O  O     . PHE A 1 738  ? 5.305   39.371  -21.938 1.00 74.10  ? 766  PHE A O     1 
ATOM   4426  C  CB    . PHE A 1 738  ? 3.217   38.228  -19.468 1.00 68.18  ? 766  PHE A CB    1 
ATOM   4427  C  CG    . PHE A 1 738  ? 2.071   37.423  -20.004 1.00 87.16  ? 766  PHE A CG    1 
ATOM   4428  C  CD1   . PHE A 1 738  ? 1.083   38.024  -20.767 1.00 91.36  ? 766  PHE A CD1   1 
ATOM   4429  C  CD2   . PHE A 1 738  ? 1.988   36.064  -19.760 1.00 92.73  ? 766  PHE A CD2   1 
ATOM   4430  C  CE1   . PHE A 1 738  ? 0.031   37.288  -21.270 1.00 84.93  ? 766  PHE A CE1   1 
ATOM   4431  C  CE2   . PHE A 1 738  ? 0.936   35.323  -20.259 1.00 84.67  ? 766  PHE A CE2   1 
ATOM   4432  C  CZ    . PHE A 1 738  ? -0.043  35.934  -21.014 1.00 90.93  ? 766  PHE A CZ    1 
ATOM   4433  N  N     . ALA A 1 739  ? 3.665   37.903  -22.428 1.00 69.90  ? 767  ALA A N     1 
ATOM   4434  C  CA    . ALA A 1 739  ? 3.459   38.364  -23.799 1.00 72.81  ? 767  ALA A CA    1 
ATOM   4435  C  C     . ALA A 1 739  ? 3.147   39.856  -23.840 1.00 73.95  ? 767  ALA A C     1 
ATOM   4436  O  O     . ALA A 1 739  ? 1.990   40.264  -23.723 1.00 66.87  ? 767  ALA A O     1 
ATOM   4437  C  CB    . ALA A 1 739  ? 2.339   37.576  -24.455 1.00 55.43  ? 767  ALA A CB    1 
ATOM   4438  N  N     . LYS A 1 740  ? 4.185   40.667  -24.015 1.00 72.07  ? 768  LYS A N     1 
ATOM   4439  C  CA    . LYS A 1 740  ? 4.045   42.113  -23.909 1.00 56.15  ? 768  LYS A CA    1 
ATOM   4440  C  C     . LYS A 1 740  ? 4.352   42.850  -25.208 1.00 56.44  ? 768  LYS A C     1 
ATOM   4441  O  O     . LYS A 1 740  ? 4.146   44.060  -25.303 1.00 49.29  ? 768  LYS A O     1 
ATOM   4442  C  CB    . LYS A 1 740  ? 4.938   42.639  -22.788 1.00 64.31  ? 768  LYS A CB    1 
ATOM   4443  C  CG    . LYS A 1 740  ? 4.181   42.989  -21.515 1.00 69.87  ? 768  LYS A CG    1 
ATOM   4444  C  CD    . LYS A 1 740  ? 3.245   41.869  -21.077 1.00 72.02  ? 768  LYS A CD    1 
ATOM   4445  C  CE    . LYS A 1 740  ? 1.784   42.276  -21.235 1.00 65.92  ? 768  LYS A CE    1 
ATOM   4446  N  NZ    . LYS A 1 740  ? 0.841   41.183  -20.877 1.00 44.64  ? 768  LYS A NZ    1 
ATOM   4447  N  N     . ASP A 1 741  ? 4.840   42.124  -26.206 1.00 68.79  ? 769  ASP A N     1 
ATOM   4448  C  CA    . ASP A 1 741  ? 5.063   42.710  -27.521 1.00 72.30  ? 769  ASP A CA    1 
ATOM   4449  C  C     . ASP A 1 741  ? 4.615   41.758  -28.621 1.00 73.72  ? 769  ASP A C     1 
ATOM   4450  O  O     . ASP A 1 741  ? 5.334   41.520  -29.592 1.00 68.78  ? 769  ASP A O     1 
ATOM   4451  C  CB    . ASP A 1 741  ? 6.531   43.091  -27.701 1.00 70.90  ? 769  ASP A CB    1 
ATOM   4452  C  CG    . ASP A 1 741  ? 6.855   44.438  -27.089 1.00 69.18  ? 769  ASP A CG    1 
ATOM   4453  O  OD1   . ASP A 1 741  ? 5.956   45.304  -27.060 1.00 70.27  ? 769  ASP A OD1   1 
ATOM   4454  O  OD2   . ASP A 1 741  ? 8.003   44.634  -26.638 1.00 81.05  ? 769  ASP A OD2   1 
ATOM   4455  N  N     . PHE A 1 742  ? 3.413   41.217  -28.458 1.00 77.35  ? 770  PHE A N     1 
ATOM   4456  C  CA    . PHE A 1 742  ? 2.824   40.355  -29.470 1.00 75.97  ? 770  PHE A CA    1 
ATOM   4457  C  C     . PHE A 1 742  ? 1.480   40.902  -29.931 1.00 72.49  ? 770  PHE A C     1 
ATOM   4458  O  O     . PHE A 1 742  ? 0.521   40.153  -30.098 1.00 74.80  ? 770  PHE A O     1 
ATOM   4459  C  CB    . PHE A 1 742  ? 2.665   38.932  -28.936 1.00 71.23  ? 770  PHE A CB    1 
ATOM   4460  C  CG    . PHE A 1 742  ? 3.966   38.274  -28.581 1.00 71.37  ? 770  PHE A CG    1 
ATOM   4461  C  CD1   . PHE A 1 742  ? 4.283   37.998  -27.264 1.00 73.33  ? 770  PHE A CD1   1 
ATOM   4462  C  CD2   . PHE A 1 742  ? 4.878   37.941  -29.568 1.00 71.50  ? 770  PHE A CD2   1 
ATOM   4463  C  CE1   . PHE A 1 742  ? 5.481   37.393  -26.937 1.00 75.44  ? 770  PHE A CE1   1 
ATOM   4464  C  CE2   . PHE A 1 742  ? 6.078   37.339  -29.248 1.00 73.49  ? 770  PHE A CE2   1 
ATOM   4465  C  CZ    . PHE A 1 742  ? 6.379   37.064  -27.928 1.00 68.81  ? 770  PHE A CZ    1 
ATOM   4466  N  N     . LEU A 1 743  ? 1.419   42.216  -30.127 1.00 67.41  ? 771  LEU A N     1 
ATOM   4467  C  CA    . LEU A 1 743  ? 0.225   42.862  -30.665 1.00 75.61  ? 771  LEU A CA    1 
ATOM   4468  C  C     . LEU A 1 743  ? -0.201  42.297  -32.026 1.00 76.60  ? 771  LEU A C     1 
ATOM   4469  O  O     . LEU A 1 743  ? -1.395  42.100  -32.255 1.00 71.86  ? 771  LEU A O     1 
ATOM   4470  C  CB    . LEU A 1 743  ? 0.435   44.377  -30.773 1.00 71.69  ? 771  LEU A CB    1 
ATOM   4471  C  CG    . LEU A 1 743  ? 0.041   45.225  -29.561 1.00 66.72  ? 771  LEU A CG    1 
ATOM   4472  C  CD1   . LEU A 1 743  ? -1.440  45.058  -29.258 1.00 66.94  ? 771  LEU A CD1   1 
ATOM   4473  C  CD2   . LEU A 1 743  ? 0.885   44.880  -28.343 1.00 55.96  ? 771  LEU A CD2   1 
ATOM   4474  N  N     . PRO A 1 744  ? 0.757   42.042  -32.940 1.00 71.10  ? 772  PRO A N     1 
ATOM   4475  C  CA    . PRO A 1 744  ? 0.300   41.377  -34.166 1.00 73.23  ? 772  PRO A CA    1 
ATOM   4476  C  C     . PRO A 1 744  ? -0.149  39.941  -33.911 1.00 71.71  ? 772  PRO A C     1 
ATOM   4477  O  O     . PRO A 1 744  ? -0.923  39.393  -34.695 1.00 70.96  ? 772  PRO A O     1 
ATOM   4478  C  CB    . PRO A 1 744  ? 1.537   41.414  -35.071 1.00 69.01  ? 772  PRO A CB    1 
ATOM   4479  C  CG    . PRO A 1 744  ? 2.686   41.565  -34.140 1.00 75.29  ? 772  PRO A CG    1 
ATOM   4480  C  CD    . PRO A 1 744  ? 2.176   42.433  -33.036 1.00 72.03  ? 772  PRO A CD    1 
ATOM   4481  N  N     . LYS A 1 745  ? 0.331   39.345  -32.824 1.00 76.35  ? 773  LYS A N     1 
ATOM   4482  C  CA    . LYS A 1 745  ? -0.071  37.993  -32.456 1.00 68.40  ? 773  LYS A CA    1 
ATOM   4483  C  C     . LYS A 1 745  ? -1.232  38.042  -31.464 1.00 77.78  ? 773  LYS A C     1 
ATOM   4484  O  O     . LYS A 1 745  ? -1.666  37.016  -30.942 1.00 74.14  ? 773  LYS A O     1 
ATOM   4485  C  CB    . LYS A 1 745  ? 1.111   37.221  -31.866 1.00 67.11  ? 773  LYS A CB    1 
ATOM   4486  C  CG    . LYS A 1 745  ? 1.027   35.717  -32.072 1.00 74.79  ? 773  LYS A CG    1 
ATOM   4487  C  CD    . LYS A 1 745  ? 0.881   35.377  -33.549 1.00 71.35  ? 773  LYS A CD    1 
ATOM   4488  C  CE    . LYS A 1 745  ? 0.625   33.893  -33.758 1.00 75.88  ? 773  LYS A CE    1 
ATOM   4489  N  NZ    . LYS A 1 745  ? 0.494   33.545  -35.201 1.00 68.90  ? 773  LYS A NZ    1 
ATOM   4490  N  N     . MET A 1 746  ? -1.727  39.249  -31.210 1.00 69.54  ? 774  MET A N     1 
ATOM   4491  C  CA    . MET A 1 746  ? -2.878  39.446  -30.340 1.00 77.81  ? 774  MET A CA    1 
ATOM   4492  C  C     . MET A 1 746  ? -4.037  40.008  -31.153 1.00 71.65  ? 774  MET A C     1 
ATOM   4493  O  O     . MET A 1 746  ? -5.199  39.897  -30.764 1.00 76.86  ? 774  MET A O     1 
ATOM   4494  C  CB    . MET A 1 746  ? -2.528  40.384  -29.182 1.00 76.06  ? 774  MET A CB    1 
ATOM   4495  C  CG    . MET A 1 746  ? -2.935  39.874  -27.808 1.00 77.50  ? 774  MET A CG    1 
ATOM   4496  S  SD    . MET A 1 746  ? -4.720  39.793  -27.577 1.00 77.83  ? 774  MET A SD    1 
ATOM   4497  C  CE    . MET A 1 746  ? -4.814  39.152  -25.907 1.00 84.10  ? 774  MET A CE    1 
ATOM   4498  N  N     . GLU A 1 747  ? -3.705  40.611  -32.291 1.00 67.63  ? 775  GLU A N     1 
ATOM   4499  C  CA    . GLU A 1 747  ? -4.707  41.185  -33.180 1.00 72.70  ? 775  GLU A CA    1 
ATOM   4500  C  C     . GLU A 1 747  ? -4.788  40.411  -34.492 1.00 77.50  ? 775  GLU A C     1 
ATOM   4501  O  O     . GLU A 1 747  ? -4.796  41.000  -35.572 1.00 74.15  ? 775  GLU A O     1 
ATOM   4502  C  CB    . GLU A 1 747  ? -4.399  42.658  -33.457 1.00 68.36  ? 775  GLU A CB    1 
ATOM   4503  C  CG    . GLU A 1 747  ? -4.406  43.541  -32.218 1.00 73.64  ? 775  GLU A CG    1 
ATOM   4504  C  CD    . GLU A 1 747  ? -4.089  44.991  -32.532 1.00 68.81  ? 775  GLU A CD    1 
ATOM   4505  O  OE1   . GLU A 1 747  ? -3.733  45.287  -33.692 1.00 74.39  ? 775  GLU A OE1   1 
ATOM   4506  O  OE2   . GLU A 1 747  ? -4.196  45.836  -31.618 1.00 71.88  ? 775  GLU A OE2   1 
ATOM   4507  N  N     . ASP A 1 748  ? -4.842  39.086  -34.389 1.00 76.85  ? 776  ASP A N     1 
ATOM   4508  C  CA    . ASP A 1 748  ? -4.974  38.226  -35.559 1.00 85.93  ? 776  ASP A CA    1 
ATOM   4509  C  C     . ASP A 1 748  ? -5.696  36.935  -35.194 1.00 86.40  ? 776  ASP A C     1 
ATOM   4510  O  O     . ASP A 1 748  ? -5.608  35.938  -35.910 1.00 91.27  ? 776  ASP A O     1 
ATOM   4511  C  CB    . ASP A 1 748  ? -3.602  37.907  -36.159 1.00 71.52  ? 776  ASP A CB    1 
ATOM   4512  C  CG    . ASP A 1 748  ? -2.757  37.036  -35.250 1.00 70.01  ? 776  ASP A CG    1 
ATOM   4513  O  OD1   . ASP A 1 748  ? -2.876  37.172  -34.014 1.00 71.09  ? 776  ASP A OD1   1 
ATOM   4514  O  OD2   . ASP A 1 748  ? -1.973  36.214  -35.771 1.00 70.33  ? 776  ASP A OD2   1 
ATOM   4515  N  N     . GLY A 1 749  ? -6.409  36.961  -34.073 1.00 84.94  ? 777  GLY A N     1 
ATOM   4516  C  CA    . GLY A 1 749  ? -7.101  35.785  -33.585 1.00 87.70  ? 777  GLY A CA    1 
ATOM   4517  C  C     . GLY A 1 749  ? -6.329  35.112  -32.468 1.00 87.82  ? 777  GLY A C     1 
ATOM   4518  O  O     . GLY A 1 749  ? -6.623  35.313  -31.291 1.00 72.88  ? 777  GLY A O     1 
ATOM   4519  N  N     . THR A 1 750  ? -5.337  34.311  -32.841 1.00 81.60  ? 778  THR A N     1 
ATOM   4520  C  CA    . THR A 1 750  ? -4.495  33.621  -31.871 1.00 76.34  ? 778  THR A CA    1 
ATOM   4521  C  C     . THR A 1 750  ? -3.250  34.441  -31.563 1.00 77.99  ? 778  THR A C     1 
ATOM   4522  O  O     . THR A 1 750  ? -2.442  34.696  -32.456 1.00 65.62  ? 778  THR A O     1 
ATOM   4523  C  CB    . THR A 1 750  ? -4.065  32.235  -32.378 1.00 85.52  ? 778  THR A CB    1 
ATOM   4524  O  OG1   . THR A 1 750  ? -5.216  31.391  -32.508 1.00 72.74  ? 778  THR A OG1   1 
ATOM   4525  C  CG2   . THR A 1 750  ? -3.078  31.597  -31.414 1.00 92.95  ? 778  THR A CG2   1 
ATOM   4526  N  N     . LEU A 1 751  ? -3.083  34.843  -30.305 1.00 70.97  ? 779  LEU A N     1 
ATOM   4527  C  CA    . LEU A 1 751  ? -3.991  34.468  -29.223 1.00 73.51  ? 779  LEU A CA    1 
ATOM   4528  C  C     . LEU A 1 751  ? -4.907  35.620  -28.817 1.00 77.31  ? 779  LEU A C     1 
ATOM   4529  O  O     . LEU A 1 751  ? -4.707  36.762  -29.230 1.00 69.05  ? 779  LEU A O     1 
ATOM   4530  C  CB    . LEU A 1 751  ? -3.196  33.970  -28.003 1.00 76.75  ? 779  LEU A CB    1 
ATOM   4531  C  CG    . LEU A 1 751  ? -2.403  34.891  -27.052 1.00 74.79  ? 779  LEU A CG    1 
ATOM   4532  C  CD1   . LEU A 1 751  ? -1.636  35.999  -27.774 1.00 74.52  ? 779  LEU A CD1   1 
ATOM   4533  C  CD2   . LEU A 1 751  ? -3.279  35.483  -25.947 1.00 74.79  ? 779  LEU A CD2   1 
ATOM   4534  N  N     . GLN A 1 752  ? -5.909  35.308  -28.001 1.00 72.86  ? 780  GLN A N     1 
ATOM   4535  C  CA    . GLN A 1 752  ? -6.838  36.315  -27.501 1.00 70.58  ? 780  GLN A CA    1 
ATOM   4536  C  C     . GLN A 1 752  ? -7.082  36.129  -26.005 1.00 77.20  ? 780  GLN A C     1 
ATOM   4537  O  O     . GLN A 1 752  ? -6.484  35.257  -25.375 1.00 56.83  ? 780  GLN A O     1 
ATOM   4538  C  CB    . GLN A 1 752  ? -8.164  36.259  -28.269 1.00 69.19  ? 780  GLN A CB    1 
ATOM   4539  C  CG    . GLN A 1 752  ? -9.079  35.091  -27.902 1.00 76.18  ? 780  GLN A CG    1 
ATOM   4540  C  CD    . GLN A 1 752  ? -8.636  33.767  -28.499 1.00 73.61  ? 780  GLN A CD    1 
ATOM   4541  O  OE1   . GLN A 1 752  ? -7.660  33.701  -29.244 1.00 71.22  ? 780  GLN A OE1   1 
ATOM   4542  N  NE2   . GLN A 1 752  ? -9.359  32.703  -28.173 1.00 74.75  ? 780  GLN A NE2   1 
ATOM   4543  N  N     . ALA A 1 753  ? -7.957  36.956  -25.442 1.00 70.95  ? 781  ALA A N     1 
ATOM   4544  C  CA    . ALA A 1 753  ? -8.302  36.857  -24.028 1.00 68.29  ? 781  ALA A CA    1 
ATOM   4545  C  C     . ALA A 1 753  ? -9.808  36.705  -23.844 1.00 71.90  ? 781  ALA A C     1 
ATOM   4546  O  O     . ALA A 1 753  ? -10.582 36.930  -24.774 1.00 71.01  ? 781  ALA A O     1 
ATOM   4547  C  CB    . ALA A 1 753  ? -7.795  38.072  -23.271 1.00 64.14  ? 781  ALA A CB    1 
ATOM   4548  N  N     . GLY A 1 754  ? -10.217 36.323  -22.638 1.00 68.25  ? 782  GLY A N     1 
ATOM   4549  C  CA    . GLY A 1 754  ? -11.624 36.133  -22.338 1.00 71.57  ? 782  GLY A CA    1 
ATOM   4550  C  C     . GLY A 1 754  ? -11.868 35.762  -20.888 1.00 90.13  ? 782  GLY A C     1 
ATOM   4551  O  O     . GLY A 1 754  ? -11.268 34.815  -20.381 1.00 86.42  ? 782  GLY A O     1 
ATOM   4552  N  N     . PRO A 1 755  ? -12.756 36.505  -20.209 1.00 85.20  ? 783  PRO A N     1 
ATOM   4553  C  CA    . PRO A 1 755  ? -13.490 37.645  -20.770 1.00 84.67  ? 783  PRO A CA    1 
ATOM   4554  C  C     . PRO A 1 755  ? -12.672 38.939  -20.779 1.00 91.25  ? 783  PRO A C     1 
ATOM   4555  O  O     . PRO A 1 755  ? -12.032 39.272  -19.781 1.00 90.35  ? 783  PRO A O     1 
ATOM   4556  C  CB    . PRO A 1 755  ? -14.694 37.771  -19.837 1.00 85.70  ? 783  PRO A CB    1 
ATOM   4557  C  CG    . PRO A 1 755  ? -14.189 37.280  -18.526 1.00 90.86  ? 783  PRO A CG    1 
ATOM   4558  C  CD    . PRO A 1 755  ? -13.192 36.192  -18.836 1.00 93.22  ? 783  PRO A CD    1 
ATOM   4559  N  N     . GLY A 1 756  ? -12.695 39.653  -21.901 1.00 85.72  ? 784  GLY A N     1 
ATOM   4560  C  CA    . GLY A 1 756  ? -13.449 39.230  -23.066 1.00 90.88  ? 784  GLY A CA    1 
ATOM   4561  C  C     . GLY A 1 756  ? -13.551 40.308  -24.126 1.00 73.93  ? 784  GLY A C     1 
ATOM   4562  O  O     . GLY A 1 756  ? -13.670 41.493  -23.812 1.00 72.86  ? 784  GLY A O     1 
ATOM   4563  N  N     . GLY A 1 757  ? -13.502 39.895  -25.388 1.00 77.21  ? 785  GLY A N     1 
ATOM   4564  C  CA    . GLY A 1 757  ? -13.619 40.820  -26.501 1.00 70.72  ? 785  GLY A CA    1 
ATOM   4565  C  C     . GLY A 1 757  ? -12.296 41.445  -26.893 1.00 76.30  ? 785  GLY A C     1 
ATOM   4566  O  O     . GLY A 1 757  ? -11.296 40.747  -27.073 1.00 76.01  ? 785  GLY A O     1 
ATOM   4567  N  N     . ALA A 1 758  ? -12.291 42.767  -27.029 1.00 91.29  ? 786  ALA A N     1 
ATOM   4568  C  CA    . ALA A 1 758  ? -11.087 43.497  -27.404 1.00 92.03  ? 786  ALA A CA    1 
ATOM   4569  C  C     . ALA A 1 758  ? -10.373 44.048  -26.174 1.00 81.80  ? 786  ALA A C     1 
ATOM   4570  O  O     . ALA A 1 758  ? -9.578  44.982  -26.274 1.00 69.25  ? 786  ALA A O     1 
ATOM   4571  C  CB    . ALA A 1 758  ? -11.429 44.623  -28.368 1.00 92.98  ? 786  ALA A CB    1 
ATOM   4572  N  N     . SER A 1 759  ? -10.665 43.464  -25.016 1.00 68.57  ? 787  SER A N     1 
ATOM   4573  C  CA    . SER A 1 759  ? -10.034 43.873  -23.767 1.00 69.76  ? 787  SER A CA    1 
ATOM   4574  C  C     . SER A 1 759  ? -8.547  43.535  -23.775 1.00 72.91  ? 787  SER A C     1 
ATOM   4575  O  O     . SER A 1 759  ? -7.724  44.292  -23.259 1.00 81.32  ? 787  SER A O     1 
ATOM   4576  C  CB    . SER A 1 759  ? -10.723 43.203  -22.576 1.00 72.27  ? 787  SER A CB    1 
ATOM   4577  O  OG    . SER A 1 759  ? -10.122 43.589  -21.353 1.00 72.32  ? 787  SER A OG    1 
ATOM   4578  N  N     . GLY A 1 760  ? -8.214  42.392  -24.367 1.00 71.41  ? 788  GLY A N     1 
ATOM   4579  C  CA    . GLY A 1 760  ? -6.836  41.951  -24.490 1.00 71.71  ? 788  GLY A CA    1 
ATOM   4580  C  C     . GLY A 1 760  ? -5.933  42.916  -25.240 1.00 66.67  ? 788  GLY A C     1 
ATOM   4581  O  O     . GLY A 1 760  ? -5.016  43.492  -24.649 1.00 68.11  ? 788  GLY A O     1 
ATOM   4582  N  N     . PRO A 1 761  ? -6.183  43.097  -26.550 1.00 67.31  ? 789  PRO A N     1 
ATOM   4583  C  CA    . PRO A 1 761  ? -5.376  44.005  -27.375 1.00 60.24  ? 789  PRO A CA    1 
ATOM   4584  C  C     . PRO A 1 761  ? -5.350  45.434  -26.836 1.00 60.86  ? 789  PRO A C     1 
ATOM   4585  O  O     . PRO A 1 761  ? -4.358  46.139  -27.024 1.00 70.38  ? 789  PRO A O     1 
ATOM   4586  C  CB    . PRO A 1 761  ? -6.068  43.948  -28.744 1.00 66.67  ? 789  PRO A CB    1 
ATOM   4587  C  CG    . PRO A 1 761  ? -7.427  43.386  -28.478 1.00 68.37  ? 789  PRO A CG    1 
ATOM   4588  C  CD    . PRO A 1 761  ? -7.238  42.442  -27.339 1.00 69.21  ? 789  PRO A CD    1 
ATOM   4589  N  N     . ARG A 1 762  ? -6.421  45.850  -26.167 1.00 45.33  ? 790  ARG A N     1 
ATOM   4590  C  CA    . ARG A 1 762  ? -6.452  47.172  -25.556 1.00 55.38  ? 790  ARG A CA    1 
ATOM   4591  C  C     . ARG A 1 762  ? -5.528  47.225  -24.344 1.00 56.46  ? 790  ARG A C     1 
ATOM   4592  O  O     . ARG A 1 762  ? -4.847  48.223  -24.123 1.00 69.28  ? 790  ARG A O     1 
ATOM   4593  C  CB    . ARG A 1 762  ? -7.875  47.559  -25.149 1.00 70.28  ? 790  ARG A CB    1 
ATOM   4594  C  CG    . ARG A 1 762  ? -7.961  48.927  -24.487 1.00 75.27  ? 790  ARG A CG    1 
ATOM   4595  C  CD    . ARG A 1 762  ? -7.353  50.003  -25.377 1.00 64.42  ? 790  ARG A CD    1 
ATOM   4596  N  NE    . ARG A 1 762  ? -6.642  51.020  -24.606 1.00 42.16  ? 790  ARG A NE    1 
ATOM   4597  C  CZ    . ARG A 1 762  ? -7.195  52.141  -24.155 1.00 67.25  ? 790  ARG A CZ    1 
ATOM   4598  N  NH1   . ARG A 1 762  ? -8.473  52.398  -24.397 1.00 74.74  ? 790  ARG A NH1   1 
ATOM   4599  N  NH2   . ARG A 1 762  ? -6.468  53.007  -23.463 1.00 41.43  ? 790  ARG A NH2   1 
ATOM   4600  N  N     . ALA A 1 763  ? -5.507  46.149  -23.562 1.00 64.11  ? 791  ALA A N     1 
ATOM   4601  C  CA    . ALA A 1 763  ? -4.620  46.065  -22.406 1.00 65.78  ? 791  ALA A CA    1 
ATOM   4602  C  C     . ALA A 1 763  ? -3.157  46.079  -22.848 1.00 67.69  ? 791  ALA A C     1 
ATOM   4603  O  O     . ALA A 1 763  ? -2.320  46.767  -22.254 1.00 66.31  ? 791  ALA A O     1 
ATOM   4604  C  CB    . ALA A 1 763  ? -4.920  44.817  -21.593 1.00 48.72  ? 791  ALA A CB    1 
ATOM   4605  N  N     . LEU A 1 764  ? -2.860  45.317  -23.896 1.00 40.68  ? 792  LEU A N     1 
ATOM   4606  C  CA    . LEU A 1 764  ? -1.529  45.321  -24.493 1.00 49.32  ? 792  LEU A CA    1 
ATOM   4607  C  C     . LEU A 1 764  ? -1.169  46.711  -25.009 1.00 49.99  ? 792  LEU A C     1 
ATOM   4608  O  O     . LEU A 1 764  ? -0.024  47.152  -24.884 1.00 55.75  ? 792  LEU A O     1 
ATOM   4609  C  CB    . LEU A 1 764  ? -1.444  44.299  -25.628 1.00 42.99  ? 792  LEU A CB    1 
ATOM   4610  C  CG    . LEU A 1 764  ? -0.813  42.942  -25.306 1.00 55.19  ? 792  LEU A CG    1 
ATOM   4611  C  CD1   . LEU A 1 764  ? 0.646   43.116  -24.918 1.00 72.74  ? 792  LEU A CD1   1 
ATOM   4612  C  CD2   . LEU A 1 764  ? -1.582  42.226  -24.206 1.00 43.88  ? 792  LEU A CD2   1 
ATOM   4613  N  N     . GLU A 1 765  ? -2.152  47.395  -25.589 1.00 48.19  ? 793  GLU A N     1 
ATOM   4614  C  CA    . GLU A 1 765  ? -1.953  48.758  -26.071 1.00 56.48  ? 793  GLU A CA    1 
ATOM   4615  C  C     . GLU A 1 765  ? -1.575  49.693  -24.928 1.00 60.57  ? 793  GLU A C     1 
ATOM   4616  O  O     . GLU A 1 765  ? -0.616  50.456  -25.036 1.00 43.71  ? 793  GLU A O     1 
ATOM   4617  C  CB    . GLU A 1 765  ? -3.210  49.273  -26.779 1.00 72.45  ? 793  GLU A CB    1 
ATOM   4618  C  CG    . GLU A 1 765  ? -3.297  48.903  -28.253 1.00 69.84  ? 793  GLU A CG    1 
ATOM   4619  C  CD    . GLU A 1 765  ? -2.319  49.683  -29.113 1.00 81.45  ? 793  GLU A CD    1 
ATOM   4620  O  OE1   . GLU A 1 765  ? -2.082  49.272  -30.268 1.00 91.34  ? 793  GLU A OE1   1 
ATOM   4621  O  OE2   . GLU A 1 765  ? -1.792  50.711  -28.637 1.00 84.75  ? 793  GLU A OE2   1 
ATOM   4622  N  N     . ILE A 1 766  ? -2.333  49.622  -23.838 1.00 46.06  ? 794  ILE A N     1 
ATOM   4623  C  CA    . ILE A 1 766  ? -2.075  50.436  -22.654 1.00 45.23  ? 794  ILE A CA    1 
ATOM   4624  C  C     . ILE A 1 766  ? -0.682  50.162  -22.098 1.00 68.87  ? 794  ILE A C     1 
ATOM   4625  O  O     . ILE A 1 766  ? 0.042   51.089  -21.730 1.00 46.03  ? 794  ILE A O     1 
ATOM   4626  C  CB    . ILE A 1 766  ? -3.123  50.179  -21.554 1.00 46.95  ? 794  ILE A CB    1 
ATOM   4627  C  CG1   . ILE A 1 766  ? -4.509  50.612  -22.030 1.00 73.42  ? 794  ILE A CG1   1 
ATOM   4628  C  CG2   . ILE A 1 766  ? -2.756  50.917  -20.276 1.00 46.47  ? 794  ILE A CG2   1 
ATOM   4629  C  CD1   . ILE A 1 766  ? -5.602  50.376  -21.016 1.00 74.75  ? 794  ILE A CD1   1 
ATOM   4630  N  N     . ASN A 1 767  ? -0.309  48.887  -22.046 1.00 65.44  ? 795  ASN A N     1 
ATOM   4631  C  CA    . ASN A 1 767  ? 1.025   48.510  -21.595 1.00 64.08  ? 795  ASN A CA    1 
ATOM   4632  C  C     . ASN A 1 767  ? 2.114   49.103  -22.480 1.00 46.77  ? 795  ASN A C     1 
ATOM   4633  O  O     . ASN A 1 767  ? 3.130   49.588  -21.985 1.00 40.76  ? 795  ASN A O     1 
ATOM   4634  C  CB    . ASN A 1 767  ? 1.171   46.989  -21.552 1.00 65.50  ? 795  ASN A CB    1 
ATOM   4635  C  CG    . ASN A 1 767  ? 2.567   46.551  -21.152 1.00 46.28  ? 795  ASN A CG    1 
ATOM   4636  O  OD1   . ASN A 1 767  ? 3.418   46.295  -22.004 1.00 44.77  ? 795  ASN A OD1   1 
ATOM   4637  N  ND2   . ASN A 1 767  ? 2.811   46.469  -19.850 1.00 47.24  ? 795  ASN A ND2   1 
ATOM   4638  N  N     . LYS A 1 768  ? 1.895   49.063  -23.791 1.00 49.01  ? 796  LYS A N     1 
ATOM   4639  C  CA    . LYS A 1 768  ? 2.867   49.596  -24.739 1.00 46.51  ? 796  LYS A CA    1 
ATOM   4640  C  C     . LYS A 1 768  ? 2.970   51.118  -24.636 1.00 40.90  ? 796  LYS A C     1 
ATOM   4641  O  O     . LYS A 1 768  ? 4.039   51.694  -24.849 1.00 92.67  ? 796  LYS A O     1 
ATOM   4642  C  CB    . LYS A 1 768  ? 2.499   49.182  -26.167 1.00 45.84  ? 796  LYS A CB    1 
ATOM   4643  C  CG    . LYS A 1 768  ? 3.498   49.633  -27.219 1.00 56.24  ? 796  LYS A CG    1 
ATOM   4644  C  CD    . LYS A 1 768  ? 3.080   49.202  -28.614 1.00 56.09  ? 796  LYS A CD    1 
ATOM   4645  C  CE    . LYS A 1 768  ? 3.197   47.698  -28.784 1.00 64.15  ? 796  LYS A CE    1 
ATOM   4646  N  NZ    . LYS A 1 768  ? 2.880   47.275  -30.175 1.00 74.82  ? 796  LYS A NZ    1 
ATOM   4647  N  N     . MET A 1 769  ? 1.856   51.762  -24.300 1.00 41.01  ? 797  MET A N     1 
ATOM   4648  C  CA    . MET A 1 769  ? 1.814   53.215  -24.173 1.00 41.18  ? 797  MET A CA    1 
ATOM   4649  C  C     . MET A 1 769  ? 2.643   53.713  -22.993 1.00 41.18  ? 797  MET A C     1 
ATOM   4650  O  O     . MET A 1 769  ? 3.349   54.714  -23.100 1.00 60.86  ? 797  MET A O     1 
ATOM   4651  C  CB    . MET A 1 769  ? 0.370   53.700  -24.023 1.00 48.47  ? 797  MET A CB    1 
ATOM   4652  C  CG    . MET A 1 769  ? -0.459  53.617  -25.294 1.00 42.21  ? 797  MET A CG    1 
ATOM   4653  S  SD    . MET A 1 769  ? -2.166  54.152  -25.048 1.00 46.52  ? 797  MET A SD    1 
ATOM   4654  C  CE    . MET A 1 769  ? -2.833  53.907  -26.690 1.00 49.13  ? 797  MET A CE    1 
ATOM   4655  N  N     . ILE A 1 770  ? 2.553   53.010  -21.868 1.00 41.62  ? 798  ILE A N     1 
ATOM   4656  C  CA    . ILE A 1 770  ? 3.223   53.441  -20.646 1.00 47.91  ? 798  ILE A CA    1 
ATOM   4657  C  C     . ILE A 1 770  ? 4.518   52.679  -20.384 1.00 49.59  ? 798  ILE A C     1 
ATOM   4658  O  O     . ILE A 1 770  ? 5.084   52.768  -19.296 1.00 46.37  ? 798  ILE A O     1 
ATOM   4659  C  CB    . ILE A 1 770  ? 2.307   53.279  -19.417 1.00 49.62  ? 798  ILE A CB    1 
ATOM   4660  C  CG1   . ILE A 1 770  ? 2.001   51.800  -19.166 1.00 40.99  ? 798  ILE A CG1   1 
ATOM   4661  C  CG2   . ILE A 1 770  ? 1.023   54.070  -19.603 1.00 43.02  ? 798  ILE A CG2   1 
ATOM   4662  C  CD1   . ILE A 1 770  ? 1.178   51.548  -17.918 1.00 42.74  ? 798  ILE A CD1   1 
ATOM   4663  N  N     . SER A 1 771  ? 4.986   51.937  -21.383 1.00 66.49  ? 799  SER A N     1 
ATOM   4664  C  CA    . SER A 1 771  ? 6.197   51.133  -21.238 1.00 73.12  ? 799  SER A CA    1 
ATOM   4665  C  C     . SER A 1 771  ? 7.424   52.000  -20.980 1.00 73.40  ? 799  SER A C     1 
ATOM   4666  O  O     . SER A 1 771  ? 8.267   51.665  -20.148 1.00 70.96  ? 799  SER A O     1 
ATOM   4667  C  CB    . SER A 1 771  ? 6.425   50.273  -22.483 1.00 71.11  ? 799  SER A CB    1 
ATOM   4668  O  OG    . SER A 1 771  ? 5.414   49.290  -22.620 1.00 76.22  ? 799  SER A OG    1 
ATOM   4669  N  N     . PHE A 1 772  ? 7.517   53.115  -21.696 1.00 68.41  ? 800  PHE A N     1 
ATOM   4670  C  CA    . PHE A 1 772  ? 8.668   54.001  -21.578 1.00 43.02  ? 800  PHE A CA    1 
ATOM   4671  C  C     . PHE A 1 772  ? 8.662   54.781  -20.271 1.00 91.08  ? 800  PHE A C     1 
ATOM   4672  O  O     . PHE A 1 772  ? 9.652   54.791  -19.540 1.00 40.63  ? 800  PHE A O     1 
ATOM   4673  C  CB    . PHE A 1 772  ? 8.715   54.972  -22.757 1.00 49.61  ? 800  PHE A CB    1 
ATOM   4674  C  CG    . PHE A 1 772  ? 9.769   56.031  -22.625 1.00 47.37  ? 800  PHE A CG    1 
ATOM   4675  C  CD1   . PHE A 1 772  ? 9.417   57.356  -22.428 1.00 42.42  ? 800  PHE A CD1   1 
ATOM   4676  C  CD2   . PHE A 1 772  ? 11.113  55.701  -22.686 1.00 85.24  ? 800  PHE A CD2   1 
ATOM   4677  C  CE1   . PHE A 1 772  ? 10.385  58.333  -22.303 1.00 90.45  ? 800  PHE A CE1   1 
ATOM   4678  C  CE2   . PHE A 1 772  ? 12.086  56.673  -22.561 1.00 84.74  ? 800  PHE A CE2   1 
ATOM   4679  C  CZ    . PHE A 1 772  ? 11.721  57.991  -22.369 1.00 93.04  ? 800  PHE A CZ    1 
ATOM   4680  N  N     . TRP A 1 773  ? 7.541   55.433  -19.982 1.00 41.18  ? 801  TRP A N     1 
ATOM   4681  C  CA    . TRP A 1 773  ? 7.442   56.299  -18.814 1.00 41.41  ? 801  TRP A CA    1 
ATOM   4682  C  C     . TRP A 1 773  ? 7.530   55.519  -17.504 1.00 43.50  ? 801  TRP A C     1 
ATOM   4683  O  O     . TRP A 1 773  ? 7.877   56.080  -16.468 1.00 90.70  ? 801  TRP A O     1 
ATOM   4684  C  CB    . TRP A 1 773  ? 6.139   57.102  -18.858 1.00 42.31  ? 801  TRP A CB    1 
ATOM   4685  C  CG    . TRP A 1 773  ? 6.110   58.235  -17.879 1.00 47.62  ? 801  TRP A CG    1 
ATOM   4686  C  CD1   . TRP A 1 773  ? 5.515   58.244  -16.651 1.00 56.34  ? 801  TRP A CD1   1 
ATOM   4687  C  CD2   . TRP A 1 773  ? 6.712   59.524  -18.043 1.00 47.17  ? 801  TRP A CD2   1 
ATOM   4688  N  NE1   . TRP A 1 773  ? 5.704   59.462  -16.042 1.00 92.47  ? 801  TRP A NE1   1 
ATOM   4689  C  CE2   . TRP A 1 773  ? 6.438   60.264  -16.876 1.00 91.35  ? 801  TRP A CE2   1 
ATOM   4690  C  CE3   . TRP A 1 773  ? 7.454   60.125  -19.064 1.00 87.17  ? 801  TRP A CE3   1 
ATOM   4691  C  CZ2   . TRP A 1 773  ? 6.880   61.574  -16.702 1.00 91.62  ? 801  TRP A CZ2   1 
ATOM   4692  C  CZ3   . TRP A 1 773  ? 7.892   61.424  -18.889 1.00 87.38  ? 801  TRP A CZ3   1 
ATOM   4693  C  CH2   . TRP A 1 773  ? 7.605   62.134  -17.717 1.00 42.48  ? 801  TRP A CH2   1 
ATOM   4694  N  N     . ARG A 1 774  ? 7.217   54.228  -17.548 1.00 43.05  ? 802  ARG A N     1 
ATOM   4695  C  CA    . ARG A 1 774  ? 7.287   53.395  -16.352 1.00 92.39  ? 802  ARG A CA    1 
ATOM   4696  C  C     . ARG A 1 774  ? 8.732   53.208  -15.907 1.00 67.53  ? 802  ARG A C     1 
ATOM   4697  O  O     . ARG A 1 774  ? 9.039   53.262  -14.716 1.00 48.67  ? 802  ARG A O     1 
ATOM   4698  C  CB    . ARG A 1 774  ? 6.641   52.030  -16.596 1.00 93.47  ? 802  ARG A CB    1 
ATOM   4699  C  CG    . ARG A 1 774  ? 6.505   51.182  -15.339 1.00 41.52  ? 802  ARG A CG    1 
ATOM   4700  C  CD    . ARG A 1 774  ? 6.311   49.703  -15.655 1.00 49.27  ? 802  ARG A CD    1 
ATOM   4701  N  NE    . ARG A 1 774  ? 5.133   49.448  -16.480 1.00 43.69  ? 802  ARG A NE    1 
ATOM   4702  C  CZ    . ARG A 1 774  ? 5.175   49.179  -17.781 1.00 46.11  ? 802  ARG A CZ    1 
ATOM   4703  N  NH1   . ARG A 1 774  ? 6.341   49.128  -18.411 1.00 41.03  ? 802  ARG A NH1   1 
ATOM   4704  N  NH2   . ARG A 1 774  ? 4.053   48.960  -18.451 1.00 47.75  ? 802  ARG A NH2   1 
ATOM   4705  N  N     . ASN A 1 775  ? 9.615   52.993  -16.876 1.00 68.14  ? 803  ASN A N     1 
ATOM   4706  C  CA    . ASN A 1 775  ? 11.015  52.708  -16.590 1.00 69.41  ? 803  ASN A CA    1 
ATOM   4707  C  C     . ASN A 1 775  ? 11.904  53.942  -16.679 1.00 73.80  ? 803  ASN A C     1 
ATOM   4708  O  O     . ASN A 1 775  ? 13.124  53.824  -16.795 1.00 71.64  ? 803  ASN A O     1 
ATOM   4709  C  CB    . ASN A 1 775  ? 11.544  51.635  -17.546 1.00 73.48  ? 803  ASN A CB    1 
ATOM   4710  C  CG    . ASN A 1 775  ? 10.736  50.353  -17.491 1.00 70.52  ? 803  ASN A CG    1 
ATOM   4711  O  OD1   . ASN A 1 775  ? 10.163  50.010  -16.458 1.00 75.24  ? 803  ASN A OD1   1 
ATOM   4712  N  ND2   . ASN A 1 775  ? 10.689  49.636  -18.608 1.00 77.75  ? 803  ASN A ND2   1 
ATOM   4713  N  N     . ALA A 1 776  ? 11.303  55.125  -16.620 1.00 66.56  ? 804  ALA A N     1 
ATOM   4714  C  CA    . ALA A 1 776  ? 12.065  56.349  -16.841 1.00 67.45  ? 804  ALA A CA    1 
ATOM   4715  C  C     . ALA A 1 776  ? 11.593  57.539  -16.007 1.00 49.42  ? 804  ALA A C     1 
ATOM   4716  O  O     . ALA A 1 776  ? 12.380  58.445  -15.742 1.00 60.39  ? 804  ALA A O     1 
ATOM   4717  C  CB    . ALA A 1 776  ? 12.034  56.713  -18.321 1.00 44.96  ? 804  ALA A CB    1 
ATOM   4718  N  N     . HIS A 1 777  ? 10.328  57.528  -15.588 1.00 66.77  ? 805  HIS A N     1 
ATOM   4719  C  CA    . HIS A 1 777  ? 9.712   58.686  -14.931 1.00 90.81  ? 805  HIS A CA    1 
ATOM   4720  C  C     . HIS A 1 777  ? 10.535  59.246  -13.772 1.00 44.33  ? 805  HIS A C     1 
ATOM   4721  O  O     . HIS A 1 777  ? 10.535  60.453  -13.536 1.00 40.00  ? 805  HIS A O     1 
ATOM   4722  C  CB    . HIS A 1 777  ? 8.303   58.336  -14.434 1.00 92.10  ? 805  HIS A CB    1 
ATOM   4723  C  CG    . HIS A 1 777  ? 8.279   57.526  -13.175 1.00 93.76  ? 805  HIS A CG    1 
ATOM   4724  N  ND1   . HIS A 1 777  ? 8.392   58.092  -11.923 1.00 41.26  ? 805  HIS A ND1   1 
ATOM   4725  C  CD2   . HIS A 1 777  ? 8.142   56.193  -12.973 1.00 67.13  ? 805  HIS A CD2   1 
ATOM   4726  C  CE1   . HIS A 1 777  ? 8.334   57.143  -11.005 1.00 67.51  ? 805  HIS A CE1   1 
ATOM   4727  N  NE2   . HIS A 1 777  ? 8.182   55.982  -11.616 1.00 65.26  ? 805  HIS A NE2   1 
ATOM   4728  N  N     . LYS A 1 778  ? 11.238  58.374  -13.056 1.00 64.07  ? 806  LYS A N     1 
ATOM   4729  C  CA    . LYS A 1 778  ? 12.101  58.813  -11.967 1.00 93.78  ? 806  LYS A CA    1 
ATOM   4730  C  C     . LYS A 1 778  ? 13.262  59.640  -12.505 1.00 92.69  ? 806  LYS A C     1 
ATOM   4731  O  O     . LYS A 1 778  ? 13.688  60.608  -11.878 1.00 46.58  ? 806  LYS A O     1 
ATOM   4732  C  CB    . LYS A 1 778  ? 12.630  57.617  -11.173 1.00 42.16  ? 806  LYS A CB    1 
ATOM   4733  C  CG    . LYS A 1 778  ? 13.707  57.980  -10.160 1.00 42.77  ? 806  LYS A CG    1 
ATOM   4734  C  CD    . LYS A 1 778  ? 14.287  56.748  -9.487  1.00 55.31  ? 806  LYS A CD    1 
ATOM   4735  C  CE    . LYS A 1 778  ? 13.333  56.176  -8.453  1.00 56.94  ? 806  LYS A CE    1 
ATOM   4736  N  NZ    . LYS A 1 778  ? 13.145  57.103  -7.303  1.00 67.96  ? 806  LYS A NZ    1 
ATOM   4737  N  N     . ARG A 1 779  ? 13.760  59.263  -13.677 1.00 91.18  ? 807  ARG A N     1 
ATOM   4738  C  CA    . ARG A 1 779  ? 14.930  59.918  -14.250 1.00 90.41  ? 807  ARG A CA    1 
ATOM   4739  C  C     . ARG A 1 779  ? 14.596  61.259  -14.898 1.00 40.32  ? 807  ARG A C     1 
ATOM   4740  O  O     . ARG A 1 779  ? 15.466  62.119  -15.027 1.00 49.77  ? 807  ARG A O     1 
ATOM   4741  C  CB    . ARG A 1 779  ? 15.603  59.003  -15.275 1.00 87.60  ? 807  ARG A CB    1 
ATOM   4742  C  CG    . ARG A 1 779  ? 16.025  57.655  -14.718 1.00 48.93  ? 807  ARG A CG    1 
ATOM   4743  C  CD    . ARG A 1 779  ? 17.112  57.027  -15.573 1.00 40.40  ? 807  ARG A CD    1 
ATOM   4744  N  NE    . ARG A 1 779  ? 16.739  56.964  -16.983 1.00 64.13  ? 807  ARG A NE    1 
ATOM   4745  C  CZ    . ARG A 1 779  ? 16.183  55.906  -17.564 1.00 55.99  ? 807  ARG A CZ    1 
ATOM   4746  N  NH1   . ARG A 1 779  ? 15.930  54.814  -16.855 1.00 49.43  ? 807  ARG A NH1   1 
ATOM   4747  N  NH2   . ARG A 1 779  ? 15.879  55.939  -18.854 1.00 64.64  ? 807  ARG A NH2   1 
ATOM   4748  N  N     . ILE A 1 780  ? 13.343  61.440  -15.304 1.00 87.41  ? 808  ILE A N     1 
ATOM   4749  C  CA    . ILE A 1 780  ? 12.942  62.686  -15.949 1.00 87.22  ? 808  ILE A CA    1 
ATOM   4750  C  C     . ILE A 1 780  ? 12.297  63.664  -14.973 1.00 90.74  ? 808  ILE A C     1 
ATOM   4751  O  O     . ILE A 1 780  ? 12.476  64.875  -15.091 1.00 47.67  ? 808  ILE A O     1 
ATOM   4752  C  CB    . ILE A 1 780  ? 11.958  62.451  -17.113 1.00 86.56  ? 808  ILE A CB    1 
ATOM   4753  C  CG1   . ILE A 1 780  ? 11.698  60.960  -17.332 1.00 44.26  ? 808  ILE A CG1   1 
ATOM   4754  C  CG2   . ILE A 1 780  ? 12.491  63.086  -18.377 1.00 85.87  ? 808  ILE A CG2   1 
ATOM   4755  C  CD1   . ILE A 1 780  ? 12.613  60.309  -18.351 1.00 90.84  ? 808  ILE A CD1   1 
ATOM   4756  N  N     . SER A 1 781  ? 11.536  63.142  -14.016 1.00 91.84  ? 809  SER A N     1 
ATOM   4757  C  CA    . SER A 1 781  ? 10.887  63.996  -13.028 1.00 47.46  ? 809  SER A CA    1 
ATOM   4758  C  C     . SER A 1 781  ? 11.918  64.593  -12.078 1.00 66.08  ? 809  SER A C     1 
ATOM   4759  O  O     . SER A 1 781  ? 11.809  65.753  -11.679 1.00 68.38  ? 809  SER A O     1 
ATOM   4760  C  CB    . SER A 1 781  ? 9.834   63.216  -12.239 1.00 64.24  ? 809  SER A CB    1 
ATOM   4761  O  OG    . SER A 1 781  ? 10.430  62.168  -11.494 1.00 68.16  ? 809  SER A OG    1 
ATOM   4762  N  N     . SER A 1 782  ? 12.919  63.794  -11.724 1.00 40.55  ? 810  SER A N     1 
ATOM   4763  C  CA    . SER A 1 782  ? 13.973  64.243  -10.822 1.00 47.38  ? 810  SER A CA    1 
ATOM   4764  C  C     . SER A 1 782  ? 15.095  64.937  -11.588 1.00 47.65  ? 810  SER A C     1 
ATOM   4765  O  O     . SER A 1 782  ? 16.008  65.505  -10.985 1.00 41.80  ? 810  SER A O     1 
ATOM   4766  C  CB    . SER A 1 782  ? 14.533  63.067  -10.021 1.00 40.86  ? 810  SER A CB    1 
ATOM   4767  O  OG    . SER A 1 782  ? 15.122  62.103  -10.876 1.00 69.75  ? 810  SER A OG    1 
ATOM   4768  N  N     . GLN A 1 783  ? 15.021  64.880  -12.915 1.00 47.66  ? 811  GLN A N     1 
ATOM   4769  C  CA    . GLN A 1 783  ? 15.971  65.577  -13.775 1.00 43.83  ? 811  GLN A CA    1 
ATOM   4770  C  C     . GLN A 1 783  ? 15.955  67.064  -13.452 1.00 93.49  ? 811  GLN A C     1 
ATOM   4771  O  O     . GLN A 1 783  ? 15.149  67.816  -14.001 1.00 46.93  ? 811  GLN A O     1 
ATOM   4772  C  CB    . GLN A 1 783  ? 15.635  65.347  -15.251 1.00 90.52  ? 811  GLN A CB    1 
ATOM   4773  C  CG    . GLN A 1 783  ? 16.653  65.908  -16.227 1.00 40.94  ? 811  GLN A CG    1 
ATOM   4774  C  CD    . GLN A 1 783  ? 17.931  65.093  -16.274 1.00 66.17  ? 811  GLN A CD    1 
ATOM   4775  O  OE1   . GLN A 1 783  ? 19.004  65.617  -16.576 1.00 56.69  ? 811  GLN A OE1   1 
ATOM   4776  N  NE2   . GLN A 1 783  ? 17.821  63.802  -15.982 1.00 71.58  ? 811  GLN A NE2   1 
ATOM   4777  N  N     . MET A 1 784  ? 16.841  67.481  -12.552 1.00 44.60  ? 812  MET A N     1 
ATOM   4778  C  CA    . MET A 1 784  ? 16.829  68.850  -12.046 1.00 56.14  ? 812  MET A CA    1 
ATOM   4779  C  C     . MET A 1 784  ? 17.128  69.865  -13.141 1.00 74.60  ? 812  MET A C     1 
ATOM   4780  O  O     . MET A 1 784  ? 17.585  69.510  -14.224 1.00 70.41  ? 812  MET A O     1 
ATOM   4781  C  CB    . MET A 1 784  ? 17.833  69.016  -10.905 1.00 68.11  ? 812  MET A CB    1 
ATOM   4782  C  CG    . MET A 1 784  ? 19.261  69.292  -11.348 1.00 43.91  ? 812  MET A CG    1 
ATOM   4783  S  SD    . MET A 1 784  ? 20.279  69.893  -9.984  1.00 44.23  ? 812  MET A SD    1 
ATOM   4784  C  CE    . MET A 1 784  ? 21.870  70.059  -10.784 1.00 45.92  ? 812  MET A CE    1 
ATOM   4785  N  N     . VAL A 1 785  ? 16.858  71.131  -12.844 1.00 56.48  ? 813  VAL A N     1 
ATOM   4786  C  CA    . VAL A 1 785  ? 17.049  72.206  -13.805 1.00 56.10  ? 813  VAL A CA    1 
ATOM   4787  C  C     . VAL A 1 785  ? 17.104  73.551  -13.088 1.00 47.20  ? 813  VAL A C     1 
ATOM   4788  O  O     . VAL A 1 785  ? 16.212  73.888  -12.313 1.00 55.45  ? 813  VAL A O     1 
ATOM   4789  C  CB    . VAL A 1 785  ? 15.926  72.218  -14.867 1.00 67.18  ? 813  VAL A CB    1 
ATOM   4790  C  CG1   . VAL A 1 785  ? 14.574  71.946  -14.221 1.00 44.67  ? 813  VAL A CG1   1 
ATOM   4791  C  CG2   . VAL A 1 785  ? 15.909  73.542  -15.610 1.00 60.66  ? 813  VAL A CG2   1 
ATOM   4792  N  N     . VAL A 1 786  ? 18.166  74.310  -13.342 1.00 47.88  ? 814  VAL A N     1 
ATOM   4793  C  CA    . VAL A 1 786  ? 18.339  75.619  -12.725 1.00 40.78  ? 814  VAL A CA    1 
ATOM   4794  C  C     . VAL A 1 786  ? 17.794  76.717  -13.633 1.00 42.39  ? 814  VAL A C     1 
ATOM   4795  O  O     . VAL A 1 786  ? 18.037  76.713  -14.839 1.00 40.84  ? 814  VAL A O     1 
ATOM   4796  C  CB    . VAL A 1 786  ? 19.823  75.899  -12.405 1.00 41.32  ? 814  VAL A CB    1 
ATOM   4797  C  CG1   . VAL A 1 786  ? 20.007  77.315  -11.877 1.00 49.47  ? 814  VAL A CG1   1 
ATOM   4798  C  CG2   . VAL A 1 786  ? 20.346  74.882  -11.406 1.00 40.82  ? 814  VAL A CG2   1 
ATOM   4799  N  N     . TRP A 1 787  ? 17.046  77.648  -13.047 1.00 44.97  ? 815  TRP A N     1 
ATOM   4800  C  CA    . TRP A 1 787  ? 16.487  78.768  -13.794 1.00 47.03  ? 815  TRP A CA    1 
ATOM   4801  C  C     . TRP A 1 787  ? 17.305  80.034  -13.575 1.00 75.53  ? 815  TRP A C     1 
ATOM   4802  O  O     . TRP A 1 787  ? 17.562  80.425  -12.436 1.00 68.42  ? 815  TRP A O     1 
ATOM   4803  C  CB    . TRP A 1 787  ? 15.035  79.015  -13.386 1.00 49.08  ? 815  TRP A CB    1 
ATOM   4804  C  CG    . TRP A 1 787  ? 14.203  77.780  -13.370 1.00 46.87  ? 815  TRP A CG    1 
ATOM   4805  C  CD1   . TRP A 1 787  ? 13.880  77.024  -12.284 1.00 48.81  ? 815  TRP A CD1   1 
ATOM   4806  C  CD2   . TRP A 1 787  ? 13.589  77.148  -14.497 1.00 44.85  ? 815  TRP A CD2   1 
ATOM   4807  N  NE1   . TRP A 1 787  ? 13.100  75.959  -12.662 1.00 44.61  ? 815  TRP A NE1   1 
ATOM   4808  C  CE2   . TRP A 1 787  ? 12.907  76.013  -14.017 1.00 43.42  ? 815  TRP A CE2   1 
ATOM   4809  C  CE3   . TRP A 1 787  ? 13.550  77.431  -15.864 1.00 44.43  ? 815  TRP A CE3   1 
ATOM   4810  C  CZ2   . TRP A 1 787  ? 12.195  75.163  -14.856 1.00 41.51  ? 815  TRP A CZ2   1 
ATOM   4811  C  CZ3   . TRP A 1 787  ? 12.843  76.587  -16.694 1.00 42.61  ? 815  TRP A CZ3   1 
ATOM   4812  C  CH2   . TRP A 1 787  ? 12.175  75.466  -16.188 1.00 60.61  ? 815  TRP A CH2   1 
ATOM   4813  N  N     . LEU A 1 788  ? 17.714  80.674  -14.666 1.00 60.12  ? 816  LEU A N     1 
ATOM   4814  C  CA    . LEU A 1 788  ? 18.450  81.928  -14.567 1.00 67.10  ? 816  LEU A CA    1 
ATOM   4815  C  C     . LEU A 1 788  ? 17.511  83.125  -14.701 1.00 66.87  ? 816  LEU A C     1 
ATOM   4816  O  O     . LEU A 1 788  ? 16.783  83.247  -15.685 1.00 67.07  ? 816  LEU A O     1 
ATOM   4817  C  CB    . LEU A 1 788  ? 19.560  81.993  -15.622 1.00 56.02  ? 816  LEU A CB    1 
ATOM   4818  C  CG    . LEU A 1 788  ? 19.468  81.108  -16.868 1.00 48.88  ? 816  LEU A CG    1 
ATOM   4819  C  CD1   . LEU A 1 788  ? 18.413  81.613  -17.837 1.00 74.41  ? 816  LEU A CD1   1 
ATOM   4820  C  CD2   . LEU A 1 788  ? 20.822  81.023  -17.550 1.00 47.90  ? 816  LEU A CD2   1 
ATOM   4821  N  N     . PRO A 1 789  ? 17.527  84.015  -13.698 1.00 60.34  ? 817  PRO A N     1 
ATOM   4822  C  CA    . PRO A 1 789  ? 16.646  85.186  -13.665 1.00 70.61  ? 817  PRO A CA    1 
ATOM   4823  C  C     . PRO A 1 789  ? 16.965  86.181  -14.776 1.00 69.85  ? 817  PRO A C     1 
ATOM   4824  O  O     . PRO A 1 789  ? 17.930  85.989  -15.515 1.00 77.72  ? 817  PRO A O     1 
ATOM   4825  C  CB    . PRO A 1 789  ? 16.925  85.794  -12.289 1.00 67.84  ? 817  PRO A CB    1 
ATOM   4826  C  CG    . PRO A 1 789  ? 18.309  85.359  -11.965 1.00 65.66  ? 817  PRO A CG    1 
ATOM   4827  C  CD    . PRO A 1 789  ? 18.438  83.981  -12.541 1.00 69.87  ? 817  PRO A CD    1 
ATOM   4828  N  N     . ARG A 1 790  ? 16.164  87.236  -14.883 1.00 71.05  ? 818  ARG A N     1 
ATOM   4829  C  CA    . ARG A 1 790  ? 16.342  88.224  -15.941 1.00 76.17  ? 818  ARG A CA    1 
ATOM   4830  C  C     . ARG A 1 790  ? 17.602  89.057  -15.722 1.00 74.19  ? 818  ARG A C     1 
ATOM   4831  O  O     . ARG A 1 790  ? 18.016  89.812  -16.601 1.00 86.14  ? 818  ARG A O     1 
ATOM   4832  C  CB    . ARG A 1 790  ? 15.116  89.138  -16.044 1.00 71.85  ? 818  ARG A CB    1 
ATOM   4833  C  CG    . ARG A 1 790  ? 15.002  90.201  -14.958 1.00 90.44  ? 818  ARG A CG    1 
ATOM   4834  C  CD    . ARG A 1 790  ? 14.385  89.657  -13.677 1.00 90.47  ? 818  ARG A CD    1 
ATOM   4835  N  NE    . ARG A 1 790  ? 15.390  89.175  -12.734 1.00 87.27  ? 818  ARG A NE    1 
ATOM   4836  C  CZ    . ARG A 1 790  ? 15.965  89.933  -11.806 1.00 81.06  ? 818  ARG A CZ    1 
ATOM   4837  N  NH1   . ARG A 1 790  ? 15.636  91.213  -11.697 1.00 93.71  ? 818  ARG A NH1   1 
ATOM   4838  N  NH2   . ARG A 1 790  ? 16.869  89.413  -10.988 1.00 90.48  ? 818  ARG A NH2   1 
ATOM   4839  N  N     . SER A 1 791  ? 18.210  88.912  -14.550 1.00 77.71  ? 819  SER A N     1 
ATOM   4840  C  CA    . SER A 1 791  ? 19.436  89.632  -14.232 1.00 77.06  ? 819  SER A CA    1 
ATOM   4841  C  C     . SER A 1 791  ? 20.637  89.018  -14.942 1.00 71.57  ? 819  SER A C     1 
ATOM   4842  O  O     . SER A 1 791  ? 21.564  89.726  -15.333 1.00 71.61  ? 819  SER A O     1 
ATOM   4843  C  CB    . SER A 1 791  ? 19.674  89.647  -12.721 1.00 68.27  ? 819  SER A CB    1 
ATOM   4844  O  OG    . SER A 1 791  ? 19.869  88.335  -12.224 1.00 73.99  ? 819  SER A OG    1 
ATOM   4845  N  N     . ALA A 1 792  ? 20.614  87.699  -15.110 1.00 69.67  ? 820  ALA A N     1 
ATOM   4846  C  CA    . ALA A 1 792  ? 21.745  86.990  -15.699 1.00 72.76  ? 820  ALA A CA    1 
ATOM   4847  C  C     . ALA A 1 792  ? 21.363  86.229  -16.965 1.00 70.56  ? 820  ALA A C     1 
ATOM   4848  O  O     . ALA A 1 792  ? 21.479  85.005  -17.022 1.00 69.28  ? 820  ALA A O     1 
ATOM   4849  C  CB    . ALA A 1 792  ? 22.356  86.039  -14.679 1.00 71.34  ? 820  ALA A CB    1 
ATOM   4850  N  N     . LEU A 1 793  ? 20.912  86.960  -17.978 1.00 64.81  ? 821  LEU A N     1 
ATOM   4851  C  CA    . LEU A 1 793  ? 20.642  86.373  -19.285 1.00 56.82  ? 821  LEU A CA    1 
ATOM   4852  C  C     . LEU A 1 793  ? 20.935  87.394  -20.381 1.00 66.04  ? 821  LEU A C     1 
ATOM   4853  O  O     . LEU A 1 793  ? 20.912  88.597  -20.121 1.00 70.17  ? 821  LEU A O     1 
ATOM   4854  C  CB    . LEU A 1 793  ? 19.195  85.871  -19.368 1.00 75.13  ? 821  LEU A CB    1 
ATOM   4855  C  CG    . LEU A 1 793  ? 18.064  86.652  -18.698 1.00 75.67  ? 821  LEU A CG    1 
ATOM   4856  C  CD1   . LEU A 1 793  ? 17.823  87.999  -19.359 1.00 76.22  ? 821  LEU A CD1   1 
ATOM   4857  C  CD2   . LEU A 1 793  ? 16.794  85.816  -18.709 1.00 56.83  ? 821  LEU A CD2   1 
ATOM   4858  N  N     . PRO A 1 794  ? 21.231  86.918  -21.604 1.00 64.52  ? 822  PRO A N     1 
ATOM   4859  C  CA    . PRO A 1 794  ? 21.519  87.822  -22.722 1.00 67.81  ? 822  PRO A CA    1 
ATOM   4860  C  C     . PRO A 1 794  ? 20.412  88.845  -22.942 1.00 73.78  ? 822  PRO A C     1 
ATOM   4861  O  O     . PRO A 1 794  ? 19.277  88.481  -23.245 1.00 72.89  ? 822  PRO A O     1 
ATOM   4862  C  CB    . PRO A 1 794  ? 21.638  86.876  -23.926 1.00 65.20  ? 822  PRO A CB    1 
ATOM   4863  C  CG    . PRO A 1 794  ? 21.066  85.567  -23.468 1.00 60.97  ? 822  PRO A CG    1 
ATOM   4864  C  CD    . PRO A 1 794  ? 21.348  85.508  -22.007 1.00 71.74  ? 822  PRO A CD    1 
ATOM   4865  N  N     . ARG A 1 795  ? 20.752  90.117  -22.774 1.00 75.65  ? 823  ARG A N     1 
ATOM   4866  C  CA    . ARG A 1 795  ? 19.791  91.199  -22.934 1.00 90.13  ? 823  ARG A CA    1 
ATOM   4867  C  C     . ARG A 1 795  ? 19.356  91.327  -24.391 1.00 87.22  ? 823  ARG A C     1 
ATOM   4868  O  O     . ARG A 1 795  ? 18.285  91.858  -24.684 1.00 70.35  ? 823  ARG A O     1 
ATOM   4869  C  CB    . ARG A 1 795  ? 20.388  92.512  -22.427 1.00 74.11  ? 823  ARG A CB    1 
ATOM   4870  C  CG    . ARG A 1 795  ? 20.768  92.470  -20.953 1.00 69.00  ? 823  ARG A CG    1 
ATOM   4871  C  CD    . ARG A 1 795  ? 21.770  93.556  -20.595 1.00 91.01  ? 823  ARG A CD    1 
ATOM   4872  N  NE    . ARG A 1 795  ? 21.226  94.897  -20.782 1.00 84.19  ? 823  ARG A NE    1 
ATOM   4873  C  CZ    . ARG A 1 795  ? 21.921  96.015  -20.596 1.00 84.53  ? 823  ARG A CZ    1 
ATOM   4874  N  NH1   . ARG A 1 795  ? 23.191  95.952  -20.220 1.00 69.59  ? 823  ARG A NH1   1 
ATOM   4875  N  NH2   . ARG A 1 795  ? 21.347  97.194  -20.788 1.00 84.90  ? 823  ARG A NH2   1 
ATOM   4876  N  N     . ALA A 1 796  ? 20.191  90.826  -25.297 1.00 90.73  ? 824  ALA A N     1 
ATOM   4877  C  CA    . ALA A 1 796  ? 19.860  90.799  -26.717 1.00 84.87  ? 824  ALA A CA    1 
ATOM   4878  C  C     . ALA A 1 796  ? 18.746  89.791  -26.987 1.00 68.42  ? 824  ALA A C     1 
ATOM   4879  O  O     . ALA A 1 796  ? 18.083  89.843  -28.023 1.00 72.87  ? 824  ALA A O     1 
ATOM   4880  C  CB    . ALA A 1 796  ? 21.092  90.468  -27.545 1.00 81.74  ? 824  ALA A CB    1 
ATOM   4881  N  N     . VAL A 1 797  ? 18.552  88.872  -26.048 1.00 75.78  ? 825  VAL A N     1 
ATOM   4882  C  CA    . VAL A 1 797  ? 17.457  87.914  -26.116 1.00 73.25  ? 825  VAL A CA    1 
ATOM   4883  C  C     . VAL A 1 797  ? 16.184  88.555  -25.564 1.00 77.32  ? 825  VAL A C     1 
ATOM   4884  O  O     . VAL A 1 797  ? 15.081  88.292  -26.045 1.00 71.37  ? 825  VAL A O     1 
ATOM   4885  C  CB    . VAL A 1 797  ? 17.802  86.619  -25.346 1.00 67.70  ? 825  VAL A CB    1 
ATOM   4886  C  CG1   . VAL A 1 797  ? 16.552  85.858  -24.945 1.00 65.86  ? 825  VAL A CG1   1 
ATOM   4887  C  CG2   . VAL A 1 797  ? 18.723  85.747  -26.180 1.00 75.51  ? 825  VAL A CG2   1 
ATOM   4888  N  N     . ILE A 1 798  ? 16.346  89.416  -24.564 1.00 73.85  ? 826  ILE A N     1 
ATOM   4889  C  CA    . ILE A 1 798  ? 15.230  90.201  -24.049 1.00 70.98  ? 826  ILE A CA    1 
ATOM   4890  C  C     . ILE A 1 798  ? 14.723  91.150  -25.135 1.00 81.93  ? 826  ILE A C     1 
ATOM   4891  O  O     . ILE A 1 798  ? 13.516  91.355  -25.281 1.00 68.62  ? 826  ILE A O     1 
ATOM   4892  C  CB    . ILE A 1 798  ? 15.629  90.997  -22.786 1.00 69.45  ? 826  ILE A CB    1 
ATOM   4893  C  CG1   . ILE A 1 798  ? 15.802  90.049  -21.599 1.00 70.43  ? 826  ILE A CG1   1 
ATOM   4894  C  CG2   . ILE A 1 798  ? 14.580  92.044  -22.447 1.00 70.58  ? 826  ILE A CG2   1 
ATOM   4895  C  CD1   . ILE A 1 798  ? 14.541  89.285  -21.241 1.00 75.87  ? 826  ILE A CD1   1 
ATOM   4896  N  N     . ARG A 1 799  ? 15.651  91.708  -25.908 1.00 87.23  ? 827  ARG A N     1 
ATOM   4897  C  CA    . ARG A 1 799  ? 15.302  92.566  -27.038 1.00 90.52  ? 827  ARG A CA    1 
ATOM   4898  C  C     . ARG A 1 799  ? 14.475  91.807  -28.075 1.00 81.59  ? 827  ARG A C     1 
ATOM   4899  O  O     . ARG A 1 799  ? 13.623  92.388  -28.748 1.00 85.79  ? 827  ARG A O     1 
ATOM   4900  C  CB    . ARG A 1 799  ? 16.563  93.137  -27.691 1.00 70.94  ? 827  ARG A CB    1 
ATOM   4901  C  CG    . ARG A 1 799  ? 17.369  94.067  -26.798 1.00 76.29  ? 827  ARG A CG    1 
ATOM   4902  C  CD    . ARG A 1 799  ? 16.541  95.257  -26.344 1.00 69.63  ? 827  ARG A CD    1 
ATOM   4903  N  NE    . ARG A 1 799  ? 17.328  96.206  -25.561 1.00 74.38  ? 827  ARG A NE    1 
ATOM   4904  C  CZ    . ARG A 1 799  ? 17.476  96.146  -24.242 1.00 70.18  ? 827  ARG A CZ    1 
ATOM   4905  N  NH1   . ARG A 1 799  ? 16.889  95.179  -23.550 1.00 71.36  ? 827  ARG A NH1   1 
ATOM   4906  N  NH2   . ARG A 1 799  ? 18.211  97.053  -23.613 1.00 74.72  ? 827  ARG A NH2   1 
ATOM   4907  N  N     . HIS A 1 800  ? 14.739  90.510  -28.198 1.00 86.32  ? 828  HIS A N     1 
ATOM   4908  C  CA    . HIS A 1 800  ? 13.976  89.642  -29.089 1.00 77.50  ? 828  HIS A CA    1 
ATOM   4909  C  C     . HIS A 1 800  ? 12.534  89.540  -28.594 1.00 90.33  ? 828  HIS A C     1 
ATOM   4910  O  O     . HIS A 1 800  ? 12.299  89.394  -27.395 1.00 84.79  ? 828  HIS A O     1 
ATOM   4911  C  CB    . HIS A 1 800  ? 14.625  88.256  -29.168 1.00 73.12  ? 828  HIS A CB    1 
ATOM   4912  C  CG    . HIS A 1 800  ? 14.100  87.397  -30.275 1.00 69.94  ? 828  HIS A CG    1 
ATOM   4913  N  ND1   . HIS A 1 800  ? 12.981  86.605  -30.137 1.00 68.17  ? 828  HIS A ND1   1 
ATOM   4914  C  CD2   . HIS A 1 800  ? 14.546  87.201  -31.539 1.00 70.68  ? 828  HIS A CD2   1 
ATOM   4915  C  CE1   . HIS A 1 800  ? 12.758  85.961  -31.268 1.00 75.93  ? 828  HIS A CE1   1 
ATOM   4916  N  NE2   . HIS A 1 800  ? 13.694  86.305  -32.135 1.00 69.39  ? 828  HIS A NE2   1 
ATOM   4917  N  N     . PRO A 1 801  ? 11.562  89.619  -29.519 1.00 69.70  ? 829  PRO A N     1 
ATOM   4918  C  CA    . PRO A 1 801  ? 10.132  89.651  -29.183 1.00 71.36  ? 829  PRO A CA    1 
ATOM   4919  C  C     . PRO A 1 801  ? 9.606   88.391  -28.491 1.00 76.64  ? 829  PRO A C     1 
ATOM   4920  O  O     . PRO A 1 801  ? 8.630   87.808  -28.961 1.00 68.31  ? 829  PRO A O     1 
ATOM   4921  C  CB    . PRO A 1 801  ? 9.459   89.825  -30.550 1.00 72.37  ? 829  PRO A CB    1 
ATOM   4922  C  CG    . PRO A 1 801  ? 10.456  89.311  -31.533 1.00 75.14  ? 829  PRO A CG    1 
ATOM   4923  C  CD    . PRO A 1 801  ? 11.783  89.709  -30.972 1.00 71.10  ? 829  PRO A CD    1 
ATOM   4924  N  N     . ASP A 1 802  ? 10.240  87.995  -27.389 1.00 76.10  ? 830  ASP A N     1 
ATOM   4925  C  CA    . ASP A 1 802  ? 9.780   86.873  -26.573 1.00 70.23  ? 830  ASP A CA    1 
ATOM   4926  C  C     . ASP A 1 802  ? 10.239  87.044  -25.128 1.00 76.53  ? 830  ASP A C     1 
ATOM   4927  O  O     . ASP A 1 802  ? 11.387  87.409  -24.873 1.00 69.41  ? 830  ASP A O     1 
ATOM   4928  C  CB    . ASP A 1 802  ? 10.295  85.541  -27.125 1.00 74.34  ? 830  ASP A CB    1 
ATOM   4929  C  CG    . ASP A 1 802  ? 9.484   85.038  -28.303 1.00 68.65  ? 830  ASP A CG    1 
ATOM   4930  O  OD1   . ASP A 1 802  ? 8.240   85.139  -28.259 1.00 77.26  ? 830  ASP A OD1   1 
ATOM   4931  O  OD2   . ASP A 1 802  ? 10.091  84.538  -29.273 1.00 73.52  ? 830  ASP A OD2   1 
ATOM   4932  N  N     . TYR A 1 803  ? 9.342   86.779  -24.183 1.00 75.94  ? 831  TYR A N     1 
ATOM   4933  C  CA    . TYR A 1 803  ? 9.692   86.863  -22.764 1.00 81.83  ? 831  TYR A CA    1 
ATOM   4934  C  C     . TYR A 1 803  ? 9.620   85.536  -21.977 1.00 72.01  ? 831  TYR A C     1 
ATOM   4935  O  O     . TYR A 1 803  ? 10.546  85.258  -21.216 1.00 71.67  ? 831  TYR A O     1 
ATOM   4936  C  CB    . TYR A 1 803  ? 8.829   87.915  -22.058 1.00 87.60  ? 831  TYR A CB    1 
ATOM   4937  C  CG    . TYR A 1 803  ? 9.203   88.098  -20.605 1.00 76.14  ? 831  TYR A CG    1 
ATOM   4938  C  CD1   . TYR A 1 803  ? 8.393   87.607  -19.588 1.00 76.20  ? 831  TYR A CD1   1 
ATOM   4939  C  CD2   . TYR A 1 803  ? 10.382  88.742  -20.250 1.00 81.77  ? 831  TYR A CD2   1 
ATOM   4940  C  CE1   . TYR A 1 803  ? 8.739   87.769  -18.259 1.00 72.97  ? 831  TYR A CE1   1 
ATOM   4941  C  CE2   . TYR A 1 803  ? 10.737  88.907  -18.925 1.00 92.62  ? 831  TYR A CE2   1 
ATOM   4942  C  CZ    . TYR A 1 803  ? 9.912   88.419  -17.934 1.00 86.05  ? 831  TYR A CZ    1 
ATOM   4943  O  OH    . TYR A 1 803  ? 10.264  88.582  -16.613 1.00 90.46  ? 831  TYR A OH    1 
ATOM   4944  N  N     . ASP A 1 804  ? 8.562   84.725  -22.102 1.00 81.79  ? 832  ASP A N     1 
ATOM   4945  C  CA    . ASP A 1 804  ? 7.362   84.981  -22.896 1.00 44.41  ? 832  ASP A CA    1 
ATOM   4946  C  C     . ASP A 1 804  ? 6.121   84.887  -22.016 1.00 44.40  ? 832  ASP A C     1 
ATOM   4947  O  O     . ASP A 1 804  ? 5.773   83.805  -21.540 1.00 47.16  ? 832  ASP A O     1 
ATOM   4948  C  CB    . ASP A 1 804  ? 7.267   83.994  -24.063 1.00 41.00  ? 832  ASP A CB    1 
ATOM   4949  C  CG    . ASP A 1 804  ? 6.320   84.462  -25.154 1.00 55.14  ? 832  ASP A CG    1 
ATOM   4950  O  OD1   . ASP A 1 804  ? 5.430   85.290  -24.869 1.00 55.04  ? 832  ASP A OD1   1 
ATOM   4951  O  OD2   . ASP A 1 804  ? 6.466   83.996  -26.304 1.00 56.52  ? 832  ASP A OD2   1 
ATOM   4952  N  N     . GLU A 1 805  ? 5.465   86.028  -21.810 1.00 46.11  ? 833  GLU A N     1 
ATOM   4953  C  CA    . GLU A 1 805  ? 4.278   86.120  -20.963 1.00 47.79  ? 833  GLU A CA    1 
ATOM   4954  C  C     . GLU A 1 805  ? 4.569   85.583  -19.563 1.00 44.82  ? 833  GLU A C     1 
ATOM   4955  O  O     . GLU A 1 805  ? 4.012   84.564  -19.151 1.00 40.66  ? 833  GLU A O     1 
ATOM   4956  C  CB    . GLU A 1 805  ? 3.102   85.365  -21.594 1.00 41.52  ? 833  GLU A CB    1 
ATOM   4957  C  CG    . GLU A 1 805  ? 1.732   85.788  -21.083 1.00 48.97  ? 833  GLU A CG    1 
ATOM   4958  C  CD    . GLU A 1 805  ? 1.312   87.154  -21.593 1.00 40.29  ? 833  GLU A CD    1 
ATOM   4959  O  OE1   . GLU A 1 805  ? 1.901   87.628  -22.588 1.00 49.55  ? 833  GLU A OE1   1 
ATOM   4960  O  OE2   . GLU A 1 805  ? 0.392   87.754  -21.000 1.00 42.24  ? 833  GLU A OE2   1 
ATOM   4961  N  N     . GLU A 1 806  ? 5.452   86.280  -18.848 1.00 75.15  ? 834  GLU A N     1 
ATOM   4962  C  CA    . GLU A 1 806  ? 5.896   85.881  -17.512 1.00 90.84  ? 834  GLU A CA    1 
ATOM   4963  C  C     . GLU A 1 806  ? 6.466   84.465  -17.506 1.00 84.97  ? 834  GLU A C     1 
ATOM   4964  O  O     . GLU A 1 806  ? 6.277   83.712  -16.550 1.00 73.15  ? 834  GLU A O     1 
ATOM   4965  C  CB    . GLU A 1 806  ? 4.750   85.992  -16.503 1.00 81.56  ? 834  GLU A CB    1 
ATOM   4966  C  CG    . GLU A 1 806  ? 4.187   87.395  -16.358 1.00 84.37  ? 834  GLU A CG    1 
ATOM   4967  C  CD    . GLU A 1 806  ? 3.100   87.480  -15.305 1.00 87.43  ? 834  GLU A CD    1 
ATOM   4968  O  OE1   . GLU A 1 806  ? 2.874   86.474  -14.599 1.00 85.66  ? 834  GLU A OE1   1 
ATOM   4969  O  OE2   . GLU A 1 806  ? 2.470   88.551  -15.184 1.00 93.23  ? 834  GLU A OE2   1 
ATOM   4970  N  N     . GLY A 1 807  ? 7.169   84.113  -18.578 1.00 90.98  ? 835  GLY A N     1 
ATOM   4971  C  CA    . GLY A 1 807  ? 7.748   82.790  -18.710 1.00 68.75  ? 835  GLY A CA    1 
ATOM   4972  C  C     . GLY A 1 807  ? 9.129   82.687  -18.094 1.00 76.86  ? 835  GLY A C     1 
ATOM   4973  O  O     . GLY A 1 807  ? 9.875   83.666  -18.046 1.00 72.03  ? 835  GLY A O     1 
ATOM   4974  N  N     . LEU A 1 808  ? 9.470   81.493  -17.622 1.00 68.71  ? 836  LEU A N     1 
ATOM   4975  C  CA    . LEU A 1 808  ? 10.768  81.251  -17.002 1.00 73.02  ? 836  LEU A CA    1 
ATOM   4976  C  C     . LEU A 1 808  ? 11.711  80.519  -17.948 1.00 60.98  ? 836  LEU A C     1 
ATOM   4977  O  O     . LEU A 1 808  ? 11.350  79.495  -18.526 1.00 60.55  ? 836  LEU A O     1 
ATOM   4978  C  CB    . LEU A 1 808  ? 10.605  80.449  -15.708 1.00 65.57  ? 836  LEU A CB    1 
ATOM   4979  C  CG    . LEU A 1 808  ? 10.453  81.239  -14.406 1.00 71.74  ? 836  LEU A CG    1 
ATOM   4980  C  CD1   . LEU A 1 808  ? 11.698  82.079  -14.150 1.00 66.37  ? 836  LEU A CD1   1 
ATOM   4981  C  CD2   . LEU A 1 808  ? 9.204   82.112  -14.421 1.00 76.35  ? 836  LEU A CD2   1 
ATOM   4982  N  N     . TYR A 1 809  ? 12.921  81.047  -18.103 1.00 60.30  ? 837  TYR A N     1 
ATOM   4983  C  CA    . TYR A 1 809  ? 13.938  80.388  -18.914 1.00 68.37  ? 837  TYR A CA    1 
ATOM   4984  C  C     . TYR A 1 809  ? 15.059  79.831  -18.043 1.00 55.68  ? 837  TYR A C     1 
ATOM   4985  O  O     . TYR A 1 809  ? 15.482  80.462  -17.076 1.00 66.47  ? 837  TYR A O     1 
ATOM   4986  C  CB    . TYR A 1 809  ? 14.510  81.350  -19.957 1.00 56.05  ? 837  TYR A CB    1 
ATOM   4987  C  CG    . TYR A 1 809  ? 13.598  81.579  -21.140 1.00 56.64  ? 837  TYR A CG    1 
ATOM   4988  C  CD1   . TYR A 1 809  ? 13.373  80.573  -22.072 1.00 74.72  ? 837  TYR A CD1   1 
ATOM   4989  C  CD2   . TYR A 1 809  ? 12.967  82.800  -21.330 1.00 68.05  ? 837  TYR A CD2   1 
ATOM   4990  C  CE1   . TYR A 1 809  ? 12.540  80.776  -23.156 1.00 75.46  ? 837  TYR A CE1   1 
ATOM   4991  C  CE2   . TYR A 1 809  ? 12.135  83.011  -22.413 1.00 66.40  ? 837  TYR A CE2   1 
ATOM   4992  C  CZ    . TYR A 1 809  ? 11.923  81.997  -23.321 1.00 69.98  ? 837  TYR A CZ    1 
ATOM   4993  O  OH    . TYR A 1 809  ? 11.094  82.207  -24.400 1.00 76.94  ? 837  TYR A OH    1 
ATOM   4994  N  N     . GLY A 1 810  ? 15.532  78.639  -18.391 1.00 45.65  ? 838  GLY A N     1 
ATOM   4995  C  CA    . GLY A 1 810  ? 16.597  77.998  -17.645 1.00 42.48  ? 838  GLY A CA    1 
ATOM   4996  C  C     . GLY A 1 810  ? 17.273  76.924  -18.470 1.00 49.49  ? 838  GLY A C     1 
ATOM   4997  O  O     . GLY A 1 810  ? 17.132  76.896  -19.693 1.00 56.72  ? 838  GLY A O     1 
ATOM   4998  N  N     . ALA A 1 811  ? 18.005  76.038  -17.804 1.00 47.66  ? 839  ALA A N     1 
ATOM   4999  C  CA    . ALA A 1 811  ? 18.715  74.969  -18.494 1.00 47.47  ? 839  ALA A CA    1 
ATOM   5000  C  C     . ALA A 1 811  ? 19.173  73.870  -17.542 1.00 43.69  ? 839  ALA A C     1 
ATOM   5001  O  O     . ALA A 1 811  ? 19.105  74.014  -16.321 1.00 44.62  ? 839  ALA A O     1 
ATOM   5002  C  CB    . ALA A 1 811  ? 19.909  75.533  -19.248 1.00 41.65  ? 839  ALA A CB    1 
ATOM   5003  N  N     . ILE A 1 812  ? 19.640  72.771  -18.123 1.00 41.76  ? 840  ILE A N     1 
ATOM   5004  C  CA    . ILE A 1 812  ? 20.209  71.663  -17.372 1.00 65.00  ? 840  ILE A CA    1 
ATOM   5005  C  C     . ILE A 1 812  ? 21.379  71.061  -18.148 1.00 56.47  ? 840  ILE A C     1 
ATOM   5006  O  O     . ILE A 1 812  ? 21.296  70.853  -19.364 1.00 48.59  ? 840  ILE A O     1 
ATOM   5007  C  CB    . ILE A 1 812  ? 19.154  70.573  -17.071 1.00 66.86  ? 840  ILE A CB    1 
ATOM   5008  C  CG1   . ILE A 1 812  ? 19.819  69.318  -16.492 1.00 70.47  ? 840  ILE A CG1   1 
ATOM   5009  C  CG2   . ILE A 1 812  ? 18.358  70.230  -18.324 1.00 40.02  ? 840  ILE A CG2   1 
ATOM   5010  C  CD1   . ILE A 1 812  ? 20.553  69.551  -15.179 1.00 72.60  ? 840  ILE A CD1   1 
ATOM   5011  N  N     . LEU A 1 813  ? 22.479  70.816  -17.443 1.00 40.19  ? 841  LEU A N     1 
ATOM   5012  C  CA    . LEU A 1 813  ? 23.622  70.134  -18.027 1.00 93.77  ? 841  LEU A CA    1 
ATOM   5013  C  C     . LEU A 1 813  ? 23.406  68.631  -17.922 1.00 92.52  ? 841  LEU A C     1 
ATOM   5014  O  O     . LEU A 1 813  ? 23.234  68.104  -16.823 1.00 92.68  ? 841  LEU A O     1 
ATOM   5015  C  CB    . LEU A 1 813  ? 24.925  70.542  -17.335 1.00 77.33  ? 841  LEU A CB    1 
ATOM   5016  C  CG    . LEU A 1 813  ? 25.325  72.020  -17.341 1.00 47.47  ? 841  LEU A CG    1 
ATOM   5017  C  CD1   . LEU A 1 813  ? 24.817  72.719  -18.591 1.00 42.87  ? 841  LEU A CD1   1 
ATOM   5018  C  CD2   . LEU A 1 813  ? 24.821  72.726  -16.098 1.00 44.12  ? 841  LEU A CD2   1 
ATOM   5019  N  N     . PRO A 1 814  ? 23.414  67.939  -19.073 1.00 91.64  ? 842  PRO A N     1 
ATOM   5020  C  CA    . PRO A 1 814  ? 23.103  66.512  -19.207 1.00 93.19  ? 842  PRO A CA    1 
ATOM   5021  C  C     . PRO A 1 814  ? 23.806  65.604  -18.203 1.00 47.87  ? 842  PRO A C     1 
ATOM   5022  O  O     . PRO A 1 814  ? 23.324  64.496  -17.977 1.00 55.35  ? 842  PRO A O     1 
ATOM   5023  C  CB    . PRO A 1 814  ? 23.568  66.197  -20.628 1.00 90.57  ? 842  PRO A CB    1 
ATOM   5024  C  CG    . PRO A 1 814  ? 23.341  67.459  -21.357 1.00 47.69  ? 842  PRO A CG    1 
ATOM   5025  C  CD    . PRO A 1 814  ? 23.697  68.553  -20.382 1.00 48.87  ? 842  PRO A CD    1 
ATOM   5026  N  N     . GLN A 1 815  ? 24.908  66.066  -17.617 1.00 92.51  ? 843  GLN A N     1 
ATOM   5027  C  CA    . GLN A 1 815  ? 25.660  65.276  -16.644 1.00 71.53  ? 843  GLN A CA    1 
ATOM   5028  C  C     . GLN A 1 815  ? 26.130  63.971  -17.286 1.00 56.19  ? 843  GLN A C     1 
ATOM   5029  O  O     . GLN A 1 815  ? 25.627  62.889  -16.981 1.00 93.46  ? 843  GLN A O     1 
ATOM   5030  C  CB    . GLN A 1 815  ? 24.811  65.006  -15.396 1.00 48.26  ? 843  GLN A CB    1 
ATOM   5031  C  CG    . GLN A 1 815  ? 25.551  64.339  -14.251 1.00 45.78  ? 843  GLN A CG    1 
ATOM   5032  C  CD    . GLN A 1 815  ? 24.661  64.110  -13.050 1.00 44.91  ? 843  GLN A CD    1 
ATOM   5033  O  OE1   . GLN A 1 815  ? 23.704  64.851  -12.822 1.00 41.56  ? 843  GLN A OE1   1 
ATOM   5034  N  NE2   . GLN A 1 815  ? 24.967  63.076  -12.276 1.00 67.50  ? 843  GLN A NE2   1 
ATOM   5035  N  N     . VAL A 1 816  ? 27.100  64.093  -18.186 1.00 40.59  ? 844  VAL A N     1 
ATOM   5036  C  CA    . VAL A 1 816  ? 27.551  62.970  -18.997 1.00 44.99  ? 844  VAL A CA    1 
ATOM   5037  C  C     . VAL A 1 816  ? 28.966  62.516  -18.647 1.00 46.19  ? 844  VAL A C     1 
ATOM   5038  O  O     . VAL A 1 816  ? 29.897  63.320  -18.616 1.00 64.05  ? 844  VAL A O     1 
ATOM   5039  C  CB    . VAL A 1 816  ? 27.497  63.324  -20.501 1.00 47.13  ? 844  VAL A CB    1 
ATOM   5040  C  CG1   . VAL A 1 816  ? 28.007  64.739  -20.735 1.00 44.80  ? 844  VAL A CG1   1 
ATOM   5041  C  CG2   . VAL A 1 816  ? 28.305  62.328  -21.317 1.00 46.37  ? 844  VAL A CG2   1 
ATOM   5042  N  N     . VAL A 1 817  ? 29.119  61.223  -18.374 1.00 47.10  ? 845  VAL A N     1 
ATOM   5043  C  CA    . VAL A 1 817  ? 30.442  60.636  -18.215 1.00 45.15  ? 845  VAL A CA    1 
ATOM   5044  C  C     . VAL A 1 817  ? 31.121  60.591  -19.580 1.00 64.30  ? 845  VAL A C     1 
ATOM   5045  O  O     . VAL A 1 817  ? 30.620  59.960  -20.511 1.00 46.49  ? 845  VAL A O     1 
ATOM   5046  C  CB    . VAL A 1 817  ? 30.376  59.226  -17.608 1.00 47.75  ? 845  VAL A CB    1 
ATOM   5047  C  CG1   . VAL A 1 817  ? 31.765  58.614  -17.534 1.00 40.93  ? 845  VAL A CG1   1 
ATOM   5048  C  CG2   . VAL A 1 817  ? 29.739  59.278  -16.229 1.00 47.56  ? 845  VAL A CG2   1 
ATOM   5049  N  N     . THR A 1 818  ? 32.262  61.266  -19.683 1.00 60.41  ? 846  THR A N     1 
ATOM   5050  C  CA    . THR A 1 818  ? 32.919  61.516  -20.963 1.00 55.60  ? 846  THR A CA    1 
ATOM   5051  C  C     . THR A 1 818  ? 33.258  60.248  -21.743 1.00 67.65  ? 846  THR A C     1 
ATOM   5052  O  O     . THR A 1 818  ? 33.251  60.247  -22.973 1.00 67.44  ? 846  THR A O     1 
ATOM   5053  C  CB    . THR A 1 818  ? 34.213  62.320  -20.762 1.00 75.79  ? 846  THR A CB    1 
ATOM   5054  O  OG1   . THR A 1 818  ? 33.997  63.338  -19.777 1.00 71.16  ? 846  THR A OG1   1 
ATOM   5055  C  CG2   . THR A 1 818  ? 34.645  62.961  -22.068 1.00 69.09  ? 846  THR A CG2   1 
ATOM   5056  N  N     . ALA A 1 819  ? 33.547  59.168  -21.027 1.00 69.01  ? 847  ALA A N     1 
ATOM   5057  C  CA    . ALA A 1 819  ? 33.959  57.929  -21.671 1.00 64.63  ? 847  ALA A CA    1 
ATOM   5058  C  C     . ALA A 1 819  ? 33.545  56.703  -20.869 1.00 45.69  ? 847  ALA A C     1 
ATOM   5059  O  O     . ALA A 1 819  ? 34.157  56.375  -19.854 1.00 47.72  ? 847  ALA A O     1 
ATOM   5060  C  CB    . ALA A 1 819  ? 35.463  57.929  -21.891 1.00 67.07  ? 847  ALA A CB    1 
ATOM   5061  N  N     . GLY A 1 820  ? 32.495  56.035  -21.332 1.00 60.31  ? 848  GLY A N     1 
ATOM   5062  C  CA    . GLY A 1 820  ? 32.077  54.773  -20.756 1.00 45.33  ? 848  GLY A CA    1 
ATOM   5063  C  C     . GLY A 1 820  ? 32.186  53.687  -21.805 1.00 66.34  ? 848  GLY A C     1 
ATOM   5064  O  O     . GLY A 1 820  ? 31.681  53.854  -22.917 1.00 45.91  ? 848  GLY A O     1 
ATOM   5065  N  N     . THR A 1 821  ? 32.861  52.594  -21.450 1.00 74.72  ? 849  THR A N     1 
ATOM   5066  C  CA    . THR A 1 821  ? 33.053  51.435  -22.325 1.00 76.07  ? 849  THR A CA    1 
ATOM   5067  C  C     . THR A 1 821  ? 31.816  51.132  -23.155 1.00 85.87  ? 849  THR A C     1 
ATOM   5068  O  O     . THR A 1 821  ? 30.703  51.176  -22.632 1.00 70.15  ? 849  THR A O     1 
ATOM   5069  C  CB    . THR A 1 821  ? 33.398  50.162  -21.515 1.00 90.09  ? 849  THR A CB    1 
ATOM   5070  O  OG1   . THR A 1 821  ? 32.667  50.167  -20.283 1.00 90.30  ? 849  THR A OG1   1 
ATOM   5071  C  CG2   . THR A 1 821  ? 34.880  50.077  -21.208 1.00 69.06  ? 849  THR A CG2   1 
ATOM   5072  N  N     . ILE A 1 822  ? 31.978  50.864  -24.449 1.00 74.20  ? 850  ILE A N     1 
ATOM   5073  C  CA    . ILE A 1 822  ? 33.226  50.999  -25.201 1.00 77.39  ? 850  ILE A CA    1 
ATOM   5074  C  C     . ILE A 1 822  ? 32.714  51.389  -26.594 1.00 72.04  ? 850  ILE A C     1 
ATOM   5075  O  O     . ILE A 1 822  ? 31.627  50.955  -26.977 1.00 69.85  ? 850  ILE A O     1 
ATOM   5076  C  CB    . ILE A 1 822  ? 34.079  49.676  -25.200 1.00 93.17  ? 850  ILE A CB    1 
ATOM   5077  C  CG1   . ILE A 1 822  ? 35.589  49.947  -25.259 1.00 69.67  ? 850  ILE A CG1   1 
ATOM   5078  C  CG2   . ILE A 1 822  ? 33.687  48.755  -26.340 1.00 90.46  ? 850  ILE A CG2   1 
ATOM   5079  C  CD1   . ILE A 1 822  ? 36.095  50.981  -24.286 1.00 76.29  ? 850  ILE A CD1   1 
ATOM   5080  N  N     . THR A 1 823  ? 33.434  52.219  -27.347 1.00 75.29  ? 851  THR A N     1 
ATOM   5081  C  CA    . THR A 1 823  ? 34.764  52.701  -27.008 1.00 71.70  ? 851  THR A CA    1 
ATOM   5082  C  C     . THR A 1 823  ? 34.779  54.157  -26.582 1.00 77.92  ? 851  THR A C     1 
ATOM   5083  O  O     . THR A 1 823  ? 34.725  55.054  -27.420 1.00 72.44  ? 851  THR A O     1 
ATOM   5084  C  CB    . THR A 1 823  ? 35.709  52.528  -28.196 1.00 75.40  ? 851  THR A CB    1 
ATOM   5085  O  OG1   . THR A 1 823  ? 35.870  53.783  -28.869 1.00 68.88  ? 851  THR A OG1   1 
ATOM   5086  C  CG2   . THR A 1 823  ? 35.126  51.511  -29.157 1.00 93.02  ? 851  THR A CG2   1 
ATOM   5087  N  N     . ARG A 1 824  ? 34.861  54.380  -25.274 1.00 66.71  ? 852  ARG A N     1 
ATOM   5088  C  CA    . ARG A 1 824  ? 34.887  55.724  -24.708 1.00 67.51  ? 852  ARG A CA    1 
ATOM   5089  C  C     . ARG A 1 824  ? 33.672  56.542  -25.139 1.00 60.46  ? 852  ARG A C     1 
ATOM   5090  O  O     . ARG A 1 824  ? 33.735  57.769  -25.211 1.00 56.27  ? 852  ARG A O     1 
ATOM   5091  C  CB    . ARG A 1 824  ? 36.176  56.448  -25.104 1.00 73.57  ? 852  ARG A CB    1 
ATOM   5092  C  CG    . ARG A 1 824  ? 37.437  55.642  -24.847 1.00 74.24  ? 852  ARG A CG    1 
ATOM   5093  C  CD    . ARG A 1 824  ? 38.685  56.424  -25.220 1.00 74.02  ? 852  ARG A CD    1 
ATOM   5094  N  NE    . ARG A 1 824  ? 38.588  57.018  -26.551 1.00 74.73  ? 852  ARG A NE    1 
ATOM   5095  C  CZ    . ARG A 1 824  ? 38.836  56.366  -27.682 1.00 77.08  ? 852  ARG A CZ    1 
ATOM   5096  N  NH1   . ARG A 1 824  ? 39.189  55.089  -27.651 1.00 65.14  ? 852  ARG A NH1   1 
ATOM   5097  N  NH2   . ARG A 1 824  ? 38.724  56.992  -28.846 1.00 71.53  ? 852  ARG A NH2   1 
ATOM   5098  N  N     . ARG A 1 825  ? 32.572  55.855  -25.431 1.00 45.66  ? 853  ARG A N     1 
ATOM   5099  C  CA    . ARG A 1 825  ? 31.326  56.522  -25.777 1.00 45.15  ? 853  ARG A CA    1 
ATOM   5100  C  C     . ARG A 1 825  ? 30.741  57.228  -24.564 1.00 48.62  ? 853  ARG A C     1 
ATOM   5101  O  O     . ARG A 1 825  ? 31.073  56.902  -23.425 1.00 40.47  ? 853  ARG A O     1 
ATOM   5102  C  CB    . ARG A 1 825  ? 30.310  55.528  -26.340 1.00 67.82  ? 853  ARG A CB    1 
ATOM   5103  C  CG    . ARG A 1 825  ? 30.459  55.274  -27.822 1.00 60.95  ? 853  ARG A CG    1 
ATOM   5104  C  CD    . ARG A 1 825  ? 29.216  54.625  -28.394 1.00 55.26  ? 853  ARG A CD    1 
ATOM   5105  N  NE    . ARG A 1 825  ? 29.278  54.543  -29.849 1.00 44.49  ? 853  ARG A NE    1 
ATOM   5106  C  CZ    . ARG A 1 825  ? 28.287  54.099  -30.613 1.00 44.18  ? 853  ARG A CZ    1 
ATOM   5107  N  NH1   . ARG A 1 825  ? 27.151  53.695  -30.060 1.00 42.08  ? 853  ARG A NH1   1 
ATOM   5108  N  NH2   . ARG A 1 825  ? 28.432  54.061  -31.930 1.00 46.26  ? 853  ARG A NH2   1 
ATOM   5109  N  N     . ALA A 1 826  ? 29.869  58.196  -24.818 1.00 47.35  ? 854  ALA A N     1 
ATOM   5110  C  CA    . ALA A 1 826  ? 29.213  58.928  -23.745 1.00 45.18  ? 854  ALA A CA    1 
ATOM   5111  C  C     . ALA A 1 826  ? 28.308  58.004  -22.936 1.00 56.25  ? 854  ALA A C     1 
ATOM   5112  O  O     . ALA A 1 826  ? 27.739  57.054  -23.473 1.00 48.76  ? 854  ALA A O     1 
ATOM   5113  C  CB    . ALA A 1 826  ? 28.416  60.091  -24.312 1.00 56.66  ? 854  ALA A CB    1 
ATOM   5114  N  N     . VAL A 1 827  ? 28.187  58.281  -21.641 1.00 56.68  ? 855  VAL A N     1 
ATOM   5115  C  CA    . VAL A 1 827  ? 27.281  57.531  -20.774 1.00 68.43  ? 855  VAL A CA    1 
ATOM   5116  C  C     . VAL A 1 827  ? 26.436  58.472  -19.920 1.00 64.94  ? 855  VAL A C     1 
ATOM   5117  O  O     . VAL A 1 827  ? 26.963  59.265  -19.140 1.00 66.92  ? 855  VAL A O     1 
ATOM   5118  C  CB    . VAL A 1 827  ? 28.042  56.552  -19.859 1.00 45.57  ? 855  VAL A CB    1 
ATOM   5119  C  CG1   . VAL A 1 827  ? 27.161  56.103  -18.703 1.00 45.13  ? 855  VAL A CG1   1 
ATOM   5120  C  CG2   . VAL A 1 827  ? 28.505  55.349  -20.657 1.00 47.62  ? 855  VAL A CG2   1 
ATOM   5121  N  N     . GLU A 1 828  ? 25.120  58.375  -20.075 1.00 93.62  ? 856  GLU A N     1 
ATOM   5122  C  CA    . GLU A 1 828  ? 24.197  59.243  -19.358 1.00 47.88  ? 856  GLU A CA    1 
ATOM   5123  C  C     . GLU A 1 828  ? 22.888  58.509  -19.076 1.00 64.56  ? 856  GLU A C     1 
ATOM   5124  O  O     . GLU A 1 828  ? 22.267  57.969  -19.991 1.00 71.20  ? 856  GLU A O     1 
ATOM   5125  C  CB    . GLU A 1 828  ? 23.942  60.521  -20.158 1.00 42.16  ? 856  GLU A CB    1 
ATOM   5126  C  CG    . GLU A 1 828  ? 23.562  61.720  -19.314 1.00 43.06  ? 856  GLU A CG    1 
ATOM   5127  C  CD    . GLU A 1 828  ? 22.126  61.670  -18.836 1.00 64.86  ? 856  GLU A CD    1 
ATOM   5128  O  OE1   . GLU A 1 828  ? 21.267  61.181  -19.597 1.00 72.72  ? 856  GLU A OE1   1 
ATOM   5129  O  OE2   . GLU A 1 828  ? 21.858  62.114  -17.700 1.00 56.65  ? 856  GLU A OE2   1 
ATOM   5130  N  N     . PRO A 1 829  ? 22.471  58.487  -17.800 1.00 67.15  ? 857  PRO A N     1 
ATOM   5131  C  CA    . PRO A 1 829  ? 21.311  57.723  -17.326 1.00 48.52  ? 857  PRO A CA    1 
ATOM   5132  C  C     . PRO A 1 829  ? 19.995  58.020  -18.049 1.00 55.38  ? 857  PRO A C     1 
ATOM   5133  O  O     . PRO A 1 829  ? 19.169  57.117  -18.178 1.00 55.67  ? 857  PRO A O     1 
ATOM   5134  C  CB    . PRO A 1 829  ? 21.205  58.138  -15.855 1.00 55.21  ? 857  PRO A CB    1 
ATOM   5135  C  CG    . PRO A 1 829  ? 22.589  58.507  -15.473 1.00 93.52  ? 857  PRO A CG    1 
ATOM   5136  C  CD    . PRO A 1 829  ? 23.173  59.159  -16.691 1.00 92.64  ? 857  PRO A CD    1 
ATOM   5137  N  N     . THR A 1 830  ? 19.804  59.250  -18.516 1.00 42.79  ? 858  THR A N     1 
ATOM   5138  C  CA    . THR A 1 830  ? 18.496  59.670  -19.014 1.00 48.31  ? 858  THR A CA    1 
ATOM   5139  C  C     . THR A 1 830  ? 18.463  60.015  -20.502 1.00 43.14  ? 858  THR A C     1 
ATOM   5140  O  O     . THR A 1 830  ? 17.665  59.460  -21.257 1.00 43.73  ? 858  THR A O     1 
ATOM   5141  C  CB    . THR A 1 830  ? 17.982  60.899  -18.233 1.00 40.72  ? 858  THR A CB    1 
ATOM   5142  O  OG1   . THR A 1 830  ? 18.008  60.623  -16.827 1.00 49.09  ? 858  THR A OG1   1 
ATOM   5143  C  CG2   . THR A 1 830  ? 16.564  61.246  -18.656 1.00 46.27  ? 858  THR A CG2   1 
ATOM   5144  N  N     . TRP A 1 831  ? 19.330  60.933  -20.915 1.00 47.73  ? 859  TRP A N     1 
ATOM   5145  C  CA    . TRP A 1 831  ? 19.236  61.542  -22.239 1.00 49.51  ? 859  TRP A CA    1 
ATOM   5146  C  C     . TRP A 1 831  ? 19.778  60.677  -23.375 1.00 60.58  ? 859  TRP A C     1 
ATOM   5147  O  O     . TRP A 1 831  ? 19.395  60.856  -24.530 1.00 45.67  ? 859  TRP A O     1 
ATOM   5148  C  CB    . TRP A 1 831  ? 19.954  62.891  -22.231 1.00 47.20  ? 859  TRP A CB    1 
ATOM   5149  C  CG    . TRP A 1 831  ? 19.309  63.871  -21.306 1.00 48.08  ? 859  TRP A CG    1 
ATOM   5150  C  CD1   . TRP A 1 831  ? 19.699  64.182  -20.036 1.00 40.48  ? 859  TRP A CD1   1 
ATOM   5151  C  CD2   . TRP A 1 831  ? 18.139  64.653  -21.570 1.00 85.41  ? 859  TRP A CD2   1 
ATOM   5152  N  NE1   . TRP A 1 831  ? 18.850  65.118  -19.497 1.00 49.44  ? 859  TRP A NE1   1 
ATOM   5153  C  CE2   . TRP A 1 831  ? 17.883  65.423  -20.418 1.00 85.84  ? 859  TRP A CE2   1 
ATOM   5154  C  CE3   . TRP A 1 831  ? 17.286  64.780  -22.670 1.00 85.43  ? 859  TRP A CE3   1 
ATOM   5155  C  CZ2   . TRP A 1 831  ? 16.811  66.309  -20.336 1.00 43.84  ? 859  TRP A CZ2   1 
ATOM   5156  C  CZ3   . TRP A 1 831  ? 16.224  65.660  -22.587 1.00 41.07  ? 859  TRP A CZ3   1 
ATOM   5157  C  CH2   . TRP A 1 831  ? 15.995  66.412  -21.428 1.00 43.96  ? 859  TRP A CH2   1 
ATOM   5158  N  N     . LEU A 1 832  ? 20.663  59.742  -23.054 1.00 49.27  ? 860  LEU A N     1 
ATOM   5159  C  CA    . LEU A 1 832  ? 21.204  58.855  -24.076 1.00 56.88  ? 860  LEU A CA    1 
ATOM   5160  C  C     . LEU A 1 832  ? 20.261  57.687  -24.340 1.00 47.34  ? 860  LEU A C     1 
ATOM   5161  O  O     . LEU A 1 832  ? 20.377  57.000  -25.353 1.00 47.05  ? 860  LEU A O     1 
ATOM   5162  C  CB    . LEU A 1 832  ? 22.588  58.349  -23.670 1.00 43.75  ? 860  LEU A CB    1 
ATOM   5163  C  CG    . LEU A 1 832  ? 23.683  59.414  -23.739 1.00 47.82  ? 860  LEU A CG    1 
ATOM   5164  C  CD1   . LEU A 1 832  ? 25.013  58.843  -23.307 1.00 41.88  ? 860  LEU A CD1   1 
ATOM   5165  C  CD2   . LEU A 1 832  ? 23.783  59.985  -25.141 1.00 91.79  ? 860  LEU A CD2   1 
ATOM   5166  N  N     . THR A 1 833  ? 19.325  57.471  -23.424 1.00 60.14  ? 861  THR A N     1 
ATOM   5167  C  CA    . THR A 1 833  ? 18.312  56.437  -23.595 1.00 66.40  ? 861  THR A CA    1 
ATOM   5168  C  C     . THR A 1 833  ? 16.940  57.079  -23.761 1.00 56.31  ? 861  THR A C     1 
ATOM   5169  O  O     . THR A 1 833  ? 15.910  56.456  -23.502 1.00 49.62  ? 861  THR A O     1 
ATOM   5170  C  CB    . THR A 1 833  ? 18.289  55.464  -22.405 1.00 69.99  ? 861  THR A CB    1 
ATOM   5171  O  OG1   . THR A 1 833  ? 17.829  56.147  -21.232 1.00 73.25  ? 861  THR A OG1   1 
ATOM   5172  C  CG2   . THR A 1 833  ? 19.680  54.911  -22.149 1.00 60.88  ? 861  THR A CG2   1 
ATOM   5173  N  N     . ALA A 1 834  ? 16.942  58.334  -24.197 1.00 56.44  ? 862  ALA A N     1 
ATOM   5174  C  CA    . ALA A 1 834  ? 15.714  59.092  -24.400 1.00 66.21  ? 862  ALA A CA    1 
ATOM   5175  C  C     . ALA A 1 834  ? 14.960  58.604  -25.630 1.00 66.90  ? 862  ALA A C     1 
ATOM   5176  O  O     . ALA A 1 834  ? 15.521  58.538  -26.723 1.00 69.10  ? 862  ALA A O     1 
ATOM   5177  C  CB    . ALA A 1 834  ? 16.028  60.572  -24.529 1.00 75.91  ? 862  ALA A CB    1 
ATOM   5178  N  N     . SER A 1 835  ? 13.686  58.273  -25.446 1.00 60.33  ? 863  SER A N     1 
ATOM   5179  C  CA    . SER A 1 835  ? 12.856  57.763  -26.532 1.00 93.51  ? 863  SER A CA    1 
ATOM   5180  C  C     . SER A 1 835  ? 12.694  58.781  -27.656 1.00 68.06  ? 863  SER A C     1 
ATOM   5181  O  O     . SER A 1 835  ? 12.894  59.979  -27.461 1.00 64.07  ? 863  SER A O     1 
ATOM   5182  C  CB    . SER A 1 835  ? 11.481  57.353  -26.006 1.00 85.63  ? 863  SER A CB    1 
ATOM   5183  O  OG    . SER A 1 835  ? 10.638  56.940  -27.067 1.00 68.84  ? 863  SER A OG    1 
ATOM   5184  N  N     . ASN A 1 836  ? 12.333  58.289  -28.836 1.00 56.02  ? 864  ASN A N     1 
ATOM   5185  C  CA    . ASN A 1 836  ? 12.136  59.148  -29.995 1.00 76.68  ? 864  ASN A CA    1 
ATOM   5186  C  C     . ASN A 1 836  ? 10.678  59.561  -30.159 1.00 68.00  ? 864  ASN A C     1 
ATOM   5187  O  O     . ASN A 1 836  ? 9.816   59.146  -29.386 1.00 71.59  ? 864  ASN A O     1 
ATOM   5188  C  CB    . ASN A 1 836  ? 12.631  58.451  -31.262 1.00 72.85  ? 864  ASN A CB    1 
ATOM   5189  C  CG    . ASN A 1 836  ? 14.141  58.472  -31.383 1.00 65.22  ? 864  ASN A CG    1 
ATOM   5190  O  OD1   . ASN A 1 836  ? 14.793  59.439  -30.988 1.00 43.26  ? 864  ASN A OD1   1 
ATOM   5191  N  ND2   . ASN A 1 836  ? 14.707  57.403  -31.932 1.00 72.56  ? 864  ASN A ND2   1 
ATOM   5192  N  N     . ALA A 1 837  ? 10.412  60.378  -31.172 1.00 77.84  ? 865  ALA A N     1 
ATOM   5193  C  CA    . ALA A 1 837  ? 9.073   60.907  -31.403 1.00 55.02  ? 865  ALA A CA    1 
ATOM   5194  C  C     . ALA A 1 837  ? 8.121   59.838  -31.931 1.00 60.95  ? 865  ALA A C     1 
ATOM   5195  O  O     . ALA A 1 837  ? 7.957   59.685  -33.141 1.00 55.19  ? 865  ALA A O     1 
ATOM   5196  C  CB    . ALA A 1 837  ? 9.132   62.082  -32.370 1.00 69.15  ? 865  ALA A CB    1 
ATOM   5197  N  N     . ARG A 1 838  ? 7.499   59.099  -31.018 1.00 45.43  ? 866  ARG A N     1 
ATOM   5198  C  CA    . ARG A 1 838  ? 6.492   58.113  -31.393 1.00 69.33  ? 866  ARG A CA    1 
ATOM   5199  C  C     . ARG A 1 838  ? 5.135   58.489  -30.812 1.00 64.43  ? 866  ARG A C     1 
ATOM   5200  O  O     . ARG A 1 838  ? 5.021   58.761  -29.617 1.00 43.93  ? 866  ARG A O     1 
ATOM   5201  C  CB    . ARG A 1 838  ? 6.892   56.713  -30.924 1.00 70.34  ? 866  ARG A CB    1 
ATOM   5202  C  CG    . ARG A 1 838  ? 7.084   55.710  -32.053 1.00 70.90  ? 866  ARG A CG    1 
ATOM   5203  C  CD    . ARG A 1 838  ? 7.001   54.276  -31.548 1.00 68.40  ? 866  ARG A CD    1 
ATOM   5204  N  NE    . ARG A 1 838  ? 7.882   54.040  -30.408 1.00 71.95  ? 866  ARG A NE    1 
ATOM   5205  C  CZ    . ARG A 1 838  ? 9.144   53.635  -30.508 1.00 75.51  ? 866  ARG A CZ    1 
ATOM   5206  N  NH1   . ARG A 1 838  ? 9.681   53.421  -31.702 1.00 81.75  ? 866  ARG A NH1   1 
ATOM   5207  N  NH2   . ARG A 1 838  ? 9.870   53.445  -29.415 1.00 74.82  ? 866  ARG A NH2   1 
ATOM   5208  N  N     . PRO A 1 839  ? 4.094   58.494  -31.659 1.00 56.93  ? 867  PRO A N     1 
ATOM   5209  C  CA    . PRO A 1 839  ? 2.733   58.856  -31.248 1.00 44.21  ? 867  PRO A CA    1 
ATOM   5210  C  C     . PRO A 1 839  ? 2.076   57.806  -30.353 1.00 43.46  ? 867  PRO A C     1 
ATOM   5211  O  O     . PRO A 1 839  ? 0.883   57.893  -30.076 1.00 44.63  ? 867  PRO A O     1 
ATOM   5212  C  CB    . PRO A 1 839  ? 1.989   58.968  -32.581 1.00 46.98  ? 867  PRO A CB    1 
ATOM   5213  C  CG    . PRO A 1 839  ? 2.719   58.044  -33.487 1.00 47.14  ? 867  PRO A CG    1 
ATOM   5214  C  CD    . PRO A 1 839  ? 4.164   58.157  -33.092 1.00 69.12  ? 867  PRO A CD    1 
ATOM   5215  N  N     . ASP A 1 840  ? 2.855   56.828  -29.906 1.00 75.01  ? 868  ASP A N     1 
ATOM   5216  C  CA    . ASP A 1 840  ? 2.346   55.757  -29.061 1.00 56.07  ? 868  ASP A CA    1 
ATOM   5217  C  C     . ASP A 1 840  ? 2.766   55.939  -27.605 1.00 75.91  ? 868  ASP A C     1 
ATOM   5218  O  O     . ASP A 1 840  ? 1.942   55.840  -26.695 1.00 56.88  ? 868  ASP A O     1 
ATOM   5219  C  CB    . ASP A 1 840  ? 2.832   54.404  -29.582 1.00 67.04  ? 868  ASP A CB    1 
ATOM   5220  C  CG    . ASP A 1 840  ? 2.717   53.306  -28.548 1.00 77.29  ? 868  ASP A CG    1 
ATOM   5221  O  OD1   . ASP A 1 840  ? 1.632   53.155  -27.951 1.00 74.80  ? 868  ASP A OD1   1 
ATOM   5222  O  OD2   . ASP A 1 840  ? 3.722   52.599  -28.327 1.00 70.91  ? 868  ASP A OD2   1 
ATOM   5223  N  N     . ARG A 1 841  ? 4.051   56.210  -27.394 1.00 71.15  ? 869  ARG A N     1 
ATOM   5224  C  CA    . ARG A 1 841  ? 4.610   56.316  -26.050 1.00 66.05  ? 869  ARG A CA    1 
ATOM   5225  C  C     . ARG A 1 841  ? 4.208   57.624  -25.374 1.00 48.18  ? 869  ARG A C     1 
ATOM   5226  O  O     . ARG A 1 841  ? 4.038   58.647  -26.036 1.00 65.29  ? 869  ARG A O     1 
ATOM   5227  C  CB    . ARG A 1 841  ? 6.134   56.193  -26.103 1.00 73.75  ? 869  ARG A CB    1 
ATOM   5228  C  CG    . ARG A 1 841  ? 6.626   55.209  -27.153 1.00 64.04  ? 869  ARG A CG    1 
ATOM   5229  C  CD    . ARG A 1 841  ? 8.088   54.858  -26.955 1.00 64.37  ? 869  ARG A CD    1 
ATOM   5230  N  NE    . ARG A 1 841  ? 8.278   53.993  -25.796 1.00 74.96  ? 869  ARG A NE    1 
ATOM   5231  C  CZ    . ARG A 1 841  ? 8.180   52.668  -25.830 1.00 90.31  ? 869  ARG A CZ    1 
ATOM   5232  N  NH1   . ARG A 1 841  ? 7.895   52.052  -26.970 1.00 91.64  ? 869  ARG A NH1   1 
ATOM   5233  N  NH2   . ARG A 1 841  ? 8.369   51.957  -24.727 1.00 92.65  ? 869  ARG A NH2   1 
ATOM   5234  N  N     . VAL A 1 842  ? 4.064   57.584  -24.053 1.00 46.20  ? 870  VAL A N     1 
ATOM   5235  C  CA    . VAL A 1 842  ? 3.564   58.729  -23.296 1.00 46.21  ? 870  VAL A CA    1 
ATOM   5236  C  C     . VAL A 1 842  ? 4.553   59.894  -23.254 1.00 56.79  ? 870  VAL A C     1 
ATOM   5237  O  O     . VAL A 1 842  ? 4.239   60.994  -23.705 1.00 75.23  ? 870  VAL A O     1 
ATOM   5238  C  CB    . VAL A 1 842  ? 3.202   58.329  -21.851 1.00 40.35  ? 870  VAL A CB    1 
ATOM   5239  C  CG1   . VAL A 1 842  ? 2.894   59.561  -21.015 1.00 40.11  ? 870  VAL A CG1   1 
ATOM   5240  C  CG2   . VAL A 1 842  ? 2.018   57.374  -21.848 1.00 40.83  ? 870  VAL A CG2   1 
ATOM   5241  N  N     . GLY A 1 843  ? 5.743   59.656  -22.713 1.00 43.42  ? 871  GLY A N     1 
ATOM   5242  C  CA    . GLY A 1 843  ? 6.728   60.715  -22.572 1.00 43.47  ? 871  GLY A CA    1 
ATOM   5243  C  C     . GLY A 1 843  ? 7.636   60.865  -23.779 1.00 47.38  ? 871  GLY A C     1 
ATOM   5244  O  O     . GLY A 1 843  ? 8.761   61.351  -23.659 1.00 86.22  ? 871  GLY A O     1 
ATOM   5245  N  N     . SER A 1 844  ? 7.138   60.468  -24.947 1.00 49.58  ? 872  SER A N     1 
ATOM   5246  C  CA    . SER A 1 844  ? 7.938   60.448  -26.171 1.00 43.04  ? 872  SER A CA    1 
ATOM   5247  C  C     . SER A 1 844  ? 8.365   61.838  -26.640 1.00 42.84  ? 872  SER A C     1 
ATOM   5248  O  O     . SER A 1 844  ? 9.145   61.970  -27.583 1.00 55.09  ? 872  SER A O     1 
ATOM   5249  C  CB    . SER A 1 844  ? 7.164   59.747  -27.289 1.00 48.37  ? 872  SER A CB    1 
ATOM   5250  O  OG    . SER A 1 844  ? 7.860   59.830  -28.519 1.00 56.00  ? 872  SER A OG    1 
ATOM   5251  N  N     . GLU A 1 845  ? 7.856   62.869  -25.978 1.00 41.19  ? 873  GLU A N     1 
ATOM   5252  C  CA    . GLU A 1 845  ? 8.162   64.244  -26.347 1.00 41.80  ? 873  GLU A CA    1 
ATOM   5253  C  C     . GLU A 1 845  ? 9.421   64.741  -25.651 1.00 55.82  ? 873  GLU A C     1 
ATOM   5254  O  O     . GLU A 1 845  ? 9.877   65.855  -25.907 1.00 68.95  ? 873  GLU A O     1 
ATOM   5255  C  CB    . GLU A 1 845  ? 6.987   65.160  -26.006 1.00 45.87  ? 873  GLU A CB    1 
ATOM   5256  C  CG    . GLU A 1 845  ? 5.644   64.624  -26.455 1.00 66.69  ? 873  GLU A CG    1 
ATOM   5257  C  CD    . GLU A 1 845  ? 4.990   63.721  -25.426 1.00 68.07  ? 873  GLU A CD    1 
ATOM   5258  O  OE1   . GLU A 1 845  ? 5.279   63.884  -24.221 1.00 48.68  ? 873  GLU A OE1   1 
ATOM   5259  O  OE2   . GLU A 1 845  ? 4.187   62.850  -25.824 1.00 65.17  ? 873  GLU A OE2   1 
ATOM   5260  N  N     . LEU A 1 846  ? 9.972   63.905  -24.774 1.00 40.50  ? 874  LEU A N     1 
ATOM   5261  C  CA    . LEU A 1 846  ? 11.134  64.261  -23.963 1.00 43.38  ? 874  LEU A CA    1 
ATOM   5262  C  C     . LEU A 1 846  ? 12.276  64.816  -24.811 1.00 65.86  ? 874  LEU A C     1 
ATOM   5263  O  O     . LEU A 1 846  ? 12.924  65.793  -24.436 1.00 42.62  ? 874  LEU A O     1 
ATOM   5264  C  CB    . LEU A 1 846  ? 11.609  63.041  -23.165 1.00 42.92  ? 874  LEU A CB    1 
ATOM   5265  C  CG    . LEU A 1 846  ? 12.685  63.222  -22.088 1.00 40.15  ? 874  LEU A CG    1 
ATOM   5266  C  CD1   . LEU A 1 846  ? 14.067  62.884  -22.616 1.00 77.64  ? 874  LEU A CD1   1 
ATOM   5267  C  CD2   . LEU A 1 846  ? 12.653  64.626  -21.502 1.00 45.63  ? 874  LEU A CD2   1 
ATOM   5268  N  N     . LYS A 1 847  ? 12.506  64.193  -25.960 1.00 70.93  ? 875  LYS A N     1 
ATOM   5269  C  CA    . LYS A 1 847  ? 13.569  64.619  -26.856 1.00 68.72  ? 875  LYS A CA    1 
ATOM   5270  C  C     . LYS A 1 847  ? 13.316  66.032  -27.376 1.00 69.35  ? 875  LYS A C     1 
ATOM   5271  O  O     . LYS A 1 847  ? 14.242  66.831  -27.497 1.00 56.26  ? 875  LYS A O     1 
ATOM   5272  C  CB    . LYS A 1 847  ? 13.699  63.640  -28.024 1.00 74.96  ? 875  LYS A CB    1 
ATOM   5273  C  CG    . LYS A 1 847  ? 15.074  63.602  -28.665 1.00 76.44  ? 875  LYS A CG    1 
ATOM   5274  C  CD    . LYS A 1 847  ? 16.116  63.058  -27.704 1.00 75.60  ? 875  LYS A CD    1 
ATOM   5275  C  CE    . LYS A 1 847  ? 17.406  62.721  -28.430 1.00 75.39  ? 875  LYS A CE    1 
ATOM   5276  N  NZ    . LYS A 1 847  ? 17.188  61.686  -29.480 1.00 72.46  ? 875  LYS A NZ    1 
ATOM   5277  N  N     . ALA A 1 848  ? 12.055  66.338  -27.665 1.00 66.25  ? 876  ALA A N     1 
ATOM   5278  C  CA    . ALA A 1 848  ? 11.697  67.613  -28.282 1.00 60.47  ? 876  ALA A CA    1 
ATOM   5279  C  C     . ALA A 1 848  ? 11.256  68.668  -27.268 1.00 56.32  ? 876  ALA A C     1 
ATOM   5280  O  O     . ALA A 1 848  ? 10.661  69.679  -27.640 1.00 45.68  ? 876  ALA A O     1 
ATOM   5281  C  CB    . ALA A 1 848  ? 10.605  67.399  -29.319 1.00 68.25  ? 876  ALA A CB    1 
ATOM   5282  N  N     . MET A 1 849  ? 11.546  68.435  -25.992 1.00 68.71  ? 877  MET A N     1 
ATOM   5283  C  CA    . MET A 1 849  ? 11.231  69.418  -24.959 1.00 69.97  ? 877  MET A CA    1 
ATOM   5284  C  C     . MET A 1 849  ? 12.422  70.320  -24.667 1.00 56.96  ? 877  MET A C     1 
ATOM   5285  O  O     . MET A 1 849  ? 12.310  71.286  -23.912 1.00 73.18  ? 877  MET A O     1 
ATOM   5286  C  CB    . MET A 1 849  ? 10.771  68.732  -23.673 1.00 70.65  ? 877  MET A CB    1 
ATOM   5287  C  CG    . MET A 1 849  ? 9.379   68.129  -23.761 1.00 73.04  ? 877  MET A CG    1 
ATOM   5288  S  SD    . MET A 1 849  ? 8.177   69.248  -24.505 1.00 45.25  ? 877  MET A SD    1 
ATOM   5289  C  CE    . MET A 1 849  ? 8.237   70.626  -23.366 1.00 43.61  ? 877  MET A CE    1 
ATOM   5290  N  N     . VAL A 1 850  ? 13.566  69.994  -25.259 1.00 60.85  ? 878  VAL A N     1 
ATOM   5291  C  CA    . VAL A 1 850  ? 14.738  70.849  -25.157 1.00 90.41  ? 878  VAL A CA    1 
ATOM   5292  C  C     . VAL A 1 850  ? 14.604  71.979  -26.169 1.00 55.44  ? 878  VAL A C     1 
ATOM   5293  O  O     . VAL A 1 850  ? 15.046  71.863  -27.312 1.00 45.54  ? 878  VAL A O     1 
ATOM   5294  C  CB    . VAL A 1 850  ? 16.042  70.072  -25.403 1.00 43.89  ? 878  VAL A CB    1 
ATOM   5295  C  CG1   . VAL A 1 850  ? 17.246  70.973  -25.168 1.00 93.59  ? 878  VAL A CG1   1 
ATOM   5296  C  CG2   . VAL A 1 850  ? 16.107  68.850  -24.500 1.00 93.01  ? 878  VAL A CG2   1 
ATOM   5297  N  N     . GLN A 1 851  ? 13.978  73.070  -25.740 1.00 49.93  ? 879  GLN A N     1 
ATOM   5298  C  CA    . GLN A 1 851  ? 13.668  74.179  -26.633 1.00 42.10  ? 879  GLN A CA    1 
ATOM   5299  C  C     . GLN A 1 851  ? 14.697  75.297  -26.533 1.00 48.09  ? 879  GLN A C     1 
ATOM   5300  O  O     . GLN A 1 851  ? 15.060  75.731  -25.438 1.00 56.69  ? 879  GLN A O     1 
ATOM   5301  C  CB    . GLN A 1 851  ? 12.276  74.726  -26.325 1.00 86.58  ? 879  GLN A CB    1 
ATOM   5302  C  CG    . GLN A 1 851  ? 11.185  73.676  -26.365 1.00 49.13  ? 879  GLN A CG    1 
ATOM   5303  C  CD    . GLN A 1 851  ? 9.889   74.174  -25.767 1.00 40.40  ? 879  GLN A CD    1 
ATOM   5304  O  OE1   . GLN A 1 851  ? 9.859   75.208  -25.102 1.00 46.33  ? 879  GLN A OE1   1 
ATOM   5305  N  NE2   . GLN A 1 851  ? 8.808   73.441  -26.001 1.00 69.37  ? 879  GLN A NE2   1 
ATOM   5306  N  N     . ALA A 1 852  ? 15.160  75.760  -27.688 1.00 49.75  ? 880  ALA A N     1 
ATOM   5307  C  CA    . ALA A 1 852  ? 16.145  76.830  -27.744 1.00 48.89  ? 880  ALA A CA    1 
ATOM   5308  C  C     . ALA A 1 852  ? 15.543  78.147  -27.275 1.00 69.45  ? 880  ALA A C     1 
ATOM   5309  O  O     . ALA A 1 852  ? 14.381  78.436  -27.556 1.00 76.69  ? 880  ALA A O     1 
ATOM   5310  C  CB    . ALA A 1 852  ? 16.695  76.972  -29.155 1.00 43.16  ? 880  ALA A CB    1 
ATOM   5311  N  N     . PRO A 1 853  ? 16.337  78.947  -26.548 1.00 64.29  ? 881  PRO A N     1 
ATOM   5312  C  CA    . PRO A 1 853  ? 15.925  80.287  -26.121 1.00 65.77  ? 881  PRO A CA    1 
ATOM   5313  C  C     . PRO A 1 853  ? 15.626  81.185  -27.319 1.00 71.73  ? 881  PRO A C     1 
ATOM   5314  O  O     . PRO A 1 853  ? 16.151  80.937  -28.404 1.00 68.55  ? 881  PRO A O     1 
ATOM   5315  C  CB    . PRO A 1 853  ? 17.141  80.795  -25.338 1.00 65.80  ? 881  PRO A CB    1 
ATOM   5316  C  CG    . PRO A 1 853  ? 17.853  79.561  -24.902 1.00 60.05  ? 881  PRO A CG    1 
ATOM   5317  C  CD    . PRO A 1 853  ? 17.665  78.589  -26.024 1.00 69.25  ? 881  PRO A CD    1 
ATOM   5318  N  N     . PRO A 1 854  ? 14.786  82.214  -27.126 1.00 67.79  ? 882  PRO A N     1 
ATOM   5319  C  CA    . PRO A 1 854  ? 14.431  83.141  -28.207 1.00 55.52  ? 882  PRO A CA    1 
ATOM   5320  C  C     . PRO A 1 854  ? 15.649  83.859  -28.773 1.00 56.17  ? 882  PRO A C     1 
ATOM   5321  O  O     . PRO A 1 854  ? 16.504  84.315  -28.016 1.00 65.75  ? 882  PRO A O     1 
ATOM   5322  C  CB    . PRO A 1 854  ? 13.481  84.131  -27.527 1.00 56.62  ? 882  PRO A CB    1 
ATOM   5323  C  CG    . PRO A 1 854  ? 13.770  84.009  -26.072 1.00 44.06  ? 882  PRO A CG    1 
ATOM   5324  C  CD    . PRO A 1 854  ? 14.148  82.583  -25.852 1.00 43.77  ? 882  PRO A CD    1 
ATOM   5325  N  N     . GLY A 1 855  ? 15.721  83.954  -30.096 1.00 56.28  ? 883  GLY A N     1 
ATOM   5326  C  CA    . GLY A 1 855  ? 16.880  84.524  -30.756 1.00 60.62  ? 883  GLY A CA    1 
ATOM   5327  C  C     . GLY A 1 855  ? 17.889  83.440  -31.079 1.00 56.10  ? 883  GLY A C     1 
ATOM   5328  O  O     . GLY A 1 855  ? 18.731  83.600  -31.961 1.00 49.53  ? 883  GLY A O     1 
ATOM   5329  N  N     . TYR A 1 856  ? 17.794  82.329  -30.355 1.00 60.86  ? 884  TYR A N     1 
ATOM   5330  C  CA    . TYR A 1 856  ? 18.667  81.185  -30.576 1.00 69.67  ? 884  TYR A CA    1 
ATOM   5331  C  C     . TYR A 1 856  ? 17.931  80.043  -31.267 1.00 67.02  ? 884  TYR A C     1 
ATOM   5332  O  O     . TYR A 1 856  ? 16.704  79.952  -31.211 1.00 69.55  ? 884  TYR A O     1 
ATOM   5333  C  CB    . TYR A 1 856  ? 19.258  80.690  -29.253 1.00 75.37  ? 884  TYR A CB    1 
ATOM   5334  C  CG    . TYR A 1 856  ? 20.305  81.604  -28.658 1.00 68.22  ? 884  TYR A CG    1 
ATOM   5335  C  CD1   . TYR A 1 856  ? 21.582  81.671  -29.199 1.00 69.49  ? 884  TYR A CD1   1 
ATOM   5336  C  CD2   . TYR A 1 856  ? 20.022  82.389  -27.548 1.00 72.48  ? 884  TYR A CD2   1 
ATOM   5337  C  CE1   . TYR A 1 856  ? 22.545  82.501  -28.658 1.00 70.36  ? 884  TYR A CE1   1 
ATOM   5338  C  CE2   . TYR A 1 856  ? 20.980  83.220  -27.000 1.00 70.51  ? 884  TYR A CE2   1 
ATOM   5339  C  CZ    . TYR A 1 856  ? 22.238  83.273  -27.559 1.00 77.48  ? 884  TYR A CZ    1 
ATOM   5340  O  OH    . TYR A 1 856  ? 23.193  84.101  -27.015 1.00 70.85  ? 884  TYR A OH    1 
ATOM   5341  N  N     . THR A 1 857  ? 18.695  79.177  -31.922 1.00 55.34  ? 885  THR A N     1 
ATOM   5342  C  CA    . THR A 1 857  ? 18.153  77.979  -32.548 1.00 47.13  ? 885  THR A CA    1 
ATOM   5343  C  C     . THR A 1 857  ? 19.249  76.926  -32.654 1.00 56.14  ? 885  THR A C     1 
ATOM   5344  O  O     . THR A 1 857  ? 20.425  77.255  -32.813 1.00 48.27  ? 885  THR A O     1 
ATOM   5345  C  CB    . THR A 1 857  ? 17.572  78.271  -33.945 1.00 44.96  ? 885  THR A CB    1 
ATOM   5346  O  OG1   . THR A 1 857  ? 17.121  77.050  -34.541 1.00 45.00  ? 885  THR A OG1   1 
ATOM   5347  C  CG2   . THR A 1 857  ? 18.622  78.902  -34.843 1.00 85.95  ? 885  THR A CG2   1 
ATOM   5348  N  N     . LEU A 1 858  ? 18.870  75.657  -32.553 1.00 69.12  ? 886  LEU A N     1 
ATOM   5349  C  CA    . LEU A 1 858  ? 19.861  74.594  -32.623 1.00 46.97  ? 886  LEU A CA    1 
ATOM   5350  C  C     . LEU A 1 858  ? 19.989  74.024  -34.034 1.00 65.75  ? 886  LEU A C     1 
ATOM   5351  O  O     . LEU A 1 858  ? 18.995  73.827  -34.750 1.00 49.99  ? 886  LEU A O     1 
ATOM   5352  C  CB    . LEU A 1 858  ? 19.543  73.483  -31.612 1.00 46.19  ? 886  LEU A CB    1 
ATOM   5353  C  CG    . LEU A 1 858  ? 18.147  72.868  -31.501 1.00 47.17  ? 886  LEU A CG    1 
ATOM   5354  C  CD1   . LEU A 1 858  ? 17.952  71.742  -32.506 1.00 68.15  ? 886  LEU A CD1   1 
ATOM   5355  C  CD2   . LEU A 1 858  ? 17.909  72.375  -30.080 1.00 77.28  ? 886  LEU A CD2   1 
ATOM   5356  N  N     . VAL A 1 859  ? 21.242  73.795  -34.419 1.00 69.19  ? 887  VAL A N     1 
ATOM   5357  C  CA    . VAL A 1 859  ? 21.598  73.223  -35.709 1.00 68.81  ? 887  VAL A CA    1 
ATOM   5358  C  C     . VAL A 1 859  ? 22.441  71.973  -35.495 1.00 67.83  ? 887  VAL A C     1 
ATOM   5359  O  O     . VAL A 1 859  ? 23.521  72.038  -34.911 1.00 68.92  ? 887  VAL A O     1 
ATOM   5360  C  CB    . VAL A 1 859  ? 22.386  74.222  -36.579 1.00 68.58  ? 887  VAL A CB    1 
ATOM   5361  C  CG1   . VAL A 1 859  ? 22.770  73.585  -37.907 1.00 49.40  ? 887  VAL A CG1   1 
ATOM   5362  C  CG2   . VAL A 1 859  ? 21.581  75.492  -36.797 1.00 74.18  ? 887  VAL A CG2   1 
ATOM   5363  N  N     . GLY A 1 860  ? 21.944  70.836  -35.966 1.00 71.68  ? 888  GLY A N     1 
ATOM   5364  C  CA    . GLY A 1 860  ? 22.638  69.577  -35.785 1.00 69.83  ? 888  GLY A CA    1 
ATOM   5365  C  C     . GLY A 1 860  ? 22.594  68.681  -37.004 1.00 73.71  ? 888  GLY A C     1 
ATOM   5366  O  O     . GLY A 1 860  ? 22.007  69.035  -38.026 1.00 76.07  ? 888  GLY A O     1 
ATOM   5367  N  N     . ALA A 1 861  ? 23.221  67.514  -36.893 1.00 67.09  ? 889  ALA A N     1 
ATOM   5368  C  CA    . ALA A 1 861  ? 23.268  66.567  -37.999 1.00 47.05  ? 889  ALA A CA    1 
ATOM   5369  C  C     . ALA A 1 861  ? 23.573  65.154  -37.513 1.00 67.36  ? 889  ALA A C     1 
ATOM   5370  O  O     . ALA A 1 861  ? 24.194  64.963  -36.464 1.00 45.34  ? 889  ALA A O     1 
ATOM   5371  C  CB    . ALA A 1 861  ? 24.301  67.005  -39.027 1.00 56.49  ? 889  ALA A CB    1 
ATOM   5372  N  N     . ASP A 1 862  ? 23.129  64.171  -38.289 1.00 69.04  ? 890  ASP A N     1 
ATOM   5373  C  CA    . ASP A 1 862  ? 23.374  62.767  -37.986 1.00 68.18  ? 890  ASP A CA    1 
ATOM   5374  C  C     . ASP A 1 862  ? 24.149  62.110  -39.124 1.00 64.60  ? 890  ASP A C     1 
ATOM   5375  O  O     . ASP A 1 862  ? 23.701  62.112  -40.272 1.00 73.45  ? 890  ASP A O     1 
ATOM   5376  C  CB    . ASP A 1 862  ? 22.053  62.032  -37.744 1.00 68.11  ? 890  ASP A CB    1 
ATOM   5377  C  CG    . ASP A 1 862  ? 22.254  60.582  -37.347 1.00 75.17  ? 890  ASP A CG    1 
ATOM   5378  O  OD1   . ASP A 1 862  ? 22.355  59.724  -38.249 1.00 77.44  ? 890  ASP A OD1   1 
ATOM   5379  O  OD2   . ASP A 1 862  ? 22.311  60.300  -36.132 1.00 69.69  ? 890  ASP A OD2   1 
ATOM   5380  N  N     . VAL A 1 863  ? 25.314  61.557  -38.802 1.00 55.99  ? 891  VAL A N     1 
ATOM   5381  C  CA    . VAL A 1 863  ? 26.170  60.922  -39.800 1.00 60.16  ? 891  VAL A CA    1 
ATOM   5382  C  C     . VAL A 1 863  ? 25.473  59.726  -40.444 1.00 66.70  ? 891  VAL A C     1 
ATOM   5383  O  O     . VAL A 1 863  ? 25.040  58.801  -39.757 1.00 49.74  ? 891  VAL A O     1 
ATOM   5384  C  CB    . VAL A 1 863  ? 27.503  60.459  -39.181 1.00 68.96  ? 891  VAL A CB    1 
ATOM   5385  C  CG1   . VAL A 1 863  ? 28.397  59.841  -40.244 1.00 67.09  ? 891  VAL A CG1   1 
ATOM   5386  C  CG2   . VAL A 1 863  ? 28.204  61.624  -38.498 1.00 56.08  ? 891  VAL A CG2   1 
ATOM   5387  N  N     . ASP A 1 864  ? 25.364  59.751  -41.767 1.00 74.58  ? 892  ASP A N     1 
ATOM   5388  C  CA    . ASP A 1 864  ? 24.673  58.691  -42.492 1.00 77.02  ? 892  ASP A CA    1 
ATOM   5389  C  C     . ASP A 1 864  ? 25.479  58.183  -43.685 1.00 76.19  ? 892  ASP A C     1 
ATOM   5390  O  O     . ASP A 1 864  ? 25.424  58.761  -44.770 1.00 81.76  ? 892  ASP A O     1 
ATOM   5391  C  CB    . ASP A 1 864  ? 23.298  59.180  -42.958 1.00 72.43  ? 892  ASP A CB    1 
ATOM   5392  C  CG    . ASP A 1 864  ? 23.305  60.640  -43.374 1.00 76.77  ? 892  ASP A CG    1 
ATOM   5393  O  OD1   . ASP A 1 864  ? 22.232  61.277  -43.318 1.00 73.11  ? 892  ASP A OD1   1 
ATOM   5394  O  OD2   . ASP A 1 864  ? 24.379  61.153  -43.752 1.00 73.28  ? 892  ASP A OD2   1 
ATOM   5395  N  N     . SER A 1 865  ? 26.225  57.099  -43.486 1.00 77.40  ? 893  SER A N     1 
ATOM   5396  C  CA    . SER A 1 865  ? 26.316  56.424  -42.194 1.00 67.59  ? 893  SER A CA    1 
ATOM   5397  C  C     . SER A 1 865  ? 27.777  56.295  -41.783 1.00 73.58  ? 893  SER A C     1 
ATOM   5398  O  O     . SER A 1 865  ? 28.668  56.382  -42.628 1.00 73.35  ? 893  SER A O     1 
ATOM   5399  C  CB    . SER A 1 865  ? 25.654  55.048  -42.256 1.00 56.75  ? 893  SER A CB    1 
ATOM   5400  O  OG    . SER A 1 865  ? 26.270  54.232  -43.236 1.00 69.90  ? 893  SER A OG    1 
ATOM   5401  N  N     . GLN A 1 866  ? 28.031  56.081  -40.495 1.00 64.36  ? 894  GLN A N     1 
ATOM   5402  C  CA    . GLN A 1 866  ? 29.411  56.060  -40.019 1.00 65.64  ? 894  GLN A CA    1 
ATOM   5403  C  C     . GLN A 1 866  ? 30.036  54.663  -40.027 1.00 66.95  ? 894  GLN A C     1 
ATOM   5404  O  O     . GLN A 1 866  ? 30.910  54.393  -40.845 1.00 75.29  ? 894  GLN A O     1 
ATOM   5405  C  CB    . GLN A 1 866  ? 29.514  56.680  -38.618 1.00 43.05  ? 894  GLN A CB    1 
ATOM   5406  C  CG    . GLN A 1 866  ? 28.499  56.203  -37.593 1.00 56.77  ? 894  GLN A CG    1 
ATOM   5407  C  CD    . GLN A 1 866  ? 28.820  56.705  -36.199 1.00 64.45  ? 894  GLN A CD    1 
ATOM   5408  O  OE1   . GLN A 1 866  ? 28.497  56.059  -35.202 1.00 67.20  ? 894  GLN A OE1   1 
ATOM   5409  N  NE2   . GLN A 1 866  ? 29.464  57.864  -36.123 1.00 68.21  ? 894  GLN A NE2   1 
ATOM   5410  N  N     . GLU A 1 867  ? 29.589  53.780  -39.137 1.00 48.99  ? 895  GLU A N     1 
ATOM   5411  C  CA    . GLU A 1 867  ? 30.270  52.504  -38.912 1.00 64.22  ? 895  GLU A CA    1 
ATOM   5412  C  C     . GLU A 1 867  ? 30.301  51.604  -40.148 1.00 56.41  ? 895  GLU A C     1 
ATOM   5413  O  O     . GLU A 1 867  ? 31.256  50.849  -40.354 1.00 60.43  ? 895  GLU A O     1 
ATOM   5414  C  CB    . GLU A 1 867  ? 29.622  51.760  -37.739 1.00 77.12  ? 895  GLU A CB    1 
ATOM   5415  C  CG    . GLU A 1 867  ? 29.943  52.368  -36.376 1.00 87.64  ? 895  GLU A CG    1 
ATOM   5416  C  CD    . GLU A 1 867  ? 29.803  51.372  -35.236 1.00 49.88  ? 895  GLU A CD    1 
ATOM   5417  O  OE1   . GLU A 1 867  ? 29.673  50.162  -35.513 1.00 41.60  ? 895  GLU A OE1   1 
ATOM   5418  O  OE2   . GLU A 1 867  ? 29.824  51.799  -34.061 1.00 71.84  ? 895  GLU A OE2   1 
ATOM   5419  N  N     . LEU A 1 868  ? 29.262  51.695  -40.972 1.00 64.95  ? 896  LEU A N     1 
ATOM   5420  C  CA    . LEU A 1 868  ? 29.193  50.918  -42.204 1.00 65.97  ? 896  LEU A CA    1 
ATOM   5421  C  C     . LEU A 1 868  ? 30.314  51.325  -43.158 1.00 55.26  ? 896  LEU A C     1 
ATOM   5422  O  O     . LEU A 1 868  ? 31.088  50.486  -43.628 1.00 55.26  ? 896  LEU A O     1 
ATOM   5423  C  CB    . LEU A 1 868  ? 27.831  51.104  -42.874 1.00 73.11  ? 896  LEU A CB    1 
ATOM   5424  C  CG    . LEU A 1 868  ? 27.427  50.083  -43.937 1.00 71.98  ? 896  LEU A CG    1 
ATOM   5425  C  CD1   . LEU A 1 868  ? 27.203  48.720  -43.304 1.00 69.87  ? 896  LEU A CD1   1 
ATOM   5426  C  CD2   . LEU A 1 868  ? 26.183  50.546  -44.674 1.00 77.15  ? 896  LEU A CD2   1 
ATOM   5427  N  N     . TRP A 1 869  ? 30.396  52.623  -43.429 1.00 48.06  ? 897  TRP A N     1 
ATOM   5428  C  CA    . TRP A 1 869  ? 31.428  53.174  -44.300 1.00 55.24  ? 897  TRP A CA    1 
ATOM   5429  C  C     . TRP A 1 869  ? 32.809  52.986  -43.686 1.00 55.47  ? 897  TRP A C     1 
ATOM   5430  O  O     . TRP A 1 869  ? 33.813  52.921  -44.391 1.00 56.88  ? 897  TRP A O     1 
ATOM   5431  C  CB    . TRP A 1 869  ? 31.160  54.655  -44.567 1.00 69.77  ? 897  TRP A CB    1 
ATOM   5432  C  CG    . TRP A 1 869  ? 32.204  55.326  -45.401 1.00 68.47  ? 897  TRP A CG    1 
ATOM   5433  C  CD1   . TRP A 1 869  ? 32.309  55.299  -46.760 1.00 66.28  ? 897  TRP A CD1   1 
ATOM   5434  C  CD2   . TRP A 1 869  ? 33.287  56.136  -44.930 1.00 68.66  ? 897  TRP A CD2   1 
ATOM   5435  N  NE1   . TRP A 1 869  ? 33.392  56.040  -47.166 1.00 67.69  ? 897  TRP A NE1   1 
ATOM   5436  C  CE2   . TRP A 1 869  ? 34.009  56.566  -46.061 1.00 70.56  ? 897  TRP A CE2   1 
ATOM   5437  C  CE3   . TRP A 1 869  ? 33.718  56.540  -43.662 1.00 70.46  ? 897  TRP A CE3   1 
ATOM   5438  C  CZ2   . TRP A 1 869  ? 35.139  57.377  -45.963 1.00 65.25  ? 897  TRP A CZ2   1 
ATOM   5439  C  CZ3   . TRP A 1 869  ? 34.839  57.344  -43.566 1.00 67.30  ? 897  TRP A CZ3   1 
ATOM   5440  C  CH2   . TRP A 1 869  ? 35.537  57.753  -44.710 1.00 55.73  ? 897  TRP A CH2   1 
ATOM   5441  N  N     . ILE A 1 870  ? 32.842  52.901  -42.361 1.00 49.25  ? 898  ILE A N     1 
ATOM   5442  C  CA    . ILE A 1 870  ? 34.070  52.645  -41.625 1.00 46.71  ? 898  ILE A CA    1 
ATOM   5443  C  C     . ILE A 1 870  ? 34.598  51.251  -41.943 1.00 56.87  ? 898  ILE A C     1 
ATOM   5444  O  O     . ILE A 1 870  ? 35.752  51.096  -42.348 1.00 69.21  ? 898  ILE A O     1 
ATOM   5445  C  CB    . ILE A 1 870  ? 33.845  52.795  -40.107 1.00 93.11  ? 898  ILE A CB    1 
ATOM   5446  C  CG1   . ILE A 1 870  ? 33.866  54.274  -39.717 1.00 69.93  ? 898  ILE A CG1   1 
ATOM   5447  C  CG2   . ILE A 1 870  ? 34.893  52.021  -39.325 1.00 68.54  ? 898  ILE A CG2   1 
ATOM   5448  C  CD1   . ILE A 1 870  ? 33.395  54.541  -38.308 1.00 77.67  ? 898  ILE A CD1   1 
ATOM   5449  N  N     . ALA A 1 871  ? 33.748  50.242  -41.769 1.00 49.55  ? 899  ALA A N     1 
ATOM   5450  C  CA    . ALA A 1 871  ? 34.118  48.871  -42.103 1.00 64.87  ? 899  ALA A CA    1 
ATOM   5451  C  C     . ALA A 1 871  ? 34.483  48.766  -43.581 1.00 60.86  ? 899  ALA A C     1 
ATOM   5452  O  O     . ALA A 1 871  ? 35.436  48.072  -43.954 1.00 69.75  ? 899  ALA A O     1 
ATOM   5453  C  CB    . ALA A 1 871  ? 32.988  47.915  -41.762 1.00 56.61  ? 899  ALA A CB    1 
ATOM   5454  N  N     . ALA A 1 872  ? 33.720  49.472  -44.412 1.00 66.27  ? 900  ALA A N     1 
ATOM   5455  C  CA    . ALA A 1 872  ? 33.970  49.518  -45.848 1.00 70.33  ? 900  ALA A CA    1 
ATOM   5456  C  C     . ALA A 1 872  ? 35.388  49.995  -46.153 1.00 70.32  ? 900  ALA A C     1 
ATOM   5457  O  O     . ALA A 1 872  ? 36.134  49.329  -46.872 1.00 76.48  ? 900  ALA A O     1 
ATOM   5458  C  CB    . ALA A 1 872  ? 32.953  50.420  -46.529 1.00 69.14  ? 900  ALA A CB    1 
ATOM   5459  N  N     . VAL A 1 873  ? 35.749  51.147  -45.594 1.00 56.56  ? 901  VAL A N     1 
ATOM   5460  C  CA    . VAL A 1 873  ? 37.069  51.734  -45.803 1.00 49.92  ? 901  VAL A CA    1 
ATOM   5461  C  C     . VAL A 1 873  ? 38.168  50.829  -45.262 1.00 55.25  ? 901  VAL A C     1 
ATOM   5462  O  O     . VAL A 1 873  ? 39.188  50.621  -45.919 1.00 73.55  ? 901  VAL A O     1 
ATOM   5463  C  CB    . VAL A 1 873  ? 37.177  53.123  -45.147 1.00 43.32  ? 901  VAL A CB    1 
ATOM   5464  C  CG1   . VAL A 1 873  ? 38.625  53.579  -45.085 1.00 65.31  ? 901  VAL A CG1   1 
ATOM   5465  C  CG2   . VAL A 1 873  ? 36.344  54.124  -45.914 1.00 49.19  ? 901  VAL A CG2   1 
ATOM   5466  N  N     . LEU A 1 874  ? 37.949  50.278  -44.071 1.00 49.07  ? 902  LEU A N     1 
ATOM   5467  C  CA    . LEU A 1 874  ? 38.892  49.328  -43.489 1.00 46.22  ? 902  LEU A CA    1 
ATOM   5468  C  C     . LEU A 1 874  ? 39.070  48.112  -44.395 1.00 69.69  ? 902  LEU A C     1 
ATOM   5469  O  O     . LEU A 1 874  ? 40.094  47.433  -44.339 1.00 70.95  ? 902  LEU A O     1 
ATOM   5470  C  CB    . LEU A 1 874  ? 38.431  48.888  -42.099 1.00 85.27  ? 902  LEU A CB    1 
ATOM   5471  C  CG    . LEU A 1 874  ? 38.488  49.951  -41.000 1.00 91.79  ? 902  LEU A CG    1 
ATOM   5472  C  CD1   . LEU A 1 874  ? 38.099  49.351  -39.658 1.00 90.64  ? 902  LEU A CD1   1 
ATOM   5473  C  CD2   . LEU A 1 874  ? 39.870  50.582  -40.932 1.00 90.74  ? 902  LEU A CD2   1 
ATOM   5474  N  N     . GLY A 1 875  ? 38.070  47.845  -45.230 1.00 71.41  ? 903  GLY A N     1 
ATOM   5475  C  CA    . GLY A 1 875  ? 38.167  46.779  -46.209 1.00 55.00  ? 903  GLY A CA    1 
ATOM   5476  C  C     . GLY A 1 875  ? 38.946  47.160  -47.456 1.00 55.33  ? 903  GLY A C     1 
ATOM   5477  O  O     . GLY A 1 875  ? 39.947  46.522  -47.791 1.00 67.46  ? 903  GLY A O     1 
ATOM   5478  N  N     . ASP A 1 876  ? 38.491  48.205  -48.143 1.00 69.20  ? 904  ASP A N     1 
ATOM   5479  C  CA    . ASP A 1 876  ? 39.087  48.597  -49.419 1.00 93.87  ? 904  ASP A CA    1 
ATOM   5480  C  C     . ASP A 1 876  ? 40.524  49.090  -49.271 1.00 92.24  ? 904  ASP A C     1 
ATOM   5481  O  O     . ASP A 1 876  ? 41.372  48.799  -50.115 1.00 90.98  ? 904  ASP A O     1 
ATOM   5482  C  CB    . ASP A 1 876  ? 38.236  49.672  -50.105 1.00 71.89  ? 904  ASP A CB    1 
ATOM   5483  C  CG    . ASP A 1 876  ? 37.938  50.854  -49.203 1.00 76.46  ? 904  ASP A CG    1 
ATOM   5484  O  OD1   . ASP A 1 876  ? 36.748  51.086  -48.906 1.00 70.49  ? 904  ASP A OD1   1 
ATOM   5485  O  OD2   . ASP A 1 876  ? 38.888  51.556  -48.797 1.00 84.62  ? 904  ASP A OD2   1 
ATOM   5486  N  N     . ALA A 1 877  ? 40.797  49.832  -48.203 1.00 70.02  ? 905  ALA A N     1 
ATOM   5487  C  CA    . ALA A 1 877  ? 42.145  50.333  -47.953 1.00 72.42  ? 905  ALA A CA    1 
ATOM   5488  C  C     . ALA A 1 877  ? 43.102  49.183  -47.665 1.00 77.31  ? 905  ALA A C     1 
ATOM   5489  O  O     . ALA A 1 877  ? 44.302  49.280  -47.921 1.00 74.61  ? 905  ALA A O     1 
ATOM   5490  C  CB    . ALA A 1 877  ? 42.142  51.320  -46.802 1.00 76.69  ? 905  ALA A CB    1 
ATOM   5491  N  N     . HIS A 1 878  ? 42.560  48.096  -47.128 1.00 72.44  ? 906  HIS A N     1 
ATOM   5492  C  CA    . HIS A 1 878  ? 43.345  46.900  -46.861 1.00 69.34  ? 906  HIS A CA    1 
ATOM   5493  C  C     . HIS A 1 878  ? 43.610  46.135  -48.150 1.00 70.83  ? 906  HIS A C     1 
ATOM   5494  O  O     . HIS A 1 878  ? 44.732  45.699  -48.404 1.00 69.60  ? 906  HIS A O     1 
ATOM   5495  C  CB    . HIS A 1 878  ? 42.628  46.003  -45.854 1.00 70.41  ? 906  HIS A CB    1 
ATOM   5496  C  CG    . HIS A 1 878  ? 43.332  44.710  -45.585 1.00 76.90  ? 906  HIS A CG    1 
ATOM   5497  N  ND1   . HIS A 1 878  ? 43.025  43.543  -46.253 1.00 68.31  ? 906  HIS A ND1   1 
ATOM   5498  C  CD2   . HIS A 1 878  ? 44.325  44.398  -44.720 1.00 74.02  ? 906  HIS A CD2   1 
ATOM   5499  C  CE1   . HIS A 1 878  ? 43.800  42.569  -45.811 1.00 68.74  ? 906  HIS A CE1   1 
ATOM   5500  N  NE2   . HIS A 1 878  ? 44.598  43.061  -44.881 1.00 72.43  ? 906  HIS A NE2   1 
ATOM   5501  N  N     . PHE A 1 879  ? 42.568  45.977  -48.960 1.00 70.86  ? 907  PHE A N     1 
ATOM   5502  C  CA    . PHE A 1 879  ? 42.687  45.249  -50.218 1.00 76.05  ? 907  PHE A CA    1 
ATOM   5503  C  C     . PHE A 1 879  ? 43.566  46.001  -51.215 1.00 71.10  ? 907  PHE A C     1 
ATOM   5504  O  O     . PHE A 1 879  ? 44.503  45.435  -51.777 1.00 74.78  ? 907  PHE A O     1 
ATOM   5505  C  CB    . PHE A 1 879  ? 41.305  44.990  -50.821 1.00 74.78  ? 907  PHE A CB    1 
ATOM   5506  C  CG    . PHE A 1 879  ? 41.322  44.053  -51.993 1.00 75.70  ? 907  PHE A CG    1 
ATOM   5507  C  CD1   . PHE A 1 879  ? 41.255  42.683  -51.801 1.00 77.13  ? 907  PHE A CD1   1 
ATOM   5508  C  CD2   . PHE A 1 879  ? 41.407  44.539  -53.287 1.00 85.52  ? 907  PHE A CD2   1 
ATOM   5509  C  CE1   . PHE A 1 879  ? 41.272  41.816  -52.877 1.00 93.80  ? 907  PHE A CE1   1 
ATOM   5510  C  CE2   . PHE A 1 879  ? 41.426  43.677  -54.366 1.00 92.48  ? 907  PHE A CE2   1 
ATOM   5511  C  CZ    . PHE A 1 879  ? 41.358  42.314  -54.161 1.00 92.23  ? 907  PHE A CZ    1 
ATOM   5512  N  N     . ALA A 1 880  ? 43.259  47.277  -51.431 1.00 74.94  ? 908  ALA A N     1 
ATOM   5513  C  CA    . ALA A 1 880  ? 44.030  48.104  -52.354 1.00 67.03  ? 908  ALA A CA    1 
ATOM   5514  C  C     . ALA A 1 880  ? 44.037  49.568  -51.923 1.00 48.91  ? 908  ALA A C     1 
ATOM   5515  O  O     . ALA A 1 880  ? 43.895  49.878  -50.740 1.00 49.43  ? 908  ALA A O     1 
ATOM   5516  C  CB    . ALA A 1 880  ? 43.485  47.970  -53.768 1.00 68.01  ? 908  ALA A CB    1 
ATOM   5517  N  N     . GLY A 1 881  ? 44.201  50.467  -52.888 1.00 46.47  ? 909  GLY A N     1 
ATOM   5518  C  CA    . GLY A 1 881  ? 44.309  51.884  -52.595 1.00 66.93  ? 909  GLY A CA    1 
ATOM   5519  C  C     . GLY A 1 881  ? 42.996  52.638  -52.682 1.00 76.92  ? 909  GLY A C     1 
ATOM   5520  O  O     . GLY A 1 881  ? 42.708  53.495  -51.846 1.00 75.11  ? 909  GLY A O     1 
ATOM   5521  N  N     . MET A 1 882  ? 42.197  52.318  -53.695 1.00 71.51  ? 910  MET A N     1 
ATOM   5522  C  CA    . MET A 1 882  ? 40.939  53.020  -53.928 1.00 69.12  ? 910  MET A CA    1 
ATOM   5523  C  C     . MET A 1 882  ? 39.883  52.614  -52.901 1.00 74.90  ? 910  MET A C     1 
ATOM   5524  O  O     . MET A 1 882  ? 40.105  51.713  -52.093 1.00 72.27  ? 910  MET A O     1 
ATOM   5525  C  CB    . MET A 1 882  ? 40.437  52.753  -55.350 1.00 91.04  ? 910  MET A CB    1 
ATOM   5526  C  CG    . MET A 1 882  ? 39.568  53.864  -55.921 1.00 91.24  ? 910  MET A CG    1 
ATOM   5527  S  SD    . MET A 1 882  ? 40.360  55.477  -55.779 1.00 84.31  ? 910  MET A SD    1 
ATOM   5528  C  CE    . MET A 1 882  ? 39.008  56.562  -56.221 1.00 90.59  ? 910  MET A CE    1 
ATOM   5529  N  N     . HIS A 1 883  ? 38.736  53.287  -52.935 1.00 77.08  ? 911  HIS A N     1 
ATOM   5530  C  CA    . HIS A 1 883  ? 37.678  53.065  -51.956 1.00 76.95  ? 911  HIS A CA    1 
ATOM   5531  C  C     . HIS A 1 883  ? 36.636  52.055  -52.435 1.00 74.24  ? 911  HIS A C     1 
ATOM   5532  O  O     . HIS A 1 883  ? 35.965  51.415  -51.626 1.00 55.75  ? 911  HIS A O     1 
ATOM   5533  C  CB    . HIS A 1 883  ? 36.992  54.389  -51.613 1.00 72.04  ? 911  HIS A CB    1 
ATOM   5534  C  CG    . HIS A 1 883  ? 37.930  55.445  -51.117 1.00 77.79  ? 911  HIS A CG    1 
ATOM   5535  N  ND1   . HIS A 1 883  ? 38.090  55.729  -49.778 1.00 69.63  ? 911  HIS A ND1   1 
ATOM   5536  C  CD2   . HIS A 1 883  ? 38.759  56.286  -51.781 1.00 69.71  ? 911  HIS A CD2   1 
ATOM   5537  C  CE1   . HIS A 1 883  ? 38.976  56.699  -49.639 1.00 75.89  ? 911  HIS A CE1   1 
ATOM   5538  N  NE2   . HIS A 1 883  ? 39.397  57.055  -50.839 1.00 74.03  ? 911  HIS A NE2   1 
ATOM   5539  N  N     . GLY A 1 884  ? 36.501  51.918  -53.749 1.00 70.48  ? 912  GLY A N     1 
ATOM   5540  C  CA    . GLY A 1 884  ? 35.495  51.038  -54.316 1.00 73.71  ? 912  GLY A CA    1 
ATOM   5541  C  C     . GLY A 1 884  ? 36.045  49.711  -54.797 1.00 71.77  ? 912  GLY A C     1 
ATOM   5542  O  O     . GLY A 1 884  ? 35.476  49.083  -55.690 1.00 76.47  ? 912  GLY A O     1 
ATOM   5543  N  N     . CYS A 1 885  ? 37.151  49.277  -54.202 1.00 72.73  ? 913  CYS A N     1 
ATOM   5544  C  CA    . CYS A 1 885  ? 37.792  48.030  -54.604 1.00 70.66  ? 913  CYS A CA    1 
ATOM   5545  C  C     . CYS A 1 885  ? 37.386  46.870  -53.700 1.00 75.33  ? 913  CYS A C     1 
ATOM   5546  O  O     . CYS A 1 885  ? 38.182  45.971  -53.433 1.00 75.51  ? 913  CYS A O     1 
ATOM   5547  C  CB    . CYS A 1 885  ? 39.313  48.189  -54.601 1.00 68.16  ? 913  CYS A CB    1 
ATOM   5548  S  SG    . CYS A 1 885  ? 40.012  48.657  -53.006 1.00 85.53  ? 913  CYS A SG    1 
ATOM   5549  N  N     . THR A 1 886  ? 36.143  46.898  -53.232 1.00 68.97  ? 914  THR A N     1 
ATOM   5550  C  CA    . THR A 1 886  ? 35.611  45.824  -52.400 1.00 72.19  ? 914  THR A CA    1 
ATOM   5551  C  C     . THR A 1 886  ? 34.156  45.534  -52.744 1.00 85.32  ? 914  THR A C     1 
ATOM   5552  O  O     . THR A 1 886  ? 33.420  46.425  -53.166 1.00 75.87  ? 914  THR A O     1 
ATOM   5553  C  CB    . THR A 1 886  ? 35.719  46.157  -50.900 1.00 69.02  ? 914  THR A CB    1 
ATOM   5554  O  OG1   . THR A 1 886  ? 35.569  47.570  -50.711 1.00 74.35  ? 914  THR A OG1   1 
ATOM   5555  C  CG2   . THR A 1 886  ? 37.068  45.721  -50.355 1.00 75.11  ? 914  THR A CG2   1 
ATOM   5556  N  N     . ALA A 1 887  ? 33.749  44.282  -52.563 1.00 85.81  ? 915  ALA A N     1 
ATOM   5557  C  CA    . ALA A 1 887  ? 32.382  43.868  -52.855 1.00 84.45  ? 915  ALA A CA    1 
ATOM   5558  C  C     . ALA A 1 887  ? 31.395  44.522  -51.897 1.00 69.65  ? 915  ALA A C     1 
ATOM   5559  O  O     . ALA A 1 887  ? 30.287  44.890  -52.285 1.00 93.14  ? 915  ALA A O     1 
ATOM   5560  C  CB    . ALA A 1 887  ? 32.261  42.356  -52.788 1.00 90.89  ? 915  ALA A CB    1 
ATOM   5561  N  N     . PHE A 1 888  ? 31.805  44.662  -50.643 1.00 77.66  ? 916  PHE A N     1 
ATOM   5562  C  CA    . PHE A 1 888  ? 30.956  45.272  -49.631 1.00 71.71  ? 916  PHE A CA    1 
ATOM   5563  C  C     . PHE A 1 888  ? 31.115  46.790  -49.610 1.00 72.88  ? 916  PHE A C     1 
ATOM   5564  O  O     . PHE A 1 888  ? 30.137  47.521  -49.461 1.00 70.42  ? 916  PHE A O     1 
ATOM   5565  C  CB    . PHE A 1 888  ? 31.267  44.686  -48.251 1.00 60.39  ? 916  PHE A CB    1 
ATOM   5566  C  CG    . PHE A 1 888  ? 30.788  45.536  -47.112 1.00 64.79  ? 916  PHE A CG    1 
ATOM   5567  C  CD1   . PHE A 1 888  ? 29.454  45.533  -46.741 1.00 55.74  ? 916  PHE A CD1   1 
ATOM   5568  C  CD2   . PHE A 1 888  ? 31.673  46.340  -46.413 1.00 66.78  ? 916  PHE A CD2   1 
ATOM   5569  C  CE1   . PHE A 1 888  ? 29.011  46.317  -45.694 1.00 67.16  ? 916  PHE A CE1   1 
ATOM   5570  C  CE2   . PHE A 1 888  ? 31.237  47.126  -45.367 1.00 68.32  ? 916  PHE A CE2   1 
ATOM   5571  C  CZ    . PHE A 1 888  ? 29.905  47.115  -45.006 1.00 66.47  ? 916  PHE A CZ    1 
ATOM   5572  N  N     . GLY A 1 889  ? 32.349  47.257  -49.769 1.00 70.62  ? 917  GLY A N     1 
ATOM   5573  C  CA    . GLY A 1 889  ? 32.644  48.676  -49.688 1.00 69.19  ? 917  GLY A CA    1 
ATOM   5574  C  C     . GLY A 1 889  ? 32.149  49.511  -50.855 1.00 66.18  ? 917  GLY A C     1 
ATOM   5575  O  O     . GLY A 1 889  ? 32.126  50.739  -50.774 1.00 68.21  ? 917  GLY A O     1 
ATOM   5576  N  N     . TRP A 1 890  ? 31.752  48.854  -51.940 1.00 72.98  ? 918  TRP A N     1 
ATOM   5577  C  CA    . TRP A 1 890  ? 31.298  49.565  -53.132 1.00 75.43  ? 918  TRP A CA    1 
ATOM   5578  C  C     . TRP A 1 890  ? 29.823  49.939  -53.033 1.00 68.75  ? 918  TRP A C     1 
ATOM   5579  O  O     . TRP A 1 890  ? 29.391  50.951  -53.584 1.00 71.93  ? 918  TRP A O     1 
ATOM   5580  C  CB    . TRP A 1 890  ? 31.538  48.721  -54.386 1.00 74.14  ? 918  TRP A CB    1 
ATOM   5581  C  CG    . TRP A 1 890  ? 31.333  49.473  -55.671 1.00 81.21  ? 918  TRP A CG    1 
ATOM   5582  C  CD1   . TRP A 1 890  ? 32.267  50.199  -56.353 1.00 90.05  ? 918  TRP A CD1   1 
ATOM   5583  C  CD2   . TRP A 1 890  ? 30.120  49.568  -56.430 1.00 81.82  ? 918  TRP A CD2   1 
ATOM   5584  N  NE1   . TRP A 1 890  ? 31.711  50.742  -57.486 1.00 90.71  ? 918  TRP A NE1   1 
ATOM   5585  C  CE2   . TRP A 1 890  ? 30.394  50.369  -57.557 1.00 90.78  ? 918  TRP A CE2   1 
ATOM   5586  C  CE3   . TRP A 1 890  ? 28.830  49.055  -56.265 1.00 93.53  ? 918  TRP A CE3   1 
ATOM   5587  C  CZ2   . TRP A 1 890  ? 29.426  50.669  -58.513 1.00 90.19  ? 918  TRP A CZ2   1 
ATOM   5588  C  CZ3   . TRP A 1 890  ? 27.870  49.354  -57.216 1.00 87.07  ? 918  TRP A CZ3   1 
ATOM   5589  C  CH2   . TRP A 1 890  ? 28.174  50.153  -58.326 1.00 81.75  ? 918  TRP A CH2   1 
ATOM   5590  N  N     . MET A 1 891  ? 29.054  49.117  -52.327 1.00 77.10  ? 919  MET A N     1 
ATOM   5591  C  CA    . MET A 1 891  ? 27.618  49.334  -52.196 1.00 76.41  ? 919  MET A CA    1 
ATOM   5592  C  C     . MET A 1 891  ? 27.295  50.393  -51.146 1.00 77.98  ? 919  MET A C     1 
ATOM   5593  O  O     . MET A 1 891  ? 26.236  51.019  -51.191 1.00 74.98  ? 919  MET A O     1 
ATOM   5594  C  CB    . MET A 1 891  ? 26.911  48.023  -51.848 1.00 68.22  ? 919  MET A CB    1 
ATOM   5595  C  CG    . MET A 1 891  ? 27.149  46.902  -52.848 1.00 72.04  ? 919  MET A CG    1 
ATOM   5596  S  SD    . MET A 1 891  ? 26.249  45.395  -52.435 1.00 81.46  ? 919  MET A SD    1 
ATOM   5597  C  CE    . MET A 1 891  ? 24.555  45.963  -52.564 1.00 77.69  ? 919  MET A CE    1 
ATOM   5598  N  N     . THR A 1 892  ? 28.209  50.586  -50.200 1.00 68.09  ? 920  THR A N     1 
ATOM   5599  C  CA    . THR A 1 892  ? 28.002  51.547  -49.121 1.00 68.88  ? 920  THR A CA    1 
ATOM   5600  C  C     . THR A 1 892  ? 28.010  52.982  -49.636 1.00 72.21  ? 920  THR A C     1 
ATOM   5601  O  O     . THR A 1 892  ? 27.136  53.779  -49.297 1.00 72.32  ? 920  THR A O     1 
ATOM   5602  C  CB    . THR A 1 892  ? 29.077  51.407  -48.023 1.00 70.92  ? 920  THR A CB    1 
ATOM   5603  O  OG1   . THR A 1 892  ? 30.367  51.703  -48.572 1.00 68.42  ? 920  THR A OG1   1 
ATOM   5604  C  CG2   . THR A 1 892  ? 29.083  49.996  -47.455 1.00 72.29  ? 920  THR A CG2   1 
ATOM   5605  N  N     . LEU A 1 893  ? 29.003  53.301  -50.460 1.00 72.90  ? 921  LEU A N     1 
ATOM   5606  C  CA    . LEU A 1 893  ? 29.169  54.653  -50.982 1.00 71.03  ? 921  LEU A CA    1 
ATOM   5607  C  C     . LEU A 1 893  ? 28.529  54.807  -52.358 1.00 68.75  ? 921  LEU A C     1 
ATOM   5608  O  O     . LEU A 1 893  ? 29.024  55.550  -53.206 1.00 71.10  ? 921  LEU A O     1 
ATOM   5609  C  CB    . LEU A 1 893  ? 30.657  55.012  -51.039 1.00 77.98  ? 921  LEU A CB    1 
ATOM   5610  C  CG    . LEU A 1 893  ? 31.606  53.905  -51.512 1.00 73.23  ? 921  LEU A CG    1 
ATOM   5611  C  CD1   . LEU A 1 893  ? 31.778  53.914  -53.027 1.00 76.65  ? 921  LEU A CD1   1 
ATOM   5612  C  CD2   . LEU A 1 893  ? 32.954  54.003  -50.809 1.00 69.03  ? 921  LEU A CD2   1 
ATOM   5613  N  N     . GLN A 1 894  ? 27.419  54.107  -52.568 1.00 68.64  ? 922  GLN A N     1 
ATOM   5614  C  CA    . GLN A 1 894  ? 26.748  54.104  -53.862 1.00 70.58  ? 922  GLN A CA    1 
ATOM   5615  C  C     . GLN A 1 894  ? 25.321  54.639  -53.762 1.00 75.49  ? 922  GLN A C     1 
ATOM   5616  O  O     . GLN A 1 894  ? 24.773  55.153  -54.737 1.00 66.01  ? 922  GLN A O     1 
ATOM   5617  C  CB    . GLN A 1 894  ? 26.738  52.688  -54.446 1.00 70.06  ? 922  GLN A CB    1 
ATOM   5618  C  CG    . GLN A 1 894  ? 26.419  52.618  -55.931 1.00 73.04  ? 922  GLN A CG    1 
ATOM   5619  C  CD    . GLN A 1 894  ? 27.545  53.147  -56.800 1.00 76.05  ? 922  GLN A CD    1 
ATOM   5620  O  OE1   . GLN A 1 894  ? 28.667  53.346  -56.332 1.00 71.60  ? 922  GLN A OE1   1 
ATOM   5621  N  NE2   . GLN A 1 894  ? 27.250  53.376  -58.074 1.00 76.03  ? 922  GLN A NE2   1 
ATOM   5622  N  N     . GLY A 1 895  ? 24.726  54.523  -52.579 1.00 72.76  ? 923  GLY A N     1 
ATOM   5623  C  CA    . GLY A 1 895  ? 23.343  54.919  -52.385 1.00 74.98  ? 923  GLY A CA    1 
ATOM   5624  C  C     . GLY A 1 895  ? 23.159  56.279  -51.738 1.00 81.85  ? 923  GLY A C     1 
ATOM   5625  O  O     . GLY A 1 895  ? 23.971  56.704  -50.916 1.00 91.07  ? 923  GLY A O     1 
ATOM   5626  N  N     . ARG A 1 896  ? 22.083  56.963  -52.117 1.00 91.61  ? 924  ARG A N     1 
ATOM   5627  C  CA    . ARG A 1 896  ? 21.730  58.246  -51.519 1.00 93.93  ? 924  ARG A CA    1 
ATOM   5628  C  C     . ARG A 1 896  ? 20.336  58.155  -50.906 1.00 72.71  ? 924  ARG A C     1 
ATOM   5629  O  O     . ARG A 1 896  ? 19.414  57.628  -51.527 1.00 73.58  ? 924  ARG A O     1 
ATOM   5630  C  CB    . ARG A 1 896  ? 21.789  59.367  -52.560 1.00 85.99  ? 924  ARG A CB    1 
ATOM   5631  C  CG    . ARG A 1 896  ? 21.895  60.770  -51.973 1.00 90.35  ? 924  ARG A CG    1 
ATOM   5632  C  CD    . ARG A 1 896  ? 23.241  60.990  -51.291 1.00 91.97  ? 924  ARG A CD    1 
ATOM   5633  N  NE    . ARG A 1 896  ? 23.426  62.376  -50.866 1.00 90.41  ? 924  ARG A NE    1 
ATOM   5634  C  CZ    . ARG A 1 896  ? 24.525  62.839  -50.277 1.00 74.13  ? 924  ARG A CZ    1 
ATOM   5635  N  NH1   . ARG A 1 896  ? 25.546  62.028  -50.038 1.00 76.81  ? 924  ARG A NH1   1 
ATOM   5636  N  NH2   . ARG A 1 896  ? 24.604  64.116  -49.926 1.00 77.56  ? 924  ARG A NH2   1 
ATOM   5637  N  N     . LYS A 1 897  ? 20.186  58.665  -49.687 1.00 74.12  ? 925  LYS A N     1 
ATOM   5638  C  CA    . LYS A 1 897  ? 18.929  58.537  -48.954 1.00 77.22  ? 925  LYS A CA    1 
ATOM   5639  C  C     . LYS A 1 897  ? 17.812  59.388  -49.555 1.00 81.23  ? 925  LYS A C     1 
ATOM   5640  O  O     . LYS A 1 897  ? 16.648  58.984  -49.555 1.00 81.65  ? 925  LYS A O     1 
ATOM   5641  C  CB    . LYS A 1 897  ? 19.135  58.901  -47.479 1.00 68.92  ? 925  LYS A CB    1 
ATOM   5642  C  CG    . LYS A 1 897  ? 19.764  60.264  -47.239 1.00 72.22  ? 925  LYS A CG    1 
ATOM   5643  C  CD    . LYS A 1 897  ? 20.062  60.482  -45.761 1.00 77.00  ? 925  LYS A CD    1 
ATOM   5644  C  CE    . LYS A 1 897  ? 18.803  60.365  -44.914 1.00 77.20  ? 925  LYS A CE    1 
ATOM   5645  N  NZ    . LYS A 1 897  ? 19.086  60.555  -43.464 1.00 56.86  ? 925  LYS A NZ    1 
ATOM   5646  N  N     . SER A 1 898  ? 18.167  60.562  -50.069 1.00 81.66  ? 926  SER A N     1 
ATOM   5647  C  CA    . SER A 1 898  ? 17.192  61.445  -50.701 1.00 90.63  ? 926  SER A CA    1 
ATOM   5648  C  C     . SER A 1 898  ? 16.705  60.852  -52.019 1.00 72.15  ? 926  SER A C     1 
ATOM   5649  O  O     . SER A 1 898  ? 17.511  60.544  -52.898 1.00 72.52  ? 926  SER A O     1 
ATOM   5650  C  CB    . SER A 1 898  ? 17.794  62.832  -50.931 1.00 93.63  ? 926  SER A CB    1 
ATOM   5651  O  OG    . SER A 1 898  ? 18.969  62.754  -51.719 1.00 70.58  ? 926  SER A OG    1 
ATOM   5652  N  N     . ARG A 1 899  ? 15.384  60.699  -52.135 1.00 74.86  ? 927  ARG A N     1 
ATOM   5653  C  CA    . ARG A 1 899  ? 14.703  60.066  -53.278 1.00 74.38  ? 927  ARG A CA    1 
ATOM   5654  C  C     . ARG A 1 899  ? 15.451  58.878  -53.890 1.00 73.15  ? 927  ARG A C     1 
ATOM   5655  O  O     . ARG A 1 899  ? 15.340  58.614  -55.087 1.00 73.27  ? 927  ARG A O     1 
ATOM   5656  C  CB    . ARG A 1 899  ? 14.409  61.100  -54.378 1.00 77.93  ? 927  ARG A CB    1 
ATOM   5657  C  CG    . ARG A 1 899  ? 15.627  61.748  -55.028 1.00 72.52  ? 927  ARG A CG    1 
ATOM   5658  C  CD    . ARG A 1 899  ? 15.420  61.973  -56.521 1.00 75.23  ? 927  ARG A CD    1 
ATOM   5659  N  NE    . ARG A 1 899  ? 15.653  60.760  -57.301 1.00 72.81  ? 927  ARG A NE    1 
ATOM   5660  C  CZ    . ARG A 1 899  ? 14.694  59.939  -57.719 1.00 69.18  ? 927  ARG A CZ    1 
ATOM   5661  N  NH1   . ARG A 1 899  ? 13.425  60.196  -57.435 1.00 77.74  ? 927  ARG A NH1   1 
ATOM   5662  N  NH2   . ARG A 1 899  ? 15.005  58.858  -58.422 1.00 68.21  ? 927  ARG A NH2   1 
ATOM   5663  N  N     . GLY A 1 900  ? 16.195  58.151  -53.064 1.00 86.64  ? 928  GLY A N     1 
ATOM   5664  C  CA    . GLY A 1 900  ? 16.986  57.038  -53.548 1.00 76.64  ? 928  GLY A CA    1 
ATOM   5665  C  C     . GLY A 1 900  ? 16.930  55.832  -52.635 1.00 77.68  ? 928  GLY A C     1 
ATOM   5666  O  O     . GLY A 1 900  ? 15.916  55.575  -51.986 1.00 74.65  ? 928  GLY A O     1 
ATOM   5667  N  N     . THR A 1 901  ? 18.033  55.093  -52.583 1.00 77.04  ? 929  THR A N     1 
ATOM   5668  C  CA    . THR A 1 901  ? 18.091  53.865  -51.805 1.00 71.52  ? 929  THR A CA    1 
ATOM   5669  C  C     . THR A 1 901  ? 19.501  53.590  -51.291 1.00 77.80  ? 929  THR A C     1 
ATOM   5670  O  O     . THR A 1 901  ? 20.427  53.372  -52.073 1.00 86.66  ? 929  THR A O     1 
ATOM   5671  C  CB    . THR A 1 901  ? 17.610  52.661  -52.635 1.00 85.30  ? 929  THR A CB    1 
ATOM   5672  O  OG1   . THR A 1 901  ? 16.231  52.839  -52.982 1.00 91.00  ? 929  THR A OG1   1 
ATOM   5673  C  CG2   . THR A 1 901  ? 17.762  51.377  -51.848 1.00 86.12  ? 929  THR A CG2   1 
ATOM   5674  N  N     . ASP A 1 902  ? 19.655  53.603  -49.971 1.00 74.71  ? 930  ASP A N     1 
ATOM   5675  C  CA    . ASP A 1 902  ? 20.937  53.311  -49.341 1.00 69.69  ? 930  ASP A CA    1 
ATOM   5676  C  C     . ASP A 1 902  ? 21.178  51.808  -49.309 1.00 77.47  ? 930  ASP A C     1 
ATOM   5677  O  O     . ASP A 1 902  ? 20.373  51.037  -49.826 1.00 86.75  ? 930  ASP A O     1 
ATOM   5678  C  CB    . ASP A 1 902  ? 20.983  53.881  -47.923 1.00 73.63  ? 930  ASP A CB    1 
ATOM   5679  C  CG    . ASP A 1 902  ? 20.506  55.316  -47.858 1.00 70.55  ? 930  ASP A CG    1 
ATOM   5680  O  OD1   . ASP A 1 902  ? 21.343  56.230  -48.007 1.00 87.56  ? 930  ASP A OD1   1 
ATOM   5681  O  OD2   . ASP A 1 902  ? 19.292  55.529  -47.658 1.00 76.96  ? 930  ASP A OD2   1 
ATOM   5682  N  N     . LEU A 1 903  ? 22.284  51.393  -48.699 1.00 74.36  ? 931  LEU A N     1 
ATOM   5683  C  CA    . LEU A 1 903  ? 22.580  49.972  -48.557 1.00 73.47  ? 931  LEU A CA    1 
ATOM   5684  C  C     . LEU A 1 903  ? 21.574  49.312  -47.619 1.00 71.21  ? 931  LEU A C     1 
ATOM   5685  O  O     . LEU A 1 903  ? 21.034  48.243  -47.921 1.00 68.72  ? 931  LEU A O     1 
ATOM   5686  C  CB    . LEU A 1 903  ? 24.005  49.759  -48.043 1.00 71.59  ? 931  LEU A CB    1 
ATOM   5687  C  CG    . LEU A 1 903  ? 24.435  48.297  -47.901 1.00 76.39  ? 931  LEU A CG    1 
ATOM   5688  C  CD1   . LEU A 1 903  ? 24.226  47.545  -49.207 1.00 73.51  ? 931  LEU A CD1   1 
ATOM   5689  C  CD2   . LEU A 1 903  ? 25.881  48.195  -47.449 1.00 55.32  ? 931  LEU A CD2   1 
ATOM   5690  N  N     . HIS A 1 904  ? 21.327  49.958  -46.483 1.00 72.74  ? 932  HIS A N     1 
ATOM   5691  C  CA    . HIS A 1 904  ? 20.320  49.494  -45.537 1.00 73.06  ? 932  HIS A CA    1 
ATOM   5692  C  C     . HIS A 1 904  ? 18.956  49.438  -46.213 1.00 75.80  ? 932  HIS A C     1 
ATOM   5693  O  O     . HIS A 1 904  ? 18.187  48.498  -46.011 1.00 77.69  ? 932  HIS A O     1 
ATOM   5694  C  CB    . HIS A 1 904  ? 20.258  50.408  -44.309 1.00 75.25  ? 932  HIS A CB    1 
ATOM   5695  C  CG    . HIS A 1 904  ? 21.543  50.489  -43.545 1.00 77.56  ? 932  HIS A CG    1 
ATOM   5696  N  ND1   . HIS A 1 904  ? 21.840  49.645  -42.496 1.00 73.01  ? 932  HIS A ND1   1 
ATOM   5697  C  CD2   . HIS A 1 904  ? 22.604  51.322  -43.669 1.00 76.85  ? 932  HIS A CD2   1 
ATOM   5698  C  CE1   . HIS A 1 904  ? 23.030  49.950  -42.011 1.00 75.50  ? 932  HIS A CE1   1 
ATOM   5699  N  NE2   . HIS A 1 904  ? 23.515  50.965  -42.704 1.00 68.56  ? 932  HIS A NE2   1 
ATOM   5700  N  N     . SER A 1 905  ? 18.670  50.451  -47.025 1.00 76.56  ? 933  SER A N     1 
ATOM   5701  C  CA    . SER A 1 905  ? 17.407  50.532  -47.747 1.00 70.90  ? 933  SER A CA    1 
ATOM   5702  C  C     . SER A 1 905  ? 17.350  49.518  -48.885 1.00 77.55  ? 933  SER A C     1 
ATOM   5703  O  O     . SER A 1 905  ? 16.270  49.091  -49.292 1.00 77.43  ? 933  SER A O     1 
ATOM   5704  C  CB    . SER A 1 905  ? 17.195  51.947  -48.289 1.00 74.93  ? 933  SER A CB    1 
ATOM   5705  O  OG    . SER A 1 905  ? 15.970  52.046  -48.996 1.00 76.69  ? 933  SER A OG    1 
ATOM   5706  N  N     . LYS A 1 906  ? 18.516  49.136  -49.398 1.00 73.20  ? 934  LYS A N     1 
ATOM   5707  C  CA    . LYS A 1 906  ? 18.588  48.154  -50.474 1.00 77.46  ? 934  LYS A CA    1 
ATOM   5708  C  C     . LYS A 1 906  ? 18.381  46.752  -49.918 1.00 75.53  ? 934  LYS A C     1 
ATOM   5709  O  O     . LYS A 1 906  ? 17.895  45.860  -50.615 1.00 74.32  ? 934  LYS A O     1 
ATOM   5710  C  CB    . LYS A 1 906  ? 19.928  48.247  -51.207 1.00 75.04  ? 934  LYS A CB    1 
ATOM   5711  C  CG    . LYS A 1 906  ? 19.959  47.520  -52.542 1.00 75.73  ? 934  LYS A CG    1 
ATOM   5712  C  CD    . LYS A 1 906  ? 21.264  47.776  -53.282 1.00 70.15  ? 934  LYS A CD    1 
ATOM   5713  C  CE    . LYS A 1 906  ? 21.267  47.099  -54.643 1.00 77.77  ? 934  LYS A CE    1 
ATOM   5714  N  NZ    . LYS A 1 906  ? 22.530  47.351  -55.391 1.00 69.03  ? 934  LYS A NZ    1 
ATOM   5715  N  N     . THR A 1 907  ? 18.752  46.564  -48.655 1.00 77.53  ? 935  THR A N     1 
ATOM   5716  C  CA    . THR A 1 907  ? 18.515  45.297  -47.975 1.00 73.55  ? 935  THR A CA    1 
ATOM   5717  C  C     . THR A 1 907  ? 17.104  45.259  -47.392 1.00 92.85  ? 935  THR A C     1 
ATOM   5718  O  O     . THR A 1 907  ? 16.556  44.187  -47.133 1.00 87.39  ? 935  THR A O     1 
ATOM   5719  C  CB    . THR A 1 907  ? 19.540  45.056  -46.852 1.00 74.11  ? 935  THR A CB    1 
ATOM   5720  O  OG1   . THR A 1 907  ? 19.466  46.122  -45.898 1.00 73.80  ? 935  THR A OG1   1 
ATOM   5721  C  CG2   . THR A 1 907  ? 20.948  44.990  -47.424 1.00 73.56  ? 935  THR A CG2   1 
ATOM   5722  N  N     . ALA A 1 908  ? 16.521  46.437  -47.194 1.00 71.48  ? 936  ALA A N     1 
ATOM   5723  C  CA    . ALA A 1 908  ? 15.181  46.549  -46.627 1.00 72.27  ? 936  ALA A CA    1 
ATOM   5724  C  C     . ALA A 1 908  ? 14.108  46.401  -47.699 1.00 93.98  ? 936  ALA A C     1 
ATOM   5725  O  O     . ALA A 1 908  ? 12.935  46.187  -47.392 1.00 68.31  ? 936  ALA A O     1 
ATOM   5726  C  CB    . ALA A 1 908  ? 15.023  47.875  -45.904 1.00 76.09  ? 936  ALA A CB    1 
ATOM   5727  N  N     . THR A 1 909  ? 14.512  46.525  -48.959 1.00 92.92  ? 937  THR A N     1 
ATOM   5728  C  CA    . THR A 1 909  ? 13.590  46.356  -50.074 1.00 86.89  ? 937  THR A CA    1 
ATOM   5729  C  C     . THR A 1 909  ? 13.910  45.077  -50.838 1.00 90.30  ? 937  THR A C     1 
ATOM   5730  O  O     . THR A 1 909  ? 14.112  45.100  -52.052 1.00 84.11  ? 937  THR A O     1 
ATOM   5731  C  CB    . THR A 1 909  ? 13.636  47.555  -51.040 1.00 73.35  ? 937  THR A CB    1 
ATOM   5732  O  OG1   . THR A 1 909  ? 14.977  47.744  -51.508 1.00 76.26  ? 937  THR A OG1   1 
ATOM   5733  C  CG2   . THR A 1 909  ? 13.163  48.821  -50.341 1.00 73.96  ? 937  THR A CG2   1 
ATOM   5734  N  N     . THR A 1 910  ? 13.956  43.964  -50.114 1.00 91.77  ? 938  THR A N     1 
ATOM   5735  C  CA    . THR A 1 910  ? 14.262  42.665  -50.712 1.00 73.95  ? 938  THR A CA    1 
ATOM   5736  C  C     . THR A 1 910  ? 13.059  41.770  -51.099 1.00 84.91  ? 938  THR A C     1 
ATOM   5737  O  O     . THR A 1 910  ? 13.104  41.171  -52.173 1.00 68.67  ? 938  THR A O     1 
ATOM   5738  C  CB    . THR A 1 910  ? 15.201  41.845  -49.792 1.00 93.46  ? 938  THR A CB    1 
ATOM   5739  O  OG1   . THR A 1 910  ? 14.865  42.076  -48.421 1.00 69.17  ? 938  THR A OG1   1 
ATOM   5740  C  CG2   . THR A 1 910  ? 16.649  42.252  -50.016 1.00 64.84  ? 938  THR A CG2   1 
ATOM   5741  N  N     . VAL A 1 911  ? 11.995  41.647  -50.293 1.00 43.94  ? 939  VAL A N     1 
ATOM   5742  C  CA    . VAL A 1 911  ? 11.765  42.328  -49.018 1.00 47.58  ? 939  VAL A CA    1 
ATOM   5743  C  C     . VAL A 1 911  ? 11.731  41.330  -47.857 1.00 40.59  ? 939  VAL A C     1 
ATOM   5744  O  O     . VAL A 1 911  ? 11.311  40.186  -48.034 1.00 43.36  ? 939  VAL A O     1 
ATOM   5745  C  CB    . VAL A 1 911  ? 10.442  43.133  -49.051 1.00 41.65  ? 939  VAL A CB    1 
ATOM   5746  C  CG1   . VAL A 1 911  ? 10.526  44.252  -50.076 1.00 45.92  ? 939  VAL A CG1   1 
ATOM   5747  C  CG2   . VAL A 1 911  ? 9.264   42.218  -49.356 1.00 42.22  ? 939  VAL A CG2   1 
ATOM   5748  N  N     . GLY A 1 912  ? 12.179  41.750  -46.674 1.00 69.59  ? 940  GLY A N     1 
ATOM   5749  C  CA    . GLY A 1 912  ? 12.711  43.084  -46.454 1.00 75.57  ? 940  GLY A CA    1 
ATOM   5750  C  C     . GLY A 1 912  ? 11.800  43.955  -45.611 1.00 86.74  ? 940  GLY A C     1 
ATOM   5751  O  O     . GLY A 1 912  ? 10.584  43.971  -45.806 1.00 73.51  ? 940  GLY A O     1 
ATOM   5752  N  N     . ILE A 1 913  ? 12.396  44.686  -44.674 1.00 71.50  ? 941  ILE A N     1 
ATOM   5753  C  CA    . ILE A 1 913  ? 11.649  45.573  -43.788 1.00 68.70  ? 941  ILE A CA    1 
ATOM   5754  C  C     . ILE A 1 913  ? 12.405  46.879  -43.553 1.00 86.92  ? 941  ILE A C     1 
ATOM   5755  O  O     . ILE A 1 913  ? 13.553  46.874  -43.108 1.00 93.71  ? 941  ILE A O     1 
ATOM   5756  C  CB    . ILE A 1 913  ? 11.348  44.906  -42.423 1.00 70.58  ? 941  ILE A CB    1 
ATOM   5757  C  CG1   . ILE A 1 913  ? 12.566  44.123  -41.911 1.00 77.38  ? 941  ILE A CG1   1 
ATOM   5758  C  CG2   . ILE A 1 913  ? 10.123  44.008  -42.526 1.00 71.42  ? 941  ILE A CG2   1 
ATOM   5759  C  CD1   . ILE A 1 913  ? 12.574  42.642  -42.270 1.00 77.16  ? 941  ILE A CD1   1 
ATOM   5760  N  N     . SER A 1 914  ? 11.754  47.997  -43.854 1.00 68.70  ? 942  SER A N     1 
ATOM   5761  C  CA    . SER A 1 914  ? 12.381  49.307  -43.724 1.00 75.54  ? 942  SER A CA    1 
ATOM   5762  C  C     . SER A 1 914  ? 12.051  49.957  -42.383 1.00 73.62  ? 942  SER A C     1 
ATOM   5763  O  O     . SER A 1 914  ? 10.898  49.948  -41.952 1.00 75.46  ? 942  SER A O     1 
ATOM   5764  C  CB    . SER A 1 914  ? 11.946  50.221  -44.871 1.00 87.63  ? 942  SER A CB    1 
ATOM   5765  O  OG    . SER A 1 914  ? 12.255  49.645  -46.129 1.00 42.40  ? 942  SER A OG    1 
ATOM   5766  N  N     . ARG A 1 915  ? 13.060  50.520  -41.722 1.00 87.82  ? 943  ARG A N     1 
ATOM   5767  C  CA    . ARG A 1 915  ? 14.434  50.508  -42.215 1.00 76.61  ? 943  ARG A CA    1 
ATOM   5768  C  C     . ARG A 1 915  ? 15.397  50.191  -41.076 1.00 70.64  ? 943  ARG A C     1 
ATOM   5769  O  O     . ARG A 1 915  ? 16.475  49.640  -41.295 1.00 56.86  ? 943  ARG A O     1 
ATOM   5770  C  CB    . ARG A 1 915  ? 14.794  51.852  -42.855 1.00 75.36  ? 943  ARG A CB    1 
ATOM   5771  C  CG    . ARG A 1 915  ? 16.183  51.899  -43.480 1.00 72.78  ? 943  ARG A CG    1 
ATOM   5772  C  CD    . ARG A 1 915  ? 16.486  53.274  -44.057 1.00 75.83  ? 943  ARG A CD    1 
ATOM   5773  N  NE    . ARG A 1 915  ? 17.812  53.338  -44.668 1.00 73.86  ? 943  ARG A NE    1 
ATOM   5774  C  CZ    . ARG A 1 915  ? 18.914  53.722  -44.030 1.00 75.92  ? 943  ARG A CZ    1 
ATOM   5775  N  NH1   . ARG A 1 915  ? 18.854  54.077  -42.754 1.00 68.88  ? 943  ARG A NH1   1 
ATOM   5776  N  NH2   . ARG A 1 915  ? 20.076  53.751  -44.667 1.00 73.26  ? 943  ARG A NH2   1 
ATOM   5777  N  N     . GLU A 1 916  ? 14.990  50.543  -39.860 1.00 76.59  ? 944  GLU A N     1 
ATOM   5778  C  CA    . GLU A 1 916  ? 15.801  50.316  -38.668 1.00 70.81  ? 944  GLU A CA    1 
ATOM   5779  C  C     . GLU A 1 916  ? 16.092  48.831  -38.465 1.00 68.17  ? 944  GLU A C     1 
ATOM   5780  O  O     . GLU A 1 916  ? 17.165  48.454  -37.990 1.00 72.06  ? 944  GLU A O     1 
ATOM   5781  C  CB    . GLU A 1 916  ? 15.099  50.885  -37.433 1.00 77.55  ? 944  GLU A CB    1 
ATOM   5782  C  CG    . GLU A 1 916  ? 14.612  52.319  -37.592 1.00 86.74  ? 944  GLU A CG    1 
ATOM   5783  C  CD    . GLU A 1 916  ? 15.746  53.325  -37.636 1.00 85.57  ? 944  GLU A CD    1 
ATOM   5784  O  OE1   . GLU A 1 916  ? 16.856  52.997  -37.168 1.00 90.62  ? 944  GLU A OE1   1 
ATOM   5785  O  OE2   . GLU A 1 916  ? 15.525  54.448  -38.138 1.00 91.57  ? 944  GLU A OE2   1 
ATOM   5786  N  N     . HIS A 1 917  ? 15.126  47.996  -38.832 1.00 68.46  ? 945  HIS A N     1 
ATOM   5787  C  CA    . HIS A 1 917  ? 15.258  46.551  -38.694 1.00 71.14  ? 945  HIS A CA    1 
ATOM   5788  C  C     . HIS A 1 917  ? 16.385  46.011  -39.572 1.00 70.82  ? 945  HIS A C     1 
ATOM   5789  O  O     . HIS A 1 917  ? 17.193  45.194  -39.127 1.00 65.39  ? 945  HIS A O     1 
ATOM   5790  C  CB    . HIS A 1 917  ? 13.937  45.864  -39.045 1.00 66.66  ? 945  HIS A CB    1 
ATOM   5791  C  CG    . HIS A 1 917  ? 12.750  46.444  -38.340 1.00 65.18  ? 945  HIS A CG    1 
ATOM   5792  N  ND1   . HIS A 1 917  ? 12.093  47.569  -38.790 1.00 70.38  ? 945  HIS A ND1   1 
ATOM   5793  C  CD2   . HIS A 1 917  ? 12.105  46.057  -37.214 1.00 56.16  ? 945  HIS A CD2   1 
ATOM   5794  C  CE1   . HIS A 1 917  ? 11.093  47.849  -37.974 1.00 72.54  ? 945  HIS A CE1   1 
ATOM   5795  N  NE2   . HIS A 1 917  ? 11.078  46.947  -37.009 1.00 76.01  ? 945  HIS A NE2   1 
ATOM   5796  N  N     . ALA A 1 918  ? 16.435  46.477  -40.817 1.00 68.94  ? 946  ALA A N     1 
ATOM   5797  C  CA    . ALA A 1 918  ? 17.488  46.080  -41.745 1.00 66.35  ? 946  ALA A CA    1 
ATOM   5798  C  C     . ALA A 1 918  ? 18.844  46.576  -41.257 1.00 70.74  ? 946  ALA A C     1 
ATOM   5799  O  O     . ALA A 1 918  ? 19.872  45.935  -41.483 1.00 68.95  ? 946  ALA A O     1 
ATOM   5800  C  CB    . ALA A 1 918  ? 17.198  46.609  -43.140 1.00 55.49  ? 946  ALA A CB    1 
ATOM   5801  N  N     . LYS A 1 919  ? 18.833  47.725  -40.590 1.00 69.26  ? 947  LYS A N     1 
ATOM   5802  C  CA    . LYS A 1 919  ? 20.035  48.279  -39.982 1.00 64.92  ? 947  LYS A CA    1 
ATOM   5803  C  C     . LYS A 1 919  ? 20.545  47.350  -38.883 1.00 56.05  ? 947  LYS A C     1 
ATOM   5804  O  O     . LYS A 1 919  ? 21.742  47.066  -38.799 1.00 56.90  ? 947  LYS A O     1 
ATOM   5805  C  CB    . LYS A 1 919  ? 19.751  49.673  -39.419 1.00 64.69  ? 947  LYS A CB    1 
ATOM   5806  C  CG    . LYS A 1 919  ? 20.947  50.350  -38.782 1.00 65.93  ? 947  LYS A CG    1 
ATOM   5807  C  CD    . LYS A 1 919  ? 20.544  51.652  -38.109 1.00 55.65  ? 947  LYS A CD    1 
ATOM   5808  C  CE    . LYS A 1 919  ? 19.886  52.606  -39.091 1.00 42.71  ? 947  LYS A CE    1 
ATOM   5809  N  NZ    . LYS A 1 919  ? 19.544  53.905  -38.449 1.00 44.82  ? 947  LYS A NZ    1 
ATOM   5810  N  N     . ILE A 1 920  ? 19.622  46.878  -38.049 1.00 66.73  ? 948  ILE A N     1 
ATOM   5811  C  CA    . ILE A 1 920  ? 19.943  45.920  -36.995 1.00 55.43  ? 948  ILE A CA    1 
ATOM   5812  C  C     . ILE A 1 920  ? 20.471  44.616  -37.587 1.00 69.03  ? 948  ILE A C     1 
ATOM   5813  O  O     . ILE A 1 920  ? 21.382  43.992  -37.039 1.00 49.60  ? 948  ILE A O     1 
ATOM   5814  C  CB    . ILE A 1 920  ? 18.709  45.620  -36.113 1.00 55.38  ? 948  ILE A CB    1 
ATOM   5815  C  CG1   . ILE A 1 920  ? 18.241  46.888  -35.399 1.00 60.41  ? 948  ILE A CG1   1 
ATOM   5816  C  CG2   . ILE A 1 920  ? 19.013  44.527  -35.097 1.00 44.85  ? 948  ILE A CG2   1 
ATOM   5817  C  CD1   . ILE A 1 920  ? 17.027  46.677  -34.522 1.00 45.13  ? 948  ILE A CD1   1 
ATOM   5818  N  N     . PHE A 1 921  ? 19.899  44.216  -38.717 1.00 64.80  ? 949  PHE A N     1 
ATOM   5819  C  CA    . PHE A 1 921  ? 20.300  42.983  -39.382 1.00 73.29  ? 949  PHE A CA    1 
ATOM   5820  C  C     . PHE A 1 921  ? 21.719  43.094  -39.933 1.00 69.93  ? 949  PHE A C     1 
ATOM   5821  O  O     . PHE A 1 921  ? 22.520  42.169  -39.798 1.00 67.59  ? 949  PHE A O     1 
ATOM   5822  C  CB    . PHE A 1 921  ? 19.318  42.640  -40.503 1.00 74.20  ? 949  PHE A CB    1 
ATOM   5823  C  CG    . PHE A 1 921  ? 19.447  41.235  -41.015 1.00 69.84  ? 949  PHE A CG    1 
ATOM   5824  C  CD1   . PHE A 1 921  ? 18.820  40.186  -40.361 1.00 69.20  ? 949  PHE A CD1   1 
ATOM   5825  C  CD2   . PHE A 1 921  ? 20.189  40.961  -42.151 1.00 73.00  ? 949  PHE A CD2   1 
ATOM   5826  C  CE1   . PHE A 1 921  ? 18.934  38.891  -40.829 1.00 69.54  ? 949  PHE A CE1   1 
ATOM   5827  C  CE2   . PHE A 1 921  ? 20.307  39.668  -42.624 1.00 69.26  ? 949  PHE A CE2   1 
ATOM   5828  C  CZ    . PHE A 1 921  ? 19.678  38.632  -41.962 1.00 69.98  ? 949  PHE A CZ    1 
ATOM   5829  N  N     . ASN A 1 922  ? 22.024  44.233  -40.548 1.00 65.67  ? 950  ASN A N     1 
ATOM   5830  C  CA    . ASN A 1 922  ? 23.349  44.468  -41.113 1.00 60.54  ? 950  ASN A CA    1 
ATOM   5831  C  C     . ASN A 1 922  ? 24.424  44.622  -40.040 1.00 67.65  ? 950  ASN A C     1 
ATOM   5832  O  O     . ASN A 1 922  ? 25.429  43.908  -40.050 1.00 43.52  ? 950  ASN A O     1 
ATOM   5833  C  CB    . ASN A 1 922  ? 23.330  45.707  -42.012 1.00 49.78  ? 950  ASN A CB    1 
ATOM   5834  C  CG    . ASN A 1 922  ? 22.679  45.442  -43.357 1.00 60.94  ? 950  ASN A CG    1 
ATOM   5835  O  OD1   . ASN A 1 922  ? 22.767  44.338  -43.894 1.00 67.63  ? 950  ASN A OD1   1 
ATOM   5836  N  ND2   . ASN A 1 922  ? 22.025  46.457  -43.909 1.00 66.80  ? 950  ASN A ND2   1 
ATOM   5837  N  N     . TYR A 1 923  ? 24.208  45.552  -39.113 1.00 68.23  ? 951  TYR A N     1 
ATOM   5838  C  CA    . TYR A 1 923  ? 25.164  45.788  -38.035 1.00 65.57  ? 951  TYR A CA    1 
ATOM   5839  C  C     . TYR A 1 923  ? 25.302  44.562  -37.136 1.00 55.83  ? 951  TYR A C     1 
ATOM   5840  O  O     . TYR A 1 923  ? 26.328  44.370  -36.487 1.00 69.65  ? 951  TYR A O     1 
ATOM   5841  C  CB    . TYR A 1 923  ? 24.756  47.013  -37.212 1.00 46.35  ? 951  TYR A CB    1 
ATOM   5842  C  CG    . TYR A 1 923  ? 25.114  48.328  -37.870 1.00 60.36  ? 951  TYR A CG    1 
ATOM   5843  C  CD1   . TYR A 1 923  ? 26.338  48.498  -38.504 1.00 65.70  ? 951  TYR A CD1   1 
ATOM   5844  C  CD2   . TYR A 1 923  ? 24.226  49.396  -37.865 1.00 49.98  ? 951  TYR A CD2   1 
ATOM   5845  C  CE1   . TYR A 1 923  ? 26.671  49.695  -39.109 1.00 69.88  ? 951  TYR A CE1   1 
ATOM   5846  C  CE2   . TYR A 1 923  ? 24.549  50.597  -38.470 1.00 60.35  ? 951  TYR A CE2   1 
ATOM   5847  C  CZ    . TYR A 1 923  ? 25.773  50.741  -39.089 1.00 72.36  ? 951  TYR A CZ    1 
ATOM   5848  O  OH    . TYR A 1 923  ? 26.101  51.934  -39.691 1.00 70.53  ? 951  TYR A OH    1 
ATOM   5849  N  N     . GLY A 1 924  ? 24.265  43.731  -37.106 1.00 48.42  ? 952  GLY A N     1 
ATOM   5850  C  CA    . GLY A 1 924  ? 24.330  42.469  -36.395 1.00 49.13  ? 952  GLY A CA    1 
ATOM   5851  C  C     . GLY A 1 924  ? 25.106  41.442  -37.193 1.00 56.99  ? 952  GLY A C     1 
ATOM   5852  O  O     . GLY A 1 924  ? 25.742  40.551  -36.629 1.00 44.36  ? 952  GLY A O     1 
ATOM   5853  N  N     . ARG A 1 925  ? 25.055  41.574  -38.515 1.00 68.01  ? 953  ARG A N     1 
ATOM   5854  C  CA    . ARG A 1 925  ? 25.760  40.660  -39.406 1.00 70.95  ? 953  ARG A CA    1 
ATOM   5855  C  C     . ARG A 1 925  ? 27.262  40.919  -39.375 1.00 56.03  ? 953  ARG A C     1 
ATOM   5856  O  O     . ARG A 1 925  ? 28.062  39.987  -39.468 1.00 55.73  ? 953  ARG A O     1 
ATOM   5857  C  CB    . ARG A 1 925  ? 25.228  40.784  -40.838 1.00 69.49  ? 953  ARG A CB    1 
ATOM   5858  C  CG    . ARG A 1 925  ? 25.894  39.850  -41.838 1.00 73.26  ? 953  ARG A CG    1 
ATOM   5859  C  CD    . ARG A 1 925  ? 25.232  39.927  -43.205 1.00 74.33  ? 953  ARG A CD    1 
ATOM   5860  N  NE    . ARG A 1 925  ? 25.297  41.270  -43.774 1.00 75.44  ? 953  ARG A NE    1 
ATOM   5861  C  CZ    . ARG A 1 925  ? 26.306  41.721  -44.512 1.00 71.00  ? 953  ARG A CZ    1 
ATOM   5862  N  NH1   . ARG A 1 925  ? 27.344  40.938  -44.771 1.00 70.42  ? 953  ARG A NH1   1 
ATOM   5863  N  NH2   . ARG A 1 925  ? 26.280  42.958  -44.989 1.00 73.50  ? 953  ARG A NH2   1 
ATOM   5864  N  N     . ILE A 1 926  ? 27.641  42.185  -39.237 1.00 67.30  ? 954  ILE A N     1 
ATOM   5865  C  CA    . ILE A 1 926  ? 29.053  42.551  -39.207 1.00 66.38  ? 954  ILE A CA    1 
ATOM   5866  C  C     . ILE A 1 926  ? 29.746  42.029  -37.946 1.00 67.77  ? 954  ILE A C     1 
ATOM   5867  O  O     . ILE A 1 926  ? 30.931  41.695  -37.973 1.00 65.54  ? 954  ILE A O     1 
ATOM   5868  C  CB    . ILE A 1 926  ? 29.244  44.083  -39.292 1.00 64.11  ? 954  ILE A CB    1 
ATOM   5869  C  CG1   . ILE A 1 926  ? 28.461  44.658  -40.472 1.00 60.86  ? 954  ILE A CG1   1 
ATOM   5870  C  CG2   . ILE A 1 926  ? 30.716  44.437  -39.435 1.00 56.98  ? 954  ILE A CG2   1 
ATOM   5871  C  CD1   . ILE A 1 926  ? 28.635  46.152  -40.646 1.00 49.39  ? 954  ILE A CD1   1 
ATOM   5872  N  N     . TYR A 1 927  ? 29.005  41.947  -36.845 1.00 56.07  ? 955  TYR A N     1 
ATOM   5873  C  CA    . TYR A 1 927  ? 29.602  41.575  -35.565 1.00 60.28  ? 955  TYR A CA    1 
ATOM   5874  C  C     . TYR A 1 927  ? 29.165  40.187  -35.102 1.00 55.50  ? 955  TYR A C     1 
ATOM   5875  O  O     . TYR A 1 927  ? 29.160  39.900  -33.906 1.00 72.88  ? 955  TYR A O     1 
ATOM   5876  C  CB    . TYR A 1 927  ? 29.252  42.610  -34.492 1.00 66.19  ? 955  TYR A CB    1 
ATOM   5877  C  CG    . TYR A 1 927  ? 29.428  44.045  -34.936 1.00 68.31  ? 955  TYR A CG    1 
ATOM   5878  C  CD1   . TYR A 1 927  ? 30.472  44.415  -35.775 1.00 56.26  ? 955  TYR A CD1   1 
ATOM   5879  C  CD2   . TYR A 1 927  ? 28.545  45.030  -34.520 1.00 77.97  ? 955  TYR A CD2   1 
ATOM   5880  C  CE1   . TYR A 1 927  ? 30.626  45.723  -36.186 1.00 48.55  ? 955  TYR A CE1   1 
ATOM   5881  C  CE2   . TYR A 1 927  ? 28.692  46.340  -34.926 1.00 72.82  ? 955  TYR A CE2   1 
ATOM   5882  C  CZ    . TYR A 1 927  ? 29.734  46.682  -35.756 1.00 74.86  ? 955  TYR A CZ    1 
ATOM   5883  O  OH    . TYR A 1 927  ? 29.879  47.989  -36.159 1.00 76.21  ? 955  TYR A OH    1 
ATOM   5884  N  N     . GLY A 1 928  ? 28.800  39.331  -36.051 1.00 45.29  ? 956  GLY A N     1 
ATOM   5885  C  CA    . GLY A 1 928  ? 28.422  37.966  -35.731 1.00 65.82  ? 956  GLY A CA    1 
ATOM   5886  C  C     . GLY A 1 928  ? 27.024  37.593  -36.186 1.00 74.22  ? 956  GLY A C     1 
ATOM   5887  O  O     . GLY A 1 928  ? 26.082  37.584  -35.392 1.00 56.90  ? 956  GLY A O     1 
ATOM   5888  N  N     . ALA A 1 929  ? 26.890  37.281  -37.471 1.00 71.76  ? 957  ALA A N     1 
ATOM   5889  C  CA    . ALA A 1 929  ? 25.611  36.857  -38.025 1.00 69.38  ? 957  ALA A CA    1 
ATOM   5890  C  C     . ALA A 1 929  ? 25.351  35.390  -37.721 1.00 72.95  ? 957  ALA A C     1 
ATOM   5891  O  O     . ALA A 1 929  ? 25.415  34.547  -38.615 1.00 76.71  ? 957  ALA A O     1 
ATOM   5892  C  CB    . ALA A 1 929  ? 25.571  37.095  -39.523 1.00 69.31  ? 957  ALA A CB    1 
ATOM   5893  N  N     . GLY A 1 930  ? 25.067  35.089  -36.458 1.00 86.80  ? 958  GLY A N     1 
ATOM   5894  C  CA    . GLY A 1 930  ? 24.729  33.736  -36.063 1.00 87.89  ? 958  GLY A CA    1 
ATOM   5895  C  C     . GLY A 1 930  ? 23.497  33.269  -36.810 1.00 81.71  ? 958  GLY A C     1 
ATOM   5896  O  O     . GLY A 1 930  ? 22.529  34.020  -36.942 1.00 93.80  ? 958  GLY A O     1 
ATOM   5897  N  N     . GLN A 1 931  ? 23.540  32.040  -37.314 1.00 87.21  ? 959  GLN A N     1 
ATOM   5898  C  CA    . GLN A 1 931  ? 22.427  31.486  -38.080 1.00 70.09  ? 959  GLN A CA    1 
ATOM   5899  C  C     . GLN A 1 931  ? 21.093  31.548  -37.325 1.00 71.93  ? 959  GLN A C     1 
ATOM   5900  O  O     . GLN A 1 931  ? 20.121  32.067  -37.868 1.00 77.23  ? 959  GLN A O     1 
ATOM   5901  C  CB    . GLN A 1 931  ? 22.727  30.044  -38.506 1.00 70.14  ? 959  GLN A CB    1 
ATOM   5902  C  CG    . GLN A 1 931  ? 21.589  29.379  -39.269 1.00 72.93  ? 959  GLN A CG    1 
ATOM   5903  C  CD    . GLN A 1 931  ? 21.902  27.948  -39.663 1.00 69.15  ? 959  GLN A CD    1 
ATOM   5904  O  OE1   . GLN A 1 931  ? 23.024  27.474  -39.485 1.00 71.26  ? 959  GLN A OE1   1 
ATOM   5905  N  NE2   . GLN A 1 931  ? 20.906  27.252  -40.201 1.00 73.84  ? 959  GLN A NE2   1 
ATOM   5906  N  N     . PRO A 1 932  ? 21.035  31.040  -36.074 1.00 93.36  ? 960  PRO A N     1 
ATOM   5907  C  CA    . PRO A 1 932  ? 19.731  31.115  -35.404 1.00 90.50  ? 960  PRO A CA    1 
ATOM   5908  C  C     . PRO A 1 932  ? 19.348  32.540  -35.010 1.00 86.29  ? 960  PRO A C     1 
ATOM   5909  O  O     . PRO A 1 932  ? 18.157  32.863  -34.952 1.00 91.73  ? 960  PRO A O     1 
ATOM   5910  C  CB    . PRO A 1 932  ? 19.928  30.245  -34.161 1.00 91.46  ? 960  PRO A CB    1 
ATOM   5911  C  CG    . PRO A 1 932  ? 21.377  30.347  -33.869 1.00 81.66  ? 960  PRO A CG    1 
ATOM   5912  C  CD    . PRO A 1 932  ? 22.051  30.406  -35.210 1.00 86.78  ? 960  PRO A CD    1 
ATOM   5913  N  N     . PHE A 1 933  ? 20.345  33.378  -34.741 1.00 73.48  ? 961  PHE A N     1 
ATOM   5914  C  CA    . PHE A 1 933  ? 20.086  34.765  -34.380 1.00 74.94  ? 961  PHE A CA    1 
ATOM   5915  C  C     . PHE A 1 933  ? 19.452  35.508  -35.546 1.00 70.43  ? 961  PHE A C     1 
ATOM   5916  O  O     . PHE A 1 933  ? 18.356  36.051  -35.418 1.00 72.54  ? 961  PHE A O     1 
ATOM   5917  C  CB    . PHE A 1 933  ? 21.369  35.474  -33.945 1.00 71.58  ? 961  PHE A CB    1 
ATOM   5918  C  CG    . PHE A 1 933  ? 21.153  36.903  -33.536 1.00 73.09  ? 961  PHE A CG    1 
ATOM   5919  C  CD1   . PHE A 1 933  ? 20.709  37.212  -32.261 1.00 69.92  ? 961  PHE A CD1   1 
ATOM   5920  C  CD2   . PHE A 1 933  ? 21.382  37.937  -34.430 1.00 77.73  ? 961  PHE A CD2   1 
ATOM   5921  C  CE1   . PHE A 1 933  ? 20.503  38.524  -31.883 1.00 69.73  ? 961  PHE A CE1   1 
ATOM   5922  C  CE2   . PHE A 1 933  ? 21.177  39.251  -34.057 1.00 73.72  ? 961  PHE A CE2   1 
ATOM   5923  C  CZ    . PHE A 1 933  ? 20.737  39.545  -32.782 1.00 73.26  ? 961  PHE A CZ    1 
ATOM   5924  N  N     . ALA A 1 934  ? 20.144  35.525  -36.681 1.00 56.97  ? 962  ALA A N     1 
ATOM   5925  C  CA    . ALA A 1 934  ? 19.616  36.141  -37.893 1.00 68.82  ? 962  ALA A CA    1 
ATOM   5926  C  C     . ALA A 1 934  ? 18.292  35.493  -38.283 1.00 74.08  ? 962  ALA A C     1 
ATOM   5927  O  O     . ALA A 1 934  ? 17.412  36.144  -38.853 1.00 68.88  ? 962  ALA A O     1 
ATOM   5928  C  CB    . ALA A 1 934  ? 20.619  36.032  -39.029 1.00 66.47  ? 962  ALA A CB    1 
ATOM   5929  N  N     . GLU A 1 935  ? 18.158  34.209  -37.959 1.00 76.49  ? 963  GLU A N     1 
ATOM   5930  C  CA    . GLU A 1 935  ? 16.929  33.473  -38.225 1.00 76.18  ? 963  GLU A CA    1 
ATOM   5931  C  C     . GLU A 1 935  ? 15.745  34.083  -37.493 1.00 70.12  ? 963  GLU A C     1 
ATOM   5932  O  O     . GLU A 1 935  ? 14.848  34.649  -38.121 1.00 71.73  ? 963  GLU A O     1 
ATOM   5933  C  CB    . GLU A 1 935  ? 17.080  31.998  -37.839 1.00 87.51  ? 963  GLU A CB    1 
ATOM   5934  C  CG    . GLU A 1 935  ? 15.811  31.173  -37.996 1.00 91.53  ? 963  GLU A CG    1 
ATOM   5935  C  CD    . GLU A 1 935  ? 16.092  29.693  -38.181 1.00 93.62  ? 963  GLU A CD    1 
ATOM   5936  O  OE1   . GLU A 1 935  ? 15.125  28.913  -38.307 1.00 90.95  ? 963  GLU A OE1   1 
ATOM   5937  O  OE2   . GLU A 1 935  ? 17.281  29.309  -38.205 1.00 87.46  ? 963  GLU A OE2   1 
ATOM   5938  N  N     . ARG A 1 936  ? 15.747  33.982  -36.167 1.00 72.40  ? 964  ARG A N     1 
ATOM   5939  C  CA    . ARG A 1 936  ? 14.606  34.449  -35.388 1.00 73.59  ? 964  ARG A CA    1 
ATOM   5940  C  C     . ARG A 1 936  ? 14.454  35.965  -35.490 1.00 81.39  ? 964  ARG A C     1 
ATOM   5941  O  O     . ARG A 1 936  ? 13.366  36.493  -35.283 1.00 87.43  ? 964  ARG A O     1 
ATOM   5942  C  CB    . ARG A 1 936  ? 14.727  34.015  -33.922 1.00 69.98  ? 964  ARG A CB    1 
ATOM   5943  C  CG    . ARG A 1 936  ? 15.238  35.082  -32.967 1.00 68.23  ? 964  ARG A CG    1 
ATOM   5944  C  CD    . ARG A 1 936  ? 16.751  35.078  -32.884 1.00 84.03  ? 964  ARG A CD    1 
ATOM   5945  N  NE    . ARG A 1 936  ? 17.270  33.777  -32.474 1.00 87.09  ? 964  ARG A NE    1 
ATOM   5946  C  CZ    . ARG A 1 936  ? 17.397  33.389  -31.210 1.00 81.90  ? 964  ARG A CZ    1 
ATOM   5947  N  NH1   . ARG A 1 936  ? 17.039  34.201  -30.225 1.00 87.57  ? 964  ARG A NH1   1 
ATOM   5948  N  NH2   . ARG A 1 936  ? 17.880  32.186  -30.929 1.00 90.25  ? 964  ARG A NH2   1 
ATOM   5949  N  N     . LEU A 1 937  ? 15.539  36.658  -35.828 1.00 72.56  ? 965  LEU A N     1 
ATOM   5950  C  CA    . LEU A 1 937  ? 15.494  38.107  -36.003 1.00 74.28  ? 965  LEU A CA    1 
ATOM   5951  C  C     . LEU A 1 937  ? 14.721  38.485  -37.263 1.00 72.47  ? 965  LEU A C     1 
ATOM   5952  O  O     . LEU A 1 937  ? 13.709  39.191  -37.199 1.00 76.83  ? 965  LEU A O     1 
ATOM   5953  C  CB    . LEU A 1 937  ? 16.908  38.687  -36.068 1.00 86.00  ? 965  LEU A CB    1 
ATOM   5954  C  CG    . LEU A 1 937  ? 17.044  40.205  -35.941 1.00 90.94  ? 965  LEU A CG    1 
ATOM   5955  C  CD1   . LEU A 1 937  ? 16.653  40.658  -34.542 1.00 90.70  ? 965  LEU A CD1   1 
ATOM   5956  C  CD2   . LEU A 1 937  ? 18.460  40.649  -36.279 1.00 93.53  ? 965  LEU A CD2   1 
ATOM   5957  N  N     . LEU A 1 938  ? 15.205  38.010  -38.408 1.00 77.48  ? 966  LEU A N     1 
ATOM   5958  C  CA    . LEU A 1 938  ? 14.573  38.310  -39.689 1.00 71.82  ? 966  LEU A CA    1 
ATOM   5959  C  C     . LEU A 1 938  ? 13.150  37.760  -39.738 1.00 74.30  ? 966  LEU A C     1 
ATOM   5960  O  O     . LEU A 1 938  ? 12.268  38.348  -40.365 1.00 72.30  ? 966  LEU A O     1 
ATOM   5961  C  CB    . LEU A 1 938  ? 15.403  37.743  -40.844 1.00 68.80  ? 966  LEU A CB    1 
ATOM   5962  C  CG    . LEU A 1 938  ? 14.956  38.115  -42.259 1.00 75.15  ? 966  LEU A CG    1 
ATOM   5963  C  CD1   . LEU A 1 938  ? 14.959  39.624  -42.444 1.00 72.96  ? 966  LEU A CD1   1 
ATOM   5964  C  CD2   . LEU A 1 938  ? 15.842  37.443  -43.297 1.00 60.71  ? 966  LEU A CD2   1 
ATOM   5965  N  N     . MET A 1 939  ? 12.931  36.635  -39.064 1.00 72.33  ? 967  MET A N     1 
ATOM   5966  C  CA    . MET A 1 939  ? 11.606  36.029  -38.997 1.00 73.01  ? 967  MET A CA    1 
ATOM   5967  C  C     . MET A 1 939  ? 10.678  36.842  -38.093 1.00 76.74  ? 967  MET A C     1 
ATOM   5968  O  O     . MET A 1 939  ? 9.476   36.934  -38.347 1.00 77.52  ? 967  MET A O     1 
ATOM   5969  C  CB    . MET A 1 939  ? 11.707  34.582  -38.508 1.00 75.04  ? 967  MET A CB    1 
ATOM   5970  C  CG    . MET A 1 939  ? 10.398  33.811  -38.518 1.00 71.82  ? 967  MET A CG    1 
ATOM   5971  S  SD    . MET A 1 939  ? 10.650  32.039  -38.288 1.00 68.91  ? 967  MET A SD    1 
ATOM   5972  C  CE    . MET A 1 939  ? 11.673  32.023  -36.817 1.00 68.13  ? 967  MET A CE    1 
ATOM   5973  N  N     . GLN A 1 940  ? 11.241  37.435  -37.043 1.00 72.53  ? 968  GLN A N     1 
ATOM   5974  C  CA    . GLN A 1 940  ? 10.479  38.311  -36.155 1.00 68.86  ? 968  GLN A CA    1 
ATOM   5975  C  C     . GLN A 1 940  ? 10.075  39.594  -36.870 1.00 72.23  ? 968  GLN A C     1 
ATOM   5976  O  O     . GLN A 1 940  ? 8.973   40.107  -36.672 1.00 76.91  ? 968  GLN A O     1 
ATOM   5977  C  CB    . GLN A 1 940  ? 11.293  38.652  -34.901 1.00 73.08  ? 968  GLN A CB    1 
ATOM   5978  C  CG    . GLN A 1 940  ? 10.603  39.587  -33.917 1.00 72.46  ? 968  GLN A CG    1 
ATOM   5979  C  CD    . GLN A 1 940  ? 11.530  40.044  -32.802 1.00 74.55  ? 968  GLN A CD    1 
ATOM   5980  O  OE1   . GLN A 1 940  ? 12.753  39.964  -32.924 1.00 69.47  ? 968  GLN A OE1   1 
ATOM   5981  N  NE2   . GLN A 1 940  ? 10.950  40.523  -31.708 1.00 67.14  ? 968  GLN A NE2   1 
ATOM   5982  N  N     . PHE A 1 941  ? 10.972  40.106  -37.707 1.00 72.80  ? 969  PHE A N     1 
ATOM   5983  C  CA    . PHE A 1 941  ? 10.749  41.390  -38.364 1.00 77.35  ? 969  PHE A CA    1 
ATOM   5984  C  C     . PHE A 1 941  ? 9.897   41.288  -39.630 1.00 69.20  ? 969  PHE A C     1 
ATOM   5985  O  O     . PHE A 1 941  ? 9.151   42.213  -39.952 1.00 77.92  ? 969  PHE A O     1 
ATOM   5986  C  CB    . PHE A 1 941  ? 12.090  42.045  -38.701 1.00 72.55  ? 969  PHE A CB    1 
ATOM   5987  C  CG    . PHE A 1 941  ? 12.865  42.495  -37.494 1.00 72.42  ? 969  PHE A CG    1 
ATOM   5988  C  CD1   . PHE A 1 941  ? 12.224  42.732  -36.289 1.00 73.66  ? 969  PHE A CD1   1 
ATOM   5989  C  CD2   . PHE A 1 941  ? 14.235  42.684  -37.567 1.00 69.57  ? 969  PHE A CD2   1 
ATOM   5990  C  CE1   . PHE A 1 941  ? 12.936  43.147  -35.178 1.00 70.71  ? 969  PHE A CE1   1 
ATOM   5991  C  CE2   . PHE A 1 941  ? 14.951  43.100  -36.461 1.00 76.44  ? 969  PHE A CE2   1 
ATOM   5992  C  CZ    . PHE A 1 941  ? 14.301  43.331  -35.265 1.00 71.42  ? 969  PHE A CZ    1 
ATOM   5993  N  N     . ASN A 1 942  ? 10.003  40.172  -40.345 1.00 72.77  ? 970  ASN A N     1 
ATOM   5994  C  CA    . ASN A 1 942  ? 9.302   40.027  -41.618 1.00 92.02  ? 970  ASN A CA    1 
ATOM   5995  C  C     . ASN A 1 942  ? 7.962   39.304  -41.484 1.00 85.98  ? 970  ASN A C     1 
ATOM   5996  O  O     . ASN A 1 942  ? 7.076   39.474  -42.323 1.00 87.14  ? 970  ASN A O     1 
ATOM   5997  C  CB    . ASN A 1 942  ? 10.188  39.295  -42.629 1.00 81.51  ? 970  ASN A CB    1 
ATOM   5998  C  CG    . ASN A 1 942  ? 9.792   39.578  -44.067 1.00 81.84  ? 970  ASN A CG    1 
ATOM   5999  O  OD1   . ASN A 1 942  ? 10.498  40.283  -44.788 1.00 92.56  ? 970  ASN A OD1   1 
ATOM   6000  N  ND2   . ASN A 1 942  ? 8.663   39.024  -44.492 1.00 81.63  ? 970  ASN A ND2   1 
ATOM   6001  N  N     . HIS A 1 943  ? 7.828   38.501  -40.431 1.00 77.55  ? 971  HIS A N     1 
ATOM   6002  C  CA    . HIS A 1 943  ? 6.597   37.760  -40.149 1.00 73.62  ? 971  HIS A CA    1 
ATOM   6003  C  C     . HIS A 1 943  ? 6.151   36.874  -41.312 1.00 74.16  ? 971  HIS A C     1 
ATOM   6004  O  O     . HIS A 1 943  ? 5.192   37.195  -42.013 1.00 73.58  ? 971  HIS A O     1 
ATOM   6005  C  CB    . HIS A 1 943  ? 5.465   38.723  -39.776 1.00 69.71  ? 971  HIS A CB    1 
ATOM   6006  C  CG    . HIS A 1 943  ? 5.561   39.262  -38.383 1.00 70.64  ? 971  HIS A CG    1 
ATOM   6007  N  ND1   . HIS A 1 943  ? 5.238   40.564  -38.065 1.00 70.28  ? 971  HIS A ND1   1 
ATOM   6008  C  CD2   . HIS A 1 943  ? 5.932   38.672  -37.222 1.00 72.97  ? 971  HIS A CD2   1 
ATOM   6009  C  CE1   . HIS A 1 943  ? 5.413   40.755  -36.769 1.00 71.19  ? 971  HIS A CE1   1 
ATOM   6010  N  NE2   . HIS A 1 943  ? 5.833   39.622  -36.234 1.00 73.88  ? 971  HIS A NE2   1 
ATOM   6011  N  N     . ARG A 1 944  ? 6.852   35.762  -41.509 1.00 75.72  ? 972  ARG A N     1 
ATOM   6012  C  CA    . ARG A 1 944  ? 6.469   34.774  -42.513 1.00 91.62  ? 972  ARG A CA    1 
ATOM   6013  C  C     . ARG A 1 944  ? 6.797   33.369  -42.009 1.00 91.40  ? 972  ARG A C     1 
ATOM   6014  O  O     . ARG A 1 944  ? 6.866   33.140  -40.802 1.00 90.42  ? 972  ARG A O     1 
ATOM   6015  C  CB    . ARG A 1 944  ? 7.169   35.050  -43.846 1.00 81.12  ? 972  ARG A CB    1 
ATOM   6016  C  CG    . ARG A 1 944  ? 6.265   34.918  -45.062 1.00 75.91  ? 972  ARG A CG    1 
ATOM   6017  C  CD    . ARG A 1 944  ? 5.186   35.991  -45.060 1.00 68.05  ? 972  ARG A CD    1 
ATOM   6018  N  NE    . ARG A 1 944  ? 5.722   37.312  -45.376 1.00 74.84  ? 972  ARG A NE    1 
ATOM   6019  C  CZ    . ARG A 1 944  ? 5.240   38.452  -44.890 1.00 75.54  ? 972  ARG A CZ    1 
ATOM   6020  N  NH1   . ARG A 1 944  ? 4.212   38.438  -44.052 1.00 71.96  ? 972  ARG A NH1   1 
ATOM   6021  N  NH2   . ARG A 1 944  ? 5.789   39.608  -45.236 1.00 70.38  ? 972  ARG A NH2   1 
ATOM   6022  N  N     . LEU A 1 945  ? 7.002   32.430  -42.929 1.00 86.67  ? 973  LEU A N     1 
ATOM   6023  C  CA    . LEU A 1 945  ? 7.290   31.048  -42.550 1.00 81.80  ? 973  LEU A CA    1 
ATOM   6024  C  C     . LEU A 1 945  ? 8.797   30.779  -42.533 1.00 75.89  ? 973  LEU A C     1 
ATOM   6025  O  O     . LEU A 1 945  ? 9.561   31.414  -43.259 1.00 68.13  ? 973  LEU A O     1 
ATOM   6026  C  CB    . LEU A 1 945  ? 6.560   30.060  -43.479 1.00 73.96  ? 973  LEU A CB    1 
ATOM   6027  C  CG    . LEU A 1 945  ? 6.805   29.866  -44.987 1.00 73.13  ? 973  LEU A CG    1 
ATOM   6028  C  CD1   . LEU A 1 945  ? 6.848   31.179  -45.766 1.00 69.05  ? 973  LEU A CD1   1 
ATOM   6029  C  CD2   . LEU A 1 945  ? 8.051   29.032  -45.261 1.00 68.19  ? 973  LEU A CD2   1 
ATOM   6030  N  N     . THR A 1 946  ? 9.208   29.827  -41.700 1.00 70.49  ? 974  THR A N     1 
ATOM   6031  C  CA    . THR A 1 946  ? 10.618  29.623  -41.373 1.00 73.20  ? 974  THR A CA    1 
ATOM   6032  C  C     . THR A 1 946  ? 11.477  29.059  -42.508 1.00 91.66  ? 974  THR A C     1 
ATOM   6033  O  O     . THR A 1 946  ? 12.688  29.270  -42.528 1.00 92.11  ? 974  THR A O     1 
ATOM   6034  C  CB    . THR A 1 946  ? 10.765  28.686  -40.154 1.00 74.50  ? 974  THR A CB    1 
ATOM   6035  O  OG1   . THR A 1 946  ? 12.150  28.381  -39.946 1.00 69.40  ? 974  THR A OG1   1 
ATOM   6036  C  CG2   . THR A 1 946  ? 9.994   27.392  -40.375 1.00 68.20  ? 974  THR A CG2   1 
ATOM   6037  N  N     . GLN A 1 947  ? 10.862  28.342  -43.443 1.00 84.94  ? 975  GLN A N     1 
ATOM   6038  C  CA    . GLN A 1 947  ? 11.615  27.709  -44.525 1.00 74.35  ? 975  GLN A CA    1 
ATOM   6039  C  C     . GLN A 1 947  ? 12.098  28.725  -45.560 1.00 69.13  ? 975  GLN A C     1 
ATOM   6040  O  O     . GLN A 1 947  ? 13.294  28.789  -45.870 1.00 69.80  ? 975  GLN A O     1 
ATOM   6041  C  CB    . GLN A 1 947  ? 10.769  26.628  -45.202 1.00 69.43  ? 975  GLN A CB    1 
ATOM   6042  C  CG    . GLN A 1 947  ? 10.553  25.387  -44.348 1.00 68.70  ? 975  GLN A CG    1 
ATOM   6043  C  CD    . GLN A 1 947  ? 9.086   25.078  -44.120 1.00 68.68  ? 975  GLN A CD    1 
ATOM   6044  O  OE1   . GLN A 1 947  ? 8.407   25.761  -43.354 1.00 74.87  ? 975  GLN A OE1   1 
ATOM   6045  N  NE2   . GLN A 1 947  ? 8.590   24.043  -44.788 1.00 72.65  ? 975  GLN A NE2   1 
ATOM   6046  N  N     . GLN A 1 948  ? 11.166  29.510  -46.096 1.00 71.78  ? 976  GLN A N     1 
ATOM   6047  C  CA    . GLN A 1 948  ? 11.502  30.575  -47.035 1.00 90.23  ? 976  GLN A CA    1 
ATOM   6048  C  C     . GLN A 1 948  ? 12.484  31.546  -46.398 1.00 84.30  ? 976  GLN A C     1 
ATOM   6049  O  O     . GLN A 1 948  ? 13.444  31.985  -47.034 1.00 93.19  ? 976  GLN A O     1 
ATOM   6050  C  CB    . GLN A 1 948  ? 10.247  31.323  -47.489 1.00 90.44  ? 976  GLN A CB    1 
ATOM   6051  C  CG    . GLN A 1 948  ? 9.340   30.530  -48.412 1.00 77.84  ? 976  GLN A CG    1 
ATOM   6052  C  CD    . GLN A 1 948  ? 8.188   31.362  -48.938 1.00 71.31  ? 976  GLN A CD    1 
ATOM   6053  O  OE1   . GLN A 1 948  ? 8.107   32.564  -48.680 1.00 74.22  ? 976  GLN A OE1   1 
ATOM   6054  N  NE2   . GLN A 1 948  ? 7.286   30.726  -49.677 1.00 81.33  ? 976  GLN A NE2   1 
ATOM   6055  N  N     . GLU A 1 949  ? 12.230  31.871  -45.134 1.00 81.87  ? 977  GLU A N     1 
ATOM   6056  C  CA    . GLU A 1 949  ? 13.133  32.702  -44.353 1.00 91.96  ? 977  GLU A CA    1 
ATOM   6057  C  C     . GLU A 1 949  ? 14.536  32.108  -44.341 1.00 86.79  ? 977  GLU A C     1 
ATOM   6058  O  O     . GLU A 1 949  ? 15.514  32.807  -44.603 1.00 87.08  ? 977  GLU A O     1 
ATOM   6059  C  CB    . GLU A 1 949  ? 12.618  32.860  -42.921 1.00 91.35  ? 977  GLU A CB    1 
ATOM   6060  C  CG    . GLU A 1 949  ? 12.036  34.227  -42.601 1.00 76.12  ? 977  GLU A CG    1 
ATOM   6061  C  CD    . GLU A 1 949  ? 10.574  34.347  -42.977 1.00 69.91  ? 977  GLU A CD    1 
ATOM   6062  O  OE1   . GLU A 1 949  ? 9.765   34.699  -42.093 1.00 69.75  ? 977  GLU A OE1   1 
ATOM   6063  O  OE2   . GLU A 1 949  ? 10.233  34.094  -44.152 1.00 75.00  ? 977  GLU A OE2   1 
ATOM   6064  N  N     . ALA A 1 950  ? 14.622  30.815  -44.033 1.00 84.61  ? 978  ALA A N     1 
ATOM   6065  C  CA    . ALA A 1 950  ? 15.899  30.108  -43.997 1.00 72.28  ? 978  ALA A CA    1 
ATOM   6066  C  C     . ALA A 1 950  ? 16.612  30.210  -45.338 1.00 76.63  ? 978  ALA A C     1 
ATOM   6067  O  O     . ALA A 1 950  ? 17.836  30.349  -45.393 1.00 72.25  ? 978  ALA A O     1 
ATOM   6068  C  CB    . ALA A 1 950  ? 15.690  28.651  -43.615 1.00 73.11  ? 978  ALA A CB    1 
ATOM   6069  N  N     . ALA A 1 951  ? 15.836  30.144  -46.416 1.00 77.76  ? 979  ALA A N     1 
ATOM   6070  C  CA    . ALA A 1 951  ? 16.385  30.338  -47.752 1.00 92.97  ? 979  ALA A CA    1 
ATOM   6071  C  C     . ALA A 1 951  ? 16.975  31.740  -47.888 1.00 85.17  ? 979  ALA A C     1 
ATOM   6072  O  O     . ALA A 1 951  ? 18.081  31.904  -48.405 1.00 86.40  ? 979  ALA A O     1 
ATOM   6073  C  CB    . ALA A 1 951  ? 15.317  30.102  -48.810 1.00 84.19  ? 979  ALA A CB    1 
ATOM   6074  N  N     . GLU A 1 952  ? 16.241  32.743  -47.409 1.00 87.52  ? 980  GLU A N     1 
ATOM   6075  C  CA    . GLU A 1 952  ? 16.700  34.131  -47.481 1.00 69.54  ? 980  GLU A CA    1 
ATOM   6076  C  C     . GLU A 1 952  ? 18.014  34.331  -46.729 1.00 73.51  ? 980  GLU A C     1 
ATOM   6077  O  O     . GLU A 1 952  ? 18.940  34.966  -47.238 1.00 70.86  ? 980  GLU A O     1 
ATOM   6078  C  CB    . GLU A 1 952  ? 15.637  35.085  -46.928 1.00 74.90  ? 980  GLU A CB    1 
ATOM   6079  C  CG    . GLU A 1 952  ? 14.258  34.927  -47.551 1.00 68.65  ? 980  GLU A CG    1 
ATOM   6080  C  CD    . GLU A 1 952  ? 14.278  35.015  -49.065 1.00 85.27  ? 980  GLU A CD    1 
ATOM   6081  O  OE1   . GLU A 1 952  ? 14.985  35.891  -49.606 1.00 81.57  ? 980  GLU A OE1   1 
ATOM   6082  O  OE2   . GLU A 1 952  ? 13.585  34.203  -49.716 1.00 93.36  ? 980  GLU A OE2   1 
ATOM   6083  N  N     . LYS A 1 953  ? 18.087  33.787  -45.516 1.00 81.82  ? 981  LYS A N     1 
ATOM   6084  C  CA    . LYS A 1 953  ? 19.301  33.861  -44.710 1.00 74.83  ? 981  LYS A CA    1 
ATOM   6085  C  C     . LYS A 1 953  ? 20.461  33.182  -45.423 1.00 73.99  ? 981  LYS A C     1 
ATOM   6086  O  O     . LYS A 1 953  ? 21.530  33.770  -45.578 1.00 73.81  ? 981  LYS A O     1 
ATOM   6087  C  CB    . LYS A 1 953  ? 19.085  33.213  -43.342 1.00 68.81  ? 981  LYS A CB    1 
ATOM   6088  C  CG    . LYS A 1 953  ? 17.859  33.710  -42.606 1.00 86.16  ? 981  LYS A CG    1 
ATOM   6089  C  CD    . LYS A 1 953  ? 17.261  32.600  -41.764 1.00 81.50  ? 981  LYS A CD    1 
ATOM   6090  C  CE    . LYS A 1 953  ? 15.817  32.899  -41.417 1.00 92.41  ? 981  LYS A CE    1 
ATOM   6091  N  NZ    . LYS A 1 953  ? 15.068  31.660  -41.069 1.00 93.90  ? 981  LYS A NZ    1 
ATOM   6092  N  N     . ALA A 1 954  ? 20.234  31.945  -45.859 1.00 69.09  ? 982  ALA A N     1 
ATOM   6093  C  CA    . ALA A 1 954  ? 21.255  31.167  -46.556 1.00 81.02  ? 982  ALA A CA    1 
ATOM   6094  C  C     . ALA A 1 954  ? 21.778  31.905  -47.786 1.00 85.66  ? 982  ALA A C     1 
ATOM   6095  O  O     . ALA A 1 954  ? 22.956  31.798  -48.129 1.00 86.13  ? 982  ALA A O     1 
ATOM   6096  C  CB    . ALA A 1 954  ? 20.704  29.805  -46.951 1.00 81.59  ? 982  ALA A CB    1 
ATOM   6097  N  N     . GLN A 1 955  ? 20.897  32.653  -48.444 1.00 81.10  ? 983  GLN A N     1 
ATOM   6098  C  CA    . GLN A 1 955  ? 21.299  33.491  -49.568 1.00 85.14  ? 983  GLN A CA    1 
ATOM   6099  C  C     . GLN A 1 955  ? 22.133  34.678  -49.088 1.00 85.07  ? 983  GLN A C     1 
ATOM   6100  O  O     . GLN A 1 955  ? 23.100  35.071  -49.740 1.00 90.20  ? 983  GLN A O     1 
ATOM   6101  C  CB    . GLN A 1 955  ? 20.073  33.984  -50.341 1.00 92.00  ? 983  GLN A CB    1 
ATOM   6102  C  CG    . GLN A 1 955  ? 19.325  32.892  -51.091 1.00 91.54  ? 983  GLN A CG    1 
ATOM   6103  C  CD    . GLN A 1 955  ? 17.991  33.366  -51.634 1.00 90.14  ? 983  GLN A CD    1 
ATOM   6104  O  OE1   . GLN A 1 955  ? 17.026  32.603  -51.698 1.00 87.50  ? 983  GLN A OE1   1 
ATOM   6105  N  NE2   . GLN A 1 955  ? 17.930  34.632  -52.032 1.00 91.77  ? 983  GLN A NE2   1 
ATOM   6106  N  N     . GLN A 1 956  ? 21.754  35.242  -47.945 1.00 86.13  ? 984  GLN A N     1 
ATOM   6107  C  CA    . GLN A 1 956  ? 22.462  36.391  -47.385 1.00 91.08  ? 984  GLN A CA    1 
ATOM   6108  C  C     . GLN A 1 956  ? 23.706  35.973  -46.602 1.00 91.22  ? 984  GLN A C     1 
ATOM   6109  O  O     . GLN A 1 956  ? 24.544  36.810  -46.264 1.00 86.11  ? 984  GLN A O     1 
ATOM   6110  C  CB    . GLN A 1 956  ? 21.530  37.208  -46.486 1.00 87.78  ? 984  GLN A CB    1 
ATOM   6111  C  CG    . GLN A 1 956  ? 20.496  38.032  -47.241 1.00 68.57  ? 984  GLN A CG    1 
ATOM   6112  C  CD    . GLN A 1 956  ? 21.111  39.197  -47.996 1.00 77.05  ? 984  GLN A CD    1 
ATOM   6113  O  OE1   . GLN A 1 956  ? 22.181  39.689  -47.637 1.00 90.49  ? 984  GLN A OE1   1 
ATOM   6114  N  NE2   . GLN A 1 956  ? 20.435  39.642  -49.049 1.00 74.39  ? 984  GLN A NE2   1 
ATOM   6115  N  N     . MET A 1 957  ? 23.825  34.679  -46.318 1.00 91.18  ? 985  MET A N     1 
ATOM   6116  C  CA    . MET A 1 957  ? 24.989  34.153  -45.607 1.00 90.51  ? 985  MET A CA    1 
ATOM   6117  C  C     . MET A 1 957  ? 26.178  33.954  -46.542 1.00 84.58  ? 985  MET A C     1 
ATOM   6118  O  O     . MET A 1 957  ? 27.222  33.448  -46.131 1.00 84.49  ? 985  MET A O     1 
ATOM   6119  C  CB    . MET A 1 957  ? 24.652  32.828  -44.916 1.00 87.25  ? 985  MET A CB    1 
ATOM   6120  C  CG    . MET A 1 957  ? 23.816  32.961  -43.653 1.00 93.14  ? 985  MET A CG    1 
ATOM   6121  S  SD    . MET A 1 957  ? 24.620  33.920  -42.357 1.00 76.10  ? 985  MET A SD    1 
ATOM   6122  C  CE    . MET A 1 957  ? 23.405  33.789  -41.048 1.00 74.40  ? 985  MET A CE    1 
ATOM   6123  N  N     . TYR A 1 958  ? 26.014  34.352  -47.800 1.00 93.14  ? 986  TYR A N     1 
ATOM   6124  C  CA    . TYR A 1 958  ? 27.072  34.208  -48.793 1.00 81.11  ? 986  TYR A CA    1 
ATOM   6125  C  C     . TYR A 1 958  ? 28.223  35.166  -48.507 1.00 81.47  ? 986  TYR A C     1 
ATOM   6126  O  O     . TYR A 1 958  ? 29.340  34.972  -48.986 1.00 69.76  ? 986  TYR A O     1 
ATOM   6127  C  CB    . TYR A 1 958  ? 26.527  34.461  -50.201 1.00 72.89  ? 986  TYR A CB    1 
ATOM   6128  C  CG    . TYR A 1 958  ? 26.774  35.868  -50.704 1.00 76.09  ? 986  TYR A CG    1 
ATOM   6129  C  CD1   . TYR A 1 958  ? 27.792  36.131  -51.613 1.00 74.07  ? 986  TYR A CD1   1 
ATOM   6130  C  CD2   . TYR A 1 958  ? 25.997  36.932  -50.264 1.00 75.55  ? 986  TYR A CD2   1 
ATOM   6131  C  CE1   . TYR A 1 958  ? 28.025  37.413  -52.073 1.00 72.13  ? 986  TYR A CE1   1 
ATOM   6132  C  CE2   . TYR A 1 958  ? 26.225  38.218  -50.719 1.00 73.13  ? 986  TYR A CE2   1 
ATOM   6133  C  CZ    . TYR A 1 958  ? 27.240  38.452  -51.623 1.00 77.29  ? 986  TYR A CZ    1 
ATOM   6134  O  OH    . TYR A 1 958  ? 27.470  39.729  -52.080 1.00 90.58  ? 986  TYR A OH    1 
ATOM   6135  N  N     . ALA A 1 959  ? 27.936  36.199  -47.723 1.00 76.36  ? 987  ALA A N     1 
ATOM   6136  C  CA    . ALA A 1 959  ? 28.886  37.276  -47.481 1.00 68.26  ? 987  ALA A CA    1 
ATOM   6137  C  C     . ALA A 1 959  ? 30.038  36.860  -46.566 1.00 75.94  ? 987  ALA A C     1 
ATOM   6138  O  O     . ALA A 1 959  ? 31.199  37.165  -46.843 1.00 60.51  ? 987  ALA A O     1 
ATOM   6139  C  CB    . ALA A 1 959  ? 28.158  38.478  -46.899 1.00 46.29  ? 987  ALA A CB    1 
ATOM   6140  N  N     . ALA A 1 960  ? 29.718  36.162  -45.481 1.00 74.72  ? 988  ALA A N     1 
ATOM   6141  C  CA    . ALA A 1 960  ? 30.730  35.764  -44.505 1.00 75.16  ? 988  ALA A CA    1 
ATOM   6142  C  C     . ALA A 1 960  ? 31.525  34.538  -44.958 1.00 86.07  ? 988  ALA A C     1 
ATOM   6143  O  O     . ALA A 1 960  ? 32.660  34.338  -44.528 1.00 84.53  ? 988  ALA A O     1 
ATOM   6144  C  CB    . ALA A 1 960  ? 30.081  35.502  -43.150 1.00 56.50  ? 988  ALA A CB    1 
ATOM   6145  N  N     . THR A 1 961  ? 30.926  33.721  -45.822 1.00 90.34  ? 989  THR A N     1 
ATOM   6146  C  CA    . THR A 1 961  ? 31.596  32.535  -46.358 1.00 90.25  ? 989  THR A CA    1 
ATOM   6147  C  C     . THR A 1 961  ? 32.829  32.918  -47.179 1.00 70.28  ? 989  THR A C     1 
ATOM   6148  O  O     . THR A 1 961  ? 32.846  33.975  -47.809 1.00 68.25  ? 989  THR A O     1 
ATOM   6149  C  CB    . THR A 1 961  ? 30.639  31.691  -47.235 1.00 90.08  ? 989  THR A CB    1 
ATOM   6150  O  OG1   . THR A 1 961  ? 29.619  32.532  -47.785 1.00 86.76  ? 989  THR A OG1   1 
ATOM   6151  C  CG2   . THR A 1 961  ? 29.997  30.588  -46.408 1.00 86.38  ? 989  THR A CG2   1 
ATOM   6152  N  N     . LYS A 1 962  ? 33.859  32.072  -47.173 1.00 73.29  ? 990  LYS A N     1 
ATOM   6153  C  CA    . LYS A 1 962  ? 33.850  30.793  -46.463 1.00 74.58  ? 990  LYS A CA    1 
ATOM   6154  C  C     . LYS A 1 962  ? 34.470  30.889  -45.075 1.00 74.80  ? 990  LYS A C     1 
ATOM   6155  O  O     . LYS A 1 962  ? 33.762  30.980  -44.070 1.00 85.95  ? 990  LYS A O     1 
ATOM   6156  C  CB    . LYS A 1 962  ? 34.586  29.730  -47.283 1.00 76.09  ? 990  LYS A CB    1 
ATOM   6157  C  CG    . LYS A 1 962  ? 33.790  29.187  -48.459 1.00 81.13  ? 990  LYS A CG    1 
ATOM   6158  C  CD    . LYS A 1 962  ? 32.741  28.184  -48.006 1.00 91.83  ? 990  LYS A CD    1 
ATOM   6159  C  CE    . LYS A 1 962  ? 33.388  26.958  -47.377 1.00 87.81  ? 990  LYS A CE    1 
ATOM   6160  N  NZ    . LYS A 1 962  ? 34.301  26.247  -48.318 1.00 86.62  ? 990  LYS A NZ    1 
ATOM   6161  N  N     . GLY A 1 963  ? 35.797  30.858  -45.028 1.00 75.56  ? 991  GLY A N     1 
ATOM   6162  C  CA    . GLY A 1 963  ? 36.521  30.895  -43.773 1.00 69.52  ? 991  GLY A CA    1 
ATOM   6163  C  C     . GLY A 1 963  ? 37.867  30.209  -43.893 1.00 72.77  ? 991  GLY A C     1 
ATOM   6164  O  O     . GLY A 1 963  ? 38.560  30.363  -44.900 1.00 77.83  ? 991  GLY A O     1 
ATOM   6165  N  N     . LEU A 1 964  ? 38.233  29.446  -42.868 1.00 75.49  ? 992  LEU A N     1 
ATOM   6166  C  CA    . LEU A 1 964  ? 39.517  28.751  -42.837 1.00 76.03  ? 992  LEU A CA    1 
ATOM   6167  C  C     . LEU A 1 964  ? 39.651  27.790  -44.015 1.00 77.77  ? 992  LEU A C     1 
ATOM   6168  O  O     . LEU A 1 964  ? 40.604  27.874  -44.790 1.00 73.72  ? 992  LEU A O     1 
ATOM   6169  C  CB    . LEU A 1 964  ? 39.680  27.995  -41.515 1.00 55.65  ? 992  LEU A CB    1 
ATOM   6170  C  CG    . LEU A 1 964  ? 41.072  27.876  -40.888 1.00 56.49  ? 992  LEU A CG    1 
ATOM   6171  C  CD1   . LEU A 1 964  ? 40.970  27.206  -39.525 1.00 55.91  ? 992  LEU A CD1   1 
ATOM   6172  C  CD2   . LEU A 1 964  ? 42.039  27.115  -41.784 1.00 43.86  ? 992  LEU A CD2   1 
ATOM   6173  N  N     . LEU A 1 997  ? 45.053  16.880  -37.527 1.00 81.71  ? 1025 LEU A N     1 
ATOM   6174  C  CA    . LEU A 1 997  ? 44.263  15.655  -37.526 1.00 90.59  ? 1025 LEU A CA    1 
ATOM   6175  C  C     . LEU A 1 997  ? 42.874  15.922  -38.102 1.00 85.56  ? 1025 LEU A C     1 
ATOM   6176  O  O     . LEU A 1 997  ? 42.720  16.107  -39.310 1.00 87.69  ? 1025 LEU A O     1 
ATOM   6177  C  CB    . LEU A 1 997  ? 44.158  15.087  -36.109 1.00 91.77  ? 1025 LEU A CB    1 
ATOM   6178  C  CG    . LEU A 1 997  ? 43.896  13.585  -35.972 1.00 91.02  ? 1025 LEU A CG    1 
ATOM   6179  C  CD1   . LEU A 1 997  ? 45.050  12.783  -36.557 1.00 87.35  ? 1025 LEU A CD1   1 
ATOM   6180  C  CD2   . LEU A 1 997  ? 43.663  13.214  -34.516 1.00 92.14  ? 1025 LEU A CD2   1 
ATOM   6181  N  N     . ARG A 1 998  ? 41.868  15.942  -37.234 1.00 87.27  ? 1026 ARG A N     1 
ATOM   6182  C  CA    . ARG A 1 998  ? 40.507  16.269  -37.647 1.00 90.13  ? 1026 ARG A CA    1 
ATOM   6183  C  C     . ARG A 1 998  ? 40.287  17.779  -37.608 1.00 93.39  ? 1026 ARG A C     1 
ATOM   6184  O  O     . ARG A 1 998  ? 40.739  18.456  -36.684 1.00 85.90  ? 1026 ARG A O     1 
ATOM   6185  C  CB    . ARG A 1 998  ? 39.489  15.547  -36.759 1.00 85.33  ? 1026 ARG A CB    1 
ATOM   6186  C  CG    . ARG A 1 998  ? 40.004  15.204  -35.367 1.00 81.30  ? 1026 ARG A CG    1 
ATOM   6187  C  CD    . ARG A 1 998  ? 39.990  16.409  -34.440 1.00 81.31  ? 1026 ARG A CD    1 
ATOM   6188  N  NE    . ARG A 1 998  ? 41.079  16.361  -33.469 1.00 90.73  ? 1026 ARG A NE    1 
ATOM   6189  C  CZ    . ARG A 1 998  ? 42.258  16.950  -33.644 1.00 93.04  ? 1026 ARG A CZ    1 
ATOM   6190  N  NH1   . ARG A 1 998  ? 42.499  17.637  -34.753 1.00 84.53  ? 1026 ARG A NH1   1 
ATOM   6191  N  NH2   . ARG A 1 998  ? 43.195  16.855  -32.711 1.00 86.19  ? 1026 ARG A NH2   1 
ATOM   6192  N  N     . LYS A 1 999  ? 39.595  18.303  -38.616 1.00 92.38  ? 1027 LYS A N     1 
ATOM   6193  C  CA    . LYS A 1 999  ? 39.408  19.745  -38.748 1.00 69.98  ? 1027 LYS A CA    1 
ATOM   6194  C  C     . LYS A 1 999  ? 38.354  20.098  -39.795 1.00 84.90  ? 1027 LYS A C     1 
ATOM   6195  O  O     . LYS A 1 999  ? 37.791  19.218  -40.447 1.00 74.61  ? 1027 LYS A O     1 
ATOM   6196  C  CB    . LYS A 1 999  ? 40.734  20.426  -39.112 1.00 71.04  ? 1027 LYS A CB    1 
ATOM   6197  C  CG    . LYS A 1 999  ? 41.149  20.301  -40.581 1.00 77.22  ? 1027 LYS A CG    1 
ATOM   6198  C  CD    . LYS A 1 999  ? 41.699  18.920  -40.933 1.00 77.25  ? 1027 LYS A CD    1 
ATOM   6199  C  CE    . LYS A 1 999  ? 40.668  18.063  -41.661 1.00 74.17  ? 1027 LYS A CE    1 
ATOM   6200  N  NZ    . LYS A 1 999  ? 40.214  18.681  -42.938 1.00 69.23  ? 1027 LYS A NZ    1 
ATOM   6201  N  N     . VAL A 1 1000 ? 38.093  21.394  -39.942 1.00 92.36  ? 1028 VAL A N     1 
ATOM   6202  C  CA    . VAL A 1 1000 ? 37.223  21.891  -41.001 1.00 85.49  ? 1028 VAL A CA    1 
ATOM   6203  C  C     . VAL A 1 1000 ? 37.894  21.657  -42.350 1.00 87.40  ? 1028 VAL A C     1 
ATOM   6204  O  O     . VAL A 1 1000 ? 39.081  21.939  -42.518 1.00 92.97  ? 1028 VAL A O     1 
ATOM   6205  C  CB    . VAL A 1 1000 ? 36.906  23.389  -40.823 1.00 68.81  ? 1028 VAL A CB    1 
ATOM   6206  C  CG1   . VAL A 1 1000 ? 35.999  23.882  -41.942 1.00 77.70  ? 1028 VAL A CG1   1 
ATOM   6207  C  CG2   . VAL A 1 1000 ? 36.266  23.637  -39.466 1.00 73.43  ? 1028 VAL A CG2   1 
ATOM   6208  N  N     . GLN A 1 1001 ? 37.130  21.147  -43.310 1.00 93.44  ? 1029 GLN A N     1 
ATOM   6209  C  CA    . GLN A 1 1001 ? 37.688  20.696  -44.581 1.00 70.35  ? 1029 GLN A CA    1 
ATOM   6210  C  C     . GLN A 1 1001 ? 38.133  21.838  -45.496 1.00 72.63  ? 1029 GLN A C     1 
ATOM   6211  O  O     . GLN A 1 1001 ? 37.689  21.929  -46.641 1.00 74.21  ? 1029 GLN A O     1 
ATOM   6212  C  CB    . GLN A 1 1001 ? 36.666  19.822  -45.313 1.00 76.65  ? 1029 GLN A CB    1 
ATOM   6213  C  CG    . GLN A 1 1001 ? 35.828  18.947  -44.391 1.00 74.24  ? 1029 GLN A CG    1 
ATOM   6214  C  CD    . GLN A 1 1001 ? 36.669  18.053  -43.500 1.00 73.34  ? 1029 GLN A CD    1 
ATOM   6215  O  OE1   . GLN A 1 1001 ? 37.714  17.548  -43.913 1.00 69.78  ? 1029 GLN A OE1   1 
ATOM   6216  N  NE2   . GLN A 1 1001 ? 36.218  17.856  -42.266 1.00 72.40  ? 1029 GLN A NE2   1 
ATOM   6217  N  N     . ARG A 1 1002 ? 39.016  22.696  -44.990 1.00 92.23  ? 1030 ARG A N     1 
ATOM   6218  C  CA    . ARG A 1 1002 ? 39.595  23.777  -45.785 1.00 92.65  ? 1030 ARG A CA    1 
ATOM   6219  C  C     . ARG A 1 1002 ? 40.824  24.366  -45.096 1.00 93.14  ? 1030 ARG A C     1 
ATOM   6220  O  O     . ARG A 1 1002 ? 40.728  24.912  -43.997 1.00 90.33  ? 1030 ARG A O     1 
ATOM   6221  C  CB    . ARG A 1 1002 ? 38.563  24.878  -46.045 1.00 69.30  ? 1030 ARG A CB    1 
ATOM   6222  C  CG    . ARG A 1 1002 ? 39.056  25.969  -46.983 1.00 76.27  ? 1030 ARG A CG    1 
ATOM   6223  C  CD    . ARG A 1 1002 ? 37.955  26.963  -47.319 1.00 77.74  ? 1030 ARG A CD    1 
ATOM   6224  N  NE    . ARG A 1 1002 ? 38.423  27.992  -48.243 1.00 81.75  ? 1030 ARG A NE    1 
ATOM   6225  C  CZ    . ARG A 1 1002 ? 38.426  27.863  -49.566 1.00 90.93  ? 1030 ARG A CZ    1 
ATOM   6226  N  NH1   . ARG A 1 1002 ? 37.984  26.744  -50.126 1.00 86.38  ? 1030 ARG A NH1   1 
ATOM   6227  N  NH2   . ARG A 1 1002 ? 38.871  28.851  -50.331 1.00 90.74  ? 1030 ARG A NH2   1 
ATOM   6228  N  N     . GLU A 1 1003 ? 41.980  24.247  -45.744 1.00 90.65  ? 1031 GLU A N     1 
ATOM   6229  C  CA    . GLU A 1 1003 ? 43.228  24.765  -45.191 1.00 84.97  ? 1031 GLU A CA    1 
ATOM   6230  C  C     . GLU A 1 1003 ? 44.011  25.540  -46.246 1.00 92.61  ? 1031 GLU A C     1 
ATOM   6231  O  O     . GLU A 1 1003 ? 43.460  25.939  -47.272 1.00 85.26  ? 1031 GLU A O     1 
ATOM   6232  C  CB    . GLU A 1 1003 ? 44.095  23.630  -44.634 1.00 86.34  ? 1031 GLU A CB    1 
ATOM   6233  C  CG    . GLU A 1 1003 ? 43.396  22.720  -43.633 1.00 84.72  ? 1031 GLU A CG    1 
ATOM   6234  C  CD    . GLU A 1 1003 ? 42.563  21.646  -44.305 1.00 81.53  ? 1031 GLU A CD    1 
ATOM   6235  O  OE1   . GLU A 1 1003 ? 42.797  21.373  -45.501 1.00 91.29  ? 1031 GLU A OE1   1 
ATOM   6236  O  OE2   . GLU A 1 1003 ? 41.671  21.078  -43.640 1.00 90.85  ? 1031 GLU A OE2   1 
ATOM   6237  N  N     . THR A 1 1004 ? 45.299  25.749  -45.988 1.00 85.00  ? 1032 THR A N     1 
ATOM   6238  C  CA    . THR A 1 1004 ? 46.171  26.413  -46.951 1.00 92.70  ? 1032 THR A CA    1 
ATOM   6239  C  C     . THR A 1 1004 ? 46.533  25.457  -48.080 1.00 71.22  ? 1032 THR A C     1 
ATOM   6240  O  O     . THR A 1 1004 ? 46.837  25.883  -49.195 1.00 75.23  ? 1032 THR A O     1 
ATOM   6241  C  CB    . THR A 1 1004 ? 47.461  26.942  -46.293 1.00 90.18  ? 1032 THR A CB    1 
ATOM   6242  O  OG1   . THR A 1 1004 ? 48.329  27.474  -47.301 1.00 69.47  ? 1032 THR A OG1   1 
ATOM   6243  C  CG2   . THR A 1 1004 ? 48.182  25.829  -45.551 1.00 92.25  ? 1032 THR A CG2   1 
ATOM   6244  N  N     . ALA A 1 1005 ? 46.501  24.163  -47.781 1.00 90.58  ? 1033 ALA A N     1 
ATOM   6245  C  CA    . ALA A 1 1005 ? 46.739  23.141  -48.790 1.00 90.89  ? 1033 ALA A CA    1 
ATOM   6246  C  C     . ALA A 1 1005 ? 45.566  23.101  -49.759 1.00 69.26  ? 1033 ALA A C     1 
ATOM   6247  O  O     . ALA A 1 1005 ? 44.430  23.388  -49.381 1.00 69.08  ? 1033 ALA A O     1 
ATOM   6248  C  CB    . ALA A 1 1005 ? 46.948  21.783  -48.142 1.00 85.76  ? 1033 ALA A CB    1 
ATOM   6249  N  N     . ARG A 1 1006 ? 45.847  22.748  -51.008 1.00 71.31  ? 1034 ARG A N     1 
ATOM   6250  C  CA    . ARG A 1 1006 ? 44.817  22.715  -52.039 1.00 73.06  ? 1034 ARG A CA    1 
ATOM   6251  C  C     . ARG A 1 1006 ? 43.787  21.630  -51.740 1.00 77.58  ? 1034 ARG A C     1 
ATOM   6252  O  O     . ARG A 1 1006 ? 42.626  21.738  -52.132 1.00 71.82  ? 1034 ARG A O     1 
ATOM   6253  C  CB    . ARG A 1 1006 ? 45.448  22.497  -53.414 1.00 71.01  ? 1034 ARG A CB    1 
ATOM   6254  C  CG    . ARG A 1 1006 ? 46.616  23.430  -53.705 1.00 93.04  ? 1034 ARG A CG    1 
ATOM   6255  C  CD    . ARG A 1 1006 ? 46.228  24.889  -53.511 1.00 92.58  ? 1034 ARG A CD    1 
ATOM   6256  N  NE    . ARG A 1 1006 ? 47.375  25.785  -53.638 1.00 90.17  ? 1034 ARG A NE    1 
ATOM   6257  C  CZ    . ARG A 1 1006 ? 48.139  26.171  -52.621 1.00 87.09  ? 1034 ARG A CZ    1 
ATOM   6258  N  NH1   . ARG A 1 1006 ? 49.162  26.988  -52.829 1.00 87.56  ? 1034 ARG A NH1   1 
ATOM   6259  N  NH2   . ARG A 1 1006 ? 47.881  25.739  -51.393 1.00 86.58  ? 1034 ARG A NH2   1 
ATOM   6260  N  N     . LYS A 1 1007 ? 44.222  20.587  -51.040 1.00 75.48  ? 1035 LYS A N     1 
ATOM   6261  C  CA    . LYS A 1 1007 ? 43.325  19.530  -50.588 1.00 92.99  ? 1035 LYS A CA    1 
ATOM   6262  C  C     . LYS A 1 1007 ? 43.682  19.092  -49.171 1.00 91.25  ? 1035 LYS A C     1 
ATOM   6263  O  O     . LYS A 1 1007 ? 44.843  19.161  -48.765 1.00 85.41  ? 1035 LYS A O     1 
ATOM   6264  C  CB    . LYS A 1 1007 ? 43.366  18.336  -51.544 1.00 86.15  ? 1035 LYS A CB    1 
ATOM   6265  C  CG    . LYS A 1 1007 ? 42.576  18.552  -52.824 1.00 90.65  ? 1035 LYS A CG    1 
ATOM   6266  C  CD    . LYS A 1 1007 ? 41.105  18.792  -52.519 1.00 85.70  ? 1035 LYS A CD    1 
ATOM   6267  C  CE    . LYS A 1 1007 ? 40.347  19.255  -53.753 1.00 91.51  ? 1035 LYS A CE    1 
ATOM   6268  N  NZ    . LYS A 1 1007 ? 40.814  20.589  -54.224 1.00 90.55  ? 1035 LYS A NZ    1 
ATOM   6269  N  N     . SER A 1 1008 ? 42.679  18.642  -48.424 1.00 85.78  ? 1036 SER A N     1 
ATOM   6270  C  CA    . SER A 1 1008 ? 42.858  18.299  -47.017 1.00 68.05  ? 1036 SER A CA    1 
ATOM   6271  C  C     . SER A 1 1008 ? 43.429  16.897  -46.819 1.00 90.08  ? 1036 SER A C     1 
ATOM   6272  O  O     . SER A 1 1008 ? 44.190  16.658  -45.881 1.00 70.37  ? 1036 SER A O     1 
ATOM   6273  C  CB    . SER A 1 1008 ? 41.527  18.423  -46.271 1.00 77.77  ? 1036 SER A CB    1 
ATOM   6274  O  OG    . SER A 1 1008 ? 40.544  17.572  -46.833 1.00 77.66  ? 1036 SER A OG    1 
ATOM   6275  N  N     . GLN A 1 1009 ? 43.057  15.974  -47.701 1.00 86.01  ? 1037 GLN A N     1 
ATOM   6276  C  CA    . GLN A 1 1009 ? 43.467  14.579  -47.570 1.00 93.50  ? 1037 GLN A CA    1 
ATOM   6277  C  C     . GLN A 1 1009 ? 44.969  14.382  -47.755 1.00 69.99  ? 1037 GLN A C     1 
ATOM   6278  O  O     . GLN A 1 1009 ? 45.549  14.823  -48.748 1.00 73.55  ? 1037 GLN A O     1 
ATOM   6279  C  CB    . GLN A 1 1009 ? 42.707  13.705  -48.570 1.00 73.68  ? 1037 GLN A CB    1 
ATOM   6280  C  CG    . GLN A 1 1009 ? 41.305  13.327  -48.123 1.00 92.33  ? 1037 GLN A CG    1 
ATOM   6281  C  CD    . GLN A 1 1009 ? 41.305  12.406  -46.916 1.00 87.93  ? 1037 GLN A CD    1 
ATOM   6282  O  OE1   . GLN A 1 1009 ? 42.298  11.735  -46.631 1.00 91.04  ? 1037 GLN A OE1   1 
ATOM   6283  N  NE2   . GLN A 1 1009 ? 40.188  12.371  -46.199 1.00 92.90  ? 1037 GLN A NE2   1 
ATOM   6284  N  N     . TRP A 1 1010 ? 45.586  13.713  -46.786 1.00 76.95  ? 1038 TRP A N     1 
ATOM   6285  C  CA    . TRP A 1 1010 ? 47.007  13.391  -46.839 1.00 71.47  ? 1038 TRP A CA    1 
ATOM   6286  C  C     . TRP A 1 1010 ? 47.318  12.245  -45.880 1.00 71.43  ? 1038 TRP A C     1 
ATOM   6287  O  O     . TRP A 1 1010 ? 46.471  11.852  -45.078 1.00 75.57  ? 1038 TRP A O     1 
ATOM   6288  C  CB    . TRP A 1 1010 ? 47.856  14.616  -46.494 1.00 70.26  ? 1038 TRP A CB    1 
ATOM   6289  C  CG    . TRP A 1 1010 ? 49.012  14.831  -47.425 1.00 68.56  ? 1038 TRP A CG    1 
ATOM   6290  C  CD1   . TRP A 1 1010 ? 50.173  14.114  -47.472 1.00 77.46  ? 1038 TRP A CD1   1 
ATOM   6291  C  CD2   . TRP A 1 1010 ? 49.121  15.836  -48.440 1.00 68.12  ? 1038 TRP A CD2   1 
ATOM   6292  N  NE1   . TRP A 1 1010 ? 50.996  14.609  -48.456 1.00 69.46  ? 1038 TRP A NE1   1 
ATOM   6293  C  CE2   . TRP A 1 1010 ? 50.373  15.667  -49.065 1.00 69.84  ? 1038 TRP A CE2   1 
ATOM   6294  C  CE3   . TRP A 1 1010 ? 48.280  16.862  -48.883 1.00 75.89  ? 1038 TRP A CE3   1 
ATOM   6295  C  CZ2   . TRP A 1 1010 ? 50.804  16.484  -50.107 1.00 90.86  ? 1038 TRP A CZ2   1 
ATOM   6296  C  CZ3   . TRP A 1 1010 ? 48.710  17.673  -49.918 1.00 76.85  ? 1038 TRP A CZ3   1 
ATOM   6297  C  CH2   . TRP A 1 1010 ? 49.960  17.479  -50.519 1.00 81.13  ? 1038 TRP A CH2   1 
ATOM   6298  N  N     . LYS A 1 1011 ? 48.533  11.713  -45.962 1.00 72.58  ? 1039 LYS A N     1 
ATOM   6299  C  CA    . LYS A 1 1011 ? 48.940  10.612  -45.096 1.00 90.58  ? 1039 LYS A CA    1 
ATOM   6300  C  C     . LYS A 1 1011 ? 50.223  10.932  -44.334 1.00 87.44  ? 1039 LYS A C     1 
ATOM   6301  O  O     . LYS A 1 1011 ? 51.290  11.087  -44.932 1.00 92.31  ? 1039 LYS A O     1 
ATOM   6302  C  CB    . LYS A 1 1011 ? 49.118  9.328   -45.912 1.00 81.55  ? 1039 LYS A CB    1 
ATOM   6303  C  CG    . LYS A 1 1011 ? 49.863  9.515   -47.224 1.00 69.76  ? 1039 LYS A CG    1 
ATOM   6304  C  CD    . LYS A 1 1011 ? 50.271  8.179   -47.821 1.00 72.75  ? 1039 LYS A CD    1 
ATOM   6305  C  CE    . LYS A 1 1011 ? 51.234  7.440   -46.905 1.00 76.84  ? 1039 LYS A CE    1 
ATOM   6306  N  NZ    . LYS A 1 1011 ? 51.683  6.147   -47.493 1.00 74.53  ? 1039 LYS A NZ    1 
ATOM   6307  N  N     . LYS A 1 1012 ? 50.102  11.028  -43.012 1.00 91.70  ? 1040 LYS A N     1 
ATOM   6308  C  CA    . LYS A 1 1012 ? 51.232  11.299  -42.124 1.00 93.87  ? 1040 LYS A CA    1 
ATOM   6309  C  C     . LYS A 1 1012 ? 52.001  12.548  -42.553 1.00 87.67  ? 1040 LYS A C     1 
ATOM   6310  O  O     . LYS A 1 1012 ? 53.223  12.517  -42.697 1.00 92.03  ? 1040 LYS A O     1 
ATOM   6311  C  CB    . LYS A 1 1012 ? 52.172  10.091  -42.072 1.00 92.57  ? 1040 LYS A CB    1 
ATOM   6312  C  CG    . LYS A 1 1012 ? 51.463  8.759   -41.860 1.00 93.46  ? 1040 LYS A CG    1 
ATOM   6313  C  CD    . LYS A 1 1012 ? 50.651  8.750   -40.574 1.00 91.75  ? 1040 LYS A CD    1 
ATOM   6314  C  CE    . LYS A 1 1012 ? 49.871  7.453   -40.424 1.00 90.11  ? 1040 LYS A CE    1 
ATOM   6315  N  NZ    . LYS A 1 1012 ? 50.759  6.258   -40.479 1.00 71.69  ? 1040 LYS A NZ    1 
ATOM   6316  N  N     . TRP A 1 1013 ? 51.273  13.643  -42.753 1.00 72.19  ? 1041 TRP A N     1 
ATOM   6317  C  CA    . TRP A 1 1013 ? 51.863  14.883  -43.247 1.00 77.44  ? 1041 TRP A CA    1 
ATOM   6318  C  C     . TRP A 1 1013 ? 51.993  15.927  -42.139 1.00 90.37  ? 1041 TRP A C     1 
ATOM   6319  O  O     . TRP A 1 1013 ? 51.001  16.504  -41.693 1.00 87.54  ? 1041 TRP A O     1 
ATOM   6320  C  CB    . TRP A 1 1013 ? 51.029  15.433  -44.408 1.00 92.34  ? 1041 TRP A CB    1 
ATOM   6321  C  CG    . TRP A 1 1013 ? 51.594  16.663  -45.062 1.00 87.52  ? 1041 TRP A CG    1 
ATOM   6322  C  CD1   . TRP A 1 1013 ? 50.960  17.858  -45.238 1.00 87.61  ? 1041 TRP A CD1   1 
ATOM   6323  C  CD2   . TRP A 1 1013 ? 52.902  16.816  -45.630 1.00 81.40  ? 1041 TRP A CD2   1 
ATOM   6324  N  NE1   . TRP A 1 1013 ? 51.790  18.744  -45.881 1.00 81.83  ? 1041 TRP A NE1   1 
ATOM   6325  C  CE2   . TRP A 1 1013 ? 52.989  18.130  -46.130 1.00 84.23  ? 1041 TRP A CE2   1 
ATOM   6326  C  CE3   . TRP A 1 1013 ? 54.008  15.970  -45.763 1.00 87.52  ? 1041 TRP A CE3   1 
ATOM   6327  C  CZ2   . TRP A 1 1013 ? 54.136  18.619  -46.751 1.00 84.20  ? 1041 TRP A CZ2   1 
ATOM   6328  C  CZ3   . TRP A 1 1013 ? 55.146  16.457  -46.380 1.00 87.38  ? 1041 TRP A CZ3   1 
ATOM   6329  C  CH2   . TRP A 1 1013 ? 55.201  17.769  -46.867 1.00 86.10  ? 1041 TRP A CH2   1 
ATOM   6330  N  N     . GLU A 1 1014 ? 53.227  16.159  -41.703 1.00 40.53  ? 1042 GLU A N     1 
ATOM   6331  C  CA    . GLU A 1 1014 ? 53.510  17.103  -40.626 1.00 86.30  ? 1042 GLU A CA    1 
ATOM   6332  C  C     . GLU A 1 1014 ? 53.353  18.552  -41.072 1.00 90.67  ? 1042 GLU A C     1 
ATOM   6333  O  O     . GLU A 1 1014 ? 54.209  19.094  -41.771 1.00 87.44  ? 1042 GLU A O     1 
ATOM   6334  C  CB    . GLU A 1 1014 ? 54.924  16.883  -40.083 1.00 40.08  ? 1042 GLU A CB    1 
ATOM   6335  C  CG    . GLU A 1 1014 ? 55.098  15.604  -39.279 1.00 48.56  ? 1042 GLU A CG    1 
ATOM   6336  C  CD    . GLU A 1 1014 ? 54.463  15.687  -37.904 1.00 45.14  ? 1042 GLU A CD    1 
ATOM   6337  O  OE1   . GLU A 1 1014 ? 53.229  15.523  -37.802 1.00 48.35  ? 1042 GLU A OE1   1 
ATOM   6338  O  OE2   . GLU A 1 1014 ? 55.201  15.918  -36.923 1.00 41.55  ? 1042 GLU A OE2   1 
ATOM   6339  N  N     . VAL A 1 1015 ? 52.255  19.175  -40.660 1.00 81.79  ? 1043 VAL A N     1 
ATOM   6340  C  CA    . VAL A 1 1015 ? 52.013  20.579  -40.960 1.00 71.25  ? 1043 VAL A CA    1 
ATOM   6341  C  C     . VAL A 1 1015 ? 51.331  21.280  -39.793 1.00 68.10  ? 1043 VAL A C     1 
ATOM   6342  O  O     . VAL A 1 1015 ? 50.180  21.704  -39.895 1.00 71.89  ? 1043 VAL A O     1 
ATOM   6343  C  CB    . VAL A 1 1015 ? 51.153  20.751  -42.225 1.00 71.36  ? 1043 VAL A CB    1 
ATOM   6344  C  CG1   . VAL A 1 1015 ? 52.037  20.871  -43.456 1.00 66.73  ? 1043 VAL A CG1   1 
ATOM   6345  C  CG2   . VAL A 1 1015 ? 50.165  19.602  -42.358 1.00 77.66  ? 1043 VAL A CG2   1 
ATOM   6346  N  N     . VAL A 1 1016 ? 52.050  21.393  -38.683 1.00 68.27  ? 1044 VAL A N     1 
ATOM   6347  C  CA    . VAL A 1 1016 ? 51.544  22.098  -37.514 1.00 73.92  ? 1044 VAL A CA    1 
ATOM   6348  C  C     . VAL A 1 1016 ? 51.935  23.571  -37.610 1.00 85.06  ? 1044 VAL A C     1 
ATOM   6349  O  O     . VAL A 1 1016 ? 51.519  24.396  -36.796 1.00 93.49  ? 1044 VAL A O     1 
ATOM   6350  C  CB    . VAL A 1 1016 ? 52.086  21.483  -36.205 1.00 77.40  ? 1044 VAL A CB    1 
ATOM   6351  C  CG1   . VAL A 1 1016 ? 53.520  21.922  -35.964 1.00 56.07  ? 1044 VAL A CG1   1 
ATOM   6352  C  CG2   . VAL A 1 1016 ? 51.200  21.856  -35.022 1.00 72.05  ? 1044 VAL A CG2   1 
ATOM   6353  N  N     . ALA A 1 1017 ? 52.728  23.895  -38.626 1.00 87.68  ? 1045 ALA A N     1 
ATOM   6354  C  CA    . ALA A 1 1017 ? 53.222  25.254  -38.815 1.00 85.75  ? 1045 ALA A CA    1 
ATOM   6355  C  C     . ALA A 1 1017 ? 52.294  26.088  -39.695 1.00 84.66  ? 1045 ALA A C     1 
ATOM   6356  O  O     . ALA A 1 1017 ? 52.461  27.303  -39.804 1.00 92.97  ? 1045 ALA A O     1 
ATOM   6357  C  CB    . ALA A 1 1017 ? 54.623  25.225  -39.408 1.00 87.51  ? 1045 ALA A CB    1 
ATOM   6358  N  N     . GLU A 1 1018 ? 51.316  25.439  -40.320 1.00 84.28  ? 1046 GLU A N     1 
ATOM   6359  C  CA    . GLU A 1 1018 ? 50.397  26.137  -41.214 1.00 87.73  ? 1046 GLU A CA    1 
ATOM   6360  C  C     . GLU A 1 1018 ? 49.084  26.490  -40.523 1.00 92.59  ? 1046 GLU A C     1 
ATOM   6361  O  O     . GLU A 1 1018 ? 48.397  27.428  -40.926 1.00 81.03  ? 1046 GLU A O     1 
ATOM   6362  C  CB    . GLU A 1 1018 ? 50.122  25.295  -42.465 1.00 87.26  ? 1046 GLU A CB    1 
ATOM   6363  C  CG    . GLU A 1 1018 ? 49.500  23.931  -42.195 1.00 76.41  ? 1046 GLU A CG    1 
ATOM   6364  C  CD    . GLU A 1 1018 ? 47.984  23.969  -42.110 1.00 71.13  ? 1046 GLU A CD    1 
ATOM   6365  O  OE1   . GLU A 1 1018 ? 47.391  22.976  -41.638 1.00 72.99  ? 1046 GLU A OE1   1 
ATOM   6366  O  OE2   . GLU A 1 1018 ? 47.385  24.986  -42.518 1.00 71.04  ? 1046 GLU A OE2   1 
ATOM   6367  N  N     . ARG A 1 1019 ? 48.737  25.737  -39.483 1.00 91.72  ? 1047 ARG A N     1 
ATOM   6368  C  CA    . ARG A 1 1019 ? 47.483  25.950  -38.767 1.00 87.20  ? 1047 ARG A CA    1 
ATOM   6369  C  C     . ARG A 1 1019 ? 47.547  27.172  -37.853 1.00 91.59  ? 1047 ARG A C     1 
ATOM   6370  O  O     . ARG A 1 1019 ? 47.321  27.075  -36.647 1.00 87.75  ? 1047 ARG A O     1 
ATOM   6371  C  CB    . ARG A 1 1019 ? 47.111  24.699  -37.961 1.00 91.46  ? 1047 ARG A CB    1 
ATOM   6372  C  CG    . ARG A 1 1019 ? 48.288  23.996  -37.292 1.00 81.36  ? 1047 ARG A CG    1 
ATOM   6373  C  CD    . ARG A 1 1019 ? 48.295  24.217  -35.787 1.00 90.00  ? 1047 ARG A CD    1 
ATOM   6374  N  NE    . ARG A 1 1019 ? 47.036  23.812  -35.170 1.00 81.60  ? 1047 ARG A NE    1 
ATOM   6375  C  CZ    . ARG A 1 1019 ? 46.764  23.938  -33.875 1.00 81.31  ? 1047 ARG A CZ    1 
ATOM   6376  N  NH1   . ARG A 1 1019 ? 47.666  24.460  -33.054 1.00 81.67  ? 1047 ARG A NH1   1 
ATOM   6377  N  NH2   . ARG A 1 1019 ? 45.591  23.543  -33.399 1.00 86.22  ? 1047 ARG A NH2   1 
ATOM   6378  N  N     . ALA A 1 1020 ? 47.844  28.327  -38.440 1.00 85.24  ? 1048 ALA A N     1 
ATOM   6379  C  CA    . ALA A 1 1020 ? 47.972  29.563  -37.681 1.00 76.40  ? 1048 ALA A CA    1 
ATOM   6380  C  C     . ALA A 1 1020 ? 47.320  30.731  -38.411 1.00 85.74  ? 1048 ALA A C     1 
ATOM   6381  O  O     . ALA A 1 1020 ? 47.351  31.866  -37.934 1.00 71.91  ? 1048 ALA A O     1 
ATOM   6382  C  CB    . ALA A 1 1020 ? 49.436  29.862  -37.406 1.00 72.91  ? 1048 ALA A CB    1 
ATOM   6383  N  N     . TRP A 1 1021 ? 46.731  30.450  -39.569 1.00 76.29  ? 1049 TRP A N     1 
ATOM   6384  C  CA    . TRP A 1 1021 ? 46.063  31.485  -40.347 1.00 85.22  ? 1049 TRP A CA    1 
ATOM   6385  C  C     . TRP A 1 1021 ? 44.552  31.264  -40.364 1.00 90.02  ? 1049 TRP A C     1 
ATOM   6386  O  O     . TRP A 1 1021 ? 44.075  30.151  -40.587 1.00 77.96  ? 1049 TRP A O     1 
ATOM   6387  C  CB    . TRP A 1 1021 ? 46.619  31.530  -41.776 1.00 85.20  ? 1049 TRP A CB    1 
ATOM   6388  C  CG    . TRP A 1 1021 ? 46.137  30.423  -42.669 1.00 86.86  ? 1049 TRP A CG    1 
ATOM   6389  C  CD1   . TRP A 1 1021 ? 46.432  29.095  -42.564 1.00 84.23  ? 1049 TRP A CD1   1 
ATOM   6390  C  CD2   . TRP A 1 1021 ? 45.281  30.554  -43.811 1.00 91.72  ? 1049 TRP A CD2   1 
ATOM   6391  N  NE1   . TRP A 1 1021 ? 45.809  28.390  -43.565 1.00 93.77  ? 1049 TRP A NE1   1 
ATOM   6392  C  CE2   . TRP A 1 1021 ? 45.096  29.263  -44.345 1.00 85.74  ? 1049 TRP A CE2   1 
ATOM   6393  C  CE3   . TRP A 1 1021 ? 44.651  31.637  -44.432 1.00 93.92  ? 1049 TRP A CE3   1 
ATOM   6394  C  CZ2   . TRP A 1 1021 ? 44.308  29.027  -45.470 1.00 93.38  ? 1049 TRP A CZ2   1 
ATOM   6395  C  CZ3   . TRP A 1 1021 ? 43.870  31.400  -45.549 1.00 84.51  ? 1049 TRP A CZ3   1 
ATOM   6396  C  CH2   . TRP A 1 1021 ? 43.706  30.105  -46.056 1.00 87.65  ? 1049 TRP A CH2   1 
ATOM   6397  N  N     . LYS A 1 1022 ? 43.807  32.334  -40.104 1.00 86.17  ? 1050 LYS A N     1 
ATOM   6398  C  CA    . LYS A 1 1022 ? 42.350  32.293  -40.139 1.00 69.38  ? 1050 LYS A CA    1 
ATOM   6399  C  C     . LYS A 1 1022 ? 41.811  33.503  -40.890 1.00 76.51  ? 1050 LYS A C     1 
ATOM   6400  O  O     . LYS A 1 1022 ? 42.095  34.644  -40.523 1.00 73.61  ? 1050 LYS A O     1 
ATOM   6401  C  CB    . LYS A 1 1022 ? 41.769  32.255  -38.723 1.00 70.63  ? 1050 LYS A CB    1 
ATOM   6402  C  CG    . LYS A 1 1022 ? 40.247  32.283  -38.681 1.00 68.32  ? 1050 LYS A CG    1 
ATOM   6403  C  CD    . LYS A 1 1022 ? 39.724  32.633  -37.295 1.00 76.99  ? 1050 LYS A CD    1 
ATOM   6404  C  CE    . LYS A 1 1022 ? 38.203  32.702  -37.286 1.00 75.17  ? 1050 LYS A CE    1 
ATOM   6405  N  NZ    . LYS A 1 1022 ? 37.674  33.618  -38.338 1.00 69.06  ? 1050 LYS A NZ    1 
ATOM   6406  N  N     . GLY A 1 1023 ? 41.035  33.258  -41.940 1.00 67.21  ? 1051 GLY A N     1 
ATOM   6407  C  CA    . GLY A 1 1023 ? 40.469  34.346  -42.715 1.00 68.01  ? 1051 GLY A CA    1 
ATOM   6408  C  C     . GLY A 1 1023 ? 39.311  33.952  -43.610 1.00 70.03  ? 1051 GLY A C     1 
ATOM   6409  O  O     . GLY A 1 1023 ? 39.386  32.964  -44.339 1.00 69.90  ? 1051 GLY A O     1 
ATOM   6410  N  N     . GLY A 1 1024 ? 38.236  34.734  -43.560 1.00 70.13  ? 1052 GLY A N     1 
ATOM   6411  C  CA    . GLY A 1 1024 ? 37.094  34.522  -44.431 1.00 65.95  ? 1052 GLY A CA    1 
ATOM   6412  C  C     . GLY A 1 1024 ? 37.421  34.890  -45.865 1.00 74.78  ? 1052 GLY A C     1 
ATOM   6413  O  O     . GLY A 1 1024 ? 38.506  35.397  -46.150 1.00 75.98  ? 1052 GLY A O     1 
ATOM   6414  N  N     . THR A 1 1025 ? 36.482  34.639  -46.773 1.00 75.97  ? 1053 THR A N     1 
ATOM   6415  C  CA    . THR A 1 1025 ? 36.714  34.881  -48.193 1.00 76.41  ? 1053 THR A CA    1 
ATOM   6416  C  C     . THR A 1 1025 ? 35.621  35.734  -48.836 1.00 90.42  ? 1053 THR A C     1 
ATOM   6417  O  O     . THR A 1 1025 ? 34.662  36.142  -48.177 1.00 87.37  ? 1053 THR A O     1 
ATOM   6418  C  CB    . THR A 1 1025 ? 36.815  33.553  -48.976 1.00 72.51  ? 1053 THR A CB    1 
ATOM   6419  O  OG1   . THR A 1 1025 ? 35.551  32.879  -48.945 1.00 68.46  ? 1053 THR A OG1   1 
ATOM   6420  C  CG2   . THR A 1 1025 ? 37.883  32.650  -48.373 1.00 75.67  ? 1053 THR A CG2   1 
ATOM   6421  N  N     . GLU A 1 1026 ? 35.798  36.008  -50.126 1.00 86.20  ? 1054 GLU A N     1 
ATOM   6422  C  CA    . GLU A 1 1026 ? 34.777  36.632  -50.969 1.00 86.98  ? 1054 GLU A CA    1 
ATOM   6423  C  C     . GLU A 1 1026 ? 34.345  38.038  -50.545 1.00 90.78  ? 1054 GLU A C     1 
ATOM   6424  O  O     . GLU A 1 1026 ? 35.167  38.948  -50.440 1.00 90.92  ? 1054 GLU A O     1 
ATOM   6425  C  CB    . GLU A 1 1026 ? 33.544  35.726  -51.044 1.00 75.13  ? 1054 GLU A CB    1 
ATOM   6426  C  CG    . GLU A 1 1026 ? 33.294  35.152  -52.426 1.00 73.27  ? 1054 GLU A CG    1 
ATOM   6427  C  CD    . GLU A 1 1026 ? 33.155  36.232  -53.480 1.00 74.98  ? 1054 GLU A CD    1 
ATOM   6428  O  OE1   . GLU A 1 1026 ? 34.106  36.427  -54.266 1.00 68.80  ? 1054 GLU A OE1   1 
ATOM   6429  O  OE2   . GLU A 1 1026 ? 32.094  36.888  -53.520 1.00 70.21  ? 1054 GLU A OE2   1 
ATOM   6430  N  N     . SER A 1 1027 ? 33.046  38.194  -50.305 1.00 72.87  ? 1055 SER A N     1 
ATOM   6431  C  CA    . SER A 1 1027 ? 32.405  39.507  -50.212 1.00 72.79  ? 1055 SER A CA    1 
ATOM   6432  C  C     . SER A 1 1027 ? 32.925  40.429  -49.108 1.00 69.04  ? 1055 SER A C     1 
ATOM   6433  O  O     . SER A 1 1027 ? 33.344  41.553  -49.383 1.00 74.10  ? 1055 SER A O     1 
ATOM   6434  C  CB    . SER A 1 1027 ? 30.895  39.326  -50.031 1.00 76.77  ? 1055 SER A CB    1 
ATOM   6435  O  OG    . SER A 1 1027 ? 30.235  40.580  -49.993 1.00 76.65  ? 1055 SER A OG    1 
ATOM   6436  N  N     . GLU A 1 1028 ? 32.888  39.966  -47.865 1.00 77.04  ? 1056 GLU A N     1 
ATOM   6437  C  CA    . GLU A 1 1028 ? 33.170  40.844  -46.731 1.00 68.78  ? 1056 GLU A CA    1 
ATOM   6438  C  C     . GLU A 1 1028 ? 34.657  40.991  -46.415 1.00 76.43  ? 1056 GLU A C     1 
ATOM   6439  O  O     . GLU A 1 1028 ? 35.512  40.412  -47.085 1.00 77.15  ? 1056 GLU A O     1 
ATOM   6440  C  CB    . GLU A 1 1028 ? 32.426  40.348  -45.493 1.00 93.69  ? 1056 GLU A CB    1 
ATOM   6441  C  CG    . GLU A 1 1028 ? 30.924  40.306  -45.676 1.00 90.13  ? 1056 GLU A CG    1 
ATOM   6442  C  CD    . GLU A 1 1028 ? 30.380  41.578  -46.298 1.00 85.73  ? 1056 GLU A CD    1 
ATOM   6443  O  OE1   . GLU A 1 1028 ? 29.976  41.538  -47.480 1.00 73.45  ? 1056 GLU A OE1   1 
ATOM   6444  O  OE2   . GLU A 1 1028 ? 30.358  42.617  -45.606 1.00 81.69  ? 1056 GLU A OE2   1 
ATOM   6445  N  N     . MET A 1 1029 ? 34.947  41.779  -45.383 1.00 68.23  ? 1057 MET A N     1 
ATOM   6446  C  CA    . MET A 1 1029 ? 36.317  42.116  -45.014 1.00 70.70  ? 1057 MET A CA    1 
ATOM   6447  C  C     . MET A 1 1029 ? 36.551  41.927  -43.517 1.00 69.88  ? 1057 MET A C     1 
ATOM   6448  O  O     . MET A 1 1029 ? 37.298  42.684  -42.895 1.00 56.25  ? 1057 MET A O     1 
ATOM   6449  C  CB    . MET A 1 1029 ? 36.633  43.559  -45.417 1.00 71.31  ? 1057 MET A CB    1 
ATOM   6450  C  CG    . MET A 1 1029 ? 35.781  44.598  -44.698 1.00 74.33  ? 1057 MET A CG    1 
ATOM   6451  S  SD    . MET A 1 1029 ? 34.033  44.161  -44.704 1.00 42.41  ? 1057 MET A SD    1 
ATOM   6452  C  CE    . MET A 1 1029 ? 33.584  44.531  -43.010 1.00 81.51  ? 1057 MET A CE    1 
ATOM   6453  N  N     . PHE A 1 1030 ? 35.917  40.908  -42.941 1.00 71.14  ? 1058 PHE A N     1 
ATOM   6454  C  CA    . PHE A 1 1030 ? 36.075  40.618  -41.517 1.00 71.92  ? 1058 PHE A CA    1 
ATOM   6455  C  C     . PHE A 1 1030 ? 37.526  40.286  -41.174 1.00 71.11  ? 1058 PHE A C     1 
ATOM   6456  O  O     . PHE A 1 1030 ? 37.928  40.339  -40.012 1.00 71.83  ? 1058 PHE A O     1 
ATOM   6457  C  CB    . PHE A 1 1030 ? 35.168  39.460  -41.093 1.00 72.31  ? 1058 PHE A CB    1 
ATOM   6458  C  CG    . PHE A 1 1030 ? 33.706  39.713  -41.329 1.00 74.50  ? 1058 PHE A CG    1 
ATOM   6459  C  CD1   . PHE A 1 1030 ? 33.061  40.769  -40.708 1.00 71.21  ? 1058 PHE A CD1   1 
ATOM   6460  C  CD2   . PHE A 1 1030 ? 32.971  38.879  -42.156 1.00 74.04  ? 1058 PHE A CD2   1 
ATOM   6461  C  CE1   . PHE A 1 1030 ? 31.715  40.997  -40.921 1.00 68.52  ? 1058 PHE A CE1   1 
ATOM   6462  C  CE2   . PHE A 1 1030 ? 31.625  39.101  -42.368 1.00 64.02  ? 1058 PHE A CE2   1 
ATOM   6463  C  CZ    . PHE A 1 1030 ? 30.997  40.162  -41.752 1.00 66.92  ? 1058 PHE A CZ    1 
ATOM   6464  N  N     . ASN A 1 1031 ? 38.302  39.947  -42.200 1.00 69.10  ? 1059 ASN A N     1 
ATOM   6465  C  CA    . ASN A 1 1031 ? 39.707  39.594  -42.045 1.00 56.74  ? 1059 ASN A CA    1 
ATOM   6466  C  C     . ASN A 1 1031 ? 40.544  40.744  -41.498 1.00 56.21  ? 1059 ASN A C     1 
ATOM   6467  O  O     . ASN A 1 1031 ? 41.521  40.525  -40.784 1.00 74.98  ? 1059 ASN A O     1 
ATOM   6468  C  CB    . ASN A 1 1031 ? 40.279  39.138  -43.386 1.00 43.52  ? 1059 ASN A CB    1 
ATOM   6469  C  CG    . ASN A 1 1031 ? 39.331  38.234  -44.142 1.00 67.69  ? 1059 ASN A CG    1 
ATOM   6470  O  OD1   . ASN A 1 1031 ? 39.330  37.020  -43.950 1.00 66.29  ? 1059 ASN A OD1   1 
ATOM   6471  N  ND2   . ASN A 1 1031 ? 38.513  38.822  -45.008 1.00 73.87  ? 1059 ASN A ND2   1 
ATOM   6472  N  N     . LYS A 1 1032 ? 40.157  41.967  -41.845 1.00 64.35  ? 1060 LYS A N     1 
ATOM   6473  C  CA    . LYS A 1 1032 ? 40.872  43.154  -41.392 1.00 66.08  ? 1060 LYS A CA    1 
ATOM   6474  C  C     . LYS A 1 1032 ? 40.521  43.472  -39.944 1.00 65.17  ? 1060 LYS A C     1 
ATOM   6475  O  O     . LYS A 1 1032 ? 41.384  43.855  -39.155 1.00 67.64  ? 1060 LYS A O     1 
ATOM   6476  C  CB    . LYS A 1 1032 ? 40.552  44.351  -42.291 1.00 66.42  ? 1060 LYS A CB    1 
ATOM   6477  C  CG    . LYS A 1 1032 ? 41.720  45.305  -42.500 1.00 70.36  ? 1060 LYS A CG    1 
ATOM   6478  C  CD    . LYS A 1 1032 ? 42.000  46.170  -41.281 1.00 74.63  ? 1060 LYS A CD    1 
ATOM   6479  C  CE    . LYS A 1 1032 ? 43.279  46.974  -41.466 1.00 73.23  ? 1060 LYS A CE    1 
ATOM   6480  N  NZ    . LYS A 1 1032 ? 43.221  47.852  -42.669 1.00 71.78  ? 1060 LYS A NZ    1 
ATOM   6481  N  N     . LEU A 1 1033 ? 39.249  43.315  -39.601 1.00 64.60  ? 1061 LEU A N     1 
ATOM   6482  C  CA    . LEU A 1 1033 ? 38.804  43.542  -38.234 1.00 68.73  ? 1061 LEU A CA    1 
ATOM   6483  C  C     . LEU A 1 1033 ? 39.450  42.509  -37.308 1.00 77.36  ? 1061 LEU A C     1 
ATOM   6484  O  O     . LEU A 1 1033 ? 39.888  42.834  -36.199 1.00 68.70  ? 1061 LEU A O     1 
ATOM   6485  C  CB    . LEU A 1 1033 ? 37.276  43.492  -38.160 1.00 67.28  ? 1061 LEU A CB    1 
ATOM   6486  C  CG    . LEU A 1 1033 ? 36.572  44.515  -39.062 1.00 73.37  ? 1061 LEU A CG    1 
ATOM   6487  C  CD1   . LEU A 1 1033 ? 35.067  44.295  -39.093 1.00 75.04  ? 1061 LEU A CD1   1 
ATOM   6488  C  CD2   . LEU A 1 1033 ? 36.896  45.938  -38.627 1.00 69.30  ? 1061 LEU A CD2   1 
ATOM   6489  N  N     . GLU A 1 1034 ? 39.536  41.269  -37.783 1.00 72.98  ? 1062 GLU A N     1 
ATOM   6490  C  CA    . GLU A 1 1034 ? 40.255  40.224  -37.062 1.00 69.56  ? 1062 GLU A CA    1 
ATOM   6491  C  C     . GLU A 1 1034 ? 41.754  40.514  -37.036 1.00 75.71  ? 1062 GLU A C     1 
ATOM   6492  O  O     . GLU A 1 1034 ? 42.454  40.116  -36.106 1.00 73.44  ? 1062 GLU A O     1 
ATOM   6493  C  CB    . GLU A 1 1034 ? 39.996  38.851  -37.687 1.00 74.47  ? 1062 GLU A CB    1 
ATOM   6494  C  CG    . GLU A 1 1034 ? 38.587  38.317  -37.468 1.00 84.21  ? 1062 GLU A CG    1 
ATOM   6495  C  CD    . GLU A 1 1034 ? 38.426  36.883  -37.940 1.00 71.60  ? 1062 GLU A CD    1 
ATOM   6496  O  OE1   . GLU A 1 1034 ? 39.408  36.314  -38.461 1.00 70.04  ? 1062 GLU A OE1   1 
ATOM   6497  O  OE2   . GLU A 1 1034 ? 37.319  36.323  -37.787 1.00 68.51  ? 1062 GLU A OE2   1 
ATOM   6498  N  N     . SER A 1 1035 ? 42.242  41.207  -38.061 1.00 71.43  ? 1063 SER A N     1 
ATOM   6499  C  CA    . SER A 1 1035 ? 43.654  41.567  -38.133 1.00 49.99  ? 1063 SER A CA    1 
ATOM   6500  C  C     . SER A 1 1035 ? 43.996  42.587  -37.055 1.00 67.81  ? 1063 SER A C     1 
ATOM   6501  O  O     . SER A 1 1035 ? 45.076  42.544  -36.466 1.00 64.54  ? 1063 SER A O     1 
ATOM   6502  C  CB    . SER A 1 1035 ? 44.010  42.115  -39.516 1.00 64.14  ? 1063 SER A CB    1 
ATOM   6503  O  OG    . SER A 1 1035 ? 45.359  42.543  -39.566 1.00 65.72  ? 1063 SER A OG    1 
ATOM   6504  N  N     . ILE A 1 1036 ? 43.069  43.506  -36.799 1.00 66.64  ? 1064 ILE A N     1 
ATOM   6505  C  CA    . ILE A 1 1036 ? 43.231  44.457  -35.707 1.00 66.49  ? 1064 ILE A CA    1 
ATOM   6506  C  C     . ILE A 1 1036 ? 42.934  43.757  -34.383 1.00 69.46  ? 1064 ILE A C     1 
ATOM   6507  O  O     . ILE A 1 1036 ? 43.324  44.229  -33.313 1.00 92.01  ? 1064 ILE A O     1 
ATOM   6508  C  CB    . ILE A 1 1036 ? 42.309  45.692  -35.867 1.00 55.72  ? 1064 ILE A CB    1 
ATOM   6509  C  CG1   . ILE A 1 1036 ? 42.320  46.200  -37.311 1.00 42.80  ? 1064 ILE A CG1   1 
ATOM   6510  C  CG2   . ILE A 1 1036 ? 42.737  46.804  -34.925 1.00 71.03  ? 1064 ILE A CG2   1 
ATOM   6511  C  CD1   . ILE A 1 1036 ? 43.665  46.717  -37.770 1.00 56.10  ? 1064 ILE A CD1   1 
ATOM   6512  N  N     . ALA A 1 1037 ? 42.243  42.623  -34.463 1.00 74.84  ? 1065 ALA A N     1 
ATOM   6513  C  CA    . ALA A 1 1037 ? 41.895  41.864  -33.267 1.00 72.25  ? 1065 ALA A CA    1 
ATOM   6514  C  C     . ALA A 1 1037 ? 42.953  40.815  -32.931 1.00 76.25  ? 1065 ALA A C     1 
ATOM   6515  O  O     . ALA A 1 1037 ? 42.811  40.074  -31.956 1.00 75.74  ? 1065 ALA A O     1 
ATOM   6516  C  CB    . ALA A 1 1037 ? 40.539  41.204  -33.435 1.00 71.83  ? 1065 ALA A CB    1 
ATOM   6517  N  N     . THR A 1 1038 ? 44.007  40.750  -33.738 1.00 75.40  ? 1066 THR A N     1 
ATOM   6518  C  CA    . THR A 1 1038 ? 45.055  39.756  -33.535 1.00 90.14  ? 1066 THR A CA    1 
ATOM   6519  C  C     . THR A 1 1038 ? 46.282  40.347  -32.863 1.00 73.79  ? 1066 THR A C     1 
ATOM   6520  O  O     . THR A 1 1038 ? 46.947  39.672  -32.079 1.00 71.30  ? 1066 THR A O     1 
ATOM   6521  C  CB    . THR A 1 1038 ? 45.502  39.098  -34.862 1.00 87.20  ? 1066 THR A CB    1 
ATOM   6522  O  OG1   . THR A 1 1038 ? 45.540  40.079  -35.908 1.00 84.75  ? 1066 THR A OG1   1 
ATOM   6523  C  CG2   . THR A 1 1038 ? 44.561  37.966  -35.253 1.00 81.97  ? 1066 THR A CG2   1 
ATOM   6524  N  N     . SER A 1 1039 ? 46.581  41.603  -33.180 1.00 71.02  ? 1067 SER A N     1 
ATOM   6525  C  CA    . SER A 1 1039 ? 47.766  42.268  -32.653 1.00 72.17  ? 1067 SER A CA    1 
ATOM   6526  C  C     . SER A 1 1039 ? 47.740  42.311  -31.130 1.00 76.65  ? 1067 SER A C     1 
ATOM   6527  O  O     . SER A 1 1039 ? 46.756  42.735  -30.532 1.00 72.56  ? 1067 SER A O     1 
ATOM   6528  C  CB    . SER A 1 1039 ? 47.880  43.685  -33.221 1.00 71.32  ? 1067 SER A CB    1 
ATOM   6529  O  OG    . SER A 1 1039 ? 47.934  43.661  -34.636 1.00 70.14  ? 1067 SER A OG    1 
ATOM   6530  N  N     . ASP A 1 1040 ? 48.826  41.860  -30.510 1.00 74.75  ? 1068 ASP A N     1 
ATOM   6531  C  CA    . ASP A 1 1040 ? 48.931  41.845  -29.055 1.00 86.81  ? 1068 ASP A CA    1 
ATOM   6532  C  C     . ASP A 1 1040 ? 49.319  43.217  -28.516 1.00 87.91  ? 1068 ASP A C     1 
ATOM   6533  O  O     . ASP A 1 1040 ? 49.509  43.397  -27.313 1.00 84.79  ? 1068 ASP A O     1 
ATOM   6534  C  CB    . ASP A 1 1040 ? 49.946  40.794  -28.603 1.00 92.99  ? 1068 ASP A CB    1 
ATOM   6535  C  CG    . ASP A 1 1040 ? 51.166  40.736  -29.503 1.00 91.58  ? 1068 ASP A CG    1 
ATOM   6536  O  OD1   . ASP A 1 1040 ? 52.014  39.840  -29.306 1.00 86.04  ? 1068 ASP A OD1   1 
ATOM   6537  O  OD2   . ASP A 1 1040 ? 51.273  41.580  -30.416 1.00 87.39  ? 1068 ASP A OD2   1 
ATOM   6538  N  N     . ILE A 1 1041 ? 49.418  44.182  -29.422 1.00 87.69  ? 1069 ILE A N     1 
ATOM   6539  C  CA    . ILE A 1 1041 ? 49.905  45.514  -29.097 1.00 81.99  ? 1069 ILE A CA    1 
ATOM   6540  C  C     . ILE A 1 1041 ? 48.964  46.568  -29.713 1.00 68.35  ? 1069 ILE A C     1 
ATOM   6541  O  O     . ILE A 1 1041 ? 48.329  46.291  -30.732 1.00 93.20  ? 1069 ILE A O     1 
ATOM   6542  C  CB    . ILE A 1 1041 ? 51.372  45.677  -29.582 1.00 85.33  ? 1069 ILE A CB    1 
ATOM   6543  C  CG1   . ILE A 1 1041 ? 51.672  44.729  -30.744 1.00 92.63  ? 1069 ILE A CG1   1 
ATOM   6544  C  CG2   . ILE A 1 1041 ? 52.337  45.423  -28.434 1.00 90.07  ? 1069 ILE A CG2   1 
ATOM   6545  C  CD1   . ILE A 1 1041 ? 53.136  44.688  -31.129 1.00 84.62  ? 1069 ILE A CD1   1 
ATOM   6546  N  N     . PRO A 1 1042 ? 48.886  47.777  -29.112 1.00 77.02  ? 1070 PRO A N     1 
ATOM   6547  C  CA    . PRO A 1 1042 ? 47.857  48.794  -29.337 1.00 93.59  ? 1070 PRO A CA    1 
ATOM   6548  C  C     . PRO A 1 1042 ? 46.533  48.399  -30.016 1.00 68.43  ? 1070 PRO A C     1 
ATOM   6549  O  O     . PRO A 1 1042 ? 45.492  48.578  -29.380 1.00 90.11  ? 1070 PRO A O     1 
ATOM   6550  C  CB    . PRO A 1 1042 ? 48.630  49.807  -30.185 1.00 81.56  ? 1070 PRO A CB    1 
ATOM   6551  C  CG    . PRO A 1 1042 ? 50.083  49.718  -29.593 1.00 69.21  ? 1070 PRO A CG    1 
ATOM   6552  C  CD    . PRO A 1 1042 ? 50.098  48.487  -28.675 1.00 71.30  ? 1070 PRO A CD    1 
ATOM   6553  N  N     . ARG A 1 1043 ? 46.562  47.898  -31.250 1.00 77.00  ? 1071 ARG A N     1 
ATOM   6554  C  CA    . ARG A 1 1043 ? 45.339  47.652  -32.029 1.00 75.69  ? 1071 ARG A CA    1 
ATOM   6555  C  C     . ARG A 1 1043 ? 44.519  48.934  -32.198 1.00 92.62  ? 1071 ARG A C     1 
ATOM   6556  O  O     . ARG A 1 1043 ? 43.334  48.961  -31.864 1.00 84.95  ? 1071 ARG A O     1 
ATOM   6557  C  CB    . ARG A 1 1043 ? 44.456  46.576  -31.377 1.00 75.16  ? 1071 ARG A CB    1 
ATOM   6558  C  CG    . ARG A 1 1043 ? 45.195  45.421  -30.722 1.00 66.59  ? 1071 ARG A CG    1 
ATOM   6559  C  CD    . ARG A 1 1043 ? 44.988  45.416  -29.210 1.00 47.14  ? 1071 ARG A CD    1 
ATOM   6560  N  NE    . ARG A 1 1043 ? 43.613  45.099  -28.830 1.00 66.33  ? 1071 ARG A NE    1 
ATOM   6561  C  CZ    . ARG A 1 1043 ? 43.083  45.382  -27.643 1.00 73.36  ? 1071 ARG A CZ    1 
ATOM   6562  N  NH1   . ARG A 1 1043 ? 43.810  46.000  -26.722 1.00 77.06  ? 1071 ARG A NH1   1 
ATOM   6563  N  NH2   . ARG A 1 1043 ? 41.824  45.057  -27.379 1.00 70.94  ? 1071 ARG A NH2   1 
ATOM   6564  N  N     . THR A 1 1044 ? 45.141  49.991  -32.714 1.00 93.44  ? 1072 THR A N     1 
ATOM   6565  C  CA    . THR A 1 1044 ? 44.500  51.309  -32.749 1.00 72.40  ? 1072 THR A CA    1 
ATOM   6566  C  C     . THR A 1 1044 ? 44.502  51.986  -34.114 1.00 73.33  ? 1072 THR A C     1 
ATOM   6567  O  O     . THR A 1 1044 ? 45.442  52.706  -34.448 1.00 84.18  ? 1072 THR A O     1 
ATOM   6568  C  CB    . THR A 1 1044 ? 45.178  52.282  -31.780 1.00 81.76  ? 1072 THR A CB    1 
ATOM   6569  O  OG1   . THR A 1 1044 ? 46.289  52.909  -32.432 1.00 43.03  ? 1072 THR A OG1   1 
ATOM   6570  C  CG2   . THR A 1 1044 ? 45.673  51.563  -30.572 1.00 90.25  ? 1072 THR A CG2   1 
ATOM   6571  N  N     . PRO A 1 1045 ? 43.452  51.764  -34.910 1.00 90.93  ? 1073 PRO A N     1 
ATOM   6572  C  CA    . PRO A 1 1045 ? 43.375  52.476  -36.185 1.00 71.90  ? 1073 PRO A CA    1 
ATOM   6573  C  C     . PRO A 1 1045 ? 42.114  53.330  -36.366 1.00 73.95  ? 1073 PRO A C     1 
ATOM   6574  O  O     . PRO A 1 1045 ? 41.034  52.809  -36.089 1.00 73.07  ? 1073 PRO A O     1 
ATOM   6575  C  CB    . PRO A 1 1045 ? 43.384  51.328  -37.198 1.00 71.71  ? 1073 PRO A CB    1 
ATOM   6576  C  CG    . PRO A 1 1045 ? 42.795  50.120  -36.422 1.00 77.76  ? 1073 PRO A CG    1 
ATOM   6577  C  CD    . PRO A 1 1045 ? 42.682  50.513  -34.960 1.00 77.49  ? 1073 PRO A CD    1 
ATOM   6578  N  N     . VAL A 1 1046 ? 42.197  54.592  -36.807 1.00 56.62  ? 1074 VAL A N     1 
ATOM   6579  C  CA    . VAL A 1 1046 ? 43.398  55.425  -36.965 1.00 64.29  ? 1074 VAL A CA    1 
ATOM   6580  C  C     . VAL A 1 1046 ? 42.908  56.872  -37.052 1.00 71.15  ? 1074 VAL A C     1 
ATOM   6581  O  O     . VAL A 1 1046 ? 42.409  57.265  -38.106 1.00 70.16  ? 1074 VAL A O     1 
ATOM   6582  C  CB    . VAL A 1 1046 ? 44.228  55.132  -38.255 1.00 76.43  ? 1074 VAL A CB    1 
ATOM   6583  C  CG1   . VAL A 1 1046 ? 45.584  54.505  -37.925 1.00 68.94  ? 1074 VAL A CG1   1 
ATOM   6584  C  CG2   . VAL A 1 1046 ? 43.438  54.295  -39.261 1.00 69.50  ? 1074 VAL A CG2   1 
ATOM   6585  N  N     . LEU A 1 1047 ? 43.008  57.678  -35.994 1.00 77.55  ? 1075 LEU A N     1 
ATOM   6586  C  CA    . LEU A 1 1047 ? 43.551  57.334  -34.682 1.00 73.82  ? 1075 LEU A CA    1 
ATOM   6587  C  C     . LEU A 1 1047 ? 42.659  56.348  -33.918 1.00 73.46  ? 1075 LEU A C     1 
ATOM   6588  O  O     . LEU A 1 1047 ? 41.458  56.270  -34.180 1.00 81.83  ? 1075 LEU A O     1 
ATOM   6589  C  CB    . LEU A 1 1047 ? 43.735  58.621  -33.858 1.00 60.87  ? 1075 LEU A CB    1 
ATOM   6590  C  CG    . LEU A 1 1047 ? 42.459  59.372  -33.448 1.00 68.61  ? 1075 LEU A CG    1 
ATOM   6591  C  CD1   . LEU A 1 1047 ? 42.670  60.144  -32.156 1.00 66.57  ? 1075 LEU A CD1   1 
ATOM   6592  C  CD2   . LEU A 1 1047 ? 41.969  60.312  -34.544 1.00 40.69  ? 1075 LEU A CD2   1 
ATOM   6593  N  N     . GLY A 1 1048 ? 43.238  55.591  -32.986 1.00 76.62  ? 1076 GLY A N     1 
ATOM   6594  C  CA    . GLY A 1 1048 ? 44.656  55.654  -32.676 1.00 73.22  ? 1076 GLY A CA    1 
ATOM   6595  C  C     . GLY A 1 1048 ? 44.917  55.595  -31.183 1.00 77.47  ? 1076 GLY A C     1 
ATOM   6596  O  O     . GLY A 1 1048 ? 45.997  55.954  -30.715 1.00 71.63  ? 1076 GLY A O     1 
ATOM   6597  N  N     . CYS A 1 1049 ? 43.921  55.127  -30.436 1.00 72.19  ? 1077 CYS A N     1 
ATOM   6598  C  CA    . CYS A 1 1049 ? 44.020  55.025  -28.984 1.00 66.53  ? 1077 CYS A CA    1 
ATOM   6599  C  C     . CYS A 1 1049 ? 43.958  53.567  -28.536 1.00 72.15  ? 1077 CYS A C     1 
ATOM   6600  O  O     . CYS A 1 1049 ? 43.051  52.836  -28.930 1.00 49.84  ? 1077 CYS A O     1 
ATOM   6601  C  CB    . CYS A 1 1049 ? 42.898  55.824  -28.318 1.00 67.64  ? 1077 CYS A CB    1 
ATOM   6602  S  SG    . CYS A 1 1049 ? 42.681  57.501  -28.956 1.00 73.60  ? 1077 CYS A SG    1 
ATOM   6603  N  N     . CYS A 1 1050 ? 44.918  53.138  -27.720 1.00 69.66  ? 1078 CYS A N     1 
ATOM   6604  C  CA    . CYS A 1 1050 ? 44.918  51.760  -27.230 1.00 75.54  ? 1078 CYS A CA    1 
ATOM   6605  C  C     . CYS A 1 1050 ? 44.044  51.621  -25.989 1.00 73.29  ? 1078 CYS A C     1 
ATOM   6606  O  O     . CYS A 1 1050 ? 44.170  52.387  -25.032 1.00 68.62  ? 1078 CYS A O     1 
ATOM   6607  C  CB    . CYS A 1 1050 ? 46.346  51.277  -26.947 1.00 77.30  ? 1078 CYS A CB    1 
ATOM   6608  S  SG    . CYS A 1 1050 ? 47.265  52.197  -25.703 1.00 77.78  ? 1078 CYS A SG    1 
ATOM   6609  N  N     . ILE A 1 1051 ? 43.150  50.638  -26.017 1.00 49.31  ? 1079 ILE A N     1 
ATOM   6610  C  CA    . ILE A 1 1051 ? 42.176  50.457  -24.946 1.00 66.35  ? 1079 ILE A CA    1 
ATOM   6611  C  C     . ILE A 1 1051 ? 42.420  49.232  -24.084 1.00 56.17  ? 1079 ILE A C     1 
ATOM   6612  O  O     . ILE A 1 1051 ? 42.896  48.207  -24.569 1.00 68.59  ? 1079 ILE A O     1 
ATOM   6613  C  CB    . ILE A 1 1051 ? 40.740  50.343  -25.502 1.00 75.66  ? 1079 ILE A CB    1 
ATOM   6614  C  CG1   . ILE A 1 1051 ? 40.714  49.416  -26.725 1.00 68.88  ? 1079 ILE A CG1   1 
ATOM   6615  C  CG2   . ILE A 1 1051 ? 40.177  51.722  -25.818 1.00 69.45  ? 1079 ILE A CG2   1 
ATOM   6616  C  CD1   . ILE A 1 1051 ? 40.349  47.968  -26.433 1.00 73.70  ? 1079 ILE A CD1   1 
ATOM   6617  N  N     . SER A 1 1052 ? 42.072  49.362  -22.805 1.00 55.62  ? 1080 SER A N     1 
ATOM   6618  C  CA    . SER A 1 1052 ? 41.919  48.238  -21.881 1.00 68.77  ? 1080 SER A CA    1 
ATOM   6619  C  C     . SER A 1 1052 ? 43.143  47.337  -21.720 1.00 68.70  ? 1080 SER A C     1 
ATOM   6620  O  O     . SER A 1 1052 ? 43.495  46.576  -22.620 1.00 44.33  ? 1080 SER A O     1 
ATOM   6621  C  CB    . SER A 1 1052 ? 40.728  47.378  -22.317 1.00 76.89  ? 1080 SER A CB    1 
ATOM   6622  O  OG    . SER A 1 1052 ? 40.982  46.762  -23.567 1.00 73.34  ? 1080 SER A OG    1 
ATOM   6623  N  N     . ARG A 1 1053 ? 43.766  47.397  -20.548 1.00 56.50  ? 1081 ARG A N     1 
ATOM   6624  C  CA    . ARG A 1 1053 ? 44.773  46.409  -20.187 1.00 68.15  ? 1081 ARG A CA    1 
ATOM   6625  C  C     . ARG A 1 1053 ? 44.091  45.067  -19.913 1.00 76.13  ? 1081 ARG A C     1 
ATOM   6626  O  O     . ARG A 1 1053 ? 44.753  44.058  -19.663 1.00 70.84  ? 1081 ARG A O     1 
ATOM   6627  C  CB    . ARG A 1 1053 ? 45.581  46.863  -18.967 1.00 77.65  ? 1081 ARG A CB    1 
ATOM   6628  C  CG    . ARG A 1 1053 ? 46.756  47.777  -19.293 1.00 68.85  ? 1081 ARG A CG    1 
ATOM   6629  C  CD    . ARG A 1 1053 ? 46.514  49.209  -18.840 1.00 75.68  ? 1081 ARG A CD    1 
ATOM   6630  N  NE    . ARG A 1 1053 ? 47.553  49.661  -17.918 1.00 68.49  ? 1081 ARG A NE    1 
ATOM   6631  C  CZ    . ARG A 1 1053 ? 47.390  49.782  -16.604 1.00 73.85  ? 1081 ARG A CZ    1 
ATOM   6632  N  NH1   . ARG A 1 1053 ? 46.220  49.500  -16.050 1.00 74.91  ? 1081 ARG A NH1   1 
ATOM   6633  N  NH2   . ARG A 1 1053 ? 48.396  50.195  -15.846 1.00 69.79  ? 1081 ARG A NH2   1 
ATOM   6634  N  N     . ALA A 1 1054 ? 42.762  45.070  -19.980 1.00 56.56  ? 1082 ALA A N     1 
ATOM   6635  C  CA    . ALA A 1 1054 ? 41.947  43.900  -19.673 1.00 46.01  ? 1082 ALA A CA    1 
ATOM   6636  C  C     . ALA A 1 1054 ? 41.475  43.154  -20.922 1.00 43.41  ? 1082 ALA A C     1 
ATOM   6637  O  O     . ALA A 1 1054 ? 40.938  42.052  -20.823 1.00 45.48  ? 1082 ALA A O     1 
ATOM   6638  C  CB    . ALA A 1 1054 ? 40.751  44.312  -18.837 1.00 69.27  ? 1082 ALA A CB    1 
ATOM   6639  N  N     . LEU A 1 1055 ? 41.661  43.754  -22.094 1.00 91.74  ? 1083 LEU A N     1 
ATOM   6640  C  CA    . LEU A 1 1055 ? 41.261  43.106  -23.342 1.00 47.01  ? 1083 LEU A CA    1 
ATOM   6641  C  C     . LEU A 1 1055 ? 42.432  42.955  -24.301 1.00 55.66  ? 1083 LEU A C     1 
ATOM   6642  O  O     . LEU A 1 1055 ? 42.343  42.242  -25.304 1.00 68.27  ? 1083 LEU A O     1 
ATOM   6643  C  CB    . LEU A 1 1055 ? 40.145  43.888  -24.025 1.00 46.33  ? 1083 LEU A CB    1 
ATOM   6644  C  CG    . LEU A 1 1055 ? 38.867  44.125  -23.229 1.00 87.00  ? 1083 LEU A CG    1 
ATOM   6645  C  CD1   . LEU A 1 1055 ? 37.958  45.065  -23.997 1.00 70.96  ? 1083 LEU A CD1   1 
ATOM   6646  C  CD2   . LEU A 1 1055 ? 38.166  42.811  -22.941 1.00 93.62  ? 1083 LEU A CD2   1 
ATOM   6647  N  N     . GLU A 1 1056 ? 43.522  43.646  -23.994 1.00 68.83  ? 1084 GLU A N     1 
ATOM   6648  C  CA    . GLU A 1 1056 ? 44.746  43.516  -24.761 1.00 47.36  ? 1084 GLU A CA    1 
ATOM   6649  C  C     . GLU A 1 1056 ? 45.202  42.069  -24.719 1.00 91.86  ? 1084 GLU A C     1 
ATOM   6650  O  O     . GLU A 1 1056 ? 45.611  41.586  -23.669 1.00 56.98  ? 1084 GLU A O     1 
ATOM   6651  C  CB    . GLU A 1 1056 ? 45.823  44.442  -24.205 1.00 56.47  ? 1084 GLU A CB    1 
ATOM   6652  C  CG    . GLU A 1 1056 ? 46.895  44.817  -25.204 1.00 69.16  ? 1084 GLU A CG    1 
ATOM   6653  C  CD    . GLU A 1 1056 ? 47.808  45.902  -24.675 1.00 69.08  ? 1084 GLU A CD    1 
ATOM   6654  O  OE1   . GLU A 1 1056 ? 47.916  46.030  -23.438 1.00 73.80  ? 1084 GLU A OE1   1 
ATOM   6655  O  OE2   . GLU A 1 1056 ? 48.410  46.633  -25.491 1.00 74.71  ? 1084 GLU A OE2   1 
ATOM   6656  N  N     . PRO A 1 1057 ? 45.144  41.381  -25.870 1.00 42.40  ? 1085 PRO A N     1 
ATOM   6657  C  CA    . PRO A 1 1057 ? 45.409  39.943  -26.010 1.00 46.81  ? 1085 PRO A CA    1 
ATOM   6658  C  C     . PRO A 1 1057 ? 46.698  39.493  -25.332 1.00 44.04  ? 1085 PRO A C     1 
ATOM   6659  O  O     . PRO A 1 1057 ? 46.814  38.318  -24.990 1.00 49.57  ? 1085 PRO A O     1 
ATOM   6660  C  CB    . PRO A 1 1057 ? 45.498  39.745  -27.528 1.00 92.91  ? 1085 PRO A CB    1 
ATOM   6661  C  CG    . PRO A 1 1057 ? 45.690  41.110  -28.090 1.00 43.77  ? 1085 PRO A CG    1 
ATOM   6662  C  CD    . PRO A 1 1057 ? 44.953  42.024  -27.178 1.00 49.81  ? 1085 PRO A CD    1 
ATOM   6663  N  N     . SER A 1 1058 ? 47.652  40.399  -25.142 1.00 40.80  ? 1086 SER A N     1 
ATOM   6664  C  CA    . SER A 1 1058 ? 48.818  40.063  -24.341 1.00 49.49  ? 1086 SER A CA    1 
ATOM   6665  C  C     . SER A 1 1058 ? 48.359  39.833  -22.903 1.00 66.55  ? 1086 SER A C     1 
ATOM   6666  O  O     . SER A 1 1058 ? 47.864  40.751  -22.245 1.00 69.18  ? 1086 SER A O     1 
ATOM   6667  C  CB    . SER A 1 1058 ? 49.896  41.151  -24.424 1.00 56.46  ? 1086 SER A CB    1 
ATOM   6668  O  OG    . SER A 1 1058 ? 49.415  42.421  -24.026 1.00 56.80  ? 1086 SER A OG    1 
ATOM   6669  N  N     . ALA A 1 1059 ? 48.508  38.588  -22.452 1.00 74.21  ? 1087 ALA A N     1 
ATOM   6670  C  CA    . ALA A 1 1059 ? 48.050  38.117  -21.142 1.00 91.48  ? 1087 ALA A CA    1 
ATOM   6671  C  C     . ALA A 1 1059 ? 46.526  38.083  -21.029 1.00 93.59  ? 1087 ALA A C     1 
ATOM   6672  O  O     . ALA A 1 1059 ? 45.977  38.207  -19.936 1.00 81.04  ? 1087 ALA A O     1 
ATOM   6673  C  CB    . ALA A 1 1059 ? 48.648  38.969  -20.020 1.00 81.17  ? 1087 ALA A CB    1 
ATOM   6674  N  N     . VAL A 1 1060 ? 45.848  37.924  -22.162 1.00 86.57  ? 1088 VAL A N     1 
ATOM   6675  C  CA    . VAL A 1 1060 ? 44.412  37.645  -22.179 1.00 75.93  ? 1088 VAL A CA    1 
ATOM   6676  C  C     . VAL A 1 1060 ? 44.159  36.539  -23.202 1.00 90.58  ? 1088 VAL A C     1 
ATOM   6677  O  O     . VAL A 1 1060 ? 44.793  36.519  -24.256 1.00 93.87  ? 1088 VAL A O     1 
ATOM   6678  C  CB    . VAL A 1 1060 ? 43.559  38.890  -22.525 1.00 67.29  ? 1088 VAL A CB    1 
ATOM   6679  C  CG1   . VAL A 1 1060 ? 42.088  38.590  -22.314 1.00 55.85  ? 1088 VAL A CG1   1 
ATOM   6680  C  CG2   . VAL A 1 1060 ? 43.957  40.076  -21.670 1.00 60.98  ? 1088 VAL A CG2   1 
ATOM   6681  N  N     . GLN A 1 1061 ? 43.234  35.631  -22.894 1.00 90.31  ? 1089 GLN A N     1 
ATOM   6682  C  CA    . GLN A 1 1061 ? 43.057  34.387  -23.658 1.00 92.95  ? 1089 GLN A CA    1 
ATOM   6683  C  C     . GLN A 1 1061 ? 42.898  34.473  -25.196 1.00 90.82  ? 1089 GLN A C     1 
ATOM   6684  O  O     . GLN A 1 1061 ? 43.611  33.757  -25.899 1.00 91.94  ? 1089 GLN A O     1 
ATOM   6685  C  CB    . GLN A 1 1061 ? 41.865  33.600  -23.090 1.00 68.43  ? 1089 GLN A CB    1 
ATOM   6686  C  CG    . GLN A 1 1061 ? 41.551  32.302  -23.841 1.00 70.96  ? 1089 GLN A CG    1 
ATOM   6687  C  CD    . GLN A 1 1061 ? 42.740  31.352  -23.908 1.00 72.23  ? 1089 GLN A CD    1 
ATOM   6688  O  OE1   . GLN A 1 1061 ? 43.559  31.295  -22.989 1.00 84.41  ? 1089 GLN A OE1   1 
ATOM   6689  N  NE2   . GLN A 1 1061 ? 42.838  30.602  -25.000 1.00 75.71  ? 1089 GLN A NE2   1 
ATOM   6690  N  N     . GLU A 1 1062 ? 42.005  35.302  -25.747 1.00 84.29  ? 1090 GLU A N     1 
ATOM   6691  C  CA    . GLU A 1 1062 ? 41.210  36.303  -25.042 1.00 93.12  ? 1090 GLU A CA    1 
ATOM   6692  C  C     . GLU A 1 1062 ? 39.722  35.971  -25.000 1.00 90.01  ? 1090 GLU A C     1 
ATOM   6693  O  O     . GLU A 1 1062 ? 39.011  36.430  -24.107 1.00 90.05  ? 1090 GLU A O     1 
ATOM   6694  C  CB    . GLU A 1 1062 ? 41.405  37.667  -25.697 1.00 81.17  ? 1090 GLU A CB    1 
ATOM   6695  C  CG    . GLU A 1 1062 ? 41.194  37.652  -27.199 1.00 90.61  ? 1090 GLU A CG    1 
ATOM   6696  C  CD    . GLU A 1 1062 ? 40.412  38.853  -27.682 1.00 69.89  ? 1090 GLU A CD    1 
ATOM   6697  O  OE1   . GLU A 1 1062 ? 39.763  39.515  -26.844 1.00 70.05  ? 1090 GLU A OE1   1 
ATOM   6698  O  OE2   . GLU A 1 1062 ? 40.447  39.134  -28.897 1.00 73.80  ? 1090 GLU A OE2   1 
ATOM   6699  N  N     . GLU A 1 1063 ? 39.263  35.214  -25.995 1.00 91.31  ? 1091 GLU A N     1 
ATOM   6700  C  CA    . GLU A 1 1063 ? 37.873  34.755  -26.119 1.00 86.14  ? 1091 GLU A CA    1 
ATOM   6701  C  C     . GLU A 1 1063 ? 36.842  35.895  -26.149 1.00 85.31  ? 1091 GLU A C     1 
ATOM   6702  O  O     . GLU A 1 1063 ? 35.634  35.651  -26.168 1.00 85.51  ? 1091 GLU A O     1 
ATOM   6703  C  CB    . GLU A 1 1063 ? 37.545  33.758  -24.994 1.00 84.23  ? 1091 GLU A CB    1 
ATOM   6704  C  CG    . GLU A 1 1063 ? 36.958  34.350  -23.720 1.00 87.79  ? 1091 GLU A CG    1 
ATOM   6705  C  CD    . GLU A 1 1063 ? 37.497  33.683  -22.472 1.00 85.78  ? 1091 GLU A CD    1 
ATOM   6706  O  OE1   . GLU A 1 1063 ? 36.736  32.939  -21.819 1.00 81.83  ? 1091 GLU A OE1   1 
ATOM   6707  O  OE2   . GLU A 1 1063 ? 38.682  33.903  -22.143 1.00 81.47  ? 1091 GLU A OE2   1 
ATOM   6708  N  N     . PHE A 1 1064 ? 37.327  37.134  -26.183 1.00 69.74  ? 1092 PHE A N     1 
ATOM   6709  C  CA    . PHE A 1 1064 ? 36.465  38.308  -26.283 1.00 68.00  ? 1092 PHE A CA    1 
ATOM   6710  C  C     . PHE A 1 1064 ? 36.602  38.955  -27.658 1.00 69.00  ? 1092 PHE A C     1 
ATOM   6711  O  O     . PHE A 1 1064 ? 36.974  40.123  -27.769 1.00 73.41  ? 1092 PHE A O     1 
ATOM   6712  C  CB    . PHE A 1 1064 ? 36.808  39.326  -25.192 1.00 48.06  ? 1092 PHE A CB    1 
ATOM   6713  C  CG    . PHE A 1 1064 ? 36.473  38.869  -23.799 1.00 41.65  ? 1092 PHE A CG    1 
ATOM   6714  C  CD1   . PHE A 1 1064 ? 37.061  39.473  -22.701 1.00 87.49  ? 1092 PHE A CD1   1 
ATOM   6715  C  CD2   . PHE A 1 1064 ? 35.567  37.844  -23.586 1.00 65.08  ? 1092 PHE A CD2   1 
ATOM   6716  C  CE1   . PHE A 1 1064 ? 36.756  39.063  -21.415 1.00 68.06  ? 1092 PHE A CE1   1 
ATOM   6717  C  CE2   . PHE A 1 1064 ? 35.257  37.428  -22.302 1.00 64.12  ? 1092 PHE A CE2   1 
ATOM   6718  C  CZ    . PHE A 1 1064 ? 35.853  38.040  -21.215 1.00 90.57  ? 1092 PHE A CZ    1 
ATOM   6719  N  N     . MET A 1 1065 ? 36.299  38.190  -28.703 1.00 73.99  ? 1093 MET A N     1 
ATOM   6720  C  CA    . MET A 1 1065 ? 36.538  38.630  -30.074 1.00 70.39  ? 1093 MET A CA    1 
ATOM   6721  C  C     . MET A 1 1065 ? 35.533  39.674  -30.551 1.00 72.11  ? 1093 MET A C     1 
ATOM   6722  O  O     . MET A 1 1065 ? 35.917  40.742  -31.036 1.00 77.01  ? 1093 MET A O     1 
ATOM   6723  C  CB    . MET A 1 1065 ? 36.519  37.428  -31.021 1.00 74.31  ? 1093 MET A CB    1 
ATOM   6724  C  CG    . MET A 1 1065 ? 37.624  36.417  -30.765 1.00 68.85  ? 1093 MET A CG    1 
ATOM   6725  S  SD    . MET A 1 1065 ? 39.266  37.130  -30.967 1.00 72.85  ? 1093 MET A SD    1 
ATOM   6726  C  CE    . MET A 1 1065 ? 39.146  37.795  -32.625 1.00 48.00  ? 1093 MET A CE    1 
ATOM   6727  N  N     . THR A 1 1066 ? 34.250  39.351  -30.417 1.00 69.20  ? 1094 THR A N     1 
ATOM   6728  C  CA    . THR A 1 1066 ? 33.165  40.221  -30.866 1.00 69.85  ? 1094 THR A CA    1 
ATOM   6729  C  C     . THR A 1 1066 ? 33.266  41.620  -30.270 1.00 49.90  ? 1094 THR A C     1 
ATOM   6730  O  O     . THR A 1 1066 ? 33.120  42.626  -30.976 1.00 64.18  ? 1094 THR A O     1 
ATOM   6731  C  CB    . THR A 1 1066 ? 31.797  39.623  -30.503 1.00 48.60  ? 1094 THR A CB    1 
ATOM   6732  O  OG1   . THR A 1 1066 ? 31.769  39.318  -29.102 1.00 90.83  ? 1094 THR A OG1   1 
ATOM   6733  C  CG2   . THR A 1 1066 ? 31.551  38.348  -31.293 1.00 67.94  ? 1094 THR A CG2   1 
ATOM   6734  N  N     . SER A 1 1067 ? 33.531  41.670  -28.968 1.00 93.71  ? 1095 SER A N     1 
ATOM   6735  C  CA    . SER A 1 1067 ? 33.685  42.930  -28.253 1.00 47.31  ? 1095 SER A CA    1 
ATOM   6736  C  C     . SER A 1 1067 ? 34.824  43.761  -28.830 1.00 46.63  ? 1095 SER A C     1 
ATOM   6737  O  O     . SER A 1 1067 ? 34.803  44.986  -28.750 1.00 65.67  ? 1095 SER A O     1 
ATOM   6738  C  CB    . SER A 1 1067 ? 33.933  42.678  -26.763 1.00 73.93  ? 1095 SER A CB    1 
ATOM   6739  O  OG    . SER A 1 1067 ? 32.951  41.818  -26.212 1.00 87.23  ? 1095 SER A OG    1 
ATOM   6740  N  N     . ARG A 1 1068 ? 35.813  43.091  -29.414 1.00 56.82  ? 1096 ARG A N     1 
ATOM   6741  C  CA    . ARG A 1 1068 ? 36.980  43.777  -29.957 1.00 48.11  ? 1096 ARG A CA    1 
ATOM   6742  C  C     . ARG A 1 1068 ? 36.813  44.184  -31.422 1.00 49.10  ? 1096 ARG A C     1 
ATOM   6743  O  O     . ARG A 1 1068 ? 37.363  45.195  -31.846 1.00 67.56  ? 1096 ARG A O     1 
ATOM   6744  C  CB    . ARG A 1 1068 ? 38.230  42.911  -29.792 1.00 66.31  ? 1096 ARG A CB    1 
ATOM   6745  C  CG    . ARG A 1 1068 ? 38.850  43.002  -28.404 1.00 71.40  ? 1096 ARG A CG    1 
ATOM   6746  C  CD    . ARG A 1 1068 ? 40.146  42.224  -28.316 1.00 68.40  ? 1096 ARG A CD    1 
ATOM   6747  N  NE    . ARG A 1 1068 ? 41.161  42.725  -29.237 1.00 77.06  ? 1096 ARG A NE    1 
ATOM   6748  C  CZ    . ARG A 1 1068 ? 42.253  42.051  -29.583 1.00 90.35  ? 1096 ARG A CZ    1 
ATOM   6749  N  NH1   . ARG A 1 1068 ? 42.472  40.838  -29.091 1.00 87.93  ? 1096 ARG A NH1   1 
ATOM   6750  N  NH2   . ARG A 1 1068 ? 43.126  42.588  -30.424 1.00 87.01  ? 1096 ARG A NH2   1 
ATOM   6751  N  N     . VAL A 1 1069 ? 36.064  43.408  -32.197 1.00 65.28  ? 1097 VAL A N     1 
ATOM   6752  C  CA    . VAL A 1 1069 ? 35.720  43.834  -33.551 1.00 68.30  ? 1097 VAL A CA    1 
ATOM   6753  C  C     . VAL A 1 1069 ? 34.859  45.091  -33.447 1.00 73.59  ? 1097 VAL A C     1 
ATOM   6754  O  O     . VAL A 1 1069 ? 35.129  46.138  -34.082 1.00 69.38  ? 1097 VAL A O     1 
ATOM   6755  C  CB    . VAL A 1 1069 ? 34.964  42.739  -34.326 1.00 69.88  ? 1097 VAL A CB    1 
ATOM   6756  C  CG1   . VAL A 1 1069 ? 34.538  43.253  -35.689 1.00 48.25  ? 1097 VAL A CG1   1 
ATOM   6757  C  CG2   . VAL A 1 1069 ? 35.824  41.490  -34.462 1.00 69.60  ? 1097 VAL A CG2   1 
ATOM   6758  N  N     . ASN A 1 1070 ? 33.828  44.972  -32.613 1.00 67.48  ? 1098 ASN A N     1 
ATOM   6759  C  CA    . ASN A 1 1070 ? 32.973  46.098  -32.284 1.00 75.62  ? 1098 ASN A CA    1 
ATOM   6760  C  C     . ASN A 1 1070 ? 33.795  47.240  -31.702 1.00 68.85  ? 1098 ASN A C     1 
ATOM   6761  O  O     . ASN A 1 1070 ? 33.521  48.405  -31.978 1.00 75.71  ? 1098 ASN A O     1 
ATOM   6762  C  CB    . ASN A 1 1070 ? 31.874  45.675  -31.308 1.00 68.36  ? 1098 ASN A CB    1 
ATOM   6763  C  CG    . ASN A 1 1070 ? 30.907  46.799  -31.000 1.00 76.90  ? 1098 ASN A CG    1 
ATOM   6764  O  OD1   . ASN A 1 1070 ? 30.967  47.411  -29.934 1.00 72.44  ? 1098 ASN A OD1   1 
ATOM   6765  N  ND2   . ASN A 1 1070 ? 30.012  47.082  -31.940 1.00 56.39  ? 1098 ASN A ND2   1 
ATOM   6766  N  N     . TRP A 1 1071 ? 34.814  46.904  -30.912 1.00 90.74  ? 1099 TRP A N     1 
ATOM   6767  C  CA    . TRP A 1 1071 ? 35.711  47.923  -30.378 1.00 45.49  ? 1099 TRP A CA    1 
ATOM   6768  C  C     . TRP A 1 1071 ? 36.364  48.685  -31.519 1.00 87.80  ? 1099 TRP A C     1 
ATOM   6769  O  O     . TRP A 1 1071 ? 36.402  49.900  -31.492 1.00 93.35  ? 1099 TRP A O     1 
ATOM   6770  C  CB    . TRP A 1 1071 ? 36.790  47.322  -29.465 1.00 56.73  ? 1099 TRP A CB    1 
ATOM   6771  C  CG    . TRP A 1 1071 ? 38.189  47.751  -29.834 1.00 68.65  ? 1099 TRP A CG    1 
ATOM   6772  C  CD1   . TRP A 1 1071 ? 39.149  46.988  -30.432 1.00 68.80  ? 1099 TRP A CD1   1 
ATOM   6773  C  CD2   . TRP A 1 1071 ? 38.771  49.050  -29.651 1.00 65.51  ? 1099 TRP A CD2   1 
ATOM   6774  N  NE1   . TRP A 1 1071 ? 40.290  47.726  -30.628 1.00 68.21  ? 1099 TRP A NE1   1 
ATOM   6775  C  CE2   . TRP A 1 1071 ? 40.083  48.996  -30.159 1.00 69.53  ? 1099 TRP A CE2   1 
ATOM   6776  C  CE3   . TRP A 1 1071 ? 38.306  50.252  -29.111 1.00 56.57  ? 1099 TRP A CE3   1 
ATOM   6777  C  CZ2   . TRP A 1 1071 ? 40.938  50.094  -30.138 1.00 48.28  ? 1099 TRP A CZ2   1 
ATOM   6778  C  CZ3   . TRP A 1 1071 ? 39.155  51.340  -29.089 1.00 66.75  ? 1099 TRP A CZ3   1 
ATOM   6779  C  CH2   . TRP A 1 1071 ? 40.455  51.256  -29.602 1.00 66.27  ? 1099 TRP A CH2   1 
ATOM   6780  N  N     . VAL A 1 1072 ? 36.873  47.973  -32.518 1.00 90.01  ? 1100 VAL A N     1 
ATOM   6781  C  CA    . VAL A 1 1072 ? 37.571  48.621  -33.624 1.00 42.83  ? 1100 VAL A CA    1 
ATOM   6782  C  C     . VAL A 1 1072 ? 36.657  49.586  -34.369 1.00 48.94  ? 1100 VAL A C     1 
ATOM   6783  O  O     . VAL A 1 1072 ? 36.940  50.794  -34.467 1.00 42.08  ? 1100 VAL A O     1 
ATOM   6784  C  CB    . VAL A 1 1072 ? 38.127  47.591  -34.626 1.00 86.12  ? 1100 VAL A CB    1 
ATOM   6785  C  CG1   . VAL A 1 1072 ? 38.698  48.293  -35.849 1.00 72.93  ? 1100 VAL A CG1   1 
ATOM   6786  C  CG2   . VAL A 1 1072 ? 39.182  46.725  -33.965 1.00 81.61  ? 1100 VAL A CG2   1 
ATOM   6787  N  N     . VAL A 1 1073 ? 35.549  49.055  -34.879 1.00 40.41  ? 1101 VAL A N     1 
ATOM   6788  C  CA    . VAL A 1 1073 ? 34.676  49.873  -35.720 1.00 48.08  ? 1101 VAL A CA    1 
ATOM   6789  C  C     . VAL A 1 1073 ? 34.042  51.035  -34.935 1.00 40.29  ? 1101 VAL A C     1 
ATOM   6790  O  O     . VAL A 1 1073 ? 34.000  52.181  -35.411 1.00 92.74  ? 1101 VAL A O     1 
ATOM   6791  C  CB    . VAL A 1 1073 ? 33.581  49.008  -36.376 1.00 66.97  ? 1101 VAL A CB    1 
ATOM   6792  C  CG1   . VAL A 1 1073 ? 32.917  48.117  -35.345 1.00 68.65  ? 1101 VAL A CG1   1 
ATOM   6793  C  CG2   . VAL A 1 1073 ? 32.568  49.876  -37.100 1.00 71.52  ? 1101 VAL A CG2   1 
ATOM   6794  N  N     . GLN A 1 1074 ? 33.585  50.748  -33.719 1.00 90.07  ? 1102 GLN A N     1 
ATOM   6795  C  CA    . GLN A 1 1074 ? 32.947  51.763  -32.887 1.00 44.56  ? 1102 GLN A CA    1 
ATOM   6796  C  C     . GLN A 1 1074 ? 33.969  52.790  -32.416 1.00 41.58  ? 1102 GLN A C     1 
ATOM   6797  O  O     . GLN A 1 1074 ? 33.620  53.931  -32.126 1.00 48.76  ? 1102 GLN A O     1 
ATOM   6798  C  CB    . GLN A 1 1074 ? 32.249  51.113  -31.693 1.00 47.40  ? 1102 GLN A CB    1 
ATOM   6799  C  CG    . GLN A 1 1074 ? 31.211  51.974  -31.005 1.00 44.62  ? 1102 GLN A CG    1 
ATOM   6800  C  CD    . GLN A 1 1074 ? 30.263  51.145  -30.160 1.00 40.73  ? 1102 GLN A CD    1 
ATOM   6801  O  OE1   . GLN A 1 1074 ? 29.872  51.548  -29.065 1.00 41.72  ? 1102 GLN A OE1   1 
ATOM   6802  N  NE2   . GLN A 1 1074 ? 29.885  49.978  -30.670 1.00 77.75  ? 1102 GLN A NE2   1 
ATOM   6803  N  N     . SER A 1 1075 ? 35.231  52.378  -32.344 1.00 55.19  ? 1103 SER A N     1 
ATOM   6804  C  CA    . SER A 1 1075 ? 36.313  53.297  -32.013 1.00 56.44  ? 1103 SER A CA    1 
ATOM   6805  C  C     . SER A 1 1075 ? 36.507  54.266  -33.144 1.00 41.39  ? 1103 SER A C     1 
ATOM   6806  O  O     . SER A 1 1075 ? 36.675  55.458  -32.919 1.00 85.46  ? 1103 SER A O     1 
ATOM   6807  C  CB    . SER A 1 1075 ? 37.623  52.566  -31.749 1.00 76.45  ? 1103 SER A CB    1 
ATOM   6808  O  OG    . SER A 1 1075 ? 38.649  53.474  -31.393 1.00 68.12  ? 1103 SER A OG    1 
ATOM   6809  N  N     . SER A 1 1076 ? 36.505  53.746  -34.366 1.00 43.01  ? 1104 SER A N     1 
ATOM   6810  C  CA    . SER A 1 1076 ? 36.559  54.624  -35.524 1.00 68.69  ? 1104 SER A CA    1 
ATOM   6811  C  C     . SER A 1 1076 ? 35.387  55.604  -35.480 1.00 70.30  ? 1104 SER A C     1 
ATOM   6812  O  O     . SER A 1 1076 ? 35.540  56.779  -35.811 1.00 68.13  ? 1104 SER A O     1 
ATOM   6813  C  CB    . SER A 1 1076 ? 36.544  53.817  -36.817 1.00 76.73  ? 1104 SER A CB    1 
ATOM   6814  O  OG    . SER A 1 1076 ? 37.635  52.915  -36.864 1.00 72.30  ? 1104 SER A OG    1 
ATOM   6815  N  N     . ALA A 1 1077 ? 34.226  55.123  -35.040 1.00 60.99  ? 1105 ALA A N     1 
ATOM   6816  C  CA    . ALA A 1 1077 ? 33.052  55.987  -34.899 1.00 55.55  ? 1105 ALA A CA    1 
ATOM   6817  C  C     . ALA A 1 1077 ? 33.248  57.092  -33.849 1.00 66.17  ? 1105 ALA A C     1 
ATOM   6818  O  O     . ALA A 1 1077 ? 32.821  58.235  -34.043 1.00 49.20  ? 1105 ALA A O     1 
ATOM   6819  C  CB    . ALA A 1 1077 ? 31.827  55.152  -34.557 1.00 69.52  ? 1105 ALA A CB    1 
ATOM   6820  N  N     . VAL A 1 1078 ? 33.896  56.749  -32.740 1.00 67.28  ? 1106 VAL A N     1 
ATOM   6821  C  CA    . VAL A 1 1078 ? 34.079  57.692  -31.639 1.00 44.36  ? 1106 VAL A CA    1 
ATOM   6822  C  C     . VAL A 1 1078 ? 35.183  58.705  -31.940 1.00 49.36  ? 1106 VAL A C     1 
ATOM   6823  O  O     . VAL A 1 1078 ? 35.082  59.874  -31.574 1.00 43.65  ? 1106 VAL A O     1 
ATOM   6824  C  CB    . VAL A 1 1078 ? 34.389  56.951  -30.324 1.00 48.35  ? 1106 VAL A CB    1 
ATOM   6825  C  CG1   . VAL A 1 1078 ? 34.765  57.927  -29.220 1.00 73.64  ? 1106 VAL A CG1   1 
ATOM   6826  C  CG2   . VAL A 1 1078 ? 33.189  56.127  -29.911 1.00 48.00  ? 1106 VAL A CG2   1 
ATOM   6827  N  N     . ASP A 1 1079 ? 36.234  58.257  -32.614 1.00 47.11  ? 1107 ASP A N     1 
ATOM   6828  C  CA    . ASP A 1 1079 ? 37.271  59.165  -33.078 1.00 64.60  ? 1107 ASP A CA    1 
ATOM   6829  C  C     . ASP A 1 1079 ? 36.691  60.075  -34.153 1.00 49.20  ? 1107 ASP A C     1 
ATOM   6830  O  O     . ASP A 1 1079 ? 37.090  61.232  -34.278 1.00 49.51  ? 1107 ASP A O     1 
ATOM   6831  C  CB    . ASP A 1 1079 ? 38.484  58.396  -33.606 1.00 70.77  ? 1107 ASP A CB    1 
ATOM   6832  C  CG    . ASP A 1 1079 ? 39.273  57.721  -32.499 1.00 68.89  ? 1107 ASP A CG    1 
ATOM   6833  O  OD1   . ASP A 1 1079 ? 39.897  58.439  -31.689 1.00 70.34  ? 1107 ASP A OD1   1 
ATOM   6834  O  OD2   . ASP A 1 1079 ? 39.275  56.474  -32.440 1.00 75.67  ? 1107 ASP A OD2   1 
ATOM   6835  N  N     . TYR A 1 1080 ? 35.740  59.546  -34.920 1.00 46.85  ? 1108 TYR A N     1 
ATOM   6836  C  CA    . TYR A 1 1080 ? 34.973  60.364  -35.853 1.00 66.30  ? 1108 TYR A CA    1 
ATOM   6837  C  C     . TYR A 1 1080 ? 34.251  61.460  -35.075 1.00 65.59  ? 1108 TYR A C     1 
ATOM   6838  O  O     . TYR A 1 1080 ? 34.271  62.631  -35.462 1.00 66.14  ? 1108 TYR A O     1 
ATOM   6839  C  CB    . TYR A 1 1080 ? 33.970  59.507  -36.636 1.00 56.21  ? 1108 TYR A CB    1 
ATOM   6840  C  CG    . TYR A 1 1080 ? 33.379  60.189  -37.851 1.00 43.85  ? 1108 TYR A CG    1 
ATOM   6841  C  CD1   . TYR A 1 1080 ? 33.825  59.879  -39.129 1.00 56.56  ? 1108 TYR A CD1   1 
ATOM   6842  C  CD2   . TYR A 1 1080 ? 32.374  61.138  -37.722 1.00 44.30  ? 1108 TYR A CD2   1 
ATOM   6843  C  CE1   . TYR A 1 1080 ? 33.290  60.498  -40.242 1.00 56.93  ? 1108 TYR A CE1   1 
ATOM   6844  C  CE2   . TYR A 1 1080 ? 31.835  61.762  -38.830 1.00 45.42  ? 1108 TYR A CE2   1 
ATOM   6845  C  CZ    . TYR A 1 1080 ? 32.296  61.438  -40.085 1.00 56.60  ? 1108 TYR A CZ    1 
ATOM   6846  O  OH    . TYR A 1 1080 ? 31.760  62.059  -41.189 1.00 60.11  ? 1108 TYR A OH    1 
ATOM   6847  N  N     . LEU A 1 1081 ? 33.625  61.065  -33.968 1.00 47.69  ? 1109 LEU A N     1 
ATOM   6848  C  CA    . LEU A 1 1081 ? 32.910  61.998  -33.097 1.00 45.35  ? 1109 LEU A CA    1 
ATOM   6849  C  C     . LEU A 1 1081 ? 33.827  63.112  -32.588 1.00 43.05  ? 1109 LEU A C     1 
ATOM   6850  O  O     . LEU A 1 1081 ? 33.500  64.296  -32.698 1.00 91.15  ? 1109 LEU A O     1 
ATOM   6851  C  CB    . LEU A 1 1081 ? 32.291  61.239  -31.917 1.00 55.36  ? 1109 LEU A CB    1 
ATOM   6852  C  CG    . LEU A 1 1081 ? 31.078  61.792  -31.161 1.00 44.78  ? 1109 LEU A CG    1 
ATOM   6853  C  CD1   . LEU A 1 1081 ? 30.512  60.713  -30.252 1.00 47.25  ? 1109 LEU A CD1   1 
ATOM   6854  C  CD2   . LEU A 1 1081 ? 31.420  63.030  -30.348 1.00 90.88  ? 1109 LEU A CD2   1 
ATOM   6855  N  N     . HIS A 1 1082 ? 34.970  62.725  -32.027 1.00 56.15  ? 1110 HIS A N     1 
ATOM   6856  C  CA    . HIS A 1 1082 ? 35.931  63.678  -31.477 1.00 49.99  ? 1110 HIS A CA    1 
ATOM   6857  C  C     . HIS A 1 1082 ? 36.449  64.626  -32.550 1.00 47.12  ? 1110 HIS A C     1 
ATOM   6858  O  O     . HIS A 1 1082 ? 36.549  65.835  -32.325 1.00 44.00  ? 1110 HIS A O     1 
ATOM   6859  C  CB    . HIS A 1 1082 ? 37.102  62.943  -30.823 1.00 93.45  ? 1110 HIS A CB    1 
ATOM   6860  C  CG    . HIS A 1 1082 ? 36.714  62.125  -29.631 1.00 92.95  ? 1110 HIS A CG    1 
ATOM   6861  N  ND1   . HIS A 1 1082 ? 37.475  61.071  -29.174 1.00 46.43  ? 1110 HIS A ND1   1 
ATOM   6862  C  CD2   . HIS A 1 1082 ? 35.650  62.210  -28.799 1.00 42.32  ? 1110 HIS A CD2   1 
ATOM   6863  C  CE1   . HIS A 1 1082 ? 36.894  60.539  -28.113 1.00 49.78  ? 1110 HIS A CE1   1 
ATOM   6864  N  NE2   . HIS A 1 1082 ? 35.785  61.212  -27.864 1.00 47.50  ? 1110 HIS A NE2   1 
ATOM   6865  N  N     . LEU A 1 1083 ? 36.780  64.067  -33.711 1.00 91.08  ? 1111 LEU A N     1 
ATOM   6866  C  CA    . LEU A 1 1083 ? 37.214  64.866  -34.851 1.00 41.45  ? 1111 LEU A CA    1 
ATOM   6867  C  C     . LEU A 1 1083 ? 36.159  65.900  -35.211 1.00 49.64  ? 1111 LEU A C     1 
ATOM   6868  O  O     . LEU A 1 1083 ? 36.478  67.062  -35.464 1.00 76.79  ? 1111 LEU A O     1 
ATOM   6869  C  CB    . LEU A 1 1083 ? 37.509  63.978  -36.060 1.00 48.89  ? 1111 LEU A CB    1 
ATOM   6870  C  CG    . LEU A 1 1083 ? 38.829  63.209  -36.064 1.00 46.78  ? 1111 LEU A CG    1 
ATOM   6871  C  CD1   . LEU A 1 1083 ? 38.879  62.261  -37.248 1.00 46.75  ? 1111 LEU A CD1   1 
ATOM   6872  C  CD2   . LEU A 1 1083 ? 40.008  64.165  -36.095 1.00 48.94  ? 1111 LEU A CD2   1 
ATOM   6873  N  N     . MET A 1 1084 ? 34.900  65.472  -35.226 1.00 60.66  ? 1112 MET A N     1 
ATOM   6874  C  CA    . MET A 1 1084 ? 33.800  66.386  -35.504 1.00 64.70  ? 1112 MET A CA    1 
ATOM   6875  C  C     . MET A 1 1084 ? 33.734  67.499  -34.467 1.00 42.67  ? 1112 MET A C     1 
ATOM   6876  O  O     . MET A 1 1084 ? 33.535  68.665  -34.809 1.00 60.12  ? 1112 MET A O     1 
ATOM   6877  C  CB    . MET A 1 1084 ? 32.468  65.639  -35.554 1.00 69.06  ? 1112 MET A CB    1 
ATOM   6878  C  CG    . MET A 1 1084 ? 32.267  64.808  -36.807 1.00 69.05  ? 1112 MET A CG    1 
ATOM   6879  S  SD    . MET A 1 1084 ? 30.531  64.416  -37.082 1.00 41.64  ? 1112 MET A SD    1 
ATOM   6880  C  CE    . MET A 1 1084 ? 29.855  66.058  -37.314 1.00 72.15  ? 1112 MET A CE    1 
ATOM   6881  N  N     . LEU A 1 1085 ? 33.911  67.134  -33.201 1.00 42.95  ? 1113 LEU A N     1 
ATOM   6882  C  CA    . LEU A 1 1085 ? 33.869  68.108  -32.118 1.00 45.66  ? 1113 LEU A CA    1 
ATOM   6883  C  C     . LEU A 1 1085 ? 34.956  69.170  -32.263 1.00 49.31  ? 1113 LEU A C     1 
ATOM   6884  O  O     . LEU A 1 1085 ? 34.661  70.365  -32.275 1.00 65.11  ? 1113 LEU A O     1 
ATOM   6885  C  CB    . LEU A 1 1085 ? 34.001  67.410  -30.763 1.00 55.30  ? 1113 LEU A CB    1 
ATOM   6886  C  CG    . LEU A 1 1085 ? 32.850  66.490  -30.355 1.00 49.31  ? 1113 LEU A CG    1 
ATOM   6887  C  CD1   . LEU A 1 1085 ? 33.050  65.991  -28.933 1.00 56.74  ? 1113 LEU A CD1   1 
ATOM   6888  C  CD2   . LEU A 1 1085 ? 31.510  67.196  -30.495 1.00 48.14  ? 1113 LEU A CD2   1 
ATOM   6889  N  N     . VAL A 1 1086 ? 36.209  68.737  -32.379 1.00 42.41  ? 1114 VAL A N     1 
ATOM   6890  C  CA    . VAL A 1 1086 ? 37.320  69.682  -32.456 1.00 65.13  ? 1114 VAL A CA    1 
ATOM   6891  C  C     . VAL A 1 1086 ? 37.271  70.504  -33.744 1.00 55.08  ? 1114 VAL A C     1 
ATOM   6892  O  O     . VAL A 1 1086 ? 37.622  71.687  -33.743 1.00 55.78  ? 1114 VAL A O     1 
ATOM   6893  C  CB    . VAL A 1 1086 ? 38.691  68.970  -32.346 1.00 72.32  ? 1114 VAL A CB    1 
ATOM   6894  C  CG1   . VAL A 1 1086 ? 38.864  68.370  -30.961 1.00 71.23  ? 1114 VAL A CG1   1 
ATOM   6895  C  CG2   . VAL A 1 1086 ? 38.846  67.902  -33.416 1.00 75.40  ? 1114 VAL A CG2   1 
ATOM   6896  N  N     . ALA A 1 1087 ? 36.824  69.886  -34.834 1.00 42.63  ? 1115 ALA A N     1 
ATOM   6897  C  CA    . ALA A 1 1087 ? 36.699  70.595  -36.102 1.00 42.89  ? 1115 ALA A CA    1 
ATOM   6898  C  C     . ALA A 1 1087 ? 35.647  71.686  -35.987 1.00 55.29  ? 1115 ALA A C     1 
ATOM   6899  O  O     . ALA A 1 1087 ? 35.869  72.818  -36.412 1.00 45.70  ? 1115 ALA A O     1 
ATOM   6900  C  CB    . ALA A 1 1087 ? 36.351  69.637  -37.228 1.00 40.30  ? 1115 ALA A CB    1 
ATOM   6901  N  N     . MET A 1 1088 ? 34.504  71.342  -35.402 1.00 56.36  ? 1116 MET A N     1 
ATOM   6902  C  CA    . MET A 1 1088 ? 33.433  72.310  -35.208 1.00 55.25  ? 1116 MET A CA    1 
ATOM   6903  C  C     . MET A 1 1088 ? 33.871  73.441  -34.285 1.00 60.53  ? 1116 MET A C     1 
ATOM   6904  O  O     . MET A 1 1088 ? 33.534  74.601  -34.513 1.00 56.71  ? 1116 MET A O     1 
ATOM   6905  C  CB    . MET A 1 1088 ? 32.184  71.626  -34.653 1.00 48.45  ? 1116 MET A CB    1 
ATOM   6906  C  CG    . MET A 1 1088 ? 31.386  70.873  -35.700 1.00 42.27  ? 1116 MET A CG    1 
ATOM   6907  S  SD    . MET A 1 1088 ? 30.782  71.970  -36.996 1.00 60.08  ? 1116 MET A SD    1 
ATOM   6908  C  CE    . MET A 1 1088 ? 29.665  73.006  -36.059 1.00 87.25  ? 1116 MET A CE    1 
ATOM   6909  N  N     . LYS A 1 1089 ? 34.631  73.101  -33.250 1.00 69.80  ? 1117 LYS A N     1 
ATOM   6910  C  CA    . LYS A 1 1089 ? 35.115  74.104  -32.309 1.00 60.48  ? 1117 LYS A CA    1 
ATOM   6911  C  C     . LYS A 1 1089 ? 36.129  75.039  -32.961 1.00 65.05  ? 1117 LYS A C     1 
ATOM   6912  O  O     . LYS A 1 1089 ? 36.203  76.219  -32.619 1.00 65.10  ? 1117 LYS A O     1 
ATOM   6913  C  CB    . LYS A 1 1089 ? 35.738  73.435  -31.081 1.00 70.76  ? 1117 LYS A CB    1 
ATOM   6914  C  CG    . LYS A 1 1089 ? 36.196  74.414  -30.007 1.00 72.94  ? 1117 LYS A CG    1 
ATOM   6915  C  CD    . LYS A 1 1089 ? 36.805  73.695  -28.813 1.00 68.35  ? 1117 LYS A CD    1 
ATOM   6916  C  CE    . LYS A 1 1089 ? 37.274  74.684  -27.757 1.00 73.45  ? 1117 LYS A CE    1 
ATOM   6917  N  NZ    . LYS A 1 1089 ? 37.873  73.995  -26.581 1.00 71.78  ? 1117 LYS A NZ    1 
ATOM   6918  N  N     . TRP A 1 1090 ? 36.904  74.513  -33.906 1.00 56.89  ? 1118 TRP A N     1 
ATOM   6919  C  CA    . TRP A 1 1090 ? 37.978  75.292  -34.518 1.00 69.15  ? 1118 TRP A CA    1 
ATOM   6920  C  C     . TRP A 1 1090 ? 37.449  76.458  -35.353 1.00 71.26  ? 1118 TRP A C     1 
ATOM   6921  O  O     . TRP A 1 1090 ? 37.999  77.558  -35.297 1.00 67.66  ? 1118 TRP A O     1 
ATOM   6922  C  CB    . TRP A 1 1090 ? 38.879  74.386  -35.371 1.00 67.33  ? 1118 TRP A CB    1 
ATOM   6923  C  CG    . TRP A 1 1090 ? 38.897  74.694  -36.847 1.00 65.75  ? 1118 TRP A CG    1 
ATOM   6924  C  CD1   . TRP A 1 1090 ? 38.233  74.022  -37.830 1.00 71.73  ? 1118 TRP A CD1   1 
ATOM   6925  C  CD2   . TRP A 1 1090 ? 39.627  75.742  -37.502 1.00 56.35  ? 1118 TRP A CD2   1 
ATOM   6926  N  NE1   . TRP A 1 1090 ? 38.496  74.587  -39.054 1.00 73.46  ? 1118 TRP A NE1   1 
ATOM   6927  C  CE2   . TRP A 1 1090 ? 39.347  75.646  -38.880 1.00 77.94  ? 1118 TRP A CE2   1 
ATOM   6928  C  CE3   . TRP A 1 1090 ? 40.479  76.756  -37.056 1.00 72.50  ? 1118 TRP A CE3   1 
ATOM   6929  C  CZ2   . TRP A 1 1090 ? 39.893  76.522  -39.815 1.00 71.90  ? 1118 TRP A CZ2   1 
ATOM   6930  C  CZ3   . TRP A 1 1090 ? 41.021  77.625  -37.987 1.00 76.10  ? 1118 TRP A CZ3   1 
ATOM   6931  C  CH2   . TRP A 1 1090 ? 40.726  77.502  -39.350 1.00 70.48  ? 1118 TRP A CH2   1 
ATOM   6932  N  N     . LEU A 1 1091 ? 36.384  76.231  -36.115 1.00 71.43  ? 1119 LEU A N     1 
ATOM   6933  C  CA    . LEU A 1 1091 ? 35.876  77.270  -37.005 1.00 67.24  ? 1119 LEU A CA    1 
ATOM   6934  C  C     . LEU A 1 1091 ? 34.657  77.975  -36.410 1.00 69.78  ? 1119 LEU A C     1 
ATOM   6935  O  O     . LEU A 1 1091 ? 33.981  78.748  -37.088 1.00 56.85  ? 1119 LEU A O     1 
ATOM   6936  C  CB    . LEU A 1 1091 ? 35.546  76.687  -38.387 1.00 68.13  ? 1119 LEU A CB    1 
ATOM   6937  C  CG    . LEU A 1 1091 ? 34.201  76.018  -38.686 1.00 56.63  ? 1119 LEU A CG    1 
ATOM   6938  C  CD1   . LEU A 1 1091 ? 34.172  75.537  -40.130 1.00 75.44  ? 1119 LEU A CD1   1 
ATOM   6939  C  CD2   . LEU A 1 1091 ? 33.912  74.872  -37.740 1.00 64.30  ? 1119 LEU A CD2   1 
ATOM   6940  N  N     . PHE A 1 1092 ? 34.393  77.715  -35.133 1.00 55.82  ? 1120 PHE A N     1 
ATOM   6941  C  CA    . PHE A 1 1092 ? 33.324  78.405  -34.420 1.00 71.52  ? 1120 PHE A CA    1 
ATOM   6942  C  C     . PHE A 1 1092 ? 33.879  79.589  -33.637 1.00 76.98  ? 1120 PHE A C     1 
ATOM   6943  O  O     . PHE A 1 1092 ? 33.192  80.590  -33.434 1.00 68.26  ? 1120 PHE A O     1 
ATOM   6944  C  CB    . PHE A 1 1092 ? 32.592  77.445  -33.481 1.00 72.36  ? 1120 PHE A CB    1 
ATOM   6945  C  CG    . PHE A 1 1092 ? 31.193  77.122  -33.918 1.00 60.95  ? 1120 PHE A CG    1 
ATOM   6946  C  CD1   . PHE A 1 1092 ? 30.927  76.781  -35.234 1.00 60.73  ? 1120 PHE A CD1   1 
ATOM   6947  C  CD2   . PHE A 1 1092 ? 30.146  77.151  -33.013 1.00 49.43  ? 1120 PHE A CD2   1 
ATOM   6948  C  CE1   . PHE A 1 1092 ? 29.641  76.483  -35.640 1.00 65.64  ? 1120 PHE A CE1   1 
ATOM   6949  C  CE2   . PHE A 1 1092 ? 28.859  76.851  -33.413 1.00 48.56  ? 1120 PHE A CE2   1 
ATOM   6950  C  CZ    . PHE A 1 1092 ? 28.606  76.516  -34.728 1.00 66.58  ? 1120 PHE A CZ    1 
ATOM   6951  N  N     . GLU A 1 1093 ? 35.127  79.465  -33.199 1.00 70.22  ? 1121 GLU A N     1 
ATOM   6952  C  CA    . GLU A 1 1093 ? 35.799  80.543  -32.486 1.00 69.84  ? 1121 GLU A CA    1 
ATOM   6953  C  C     . GLU A 1 1093 ? 36.539  81.446  -33.466 1.00 68.58  ? 1121 GLU A C     1 
ATOM   6954  O  O     . GLU A 1 1093 ? 36.669  82.650  -33.243 1.00 67.53  ? 1121 GLU A O     1 
ATOM   6955  C  CB    . GLU A 1 1093 ? 36.770  79.980  -31.446 1.00 71.56  ? 1121 GLU A CB    1 
ATOM   6956  C  CG    . GLU A 1 1093 ? 36.109  79.124  -30.377 1.00 70.18  ? 1121 GLU A CG    1 
ATOM   6957  C  CD    . GLU A 1 1093 ? 37.092  78.632  -29.332 1.00 71.14  ? 1121 GLU A CD    1 
ATOM   6958  O  OE1   . GLU A 1 1093 ? 38.295  78.947  -29.450 1.00 72.90  ? 1121 GLU A OE1   1 
ATOM   6959  O  OE2   . GLU A 1 1093 ? 36.662  77.932  -28.392 1.00 68.13  ? 1121 GLU A OE2   1 
ATOM   6960  N  N     . GLU A 1 1094 ? 37.017  80.851  -34.554 1.00 77.96  ? 1122 GLU A N     1 
ATOM   6961  C  CA    . GLU A 1 1094 ? 37.745  81.585  -35.582 1.00 69.75  ? 1122 GLU A CA    1 
ATOM   6962  C  C     . GLU A 1 1094 ? 36.830  82.557  -36.319 1.00 75.97  ? 1122 GLU A C     1 
ATOM   6963  O  O     . GLU A 1 1094 ? 37.251  83.645  -36.712 1.00 74.60  ? 1122 GLU A O     1 
ATOM   6964  C  CB    . GLU A 1 1094 ? 38.392  80.613  -36.574 1.00 70.15  ? 1122 GLU A CB    1 
ATOM   6965  C  CG    . GLU A 1 1094 ? 39.167  81.285  -37.698 1.00 76.38  ? 1122 GLU A CG    1 
ATOM   6966  C  CD    . GLU A 1 1094 ? 40.362  82.073  -37.197 1.00 74.17  ? 1122 GLU A CD    1 
ATOM   6967  O  OE1   . GLU A 1 1094 ? 40.914  81.713  -36.136 1.00 74.27  ? 1122 GLU A OE1   1 
ATOM   6968  O  OE2   . GLU A 1 1094 ? 40.750  83.054  -37.866 1.00 73.53  ? 1122 GLU A OE2   1 
ATOM   6969  N  N     . PHE A 1 1095 ? 35.575  82.159  -36.499 1.00 71.58  ? 1123 PHE A N     1 
ATOM   6970  C  CA    . PHE A 1 1095 ? 34.600  82.999  -37.182 1.00 67.05  ? 1123 PHE A CA    1 
ATOM   6971  C  C     . PHE A 1 1095 ? 33.511  83.464  -36.222 1.00 67.55  ? 1123 PHE A C     1 
ATOM   6972  O  O     . PHE A 1 1095 ? 33.381  82.942  -35.115 1.00 60.20  ? 1123 PHE A O     1 
ATOM   6973  C  CB    . PHE A 1 1095 ? 33.985  82.250  -38.365 1.00 76.55  ? 1123 PHE A CB    1 
ATOM   6974  C  CG    . PHE A 1 1095 ? 34.996  81.757  -39.360 1.00 70.37  ? 1123 PHE A CG    1 
ATOM   6975  C  CD1   . PHE A 1 1095 ? 35.520  80.478  -39.260 1.00 68.43  ? 1123 PHE A CD1   1 
ATOM   6976  C  CD2   . PHE A 1 1095 ? 35.428  82.573  -40.392 1.00 70.15  ? 1123 PHE A CD2   1 
ATOM   6977  C  CE1   . PHE A 1 1095 ? 36.452  80.022  -40.173 1.00 68.12  ? 1123 PHE A CE1   1 
ATOM   6978  C  CE2   . PHE A 1 1095 ? 36.361  82.123  -41.308 1.00 76.93  ? 1123 PHE A CE2   1 
ATOM   6979  C  CZ    . PHE A 1 1095 ? 36.873  80.845  -41.198 1.00 74.57  ? 1123 PHE A CZ    1 
ATOM   6980  N  N     . ALA A 1 1096 ? 32.730  84.449  -36.651 1.00 66.15  ? 1124 ALA A N     1 
ATOM   6981  C  CA    . ALA A 1 1096 ? 31.697  85.030  -35.801 1.00 73.79  ? 1124 ALA A CA    1 
ATOM   6982  C  C     . ALA A 1 1096 ? 30.434  84.176  -35.780 1.00 72.41  ? 1124 ALA A C     1 
ATOM   6983  O  O     . ALA A 1 1096 ? 29.395  84.576  -36.305 1.00 74.77  ? 1124 ALA A O     1 
ATOM   6984  C  CB    . ALA A 1 1096 ? 31.370  86.442  -36.261 1.00 72.81  ? 1124 ALA A CB    1 
ATOM   6985  N  N     . ILE A 1 1097 ? 30.529  82.999  -35.170 1.00 73.71  ? 1125 ILE A N     1 
ATOM   6986  C  CA    . ILE A 1 1097 ? 29.374  82.121  -35.029 1.00 72.63  ? 1125 ILE A CA    1 
ATOM   6987  C  C     . ILE A 1 1097 ? 29.031  81.934  -33.554 1.00 66.54  ? 1125 ILE A C     1 
ATOM   6988  O  O     . ILE A 1 1097 ? 29.593  81.071  -32.881 1.00 47.03  ? 1125 ILE A O     1 
ATOM   6989  C  CB    . ILE A 1 1097 ? 29.619  80.747  -35.679 1.00 55.57  ? 1125 ILE A CB    1 
ATOM   6990  C  CG1   . ILE A 1 1097 ? 30.176  80.920  -37.094 1.00 46.50  ? 1125 ILE A CG1   1 
ATOM   6991  C  CG2   . ILE A 1 1097 ? 28.334  79.936  -35.705 1.00 49.82  ? 1125 ILE A CG2   1 
ATOM   6992  C  CD1   . ILE A 1 1097 ? 30.455  79.615  -37.806 1.00 81.12  ? 1125 ILE A CD1   1 
ATOM   6993  N  N     . ASP A 1 1098 ? 28.107  82.754  -33.062 1.00 72.09  ? 1126 ASP A N     1 
ATOM   6994  C  CA    . ASP A 1 1098 ? 27.730  82.743  -31.653 1.00 72.54  ? 1126 ASP A CA    1 
ATOM   6995  C  C     . ASP A 1 1098 ? 27.049  81.434  -31.264 1.00 73.82  ? 1126 ASP A C     1 
ATOM   6996  O  O     . ASP A 1 1098 ? 26.359  80.820  -32.075 1.00 71.69  ? 1126 ASP A O     1 
ATOM   6997  C  CB    . ASP A 1 1098 ? 26.810  83.926  -31.341 1.00 67.62  ? 1126 ASP A CB    1 
ATOM   6998  C  CG    . ASP A 1 1098 ? 26.541  84.081  -29.856 1.00 69.66  ? 1126 ASP A CG    1 
ATOM   6999  O  OD1   . ASP A 1 1098 ? 25.591  83.447  -29.350 1.00 73.77  ? 1126 ASP A OD1   1 
ATOM   7000  O  OD2   . ASP A 1 1098 ? 27.279  84.841  -29.195 1.00 75.23  ? 1126 ASP A OD2   1 
ATOM   7001  N  N     . GLY A 1 1099 ? 27.248  81.013  -30.019 1.00 73.19  ? 1127 GLY A N     1 
ATOM   7002  C  CA    . GLY A 1 1099 ? 26.661  79.780  -29.529 1.00 71.14  ? 1127 GLY A CA    1 
ATOM   7003  C  C     . GLY A 1 1099 ? 27.481  78.569  -29.924 1.00 90.14  ? 1127 GLY A C     1 
ATOM   7004  O  O     . GLY A 1 1099 ? 27.299  78.008  -31.003 1.00 76.41  ? 1127 GLY A O     1 
ATOM   7005  N  N     . ARG A 1 1100 ? 28.386  78.162  -29.041 1.00 92.68  ? 1128 ARG A N     1 
ATOM   7006  C  CA    . ARG A 1 1100 ? 29.296  77.061  -29.328 1.00 71.38  ? 1128 ARG A CA    1 
ATOM   7007  C  C     . ARG A 1 1100 ? 28.961  75.835  -28.476 1.00 91.95  ? 1128 ARG A C     1 
ATOM   7008  O  O     . ARG A 1 1100 ? 29.661  74.824  -28.520 1.00 77.60  ? 1128 ARG A O     1 
ATOM   7009  C  CB    . ARG A 1 1100 ? 30.745  77.502  -29.089 1.00 70.76  ? 1128 ARG A CB    1 
ATOM   7010  C  CG    . ARG A 1 1100 ? 31.801  76.623  -29.743 1.00 90.97  ? 1128 ARG A CG    1 
ATOM   7011  C  CD    . ARG A 1 1100 ? 33.085  76.646  -28.935 1.00 86.82  ? 1128 ARG A CD    1 
ATOM   7012  N  NE    . ARG A 1 1100 ? 32.806  76.541  -27.505 1.00 90.19  ? 1128 ARG A NE    1 
ATOM   7013  C  CZ    . ARG A 1 1100 ? 32.578  75.397  -26.868 1.00 91.18  ? 1128 ARG A CZ    1 
ATOM   7014  N  NH1   . ARG A 1 1100 ? 32.598  74.249  -27.531 1.00 84.84  ? 1128 ARG A NH1   1 
ATOM   7015  N  NH2   . ARG A 1 1100 ? 32.329  75.401  -25.565 1.00 86.83  ? 1128 ARG A NH2   1 
ATOM   7016  N  N     . PHE A 1 1101 ? 27.882  75.929  -27.705 1.00 71.95  ? 1129 PHE A N     1 
ATOM   7017  C  CA    . PHE A 1 1101 ? 27.478  74.839  -26.821 1.00 72.35  ? 1129 PHE A CA    1 
ATOM   7018  C  C     . PHE A 1 1101 ? 27.138  73.567  -27.600 1.00 71.49  ? 1129 PHE A C     1 
ATOM   7019  O  O     . PHE A 1 1101 ? 26.426  73.612  -28.603 1.00 92.44  ? 1129 PHE A O     1 
ATOM   7020  C  CB    . PHE A 1 1101 ? 26.292  75.270  -25.957 1.00 75.95  ? 1129 PHE A CB    1 
ATOM   7021  C  CG    . PHE A 1 1101 ? 26.683  75.752  -24.586 1.00 60.24  ? 1129 PHE A CG    1 
ATOM   7022  C  CD1   . PHE A 1 1101 ? 25.973  76.763  -23.962 1.00 69.20  ? 1129 PHE A CD1   1 
ATOM   7023  C  CD2   . PHE A 1 1101 ? 27.757  75.184  -23.917 1.00 67.22  ? 1129 PHE A CD2   1 
ATOM   7024  C  CE1   . PHE A 1 1101 ? 26.328  77.204  -22.699 1.00 85.21  ? 1129 PHE A CE1   1 
ATOM   7025  C  CE2   . PHE A 1 1101 ? 28.117  75.620  -22.653 1.00 64.17  ? 1129 PHE A CE2   1 
ATOM   7026  C  CZ    . PHE A 1 1101 ? 27.402  76.631  -22.044 1.00 40.26  ? 1129 PHE A CZ    1 
ATOM   7027  N  N     . CYS A 1 1102 ? 27.655  72.437  -27.126 1.00 72.92  ? 1130 CYS A N     1 
ATOM   7028  C  CA    . CYS A 1 1102 ? 27.532  71.163  -27.832 1.00 72.64  ? 1130 CYS A CA    1 
ATOM   7029  C  C     . CYS A 1 1102 ? 26.559  70.197  -27.161 1.00 93.47  ? 1130 CYS A C     1 
ATOM   7030  O  O     . CYS A 1 1102 ? 26.460  70.149  -25.938 1.00 93.26  ? 1130 CYS A O     1 
ATOM   7031  C  CB    . CYS A 1 1102 ? 28.904  70.495  -27.954 1.00 77.23  ? 1130 CYS A CB    1 
ATOM   7032  S  SG    . CYS A 1 1102 ? 28.897  68.714  -27.624 1.00 76.70  ? 1130 CYS A SG    1 
ATOM   7033  N  N     . ILE A 1 1103 ? 25.838  69.434  -27.979 1.00 85.61  ? 1131 ILE A N     1 
ATOM   7034  C  CA    . ILE A 1 1103 ? 24.945  68.380  -27.502 1.00 72.08  ? 1131 ILE A CA    1 
ATOM   7035  C  C     . ILE A 1 1103 ? 25.040  67.178  -28.437 1.00 64.34  ? 1131 ILE A C     1 
ATOM   7036  O  O     . ILE A 1 1103 ? 24.361  67.132  -29.461 1.00 48.96  ? 1131 ILE A O     1 
ATOM   7037  C  CB    . ILE A 1 1103 ? 23.467  68.834  -27.429 1.00 76.03  ? 1131 ILE A CB    1 
ATOM   7038  C  CG1   . ILE A 1 1103 ? 23.306  70.110  -26.596 1.00 76.02  ? 1131 ILE A CG1   1 
ATOM   7039  C  CG2   . ILE A 1 1103 ? 22.599  67.716  -26.864 1.00 76.10  ? 1131 ILE A CG2   1 
ATOM   7040  C  CD1   . ILE A 1 1103 ? 23.314  71.387  -27.412 1.00 91.35  ? 1131 ILE A CD1   1 
ATOM   7041  N  N     . SER A 1 1104 ? 25.877  66.207  -28.088 1.00 48.13  ? 1132 SER A N     1 
ATOM   7042  C  CA    . SER A 1 1104 ? 26.157  65.098  -28.996 1.00 60.06  ? 1132 SER A CA    1 
ATOM   7043  C  C     . SER A 1 1104 ? 25.600  63.761  -28.513 1.00 47.08  ? 1132 SER A C     1 
ATOM   7044  O  O     . SER A 1 1104 ? 25.653  63.443  -27.327 1.00 56.02  ? 1132 SER A O     1 
ATOM   7045  C  CB    . SER A 1 1104 ? 27.666  64.966  -29.216 1.00 60.37  ? 1132 SER A CB    1 
ATOM   7046  O  OG    . SER A 1 1104 ? 28.322  64.524  -28.040 1.00 49.57  ? 1132 SER A OG    1 
ATOM   7047  N  N     . ILE A 1 1105 ? 25.069  62.982  -29.449 1.00 69.51  ? 1133 ILE A N     1 
ATOM   7048  C  CA    . ILE A 1 1105 ? 24.628  61.622  -29.169 1.00 67.69  ? 1133 ILE A CA    1 
ATOM   7049  C  C     . ILE A 1 1105 ? 25.246  60.643  -30.172 1.00 56.88  ? 1133 ILE A C     1 
ATOM   7050  O  O     . ILE A 1 1105 ? 24.623  60.281  -31.172 1.00 60.90  ? 1133 ILE A O     1 
ATOM   7051  C  CB    . ILE A 1 1105 ? 23.085  61.498  -29.194 1.00 55.82  ? 1133 ILE A CB    1 
ATOM   7052  C  CG1   . ILE A 1 1105 ? 22.478  62.315  -30.343 1.00 55.82  ? 1133 ILE A CG1   1 
ATOM   7053  C  CG2   . ILE A 1 1105 ? 22.494  61.935  -27.862 1.00 45.55  ? 1133 ILE A CG2   1 
ATOM   7054  C  CD1   . ILE A 1 1105 ? 21.986  63.701  -29.960 1.00 66.75  ? 1133 ILE A CD1   1 
ATOM   7055  N  N     . HIS A 1 1106 ? 26.484  60.237  -29.899 1.00 44.12  ? 1134 HIS A N     1 
ATOM   7056  C  CA    . HIS A 1 1106 ? 27.193  59.245  -30.709 1.00 49.04  ? 1134 HIS A CA    1 
ATOM   7057  C  C     . HIS A 1 1106 ? 27.282  59.635  -32.184 1.00 64.80  ? 1134 HIS A C     1 
ATOM   7058  O  O     . HIS A 1 1106 ? 28.170  60.384  -32.590 1.00 56.19  ? 1134 HIS A O     1 
ATOM   7059  C  CB    . HIS A 1 1106 ? 26.517  57.877  -30.578 1.00 68.87  ? 1134 HIS A CB    1 
ATOM   7060  C  CG    . HIS A 1 1106 ? 26.384  57.404  -29.164 1.00 81.43  ? 1134 HIS A CG    1 
ATOM   7061  N  ND1   . HIS A 1 1106 ? 27.200  57.854  -28.149 1.00 41.24  ? 1134 HIS A ND1   1 
ATOM   7062  C  CD2   . HIS A 1 1106 ? 25.526  56.524  -28.595 1.00 70.48  ? 1134 HIS A CD2   1 
ATOM   7063  C  CE1   . HIS A 1 1106 ? 26.854  57.269  -27.016 1.00 49.39  ? 1134 HIS A CE1   1 
ATOM   7064  N  NE2   . HIS A 1 1106 ? 25.841  56.458  -27.259 1.00 44.15  ? 1134 HIS A NE2   1 
ATOM   7065  N  N     . ASP A 1 1107 ? 26.354  59.107  -32.976 1.00 47.76  ? 1135 ASP A N     1 
ATOM   7066  C  CA    . ASP A 1 1107 ? 26.281  59.388  -34.403 1.00 46.34  ? 1135 ASP A CA    1 
ATOM   7067  C  C     . ASP A 1 1107 ? 25.908  60.846  -34.645 1.00 91.50  ? 1135 ASP A C     1 
ATOM   7068  O  O     . ASP A 1 1107 ? 26.492  61.516  -35.500 1.00 87.02  ? 1135 ASP A O     1 
ATOM   7069  C  CB    . ASP A 1 1107 ? 25.259  58.457  -35.061 1.00 71.52  ? 1135 ASP A CB    1 
ATOM   7070  C  CG    . ASP A 1 1107 ? 25.267  58.542  -36.575 1.00 70.27  ? 1135 ASP A CG    1 
ATOM   7071  O  OD1   . ASP A 1 1107 ? 25.085  59.648  -37.121 1.00 76.75  ? 1135 ASP A OD1   1 
ATOM   7072  O  OD2   . ASP A 1 1107 ? 25.452  57.491  -37.223 1.00 74.64  ? 1135 ASP A OD2   1 
ATOM   7073  N  N     . GLU A 1 1108 ? 24.934  61.328  -33.879 1.00 48.75  ? 1136 GLU A N     1 
ATOM   7074  C  CA    . GLU A 1 1108 ? 24.360  62.653  -34.092 1.00 66.94  ? 1136 GLU A CA    1 
ATOM   7075  C  C     . GLU A 1 1108 ? 25.058  63.707  -33.234 1.00 47.00  ? 1136 GLU A C     1 
ATOM   7076  O  O     . GLU A 1 1108 ? 25.690  63.377  -32.232 1.00 92.50  ? 1136 GLU A O     1 
ATOM   7077  C  CB    . GLU A 1 1108 ? 22.857  62.625  -33.789 1.00 69.11  ? 1136 GLU A CB    1 
ATOM   7078  C  CG    . GLU A 1 1108 ? 22.053  63.741  -34.441 1.00 69.71  ? 1136 GLU A CG    1 
ATOM   7079  C  CD    . GLU A 1 1108 ? 20.561  63.621  -34.183 1.00 90.00  ? 1136 GLU A CD    1 
ATOM   7080  O  OE1   . GLU A 1 1108 ? 20.161  62.776  -33.353 1.00 81.65  ? 1136 GLU A OE1   1 
ATOM   7081  O  OE2   . GLU A 1 1108 ? 19.788  64.372  -34.814 1.00 90.68  ? 1136 GLU A OE2   1 
ATOM   7082  N  N     . VAL A 1 1109 ? 24.951  64.970  -33.639 1.00 49.79  ? 1137 VAL A N     1 
ATOM   7083  C  CA    . VAL A 1 1109 ? 25.517  66.075  -32.867 1.00 49.52  ? 1137 VAL A CA    1 
ATOM   7084  C  C     . VAL A 1 1109 ? 24.825  67.397  -33.211 1.00 43.20  ? 1137 VAL A C     1 
ATOM   7085  O  O     . VAL A 1 1109 ? 24.679  67.745  -34.384 1.00 68.31  ? 1137 VAL A O     1 
ATOM   7086  C  CB    . VAL A 1 1109 ? 27.045  66.201  -33.094 1.00 47.58  ? 1137 VAL A CB    1 
ATOM   7087  C  CG1   . VAL A 1 1109 ? 27.386  66.141  -34.578 1.00 47.14  ? 1137 VAL A CG1   1 
ATOM   7088  C  CG2   . VAL A 1 1109 ? 27.586  67.472  -32.454 1.00 56.19  ? 1137 VAL A CG2   1 
ATOM   7089  N  N     . ARG A 1 1110 ? 24.383  68.118  -32.180 1.00 86.17  ? 1138 ARG A N     1 
ATOM   7090  C  CA    . ARG A 1 1110 ? 23.640  69.367  -32.359 1.00 93.64  ? 1138 ARG A CA    1 
ATOM   7091  C  C     . ARG A 1 1110 ? 24.243  70.515  -31.549 1.00 44.33  ? 1138 ARG A C     1 
ATOM   7092  O  O     . ARG A 1 1110 ? 24.505  70.371  -30.357 1.00 69.11  ? 1138 ARG A O     1 
ATOM   7093  C  CB    . ARG A 1 1110 ? 22.170  69.182  -31.959 1.00 47.30  ? 1138 ARG A CB    1 
ATOM   7094  C  CG    . ARG A 1 1110 ? 21.687  67.736  -31.926 1.00 46.53  ? 1138 ARG A CG    1 
ATOM   7095  C  CD    . ARG A 1 1110 ? 21.449  67.176  -33.320 1.00 69.10  ? 1138 ARG A CD    1 
ATOM   7096  N  NE    . ARG A 1 1110 ? 20.249  67.726  -33.943 1.00 74.82  ? 1138 ARG A NE    1 
ATOM   7097  C  CZ    . ARG A 1 1110 ? 19.035  67.202  -33.811 1.00 76.77  ? 1138 ARG A CZ    1 
ATOM   7098  N  NH1   . ARG A 1 1110 ? 18.858  66.113  -33.074 1.00 65.75  ? 1138 ARG A NH1   1 
ATOM   7099  N  NH2   . ARG A 1 1110 ? 17.997  67.767  -34.413 1.00 74.19  ? 1138 ARG A NH2   1 
ATOM   7100  N  N     . TYR A 1 1111 ? 24.448  71.659  -32.197 1.00 48.71  ? 1139 TYR A N     1 
ATOM   7101  C  CA    . TYR A 1 1111 ? 24.968  72.845  -31.520 1.00 60.14  ? 1139 TYR A CA    1 
ATOM   7102  C  C     . TYR A 1 1111 ? 23.882  73.894  -31.298 1.00 56.81  ? 1139 TYR A C     1 
ATOM   7103  O  O     . TYR A 1 1111 ? 22.968  74.031  -32.108 1.00 55.81  ? 1139 TYR A O     1 
ATOM   7104  C  CB    . TYR A 1 1111 ? 26.122  73.455  -32.317 1.00 60.62  ? 1139 TYR A CB    1 
ATOM   7105  C  CG    . TYR A 1 1111 ? 27.421  72.696  -32.190 1.00 70.42  ? 1139 TYR A CG    1 
ATOM   7106  C  CD1   . TYR A 1 1111 ? 28.294  72.951  -31.142 1.00 68.30  ? 1139 TYR A CD1   1 
ATOM   7107  C  CD2   . TYR A 1 1111 ? 27.777  71.728  -33.119 1.00 73.28  ? 1139 TYR A CD2   1 
ATOM   7108  C  CE1   . TYR A 1 1111 ? 29.483  72.262  -31.020 1.00 73.60  ? 1139 TYR A CE1   1 
ATOM   7109  C  CE2   . TYR A 1 1111 ? 28.964  71.033  -33.005 1.00 73.67  ? 1139 TYR A CE2   1 
ATOM   7110  C  CZ    . TYR A 1 1111 ? 29.814  71.305  -31.953 1.00 75.58  ? 1139 TYR A CZ    1 
ATOM   7111  O  OH    . TYR A 1 1111 ? 31.000  70.617  -31.833 1.00 68.06  ? 1139 TYR A OH    1 
ATOM   7112  N  N     . LEU A 1 1112 ? 23.996  74.639  -30.201 1.00 42.91  ? 1140 LEU A N     1 
ATOM   7113  C  CA    . LEU A 1 1112 ? 23.011  75.661  -29.852 1.00 40.02  ? 1140 LEU A CA    1 
ATOM   7114  C  C     . LEU A 1 1112 ? 23.409  77.024  -30.416 1.00 90.39  ? 1140 LEU A C     1 
ATOM   7115  O  O     . LEU A 1 1112 ? 23.970  77.860  -29.709 1.00 93.40  ? 1140 LEU A O     1 
ATOM   7116  C  CB    . LEU A 1 1112 ? 22.843  75.737  -28.330 1.00 90.05  ? 1140 LEU A CB    1 
ATOM   7117  C  CG    . LEU A 1 1112 ? 21.596  76.414  -27.745 1.00 44.72  ? 1140 LEU A CG    1 
ATOM   7118  C  CD1   . LEU A 1 1112 ? 21.850  77.878  -27.404 1.00 41.73  ? 1140 LEU A CD1   1 
ATOM   7119  C  CD2   . LEU A 1 1112 ? 20.405  76.280  -28.688 1.00 56.96  ? 1140 LEU A CD2   1 
ATOM   7120  N  N     . VAL A 1 1113 ? 23.113  77.242  -31.693 1.00 93.86  ? 1141 VAL A N     1 
ATOM   7121  C  CA    . VAL A 1 1113 ? 23.483  78.483  -32.365 1.00 43.26  ? 1141 VAL A CA    1 
ATOM   7122  C  C     . VAL A 1 1113 ? 22.396  79.538  -32.175 1.00 48.21  ? 1141 VAL A C     1 
ATOM   7123  O  O     . VAL A 1 1113 ? 21.526  79.391  -31.318 1.00 68.41  ? 1141 VAL A O     1 
ATOM   7124  C  CB    . VAL A 1 1113 ? 23.722  78.255  -33.872 1.00 69.99  ? 1141 VAL A CB    1 
ATOM   7125  C  CG1   . VAL A 1 1113 ? 24.932  79.042  -34.345 1.00 66.57  ? 1141 VAL A CG1   1 
ATOM   7126  C  CG2   . VAL A 1 1113 ? 23.915  76.773  -34.158 1.00 64.43  ? 1141 VAL A CG2   1 
ATOM   7127  N  N     . ARG A 1 1114 ? 22.452  80.603  -32.968 1.00 66.87  ? 1142 ARG A N     1 
ATOM   7128  C  CA    . ARG A 1 1114 ? 21.399  81.612  -32.957 1.00 77.90  ? 1142 ARG A CA    1 
ATOM   7129  C  C     . ARG A 1 1114 ? 20.742  81.727  -34.330 1.00 70.92  ? 1142 ARG A C     1 
ATOM   7130  O  O     . ARG A 1 1114 ? 21.246  81.190  -35.317 1.00 81.50  ? 1142 ARG A O     1 
ATOM   7131  C  CB    . ARG A 1 1114 ? 21.944  82.969  -32.508 1.00 73.33  ? 1142 ARG A CB    1 
ATOM   7132  C  CG    . ARG A 1 1114 ? 23.231  83.398  -33.183 1.00 68.80  ? 1142 ARG A CG    1 
ATOM   7133  C  CD    . ARG A 1 1114 ? 23.594  84.833  -32.814 1.00 73.30  ? 1142 ARG A CD    1 
ATOM   7134  N  NE    . ARG A 1 1114 ? 23.647  85.051  -31.369 1.00 77.69  ? 1142 ARG A NE    1 
ATOM   7135  C  CZ    . ARG A 1 1114 ? 22.697  85.661  -30.666 1.00 77.37  ? 1142 ARG A CZ    1 
ATOM   7136  N  NH1   . ARG A 1 1114 ? 21.609  86.117  -31.272 1.00 76.16  ? 1142 ARG A NH1   1 
ATOM   7137  N  NH2   . ARG A 1 1114 ? 22.833  85.816  -29.356 1.00 72.06  ? 1142 ARG A NH2   1 
ATOM   7138  N  N     . GLU A 1 1115 ? 19.616  82.432  -34.382 1.00 73.08  ? 1143 GLU A N     1 
ATOM   7139  C  CA    . GLU A 1 1115 ? 18.778  82.473  -35.577 1.00 76.81  ? 1143 GLU A CA    1 
ATOM   7140  C  C     . GLU A 1 1115 ? 19.441  83.156  -36.770 1.00 69.74  ? 1143 GLU A C     1 
ATOM   7141  O  O     . GLU A 1 1115 ? 19.070  82.907  -37.917 1.00 90.27  ? 1143 GLU A O     1 
ATOM   7142  C  CB    . GLU A 1 1115 ? 17.453  83.171  -35.259 1.00 90.62  ? 1143 GLU A CB    1 
ATOM   7143  C  CG    . GLU A 1 1115 ? 16.619  82.456  -34.208 1.00 92.18  ? 1143 GLU A CG    1 
ATOM   7144  C  CD    . GLU A 1 1115 ? 15.355  83.212  -33.850 1.00 87.00  ? 1143 GLU A CD    1 
ATOM   7145  O  OE1   . GLU A 1 1115 ? 15.124  84.296  -34.427 1.00 68.47  ? 1143 GLU A OE1   1 
ATOM   7146  O  OE2   . GLU A 1 1115 ? 14.592  82.723  -32.991 1.00 86.66  ? 1143 GLU A OE2   1 
ATOM   7147  N  N     . GLU A 1 1116 ? 20.420  84.013  -36.502 1.00 74.27  ? 1144 GLU A N     1 
ATOM   7148  C  CA    . GLU A 1 1116 ? 21.068  84.776  -37.564 1.00 85.25  ? 1144 GLU A CA    1 
ATOM   7149  C  C     . GLU A 1 1116 ? 22.377  84.139  -38.026 1.00 69.68  ? 1144 GLU A C     1 
ATOM   7150  O  O     . GLU A 1 1116 ? 22.976  84.580  -39.007 1.00 76.78  ? 1144 GLU A O     1 
ATOM   7151  C  CB    . GLU A 1 1116 ? 21.320  86.217  -37.108 1.00 81.31  ? 1144 GLU A CB    1 
ATOM   7152  C  CG    . GLU A 1 1116 ? 21.849  86.355  -35.687 1.00 91.13  ? 1144 GLU A CG    1 
ATOM   7153  C  CD    . GLU A 1 1116 ? 20.742  86.424  -34.649 1.00 90.67  ? 1144 GLU A CD    1 
ATOM   7154  O  OE1   . GLU A 1 1116 ? 21.038  86.753  -33.481 1.00 85.78  ? 1144 GLU A OE1   1 
ATOM   7155  O  OE2   . GLU A 1 1116 ? 19.575  86.151  -35.000 1.00 81.27  ? 1144 GLU A OE2   1 
ATOM   7156  N  N     . ASP A 1 1117 ? 22.813  83.098  -37.324 1.00 76.63  ? 1145 ASP A N     1 
ATOM   7157  C  CA    . ASP A 1 1117 ? 24.048  82.404  -37.675 1.00 74.09  ? 1145 ASP A CA    1 
ATOM   7158  C  C     . ASP A 1 1117 ? 23.838  80.896  -37.767 1.00 77.16  ? 1145 ASP A C     1 
ATOM   7159  O  O     . ASP A 1 1117 ? 24.723  80.118  -37.414 1.00 69.22  ? 1145 ASP A O     1 
ATOM   7160  C  CB    . ASP A 1 1117 ? 25.147  82.713  -36.655 1.00 77.96  ? 1145 ASP A CB    1 
ATOM   7161  C  CG    . ASP A 1 1117 ? 25.557  84.173  -36.662 1.00 92.44  ? 1145 ASP A CG    1 
ATOM   7162  O  OD1   . ASP A 1 1117 ? 25.514  84.799  -37.741 1.00 90.19  ? 1145 ASP A OD1   1 
ATOM   7163  O  OD2   . ASP A 1 1117 ? 25.928  84.692  -35.588 1.00 86.10  ? 1145 ASP A OD2   1 
ATOM   7164  N  N     . ARG A 1 1118 ? 22.669  80.488  -38.248 1.00 75.78  ? 1146 ARG A N     1 
ATOM   7165  C  CA    . ARG A 1 1118 ? 22.327  79.071  -38.308 1.00 74.97  ? 1146 ARG A CA    1 
ATOM   7166  C  C     . ARG A 1 1118 ? 22.828  78.400  -39.587 1.00 69.85  ? 1146 ARG A C     1 
ATOM   7167  O  O     . ARG A 1 1118 ? 23.329  77.275  -39.548 1.00 73.79  ? 1146 ARG A O     1 
ATOM   7168  C  CB    . ARG A 1 1118 ? 20.812  78.887  -38.179 1.00 71.74  ? 1146 ARG A CB    1 
ATOM   7169  C  CG    . ARG A 1 1118 ? 19.985  79.795  -39.076 1.00 74.37  ? 1146 ARG A CG    1 
ATOM   7170  C  CD    . ARG A 1 1118 ? 18.501  79.505  -38.928 1.00 73.40  ? 1146 ARG A CD    1 
ATOM   7171  N  NE    . ARG A 1 1118 ? 17.683  80.387  -39.755 1.00 69.45  ? 1146 ARG A NE    1 
ATOM   7172  C  CZ    . ARG A 1 1118 ? 16.363  80.283  -39.877 1.00 68.76  ? 1146 ARG A CZ    1 
ATOM   7173  N  NH1   . ARG A 1 1118 ? 15.709  79.331  -39.227 1.00 76.65  ? 1146 ARG A NH1   1 
ATOM   7174  N  NH2   . ARG A 1 1118 ? 15.699  81.129  -40.651 1.00 76.68  ? 1146 ARG A NH2   1 
ATOM   7175  N  N     . TYR A 1 1119 ? 22.697  79.091  -40.714 1.00 76.21  ? 1147 TYR A N     1 
ATOM   7176  C  CA    . TYR A 1 1119 ? 23.086  78.526  -42.002 1.00 74.76  ? 1147 TYR A CA    1 
ATOM   7177  C  C     . TYR A 1 1119 ? 24.601  78.398  -42.121 1.00 69.31  ? 1147 TYR A C     1 
ATOM   7178  O  O     . TYR A 1 1119 ? 25.107  77.446  -42.717 1.00 70.64  ? 1147 TYR A O     1 
ATOM   7179  C  CB    . TYR A 1 1119 ? 22.537  79.379  -43.146 1.00 76.64  ? 1147 TYR A CB    1 
ATOM   7180  C  CG    . TYR A 1 1119 ? 21.034  79.532  -43.116 1.00 76.26  ? 1147 TYR A CG    1 
ATOM   7181  C  CD1   . TYR A 1 1119 ? 20.204  78.504  -43.542 1.00 76.33  ? 1147 TYR A CD1   1 
ATOM   7182  C  CD2   . TYR A 1 1119 ? 20.445  80.703  -42.661 1.00 68.07  ? 1147 TYR A CD2   1 
ATOM   7183  C  CE1   . TYR A 1 1119 ? 18.830  78.637  -43.515 1.00 77.79  ? 1147 TYR A CE1   1 
ATOM   7184  C  CE2   . TYR A 1 1119 ? 19.071  80.847  -42.631 1.00 73.92  ? 1147 TYR A CE2   1 
ATOM   7185  C  CZ    . TYR A 1 1119 ? 18.269  79.811  -43.059 1.00 69.93  ? 1147 TYR A CZ    1 
ATOM   7186  O  OH    . TYR A 1 1119 ? 16.900  79.948  -43.031 1.00 69.66  ? 1147 TYR A OH    1 
ATOM   7187  N  N     . ARG A 1 1120 ? 25.319  79.358  -41.548 1.00 68.70  ? 1148 ARG A N     1 
ATOM   7188  C  CA    . ARG A 1 1120 ? 26.775  79.324  -41.553 1.00 74.40  ? 1148 ARG A CA    1 
ATOM   7189  C  C     . ARG A 1 1120 ? 27.283  78.254  -40.591 1.00 77.10  ? 1148 ARG A C     1 
ATOM   7190  O  O     . ARG A 1 1120 ? 28.361  77.690  -40.784 1.00 68.55  ? 1148 ARG A O     1 
ATOM   7191  C  CB    . ARG A 1 1120 ? 27.348  80.694  -41.186 1.00 69.25  ? 1148 ARG A CB    1 
ATOM   7192  C  CG    . ARG A 1 1120 ? 26.845  81.825  -42.072 1.00 72.60  ? 1148 ARG A CG    1 
ATOM   7193  C  CD    . ARG A 1 1120 ? 27.610  83.121  -41.837 1.00 68.52  ? 1148 ARG A CD    1 
ATOM   7194  N  NE    . ARG A 1 1120 ? 27.488  83.606  -40.465 1.00 71.16  ? 1148 ARG A NE    1 
ATOM   7195  C  CZ    . ARG A 1 1120 ? 28.454  83.523  -39.555 1.00 70.48  ? 1148 ARG A CZ    1 
ATOM   7196  N  NH1   . ARG A 1 1120 ? 29.620  82.975  -39.869 1.00 76.32  ? 1148 ARG A NH1   1 
ATOM   7197  N  NH2   . ARG A 1 1120 ? 28.255  83.992  -38.331 1.00 69.69  ? 1148 ARG A NH2   1 
ATOM   7198  N  N     . ALA A 1 1121 ? 26.496  77.979  -39.555 1.00 77.41  ? 1149 ALA A N     1 
ATOM   7199  C  CA    . ALA A 1 1121 ? 26.816  76.916  -38.610 1.00 69.64  ? 1149 ALA A CA    1 
ATOM   7200  C  C     . ALA A 1 1121 ? 26.599  75.554  -39.258 1.00 75.50  ? 1149 ALA A C     1 
ATOM   7201  O  O     . ALA A 1 1121 ? 27.377  74.623  -39.047 1.00 71.31  ? 1149 ALA A O     1 
ATOM   7202  C  CB    . ALA A 1 1121 ? 25.977  77.048  -37.351 1.00 68.04  ? 1149 ALA A CB    1 
ATOM   7203  N  N     . ALA A 1 1122 ? 25.533  75.444  -40.045 1.00 71.60  ? 1150 ALA A N     1 
ATOM   7204  C  CA    . ALA A 1 1122 ? 25.268  74.231  -40.811 1.00 72.61  ? 1150 ALA A CA    1 
ATOM   7205  C  C     . ALA A 1 1122 ? 26.374  74.019  -41.839 1.00 69.63  ? 1150 ALA A C     1 
ATOM   7206  O  O     . ALA A 1 1122 ? 26.805  72.889  -42.090 1.00 73.39  ? 1150 ALA A O     1 
ATOM   7207  C  CB    . ALA A 1 1122 ? 23.912  74.314  -41.491 1.00 69.14  ? 1150 ALA A CB    1 
ATOM   7208  N  N     . LEU A 1 1123 ? 26.830  75.121  -42.425 1.00 74.38  ? 1151 LEU A N     1 
ATOM   7209  C  CA    . LEU A 1 1123 ? 27.951  75.096  -43.355 1.00 76.04  ? 1151 LEU A CA    1 
ATOM   7210  C  C     . LEU A 1 1123 ? 29.203  74.601  -42.636 1.00 75.45  ? 1151 LEU A C     1 
ATOM   7211  O  O     . LEU A 1 1123 ? 29.998  73.842  -43.196 1.00 72.01  ? 1151 LEU A O     1 
ATOM   7212  C  CB    . LEU A 1 1123 ? 28.172  76.488  -43.955 1.00 72.51  ? 1151 LEU A CB    1 
ATOM   7213  C  CG    . LEU A 1 1123 ? 29.167  76.675  -45.104 1.00 72.43  ? 1151 LEU A CG    1 
ATOM   7214  C  CD1   . LEU A 1 1123 ? 30.552  77.022  -44.580 1.00 77.72  ? 1151 LEU A CD1   1 
ATOM   7215  C  CD2   . LEU A 1 1123 ? 29.217  75.440  -45.996 1.00 75.21  ? 1151 LEU A CD2   1 
ATOM   7216  N  N     . ALA A 1 1124 ? 29.362  75.027  -41.386 1.00 74.35  ? 1152 ALA A N     1 
ATOM   7217  C  CA    . ALA A 1 1124 ? 30.471  74.574  -40.556 1.00 76.60  ? 1152 ALA A CA    1 
ATOM   7218  C  C     . ALA A 1 1124 ? 30.366  73.076  -40.289 1.00 71.95  ? 1152 ALA A C     1 
ATOM   7219  O  O     . ALA A 1 1124 ? 31.378  72.381  -40.212 1.00 68.58  ? 1152 ALA A O     1 
ATOM   7220  C  CB    . ALA A 1 1124 ? 30.509  75.348  -39.248 1.00 74.51  ? 1152 ALA A CB    1 
ATOM   7221  N  N     . LEU A 1 1125 ? 29.138  72.586  -40.148 1.00 69.29  ? 1153 LEU A N     1 
ATOM   7222  C  CA    . LEU A 1 1125 ? 28.900  71.158  -39.963 1.00 60.08  ? 1153 LEU A CA    1 
ATOM   7223  C  C     . LEU A 1 1125 ? 29.293  70.371  -41.206 1.00 74.88  ? 1153 LEU A C     1 
ATOM   7224  O  O     . LEU A 1 1125 ? 29.910  69.309  -41.109 1.00 73.38  ? 1153 LEU A O     1 
ATOM   7225  C  CB    . LEU A 1 1125 ? 27.434  70.892  -39.620 1.00 56.64  ? 1153 LEU A CB    1 
ATOM   7226  C  CG    . LEU A 1 1125 ? 27.006  71.131  -38.173 1.00 43.27  ? 1153 LEU A CG    1 
ATOM   7227  C  CD1   . LEU A 1 1125 ? 25.495  71.043  -38.050 1.00 66.23  ? 1153 LEU A CD1   1 
ATOM   7228  C  CD2   . LEU A 1 1125 ? 27.674  70.126  -37.252 1.00 41.18  ? 1153 LEU A CD2   1 
ATOM   7229  N  N     . GLN A 1 1126 ? 28.927  70.894  -42.372 1.00 76.25  ? 1154 GLN A N     1 
ATOM   7230  C  CA    . GLN A 1 1126 ? 29.268  70.248  -43.635 1.00 72.77  ? 1154 GLN A CA    1 
ATOM   7231  C  C     . GLN A 1 1126 ? 30.779  70.201  -43.840 1.00 76.87  ? 1154 GLN A C     1 
ATOM   7232  O  O     . GLN A 1 1126 ? 31.334  69.159  -44.202 1.00 76.35  ? 1154 GLN A O     1 
ATOM   7233  C  CB    . GLN A 1 1126 ? 28.599  70.971  -44.806 1.00 77.07  ? 1154 GLN A CB    1 
ATOM   7234  C  CG    . GLN A 1 1126 ? 27.082  70.867  -44.816 1.00 72.45  ? 1154 GLN A CG    1 
ATOM   7235  C  CD    . GLN A 1 1126 ? 26.587  69.488  -45.210 1.00 71.71  ? 1154 GLN A CD    1 
ATOM   7236  O  OE1   . GLN A 1 1126 ? 27.373  68.606  -45.557 1.00 73.42  ? 1154 GLN A OE1   1 
ATOM   7237  N  NE2   . GLN A 1 1126 ? 25.274  69.297  -45.164 1.00 77.19  ? 1154 GLN A NE2   1 
ATOM   7238  N  N     . ILE A 1 1127 ? 31.435  71.335  -43.609 1.00 55.05  ? 1155 ILE A N     1 
ATOM   7239  C  CA    . ILE A 1 1127 ? 32.889  71.411  -43.687 1.00 68.27  ? 1155 ILE A CA    1 
ATOM   7240  C  C     . ILE A 1 1127 ? 33.527  70.407  -42.735 1.00 65.02  ? 1155 ILE A C     1 
ATOM   7241  O  O     . ILE A 1 1127 ? 34.450  69.682  -43.107 1.00 55.22  ? 1155 ILE A O     1 
ATOM   7242  C  CB    . ILE A 1 1127 ? 33.403  72.825  -43.355 1.00 74.54  ? 1155 ILE A CB    1 
ATOM   7243  C  CG1   . ILE A 1 1127 ? 33.019  73.804  -44.465 1.00 71.82  ? 1155 ILE A CG1   1 
ATOM   7244  C  CG2   . ILE A 1 1127 ? 34.913  72.819  -43.161 1.00 73.42  ? 1155 ILE A CG2   1 
ATOM   7245  C  CD1   . ILE A 1 1127 ? 33.622  75.178  -44.294 1.00 76.52  ? 1155 ILE A CD1   1 
ATOM   7246  N  N     . THR A 1 1128 ? 33.014  70.368  -41.509 1.00 46.24  ? 1156 THR A N     1 
ATOM   7247  C  CA    . THR A 1 1128 ? 33.491  69.442  -40.490 1.00 40.82  ? 1156 THR A CA    1 
ATOM   7248  C  C     . THR A 1 1128 ? 33.411  67.995  -40.967 1.00 55.94  ? 1156 THR A C     1 
ATOM   7249  O  O     . THR A 1 1128 ? 34.396  67.256  -40.903 1.00 47.11  ? 1156 THR A O     1 
ATOM   7250  C  CB    . THR A 1 1128 ? 32.687  69.588  -39.185 1.00 49.21  ? 1156 THR A CB    1 
ATOM   7251  O  OG1   . THR A 1 1128 ? 33.006  70.839  -38.562 1.00 45.58  ? 1156 THR A OG1   1 
ATOM   7252  C  CG2   . THR A 1 1128 ? 33.012  68.461  -38.230 1.00 84.51  ? 1156 THR A CG2   1 
ATOM   7253  N  N     . ASN A 1 1129 ? 32.235  67.603  -41.450 1.00 46.88  ? 1157 ASN A N     1 
ATOM   7254  C  CA    . ASN A 1 1129 ? 32.020  66.248  -41.947 1.00 56.41  ? 1157 ASN A CA    1 
ATOM   7255  C  C     . ASN A 1 1129 ? 32.959  65.906  -43.097 1.00 56.39  ? 1157 ASN A C     1 
ATOM   7256  O  O     . ASN A 1 1129 ? 33.540  64.818  -43.134 1.00 55.21  ? 1157 ASN A O     1 
ATOM   7257  C  CB    . ASN A 1 1129 ? 30.569  66.066  -42.394 1.00 70.06  ? 1157 ASN A CB    1 
ATOM   7258  C  CG    . ASN A 1 1129 ? 30.311  64.692  -42.979 1.00 71.90  ? 1157 ASN A CG    1 
ATOM   7259  O  OD1   . ASN A 1 1129 ? 30.125  63.719  -42.249 1.00 77.16  ? 1157 ASN A OD1   1 
ATOM   7260  N  ND2   . ASN A 1 1129 ? 30.298  64.605  -44.304 1.00 68.07  ? 1157 ASN A ND2   1 
ATOM   7261  N  N     . LEU A 1 1130 ? 33.102  66.842  -44.030 1.00 69.53  ? 1158 LEU A N     1 
ATOM   7262  C  CA    . LEU A 1 1130 ? 34.003  66.665  -45.162 1.00 64.68  ? 1158 LEU A CA    1 
ATOM   7263  C  C     . LEU A 1 1130 ? 35.437  66.427  -44.702 1.00 66.07  ? 1158 LEU A C     1 
ATOM   7264  O  O     . LEU A 1 1130 ? 36.097  65.490  -45.154 1.00 64.93  ? 1158 LEU A O     1 
ATOM   7265  C  CB    . LEU A 1 1130 ? 33.949  67.883  -46.085 1.00 49.43  ? 1158 LEU A CB    1 
ATOM   7266  C  CG    . LEU A 1 1130 ? 34.965  67.880  -47.229 1.00 66.97  ? 1158 LEU A CG    1 
ATOM   7267  C  CD1   . LEU A 1 1130 ? 34.723  66.699  -48.158 1.00 42.95  ? 1158 LEU A CD1   1 
ATOM   7268  C  CD2   . LEU A 1 1130 ? 34.921  69.193  -47.994 1.00 43.66  ? 1158 LEU A CD2   1 
ATOM   7269  N  N     . LEU A 1 1131 ? 35.909  67.277  -43.796 1.00 60.54  ? 1159 LEU A N     1 
ATOM   7270  C  CA    . LEU A 1 1131 ? 37.269  67.179  -43.282 1.00 64.26  ? 1159 LEU A CA    1 
ATOM   7271  C  C     . LEU A 1 1131 ? 37.499  65.879  -42.514 1.00 65.81  ? 1159 LEU A C     1 
ATOM   7272  O  O     . LEU A 1 1131 ? 38.579  65.294  -42.587 1.00 48.77  ? 1159 LEU A O     1 
ATOM   7273  C  CB    . LEU A 1 1131 ? 37.590  68.378  -42.387 1.00 48.93  ? 1159 LEU A CB    1 
ATOM   7274  C  CG    . LEU A 1 1131 ? 37.674  69.740  -43.080 1.00 44.09  ? 1159 LEU A CG    1 
ATOM   7275  C  CD1   . LEU A 1 1131 ? 38.005  70.836  -42.077 1.00 46.07  ? 1159 LEU A CD1   1 
ATOM   7276  C  CD2   . LEU A 1 1131 ? 38.698  69.710  -44.204 1.00 44.09  ? 1159 LEU A CD2   1 
ATOM   7277  N  N     . THR A 1 1132 ? 36.485  65.427  -41.783 1.00 43.53  ? 1160 THR A N     1 
ATOM   7278  C  CA    . THR A 1 1132 ? 36.608  64.200  -41.001 1.00 46.69  ? 1160 THR A CA    1 
ATOM   7279  C  C     . THR A 1 1132 ? 36.654  62.973  -41.913 1.00 64.13  ? 1160 THR A C     1 
ATOM   7280  O  O     . THR A 1 1132 ? 37.479  62.071  -41.720 1.00 64.72  ? 1160 THR A O     1 
ATOM   7281  C  CB    . THR A 1 1132 ? 35.452  64.055  -39.993 1.00 42.19  ? 1160 THR A CB    1 
ATOM   7282  O  OG1   . THR A 1 1132 ? 35.365  65.241  -39.193 1.00 40.72  ? 1160 THR A OG1   1 
ATOM   7283  C  CG2   . THR A 1 1132 ? 35.685  62.860  -39.085 1.00 90.39  ? 1160 THR A CG2   1 
ATOM   7284  N  N     . ARG A 1 1133 ? 35.771  62.943  -42.908 1.00 44.04  ? 1161 ARG A N     1 
ATOM   7285  C  CA    . ARG A 1 1133 ? 35.786  61.875  -43.903 1.00 55.55  ? 1161 ARG A CA    1 
ATOM   7286  C  C     . ARG A 1 1133 ? 37.127  61.845  -44.633 1.00 75.70  ? 1161 ARG A C     1 
ATOM   7287  O  O     . ARG A 1 1133 ? 37.692  60.775  -44.880 1.00 70.38  ? 1161 ARG A O     1 
ATOM   7288  C  CB    . ARG A 1 1133 ? 34.644  62.048  -44.907 1.00 73.34  ? 1161 ARG A CB    1 
ATOM   7289  C  CG    . ARG A 1 1133 ? 33.252  61.840  -44.327 1.00 73.98  ? 1161 ARG A CG    1 
ATOM   7290  C  CD    . ARG A 1 1133 ? 33.091  60.446  -43.744 1.00 76.61  ? 1161 ARG A CD    1 
ATOM   7291  N  NE    . ARG A 1 1133 ? 31.856  59.803  -44.185 1.00 69.78  ? 1161 ARG A NE    1 
ATOM   7292  C  CZ    . ARG A 1 1133 ? 30.665  60.003  -43.630 1.00 75.76  ? 1161 ARG A CZ    1 
ATOM   7293  N  NH1   . ARG A 1 1133 ? 30.537  60.837  -42.609 1.00 77.22  ? 1161 ARG A NH1   1 
ATOM   7294  N  NH2   . ARG A 1 1133 ? 29.597  59.372  -44.099 1.00 69.71  ? 1161 ARG A NH2   1 
ATOM   7295  N  N     . CYS A 1 1134 ? 37.636  63.028  -44.967 1.00 67.76  ? 1162 CYS A N     1 
ATOM   7296  C  CA    . CYS A 1 1134 ? 38.931  63.146  -45.627 1.00 69.25  ? 1162 CYS A CA    1 
ATOM   7297  C  C     . CYS A 1 1134 ? 40.060  62.686  -44.711 1.00 68.67  ? 1162 CYS A C     1 
ATOM   7298  O  O     . CYS A 1 1134 ? 41.093  62.211  -45.178 1.00 68.03  ? 1162 CYS A O     1 
ATOM   7299  C  CB    . CYS A 1 1134 ? 39.176  64.585  -46.083 1.00 68.74  ? 1162 CYS A CB    1 
ATOM   7300  S  SG    . CYS A 1 1134 ? 38.175  65.105  -47.496 1.00 84.14  ? 1162 CYS A SG    1 
ATOM   7301  N  N     . MET A 1 1135 ? 39.858  62.833  -43.405 1.00 66.13  ? 1163 MET A N     1 
ATOM   7302  C  CA    . MET A 1 1135 ? 40.831  62.367  -42.425 1.00 67.12  ? 1163 MET A CA    1 
ATOM   7303  C  C     . MET A 1 1135 ? 40.877  60.846  -42.394 1.00 46.53  ? 1163 MET A C     1 
ATOM   7304  O  O     . MET A 1 1135 ? 41.953  60.245  -42.453 1.00 69.29  ? 1163 MET A O     1 
ATOM   7305  C  CB    . MET A 1 1135 ? 40.504  62.911  -41.034 1.00 67.65  ? 1163 MET A CB    1 
ATOM   7306  C  CG    . MET A 1 1135 ? 41.342  62.296  -39.929 1.00 74.77  ? 1163 MET A CG    1 
ATOM   7307  S  SD    . MET A 1 1135 ? 43.099  62.620  -40.151 1.00 85.36  ? 1163 MET A SD    1 
ATOM   7308  C  CE    . MET A 1 1135 ? 43.134  64.395  -39.934 1.00 73.89  ? 1163 MET A CE    1 
ATOM   7309  N  N     . PHE A 1 1136 ? 39.702  60.228  -42.298 1.00 40.15  ? 1164 PHE A N     1 
ATOM   7310  C  CA    . PHE A 1 1136 ? 39.607  58.772  -42.325 1.00 49.47  ? 1164 PHE A CA    1 
ATOM   7311  C  C     . PHE A 1 1136 ? 40.147  58.206  -43.634 1.00 56.53  ? 1164 PHE A C     1 
ATOM   7312  O  O     . PHE A 1 1136 ? 40.706  57.109  -43.662 1.00 67.18  ? 1164 PHE A O     1 
ATOM   7313  C  CB    . PHE A 1 1136 ? 38.160  58.322  -42.116 1.00 67.56  ? 1164 PHE A CB    1 
ATOM   7314  C  CG    . PHE A 1 1136 ? 37.742  58.288  -40.676 1.00 56.84  ? 1164 PHE A CG    1 
ATOM   7315  C  CD1   . PHE A 1 1136 ? 37.554  57.080  -40.024 1.00 46.28  ? 1164 PHE A CD1   1 
ATOM   7316  C  CD2   . PHE A 1 1136 ? 37.547  59.462  -39.971 1.00 66.40  ? 1164 PHE A CD2   1 
ATOM   7317  C  CE1   . PHE A 1 1136 ? 37.171  57.046  -38.697 1.00 45.42  ? 1164 PHE A CE1   1 
ATOM   7318  C  CE2   . PHE A 1 1136 ? 37.167  59.435  -38.645 1.00 56.64  ? 1164 PHE A CE2   1 
ATOM   7319  C  CZ    . PHE A 1 1136 ? 36.980  58.227  -38.008 1.00 47.64  ? 1164 PHE A CZ    1 
ATOM   7320  N  N     . ALA A 1 1137 ? 39.979  58.958  -44.716 1.00 56.27  ? 1165 ALA A N     1 
ATOM   7321  C  CA    . ALA A 1 1137 ? 40.503  58.540  -46.010 1.00 68.23  ? 1165 ALA A CA    1 
ATOM   7322  C  C     . ALA A 1 1137 ? 42.023  58.660  -46.042 1.00 74.12  ? 1165 ALA A C     1 
ATOM   7323  O  O     . ALA A 1 1137 ? 42.712  57.812  -46.609 1.00 70.99  ? 1165 ALA A O     1 
ATOM   7324  C  CB    . ALA A 1 1137 ? 39.880  59.362  -47.127 1.00 74.36  ? 1165 ALA A CB    1 
ATOM   7325  N  N     . TYR A 1 1138 ? 42.538  59.716  -45.420 1.00 77.89  ? 1166 TYR A N     1 
ATOM   7326  C  CA    . TYR A 1 1138 ? 43.969  60.001  -45.436 1.00 76.86  ? 1166 TYR A CA    1 
ATOM   7327  C  C     . TYR A 1 1138 ? 44.770  59.049  -44.552 1.00 60.27  ? 1166 TYR A C     1 
ATOM   7328  O  O     . TYR A 1 1138 ? 45.902  58.695  -44.880 1.00 56.18  ? 1166 TYR A O     1 
ATOM   7329  C  CB    . TYR A 1 1138 ? 44.225  61.445  -45.002 1.00 74.34  ? 1166 TYR A CB    1 
ATOM   7330  C  CG    . TYR A 1 1138 ? 45.683  61.749  -44.753 1.00 69.60  ? 1166 TYR A CG    1 
ATOM   7331  C  CD1   . TYR A 1 1138 ? 46.601  61.740  -45.793 1.00 70.72  ? 1166 TYR A CD1   1 
ATOM   7332  C  CD2   . TYR A 1 1138 ? 46.140  62.048  -43.477 1.00 69.64  ? 1166 TYR A CD2   1 
ATOM   7333  C  CE1   . TYR A 1 1138 ? 47.936  62.015  -45.570 1.00 68.81  ? 1166 TYR A CE1   1 
ATOM   7334  C  CE2   . TYR A 1 1138 ? 47.473  62.327  -43.244 1.00 69.07  ? 1166 TYR A CE2   1 
ATOM   7335  C  CZ    . TYR A 1 1138 ? 48.366  62.308  -44.294 1.00 76.81  ? 1166 TYR A CZ    1 
ATOM   7336  O  OH    . TYR A 1 1138 ? 49.693  62.586  -44.065 1.00 75.17  ? 1166 TYR A OH    1 
ATOM   7337  N  N     . LYS A 1 1139 ? 44.182  58.633  -43.434 1.00 55.26  ? 1167 LYS A N     1 
ATOM   7338  C  CA    . LYS A 1 1139 ? 44.872  57.749  -42.496 1.00 48.51  ? 1167 LYS A CA    1 
ATOM   7339  C  C     . LYS A 1 1139 ? 45.133  56.358  -43.071 1.00 66.03  ? 1167 LYS A C     1 
ATOM   7340  O  O     . LYS A 1 1139 ? 45.867  55.566  -42.481 1.00 77.81  ? 1167 LYS A O     1 
ATOM   7341  C  CB    . LYS A 1 1139 ? 44.072  57.622  -41.200 1.00 43.06  ? 1167 LYS A CB    1 
ATOM   7342  C  CG    . LYS A 1 1139 ? 44.081  58.871  -40.339 1.00 55.91  ? 1167 LYS A CG    1 
ATOM   7343  C  CD    . LYS A 1 1139 ? 45.492  59.251  -39.925 1.00 56.24  ? 1167 LYS A CD    1 
ATOM   7344  C  CE    . LYS A 1 1139 ? 45.469  60.366  -38.893 1.00 69.49  ? 1167 LYS A CE    1 
ATOM   7345  N  NZ    . LYS A 1 1139 ? 46.824  60.901  -38.604 1.00 76.53  ? 1167 LYS A NZ    1 
ATOM   7346  N  N     . LEU A 1 1140 ? 44.531  56.062  -44.218 1.00 68.09  ? 1168 LEU A N     1 
ATOM   7347  C  CA    . LEU A 1 1140 ? 44.704  54.761  -44.853 1.00 64.36  ? 1168 LEU A CA    1 
ATOM   7348  C  C     . LEU A 1 1140 ? 45.073  54.895  -46.328 1.00 69.88  ? 1168 LEU A C     1 
ATOM   7349  O  O     . LEU A 1 1140 ? 45.632  53.973  -46.922 1.00 67.15  ? 1168 LEU A O     1 
ATOM   7350  C  CB    . LEU A 1 1140 ? 43.430  53.927  -44.705 1.00 71.97  ? 1168 LEU A CB    1 
ATOM   7351  C  CG    . LEU A 1 1140 ? 43.013  53.566  -43.277 1.00 72.57  ? 1168 LEU A CG    1 
ATOM   7352  C  CD1   . LEU A 1 1140 ? 41.709  52.786  -43.278 1.00 66.05  ? 1168 LEU A CD1   1 
ATOM   7353  C  CD2   . LEU A 1 1140 ? 44.113  52.776  -42.585 1.00 69.81  ? 1168 LEU A CD2   1 
ATOM   7354  N  N     . GLY A 1 1141 ? 44.760  56.047  -46.912 1.00 74.47  ? 1169 GLY A N     1 
ATOM   7355  C  CA    . GLY A 1 1141 ? 45.028  56.285  -48.319 1.00 75.73  ? 1169 GLY A CA    1 
ATOM   7356  C  C     . GLY A 1 1141 ? 43.924  55.742  -49.209 1.00 69.27  ? 1169 GLY A C     1 
ATOM   7357  O  O     . GLY A 1 1141 ? 43.399  54.656  -48.958 1.00 71.83  ? 1169 GLY A O     1 
ATOM   7358  N  N     . LEU A 1 1142 ? 43.566  56.490  -50.249 1.00 84.09  ? 1170 LEU A N     1 
ATOM   7359  C  CA    . LEU A 1 1142 ? 44.190  57.775  -50.549 1.00 68.37  ? 1170 LEU A CA    1 
ATOM   7360  C  C     . LEU A 1 1142 ? 43.468  58.922  -49.851 1.00 85.12  ? 1170 LEU A C     1 
ATOM   7361  O  O     . LEU A 1 1142 ? 42.423  58.724  -49.233 1.00 81.61  ? 1170 LEU A O     1 
ATOM   7362  C  CB    . LEU A 1 1142 ? 44.208  58.025  -52.062 1.00 68.92  ? 1170 LEU A CB    1 
ATOM   7363  C  CG    . LEU A 1 1142 ? 45.379  57.494  -52.894 1.00 74.64  ? 1170 LEU A CG    1 
ATOM   7364  C  CD1   . LEU A 1 1142 ? 46.676  58.171  -52.478 1.00 70.87  ? 1170 LEU A CD1   1 
ATOM   7365  C  CD2   . LEU A 1 1142 ? 45.502  55.977  -52.801 1.00 72.15  ? 1170 LEU A CD2   1 
ATOM   7366  N  N     . ASN A 1 1143 ? 44.033  60.121  -49.956 1.00 90.79  ? 1171 ASN A N     1 
ATOM   7367  C  CA    . ASN A 1 1143 ? 43.380  61.323  -49.451 1.00 72.16  ? 1171 ASN A CA    1 
ATOM   7368  C  C     . ASN A 1 1143 ? 42.113  61.609  -50.246 1.00 93.87  ? 1171 ASN A C     1 
ATOM   7369  O  O     . ASN A 1 1143 ? 41.204  62.292  -49.773 1.00 85.67  ? 1171 ASN A O     1 
ATOM   7370  C  CB    . ASN A 1 1143 ? 44.329  62.520  -49.514 1.00 69.15  ? 1171 ASN A CB    1 
ATOM   7371  C  CG    . ASN A 1 1143 ? 44.806  62.810  -50.923 1.00 75.30  ? 1171 ASN A CG    1 
ATOM   7372  O  OD1   . ASN A 1 1143 ? 44.911  61.907  -51.754 1.00 81.63  ? 1171 ASN A OD1   1 
ATOM   7373  N  ND2   . ASN A 1 1143 ? 45.098  64.075  -51.201 1.00 69.27  ? 1171 ASN A ND2   1 
ATOM   7374  N  N     . ASP A 1 1144 ? 42.075  61.080  -51.465 1.00 81.17  ? 1172 ASP A N     1 
ATOM   7375  C  CA    . ASP A 1 1144 ? 40.893  61.140  -52.310 1.00 85.90  ? 1172 ASP A CA    1 
ATOM   7376  C  C     . ASP A 1 1144 ? 39.756  60.360  -51.658 1.00 85.40  ? 1172 ASP A C     1 
ATOM   7377  O  O     . ASP A 1 1144 ? 39.985  59.335  -51.017 1.00 93.25  ? 1172 ASP A O     1 
ATOM   7378  C  CB    . ASP A 1 1144 ? 41.211  60.581  -53.701 1.00 81.36  ? 1172 ASP A CB    1 
ATOM   7379  C  CG    . ASP A 1 1144 ? 40.129  60.882  -54.720 1.00 86.97  ? 1172 ASP A CG    1 
ATOM   7380  O  OD1   . ASP A 1 1144 ? 38.948  60.567  -54.462 1.00 90.16  ? 1172 ASP A OD1   1 
ATOM   7381  O  OD2   . ASP A 1 1144 ? 40.465  61.437  -55.787 1.00 85.66  ? 1172 ASP A OD2   1 
ATOM   7382  N  N     . LEU A 1 1145 ? 38.532  60.850  -51.822 1.00 84.90  ? 1173 LEU A N     1 
ATOM   7383  C  CA    . LEU A 1 1145 ? 37.366  60.207  -51.225 1.00 81.83  ? 1173 LEU A CA    1 
ATOM   7384  C  C     . LEU A 1 1145 ? 36.163  60.282  -52.165 1.00 87.94  ? 1173 LEU A C     1 
ATOM   7385  O  O     . LEU A 1 1145 ? 36.070  61.197  -52.985 1.00 92.90  ? 1173 LEU A O     1 
ATOM   7386  C  CB    . LEU A 1 1145 ? 37.031  60.847  -49.872 1.00 84.81  ? 1173 LEU A CB    1 
ATOM   7387  C  CG    . LEU A 1 1145 ? 36.201  62.134  -49.846 1.00 86.23  ? 1173 LEU A CG    1 
ATOM   7388  C  CD1   . LEU A 1 1145 ? 35.778  62.454  -48.421 1.00 86.57  ? 1173 LEU A CD1   1 
ATOM   7389  C  CD2   . LEU A 1 1145 ? 36.961  63.305  -50.452 1.00 81.82  ? 1173 LEU A CD2   1 
ATOM   7390  N  N     . PRO A 1 1146 ? 35.243  59.308  -52.056 1.00 90.61  ? 1174 PRO A N     1 
ATOM   7391  C  CA    . PRO A 1 1146 ? 34.035  59.244  -52.890 1.00 86.03  ? 1174 PRO A CA    1 
ATOM   7392  C  C     . PRO A 1 1146 ? 33.128  60.470  -52.765 1.00 84.80  ? 1174 PRO A C     1 
ATOM   7393  O  O     . PRO A 1 1146 ? 33.392  61.368  -51.966 1.00 75.03  ? 1174 PRO A O     1 
ATOM   7394  C  CB    . PRO A 1 1146 ? 33.321  57.994  -52.369 1.00 90.71  ? 1174 PRO A CB    1 
ATOM   7395  C  CG    . PRO A 1 1146 ? 34.411  57.149  -51.822 1.00 85.03  ? 1174 PRO A CG    1 
ATOM   7396  C  CD    . PRO A 1 1146 ? 35.386  58.108  -51.214 1.00 85.34  ? 1174 PRO A CD    1 
ATOM   7397  N  N     . GLN A 1 1147 ? 32.058  60.490  -53.554 1.00 71.02  ? 1175 GLN A N     1 
ATOM   7398  C  CA    . GLN A 1 1147 ? 31.163  61.639  -53.614 1.00 77.84  ? 1175 GLN A CA    1 
ATOM   7399  C  C     . GLN A 1 1147 ? 30.021  61.538  -52.604 1.00 73.77  ? 1175 GLN A C     1 
ATOM   7400  O  O     . GLN A 1 1147 ? 29.803  62.451  -51.808 1.00 77.09  ? 1175 GLN A O     1 
ATOM   7401  C  CB    . GLN A 1 1147 ? 30.596  61.788  -55.028 1.00 69.86  ? 1175 GLN A CB    1 
ATOM   7402  C  CG    . GLN A 1 1147 ? 31.655  61.816  -56.121 1.00 85.48  ? 1175 GLN A CG    1 
ATOM   7403  C  CD    . GLN A 1 1147 ? 31.059  61.883  -57.516 1.00 91.57  ? 1175 GLN A CD    1 
ATOM   7404  O  OE1   . GLN A 1 1147 ? 29.865  61.651  -57.707 1.00 84.77  ? 1175 GLN A OE1   1 
ATOM   7405  N  NE2   . GLN A 1 1147 ? 31.892  62.204  -58.500 1.00 87.26  ? 1175 GLN A NE2   1 
ATOM   7406  N  N     . SER A 1 1148 ? 29.298  60.422  -52.641 1.00 74.67  ? 1176 SER A N     1 
ATOM   7407  C  CA    . SER A 1 1148 ? 28.124  60.233  -51.792 1.00 75.04  ? 1176 SER A CA    1 
ATOM   7408  C  C     . SER A 1 1148 ? 28.494  59.817  -50.371 1.00 70.25  ? 1176 SER A C     1 
ATOM   7409  O  O     . SER A 1 1148 ? 27.920  58.875  -49.822 1.00 69.04  ? 1176 SER A O     1 
ATOM   7410  C  CB    . SER A 1 1148 ? 27.187  59.191  -52.409 1.00 90.63  ? 1176 SER A CB    1 
ATOM   7411  O  OG    . SER A 1 1148 ? 26.052  58.973  -51.589 1.00 84.51  ? 1176 SER A OG    1 
ATOM   7412  N  N     . VAL A 1 1149 ? 29.447  60.529  -49.779 1.00 74.16  ? 1177 VAL A N     1 
ATOM   7413  C  CA    . VAL A 1 1149 ? 29.901  60.237  -48.425 1.00 71.61  ? 1177 VAL A CA    1 
ATOM   7414  C  C     . VAL A 1 1149 ? 30.669  61.432  -47.866 1.00 67.13  ? 1177 VAL A C     1 
ATOM   7415  O  O     . VAL A 1 1149 ? 30.948  61.506  -46.669 1.00 74.90  ? 1177 VAL A O     1 
ATOM   7416  C  CB    . VAL A 1 1149 ? 30.795  58.977  -48.387 1.00 75.52  ? 1177 VAL A CB    1 
ATOM   7417  C  CG1   . VAL A 1 1149 ? 32.200  59.300  -48.877 1.00 68.80  ? 1177 VAL A CG1   1 
ATOM   7418  C  CG2   . VAL A 1 1149 ? 30.836  58.390  -46.987 1.00 76.57  ? 1177 VAL A CG2   1 
ATOM   7419  N  N     . ALA A 1 1150 ? 30.994  62.374  -48.745 1.00 65.65  ? 1178 ALA A N     1 
ATOM   7420  C  CA    . ALA A 1 1150 ? 31.789  63.537  -48.371 1.00 66.46  ? 1178 ALA A CA    1 
ATOM   7421  C  C     . ALA A 1 1150 ? 31.011  64.501  -47.481 1.00 65.49  ? 1178 ALA A C     1 
ATOM   7422  O  O     . ALA A 1 1150 ? 31.514  64.951  -46.452 1.00 66.32  ? 1178 ALA A O     1 
ATOM   7423  C  CB    . ALA A 1 1150 ? 32.284  64.257  -49.617 1.00 69.61  ? 1178 ALA A CB    1 
ATOM   7424  N  N     . PHE A 1 1151 ? 29.783  64.812  -47.882 1.00 60.77  ? 1179 PHE A N     1 
ATOM   7425  C  CA    . PHE A 1 1151 ? 28.978  65.799  -47.171 1.00 64.37  ? 1179 PHE A CA    1 
ATOM   7426  C  C     . PHE A 1 1151 ? 27.745  65.186  -46.519 1.00 67.18  ? 1179 PHE A C     1 
ATOM   7427  O  O     . PHE A 1 1151 ? 27.267  64.131  -46.937 1.00 68.83  ? 1179 PHE A O     1 
ATOM   7428  C  CB    . PHE A 1 1151 ? 28.551  66.917  -48.122 1.00 60.06  ? 1179 PHE A CB    1 
ATOM   7429  C  CG    . PHE A 1 1151 ? 29.700  67.654  -48.743 1.00 55.76  ? 1179 PHE A CG    1 
ATOM   7430  C  CD1   . PHE A 1 1151 ? 30.263  68.747  -48.107 1.00 65.41  ? 1179 PHE A CD1   1 
ATOM   7431  C  CD2   . PHE A 1 1151 ? 30.218  67.254  -49.964 1.00 72.61  ? 1179 PHE A CD2   1 
ATOM   7432  C  CE1   . PHE A 1 1151 ? 31.321  69.428  -48.676 1.00 69.18  ? 1179 PHE A CE1   1 
ATOM   7433  C  CE2   . PHE A 1 1151 ? 31.276  67.931  -50.539 1.00 71.25  ? 1179 PHE A CE2   1 
ATOM   7434  C  CZ    . PHE A 1 1151 ? 31.829  69.019  -49.893 1.00 76.77  ? 1179 PHE A CZ    1 
ATOM   7435  N  N     . PHE A 1 1152 ? 27.238  65.859  -45.491 1.00 69.73  ? 1180 PHE A N     1 
ATOM   7436  C  CA    . PHE A 1 1152 ? 26.000  65.455  -44.838 1.00 65.75  ? 1180 PHE A CA    1 
ATOM   7437  C  C     . PHE A 1 1152 ? 24.824  65.538  -45.803 1.00 76.58  ? 1180 PHE A C     1 
ATOM   7438  O  O     . PHE A 1 1152 ? 24.839  66.321  -46.754 1.00 75.79  ? 1180 PHE A O     1 
ATOM   7439  C  CB    . PHE A 1 1152 ? 25.726  66.326  -43.610 1.00 45.96  ? 1180 PHE A CB    1 
ATOM   7440  C  CG    . PHE A 1 1152 ? 26.454  65.883  -42.376 1.00 48.06  ? 1180 PHE A CG    1 
ATOM   7441  C  CD1   . PHE A 1 1152 ? 26.644  64.538  -42.113 1.00 67.69  ? 1180 PHE A CD1   1 
ATOM   7442  C  CD2   . PHE A 1 1152 ? 26.947  66.813  -41.476 1.00 64.03  ? 1180 PHE A CD2   1 
ATOM   7443  C  CE1   . PHE A 1 1152 ? 27.311  64.128  -40.975 1.00 74.53  ? 1180 PHE A CE1   1 
ATOM   7444  C  CE2   . PHE A 1 1152 ? 27.617  66.409  -40.337 1.00 65.80  ? 1180 PHE A CE2   1 
ATOM   7445  C  CZ    . PHE A 1 1152 ? 27.799  65.065  -40.087 1.00 67.47  ? 1180 PHE A CZ    1 
ATOM   7446  N  N     . SER A 1 1153 ? 23.804  64.726  -45.551 1.00 70.59  ? 1181 SER A N     1 
ATOM   7447  C  CA    . SER A 1 1153 ? 22.607  64.730  -46.378 1.00 77.14  ? 1181 SER A CA    1 
ATOM   7448  C  C     . SER A 1 1153 ? 21.464  65.445  -45.668 1.00 73.32  ? 1181 SER A C     1 
ATOM   7449  O  O     . SER A 1 1153 ? 20.618  66.068  -46.308 1.00 65.25  ? 1181 SER A O     1 
ATOM   7450  C  CB    . SER A 1 1153 ? 22.199  63.300  -46.736 1.00 76.74  ? 1181 SER A CB    1 
ATOM   7451  O  OG    . SER A 1 1153 ? 21.068  63.290  -47.589 1.00 69.56  ? 1181 SER A OG    1 
ATOM   7452  N  N     . ALA A 1 1154 ? 21.449  65.359  -44.341 1.00 72.29  ? 1182 ALA A N     1 
ATOM   7453  C  CA    . ALA A 1 1154 ? 20.388  65.972  -43.549 1.00 73.92  ? 1182 ALA A CA    1 
ATOM   7454  C  C     . ALA A 1 1154 ? 20.945  66.814  -42.405 1.00 68.18  ? 1182 ALA A C     1 
ATOM   7455  O  O     . ALA A 1 1154 ? 21.633  66.302  -41.522 1.00 76.37  ? 1182 ALA A O     1 
ATOM   7456  C  CB    . ALA A 1 1154 ? 19.452  64.902  -43.006 1.00 77.98  ? 1182 ALA A CB    1 
ATOM   7457  N  N     . VAL A 1 1155 ? 20.640  68.109  -42.427 1.00 56.39  ? 1183 VAL A N     1 
ATOM   7458  C  CA    . VAL A 1 1155 ? 21.039  69.014  -41.354 1.00 66.55  ? 1183 VAL A CA    1 
ATOM   7459  C  C     . VAL A 1 1155 ? 19.815  69.659  -40.708 1.00 64.62  ? 1183 VAL A C     1 
ATOM   7460  O  O     . VAL A 1 1155 ? 19.159  70.510  -41.310 1.00 73.72  ? 1183 VAL A O     1 
ATOM   7461  C  CB    . VAL A 1 1155 ? 21.986  70.122  -41.861 1.00 68.53  ? 1183 VAL A CB    1 
ATOM   7462  C  CG1   . VAL A 1 1155 ? 22.372  71.051  -40.721 1.00 48.27  ? 1183 VAL A CG1   1 
ATOM   7463  C  CG2   . VAL A 1 1155 ? 23.225  69.513  -42.497 1.00 45.82  ? 1183 VAL A CG2   1 
ATOM   7464  N  N     . ASP A 1 1156 ? 19.513  69.245  -39.481 1.00 66.40  ? 1184 ASP A N     1 
ATOM   7465  C  CA    . ASP A 1 1156 ? 18.352  69.749  -38.755 1.00 77.39  ? 1184 ASP A CA    1 
ATOM   7466  C  C     . ASP A 1 1156 ? 18.605  71.148  -38.199 1.00 69.91  ? 1184 ASP A C     1 
ATOM   7467  O  O     . ASP A 1 1156 ? 19.624  71.391  -37.561 1.00 69.90  ? 1184 ASP A O     1 
ATOM   7468  C  CB    . ASP A 1 1156 ? 17.983  68.793  -37.618 1.00 69.18  ? 1184 ASP A CB    1 
ATOM   7469  C  CG    . ASP A 1 1156 ? 17.923  67.347  -38.070 1.00 69.72  ? 1184 ASP A CG    1 
ATOM   7470  O  OD1   . ASP A 1 1156 ? 18.372  66.465  -37.307 1.00 72.10  ? 1184 ASP A OD1   1 
ATOM   7471  O  OD2   . ASP A 1 1156 ? 17.430  67.092  -39.189 1.00 71.22  ? 1184 ASP A OD2   1 
ATOM   7472  N  N     . ILE A 1 1157 ? 17.678  72.068  -38.447 1.00 68.99  ? 1185 ILE A N     1 
ATOM   7473  C  CA    . ILE A 1 1157 ? 17.813  73.444  -37.971 1.00 66.02  ? 1185 ILE A CA    1 
ATOM   7474  C  C     . ILE A 1 1157 ? 16.497  73.966  -37.406 1.00 73.15  ? 1185 ILE A C     1 
ATOM   7475  O  O     . ILE A 1 1157 ? 15.620  74.370  -38.171 1.00 68.85  ? 1185 ILE A O     1 
ATOM   7476  C  CB    . ILE A 1 1157 ? 18.266  74.400  -39.100 1.00 60.22  ? 1185 ILE A CB    1 
ATOM   7477  C  CG1   . ILE A 1 1157 ? 19.562  73.914  -39.750 1.00 68.11  ? 1185 ILE A CG1   1 
ATOM   7478  C  CG2   . ILE A 1 1157 ? 18.432  75.817  -38.568 1.00 45.41  ? 1185 ILE A CG2   1 
ATOM   7479  C  CD1   . ILE A 1 1157 ? 20.007  74.761  -40.923 1.00 55.37  ? 1185 ILE A CD1   1 
ATOM   7480  N  N     . ASP A 1 1158 ? 16.354  73.970  -36.081 1.00 73.39  ? 1186 ASP A N     1 
ATOM   7481  C  CA    . ASP A 1 1158 ? 15.118  74.480  -35.478 1.00 72.13  ? 1186 ASP A CA    1 
ATOM   7482  C  C     . ASP A 1 1158 ? 15.223  74.725  -33.975 1.00 73.37  ? 1186 ASP A C     1 
ATOM   7483  O  O     . ASP A 1 1158 ? 16.303  74.640  -33.396 1.00 70.43  ? 1186 ASP A O     1 
ATOM   7484  C  CB    . ASP A 1 1158 ? 13.953  73.524  -35.754 1.00 68.53  ? 1186 ASP A CB    1 
ATOM   7485  C  CG    . ASP A 1 1158 ? 14.128  72.183  -35.082 1.00 68.60  ? 1186 ASP A CG    1 
ATOM   7486  O  OD1   . ASP A 1 1158 ? 15.285  71.778  -34.846 1.00 56.04  ? 1186 ASP A OD1   1 
ATOM   7487  O  OD2   . ASP A 1 1158 ? 13.102  71.535  -34.790 1.00 47.42  ? 1186 ASP A OD2   1 
ATOM   7488  N  N     . ARG A 1 1159 ? 14.087  75.029  -33.353 1.00 75.97  ? 1187 ARG A N     1 
ATOM   7489  C  CA    . ARG A 1 1159 ? 14.048  75.417  -31.945 1.00 56.61  ? 1187 ARG A CA    1 
ATOM   7490  C  C     . ARG A 1 1159 ? 14.327  74.245  -31.010 1.00 49.50  ? 1187 ARG A C     1 
ATOM   7491  O  O     . ARG A 1 1159 ? 15.276  74.278  -30.229 1.00 47.83  ? 1187 ARG A O     1 
ATOM   7492  C  CB    . ARG A 1 1159 ? 12.692  76.041  -31.606 1.00 56.92  ? 1187 ARG A CB    1 
ATOM   7493  C  CG    . ARG A 1 1159 ? 12.635  76.706  -30.240 1.00 72.54  ? 1187 ARG A CG    1 
ATOM   7494  C  CD    . ARG A 1 1159 ? 11.317  77.438  -30.043 1.00 71.24  ? 1187 ARG A CD    1 
ATOM   7495  N  NE    . ARG A 1 1159 ? 11.253  78.130  -28.759 1.00 68.66  ? 1187 ARG A NE    1 
ATOM   7496  C  CZ    . ARG A 1 1159 ? 11.644  79.386  -28.566 1.00 71.80  ? 1187 ARG A CZ    1 
ATOM   7497  N  NH1   . ARG A 1 1159 ? 12.132  80.094  -29.575 1.00 90.69  ? 1187 ARG A NH1   1 
ATOM   7498  N  NH2   . ARG A 1 1159 ? 11.549  79.934  -27.362 1.00 71.87  ? 1187 ARG A NH2   1 
ATOM   7499  N  N     . CYS A 1 1160 ? 13.491  73.215  -31.083 1.00 44.86  ? 1188 CYS A N     1 
ATOM   7500  C  CA    . CYS A 1 1160 ? 13.683  72.025  -30.263 1.00 55.94  ? 1188 CYS A CA    1 
ATOM   7501  C  C     . CYS A 1 1160 ? 14.389  70.941  -31.065 1.00 65.95  ? 1188 CYS A C     1 
ATOM   7502  O  O     . CYS A 1 1160 ? 14.254  70.878  -32.286 1.00 65.46  ? 1188 CYS A O     1 
ATOM   7503  C  CB    . CYS A 1 1160 ? 12.344  71.506  -29.735 1.00 46.62  ? 1188 CYS A CB    1 
ATOM   7504  S  SG    . CYS A 1 1160 ? 11.260  70.802  -31.000 1.00 43.18  ? 1188 CYS A SG    1 
ATOM   7505  N  N     . LEU A 1 1161 ? 15.144  70.089  -30.381 1.00 69.15  ? 1189 LEU A N     1 
ATOM   7506  C  CA    . LEU A 1 1161 ? 15.861  69.019  -31.063 1.00 67.98  ? 1189 LEU A CA    1 
ATOM   7507  C  C     . LEU A 1 1161 ? 14.987  67.774  -31.180 1.00 56.15  ? 1189 LEU A C     1 
ATOM   7508  O  O     . LEU A 1 1161 ? 14.331  67.366  -30.222 1.00 46.61  ? 1189 LEU A O     1 
ATOM   7509  C  CB    . LEU A 1 1161 ? 17.176  68.699  -30.341 1.00 65.55  ? 1189 LEU A CB    1 
ATOM   7510  C  CG    . LEU A 1 1161 ? 17.155  68.182  -28.900 1.00 45.96  ? 1189 LEU A CG    1 
ATOM   7511  C  CD1   . LEU A 1 1161 ? 17.220  66.661  -28.861 1.00 48.24  ? 1189 LEU A CD1   1 
ATOM   7512  C  CD2   . LEU A 1 1161 ? 18.295  68.787  -28.097 1.00 71.34  ? 1189 LEU A CD2   1 
ATOM   7513  N  N     . ARG A 1 1162 ? 14.970  67.187  -32.371 1.00 56.31  ? 1190 ARG A N     1 
ATOM   7514  C  CA    . ARG A 1 1162 ? 14.211  65.968  -32.615 1.00 47.91  ? 1190 ARG A CA    1 
ATOM   7515  C  C     . ARG A 1 1162 ? 14.845  65.183  -33.756 1.00 60.10  ? 1190 ARG A C     1 
ATOM   7516  O  O     . ARG A 1 1162 ? 15.957  65.488  -34.187 1.00 69.03  ? 1190 ARG A O     1 
ATOM   7517  C  CB    . ARG A 1 1162 ? 12.746  66.284  -32.930 1.00 68.64  ? 1190 ARG A CB    1 
ATOM   7518  C  CG    . ARG A 1 1162 ? 12.533  67.081  -34.207 1.00 77.38  ? 1190 ARG A CG    1 
ATOM   7519  C  CD    . ARG A 1 1162 ? 12.507  68.577  -33.944 1.00 77.68  ? 1190 ARG A CD    1 
ATOM   7520  N  NE    . ARG A 1 1162 ? 11.225  69.020  -33.404 1.00 75.21  ? 1190 ARG A NE    1 
ATOM   7521  C  CZ    . ARG A 1 1162 ? 10.238  69.518  -34.142 1.00 69.57  ? 1190 ARG A CZ    1 
ATOM   7522  N  NH1   . ARG A 1 1162 ? 10.384  69.639  -35.455 1.00 75.01  ? 1190 ARG A NH1   1 
ATOM   7523  N  NH2   . ARG A 1 1162 ? 9.104   69.896  -33.569 1.00 65.18  ? 1190 ARG A NH2   1 
ATOM   7524  N  N     . LYS A 1 1163 ? 14.133  64.175  -34.246 1.00 46.50  ? 1191 LYS A N     1 
ATOM   7525  C  CA    . LYS A 1 1163 ? 14.672  63.291  -35.271 1.00 56.63  ? 1191 LYS A CA    1 
ATOM   7526  C  C     . LYS A 1 1163 ? 14.428  63.862  -36.662 1.00 66.18  ? 1191 LYS A C     1 
ATOM   7527  O  O     . LYS A 1 1163 ? 15.321  64.457  -37.266 1.00 55.74  ? 1191 LYS A O     1 
ATOM   7528  C  CB    . LYS A 1 1163 ? 14.057  61.892  -35.156 1.00 72.02  ? 1191 LYS A CB    1 
ATOM   7529  C  CG    . LYS A 1 1163 ? 14.155  61.268  -33.767 1.00 68.92  ? 1191 LYS A CG    1 
ATOM   7530  C  CD    . LYS A 1 1163 ? 12.938  61.610  -32.912 1.00 72.72  ? 1191 LYS A CD    1 
ATOM   7531  C  CE    . LYS A 1 1163 ? 13.337  62.327  -31.630 1.00 77.29  ? 1191 LYS A CE    1 
ATOM   7532  N  NZ    . LYS A 1 1163 ? 12.150  62.815  -30.869 1.00 45.40  ? 1191 LYS A NZ    1 
ATOM   7533  N  N     . GLU A 1 1164 ? 13.214  63.676  -37.166 1.00 72.05  ? 1192 GLU A N     1 
ATOM   7534  C  CA    . GLU A 1 1164 ? 12.834  64.228  -38.458 1.00 76.86  ? 1192 GLU A CA    1 
ATOM   7535  C  C     . GLU A 1 1164 ? 12.431  65.687  -38.283 1.00 69.78  ? 1192 GLU A C     1 
ATOM   7536  O  O     . GLU A 1 1164 ? 12.085  66.109  -37.182 1.00 75.48  ? 1192 GLU A O     1 
ATOM   7537  C  CB    . GLU A 1 1164 ? 11.690  63.421  -39.076 1.00 71.99  ? 1192 GLU A CB    1 
ATOM   7538  C  CG    . GLU A 1 1164 ? 11.646  63.460  -40.595 1.00 76.07  ? 1192 GLU A CG    1 
ATOM   7539  C  CD    . GLU A 1 1164 ? 12.790  62.691  -41.231 1.00 87.99  ? 1192 GLU A CD    1 
ATOM   7540  O  OE1   . GLU A 1 1164 ? 13.344  61.788  -40.568 1.00 85.03  ? 1192 GLU A OE1   1 
ATOM   7541  O  OE2   . GLU A 1 1164 ? 13.138  62.990  -42.393 1.00 90.12  ? 1192 GLU A OE2   1 
ATOM   7542  N  N     . VAL A 1 1165 ? 12.481  66.456  -39.366 1.00 85.95  ? 1193 VAL A N     1 
ATOM   7543  C  CA    . VAL A 1 1165 ? 12.105  67.865  -39.315 1.00 91.84  ? 1193 VAL A CA    1 
ATOM   7544  C  C     . VAL A 1 1165 ? 10.627  68.031  -38.962 1.00 86.35  ? 1193 VAL A C     1 
ATOM   7545  O  O     . VAL A 1 1165 ? 10.250  68.970  -38.260 1.00 86.70  ? 1193 VAL A O     1 
ATOM   7546  C  CB    . VAL A 1 1165 ? 12.405  68.577  -40.648 1.00 92.77  ? 1193 VAL A CB    1 
ATOM   7547  C  CG1   . VAL A 1 1165 ? 13.890  68.888  -40.757 1.00 81.41  ? 1193 VAL A CG1   1 
ATOM   7548  C  CG2   . VAL A 1 1165 ? 11.939  67.731  -41.825 1.00 92.69  ? 1193 VAL A CG2   1 
ATOM   7549  N  N     . THR A 1 1166 ? 9.797   67.113  -39.449 1.00 86.96  ? 1194 THR A N     1 
ATOM   7550  C  CA    . THR A 1 1166 ? 8.385   67.079  -39.082 1.00 75.24  ? 1194 THR A CA    1 
ATOM   7551  C  C     . THR A 1 1166 ? 8.201   66.225  -37.832 1.00 69.77  ? 1194 THR A C     1 
ATOM   7552  O  O     . THR A 1 1166 ? 8.726   65.114  -37.752 1.00 72.40  ? 1194 THR A O     1 
ATOM   7553  C  CB    . THR A 1 1166 ? 7.514   66.522  -40.222 1.00 69.50  ? 1194 THR A CB    1 
ATOM   7554  O  OG1   . THR A 1 1166 ? 8.015   65.242  -40.626 1.00 75.62  ? 1194 THR A OG1   1 
ATOM   7555  C  CG2   . THR A 1 1166 ? 7.534   67.465  -41.414 1.00 74.45  ? 1194 THR A CG2   1 
ATOM   7556  N  N     . MET A 1 1167 ? 7.457   66.740  -36.858 1.00 70.48  ? 1195 MET A N     1 
ATOM   7557  C  CA    . MET A 1 1167 ? 7.346   66.060  -35.573 1.00 68.40  ? 1195 MET A CA    1 
ATOM   7558  C  C     . MET A 1 1167 ? 5.925   66.058  -35.017 1.00 68.19  ? 1195 MET A C     1 
ATOM   7559  O  O     . MET A 1 1167 ? 5.334   67.111  -34.775 1.00 67.10  ? 1195 MET A O     1 
ATOM   7560  C  CB    . MET A 1 1167 ? 8.301   66.700  -34.559 1.00 67.26  ? 1195 MET A CB    1 
ATOM   7561  C  CG    . MET A 1 1167 ? 8.495   65.908  -33.271 1.00 56.72  ? 1195 MET A CG    1 
ATOM   7562  S  SD    . MET A 1 1167 ? 7.257   66.248  -32.004 1.00 85.70  ? 1195 MET A SD    1 
ATOM   7563  C  CE    . MET A 1 1167 ? 7.869   65.244  -30.654 1.00 69.86  ? 1195 MET A CE    1 
ATOM   7564  N  N     . ASP A 1 1168 ? 5.389   64.859  -34.815 1.00 87.83  ? 1196 ASP A N     1 
ATOM   7565  C  CA    . ASP A 1 1168 ? 4.118   64.686  -34.126 1.00 74.34  ? 1196 ASP A CA    1 
ATOM   7566  C  C     . ASP A 1 1168 ? 4.382   64.046  -32.770 1.00 68.46  ? 1196 ASP A C     1 
ATOM   7567  O  O     . ASP A 1 1168 ? 5.478   63.546  -32.521 1.00 70.37  ? 1196 ASP A O     1 
ATOM   7568  C  CB    . ASP A 1 1168 ? 3.158   63.827  -34.947 1.00 74.78  ? 1196 ASP A CB    1 
ATOM   7569  C  CG    . ASP A 1 1168 ? 3.636   62.395  -35.093 1.00 91.46  ? 1196 ASP A CG    1 
ATOM   7570  O  OD1   . ASP A 1 1168 ? 4.382   62.112  -36.052 1.00 91.51  ? 1196 ASP A OD1   1 
ATOM   7571  O  OD2   . ASP A 1 1168 ? 3.265   61.552  -34.248 1.00 91.41  ? 1196 ASP A OD2   1 
ATOM   7572  N  N     . CYS A 1 1169 ? 3.383   64.055  -31.895 1.00 87.20  ? 1197 CYS A N     1 
ATOM   7573  C  CA    . CYS A 1 1169 ? 3.571   63.524  -30.551 1.00 75.87  ? 1197 CYS A CA    1 
ATOM   7574  C  C     . CYS A 1 1169 ? 2.264   63.072  -29.905 1.00 72.98  ? 1197 CYS A C     1 
ATOM   7575  O  O     . CYS A 1 1169 ? 1.184   63.262  -30.464 1.00 69.49  ? 1197 CYS A O     1 
ATOM   7576  C  CB    . CYS A 1 1169 ? 4.264   64.568  -29.674 1.00 77.93  ? 1197 CYS A CB    1 
ATOM   7577  S  SG    . CYS A 1 1169 ? 4.011   66.275  -30.206 1.00 76.75  ? 1197 CYS A SG    1 
ATOM   7578  N  N     . LYS A 1 1170 ? 2.377   62.474  -28.722 1.00 56.76  ? 1198 LYS A N     1 
ATOM   7579  C  CA    . LYS A 1 1170 ? 1.228   61.889  -28.040 1.00 55.27  ? 1198 LYS A CA    1 
ATOM   7580  C  C     . LYS A 1 1170 ? 0.619   62.834  -27.005 1.00 76.91  ? 1198 LYS A C     1 
ATOM   7581  O  O     . LYS A 1 1170 ? -0.489  63.335  -27.194 1.00 73.34  ? 1198 LYS A O     1 
ATOM   7582  C  CB    . LYS A 1 1170 ? 1.631   60.571  -27.368 1.00 69.57  ? 1198 LYS A CB    1 
ATOM   7583  C  CG    . LYS A 1 1170 ? 0.522   59.522  -27.273 1.00 44.19  ? 1198 LYS A CG    1 
ATOM   7584  C  CD    . LYS A 1 1170 ? -0.574  59.926  -26.299 1.00 42.35  ? 1198 LYS A CD    1 
ATOM   7585  C  CE    . LYS A 1 1170 ? -0.001  60.188  -24.919 1.00 41.30  ? 1198 LYS A CE    1 
ATOM   7586  N  NZ    . LYS A 1 1170 ? -0.919  61.008  -24.083 1.00 86.32  ? 1198 LYS A NZ    1 
ATOM   7587  N  N     . THR A 1 1171 ? 1.340   63.055  -25.908 1.00 77.20  ? 1199 THR A N     1 
ATOM   7588  C  CA    . THR A 1 1171 ? 0.805   63.781  -24.752 1.00 72.10  ? 1199 THR A CA    1 
ATOM   7589  C  C     . THR A 1 1171 ? 0.279   65.194  -25.059 1.00 75.71  ? 1199 THR A C     1 
ATOM   7590  O  O     . THR A 1 1171 ? -0.848  65.516  -24.678 1.00 72.70  ? 1199 THR A O     1 
ATOM   7591  C  CB    . THR A 1 1171 ? 1.859   63.884  -23.621 1.00 76.53  ? 1199 THR A CB    1 
ATOM   7592  O  OG1   . THR A 1 1171 ? 2.340   62.577  -23.286 1.00 70.95  ? 1199 THR A OG1   1 
ATOM   7593  C  CG2   . THR A 1 1171 ? 1.252   64.531  -22.389 1.00 72.15  ? 1199 THR A CG2   1 
ATOM   7594  N  N     . PRO A 1 1172 ? 1.077   66.045  -25.738 1.00 74.21  ? 1200 PRO A N     1 
ATOM   7595  C  CA    . PRO A 1 1172 ? 0.516   67.368  -26.028 1.00 74.98  ? 1200 PRO A CA    1 
ATOM   7596  C  C     . PRO A 1 1172 ? -0.471  67.315  -27.187 1.00 68.97  ? 1200 PRO A C     1 
ATOM   7597  O  O     . PRO A 1 1172 ? -1.189  68.290  -27.426 1.00 93.16  ? 1200 PRO A O     1 
ATOM   7598  C  CB    . PRO A 1 1172 ? 1.748   68.198  -26.394 1.00 68.80  ? 1200 PRO A CB    1 
ATOM   7599  C  CG    . PRO A 1 1172 ? 2.682   67.214  -26.989 1.00 42.88  ? 1200 PRO A CG    1 
ATOM   7600  C  CD    . PRO A 1 1172 ? 2.452   65.917  -26.259 1.00 40.18  ? 1200 PRO A CD    1 
ATOM   7601  N  N     . SER A 1 1173 ? -0.481  66.191  -27.902 1.00 74.58  ? 1201 SER A N     1 
ATOM   7602  C  CA    . SER A 1 1173 ? -1.426  65.934  -28.989 1.00 74.01  ? 1201 SER A CA    1 
ATOM   7603  C  C     . SER A 1 1173 ? -1.248  66.909  -30.151 1.00 72.91  ? 1201 SER A C     1 
ATOM   7604  O  O     . SER A 1 1173 ? -1.059  66.495  -31.294 1.00 75.65  ? 1201 SER A O     1 
ATOM   7605  C  CB    . SER A 1 1173 ? -2.858  65.987  -28.460 1.00 49.24  ? 1201 SER A CB    1 
ATOM   7606  O  OG    . SER A 1 1173 ? -2.955  65.286  -27.232 1.00 92.54  ? 1201 SER A OG    1 
ATOM   7607  N  N     . ASN A 1 1174 ? -1.317  68.202  -29.850 1.00 76.14  ? 1202 ASN A N     1 
ATOM   7608  C  CA    . ASN A 1 1174 ? -1.034  69.244  -30.826 1.00 84.33  ? 1202 ASN A CA    1 
ATOM   7609  C  C     . ASN A 1 1174 ? 0.308   69.919  -30.542 1.00 85.40  ? 1202 ASN A C     1 
ATOM   7610  O  O     . ASN A 1 1174 ? 0.401   70.780  -29.668 1.00 73.32  ? 1202 ASN A O     1 
ATOM   7611  C  CB    . ASN A 1 1174 ? -2.160  70.281  -30.839 1.00 87.70  ? 1202 ASN A CB    1 
ATOM   7612  C  CG    . ASN A 1 1174 ? -2.639  70.642  -29.443 1.00 81.24  ? 1202 ASN A CG    1 
ATOM   7613  O  OD1   . ASN A 1 1174 ? -2.156  71.596  -28.834 1.00 81.90  ? 1202 ASN A OD1   1 
ATOM   7614  N  ND2   . ASN A 1 1174 ? -3.597  69.877  -28.931 1.00 90.49  ? 1202 ASN A ND2   1 
ATOM   7615  N  N     . PRO A 1 1175 ? 1.358   69.521  -31.281 1.00 86.55  ? 1203 PRO A N     1 
ATOM   7616  C  CA    . PRO A 1 1175 ? 2.709   70.074  -31.113 1.00 73.39  ? 1203 PRO A CA    1 
ATOM   7617  C  C     . PRO A 1 1175 ? 2.773   71.572  -31.399 1.00 85.66  ? 1203 PRO A C     1 
ATOM   7618  O  O     . PRO A 1 1175 ? 3.166   72.350  -30.528 1.00 75.92  ? 1203 PRO A O     1 
ATOM   7619  C  CB    . PRO A 1 1175 ? 3.542   69.289  -32.134 1.00 73.59  ? 1203 PRO A CB    1 
ATOM   7620  C  CG    . PRO A 1 1175 ? 2.555   68.771  -33.126 1.00 70.35  ? 1203 PRO A CG    1 
ATOM   7621  C  CD    . PRO A 1 1175 ? 1.306   68.504  -32.346 1.00 75.24  ? 1203 PRO A CD    1 
ATOM   7622  N  N     . THR A 1 1176 ? 2.388   71.965  -32.609 1.00 90.23  ? 1204 THR A N     1 
ATOM   7623  C  CA    . THR A 1 1176 ? 2.355   73.373  -32.986 1.00 69.57  ? 1204 THR A CA    1 
ATOM   7624  C  C     . THR A 1 1176 ? 1.191   74.062  -32.277 1.00 74.23  ? 1204 THR A C     1 
ATOM   7625  O  O     . THR A 1 1176 ? 1.133   75.291  -32.204 1.00 76.56  ? 1204 THR A O     1 
ATOM   7626  C  CB    . THR A 1 1176 ? 2.228   73.548  -34.515 1.00 76.74  ? 1204 THR A CB    1 
ATOM   7627  O  OG1   . THR A 1 1176 ? 3.088   72.613  -35.178 1.00 70.11  ? 1204 THR A OG1   1 
ATOM   7628  C  CG2   . THR A 1 1176 ? 2.611   74.961  -34.935 1.00 70.23  ? 1204 THR A CG2   1 
ATOM   7629  N  N     . GLY A 1 1177 ? 0.266   73.260  -31.755 1.00 71.38  ? 1205 GLY A N     1 
ATOM   7630  C  CA    . GLY A 1 1177 ? -0.794  73.766  -30.902 1.00 74.92  ? 1205 GLY A CA    1 
ATOM   7631  C  C     . GLY A 1 1177 ? -0.187  74.442  -29.689 1.00 76.73  ? 1205 GLY A C     1 
ATOM   7632  O  O     . GLY A 1 1177 ? -0.625  75.516  -29.277 1.00 71.49  ? 1205 GLY A O     1 
ATOM   7633  N  N     . MET A 1 1178 ? 0.829   73.802  -29.117 1.00 74.72  ? 1206 MET A N     1 
ATOM   7634  C  CA    . MET A 1 1178 ? 1.655   74.437  -28.100 1.00 73.03  ? 1206 MET A CA    1 
ATOM   7635  C  C     . MET A 1 1178 ? 2.646   75.344  -28.818 1.00 69.44  ? 1206 MET A C     1 
ATOM   7636  O  O     . MET A 1 1178 ? 2.887   75.174  -30.013 1.00 75.18  ? 1206 MET A O     1 
ATOM   7637  C  CB    . MET A 1 1178 ? 2.383   73.398  -27.245 1.00 91.00  ? 1206 MET A CB    1 
ATOM   7638  C  CG    . MET A 1 1178 ? 1.573   72.141  -26.955 1.00 90.80  ? 1206 MET A CG    1 
ATOM   7639  S  SD    . MET A 1 1178 ? -0.009  72.467  -26.153 1.00 71.22  ? 1206 MET A SD    1 
ATOM   7640  C  CE    . MET A 1 1178 ? 0.527   73.346  -24.687 1.00 92.57  ? 1206 MET A CE    1 
ATOM   7641  N  N     . GLU A 1 1179 ? 3.218   76.305  -28.101 1.00 72.41  ? 1207 GLU A N     1 
ATOM   7642  C  CA    . GLU A 1 1179 ? 4.096   77.290  -28.724 1.00 77.56  ? 1207 GLU A CA    1 
ATOM   7643  C  C     . GLU A 1 1179 ? 5.333   76.637  -29.341 1.00 74.88  ? 1207 GLU A C     1 
ATOM   7644  O  O     . GLU A 1 1179 ? 6.353   76.457  -28.675 1.00 72.81  ? 1207 GLU A O     1 
ATOM   7645  C  CB    . GLU A 1 1179 ? 4.508   78.354  -27.706 1.00 70.48  ? 1207 GLU A CB    1 
ATOM   7646  C  CG    . GLU A 1 1179 ? 3.341   78.958  -26.931 1.00 69.53  ? 1207 GLU A CG    1 
ATOM   7647  C  CD    . GLU A 1 1179 ? 2.316   79.638  -27.826 1.00 72.65  ? 1207 GLU A CD    1 
ATOM   7648  O  OE1   . GLU A 1 1179 ? 2.710   80.218  -28.860 1.00 68.33  ? 1207 GLU A OE1   1 
ATOM   7649  O  OE2   . GLU A 1 1179 ? 1.112   79.591  -27.493 1.00 72.13  ? 1207 GLU A OE2   1 
ATOM   7650  N  N     . ARG A 1 1180 ? 5.227   76.283  -30.618 1.00 70.85  ? 1208 ARG A N     1 
ATOM   7651  C  CA    . ARG A 1 1180 ? 6.329   75.655  -31.340 1.00 73.40  ? 1208 ARG A CA    1 
ATOM   7652  C  C     . ARG A 1 1180 ? 6.505   76.251  -32.734 1.00 76.25  ? 1208 ARG A C     1 
ATOM   7653  O  O     . ARG A 1 1180 ? 5.795   77.181  -33.118 1.00 76.88  ? 1208 ARG A O     1 
ATOM   7654  C  CB    . ARG A 1 1180 ? 6.109   74.145  -31.454 1.00 84.13  ? 1208 ARG A CB    1 
ATOM   7655  C  CG    . ARG A 1 1180 ? 6.270   73.379  -30.153 1.00 86.73  ? 1208 ARG A CG    1 
ATOM   7656  C  CD    . ARG A 1 1180 ? 6.276   71.880  -30.416 1.00 90.39  ? 1208 ARG A CD    1 
ATOM   7657  N  NE    . ARG A 1 1180 ? 6.439   71.102  -29.193 1.00 70.27  ? 1208 ARG A NE    1 
ATOM   7658  C  CZ    . ARG A 1 1180 ? 6.557   69.780  -29.163 1.00 74.36  ? 1208 ARG A CZ    1 
ATOM   7659  N  NH1   . ARG A 1 1180 ? 6.530   69.086  -30.293 1.00 74.73  ? 1208 ARG A NH1   1 
ATOM   7660  N  NH2   . ARG A 1 1180 ? 6.703   69.151  -28.006 1.00 64.14  ? 1208 ARG A NH2   1 
ATOM   7661  N  N     . ARG A 1 1181 ? 7.460   75.708  -33.484 1.00 75.69  ? 1209 ARG A N     1 
ATOM   7662  C  CA    . ARG A 1 1181 ? 7.697   76.126  -34.861 1.00 56.60  ? 1209 ARG A CA    1 
ATOM   7663  C  C     . ARG A 1 1181 ? 7.786   74.911  -35.779 1.00 55.36  ? 1209 ARG A C     1 
ATOM   7664  O  O     . ARG A 1 1181 ? 7.119   73.901  -35.554 1.00 56.19  ? 1209 ARG A O     1 
ATOM   7665  C  CB    . ARG A 1 1181 ? 8.977   76.962  -34.970 1.00 77.12  ? 1209 ARG A CB    1 
ATOM   7666  C  CG    . ARG A 1 1181 ? 8.976   78.230  -34.128 1.00 69.57  ? 1209 ARG A CG    1 
ATOM   7667  C  CD    . ARG A 1 1181 ? 9.981   79.253  -34.645 1.00 75.38  ? 1209 ARG A CD    1 
ATOM   7668  N  NE    . ARG A 1 1181 ? 11.346  78.735  -34.668 1.00 71.68  ? 1209 ARG A NE    1 
ATOM   7669  C  CZ    . ARG A 1 1181 ? 12.221  78.889  -33.679 1.00 76.55  ? 1209 ARG A CZ    1 
ATOM   7670  N  NH1   . ARG A 1 1181 ? 11.875  79.546  -32.580 1.00 72.92  ? 1209 ARG A NH1   1 
ATOM   7671  N  NH2   . ARG A 1 1181 ? 13.443  78.386  -33.788 1.00 68.06  ? 1209 ARG A NH2   1 
ATOM   7672  N  N     . TYR A 1 1182 ? 8.617   75.014  -36.811 1.00 68.67  ? 1210 TYR A N     1 
ATOM   7673  C  CA    . TYR A 1 1182 ? 8.814   73.915  -37.747 1.00 72.95  ? 1210 TYR A CA    1 
ATOM   7674  C  C     . TYR A 1 1182 ? 10.298  73.724  -38.046 1.00 68.53  ? 1210 TYR A C     1 
ATOM   7675  O  O     . TYR A 1 1182 ? 11.132  74.518  -37.613 1.00 69.90  ? 1210 TYR A O     1 
ATOM   7676  C  CB    . TYR A 1 1182 ? 8.038   74.167  -39.041 1.00 68.98  ? 1210 TYR A CB    1 
ATOM   7677  C  CG    . TYR A 1 1182 ? 7.161   73.010  -39.463 1.00 75.56  ? 1210 TYR A CG    1 
ATOM   7678  C  CD1   . TYR A 1 1182 ? 7.648   72.013  -40.298 1.00 87.64  ? 1210 TYR A CD1   1 
ATOM   7679  C  CD2   . TYR A 1 1182 ? 5.846   72.914  -39.025 1.00 76.48  ? 1210 TYR A CD2   1 
ATOM   7680  C  CE1   . TYR A 1 1182 ? 6.850   70.953  -40.686 1.00 87.70  ? 1210 TYR A CE1   1 
ATOM   7681  C  CE2   . TYR A 1 1182 ? 5.040   71.857  -39.408 1.00 68.17  ? 1210 TYR A CE2   1 
ATOM   7682  C  CZ    . TYR A 1 1182 ? 5.547   70.880  -40.238 1.00 86.14  ? 1210 TYR A CZ    1 
ATOM   7683  O  OH    . TYR A 1 1182 ? 4.749   69.827  -40.621 1.00 90.18  ? 1210 TYR A OH    1 
ATOM   7684  N  N     . GLY A 1 1183 ? 10.622  72.667  -38.784 1.00 68.53  ? 1211 GLY A N     1 
ATOM   7685  C  CA    . GLY A 1 1183 ? 12.001  72.375  -39.136 1.00 75.20  ? 1211 GLY A CA    1 
ATOM   7686  C  C     . GLY A 1 1183 ? 12.270  72.537  -40.620 1.00 69.93  ? 1211 GLY A C     1 
ATOM   7687  O  O     . GLY A 1 1183 ? 11.344  72.740  -41.406 1.00 69.29  ? 1211 GLY A O     1 
ATOM   7688  N  N     . ILE A 1 1184 ? 13.539  72.448  -41.006 1.00 73.17  ? 1212 ILE A N     1 
ATOM   7689  C  CA    . ILE A 1 1184 ? 13.919  72.588  -42.409 1.00 90.56  ? 1212 ILE A CA    1 
ATOM   7690  C  C     . ILE A 1 1184 ? 14.952  71.545  -42.838 1.00 87.24  ? 1212 ILE A C     1 
ATOM   7691  O  O     . ILE A 1 1184 ? 16.012  71.422  -42.223 1.00 72.88  ? 1212 ILE A O     1 
ATOM   7692  C  CB    . ILE A 1 1184 ? 14.478  73.998  -42.706 1.00 77.10  ? 1212 ILE A CB    1 
ATOM   7693  C  CG1   . ILE A 1 1184 ? 15.421  74.450  -41.589 1.00 69.09  ? 1212 ILE A CG1   1 
ATOM   7694  C  CG2   . ILE A 1 1184 ? 13.345  75.000  -42.871 1.00 74.55  ? 1212 ILE A CG2   1 
ATOM   7695  C  CD1   . ILE A 1 1184 ? 16.012  75.826  -41.810 1.00 74.50  ? 1212 ILE A CD1   1 
ATOM   7696  N  N     . PRO A 1 1185 ? 14.635  70.782  -43.896 1.00 87.27  ? 1213 PRO A N     1 
ATOM   7697  C  CA    . PRO A 1 1185 ? 15.568  69.811  -44.478 1.00 85.45  ? 1213 PRO A CA    1 
ATOM   7698  C  C     . PRO A 1 1185 ? 16.751  70.506  -45.144 1.00 40.11  ? 1213 PRO A C     1 
ATOM   7699  O  O     . PRO A 1 1185 ? 16.559  71.526  -45.806 1.00 46.59  ? 1213 PRO A O     1 
ATOM   7700  C  CB    . PRO A 1 1185 ? 14.714  69.072  -45.517 1.00 92.05  ? 1213 PRO A CB    1 
ATOM   7701  C  CG    . PRO A 1 1185 ? 13.294  69.354  -45.131 1.00 84.71  ? 1213 PRO A CG    1 
ATOM   7702  C  CD    . PRO A 1 1185 ? 13.314  70.727  -44.544 1.00 87.25  ? 1213 PRO A CD    1 
ATOM   7703  N  N     . GLN A 1 1186 ? 17.952  69.961  -44.976 1.00 75.81  ? 1214 GLN A N     1 
ATOM   7704  C  CA    . GLN A 1 1186 ? 19.148  70.594  -45.521 1.00 77.75  ? 1214 GLN A CA    1 
ATOM   7705  C  C     . GLN A 1 1186 ? 20.306  69.607  -45.670 1.00 68.65  ? 1214 GLN A C     1 
ATOM   7706  O  O     . GLN A 1 1186 ? 20.737  68.997  -44.693 1.00 71.10  ? 1214 GLN A O     1 
ATOM   7707  C  CB    . GLN A 1 1186 ? 19.574  71.763  -44.632 1.00 76.08  ? 1214 GLN A CB    1 
ATOM   7708  C  CG    . GLN A 1 1186 ? 20.226  72.906  -45.382 1.00 74.91  ? 1214 GLN A CG    1 
ATOM   7709  C  CD    . GLN A 1 1186 ? 19.242  73.677  -46.239 1.00 70.90  ? 1214 GLN A CD    1 
ATOM   7710  O  OE1   . GLN A 1 1186 ? 19.613  74.262  -47.255 1.00 68.56  ? 1214 GLN A OE1   1 
ATOM   7711  N  NE2   . GLN A 1 1186 ? 17.979  73.686  -45.828 1.00 77.28  ? 1214 GLN A NE2   1 
ATOM   7712  N  N     . GLY A 1 1187 ? 20.812  69.456  -46.892 1.00 73.25  ? 1215 GLY A N     1 
ATOM   7713  C  CA    . GLY A 1 1187 ? 20.295  70.177  -48.041 1.00 77.18  ? 1215 GLY A CA    1 
ATOM   7714  C  C     . GLY A 1 1187 ? 21.381  70.655  -48.987 1.00 70.27  ? 1215 GLY A C     1 
ATOM   7715  O  O     . GLY A 1 1187 ? 22.558  70.336  -48.816 1.00 48.73  ? 1215 GLY A O     1 
ATOM   7716  N  N     . GLU A 1 1188 ? 20.975  71.423  -49.994 1.00 73.56  ? 1216 GLU A N     1 
ATOM   7717  C  CA    . GLU A 1 1188 ? 21.903  71.980  -50.973 1.00 81.16  ? 1216 GLU A CA    1 
ATOM   7718  C  C     . GLU A 1 1188 ? 21.828  73.502  -50.999 1.00 86.85  ? 1216 GLU A C     1 
ATOM   7719  O  O     . GLU A 1 1188 ? 22.673  74.165  -51.600 1.00 90.58  ? 1216 GLU A O     1 
ATOM   7720  C  CB    . GLU A 1 1188 ? 21.611  71.421  -52.368 1.00 81.94  ? 1216 GLU A CB    1 
ATOM   7721  C  CG    . GLU A 1 1188 ? 22.249  70.071  -52.655 1.00 68.67  ? 1216 GLU A CG    1 
ATOM   7722  C  CD    . GLU A 1 1188 ? 23.703  70.189  -53.073 1.00 69.56  ? 1216 GLU A CD    1 
ATOM   7723  O  OE1   . GLU A 1 1188 ? 24.196  71.330  -53.204 1.00 68.92  ? 1216 GLU A OE1   1 
ATOM   7724  O  OE2   . GLU A 1 1188 ? 24.351  69.141  -53.277 1.00 77.69  ? 1216 GLU A OE2   1 
ATOM   7725  N  N     . ALA A 1 1189 ? 20.810  74.050  -50.342 1.00 84.03  ? 1217 ALA A N     1 
ATOM   7726  C  CA    . ALA A 1 1189 ? 20.585  75.490  -50.340 1.00 84.41  ? 1217 ALA A CA    1 
ATOM   7727  C  C     . ALA A 1 1189 ? 21.462  76.204  -49.315 1.00 93.93  ? 1217 ALA A C     1 
ATOM   7728  O  O     . ALA A 1 1189 ? 21.550  77.432  -49.315 1.00 87.11  ? 1217 ALA A O     1 
ATOM   7729  C  CB    . ALA A 1 1189 ? 19.116  75.792  -50.079 1.00 81.72  ? 1217 ALA A CB    1 
ATOM   7730  N  N     . LEU A 1 1190 ? 22.107  75.436  -48.442 1.00 86.22  ? 1218 LEU A N     1 
ATOM   7731  C  CA    . LEU A 1 1190 ? 22.991  76.014  -47.435 1.00 77.76  ? 1218 LEU A CA    1 
ATOM   7732  C  C     . LEU A 1 1190 ? 24.412  76.127  -47.976 1.00 81.72  ? 1218 LEU A C     1 
ATOM   7733  O  O     . LEU A 1 1190 ? 25.282  76.730  -47.347 1.00 77.14  ? 1218 LEU A O     1 
ATOM   7734  C  CB    . LEU A 1 1190 ? 22.964  75.188  -46.137 1.00 73.22  ? 1218 LEU A CB    1 
ATOM   7735  C  CG    . LEU A 1 1190 ? 23.680  73.839  -45.935 1.00 68.58  ? 1218 LEU A CG    1 
ATOM   7736  C  CD1   . LEU A 1 1190 ? 23.554  72.900  -47.133 1.00 76.66  ? 1218 LEU A CD1   1 
ATOM   7737  C  CD2   . LEU A 1 1190 ? 25.142  74.010  -45.517 1.00 77.19  ? 1218 LEU A CD2   1 
ATOM   7738  N  N     . ASP A 1 1191 ? 24.634  75.551  -49.153 1.00 90.20  ? 1219 ASP A N     1 
ATOM   7739  C  CA    . ASP A 1 1191 ? 25.948  75.574  -49.784 1.00 92.67  ? 1219 ASP A CA    1 
ATOM   7740  C  C     . ASP A 1 1191 ? 26.158  76.851  -50.597 1.00 92.48  ? 1219 ASP A C     1 
ATOM   7741  O  O     . ASP A 1 1191 ? 26.941  76.870  -51.546 1.00 90.82  ? 1219 ASP A O     1 
ATOM   7742  C  CB    . ASP A 1 1191 ? 26.133  74.343  -50.676 1.00 93.15  ? 1219 ASP A CB    1 
ATOM   7743  C  CG    . ASP A 1 1191 ? 26.050  73.041  -49.899 1.00 85.98  ? 1219 ASP A CG    1 
ATOM   7744  O  OD1   . ASP A 1 1191 ? 27.042  72.684  -49.228 1.00 81.26  ? 1219 ASP A OD1   1 
ATOM   7745  O  OD2   . ASP A 1 1191 ? 24.998  72.370  -49.963 1.00 76.17  ? 1219 ASP A OD2   1 
ATOM   7746  N  N     . ILE A 1 1192 ? 25.454  77.914  -50.219 1.00 90.77  ? 1220 ILE A N     1 
ATOM   7747  C  CA    . ILE A 1 1192 ? 25.602  79.207  -50.875 1.00 92.85  ? 1220 ILE A CA    1 
ATOM   7748  C  C     . ILE A 1 1192 ? 26.044  80.272  -49.874 1.00 92.54  ? 1220 ILE A C     1 
ATOM   7749  O  O     . ILE A 1 1192 ? 26.467  81.363  -50.258 1.00 84.06  ? 1220 ILE A O     1 
ATOM   7750  C  CB    . ILE A 1 1192 ? 24.292  79.656  -51.557 1.00 81.28  ? 1220 ILE A CB    1 
ATOM   7751  C  CG1   . ILE A 1 1192 ? 23.214  79.952  -50.513 1.00 76.89  ? 1220 ILE A CG1   1 
ATOM   7752  C  CG2   . ILE A 1 1192 ? 23.813  78.602  -52.546 1.00 90.50  ? 1220 ILE A CG2   1 
ATOM   7753  C  CD1   . ILE A 1 1192 ? 21.901  80.412  -51.108 1.00 68.95  ? 1220 ILE A CD1   1 
ATOM   7754  N  N     . TYR A 1 1193 ? 25.943  79.947  -48.589 1.00 87.25  ? 1221 TYR A N     1 
ATOM   7755  C  CA    . TYR A 1 1193 ? 26.383  80.850  -47.532 1.00 87.53  ? 1221 TYR A CA    1 
ATOM   7756  C  C     . TYR A 1 1193 ? 27.749  80.424  -47.010 1.00 92.48  ? 1221 TYR A C     1 
ATOM   7757  O  O     . TYR A 1 1193 ? 27.856  79.462  -46.251 1.00 85.59  ? 1221 TYR A O     1 
ATOM   7758  C  CB    . TYR A 1 1193 ? 25.371  80.880  -46.386 1.00 91.35  ? 1221 TYR A CB    1 
ATOM   7759  C  CG    . TYR A 1 1193 ? 23.931  80.950  -46.836 1.00 86.25  ? 1221 TYR A CG    1 
ATOM   7760  C  CD1   . TYR A 1 1193 ? 23.133  79.813  -46.850 1.00 85.50  ? 1221 TYR A CD1   1 
ATOM   7761  C  CD2   . TYR A 1 1193 ? 23.368  82.150  -47.249 1.00 90.83  ? 1221 TYR A CD2   1 
ATOM   7762  C  CE1   . TYR A 1 1193 ? 21.816  79.869  -47.259 1.00 77.39  ? 1221 TYR A CE1   1 
ATOM   7763  C  CE2   . TYR A 1 1193 ? 22.052  82.216  -47.661 1.00 68.80  ? 1221 TYR A CE2   1 
ATOM   7764  C  CZ    . TYR A 1 1193 ? 21.281  81.073  -47.664 1.00 87.15  ? 1221 TYR A CZ    1 
ATOM   7765  O  OH    . TYR A 1 1193 ? 19.970  81.132  -48.074 1.00 91.77  ? 1221 TYR A OH    1 
ATOM   7766  N  N     . GLN A 1 1194 ? 28.791  81.142  -47.418 1.00 93.74  ? 1222 GLN A N     1 
ATOM   7767  C  CA    . GLN A 1 1194 ? 30.156  80.797  -47.032 1.00 87.92  ? 1222 GLN A CA    1 
ATOM   7768  C  C     . GLN A 1 1194 ? 30.406  81.048  -45.547 1.00 81.66  ? 1222 GLN A C     1 
ATOM   7769  O  O     . GLN A 1 1194 ? 29.568  81.626  -44.854 1.00 84.34  ? 1222 GLN A O     1 
ATOM   7770  C  CB    . GLN A 1 1194 ? 31.166  81.580  -47.876 1.00 73.98  ? 1222 GLN A CB    1 
ATOM   7771  C  CG    . GLN A 1 1194 ? 31.339  81.057  -49.299 1.00 72.35  ? 1222 GLN A CG    1 
ATOM   7772  C  CD    . GLN A 1 1194 ? 30.114  81.280  -50.170 1.00 71.58  ? 1222 GLN A CD    1 
ATOM   7773  O  OE1   . GLN A 1 1194 ? 29.226  82.061  -49.829 1.00 71.53  ? 1222 GLN A OE1   1 
ATOM   7774  N  NE2   . GLN A 1 1194 ? 30.063  80.589  -51.304 1.00 81.12  ? 1222 GLN A NE2   1 
ATOM   7775  N  N     . ILE A 1 1195 ? 31.567  80.614  -45.069 1.00 73.95  ? 1223 ILE A N     1 
ATOM   7776  C  CA    . ILE A 1 1195 ? 31.905  80.705  -43.653 1.00 77.27  ? 1223 ILE A CA    1 
ATOM   7777  C  C     . ILE A 1 1195 ? 32.164  82.154  -43.231 1.00 90.44  ? 1223 ILE A C     1 
ATOM   7778  O  O     . ILE A 1 1195 ? 32.155  82.476  -42.042 1.00 72.71  ? 1223 ILE A O     1 
ATOM   7779  C  CB    . ILE A 1 1195 ? 33.140  79.834  -43.319 1.00 72.27  ? 1223 ILE A CB    1 
ATOM   7780  C  CG1   . ILE A 1 1195 ? 33.216  79.544  -41.816 1.00 76.26  ? 1223 ILE A CG1   1 
ATOM   7781  C  CG2   . ILE A 1 1195 ? 34.420  80.482  -43.834 1.00 69.64  ? 1223 ILE A CG2   1 
ATOM   7782  C  CD1   . ILE A 1 1195 ? 32.038  78.754  -41.285 1.00 56.47  ? 1223 ILE A CD1   1 
ATOM   7783  N  N     . ILE A 1 1196 ? 32.383  83.024  -44.213 1.00 93.46  ? 1224 ILE A N     1 
ATOM   7784  C  CA    . ILE A 1 1196 ? 32.604  84.442  -43.953 1.00 68.12  ? 1224 ILE A CA    1 
ATOM   7785  C  C     . ILE A 1 1196 ? 31.326  85.083  -43.413 1.00 71.45  ? 1224 ILE A C     1 
ATOM   7786  O  O     . ILE A 1 1196 ? 30.222  84.668  -43.767 1.00 76.44  ? 1224 ILE A O     1 
ATOM   7787  C  CB    . ILE A 1 1196 ? 33.066  85.183  -45.228 1.00 72.65  ? 1224 ILE A CB    1 
ATOM   7788  C  CG1   . ILE A 1 1196 ? 34.153  84.381  -45.947 1.00 75.19  ? 1224 ILE A CG1   1 
ATOM   7789  C  CG2   . ILE A 1 1196 ? 33.570  86.581  -44.896 1.00 68.50  ? 1224 ILE A CG2   1 
ATOM   7790  C  CD1   . ILE A 1 1196 ? 35.415  84.192  -45.132 1.00 77.81  ? 1224 ILE A CD1   1 
ATOM   7791  N  N     . GLU A 1 1197 ? 31.482  86.084  -42.551 1.00 75.04  ? 1225 GLU A N     1 
ATOM   7792  C  CA    . GLU A 1 1197 ? 30.347  86.758  -41.926 1.00 87.12  ? 1225 GLU A CA    1 
ATOM   7793  C  C     . GLU A 1 1197 ? 29.417  87.408  -42.947 1.00 85.27  ? 1225 GLU A C     1 
ATOM   7794  O  O     . GLU A 1 1197 ? 28.200  87.240  -42.885 1.00 85.16  ? 1225 GLU A O     1 
ATOM   7795  C  CB    . GLU A 1 1197 ? 30.840  87.819  -40.940 1.00 93.85  ? 1225 GLU A CB    1 
ATOM   7796  C  CG    . GLU A 1 1197 ? 31.835  87.305  -39.915 1.00 72.55  ? 1225 GLU A CG    1 
ATOM   7797  C  CD    . GLU A 1 1197 ? 32.358  88.407  -39.015 1.00 70.15  ? 1225 GLU A CD    1 
ATOM   7798  O  OE1   . GLU A 1 1197 ? 31.780  89.514  -39.033 1.00 75.53  ? 1225 GLU A OE1   1 
ATOM   7799  O  OE2   . GLU A 1 1197 ? 33.348  88.167  -38.293 1.00 73.91  ? 1225 GLU A OE2   1 
ATOM   7800  N  N     . LEU A 1 1198 ? 29.997  88.150  -43.884 1.00 84.92  ? 1226 LEU A N     1 
ATOM   7801  C  CA    . LEU A 1 1198 ? 29.215  88.872  -44.882 1.00 68.97  ? 1226 LEU A CA    1 
ATOM   7802  C  C     . LEU A 1 1198 ? 28.606  87.933  -45.920 1.00 87.24  ? 1226 LEU A C     1 
ATOM   7803  O  O     . LEU A 1 1198 ? 29.267  87.544  -46.883 1.00 76.22  ? 1226 LEU A O     1 
ATOM   7804  C  CB    . LEU A 1 1198 ? 30.082  89.926  -45.573 1.00 68.84  ? 1226 LEU A CB    1 
ATOM   7805  C  CG    . LEU A 1 1198 ? 30.715  90.973  -44.653 1.00 70.39  ? 1226 LEU A CG    1 
ATOM   7806  C  CD1   . LEU A 1 1198 ? 31.521  91.984  -45.456 1.00 68.44  ? 1226 LEU A CD1   1 
ATOM   7807  C  CD2   . LEU A 1 1198 ? 29.650  91.669  -43.819 1.00 71.44  ? 1226 LEU A CD2   1 
ATOM   7808  N  N     . THR A 1 1199 ? 27.342  87.574  -45.715 1.00 72.12  ? 1227 THR A N     1 
ATOM   7809  C  CA    . THR A 1 1199 ? 26.622  86.715  -46.650 1.00 91.67  ? 1227 THR A CA    1 
ATOM   7810  C  C     . THR A 1 1199 ? 25.303  87.353  -47.081 1.00 92.42  ? 1227 THR A C     1 
ATOM   7811  O  O     . THR A 1 1199 ? 24.975  88.463  -46.658 1.00 91.96  ? 1227 THR A O     1 
ATOM   7812  C  CB    . THR A 1 1199 ? 26.331  85.326  -46.042 1.00 77.30  ? 1227 THR A CB    1 
ATOM   7813  O  OG1   . THR A 1 1199 ? 25.594  85.475  -44.822 1.00 74.68  ? 1227 THR A OG1   1 
ATOM   7814  C  CG2   . THR A 1 1199 ? 27.627  84.583  -45.758 1.00 69.21  ? 1227 THR A CG2   1 
ATOM   7815  N  N     . LYS A 1 1200 ? 24.562  86.640  -47.925 1.00 75.28  ? 1228 LYS A N     1 
ATOM   7816  C  CA    . LYS A 1 1200 ? 23.249  87.077  -48.398 1.00 77.25  ? 1228 LYS A CA    1 
ATOM   7817  C  C     . LYS A 1 1200 ? 23.305  88.445  -49.073 1.00 68.87  ? 1228 LYS A C     1 
ATOM   7818  O  O     . LYS A 1 1200 ? 22.367  89.235  -48.974 1.00 75.66  ? 1228 LYS A O     1 
ATOM   7819  C  CB    . LYS A 1 1200 ? 22.250  87.106  -47.239 1.00 69.45  ? 1228 LYS A CB    1 
ATOM   7820  C  CG    . LYS A 1 1200 ? 22.173  85.803  -46.463 1.00 75.31  ? 1228 LYS A CG    1 
ATOM   7821  C  CD    . LYS A 1 1200 ? 21.314  85.946  -45.220 1.00 71.34  ? 1228 LYS A CD    1 
ATOM   7822  C  CE    . LYS A 1 1200 ? 21.314  84.664  -44.405 1.00 77.73  ? 1228 LYS A CE    1 
ATOM   7823  N  NZ    . LYS A 1 1200 ? 20.514  84.796  -43.157 1.00 70.21  ? 1228 LYS A NZ    1 
ATOM   7824  N  N     . ALA B 2 44   ? -30.463 45.994  -20.578 1.00 69.99  ? 68   ALA B N     1 
ATOM   7825  C  CA    . ALA B 2 44   ? -31.839 46.446  -20.751 1.00 72.39  ? 68   ALA B CA    1 
ATOM   7826  C  C     . ALA B 2 44   ? -32.798 45.624  -19.897 1.00 70.26  ? 68   ALA B C     1 
ATOM   7827  O  O     . ALA B 2 44   ? -33.975 45.479  -20.229 1.00 77.55  ? 68   ALA B O     1 
ATOM   7828  C  CB    . ALA B 2 44   ? -32.239 46.374  -22.217 1.00 70.49  ? 68   ALA B CB    1 
ATOM   7829  N  N     . LEU B 2 45   ? -32.286 45.085  -18.795 1.00 69.01  ? 69   LEU B N     1 
ATOM   7830  C  CA    . LEU B 2 45   ? -33.097 44.290  -17.881 1.00 71.16  ? 69   LEU B CA    1 
ATOM   7831  C  C     . LEU B 2 45   ? -32.707 44.552  -16.428 1.00 73.87  ? 69   LEU B C     1 
ATOM   7832  O  O     . LEU B 2 45   ? -33.067 43.790  -15.530 1.00 71.78  ? 69   LEU B O     1 
ATOM   7833  C  CB    . LEU B 2 45   ? -32.986 42.791  -18.203 1.00 84.77  ? 69   LEU B CB    1 
ATOM   7834  C  CG    . LEU B 2 45   ? -31.689 42.112  -18.678 1.00 81.77  ? 69   LEU B CG    1 
ATOM   7835  C  CD1   . LEU B 2 45   ? -31.430 42.351  -20.167 1.00 87.13  ? 69   LEU B CD1   1 
ATOM   7836  C  CD2   . LEU B 2 45   ? -30.471 42.511  -17.846 1.00 90.16  ? 69   LEU B CD2   1 
ATOM   7837  N  N     . LEU B 2 46   ? -31.966 45.633  -16.206 1.00 76.10  ? 70   LEU B N     1 
ATOM   7838  C  CA    . LEU B 2 46   ? -31.588 46.037  -14.857 1.00 72.63  ? 70   LEU B CA    1 
ATOM   7839  C  C     . LEU B 2 46   ? -32.654 46.951  -14.272 1.00 72.29  ? 70   LEU B C     1 
ATOM   7840  O  O     . LEU B 2 46   ? -32.568 47.362  -13.116 1.00 70.06  ? 70   LEU B O     1 
ATOM   7841  C  CB    . LEU B 2 46   ? -30.230 46.745  -14.850 1.00 76.20  ? 70   LEU B CB    1 
ATOM   7842  C  CG    . LEU B 2 46   ? -30.181 48.191  -15.354 1.00 69.72  ? 70   LEU B CG    1 
ATOM   7843  C  CD1   . LEU B 2 46   ? -28.976 48.918  -14.779 1.00 71.24  ? 70   LEU B CD1   1 
ATOM   7844  C  CD2   . LEU B 2 46   ? -30.148 48.241  -16.872 1.00 75.71  ? 70   LEU B CD2   1 
ATOM   7845  N  N     . GLU B 2 47   ? -33.657 47.264  -15.086 1.00 71.96  ? 71   GLU B N     1 
ATOM   7846  C  CA    . GLU B 2 47   ? -34.738 48.153  -14.681 1.00 74.00  ? 71   GLU B CA    1 
ATOM   7847  C  C     . GLU B 2 47   ? -35.501 47.583  -13.492 1.00 74.68  ? 71   GLU B C     1 
ATOM   7848  O  O     . GLU B 2 47   ? -35.943 48.324  -12.612 1.00 72.59  ? 71   GLU B O     1 
ATOM   7849  C  CB    . GLU B 2 47   ? -35.694 48.396  -15.850 1.00 74.63  ? 71   GLU B CB    1 
ATOM   7850  C  CG    . GLU B 2 47   ? -35.037 48.305  -17.221 1.00 71.77  ? 71   GLU B CG    1 
ATOM   7851  C  CD    . GLU B 2 47   ? -33.946 49.338  -17.426 1.00 74.74  ? 71   GLU B CD    1 
ATOM   7852  O  OE1   . GLU B 2 47   ? -34.024 50.424  -16.813 1.00 73.18  ? 71   GLU B OE1   1 
ATOM   7853  O  OE2   . GLU B 2 47   ? -33.008 49.062  -18.204 1.00 72.22  ? 71   GLU B OE2   1 
ATOM   7854  N  N     . ILE B 2 48   ? -35.650 46.262  -13.472 1.00 56.01  ? 72   ILE B N     1 
ATOM   7855  C  CA    . ILE B 2 48   ? -36.314 45.583  -12.367 1.00 68.56  ? 72   ILE B CA    1 
ATOM   7856  C  C     . ILE B 2 48   ? -35.529 45.798  -11.076 1.00 64.39  ? 72   ILE B C     1 
ATOM   7857  O  O     . ILE B 2 48   ? -36.106 45.895  -9.994  1.00 56.13  ? 72   ILE B O     1 
ATOM   7858  C  CB    . ILE B 2 48   ? -36.469 44.071  -12.639 1.00 70.38  ? 72   ILE B CB    1 
ATOM   7859  C  CG1   . ILE B 2 48   ? -37.038 43.836  -14.040 1.00 73.92  ? 72   ILE B CG1   1 
ATOM   7860  C  CG2   . ILE B 2 48   ? -37.359 43.421  -11.587 1.00 72.54  ? 72   ILE B CG2   1 
ATOM   7861  C  CD1   . ILE B 2 48   ? -38.425 44.406  -14.239 1.00 66.43  ? 72   ILE B CD1   1 
ATOM   7862  N  N     . CYS B 2 49   ? -34.209 45.886  -11.201 1.00 47.57  ? 73   CYS B N     1 
ATOM   7863  C  CA    . CYS B 2 49   ? -33.354 46.148  -10.050 1.00 56.41  ? 73   CYS B CA    1 
ATOM   7864  C  C     . CYS B 2 49   ? -33.508 47.593  -9.587  1.00 68.60  ? 73   CYS B C     1 
ATOM   7865  O  O     . CYS B 2 49   ? -33.274 47.909  -8.420  1.00 68.08  ? 73   CYS B O     1 
ATOM   7866  C  CB    . CYS B 2 49   ? -31.892 45.851  -10.384 1.00 68.45  ? 73   CYS B CB    1 
ATOM   7867  S  SG    . CYS B 2 49   ? -31.601 44.186  -11.025 1.00 74.94  ? 73   CYS B SG    1 
ATOM   7868  N  N     . GLN B 2 50   ? -33.908 48.465  -10.509 1.00 67.17  ? 74   GLN B N     1 
ATOM   7869  C  CA    . GLN B 2 50   ? -34.104 49.877  -10.201 1.00 55.53  ? 74   GLN B CA    1 
ATOM   7870  C  C     . GLN B 2 50   ? -35.476 50.123  -9.587  1.00 69.71  ? 74   GLN B C     1 
ATOM   7871  O  O     . GLN B 2 50   ? -35.673 51.093  -8.856  1.00 70.98  ? 74   GLN B O     1 
ATOM   7872  C  CB    . GLN B 2 50   ? -33.937 50.735  -11.458 1.00 64.66  ? 74   GLN B CB    1 
ATOM   7873  C  CG    . GLN B 2 50   ? -32.699 50.414  -12.274 1.00 64.60  ? 74   GLN B CG    1 
ATOM   7874  C  CD    . GLN B 2 50   ? -31.421 50.501  -11.464 1.00 74.63  ? 74   GLN B CD    1 
ATOM   7875  O  OE1   . GLN B 2 50   ? -31.303 51.317  -10.551 1.00 72.87  ? 74   GLN B OE1   1 
ATOM   7876  N  NE2   . GLN B 2 50   ? -30.455 49.652  -11.795 1.00 74.04  ? 74   GLN B NE2   1 
ATOM   7877  N  N     . ARG B 2 51   ? -36.426 49.245  -9.896  1.00 72.43  ? 75   ARG B N     1 
ATOM   7878  C  CA    . ARG B 2 51   ? -37.762 49.343  -9.321  1.00 65.35  ? 75   ARG B CA    1 
ATOM   7879  C  C     . ARG B 2 51   ? -37.801 48.691  -7.944  1.00 68.81  ? 75   ARG B C     1 
ATOM   7880  O  O     . ARG B 2 51   ? -38.258 49.299  -6.975  1.00 75.26  ? 75   ARG B O     1 
ATOM   7881  C  CB    . ARG B 2 51   ? -38.802 48.693  -10.236 1.00 69.50  ? 75   ARG B CB    1 
ATOM   7882  C  CG    . ARG B 2 51   ? -38.889 49.295  -11.627 1.00 69.50  ? 75   ARG B CG    1 
ATOM   7883  C  CD    . ARG B 2 51   ? -40.104 48.757  -12.368 1.00 69.32  ? 75   ARG B CD    1 
ATOM   7884  N  NE    . ARG B 2 51   ? -40.202 47.303  -12.269 1.00 85.41  ? 75   ARG B NE    1 
ATOM   7885  C  CZ    . ARG B 2 51   ? -41.224 46.588  -12.731 1.00 81.35  ? 75   ARG B CZ    1 
ATOM   7886  N  NH1   . ARG B 2 51   ? -42.243 47.191  -13.327 1.00 91.15  ? 75   ARG B NH1   1 
ATOM   7887  N  NH2   . ARG B 2 51   ? -41.227 45.269  -12.594 1.00 81.83  ? 75   ARG B NH2   1 
ATOM   7888  N  N     . ARG B 2 52   ? -37.324 47.450  -7.873  1.00 67.27  ? 76   ARG B N     1 
ATOM   7889  C  CA    . ARG B 2 52   ? -37.284 46.691  -6.626  1.00 68.21  ? 76   ARG B CA    1 
ATOM   7890  C  C     . ARG B 2 52   ? -36.537 47.469  -5.554  1.00 74.49  ? 76   ARG B C     1 
ATOM   7891  O  O     . ARG B 2 52   ? -37.042 47.681  -4.451  1.00 68.17  ? 76   ARG B O     1 
ATOM   7892  C  CB    . ARG B 2 52   ? -36.618 45.331  -6.848  1.00 74.22  ? 76   ARG B CB    1 
ATOM   7893  C  CG    . ARG B 2 52   ? -36.581 44.443  -5.615  1.00 74.78  ? 76   ARG B CG    1 
ATOM   7894  C  CD    . ARG B 2 52   ? -35.699 43.216  -5.826  1.00 77.87  ? 76   ARG B CD    1 
ATOM   7895  N  NE    . ARG B 2 52   ? -36.092 42.436  -6.997  1.00 71.99  ? 76   ARG B NE    1 
ATOM   7896  C  CZ    . ARG B 2 52   ? -35.399 42.386  -8.131  1.00 66.92  ? 76   ARG B CZ    1 
ATOM   7897  N  NH1   . ARG B 2 52   ? -34.268 43.068  -8.251  1.00 85.60  ? 76   ARG B NH1   1 
ATOM   7898  N  NH2   . ARG B 2 52   ? -35.833 41.649  -9.144  1.00 77.61  ? 76   ARG B NH2   1 
ATOM   7899  N  N     . HIS B 2 53   ? -35.326 47.889  -5.897  1.00 72.43  ? 77   HIS B N     1 
ATOM   7900  C  CA    . HIS B 2 53   ? -34.535 48.759  -5.044  1.00 56.50  ? 77   HIS B CA    1 
ATOM   7901  C  C     . HIS B 2 53   ? -34.579 50.155  -5.644  1.00 65.05  ? 77   HIS B C     1 
ATOM   7902  O  O     . HIS B 2 53   ? -33.983 50.413  -6.687  1.00 55.78  ? 77   HIS B O     1 
ATOM   7903  C  CB    . HIS B 2 53   ? -33.108 48.232  -4.921  1.00 48.21  ? 77   HIS B CB    1 
ATOM   7904  C  CG    . HIS B 2 53   ? -33.041 46.793  -4.515  1.00 77.43  ? 77   HIS B CG    1 
ATOM   7905  N  ND1   . HIS B 2 53   ? -32.873 46.394  -3.206  1.00 69.28  ? 77   HIS B ND1   1 
ATOM   7906  C  CD2   . HIS B 2 53   ? -33.146 45.656  -5.243  1.00 77.33  ? 77   HIS B CD2   1 
ATOM   7907  C  CE1   . HIS B 2 53   ? -32.863 45.075  -3.148  1.00 68.76  ? 77   HIS B CE1   1 
ATOM   7908  N  NE2   . HIS B 2 53   ? -33.026 44.602  -4.370  1.00 71.65  ? 77   HIS B NE2   1 
ATOM   7909  N  N     . PHE B 2 54   ? -35.302 51.048  -4.978  1.00 60.72  ? 78   PHE B N     1 
ATOM   7910  C  CA    . PHE B 2 54   ? -35.742 52.296  -5.592  1.00 76.11  ? 78   PHE B CA    1 
ATOM   7911  C  C     . PHE B 2 54   ? -34.627 53.283  -5.922  1.00 68.08  ? 78   PHE B C     1 
ATOM   7912  O  O     . PHE B 2 54   ? -34.355 54.209  -5.159  1.00 71.31  ? 78   PHE B O     1 
ATOM   7913  C  CB    . PHE B 2 54   ? -36.775 52.974  -4.688  1.00 73.30  ? 78   PHE B CB    1 
ATOM   7914  C  CG    . PHE B 2 54   ? -38.078 52.232  -4.605  1.00 76.35  ? 78   PHE B CG    1 
ATOM   7915  C  CD1   . PHE B 2 54   ? -39.106 52.511  -5.491  1.00 93.40  ? 78   PHE B CD1   1 
ATOM   7916  C  CD2   . PHE B 2 54   ? -38.270 51.247  -3.651  1.00 74.31  ? 78   PHE B CD2   1 
ATOM   7917  C  CE1   . PHE B 2 54   ? -40.305 51.826  -5.422  1.00 93.99  ? 78   PHE B CE1   1 
ATOM   7918  C  CE2   . PHE B 2 54   ? -39.466 50.559  -3.577  1.00 86.85  ? 78   PHE B CE2   1 
ATOM   7919  C  CZ    . PHE B 2 54   ? -40.484 50.849  -4.465  1.00 87.96  ? 78   PHE B CZ    1 
ATOM   7920  N  N     . LEU B 2 55   ? -33.991 53.077  -7.071  1.00 90.17  ? 79   LEU B N     1 
ATOM   7921  C  CA    . LEU B 2 55   ? -33.130 54.096  -7.656  1.00 41.41  ? 79   LEU B CA    1 
ATOM   7922  C  C     . LEU B 2 55   ? -33.934 54.833  -8.723  1.00 43.34  ? 79   LEU B C     1 
ATOM   7923  O  O     . LEU B 2 55   ? -33.505 55.859  -9.250  1.00 93.33  ? 79   LEU B O     1 
ATOM   7924  C  CB    . LEU B 2 55   ? -31.855 53.488  -8.252  1.00 42.65  ? 79   LEU B CB    1 
ATOM   7925  C  CG    . LEU B 2 55   ? -30.815 52.913  -7.283  1.00 86.79  ? 79   LEU B CG    1 
ATOM   7926  C  CD1   . LEU B 2 55   ? -30.958 51.406  -7.147  1.00 69.22  ? 79   LEU B CD1   1 
ATOM   7927  C  CD2   . LEU B 2 55   ? -29.400 53.284  -7.707  1.00 84.62  ? 79   LEU B CD2   1 
ATOM   7928  N  N     . SER B 2 56   ? -35.109 54.291  -9.031  1.00 87.44  ? 80   SER B N     1 
ATOM   7929  C  CA    . SER B 2 56   ? -36.041 54.913  -9.967  1.00 69.86  ? 80   SER B CA    1 
ATOM   7930  C  C     . SER B 2 56   ? -37.480 54.664  -9.524  1.00 77.73  ? 80   SER B C     1 
ATOM   7931  O  O     . SER B 2 56   ? -37.719 54.103  -8.454  1.00 76.80  ? 80   SER B O     1 
ATOM   7932  C  CB    . SER B 2 56   ? -35.826 54.381  -11.386 1.00 73.97  ? 80   SER B CB    1 
ATOM   7933  O  OG    . SER B 2 56   ? -34.552 54.749  -11.886 1.00 71.52  ? 80   SER B OG    1 
ATOM   7934  N  N     . GLY B 2 57   ? -38.436 55.083  -10.347 1.00 76.18  ? 81   GLY B N     1 
ATOM   7935  C  CA    . GLY B 2 57   ? -39.839 54.861  -10.052 1.00 90.04  ? 81   GLY B CA    1 
ATOM   7936  C  C     . GLY B 2 57   ? -40.243 53.425  -10.327 1.00 75.61  ? 81   GLY B C     1 
ATOM   7937  O  O     . GLY B 2 57   ? -39.604 52.737  -11.122 1.00 74.02  ? 81   GLY B O     1 
ATOM   7938  N  N     . SER B 2 58   ? -41.304 52.969  -9.668  1.00 92.05  ? 82   SER B N     1 
ATOM   7939  C  CA    . SER B 2 58   ? -41.791 51.606  -9.858  1.00 90.71  ? 82   SER B CA    1 
ATOM   7940  C  C     . SER B 2 58   ? -42.737 51.524  -11.051 1.00 90.80  ? 82   SER B C     1 
ATOM   7941  O  O     . SER B 2 58   ? -43.300 50.467  -11.339 1.00 93.89  ? 82   SER B O     1 
ATOM   7942  C  CB    . SER B 2 58   ? -42.491 51.100  -8.595  1.00 47.23  ? 82   SER B CB    1 
ATOM   7943  O  OG    . SER B 2 58   ? -43.642 51.872  -8.302  1.00 44.91  ? 82   SER B OG    1 
ATOM   7944  N  N     . LYS B 2 59   ? -42.908 52.648  -11.739 1.00 75.19  ? 83   LYS B N     1 
ATOM   7945  C  CA    . LYS B 2 59   ? -43.749 52.708  -12.927 1.00 77.70  ? 83   LYS B CA    1 
ATOM   7946  C  C     . LYS B 2 59   ? -43.125 51.914  -14.070 1.00 81.38  ? 83   LYS B C     1 
ATOM   7947  O  O     . LYS B 2 59   ? -41.917 51.980  -14.294 1.00 72.75  ? 83   LYS B O     1 
ATOM   7948  C  CB    . LYS B 2 59   ? -43.972 54.161  -13.352 1.00 74.28  ? 83   LYS B CB    1 
ATOM   7949  C  CG    . LYS B 2 59   ? -44.818 54.327  -14.605 1.00 72.56  ? 83   LYS B CG    1 
ATOM   7950  C  CD    . LYS B 2 59   ? -44.915 55.786  -15.042 1.00 77.18  ? 83   LYS B CD    1 
ATOM   7951  C  CE    . LYS B 2 59   ? -45.900 56.583  -14.192 1.00 72.80  ? 83   LYS B CE    1 
ATOM   7952  N  NZ    . LYS B 2 59   ? -45.351 56.992  -12.867 1.00 68.50  ? 83   LYS B NZ    1 
ATOM   7953  N  N     . GLN B 2 60   ? -43.951 51.159  -14.786 1.00 74.88  ? 84   GLN B N     1 
ATOM   7954  C  CA    . GLN B 2 60   ? -43.471 50.366  -15.909 1.00 69.74  ? 84   GLN B CA    1 
ATOM   7955  C  C     . GLN B 2 60   ? -43.116 51.264  -17.090 1.00 68.42  ? 84   GLN B C     1 
ATOM   7956  O  O     . GLN B 2 60   ? -42.188 50.972  -17.847 1.00 67.71  ? 84   GLN B O     1 
ATOM   7957  C  CB    . GLN B 2 60   ? -44.521 49.330  -16.322 1.00 93.46  ? 84   GLN B CB    1 
ATOM   7958  C  CG    . GLN B 2 60   ? -44.067 48.372  -17.418 1.00 92.79  ? 84   GLN B CG    1 
ATOM   7959  C  CD    . GLN B 2 60   ? -42.945 47.450  -16.972 1.00 86.07  ? 84   GLN B CD    1 
ATOM   7960  O  OE1   . GLN B 2 60   ? -42.744 47.227  -15.778 1.00 85.30  ? 84   GLN B OE1   1 
ATOM   7961  N  NE2   . GLN B 2 60   ? -42.207 46.910  -17.935 1.00 93.43  ? 84   GLN B NE2   1 
ATOM   7962  N  N     . GLN B 2 61   ? -43.853 52.361  -17.237 1.00 74.73  ? 85   GLN B N     1 
ATOM   7963  C  CA    . GLN B 2 61   ? -43.624 53.297  -18.332 1.00 69.56  ? 85   GLN B CA    1 
ATOM   7964  C  C     . GLN B 2 61   ? -42.366 54.128  -18.091 1.00 77.13  ? 85   GLN B C     1 
ATOM   7965  O  O     . GLN B 2 61   ? -42.441 55.323  -17.799 1.00 72.93  ? 85   GLN B O     1 
ATOM   7966  C  CB    . GLN B 2 61   ? -44.835 54.213  -18.517 1.00 74.30  ? 85   GLN B CB    1 
ATOM   7967  C  CG    . GLN B 2 61   ? -45.231 54.435  -19.971 1.00 71.28  ? 85   GLN B CG    1 
ATOM   7968  C  CD    . GLN B 2 61   ? -44.159 55.145  -20.776 1.00 74.69  ? 85   GLN B CD    1 
ATOM   7969  O  OE1   . GLN B 2 61   ? -43.488 56.048  -20.278 1.00 72.00  ? 85   GLN B OE1   1 
ATOM   7970  N  NE2   . GLN B 2 61   ? -43.993 54.737  -22.029 1.00 73.96  ? 85   GLN B NE2   1 
ATOM   7971  N  N     . LEU B 2 62   ? -41.213 53.479  -18.212 1.00 70.79  ? 86   LEU B N     1 
ATOM   7972  C  CA    . LEU B 2 62   ? -39.924 54.146  -18.075 1.00 70.51  ? 86   LEU B CA    1 
ATOM   7973  C  C     . LEU B 2 62   ? -39.046 53.852  -19.283 1.00 75.37  ? 86   LEU B C     1 
ATOM   7974  O  O     . LEU B 2 62   ? -37.913 53.392  -19.139 1.00 72.18  ? 86   LEU B O     1 
ATOM   7975  C  CB    . LEU B 2 62   ? -39.216 53.707  -16.792 1.00 56.69  ? 86   LEU B CB    1 
ATOM   7976  C  CG    . LEU B 2 62   ? -39.811 54.205  -15.475 1.00 66.36  ? 86   LEU B CG    1 
ATOM   7977  C  CD1   . LEU B 2 62   ? -39.041 53.637  -14.293 1.00 64.46  ? 86   LEU B CD1   1 
ATOM   7978  C  CD2   . LEU B 2 62   ? -39.815 55.724  -15.439 1.00 71.95  ? 86   LEU B CD2   1 
ATOM   7979  N  N     . SER B 2 63   ? -39.580 54.114  -20.472 1.00 69.28  ? 87   SER B N     1 
ATOM   7980  C  CA    . SER B 2 63   ? -38.853 53.867  -21.711 1.00 71.07  ? 87   SER B CA    1 
ATOM   7981  C  C     . SER B 2 63   ? -37.605 54.738  -21.796 1.00 72.06  ? 87   SER B C     1 
ATOM   7982  O  O     . SER B 2 63   ? -37.467 55.712  -21.057 1.00 76.60  ? 87   SER B O     1 
ATOM   7983  C  CB    . SER B 2 63   ? -39.756 54.115  -22.921 1.00 71.25  ? 87   SER B CB    1 
ATOM   7984  O  OG    . SER B 2 63   ? -40.302 55.422  -22.894 1.00 73.85  ? 87   SER B OG    1 
ATOM   7985  N  N     . ARG B 2 64   ? -36.698 54.378  -22.698 1.00 74.22  ? 88   ARG B N     1 
ATOM   7986  C  CA    . ARG B 2 64   ? -35.456 55.121  -22.872 1.00 74.71  ? 88   ARG B CA    1 
ATOM   7987  C  C     . ARG B 2 64   ? -35.747 56.553  -23.307 1.00 71.64  ? 88   ARG B C     1 
ATOM   7988  O  O     . ARG B 2 64   ? -34.998 57.472  -22.984 1.00 73.35  ? 88   ARG B O     1 
ATOM   7989  C  CB    . ARG B 2 64   ? -34.551 54.430  -23.893 1.00 74.31  ? 88   ARG B CB    1 
ATOM   7990  C  CG    . ARG B 2 64   ? -34.368 52.942  -23.646 1.00 70.29  ? 88   ARG B CG    1 
ATOM   7991  C  CD    . ARG B 2 64   ? -33.547 52.295  -24.748 1.00 69.39  ? 88   ARG B CD    1 
ATOM   7992  N  NE    . ARG B 2 64   ? -33.881 52.830  -26.064 1.00 56.86  ? 88   ARG B NE    1 
ATOM   7993  C  CZ    . ARG B 2 64   ? -33.581 52.232  -27.213 1.00 70.57  ? 88   ARG B CZ    1 
ATOM   7994  N  NH1   . ARG B 2 64   ? -33.922 52.795  -28.364 1.00 75.76  ? 88   ARG B NH1   1 
ATOM   7995  N  NH2   . ARG B 2 64   ? -32.950 51.067  -27.211 1.00 76.10  ? 88   ARG B NH2   1 
ATOM   7996  N  N     . ASP B 2 65   ? -36.843 56.733  -24.037 1.00 69.79  ? 89   ASP B N     1 
ATOM   7997  C  CA    . ASP B 2 65   ? -37.271 58.059  -24.460 1.00 67.22  ? 89   ASP B CA    1 
ATOM   7998  C  C     . ASP B 2 65   ? -37.734 58.883  -23.263 1.00 71.18  ? 89   ASP B C     1 
ATOM   7999  O  O     . ASP B 2 65   ? -37.412 60.064  -23.150 1.00 72.75  ? 89   ASP B O     1 
ATOM   8000  C  CB    . ASP B 2 65   ? -38.391 57.958  -25.497 1.00 72.51  ? 89   ASP B CB    1 
ATOM   8001  C  CG    . ASP B 2 65   ? -37.988 57.142  -26.708 1.00 77.34  ? 89   ASP B CG    1 
ATOM   8002  O  OD1   . ASP B 2 65   ? -38.567 57.359  -27.793 1.00 75.63  ? 89   ASP B OD1   1 
ATOM   8003  O  OD2   . ASP B 2 65   ? -37.091 56.283  -26.574 1.00 68.61  ? 89   ASP B OD2   1 
ATOM   8004  N  N     . SER B 2 66   ? -38.484 58.247  -22.368 1.00 66.21  ? 90   SER B N     1 
ATOM   8005  C  CA    . SER B 2 66   ? -39.008 58.922  -21.185 1.00 73.53  ? 90   SER B CA    1 
ATOM   8006  C  C     . SER B 2 66   ? -37.894 59.269  -20.201 1.00 69.04  ? 90   SER B C     1 
ATOM   8007  O  O     . SER B 2 66   ? -38.030 60.187  -19.393 1.00 56.64  ? 90   SER B O     1 
ATOM   8008  C  CB    . SER B 2 66   ? -40.065 58.053  -20.499 1.00 71.95  ? 90   SER B CB    1 
ATOM   8009  O  OG    . SER B 2 66   ? -40.639 58.724  -19.390 1.00 74.16  ? 90   SER B OG    1 
ATOM   8010  N  N     . LEU B 2 67   ? -36.793 58.529  -20.273 1.00 48.90  ? 91   LEU B N     1 
ATOM   8011  C  CA    . LEU B 2 67   ? -35.649 58.771  -19.401 1.00 45.89  ? 91   LEU B CA    1 
ATOM   8012  C  C     . LEU B 2 67   ? -34.703 59.805  -20.001 1.00 47.25  ? 91   LEU B C     1 
ATOM   8013  O  O     . LEU B 2 67   ? -34.063 60.569  -19.279 1.00 47.83  ? 91   LEU B O     1 
ATOM   8014  C  CB    . LEU B 2 67   ? -34.896 57.468  -19.133 1.00 47.65  ? 91   LEU B CB    1 
ATOM   8015  C  CG    . LEU B 2 67   ? -35.643 56.403  -18.331 1.00 42.75  ? 91   LEU B CG    1 
ATOM   8016  C  CD1   . LEU B 2 67   ? -34.826 55.125  -18.251 1.00 44.33  ? 91   LEU B CD1   1 
ATOM   8017  C  CD2   . LEU B 2 67   ? -35.968 56.920  -16.939 1.00 68.54  ? 91   LEU B CD2   1 
ATOM   8018  N  N     . LEU B 2 68   ? -34.620 59.822  -21.327 1.00 93.21  ? 92   LEU B N     1 
ATOM   8019  C  CA    . LEU B 2 68   ? -33.719 60.730  -22.027 1.00 48.52  ? 92   LEU B CA    1 
ATOM   8020  C  C     . LEU B 2 68   ? -34.358 62.097  -22.254 1.00 67.79  ? 92   LEU B C     1 
ATOM   8021  O  O     . LEU B 2 68   ? -33.665 63.075  -22.535 1.00 75.61  ? 92   LEU B O     1 
ATOM   8022  C  CB    . LEU B 2 68   ? -33.284 60.122  -23.363 1.00 66.13  ? 92   LEU B CB    1 
ATOM   8023  C  CG    . LEU B 2 68   ? -31.983 59.311  -23.390 1.00 66.83  ? 92   LEU B CG    1 
ATOM   8024  C  CD1   . LEU B 2 68   ? -31.903 58.315  -22.241 1.00 41.47  ? 92   LEU B CD1   1 
ATOM   8025  C  CD2   . LEU B 2 68   ? -31.842 58.595  -24.724 1.00 68.12  ? 92   LEU B CD2   1 
ATOM   8026  N  N     . SER B 2 69   ? -35.680 62.163  -22.129 1.00 49.00  ? 93   SER B N     1 
ATOM   8027  C  CA    . SER B 2 69   ? -36.397 63.423  -22.293 1.00 48.50  ? 93   SER B CA    1 
ATOM   8028  C  C     . SER B 2 69   ? -36.526 64.163  -20.965 1.00 60.62  ? 93   SER B C     1 
ATOM   8029  O  O     . SER B 2 69   ? -36.642 65.389  -20.934 1.00 40.66  ? 93   SER B O     1 
ATOM   8030  C  CB    . SER B 2 69   ? -37.784 63.181  -22.891 1.00 69.21  ? 93   SER B CB    1 
ATOM   8031  O  OG    . SER B 2 69   ? -37.693 62.526  -24.144 1.00 71.25  ? 93   SER B OG    1 
ATOM   8032  N  N     . GLY B 2 70   ? -36.504 63.412  -19.870 1.00 43.66  ? 94   GLY B N     1 
ATOM   8033  C  CA    . GLY B 2 70   ? -36.667 63.989  -18.549 1.00 66.81  ? 94   GLY B CA    1 
ATOM   8034  C  C     . GLY B 2 70   ? -38.126 64.026  -18.140 1.00 67.89  ? 94   GLY B C     1 
ATOM   8035  O  O     . GLY B 2 70   ? -38.494 64.678  -17.163 1.00 43.50  ? 94   GLY B O     1 
ATOM   8036  N  N     . CYS B 2 71   ? -38.958 63.316  -18.896 1.00 70.36  ? 95   CYS B N     1 
ATOM   8037  C  CA    . CYS B 2 71   ? -40.391 63.254  -18.626 1.00 68.56  ? 95   CYS B CA    1 
ATOM   8038  C  C     . CYS B 2 71   ? -40.725 62.110  -17.674 1.00 41.19  ? 95   CYS B C     1 
ATOM   8039  O  O     . CYS B 2 71   ? -41.885 61.722  -17.534 1.00 49.86  ? 95   CYS B O     1 
ATOM   8040  C  CB    . CYS B 2 71   ? -41.173 63.097  -19.930 1.00 55.23  ? 95   CYS B CB    1 
ATOM   8041  S  SG    . CYS B 2 71   ? -40.854 64.394  -21.146 1.00 69.66  ? 95   CYS B SG    1 
ATOM   8042  N  N     . HIS B 2 72   ? -39.697 61.572  -17.026 1.00 44.79  ? 96   HIS B N     1 
ATOM   8043  C  CA    . HIS B 2 72   ? -39.874 60.514  -16.041 1.00 56.03  ? 96   HIS B CA    1 
ATOM   8044  C  C     . HIS B 2 72   ? -40.578 61.058  -14.801 1.00 66.68  ? 96   HIS B C     1 
ATOM   8045  O  O     . HIS B 2 72   ? -40.432 62.235  -14.470 1.00 56.96  ? 96   HIS B O     1 
ATOM   8046  C  CB    . HIS B 2 72   ? -38.519 59.902  -15.671 1.00 60.96  ? 96   HIS B CB    1 
ATOM   8047  C  CG    . HIS B 2 72   ? -37.463 60.916  -15.359 1.00 65.87  ? 96   HIS B CG    1 
ATOM   8048  N  ND1   . HIS B 2 72   ? -37.446 61.636  -14.184 1.00 66.12  ? 96   HIS B ND1   1 
ATOM   8049  C  CD2   . HIS B 2 72   ? -36.390 61.334  -16.072 1.00 60.02  ? 96   HIS B CD2   1 
ATOM   8050  C  CE1   . HIS B 2 72   ? -36.407 62.453  -14.185 1.00 70.48  ? 96   HIS B CE1   1 
ATOM   8051  N  NE2   . HIS B 2 72   ? -35.750 62.289  -15.319 1.00 69.15  ? 96   HIS B NE2   1 
ATOM   8052  N  N     . PRO B 2 73   ? -41.352 60.203  -14.113 1.00 70.92  ? 97   PRO B N     1 
ATOM   8053  C  CA    . PRO B 2 73   ? -42.095 60.617  -12.916 1.00 70.36  ? 97   PRO B CA    1 
ATOM   8054  C  C     . PRO B 2 73   ? -41.188 61.032  -11.760 1.00 74.24  ? 97   PRO B C     1 
ATOM   8055  O  O     . PRO B 2 73   ? -41.652 61.666  -10.813 1.00 71.18  ? 97   PRO B O     1 
ATOM   8056  C  CB    . PRO B 2 73   ? -42.897 59.362  -12.552 1.00 71.62  ? 97   PRO B CB    1 
ATOM   8057  C  CG    . PRO B 2 73   ? -42.142 58.235  -13.168 1.00 69.96  ? 97   PRO B CG    1 
ATOM   8058  C  CD    . PRO B 2 73   ? -41.593 58.789  -14.445 1.00 77.02  ? 97   PRO B CD    1 
ATOM   8059  N  N     . GLY B 2 74   ? -39.911 60.675  -11.841 1.00 49.09  ? 98   GLY B N     1 
ATOM   8060  C  CA    . GLY B 2 74   ? -38.960 61.029  -10.806 1.00 46.71  ? 98   GLY B CA    1 
ATOM   8061  C  C     . GLY B 2 74   ? -38.030 59.884  -10.458 1.00 64.78  ? 98   GLY B C     1 
ATOM   8062  O  O     . GLY B 2 74   ? -38.178 58.772  -10.965 1.00 68.77  ? 98   GLY B O     1 
ATOM   8063  N  N     . PHE B 2 75   ? -37.066 60.163  -9.588  1.00 65.26  ? 99   PHE B N     1 
ATOM   8064  C  CA    . PHE B 2 75   ? -36.108 59.155  -9.156  1.00 43.98  ? 99   PHE B CA    1 
ATOM   8065  C  C     . PHE B 2 75   ? -36.403 58.710  -7.729  1.00 47.97  ? 99   PHE B C     1 
ATOM   8066  O  O     . PHE B 2 75   ? -36.963 59.468  -6.937  1.00 41.59  ? 99   PHE B O     1 
ATOM   8067  C  CB    . PHE B 2 75   ? -34.679 59.696  -9.254  1.00 44.24  ? 99   PHE B CB    1 
ATOM   8068  C  CG    . PHE B 2 75   ? -34.274 60.092  -10.647 1.00 46.15  ? 99   PHE B CG    1 
ATOM   8069  C  CD1   . PHE B 2 75   ? -34.713 59.369  -11.744 1.00 49.94  ? 99   PHE B CD1   1 
ATOM   8070  C  CD2   . PHE B 2 75   ? -33.459 61.191  -10.859 1.00 42.54  ? 99   PHE B CD2   1 
ATOM   8071  C  CE1   . PHE B 2 75   ? -34.343 59.733  -13.026 1.00 69.93  ? 99   PHE B CE1   1 
ATOM   8072  C  CE2   . PHE B 2 75   ? -33.086 61.560  -12.139 1.00 44.47  ? 99   PHE B CE2   1 
ATOM   8073  C  CZ    . PHE B 2 75   ? -33.529 60.829  -13.223 1.00 84.54  ? 99   PHE B CZ    1 
ATOM   8074  N  N     . GLY B 2 76   ? -36.029 57.477  -7.408  1.00 60.26  ? 100  GLY B N     1 
ATOM   8075  C  CA    . GLY B 2 76   ? -36.186 56.963  -6.061  1.00 65.25  ? 100  GLY B CA    1 
ATOM   8076  C  C     . GLY B 2 76   ? -35.163 57.579  -5.127  1.00 64.19  ? 100  GLY B C     1 
ATOM   8077  O  O     . GLY B 2 76   ? -34.283 58.317  -5.571  1.00 67.02  ? 100  GLY B O     1 
ATOM   8078  N  N     . PRO B 2 77   ? -35.275 57.283  -3.825  1.00 48.75  ? 101  PRO B N     1 
ATOM   8079  C  CA    . PRO B 2 77   ? -34.348 57.803  -2.812  1.00 49.90  ? 101  PRO B CA    1 
ATOM   8080  C  C     . PRO B 2 77   ? -32.892 57.432  -3.091  1.00 65.65  ? 101  PRO B C     1 
ATOM   8081  O  O     . PRO B 2 77   ? -32.009 58.284  -2.980  1.00 56.55  ? 101  PRO B O     1 
ATOM   8082  C  CB    . PRO B 2 77   ? -34.842 57.151  -1.513  1.00 60.18  ? 101  PRO B CB    1 
ATOM   8083  C  CG    . PRO B 2 77   ? -35.696 56.003  -1.946  1.00 43.81  ? 101  PRO B CG    1 
ATOM   8084  C  CD    . PRO B 2 77   ? -36.318 56.433  -3.231  1.00 48.21  ? 101  PRO B CD    1 
ATOM   8085  N  N     . LEU B 2 78   ? -32.648 56.178  -3.457  1.00 41.06  ? 102  LEU B N     1 
ATOM   8086  C  CA    . LEU B 2 78   ? -31.298 55.733  -3.779  1.00 49.14  ? 102  LEU B CA    1 
ATOM   8087  C  C     . LEU B 2 78   ? -30.794 56.417  -5.044  1.00 46.41  ? 102  LEU B C     1 
ATOM   8088  O  O     . LEU B 2 78   ? -29.601 56.691  -5.181  1.00 72.84  ? 102  LEU B O     1 
ATOM   8089  C  CB    . LEU B 2 78   ? -31.255 54.214  -3.946  1.00 45.66  ? 102  LEU B CB    1 
ATOM   8090  C  CG    . LEU B 2 78   ? -31.726 53.387  -2.750  1.00 69.36  ? 102  LEU B CG    1 
ATOM   8091  C  CD1   . LEU B 2 78   ? -31.547 51.902  -3.025  1.00 65.93  ? 102  LEU B CD1   1 
ATOM   8092  C  CD2   . LEU B 2 78   ? -30.984 53.798  -1.488  1.00 49.26  ? 102  LEU B CD2   1 
ATOM   8093  N  N     . GLY B 2 79   ? -31.713 56.694  -5.963  1.00 41.19  ? 103  GLY B N     1 
ATOM   8094  C  CA    . GLY B 2 79   ? -31.373 57.360  -7.207  1.00 91.84  ? 103  GLY B CA    1 
ATOM   8095  C  C     . GLY B 2 79   ? -31.021 58.820  -7.001  1.00 46.62  ? 103  GLY B C     1 
ATOM   8096  O  O     . GLY B 2 79   ? -30.025 59.312  -7.537  1.00 41.63  ? 103  GLY B O     1 
ATOM   8097  N  N     . VAL B 2 80   ? -31.838 59.516  -6.216  1.00 48.87  ? 104  VAL B N     1 
ATOM   8098  C  CA    . VAL B 2 80   ? -31.599 60.928  -5.946  1.00 55.49  ? 104  VAL B CA    1 
ATOM   8099  C  C     . VAL B 2 80   ? -30.379 61.084  -5.036  1.00 41.36  ? 104  VAL B C     1 
ATOM   8100  O  O     . VAL B 2 80   ? -29.717 62.120  -5.049  1.00 44.61  ? 104  VAL B O     1 
ATOM   8101  C  CB    . VAL B 2 80   ? -32.842 61.612  -5.315  1.00 55.88  ? 104  VAL B CB    1 
ATOM   8102  C  CG1   . VAL B 2 80   ? -33.076 61.125  -3.898  1.00 43.76  ? 104  VAL B CG1   1 
ATOM   8103  C  CG2   . VAL B 2 80   ? -32.698 63.129  -5.343  1.00 55.51  ? 104  VAL B CG2   1 
ATOM   8104  N  N     . GLU B 2 81   ? -30.071 60.044  -4.265  1.00 72.96  ? 105  GLU B N     1 
ATOM   8105  C  CA    . GLU B 2 81   ? -28.873 60.048  -3.432  1.00 75.84  ? 105  GLU B CA    1 
ATOM   8106  C  C     . GLU B 2 81   ? -27.630 59.840  -4.292  1.00 85.88  ? 105  GLU B C     1 
ATOM   8107  O  O     . GLU B 2 81   ? -26.605 60.495  -4.092  1.00 92.27  ? 105  GLU B O     1 
ATOM   8108  C  CB    . GLU B 2 81   ? -28.955 58.967  -2.353  1.00 43.95  ? 105  GLU B CB    1 
ATOM   8109  C  CG    . GLU B 2 81   ? -27.828 59.023  -1.334  1.00 43.03  ? 105  GLU B CG    1 
ATOM   8110  C  CD    . GLU B 2 81   ? -27.880 60.274  -0.476  1.00 64.97  ? 105  GLU B CD    1 
ATOM   8111  O  OE1   . GLU B 2 81   ? -28.991 60.801  -0.256  1.00 60.92  ? 105  GLU B OE1   1 
ATOM   8112  O  OE2   . GLU B 2 81   ? -26.810 60.733  -0.025  1.00 67.97  ? 105  GLU B OE2   1 
ATOM   8113  N  N     . LEU B 2 82   ? -27.730 58.916  -5.244  1.00 93.25  ? 106  LEU B N     1 
ATOM   8114  C  CA    . LEU B 2 82   ? -26.657 58.669  -6.202  1.00 76.29  ? 106  LEU B CA    1 
ATOM   8115  C  C     . LEU B 2 82   ? -26.346 59.943  -6.978  1.00 87.93  ? 106  LEU B C     1 
ATOM   8116  O  O     . LEU B 2 82   ? -25.186 60.351  -7.091  1.00 49.20  ? 106  LEU B O     1 
ATOM   8117  C  CB    . LEU B 2 82   ? -27.043 57.536  -7.158  1.00 72.70  ? 106  LEU B CB    1 
ATOM   8118  C  CG    . LEU B 2 82   ? -26.164 57.271  -8.384  1.00 77.77  ? 106  LEU B CG    1 
ATOM   8119  C  CD1   . LEU B 2 82   ? -24.733 56.964  -7.988  1.00 81.44  ? 106  LEU B CD1   1 
ATOM   8120  C  CD2   . LEU B 2 82   ? -26.735 56.130  -9.213  1.00 68.96  ? 106  LEU B CD2   1 
ATOM   8121  N  N     . ARG B 2 83   ? -27.393 60.577  -7.496  1.00 85.17  ? 107  ARG B N     1 
ATOM   8122  C  CA    . ARG B 2 83   ? -27.243 61.837  -8.212  1.00 84.90  ? 107  ARG B CA    1 
ATOM   8123  C  C     . ARG B 2 83   ? -26.719 62.932  -7.285  1.00 70.20  ? 107  ARG B C     1 
ATOM   8124  O  O     . ARG B 2 83   ? -25.995 63.823  -7.721  1.00 77.70  ? 107  ARG B O     1 
ATOM   8125  C  CB    . ARG B 2 83   ? -28.573 62.263  -8.835  1.00 40.51  ? 107  ARG B CB    1 
ATOM   8126  C  CG    . ARG B 2 83   ? -28.489 63.531  -9.670  1.00 44.62  ? 107  ARG B CG    1 
ATOM   8127  C  CD    . ARG B 2 83   ? -29.851 63.924  -10.214 1.00 65.93  ? 107  ARG B CD    1 
ATOM   8128  N  NE    . ARG B 2 83   ? -30.832 64.117  -9.150  1.00 45.76  ? 107  ARG B NE    1 
ATOM   8129  C  CZ    . ARG B 2 83   ? -32.091 64.489  -9.357  1.00 48.72  ? 107  ARG B CZ    1 
ATOM   8130  N  NH1   . ARG B 2 83   ? -32.525 64.709  -10.590 1.00 47.10  ? 107  ARG B NH1   1 
ATOM   8131  N  NH2   . ARG B 2 83   ? -32.917 64.641  -8.331  1.00 64.55  ? 107  ARG B NH2   1 
ATOM   8132  N  N     . LYS B 2 84   ? -27.087 62.860  -6.008  1.00 70.30  ? 108  LYS B N     1 
ATOM   8133  C  CA    . LYS B 2 84   ? -26.611 63.825  -5.020  1.00 81.44  ? 108  LYS B CA    1 
ATOM   8134  C  C     . LYS B 2 84   ? -25.100 63.749  -4.880  1.00 45.86  ? 108  LYS B C     1 
ATOM   8135  O  O     . LYS B 2 84   ? -24.404 64.763  -4.963  1.00 65.98  ? 108  LYS B O     1 
ATOM   8136  C  CB    . LYS B 2 84   ? -27.268 63.589  -3.659  1.00 85.93  ? 108  LYS B CB    1 
ATOM   8137  C  CG    . LYS B 2 84   ? -26.577 64.314  -2.512  1.00 90.66  ? 108  LYS B CG    1 
ATOM   8138  C  CD    . LYS B 2 84   ? -27.222 63.992  -1.175  1.00 46.04  ? 108  LYS B CD    1 
ATOM   8139  C  CE    . LYS B 2 84   ? -28.663 64.472  -1.127  1.00 67.88  ? 108  LYS B CE    1 
ATOM   8140  N  NZ    . LYS B 2 84   ? -29.304 64.176  0.184   1.00 67.99  ? 108  LYS B NZ    1 
ATOM   8141  N  N     . ASN B 2 85   ? -24.597 62.537  -4.666  1.00 60.03  ? 109  ASN B N     1 
ATOM   8142  C  CA    . ASN B 2 85   ? -23.162 62.325  -4.544  1.00 49.60  ? 109  ASN B CA    1 
ATOM   8143  C  C     . ASN B 2 85   ? -22.434 62.637  -5.847  1.00 45.76  ? 109  ASN B C     1 
ATOM   8144  O  O     . ASN B 2 85   ? -21.287 63.084  -5.833  1.00 44.93  ? 109  ASN B O     1 
ATOM   8145  C  CB    . ASN B 2 85   ? -22.870 60.890  -4.106  1.00 77.15  ? 109  ASN B CB    1 
ATOM   8146  C  CG    . ASN B 2 85   ? -23.382 60.594  -2.712  1.00 49.68  ? 109  ASN B CG    1 
ATOM   8147  O  OD1   . ASN B 2 85   ? -23.627 61.506  -1.922  1.00 56.17  ? 109  ASN B OD1   1 
ATOM   8148  N  ND2   . ASN B 2 85   ? -23.542 59.313  -2.400  1.00 45.10  ? 109  ASN B ND2   1 
ATOM   8149  N  N     . LEU B 2 86   ? -23.106 62.406  -6.971  1.00 68.65  ? 110  LEU B N     1 
ATOM   8150  C  CA    . LEU B 2 86   ? -22.532 62.720  -8.276  1.00 72.45  ? 110  LEU B CA    1 
ATOM   8151  C  C     . LEU B 2 86   ? -22.338 64.227  -8.442  1.00 86.80  ? 110  LEU B C     1 
ATOM   8152  O  O     . LEU B 2 86   ? -21.274 64.687  -8.862  1.00 87.91  ? 110  LEU B O     1 
ATOM   8153  C  CB    . LEU B 2 86   ? -23.419 62.175  -9.397  1.00 72.08  ? 110  LEU B CB    1 
ATOM   8154  C  CG    . LEU B 2 86   ? -22.872 62.340  -10.815 1.00 76.21  ? 110  LEU B CG    1 
ATOM   8155  C  CD1   . LEU B 2 86   ? -21.480 61.745  -10.904 1.00 40.03  ? 110  LEU B CD1   1 
ATOM   8156  C  CD2   . LEU B 2 86   ? -23.796 61.694  -11.834 1.00 74.87  ? 110  LEU B CD2   1 
ATOM   8157  N  N     . ALA B 2 87   ? -23.375 64.987  -8.103  1.00 46.26  ? 111  ALA B N     1 
ATOM   8158  C  CA    . ALA B 2 87   ? -23.337 66.442  -8.198  1.00 40.00  ? 111  ALA B CA    1 
ATOM   8159  C  C     . ALA B 2 87   ? -22.356 67.034  -7.192  1.00 92.94  ? 111  ALA B C     1 
ATOM   8160  O  O     . ALA B 2 87   ? -21.720 68.053  -7.459  1.00 69.55  ? 111  ALA B O     1 
ATOM   8161  C  CB    . ALA B 2 87   ? -24.726 67.021  -7.985  1.00 66.10  ? 111  ALA B CB    1 
ATOM   8162  N  N     . ALA B 2 88   ? -22.243 66.394  -6.033  1.00 85.79  ? 112  ALA B N     1 
ATOM   8163  C  CA    . ALA B 2 88   ? -21.283 66.822  -5.024  1.00 87.03  ? 112  ALA B CA    1 
ATOM   8164  C  C     . ALA B 2 88   ? -19.862 66.591  -5.525  1.00 84.93  ? 112  ALA B C     1 
ATOM   8165  O  O     . ALA B 2 88   ? -18.975 67.421  -5.317  1.00 91.89  ? 112  ALA B O     1 
ATOM   8166  C  CB    . ALA B 2 88   ? -21.514 66.087  -3.717  1.00 90.02  ? 112  ALA B CB    1 
ATOM   8167  N  N     . GLU B 2 89   ? -19.657 65.460  -6.192  1.00 81.14  ? 113  GLU B N     1 
ATOM   8168  C  CA    . GLU B 2 89   ? -18.354 65.132  -6.754  1.00 45.24  ? 113  GLU B CA    1 
ATOM   8169  C  C     . GLU B 2 89   ? -18.013 66.095  -7.887  1.00 41.96  ? 113  GLU B C     1 
ATOM   8170  O  O     . GLU B 2 89   ? -16.844 66.415  -8.110  1.00 43.43  ? 113  GLU B O     1 
ATOM   8171  C  CB    . GLU B 2 89   ? -18.329 63.685  -7.249  1.00 41.58  ? 113  GLU B CB    1 
ATOM   8172  C  CG    . GLU B 2 89   ? -17.088 62.911  -6.828  1.00 41.34  ? 113  GLU B CG    1 
ATOM   8173  C  CD    . GLU B 2 89   ? -17.003 62.704  -5.327  1.00 42.39  ? 113  GLU B CD    1 
ATOM   8174  O  OE1   . GLU B 2 89   ? -18.059 62.515  -4.687  1.00 90.57  ? 113  GLU B OE1   1 
ATOM   8175  O  OE2   . GLU B 2 89   ? -15.877 62.733  -4.785  1.00 44.02  ? 113  GLU B OE2   1 
ATOM   8176  N  N     . TRP B 2 90   ? -19.039 66.550  -8.602  1.00 69.17  ? 114  TRP B N     1 
ATOM   8177  C  CA    . TRP B 2 90   ? -18.871 67.623  -9.578  1.00 69.28  ? 114  TRP B CA    1 
ATOM   8178  C  C     . TRP B 2 90   ? -18.379 68.879  -8.877  1.00 45.24  ? 114  TRP B C     1 
ATOM   8179  O  O     . TRP B 2 90   ? -17.355 69.452  -9.246  1.00 42.64  ? 114  TRP B O     1 
ATOM   8180  C  CB    . TRP B 2 90   ? -20.188 67.910  -10.312 1.00 70.72  ? 114  TRP B CB    1 
ATOM   8181  C  CG    . TRP B 2 90   ? -20.218 69.224  -11.073 1.00 75.54  ? 114  TRP B CG    1 
ATOM   8182  C  CD1   . TRP B 2 90   ? -20.390 70.479  -10.551 1.00 93.76  ? 114  TRP B CD1   1 
ATOM   8183  C  CD2   . TRP B 2 90   ? -20.100 69.398  -12.491 1.00 70.06  ? 114  TRP B CD2   1 
ATOM   8184  N  NE1   . TRP B 2 90   ? -20.368 71.419  -11.553 1.00 75.08  ? 114  TRP B NE1   1 
ATOM   8185  C  CE2   . TRP B 2 90   ? -20.194 70.782  -12.753 1.00 72.83  ? 114  TRP B CE2   1 
ATOM   8186  C  CE3   . TRP B 2 90   ? -19.918 68.521  -13.564 1.00 72.24  ? 114  TRP B CE3   1 
ATOM   8187  C  CZ2   . TRP B 2 90   ? -20.113 71.305  -14.042 1.00 69.27  ? 114  TRP B CZ2   1 
ATOM   8188  C  CZ3   . TRP B 2 90   ? -19.840 69.043  -14.843 1.00 91.44  ? 114  TRP B CZ3   1 
ATOM   8189  C  CH2   . TRP B 2 90   ? -19.936 70.422  -15.071 1.00 90.05  ? 114  TRP B CH2   1 
ATOM   8190  N  N     . TRP B 2 91   ? -19.125 69.295  -7.858  1.00 43.53  ? 115  TRP B N     1 
ATOM   8191  C  CA    . TRP B 2 91   ? -18.854 70.540  -7.151  1.00 68.92  ? 115  TRP B CA    1 
ATOM   8192  C  C     . TRP B 2 91   ? -17.460 70.556  -6.533  1.00 68.22  ? 115  TRP B C     1 
ATOM   8193  O  O     . TRP B 2 91   ? -16.825 71.605  -6.438  1.00 75.18  ? 115  TRP B O     1 
ATOM   8194  C  CB    . TRP B 2 91   ? -19.910 70.771  -6.068  1.00 65.63  ? 115  TRP B CB    1 
ATOM   8195  C  CG    . TRP B 2 91   ? -19.969 72.185  -5.595  1.00 44.37  ? 115  TRP B CG    1 
ATOM   8196  C  CD1   . TRP B 2 91   ? -19.503 72.675  -4.410  1.00 44.41  ? 115  TRP B CD1   1 
ATOM   8197  C  CD2   . TRP B 2 91   ? -20.516 73.301  -6.305  1.00 46.11  ? 115  TRP B CD2   1 
ATOM   8198  N  NE1   . TRP B 2 91   ? -19.731 74.027  -4.335  1.00 46.16  ? 115  TRP B NE1   1 
ATOM   8199  C  CE2   . TRP B 2 91   ? -20.351 74.436  -5.487  1.00 44.01  ? 115  TRP B CE2   1 
ATOM   8200  C  CE3   . TRP B 2 91   ? -21.132 73.450  -7.551  1.00 81.03  ? 115  TRP B CE3   1 
ATOM   8201  C  CZ2   . TRP B 2 91   ? -20.780 75.703  -5.875  1.00 45.92  ? 115  TRP B CZ2   1 
ATOM   8202  C  CZ3   . TRP B 2 91   ? -21.555 74.709  -7.935  1.00 45.13  ? 115  TRP B CZ3   1 
ATOM   8203  C  CH2   . TRP B 2 91   ? -21.378 75.819  -7.100  1.00 42.76  ? 115  TRP B CH2   1 
ATOM   8204  N  N     . THR B 2 92   ? -16.984 69.386  -6.121  1.00 67.47  ? 116  THR B N     1 
ATOM   8205  C  CA    . THR B 2 92   ? -15.652 69.275  -5.544  1.00 45.78  ? 116  THR B CA    1 
ATOM   8206  C  C     . THR B 2 92   ? -14.572 69.438  -6.610  1.00 93.79  ? 116  THR B C     1 
ATOM   8207  O  O     . THR B 2 92   ? -13.626 70.204  -6.434  1.00 46.62  ? 116  THR B O     1 
ATOM   8208  C  CB    . THR B 2 92   ? -15.461 67.925  -4.830  1.00 90.74  ? 116  THR B CB    1 
ATOM   8209  O  OG1   . THR B 2 92   ? -16.385 67.826  -3.739  1.00 42.31  ? 116  THR B OG1   1 
ATOM   8210  C  CG2   . THR B 2 92   ? -14.044 67.801  -4.295  1.00 90.58  ? 116  THR B CG2   1 
ATOM   8211  N  N     . SER B 2 93   ? -14.727 68.726  -7.722  1.00 68.11  ? 117  SER B N     1 
ATOM   8212  C  CA    . SER B 2 93   ? -13.700 68.698  -8.759  1.00 43.44  ? 117  SER B CA    1 
ATOM   8213  C  C     . SER B 2 93   ? -13.911 69.746  -9.851  1.00 91.49  ? 117  SER B C     1 
ATOM   8214  O  O     . SER B 2 93   ? -13.380 69.610  -10.953 1.00 44.77  ? 117  SER B O     1 
ATOM   8215  C  CB    . SER B 2 93   ? -13.634 67.305  -9.391  1.00 64.42  ? 117  SER B CB    1 
ATOM   8216  O  OG    . SER B 2 93   ? -12.615 67.235  -10.373 1.00 75.64  ? 117  SER B OG    1 
ATOM   8217  N  N     . VAL B 2 94   ? -14.686 70.786  -9.550  1.00 84.63  ? 118  VAL B N     1 
ATOM   8218  C  CA    . VAL B 2 94   ? -14.902 71.880  -10.497 1.00 40.97  ? 118  VAL B CA    1 
ATOM   8219  C  C     . VAL B 2 94   ? -14.836 73.242  -9.805  1.00 42.89  ? 118  VAL B C     1 
ATOM   8220  O  O     . VAL B 2 94   ? -14.262 74.193  -10.338 1.00 40.50  ? 118  VAL B O     1 
ATOM   8221  C  CB    . VAL B 2 94   ? -16.265 71.753  -11.224 1.00 43.74  ? 118  VAL B CB    1 
ATOM   8222  C  CG1   . VAL B 2 94   ? -16.564 73.007  -12.037 1.00 73.67  ? 118  VAL B CG1   1 
ATOM   8223  C  CG2   . VAL B 2 94   ? -16.288 70.523  -12.120 1.00 40.08  ? 118  VAL B CG2   1 
ATOM   8224  N  N     . VAL B 2 95   ? -15.412 73.324  -8.610  1.00 91.39  ? 119  VAL B N     1 
ATOM   8225  C  CA    . VAL B 2 95   ? -15.537 74.597  -7.908  1.00 73.46  ? 119  VAL B CA    1 
ATOM   8226  C  C     . VAL B 2 95   ? -14.526 74.782  -6.779  1.00 56.07  ? 119  VAL B C     1 
ATOM   8227  O  O     . VAL B 2 95   ? -13.844 75.805  -6.710  1.00 65.61  ? 119  VAL B O     1 
ATOM   8228  C  CB    . VAL B 2 95   ? -16.944 74.757  -7.315  1.00 73.90  ? 119  VAL B CB    1 
ATOM   8229  C  CG1   . VAL B 2 95   ? -17.067 76.086  -6.586  1.00 40.17  ? 119  VAL B CG1   1 
ATOM   8230  C  CG2   . VAL B 2 95   ? -17.981 74.645  -8.408  1.00 74.32  ? 119  VAL B CG2   1 
ATOM   8231  N  N     . VAL B 2 96   ? -14.438 73.795  -5.894  1.00 74.99  ? 120  VAL B N     1 
ATOM   8232  C  CA    . VAL B 2 96   ? -13.654 73.939  -4.672  1.00 77.42  ? 120  VAL B CA    1 
ATOM   8233  C  C     . VAL B 2 96   ? -12.152 74.023  -4.930  1.00 45.76  ? 120  VAL B C     1 
ATOM   8234  O  O     . VAL B 2 96   ? -11.520 75.030  -4.616  1.00 71.08  ? 120  VAL B O     1 
ATOM   8235  C  CB    . VAL B 2 96   ? -13.920 72.778  -3.698  1.00 76.95  ? 120  VAL B CB    1 
ATOM   8236  C  CG1   . VAL B 2 96   ? -13.149 72.989  -2.404  1.00 90.06  ? 120  VAL B CG1   1 
ATOM   8237  C  CG2   . VAL B 2 96   ? -15.407 72.655  -3.418  1.00 76.53  ? 120  VAL B CG2   1 
ATOM   8238  N  N     . PHE B 2 97   ? -11.587 72.963  -5.499  1.00 48.79  ? 121  PHE B N     1 
ATOM   8239  C  CA    . PHE B 2 97   ? -10.142 72.873  -5.686  1.00 55.69  ? 121  PHE B CA    1 
ATOM   8240  C  C     . PHE B 2 97   ? -9.600  73.954  -6.616  1.00 69.63  ? 121  PHE B C     1 
ATOM   8241  O  O     . PHE B 2 97   ? -8.486  74.443  -6.427  1.00 76.46  ? 121  PHE B O     1 
ATOM   8242  C  CB    . PHE B 2 97   ? -9.760  71.491  -6.218  1.00 69.10  ? 121  PHE B CB    1 
ATOM   8243  C  CG    . PHE B 2 97   ? -9.827  70.404  -5.184  1.00 65.58  ? 121  PHE B CG    1 
ATOM   8244  C  CD1   . PHE B 2 97   ? -9.858  70.716  -3.834  1.00 47.59  ? 121  PHE B CD1   1 
ATOM   8245  C  CD2   . PHE B 2 97   ? -9.855  69.071  -5.559  1.00 77.13  ? 121  PHE B CD2   1 
ATOM   8246  C  CE1   . PHE B 2 97   ? -9.918  69.720  -2.879  1.00 64.40  ? 121  PHE B CE1   1 
ATOM   8247  C  CE2   . PHE B 2 97   ? -9.915  68.070  -4.609  1.00 68.49  ? 121  PHE B CE2   1 
ATOM   8248  C  CZ    . PHE B 2 97   ? -9.946  68.395  -3.267  1.00 74.34  ? 121  PHE B CZ    1 
ATOM   8249  N  N     . ARG B 2 98   ? -10.386 74.328  -7.619  1.00 68.52  ? 122  ARG B N     1 
ATOM   8250  C  CA    . ARG B 2 98   ? -9.957  75.357  -8.557  1.00 76.56  ? 122  ARG B CA    1 
ATOM   8251  C  C     . ARG B 2 98   ? -10.432 76.736  -8.114  1.00 73.48  ? 122  ARG B C     1 
ATOM   8252  O  O     . ARG B 2 98   ? -11.631 76.980  -7.979  1.00 66.03  ? 122  ARG B O     1 
ATOM   8253  C  CB    . ARG B 2 98   ? -10.464 75.045  -9.967  1.00 73.86  ? 122  ARG B CB    1 
ATOM   8254  C  CG    . ARG B 2 98   ? -9.900  73.756  -10.549 1.00 76.34  ? 122  ARG B CG    1 
ATOM   8255  C  CD    . ARG B 2 98   ? -10.371 73.535  -11.977 1.00 74.27  ? 122  ARG B CD    1 
ATOM   8256  N  NE    . ARG B 2 98   ? -9.901  72.263  -12.519 1.00 75.20  ? 122  ARG B NE    1 
ATOM   8257  C  CZ    . ARG B 2 98   ? -10.524 71.102  -12.343 1.00 75.25  ? 122  ARG B CZ    1 
ATOM   8258  N  NH1   . ARG B 2 98   ? -11.642 71.051  -11.635 1.00 81.87  ? 122  ARG B NH1   1 
ATOM   8259  N  NH2   . ARG B 2 98   ? -10.029 69.992  -12.872 1.00 72.36  ? 122  ARG B NH2   1 
ATOM   8260  N  N     . GLU B 2 99   ? -9.478  77.634  -7.883  1.00 75.02  ? 123  GLU B N     1 
ATOM   8261  C  CA    . GLU B 2 99   ? -9.791  79.009  -7.517  1.00 73.90  ? 123  GLU B CA    1 
ATOM   8262  C  C     . GLU B 2 99   ? -10.370 79.755  -8.714  1.00 65.19  ? 123  GLU B C     1 
ATOM   8263  O  O     . GLU B 2 99   ? -10.486 79.192  -9.803  1.00 74.03  ? 123  GLU B O     1 
ATOM   8264  C  CB    . GLU B 2 99   ? -8.547  79.731  -6.989  1.00 69.11  ? 123  GLU B CB    1 
ATOM   8265  C  CG    . GLU B 2 99   ? -7.407  79.857  -7.994  1.00 69.44  ? 123  GLU B CG    1 
ATOM   8266  C  CD    . GLU B 2 99   ? -6.553  78.606  -8.081  1.00 86.78  ? 123  GLU B CD    1 
ATOM   8267  O  OE1   . GLU B 2 99   ? -5.681  78.542  -8.974  1.00 81.20  ? 123  GLU B OE1   1 
ATOM   8268  O  OE2   . GLU B 2 99   ? -6.748  77.689  -7.256  1.00 86.03  ? 123  GLU B OE2   1 
ATOM   8269  N  N     . GLN B 2 100  ? -10.737 81.016  -8.497  1.00 93.65  ? 124  GLN B N     1 
ATOM   8270  C  CA    . GLN B 2 100  ? -11.346 81.860  -9.527  1.00 49.39  ? 124  GLN B CA    1 
ATOM   8271  C  C     . GLN B 2 100  ? -12.695 81.317  -10.004 1.00 64.33  ? 124  GLN B C     1 
ATOM   8272  O  O     . GLN B 2 100  ? -13.219 81.754  -11.028 1.00 66.46  ? 124  GLN B O     1 
ATOM   8273  C  CB    . GLN B 2 100  ? -10.397 82.030  -10.720 1.00 49.10  ? 124  GLN B CB    1 
ATOM   8274  C  CG    . GLN B 2 100  ? -9.093  82.732  -10.381 1.00 68.94  ? 124  GLN B CG    1 
ATOM   8275  C  CD    . GLN B 2 100  ? -8.107  82.732  -11.535 1.00 69.52  ? 124  GLN B CD    1 
ATOM   8276  O  OE1   . GLN B 2 100  ? -8.209  81.919  -12.454 1.00 84.08  ? 124  GLN B OE1   1 
ATOM   8277  N  NE2   . GLN B 2 100  ? -7.146  83.648  -11.491 1.00 75.54  ? 124  GLN B NE2   1 
ATOM   8278  N  N     . VAL B 2 101  ? -13.256 80.370  -9.259  1.00 45.49  ? 125  VAL B N     1 
ATOM   8279  C  CA    . VAL B 2 101  ? -14.571 79.825  -9.581  1.00 87.27  ? 125  VAL B CA    1 
ATOM   8280  C  C     . VAL B 2 101  ? -15.508 79.950  -8.387  1.00 93.88  ? 125  VAL B C     1 
ATOM   8281  O  O     . VAL B 2 101  ? -15.234 79.423  -7.309  1.00 92.12  ? 125  VAL B O     1 
ATOM   8282  C  CB    . VAL B 2 101  ? -14.494 78.351  -10.014 1.00 69.41  ? 125  VAL B CB    1 
ATOM   8283  C  CG1   . VAL B 2 101  ? -15.890 77.802  -10.264 1.00 77.58  ? 125  VAL B CG1   1 
ATOM   8284  C  CG2   . VAL B 2 101  ? -13.639 78.209  -11.259 1.00 69.10  ? 125  VAL B CG2   1 
ATOM   8285  N  N     . PHE B 2 102  ? -16.618 80.650  -8.594  1.00 44.79  ? 126  PHE B N     1 
ATOM   8286  C  CA    . PHE B 2 102  ? -17.554 80.944  -7.519  1.00 87.95  ? 126  PHE B CA    1 
ATOM   8287  C  C     . PHE B 2 102  ? -18.968 80.496  -7.883  1.00 92.75  ? 126  PHE B C     1 
ATOM   8288  O  O     . PHE B 2 102  ? -19.333 80.478  -9.059  1.00 91.29  ? 126  PHE B O     1 
ATOM   8289  C  CB    . PHE B 2 102  ? -17.530 82.442  -7.200  1.00 41.25  ? 126  PHE B CB    1 
ATOM   8290  C  CG    . PHE B 2 102  ? -16.164 82.963  -6.852  1.00 41.93  ? 126  PHE B CG    1 
ATOM   8291  C  CD1   . PHE B 2 102  ? -15.359 83.540  -7.821  1.00 45.27  ? 126  PHE B CD1   1 
ATOM   8292  C  CD2   . PHE B 2 102  ? -15.683 82.869  -5.557  1.00 64.55  ? 126  PHE B CD2   1 
ATOM   8293  C  CE1   . PHE B 2 102  ? -14.100 84.015  -7.503  1.00 60.86  ? 126  PHE B CE1   1 
ATOM   8294  C  CE2   . PHE B 2 102  ? -14.426 83.342  -5.233  1.00 56.36  ? 126  PHE B CE2   1 
ATOM   8295  C  CZ    . PHE B 2 102  ? -13.633 83.916  -6.207  1.00 56.74  ? 126  PHE B CZ    1 
ATOM   8296  N  N     . PRO B 2 103  ? -19.766 80.122  -6.870  1.00 41.45  ? 127  PRO B N     1 
ATOM   8297  C  CA    . PRO B 2 103  ? -21.157 79.708  -7.086  1.00 92.08  ? 127  PRO B CA    1 
ATOM   8298  C  C     . PRO B 2 103  ? -22.054 80.867  -7.509  1.00 40.94  ? 127  PRO B C     1 
ATOM   8299  O  O     . PRO B 2 103  ? -21.877 81.992  -7.039  1.00 47.83  ? 127  PRO B O     1 
ATOM   8300  C  CB    . PRO B 2 103  ? -21.579 79.169  -5.717  1.00 87.02  ? 127  PRO B CB    1 
ATOM   8301  C  CG    . PRO B 2 103  ? -20.700 79.884  -4.750  1.00 91.66  ? 127  PRO B CG    1 
ATOM   8302  C  CD    . PRO B 2 103  ? -19.382 80.029  -5.450  1.00 90.55  ? 127  PRO B CD    1 
ATOM   8303  N  N     . VAL B 2 104  ? -23.010 80.585  -8.388  1.00 60.92  ? 128  VAL B N     1 
ATOM   8304  C  CA    . VAL B 2 104  ? -23.948 81.598  -8.857  1.00 56.73  ? 128  VAL B CA    1 
ATOM   8305  C  C     . VAL B 2 104  ? -25.380 81.079  -8.719  1.00 68.40  ? 128  VAL B C     1 
ATOM   8306  O  O     . VAL B 2 104  ? -25.642 79.894  -8.926  1.00 64.98  ? 128  VAL B O     1 
ATOM   8307  C  CB    . VAL B 2 104  ? -23.651 82.003  -10.326 1.00 91.48  ? 128  VAL B CB    1 
ATOM   8308  C  CG1   . VAL B 2 104  ? -23.724 80.796  -11.250 1.00 47.33  ? 128  VAL B CG1   1 
ATOM   8309  C  CG2   . VAL B 2 104  ? -24.591 83.105  -10.792 1.00 40.52  ? 128  VAL B CG2   1 
ATOM   8310  N  N     . ASP B 2 105  ? -26.301 81.962  -8.343  1.00 74.51  ? 129  ASP B N     1 
ATOM   8311  C  CA    . ASP B 2 105  ? -27.697 81.577  -8.168  1.00 65.51  ? 129  ASP B CA    1 
ATOM   8312  C  C     . ASP B 2 105  ? -28.588 82.226  -9.220  1.00 66.49  ? 129  ASP B C     1 
ATOM   8313  O  O     . ASP B 2 105  ? -28.966 83.391  -9.094  1.00 56.05  ? 129  ASP B O     1 
ATOM   8314  C  CB    . ASP B 2 105  ? -28.187 81.951  -6.768  1.00 74.79  ? 129  ASP B CB    1 
ATOM   8315  C  CG    . ASP B 2 105  ? -29.613 81.507  -6.512  1.00 70.54  ? 129  ASP B CG    1 
ATOM   8316  O  OD1   . ASP B 2 105  ? -30.342 82.228  -5.798  1.00 77.27  ? 129  ASP B OD1   1 
ATOM   8317  O  OD2   . ASP B 2 105  ? -30.005 80.436  -7.021  1.00 69.72  ? 129  ASP B OD2   1 
ATOM   8318  N  N     . ALA B 2 106  ? -28.919 81.465  -10.257 1.00 47.00  ? 130  ALA B N     1 
ATOM   8319  C  CA    . ALA B 2 106  ? -29.815 81.946  -11.301 1.00 47.82  ? 130  ALA B CA    1 
ATOM   8320  C  C     . ALA B 2 106  ? -31.251 81.526  -11.009 1.00 70.49  ? 130  ALA B C     1 
ATOM   8321  O  O     . ALA B 2 106  ? -31.496 80.421  -10.523 1.00 70.08  ? 130  ALA B O     1 
ATOM   8322  C  CB    . ALA B 2 106  ? -29.374 81.429  -12.660 1.00 40.86  ? 130  ALA B CB    1 
ATOM   8323  N  N     . LEU B 2 107  ? -32.195 82.413  -11.304 1.00 67.94  ? 131  LEU B N     1 
ATOM   8324  C  CA    . LEU B 2 107  ? -33.608 82.124  -11.088 1.00 66.41  ? 131  LEU B CA    1 
ATOM   8325  C  C     . LEU B 2 107  ? -34.110 81.103  -12.104 1.00 65.98  ? 131  LEU B C     1 
ATOM   8326  O  O     . LEU B 2 107  ? -33.433 80.812  -13.092 1.00 56.95  ? 131  LEU B O     1 
ATOM   8327  C  CB    . LEU B 2 107  ? -34.446 83.405  -11.169 1.00 69.62  ? 131  LEU B CB    1 
ATOM   8328  C  CG    . LEU B 2 107  ? -34.332 84.429  -10.032 1.00 73.23  ? 131  LEU B CG    1 
ATOM   8329  C  CD1   . LEU B 2 107  ? -34.378 83.743  -8.672  1.00 56.49  ? 131  LEU B CD1   1 
ATOM   8330  C  CD2   . LEU B 2 107  ? -33.084 85.295  -10.167 1.00 77.75  ? 131  LEU B CD2   1 
ATOM   8331  N  N     . HIS B 2 108  ? -35.298 80.560  -11.856 1.00 65.71  ? 132  HIS B N     1 
ATOM   8332  C  CA    . HIS B 2 108  ? -35.882 79.560  -12.743 1.00 55.53  ? 132  HIS B CA    1 
ATOM   8333  C  C     . HIS B 2 108  ? -36.695 80.197  -13.869 1.00 65.61  ? 132  HIS B C     1 
ATOM   8334  O  O     . HIS B 2 108  ? -37.028 79.534  -14.851 1.00 69.99  ? 132  HIS B O     1 
ATOM   8335  C  CB    . HIS B 2 108  ? -36.769 78.594  -11.953 1.00 42.41  ? 132  HIS B CB    1 
ATOM   8336  C  CG    . HIS B 2 108  ? -36.034 77.802  -10.916 1.00 66.79  ? 132  HIS B CG    1 
ATOM   8337  N  ND1   . HIS B 2 108  ? -35.675 76.484  -11.101 1.00 68.59  ? 132  HIS B ND1   1 
ATOM   8338  C  CD2   . HIS B 2 108  ? -35.597 78.140  -9.679  1.00 56.42  ? 132  HIS B CD2   1 
ATOM   8339  C  CE1   . HIS B 2 108  ? -35.046 76.045  -10.025 1.00 55.70  ? 132  HIS B CE1   1 
ATOM   8340  N  NE2   . HIS B 2 108  ? -34.986 77.031  -9.148  1.00 65.06  ? 132  HIS B NE2   1 
ATOM   8341  N  N     . HIS B 2 109  ? -37.010 81.481  -13.726 1.00 45.81  ? 133  HIS B N     1 
ATOM   8342  C  CA    . HIS B 2 109  ? -37.869 82.165  -14.688 1.00 64.89  ? 133  HIS B CA    1 
ATOM   8343  C  C     . HIS B 2 109  ? -37.376 83.570  -15.027 1.00 77.61  ? 133  HIS B C     1 
ATOM   8344  O  O     . HIS B 2 109  ? -36.283 83.973  -14.630 1.00 76.39  ? 133  HIS B O     1 
ATOM   8345  C  CB    . HIS B 2 109  ? -39.297 82.245  -14.150 1.00 69.39  ? 133  HIS B CB    1 
ATOM   8346  C  CG    . HIS B 2 109  ? -39.452 83.189  -12.998 1.00 77.56  ? 133  HIS B CG    1 
ATOM   8347  N  ND1   . HIS B 2 109  ? -39.177 82.826  -11.696 1.00 73.40  ? 133  HIS B ND1   1 
ATOM   8348  C  CD2   . HIS B 2 109  ? -39.845 84.484  -12.953 1.00 70.33  ? 133  HIS B CD2   1 
ATOM   8349  C  CE1   . HIS B 2 109  ? -39.399 83.856  -10.899 1.00 74.62  ? 133  HIS B CE1   1 
ATOM   8350  N  NE2   . HIS B 2 109  ? -39.804 84.874  -11.636 1.00 69.87  ? 133  HIS B NE2   1 
ATOM   8351  N  N     . LYS B 2 110  ? -38.200 84.308  -15.765 1.00 74.78  ? 134  LYS B N     1 
ATOM   8352  C  CA    . LYS B 2 110  ? -37.917 85.700  -16.099 1.00 81.49  ? 134  LYS B CA    1 
ATOM   8353  C  C     . LYS B 2 110  ? -38.999 86.618  -15.537 1.00 93.62  ? 134  LYS B C     1 
ATOM   8354  O  O     . LYS B 2 110  ? -40.179 86.267  -15.545 1.00 76.73  ? 134  LYS B O     1 
ATOM   8355  C  CB    . LYS B 2 110  ? -37.810 85.882  -17.615 1.00 69.55  ? 134  LYS B CB    1 
ATOM   8356  C  CG    . LYS B 2 110  ? -36.487 85.431  -18.210 1.00 69.40  ? 134  LYS B CG    1 
ATOM   8357  C  CD    . LYS B 2 110  ? -35.334 86.257  -17.664 1.00 77.49  ? 134  LYS B CD    1 
ATOM   8358  C  CE    . LYS B 2 110  ? -34.049 85.985  -18.428 1.00 75.99  ? 134  LYS B CE    1 
ATOM   8359  N  NZ    . LYS B 2 110  ? -34.170 86.372  -19.861 1.00 77.07  ? 134  LYS B NZ    1 
ATOM   8360  N  N     . PRO B 2 111  ? -38.597 87.800  -15.042 1.00 72.24  ? 135  PRO B N     1 
ATOM   8361  C  CA    . PRO B 2 111  ? -39.525 88.783  -14.469 1.00 76.19  ? 135  PRO B CA    1 
ATOM   8362  C  C     . PRO B 2 111  ? -40.607 89.225  -15.453 1.00 68.28  ? 135  PRO B C     1 
ATOM   8363  O  O     . PRO B 2 111  ? -41.724 89.536  -15.038 1.00 69.74  ? 135  PRO B O     1 
ATOM   8364  C  CB    . PRO B 2 111  ? -38.611 89.958  -14.107 1.00 76.15  ? 135  PRO B CB    1 
ATOM   8365  C  CG    . PRO B 2 111  ? -37.266 89.346  -13.925 1.00 75.08  ? 135  PRO B CG    1 
ATOM   8366  C  CD    . PRO B 2 111  ? -37.195 88.241  -14.935 1.00 87.67  ? 135  PRO B CD    1 
ATOM   8367  N  N     . GLY B 2 112  ? -40.275 89.249  -16.739 1.00 70.50  ? 136  GLY B N     1 
ATOM   8368  C  CA    . GLY B 2 112  ? -41.221 89.653  -17.763 1.00 71.52  ? 136  GLY B CA    1 
ATOM   8369  C  C     . GLY B 2 112  ? -42.294 88.610  -18.009 1.00 69.76  ? 136  GLY B C     1 
ATOM   8370  O  O     . GLY B 2 112  ? -41.998 87.425  -18.161 1.00 71.79  ? 136  GLY B O     1 
ATOM   8371  N  N     . GLY B 2 155  ? -46.962 79.862  -19.629 1.00 84.01  ? 179  GLY B N     1 
ATOM   8372  C  CA    . GLY B 2 155  ? -45.654 80.367  -19.258 1.00 86.49  ? 179  GLY B CA    1 
ATOM   8373  C  C     . GLY B 2 155  ? -44.555 79.339  -19.448 1.00 90.93  ? 179  GLY B C     1 
ATOM   8374  O  O     . GLY B 2 155  ? -44.737 78.158  -19.148 1.00 93.25  ? 179  GLY B O     1 
ATOM   8375  N  N     . LYS B 2 156  ? -43.409 79.792  -19.949 1.00 92.12  ? 180  LYS B N     1 
ATOM   8376  C  CA    . LYS B 2 156  ? -42.265 78.915  -20.173 1.00 90.65  ? 180  LYS B CA    1 
ATOM   8377  C  C     . LYS B 2 156  ? -41.103 79.286  -19.256 1.00 76.99  ? 180  LYS B C     1 
ATOM   8378  O  O     . LYS B 2 156  ? -40.926 80.453  -18.903 1.00 77.12  ? 180  LYS B O     1 
ATOM   8379  C  CB    . LYS B 2 156  ? -41.823 78.973  -21.637 1.00 81.31  ? 180  LYS B CB    1 
ATOM   8380  C  CG    . LYS B 2 156  ? -42.917 78.610  -22.628 1.00 91.31  ? 180  LYS B CG    1 
ATOM   8381  C  CD    . LYS B 2 156  ? -42.434 78.734  -24.065 1.00 91.44  ? 180  LYS B CD    1 
ATOM   8382  C  CE    . LYS B 2 156  ? -41.320 77.745  -24.367 1.00 84.61  ? 180  LYS B CE    1 
ATOM   8383  N  NZ    . LYS B 2 156  ? -40.892 77.813  -25.791 1.00 71.03  ? 180  LYS B NZ    1 
ATOM   8384  N  N     . LEU B 2 157  ? -40.312 78.287  -18.876 1.00 73.06  ? 181  LEU B N     1 
ATOM   8385  C  CA    . LEU B 2 157  ? -39.203 78.498  -17.953 1.00 68.46  ? 181  LEU B CA    1 
ATOM   8386  C  C     . LEU B 2 157  ? -37.858 78.506  -18.673 1.00 49.53  ? 181  LEU B C     1 
ATOM   8387  O  O     . LEU B 2 157  ? -37.800 78.527  -19.903 1.00 69.68  ? 181  LEU B O     1 
ATOM   8388  C  CB    . LEU B 2 157  ? -39.199 77.425  -16.861 1.00 49.30  ? 181  LEU B CB    1 
ATOM   8389  C  CG    . LEU B 2 157  ? -40.313 77.453  -15.809 1.00 45.71  ? 181  LEU B CG    1 
ATOM   8390  C  CD1   . LEU B 2 157  ? -40.538 78.870  -15.303 1.00 49.37  ? 181  LEU B CD1   1 
ATOM   8391  C  CD2   . LEU B 2 157  ? -41.608 76.844  -16.335 1.00 65.36  ? 181  LEU B CD2   1 
ATOM   8392  N  N     . ARG B 2 158  ? -36.782 78.486  -17.893 1.00 48.29  ? 182  ARG B N     1 
ATOM   8393  C  CA    . ARG B 2 158  ? -35.428 78.525  -18.434 1.00 45.38  ? 182  ARG B CA    1 
ATOM   8394  C  C     . ARG B 2 158  ? -35.054 77.221  -19.136 1.00 60.50  ? 182  ARG B C     1 
ATOM   8395  O  O     . ARG B 2 158  ? -35.320 76.131  -18.628 1.00 44.25  ? 182  ARG B O     1 
ATOM   8396  C  CB    . ARG B 2 158  ? -34.419 78.825  -17.321 1.00 43.50  ? 182  ARG B CB    1 
ATOM   8397  C  CG    . ARG B 2 158  ? -34.460 77.839  -16.161 1.00 41.88  ? 182  ARG B CG    1 
ATOM   8398  C  CD    . ARG B 2 158  ? -33.339 78.088  -15.160 1.00 93.70  ? 182  ARG B CD    1 
ATOM   8399  N  NE    . ARG B 2 158  ? -33.353 77.104  -14.080 1.00 45.31  ? 182  ARG B NE    1 
ATOM   8400  C  CZ    . ARG B 2 158  ? -32.499 77.095  -13.061 1.00 48.80  ? 182  ARG B CZ    1 
ATOM   8401  N  NH1   . ARG B 2 158  ? -31.554 78.021  -12.976 1.00 41.38  ? 182  ARG B NH1   1 
ATOM   8402  N  NH2   . ARG B 2 158  ? -32.590 76.159  -12.126 1.00 87.66  ? 182  ARG B NH2   1 
ATOM   8403  N  N     . GLU B 2 159  ? -34.438 77.340  -20.308 1.00 64.82  ? 183  GLU B N     1 
ATOM   8404  C  CA    . GLU B 2 159  ? -33.965 76.173  -21.042 1.00 69.26  ? 183  GLU B CA    1 
ATOM   8405  C  C     . GLU B 2 159  ? -32.539 75.830  -20.627 1.00 48.12  ? 183  GLU B C     1 
ATOM   8406  O  O     . GLU B 2 159  ? -32.132 74.668  -20.654 1.00 68.88  ? 183  GLU B O     1 
ATOM   8407  C  CB    . GLU B 2 159  ? -34.037 76.415  -22.551 1.00 76.20  ? 183  GLU B CB    1 
ATOM   8408  C  CG    . GLU B 2 159  ? -35.450 76.586  -23.082 1.00 76.43  ? 183  GLU B CG    1 
ATOM   8409  C  CD    . GLU B 2 159  ? -35.489 76.801  -24.583 1.00 76.55  ? 183  GLU B CD    1 
ATOM   8410  O  OE1   . GLU B 2 159  ? -34.409 76.959  -25.193 1.00 90.50  ? 183  GLU B OE1   1 
ATOM   8411  O  OE2   . GLU B 2 159  ? -36.600 76.810  -25.153 1.00 81.38  ? 183  GLU B OE2   1 
ATOM   8412  N  N     . ASN B 2 160  ? -31.786 76.854  -20.241 1.00 44.54  ? 184  ASN B N     1 
ATOM   8413  C  CA    . ASN B 2 160  ? -30.416 76.673  -19.783 1.00 48.28  ? 184  ASN B CA    1 
ATOM   8414  C  C     . ASN B 2 160  ? -30.056 77.701  -18.720 1.00 42.71  ? 184  ASN B C     1 
ATOM   8415  O  O     . ASN B 2 160  ? -30.529 78.838  -18.758 1.00 44.71  ? 184  ASN B O     1 
ATOM   8416  C  CB    . ASN B 2 160  ? -29.439 76.766  -20.955 1.00 44.84  ? 184  ASN B CB    1 
ATOM   8417  C  CG    . ASN B 2 160  ? -29.536 78.087  -21.690 1.00 44.09  ? 184  ASN B CG    1 
ATOM   8418  O  OD1   . ASN B 2 160  ? -28.957 79.088  -21.271 1.00 42.73  ? 184  ASN B OD1   1 
ATOM   8419  N  ND2   . ASN B 2 160  ? -30.269 78.095  -22.797 1.00 65.59  ? 184  ASN B ND2   1 
ATOM   8420  N  N     . LEU B 2 161  ? -29.216 77.298  -17.773 1.00 56.33  ? 185  LEU B N     1 
ATOM   8421  C  CA    . LEU B 2 161  ? -28.828 78.174  -16.675 1.00 55.55  ? 185  LEU B CA    1 
ATOM   8422  C  C     . LEU B 2 161  ? -27.505 78.867  -16.978 1.00 41.03  ? 185  LEU B C     1 
ATOM   8423  O  O     . LEU B 2 161  ? -26.756 79.231  -16.072 1.00 84.18  ? 185  LEU B O     1 
ATOM   8424  C  CB    . LEU B 2 161  ? -28.743 77.395  -15.358 1.00 90.68  ? 185  LEU B CB    1 
ATOM   8425  C  CG    . LEU B 2 161  ? -27.679 76.322  -15.117 1.00 77.29  ? 185  LEU B CG    1 
ATOM   8426  C  CD1   . LEU B 2 161  ? -27.740 75.894  -13.665 1.00 76.80  ? 185  LEU B CD1   1 
ATOM   8427  C  CD2   . LEU B 2 161  ? -27.853 75.115  -16.023 1.00 75.31  ? 185  LEU B CD2   1 
ATOM   8428  N  N     . LEU B 2 162  ? -27.232 79.052  -18.265 1.00 49.97  ? 186  LEU B N     1 
ATOM   8429  C  CA    . LEU B 2 162  ? -26.064 79.801  -18.707 1.00 85.75  ? 186  LEU B CA    1 
ATOM   8430  C  C     . LEU B 2 162  ? -26.317 81.303  -18.637 1.00 91.34  ? 186  LEU B C     1 
ATOM   8431  O  O     . LEU B 2 162  ? -25.510 82.050  -18.085 1.00 92.12  ? 186  LEU B O     1 
ATOM   8432  C  CB    . LEU B 2 162  ? -25.677 79.401  -20.132 1.00 85.58  ? 186  LEU B CB    1 
ATOM   8433  C  CG    . LEU B 2 162  ? -24.915 80.450  -20.947 1.00 90.12  ? 186  LEU B CG    1 
ATOM   8434  C  CD1   . LEU B 2 162  ? -23.646 79.865  -21.530 1.00 48.95  ? 186  LEU B CD1   1 
ATOM   8435  C  CD2   . LEU B 2 162  ? -25.796 81.013  -22.050 1.00 93.23  ? 186  LEU B CD2   1 
ATOM   8436  N  N     . HIS B 2 163  ? -27.443 81.735  -19.196 1.00 86.54  ? 187  HIS B N     1 
ATOM   8437  C  CA    . HIS B 2 163  ? -27.778 83.155  -19.275 1.00 41.20  ? 187  HIS B CA    1 
ATOM   8438  C  C     . HIS B 2 163  ? -27.947 83.773  -17.891 1.00 45.09  ? 187  HIS B C     1 
ATOM   8439  O  O     . HIS B 2 163  ? -27.505 84.899  -17.644 1.00 42.82  ? 187  HIS B O     1 
ATOM   8440  C  CB    . HIS B 2 163  ? -29.052 83.355  -20.098 1.00 87.87  ? 187  HIS B CB    1 
ATOM   8441  C  CG    . HIS B 2 163  ? -29.435 84.790  -20.279 1.00 66.51  ? 187  HIS B CG    1 
ATOM   8442  N  ND1   . HIS B 2 163  ? -28.826 85.614  -21.201 1.00 66.95  ? 187  HIS B ND1   1 
ATOM   8443  C  CD2   . HIS B 2 163  ? -30.367 85.549  -19.654 1.00 64.50  ? 187  HIS B CD2   1 
ATOM   8444  C  CE1   . HIS B 2 163  ? -29.366 86.818  -21.137 1.00 69.42  ? 187  HIS B CE1   1 
ATOM   8445  N  NE2   . HIS B 2 163  ? -30.303 86.806  -20.207 1.00 69.04  ? 187  HIS B NE2   1 
ATOM   8446  N  N     . GLY B 2 164  ? -28.585 83.030  -16.992 1.00 87.94  ? 188  GLY B N     1 
ATOM   8447  C  CA    . GLY B 2 164  ? -28.776 83.478  -15.625 1.00 93.55  ? 188  GLY B CA    1 
ATOM   8448  C  C     . GLY B 2 164  ? -27.454 83.724  -14.925 1.00 91.16  ? 188  GLY B C     1 
ATOM   8449  O  O     . GLY B 2 164  ? -27.350 84.589  -14.054 1.00 84.86  ? 188  GLY B O     1 
ATOM   8450  N  N     . ALA B 2 165  ? -26.438 82.960  -15.312 1.00 90.30  ? 189  ALA B N     1 
ATOM   8451  C  CA    . ALA B 2 165  ? -25.099 83.137  -14.769 1.00 91.53  ? 189  ALA B CA    1 
ATOM   8452  C  C     . ALA B 2 165  ? -24.390 84.285  -15.476 1.00 87.48  ? 189  ALA B C     1 
ATOM   8453  O  O     . ALA B 2 165  ? -23.555 84.970  -14.885 1.00 42.16  ? 189  ALA B O     1 
ATOM   8454  C  CB    . ALA B 2 165  ? -24.301 81.853  -14.895 1.00 43.29  ? 189  ALA B CB    1 
ATOM   8455  N  N     . LEU B 2 166  ? -24.731 84.491  -16.744 1.00 84.72  ? 190  LEU B N     1 
ATOM   8456  C  CA    . LEU B 2 166  ? -24.188 85.601  -17.519 1.00 41.75  ? 190  LEU B CA    1 
ATOM   8457  C  C     . LEU B 2 166  ? -24.660 86.938  -16.960 1.00 49.75  ? 190  LEU B C     1 
ATOM   8458  O  O     . LEU B 2 166  ? -23.968 87.949  -17.074 1.00 41.72  ? 190  LEU B O     1 
ATOM   8459  C  CB    . LEU B 2 166  ? -24.586 85.480  -18.992 1.00 91.09  ? 190  LEU B CB    1 
ATOM   8460  C  CG    . LEU B 2 166  ? -23.524 84.955  -19.959 1.00 48.61  ? 190  LEU B CG    1 
ATOM   8461  C  CD1   . LEU B 2 166  ? -23.036 83.581  -19.539 1.00 46.38  ? 190  LEU B CD1   1 
ATOM   8462  C  CD2   . LEU B 2 166  ? -24.069 84.919  -21.376 1.00 93.44  ? 190  LEU B CD2   1 
ATOM   8463  N  N     . GLU B 2 167  ? -25.843 86.936  -16.353 1.00 69.13  ? 191  GLU B N     1 
ATOM   8464  C  CA    . GLU B 2 167  ? -26.393 88.145  -15.750 1.00 74.10  ? 191  GLU B CA    1 
ATOM   8465  C  C     . GLU B 2 167  ? -25.637 88.541  -14.482 1.00 73.86  ? 191  GLU B C     1 
ATOM   8466  O  O     . GLU B 2 167  ? -25.755 89.671  -14.007 1.00 70.46  ? 191  GLU B O     1 
ATOM   8467  C  CB    . GLU B 2 167  ? -27.877 87.954  -15.431 1.00 70.82  ? 191  GLU B CB    1 
ATOM   8468  C  CG    . GLU B 2 167  ? -28.750 87.721  -16.652 1.00 77.54  ? 191  GLU B CG    1 
ATOM   8469  C  CD    . GLU B 2 167  ? -30.187 87.405  -16.287 1.00 71.25  ? 191  GLU B CD    1 
ATOM   8470  O  OE1   . GLU B 2 167  ? -31.041 87.380  -17.198 1.00 70.22  ? 191  GLU B OE1   1 
ATOM   8471  O  OE2   . GLU B 2 167  ? -30.461 87.178  -15.090 1.00 73.61  ? 191  GLU B OE2   1 
ATOM   8472  N  N     . HIS B 2 168  ? -24.860 87.607  -13.941 1.00 66.23  ? 192  HIS B N     1 
ATOM   8473  C  CA    . HIS B 2 168  ? -24.116 87.844  -12.707 1.00 44.40  ? 192  HIS B CA    1 
ATOM   8474  C  C     . HIS B 2 168  ? -22.632 88.088  -12.968 1.00 43.65  ? 192  HIS B C     1 
ATOM   8475  O  O     . HIS B 2 168  ? -21.802 87.903  -12.078 1.00 56.60  ? 192  HIS B O     1 
ATOM   8476  C  CB    . HIS B 2 168  ? -24.278 86.660  -11.749 1.00 90.50  ? 192  HIS B CB    1 
ATOM   8477  C  CG    . HIS B 2 168  ? -25.661 86.512  -11.196 1.00 46.86  ? 192  HIS B CG    1 
ATOM   8478  N  ND1   . HIS B 2 168  ? -26.754 86.227  -11.985 1.00 45.08  ? 192  HIS B ND1   1 
ATOM   8479  C  CD2   . HIS B 2 168  ? -26.127 86.605  -9.928  1.00 46.35  ? 192  HIS B CD2   1 
ATOM   8480  C  CE1   . HIS B 2 168  ? -27.834 86.154  -11.229 1.00 66.15  ? 192  HIS B CE1   1 
ATOM   8481  N  NE2   . HIS B 2 168  ? -27.481 86.379  -9.976  1.00 64.46  ? 192  HIS B NE2   1 
ATOM   8482  N  N     . TYR B 2 169  ? -22.299 88.511  -14.182 1.00 45.86  ? 193  TYR B N     1 
ATOM   8483  C  CA    . TYR B 2 169  ? -20.902 88.654  -14.574 1.00 45.93  ? 193  TYR B CA    1 
ATOM   8484  C  C     . TYR B 2 169  ? -20.191 89.819  -13.883 1.00 56.80  ? 193  TYR B C     1 
ATOM   8485  O  O     . TYR B 2 169  ? -19.057 89.675  -13.431 1.00 65.87  ? 193  TYR B O     1 
ATOM   8486  C  CB    . TYR B 2 169  ? -20.793 88.816  -16.091 1.00 43.19  ? 193  TYR B CB    1 
ATOM   8487  C  CG    . TYR B 2 169  ? -19.406 89.190  -16.555 1.00 46.97  ? 193  TYR B CG    1 
ATOM   8488  C  CD1   . TYR B 2 169  ? -19.137 90.460  -17.048 1.00 69.62  ? 193  TYR B CD1   1 
ATOM   8489  C  CD2   . TYR B 2 169  ? -18.360 88.278  -16.485 1.00 43.50  ? 193  TYR B CD2   1 
ATOM   8490  C  CE1   . TYR B 2 169  ? -17.868 90.808  -17.468 1.00 71.81  ? 193  TYR B CE1   1 
ATOM   8491  C  CE2   . TYR B 2 169  ? -17.088 88.617  -16.902 1.00 45.91  ? 193  TYR B CE2   1 
ATOM   8492  C  CZ    . TYR B 2 169  ? -16.848 89.882  -17.393 1.00 55.44  ? 193  TYR B CZ    1 
ATOM   8493  O  OH    . TYR B 2 169  ? -15.581 90.224  -17.805 1.00 43.30  ? 193  TYR B OH    1 
ATOM   8494  N  N     . VAL B 2 170  ? -20.860 90.966  -13.800 1.00 67.90  ? 194  VAL B N     1 
ATOM   8495  C  CA    . VAL B 2 170  ? -20.233 92.194  -13.311 1.00 45.86  ? 194  VAL B CA    1 
ATOM   8496  C  C     . VAL B 2 170  ? -19.886 92.160  -11.819 1.00 65.09  ? 194  VAL B C     1 
ATOM   8497  O  O     . VAL B 2 170  ? -18.765 92.496  -11.429 1.00 75.51  ? 194  VAL B O     1 
ATOM   8498  C  CB    . VAL B 2 170  ? -21.136 93.413  -13.578 1.00 66.84  ? 194  VAL B CB    1 
ATOM   8499  C  CG1   . VAL B 2 170  ? -20.489 94.682  -13.043 1.00 69.51  ? 194  VAL B CG1   1 
ATOM   8500  C  CG2   . VAL B 2 170  ? -21.417 93.542  -15.066 1.00 66.51  ? 194  VAL B CG2   1 
ATOM   8501  N  N     . ASN B 2 171  ? -20.846 91.769  -10.987 1.00 49.92  ? 195  ASN B N     1 
ATOM   8502  C  CA    . ASN B 2 171  ? -20.611 91.679  -9.548  1.00 55.28  ? 195  ASN B CA    1 
ATOM   8503  C  C     . ASN B 2 171  ? -19.519 90.668  -9.221  1.00 73.19  ? 195  ASN B C     1 
ATOM   8504  O  O     . ASN B 2 171  ? -18.656 90.909  -8.371  1.00 74.94  ? 195  ASN B O     1 
ATOM   8505  C  CB    . ASN B 2 171  ? -21.899 91.305  -8.816  1.00 67.81  ? 195  ASN B CB    1 
ATOM   8506  C  CG    . ASN B 2 171  ? -22.968 92.365  -8.945  1.00 68.12  ? 195  ASN B CG    1 
ATOM   8507  O  OD1   . ASN B 2 171  ? -23.090 93.246  -8.094  1.00 68.22  ? 195  ASN B OD1   1 
ATOM   8508  N  ND2   . ASN B 2 171  ? -23.751 92.289  -10.015 1.00 77.51  ? 195  ASN B ND2   1 
ATOM   8509  N  N     . CYS B 2 172  ? -19.562 89.534  -9.910  1.00 69.20  ? 196  CYS B N     1 
ATOM   8510  C  CA    . CYS B 2 172  ? -18.561 88.497  -9.721  1.00 55.28  ? 196  CYS B CA    1 
ATOM   8511  C  C     . CYS B 2 172  ? -17.208 88.954  -10.258 1.00 65.98  ? 196  CYS B C     1 
ATOM   8512  O  O     . CYS B 2 172  ? -16.164 88.469  -9.822  1.00 66.40  ? 196  CYS B O     1 
ATOM   8513  C  CB    . CYS B 2 172  ? -19.009 87.199  -10.389 1.00 55.29  ? 196  CYS B CB    1 
ATOM   8514  S  SG    . CYS B 2 172  ? -20.463 86.458  -9.606  1.00 71.77  ? 196  CYS B SG    1 
ATOM   8515  N  N     . LEU B 2 173  ? -17.229 89.892  -11.201 1.00 72.88  ? 197  LEU B N     1 
ATOM   8516  C  CA    . LEU B 2 173  ? -16.004 90.554  -11.630 1.00 40.29  ? 197  LEU B CA    1 
ATOM   8517  C  C     . LEU B 2 173  ? -15.485 91.417  -10.491 1.00 43.67  ? 197  LEU B C     1 
ATOM   8518  O  O     . LEU B 2 173  ? -14.279 91.512  -10.269 1.00 45.54  ? 197  LEU B O     1 
ATOM   8519  C  CB    . LEU B 2 173  ? -16.235 91.414  -12.876 1.00 42.57  ? 197  LEU B CB    1 
ATOM   8520  C  CG    . LEU B 2 173  ? -15.675 90.943  -14.219 1.00 42.20  ? 197  LEU B CG    1 
ATOM   8521  C  CD1   . LEU B 2 173  ? -15.533 92.128  -15.162 1.00 46.70  ? 197  LEU B CD1   1 
ATOM   8522  C  CD2   . LEU B 2 173  ? -14.346 90.229  -14.044 1.00 56.39  ? 197  LEU B CD2   1 
ATOM   8523  N  N     . ASP B 2 174  ? -16.409 92.043  -9.768  1.00 76.64  ? 198  ASP B N     1 
ATOM   8524  C  CA    . ASP B 2 174  ? -16.045 92.926  -8.666  1.00 70.03  ? 198  ASP B CA    1 
ATOM   8525  C  C     . ASP B 2 174  ? -15.465 92.156  -7.483  1.00 73.52  ? 198  ASP B C     1 
ATOM   8526  O  O     . ASP B 2 174  ? -14.602 92.669  -6.772  1.00 72.93  ? 198  ASP B O     1 
ATOM   8527  C  CB    . ASP B 2 174  ? -17.254 93.747  -8.212  1.00 90.16  ? 198  ASP B CB    1 
ATOM   8528  C  CG    . ASP B 2 174  ? -16.919 94.700  -7.080  1.00 81.51  ? 198  ASP B CG    1 
ATOM   8529  O  OD1   . ASP B 2 174  ? -16.519 95.848  -7.368  1.00 87.45  ? 198  ASP B OD1   1 
ATOM   8530  O  OD2   . ASP B 2 174  ? -17.055 94.302  -5.904  1.00 84.56  ? 198  ASP B OD2   1 
ATOM   8531  N  N     . LEU B 2 175  ? -15.931 90.929  -7.268  1.00 75.41  ? 199  LEU B N     1 
ATOM   8532  C  CA    . LEU B 2 175  ? -15.421 90.140  -6.147  1.00 66.50  ? 199  LEU B CA    1 
ATOM   8533  C  C     . LEU B 2 175  ? -14.107 89.441  -6.499  1.00 66.61  ? 199  LEU B C     1 
ATOM   8534  O  O     . LEU B 2 175  ? -13.456 88.861  -5.630  1.00 72.51  ? 199  LEU B O     1 
ATOM   8535  C  CB    . LEU B 2 175  ? -16.466 89.116  -5.677  1.00 41.66  ? 199  LEU B CB    1 
ATOM   8536  C  CG    . LEU B 2 175  ? -16.761 87.832  -6.460  1.00 47.30  ? 199  LEU B CG    1 
ATOM   8537  C  CD1   . LEU B 2 175  ? -15.847 86.695  -6.034  1.00 45.07  ? 199  LEU B CD1   1 
ATOM   8538  C  CD2   . LEU B 2 175  ? -18.213 87.427  -6.274  1.00 45.57  ? 199  LEU B CD2   1 
ATOM   8539  N  N     . VAL B 2 176  ? -13.718 89.498  -7.769  1.00 69.00  ? 200  VAL B N     1 
ATOM   8540  C  CA    . VAL B 2 176  ? -12.464 88.890  -8.206  1.00 48.79  ? 200  VAL B CA    1 
ATOM   8541  C  C     . VAL B 2 176  ? -11.464 89.980  -8.601  1.00 68.14  ? 200  VAL B C     1 
ATOM   8542  O  O     . VAL B 2 176  ? -10.337 89.690  -9.012  1.00 47.59  ? 200  VAL B O     1 
ATOM   8543  C  CB    . VAL B 2 176  ? -12.691 87.915  -9.388  1.00 48.97  ? 200  VAL B CB    1 
ATOM   8544  C  CG1   . VAL B 2 176  ? -12.810 88.673  -10.701 1.00 49.74  ? 200  VAL B CG1   1 
ATOM   8545  C  CG2   . VAL B 2 176  ? -11.574 86.880  -9.461  1.00 48.39  ? 200  VAL B CG2   1 
ATOM   8546  N  N     . ASN B 2 177  ? -11.889 91.233  -8.449  1.00 77.68  ? 201  ASN B N     1 
ATOM   8547  C  CA    . ASN B 2 177  ? -11.089 92.405  -8.808  1.00 72.86  ? 201  ASN B CA    1 
ATOM   8548  C  C     . ASN B 2 177  ? -10.707 92.391  -10.287 1.00 67.20  ? 201  ASN B C     1 
ATOM   8549  O  O     . ASN B 2 177  ? -9.549  92.610  -10.643 1.00 60.54  ? 201  ASN B O     1 
ATOM   8550  C  CB    . ASN B 2 177  ? -9.832  92.494  -7.934  1.00 75.61  ? 201  ASN B CB    1 
ATOM   8551  C  CG    . ASN B 2 177  ? -9.271  93.903  -7.855  1.00 77.49  ? 201  ASN B CG    1 
ATOM   8552  O  OD1   . ASN B 2 177  ? -9.524  94.736  -8.726  1.00 84.41  ? 201  ASN B OD1   1 
ATOM   8553  N  ND2   . ASN B 2 177  ? -8.502  94.174  -6.807  1.00 91.43  ? 201  ASN B ND2   1 
ATOM   8554  N  N     . LYS B 2 178  ? -11.699 92.124  -11.134 1.00 55.28  ? 202  LYS B N     1 
ATOM   8555  C  CA    . LYS B 2 178  ? -11.536 92.097  -12.588 1.00 55.21  ? 202  LYS B CA    1 
ATOM   8556  C  C     . LYS B 2 178  ? -10.423 91.161  -13.059 1.00 55.53  ? 202  LYS B C     1 
ATOM   8557  O  O     . LYS B 2 178  ? -9.854  91.358  -14.132 1.00 69.19  ? 202  LYS B O     1 
ATOM   8558  C  CB    . LYS B 2 178  ? -11.278 93.511  -13.120 1.00 66.47  ? 202  LYS B CB    1 
ATOM   8559  C  CG    . LYS B 2 178  ? -12.454 94.461  -12.961 1.00 67.74  ? 202  LYS B CG    1 
ATOM   8560  C  CD    . LYS B 2 178  ? -12.143 95.830  -13.546 1.00 68.18  ? 202  LYS B CD    1 
ATOM   8561  C  CE    . LYS B 2 178  ? -13.358 96.745  -13.495 1.00 77.92  ? 202  LYS B CE    1 
ATOM   8562  N  NZ    . LYS B 2 178  ? -14.494 96.212  -14.299 1.00 75.66  ? 202  LYS B NZ    1 
ATOM   8563  N  N     . ARG B 2 179  ? -10.117 90.142  -12.262 1.00 47.90  ? 203  ARG B N     1 
ATOM   8564  C  CA    . ARG B 2 179  ? -9.082  89.183  -12.630 1.00 60.91  ? 203  ARG B CA    1 
ATOM   8565  C  C     . ARG B 2 179  ? -9.668  87.967  -13.339 1.00 56.93  ? 203  ARG B C     1 
ATOM   8566  O  O     . ARG B 2 179  ? -10.118 87.018  -12.696 1.00 69.37  ? 203  ARG B O     1 
ATOM   8567  C  CB    . ARG B 2 179  ? -8.296  88.729  -11.397 1.00 68.36  ? 203  ARG B CB    1 
ATOM   8568  C  CG    . ARG B 2 179  ? -7.493  89.823  -10.718 1.00 70.52  ? 203  ARG B CG    1 
ATOM   8569  C  CD    . ARG B 2 179  ? -6.501  89.235  -9.723  1.00 72.82  ? 203  ARG B CD    1 
ATOM   8570  N  NE    . ARG B 2 179  ? -7.153  88.375  -8.739  1.00 60.47  ? 203  ARG B NE    1 
ATOM   8571  C  CZ    . ARG B 2 179  ? -7.601  88.793  -7.560  1.00 70.66  ? 203  ARG B CZ    1 
ATOM   8572  N  NH1   . ARG B 2 179  ? -8.183  87.940  -6.729  1.00 71.69  ? 203  ARG B NH1   1 
ATOM   8573  N  NH2   . ARG B 2 179  ? -7.466  90.065  -7.210  1.00 68.27  ? 203  ARG B NH2   1 
ATOM   8574  N  N     . LEU B 2 180  ? -9.663  88.002  -14.666 1.00 49.45  ? 204  LEU B N     1 
ATOM   8575  C  CA    . LEU B 2 180  ? -10.066 86.846  -15.456 1.00 56.82  ? 204  LEU B CA    1 
ATOM   8576  C  C     . LEU B 2 180  ? -8.803  86.151  -15.973 1.00 68.26  ? 204  LEU B C     1 
ATOM   8577  O  O     . LEU B 2 180  ? -7.758  86.792  -16.093 1.00 45.29  ? 204  LEU B O     1 
ATOM   8578  C  CB    . LEU B 2 180  ? -11.000 87.263  -16.600 1.00 56.75  ? 204  LEU B CB    1 
ATOM   8579  C  CG    . LEU B 2 180  ? -10.417 87.698  -17.945 1.00 55.81  ? 204  LEU B CG    1 
ATOM   8580  C  CD1   . LEU B 2 180  ? -11.534 87.912  -18.951 1.00 56.89  ? 204  LEU B CD1   1 
ATOM   8581  C  CD2   . LEU B 2 180  ? -9.586  88.954  -17.809 1.00 69.92  ? 204  LEU B CD2   1 
ATOM   8582  N  N     . PRO B 2 181  ? -8.880  84.843  -16.282 1.00 56.99  ? 205  PRO B N     1 
ATOM   8583  C  CA    . PRO B 2 181  ? -10.043 83.945  -16.340 1.00 44.77  ? 205  PRO B CA    1 
ATOM   8584  C  C     . PRO B 2 181  ? -10.707 83.678  -14.993 1.00 42.78  ? 205  PRO B C     1 
ATOM   8585  O  O     . PRO B 2 181  ? -10.024 83.529  -13.982 1.00 47.06  ? 205  PRO B O     1 
ATOM   8586  C  CB    . PRO B 2 181  ? -9.451  82.650  -16.902 1.00 43.25  ? 205  PRO B CB    1 
ATOM   8587  C  CG    . PRO B 2 181  ? -8.038  82.675  -16.470 1.00 45.96  ? 205  PRO B CG    1 
ATOM   8588  C  CD    . PRO B 2 181  ? -7.627  84.117  -16.559 1.00 64.67  ? 205  PRO B CD    1 
ATOM   8589  N  N     . TYR B 2 182  ? -12.036 83.633  -14.995 1.00 47.77  ? 206  TYR B N     1 
ATOM   8590  C  CA    . TYR B 2 182  ? -12.795 83.276  -13.800 1.00 91.48  ? 206  TYR B CA    1 
ATOM   8591  C  C     . TYR B 2 182  ? -14.143 82.695  -14.208 1.00 86.58  ? 206  TYR B C     1 
ATOM   8592  O  O     . TYR B 2 182  ? -14.687 83.057  -15.250 1.00 43.83  ? 206  TYR B O     1 
ATOM   8593  C  CB    . TYR B 2 182  ? -12.978 84.488  -12.880 1.00 40.02  ? 206  TYR B CB    1 
ATOM   8594  C  CG    . TYR B 2 182  ? -14.288 85.225  -13.057 1.00 60.17  ? 206  TYR B CG    1 
ATOM   8595  C  CD1   . TYR B 2 182  ? -15.352 85.006  -12.190 1.00 47.89  ? 206  TYR B CD1   1 
ATOM   8596  C  CD2   . TYR B 2 182  ? -14.458 86.146  -14.082 1.00 67.34  ? 206  TYR B CD2   1 
ATOM   8597  C  CE1   . TYR B 2 182  ? -16.549 85.677  -12.344 1.00 40.09  ? 206  TYR B CE1   1 
ATOM   8598  C  CE2   . TYR B 2 182  ? -15.654 86.823  -14.243 1.00 56.08  ? 206  TYR B CE2   1 
ATOM   8599  C  CZ    . TYR B 2 182  ? -16.695 86.585  -13.371 1.00 46.36  ? 206  TYR B CZ    1 
ATOM   8600  O  OH    . TYR B 2 182  ? -17.887 87.256  -13.526 1.00 55.50  ? 206  TYR B OH    1 
ATOM   8601  N  N     . GLY B 2 183  ? -14.680 81.794  -13.392 1.00 47.25  ? 207  GLY B N     1 
ATOM   8602  C  CA    . GLY B 2 183  ? -15.889 81.082  -13.764 1.00 43.32  ? 207  GLY B CA    1 
ATOM   8603  C  C     . GLY B 2 183  ? -17.013 81.097  -12.747 1.00 40.82  ? 207  GLY B C     1 
ATOM   8604  O  O     . GLY B 2 183  ? -16.793 81.308  -11.555 1.00 87.05  ? 207  GLY B O     1 
ATOM   8605  N  N     . LEU B 2 184  ? -18.230 80.869  -13.233 1.00 86.99  ? 208  LEU B N     1 
ATOM   8606  C  CA    . LEU B 2 184  ? -19.404 80.764  -12.374 1.00 81.12  ? 208  LEU B CA    1 
ATOM   8607  C  C     . LEU B 2 184  ? -20.066 79.403  -12.555 1.00 87.80  ? 208  LEU B C     1 
ATOM   8608  O  O     . LEU B 2 184  ? -20.420 79.020  -13.668 1.00 92.91  ? 208  LEU B O     1 
ATOM   8609  C  CB    . LEU B 2 184  ? -20.400 81.884  -12.678 1.00 68.19  ? 208  LEU B CB    1 
ATOM   8610  C  CG    . LEU B 2 184  ? -19.854 83.307  -12.560 1.00 40.83  ? 208  LEU B CG    1 
ATOM   8611  C  CD1   . LEU B 2 184  ? -20.949 84.329  -12.819 1.00 81.93  ? 208  LEU B CD1   1 
ATOM   8612  C  CD2   . LEU B 2 184  ? -19.224 83.519  -11.195 1.00 42.39  ? 208  LEU B CD2   1 
ATOM   8613  N  N     . ALA B 2 185  ? -20.228 78.670  -11.458 1.00 85.66  ? 209  ALA B N     1 
ATOM   8614  C  CA    . ALA B 2 185  ? -20.783 77.324  -11.529 1.00 87.88  ? 209  ALA B CA    1 
ATOM   8615  C  C     . ALA B 2 185  ? -22.098 77.212  -10.767 1.00 47.58  ? 209  ALA B C     1 
ATOM   8616  O  O     . ALA B 2 185  ? -22.290 77.859  -9.737  1.00 47.84  ? 209  ALA B O     1 
ATOM   8617  C  CB    . ALA B 2 185  ? -19.783 76.316  -11.000 1.00 40.12  ? 209  ALA B CB    1 
ATOM   8618  N  N     . GLN B 2 186  ? -22.996 76.377  -11.282 1.00 48.22  ? 210  GLN B N     1 
ATOM   8619  C  CA    . GLN B 2 186  ? -24.318 76.200  -10.694 1.00 85.32  ? 210  GLN B CA    1 
ATOM   8620  C  C     . GLN B 2 186  ? -24.954 74.890  -11.152 1.00 90.10  ? 210  GLN B C     1 
ATOM   8621  O  O     . GLN B 2 186  ? -24.972 74.581  -12.345 1.00 86.32  ? 210  GLN B O     1 
ATOM   8622  C  CB    . GLN B 2 186  ? -25.220 77.379  -11.060 1.00 93.88  ? 210  GLN B CB    1 
ATOM   8623  C  CG    . GLN B 2 186  ? -26.634 77.285  -10.514 1.00 49.09  ? 210  GLN B CG    1 
ATOM   8624  C  CD    . GLN B 2 186  ? -27.543 78.354  -11.088 1.00 49.10  ? 210  GLN B CD    1 
ATOM   8625  O  OE1   . GLN B 2 186  ? -27.127 79.153  -11.928 1.00 86.49  ? 210  GLN B OE1   1 
ATOM   8626  N  NE2   . GLN B 2 186  ? -28.794 78.372  -10.639 1.00 56.29  ? 210  GLN B NE2   1 
ATOM   8627  N  N     . ILE B 2 187  ? -25.470 74.119  -10.201 1.00 77.19  ? 211  ILE B N     1 
ATOM   8628  C  CA    . ILE B 2 187  ? -26.165 72.877  -10.519 1.00 91.63  ? 211  ILE B CA    1 
ATOM   8629  C  C     . ILE B 2 187  ? -27.662 73.042  -10.296 1.00 56.42  ? 211  ILE B C     1 
ATOM   8630  O  O     . ILE B 2 187  ? -28.137 73.002  -9.160  1.00 55.74  ? 211  ILE B O     1 
ATOM   8631  C  CB    . ILE B 2 187  ? -25.654 71.697  -9.671  1.00 43.76  ? 211  ILE B CB    1 
ATOM   8632  C  CG1   . ILE B 2 187  ? -24.132 71.587  -9.763  1.00 75.72  ? 211  ILE B CG1   1 
ATOM   8633  C  CG2   . ILE B 2 187  ? -26.312 70.400  -10.117 1.00 85.02  ? 211  ILE B CG2   1 
ATOM   8634  C  CD1   . ILE B 2 187  ? -23.560 70.442  -8.963  1.00 77.73  ? 211  ILE B CD1   1 
ATOM   8635  N  N     . GLY B 2 188  ? -28.402 73.229  -11.382 1.00 73.14  ? 212  GLY B N     1 
ATOM   8636  C  CA    . GLY B 2 188  ? -29.830 73.464  -11.286 1.00 76.70  ? 212  GLY B CA    1 
ATOM   8637  C  C     . GLY B 2 188  ? -30.631 72.740  -12.348 1.00 68.62  ? 212  GLY B C     1 
ATOM   8638  O  O     . GLY B 2 188  ? -30.129 72.445  -13.432 1.00 76.50  ? 212  GLY B O     1 
ATOM   8639  N  N     . VAL B 2 189  ? -31.888 72.455  -12.030 1.00 41.36  ? 213  VAL B N     1 
ATOM   8640  C  CA    . VAL B 2 189  ? -32.774 71.771  -12.959 1.00 49.68  ? 213  VAL B CA    1 
ATOM   8641  C  C     . VAL B 2 189  ? -33.242 72.734  -14.048 1.00 44.21  ? 213  VAL B C     1 
ATOM   8642  O  O     . VAL B 2 189  ? -33.589 73.882  -13.768 1.00 91.22  ? 213  VAL B O     1 
ATOM   8643  C  CB    . VAL B 2 189  ? -33.991 71.159  -12.225 1.00 42.19  ? 213  VAL B CB    1 
ATOM   8644  C  CG1   . VAL B 2 189  ? -34.620 72.178  -11.288 1.00 46.94  ? 213  VAL B CG1   1 
ATOM   8645  C  CG2   . VAL B 2 189  ? -35.012 70.622  -13.216 1.00 93.59  ? 213  VAL B CG2   1 
ATOM   8646  N  N     . CYS B 2 190  ? -33.223 72.268  -15.293 1.00 44.65  ? 214  CYS B N     1 
ATOM   8647  C  CA    . CYS B 2 190  ? -33.686 73.075  -16.413 1.00 90.18  ? 214  CYS B CA    1 
ATOM   8648  C  C     . CYS B 2 190  ? -34.913 72.451  -17.063 1.00 86.23  ? 214  CYS B C     1 
ATOM   8649  O  O     . CYS B 2 190  ? -35.109 71.236  -17.001 1.00 43.52  ? 214  CYS B O     1 
ATOM   8650  C  CB    . CYS B 2 190  ? -32.573 73.256  -17.444 1.00 84.28  ? 214  CYS B CB    1 
ATOM   8651  S  SG    . CYS B 2 190  ? -31.238 74.334  -16.889 1.00 70.90  ? 214  CYS B SG    1 
ATOM   8652  N  N     . PHE B 2 191  ? -35.732 73.293  -17.685 1.00 92.75  ? 215  PHE B N     1 
ATOM   8653  C  CA    . PHE B 2 191  ? -36.995 72.860  -18.269 1.00 85.56  ? 215  PHE B CA    1 
ATOM   8654  C  C     . PHE B 2 191  ? -36.957 72.952  -19.789 1.00 86.35  ? 215  PHE B C     1 
ATOM   8655  O  O     . PHE B 2 191  ? -36.732 74.023  -20.352 1.00 46.62  ? 215  PHE B O     1 
ATOM   8656  C  CB    . PHE B 2 191  ? -38.149 73.698  -17.720 1.00 87.90  ? 215  PHE B CB    1 
ATOM   8657  C  CG    . PHE B 2 191  ? -38.203 73.745  -16.219 1.00 87.91  ? 215  PHE B CG    1 
ATOM   8658  C  CD1   . PHE B 2 191  ? -38.983 72.846  -15.515 1.00 93.61  ? 215  PHE B CD1   1 
ATOM   8659  C  CD2   . PHE B 2 191  ? -37.472 74.687  -15.514 1.00 49.11  ? 215  PHE B CD2   1 
ATOM   8660  C  CE1   . PHE B 2 191  ? -39.034 72.886  -14.136 1.00 49.06  ? 215  PHE B CE1   1 
ATOM   8661  C  CE2   . PHE B 2 191  ? -37.518 74.732  -14.134 1.00 45.26  ? 215  PHE B CE2   1 
ATOM   8662  C  CZ    . PHE B 2 191  ? -38.301 73.830  -13.444 1.00 43.03  ? 215  PHE B CZ    1 
ATOM   8663  N  N     . HIS B 2 192  ? -37.184 71.822  -20.447 1.00 87.09  ? 216  HIS B N     1 
ATOM   8664  C  CA    . HIS B 2 192  ? -37.104 71.754  -21.898 1.00 46.92  ? 216  HIS B CA    1 
ATOM   8665  C  C     . HIS B 2 192  ? -38.450 71.390  -22.516 1.00 45.42  ? 216  HIS B C     1 
ATOM   8666  O  O     . HIS B 2 192  ? -39.071 70.399  -22.128 1.00 65.65  ? 216  HIS B O     1 
ATOM   8667  C  CB    . HIS B 2 192  ? -36.041 70.737  -22.326 1.00 55.43  ? 216  HIS B CB    1 
ATOM   8668  C  CG    . HIS B 2 192  ? -34.650 71.096  -21.901 1.00 65.07  ? 216  HIS B CG    1 
ATOM   8669  N  ND1   . HIS B 2 192  ? -34.309 71.331  -20.586 1.00 90.09  ? 216  HIS B ND1   1 
ATOM   8670  C  CD2   . HIS B 2 192  ? -33.512 71.252  -22.618 1.00 56.00  ? 216  HIS B CD2   1 
ATOM   8671  C  CE1   . HIS B 2 192  ? -33.022 71.621  -20.512 1.00 43.15  ? 216  HIS B CE1   1 
ATOM   8672  N  NE2   . HIS B 2 192  ? -32.515 71.579  -21.731 1.00 55.67  ? 216  HIS B NE2   1 
ATOM   8673  N  N     . PRO B 2 193  ? -38.909 72.201  -23.481 1.00 42.15  ? 217  PRO B N     1 
ATOM   8674  C  CA    . PRO B 2 193  ? -40.137 71.899  -24.221 1.00 48.16  ? 217  PRO B CA    1 
ATOM   8675  C  C     . PRO B 2 193  ? -39.946 70.698  -25.140 1.00 42.61  ? 217  PRO B C     1 
ATOM   8676  O  O     . PRO B 2 193  ? -38.965 70.648  -25.882 1.00 45.70  ? 217  PRO B O     1 
ATOM   8677  C  CB    . PRO B 2 193  ? -40.387 73.177  -25.025 1.00 66.15  ? 217  PRO B CB    1 
ATOM   8678  C  CG    . PRO B 2 193  ? -39.039 73.791  -25.181 1.00 68.80  ? 217  PRO B CG    1 
ATOM   8679  C  CD    . PRO B 2 193  ? -38.301 73.472  -23.912 1.00 56.29  ? 217  PRO B CD    1 
ATOM   8680  N  N     . VAL B 2 194  ? -40.868 69.744  -25.088 1.00 68.56  ? 218  VAL B N     1 
ATOM   8681  C  CA    . VAL B 2 194  ? -40.745 68.533  -25.890 1.00 55.42  ? 218  VAL B CA    1 
ATOM   8682  C  C     . VAL B 2 194  ? -42.058 68.163  -26.580 1.00 66.39  ? 218  VAL B C     1 
ATOM   8683  O  O     . VAL B 2 194  ? -43.109 68.065  -25.942 1.00 47.00  ? 218  VAL B O     1 
ATOM   8684  C  CB    . VAL B 2 194  ? -40.260 67.346  -25.028 1.00 55.64  ? 218  VAL B CB    1 
ATOM   8685  C  CG1   . VAL B 2 194  ? -40.979 67.325  -23.685 1.00 56.12  ? 218  VAL B CG1   1 
ATOM   8686  C  CG2   . VAL B 2 194  ? -40.436 66.029  -25.772 1.00 60.16  ? 218  VAL B CG2   1 
ATOM   8687  N  N     . PHE B 2 195  ? -41.985 67.975  -27.895 1.00 64.98  ? 219  PHE B N     1 
ATOM   8688  C  CA    . PHE B 2 195  ? -43.135 67.548  -28.682 1.00 69.14  ? 219  PHE B CA    1 
ATOM   8689  C  C     . PHE B 2 195  ? -43.126 66.035  -28.867 1.00 68.89  ? 219  PHE B C     1 
ATOM   8690  O  O     . PHE B 2 195  ? -42.501 65.517  -29.792 1.00 72.35  ? 219  PHE B O     1 
ATOM   8691  C  CB    . PHE B 2 195  ? -43.151 68.249  -30.043 1.00 77.72  ? 219  PHE B CB    1 
ATOM   8692  C  CG    . PHE B 2 195  ? -43.495 69.711  -29.971 1.00 71.94  ? 219  PHE B CG    1 
ATOM   8693  C  CD1   . PHE B 2 195  ? -44.164 70.226  -28.873 1.00 76.53  ? 219  PHE B CD1   1 
ATOM   8694  C  CD2   . PHE B 2 195  ? -43.153 70.569  -31.003 1.00 75.87  ? 219  PHE B CD2   1 
ATOM   8695  C  CE1   . PHE B 2 195  ? -44.484 71.570  -28.804 1.00 72.34  ? 219  PHE B CE1   1 
ATOM   8696  C  CE2   . PHE B 2 195  ? -43.470 71.914  -30.940 1.00 76.75  ? 219  PHE B CE2   1 
ATOM   8697  C  CZ    . PHE B 2 195  ? -44.136 72.415  -29.839 1.00 70.09  ? 219  PHE B CZ    1 
ATOM   8698  N  N     . ASP B 2 196  ? -43.822 65.332  -27.979 1.00 70.09  ? 220  ASP B N     1 
ATOM   8699  C  CA    . ASP B 2 196  ? -43.860 63.875  -28.012 1.00 90.76  ? 220  ASP B CA    1 
ATOM   8700  C  C     . ASP B 2 196  ? -44.646 63.363  -29.214 1.00 93.69  ? 220  ASP B C     1 
ATOM   8701  O  O     . ASP B 2 196  ? -45.851 63.590  -29.323 1.00 84.00  ? 220  ASP B O     1 
ATOM   8702  C  CB    . ASP B 2 196  ? -44.464 63.328  -26.716 1.00 73.85  ? 220  ASP B CB    1 
ATOM   8703  C  CG    . ASP B 2 196  ? -44.413 61.815  -26.643 1.00 73.69  ? 220  ASP B CG    1 
ATOM   8704  O  OD1   . ASP B 2 196  ? -43.405 61.276  -26.139 1.00 74.23  ? 220  ASP B OD1   1 
ATOM   8705  O  OD2   . ASP B 2 196  ? -45.382 61.163  -27.088 1.00 76.00  ? 220  ASP B OD2   1 
ATOM   8706  N  N     . THR B 2 197  ? -43.955 62.669  -30.113 1.00 81.11  ? 221  THR B N     1 
ATOM   8707  C  CA    . THR B 2 197  ? -44.583 62.119  -31.309 1.00 92.42  ? 221  THR B CA    1 
ATOM   8708  C  C     . THR B 2 197  ? -44.891 60.635  -31.141 1.00 90.07  ? 221  THR B C     1 
ATOM   8709  O  O     . THR B 2 197  ? -44.738 59.849  -32.077 1.00 85.30  ? 221  THR B O     1 
ATOM   8710  C  CB    . THR B 2 197  ? -43.692 62.311  -32.551 1.00 86.41  ? 221  THR B CB    1 
ATOM   8711  O  OG1   . THR B 2 197  ? -42.418 61.695  -32.328 1.00 90.81  ? 221  THR B OG1   1 
ATOM   8712  C  CG2   . THR B 2 197  ? -43.489 63.791  -32.836 1.00 86.17  ? 221  THR B CG2   1 
ATOM   8713  N  N     . LYS B 2 205  ? -45.889 68.033  -27.018 1.00 67.79  ? 229  LYS B N     1 
ATOM   8714  C  CA    . LYS B 2 205  ? -46.810 68.970  -26.391 1.00 69.01  ? 229  LYS B CA    1 
ATOM   8715  C  C     . LYS B 2 205  ? -46.525 69.102  -24.900 1.00 55.84  ? 229  LYS B C     1 
ATOM   8716  O  O     . LYS B 2 205  ? -47.143 69.913  -24.211 1.00 66.10  ? 229  LYS B O     1 
ATOM   8717  C  CB    . LYS B 2 205  ? -48.254 68.522  -26.615 1.00 70.19  ? 229  LYS B CB    1 
ATOM   8718  C  CG    . LYS B 2 205  ? -48.555 67.134  -26.076 1.00 69.23  ? 229  LYS B CG    1 
ATOM   8719  C  CD    . LYS B 2 205  ? -49.889 66.622  -26.588 1.00 71.01  ? 229  LYS B CD    1 
ATOM   8720  C  CE    . LYS B 2 205  ? -49.871 66.473  -28.099 1.00 68.11  ? 229  LYS B CE    1 
ATOM   8721  N  NZ    . LYS B 2 205  ? -51.173 65.978  -28.620 1.00 69.79  ? 229  LYS B NZ    1 
ATOM   8722  N  N     . SER B 2 206  ? -45.580 68.307  -24.406 1.00 76.58  ? 230  SER B N     1 
ATOM   8723  C  CA    . SER B 2 206  ? -45.262 68.300  -22.982 1.00 71.73  ? 230  SER B CA    1 
ATOM   8724  C  C     . SER B 2 206  ? -43.963 69.041  -22.686 1.00 55.17  ? 230  SER B C     1 
ATOM   8725  O  O     . SER B 2 206  ? -43.344 69.615  -23.581 1.00 68.88  ? 230  SER B O     1 
ATOM   8726  C  CB    . SER B 2 206  ? -45.174 66.864  -22.462 1.00 70.01  ? 230  SER B CB    1 
ATOM   8727  O  OG    . SER B 2 206  ? -44.877 66.845  -21.076 1.00 69.58  ? 230  SER B OG    1 
ATOM   8728  N  N     . ILE B 2 207  ? -43.555 69.024  -21.421 1.00 64.50  ? 231  ILE B N     1 
ATOM   8729  C  CA    . ILE B 2 207  ? -42.330 69.695  -21.000 1.00 55.90  ? 231  ILE B CA    1 
ATOM   8730  C  C     . ILE B 2 207  ? -41.584 68.854  -19.966 1.00 70.25  ? 231  ILE B C     1 
ATOM   8731  O  O     . ILE B 2 207  ? -42.146 68.467  -18.942 1.00 75.42  ? 231  ILE B O     1 
ATOM   8732  C  CB    . ILE B 2 207  ? -42.628 71.103  -20.429 1.00 56.63  ? 231  ILE B CB    1 
ATOM   8733  C  CG1   . ILE B 2 207  ? -41.398 71.669  -19.707 1.00 44.10  ? 231  ILE B CG1   1 
ATOM   8734  C  CG2   . ILE B 2 207  ? -43.854 71.069  -19.518 1.00 68.44  ? 231  ILE B CG2   1 
ATOM   8735  C  CD1   . ILE B 2 207  ? -41.526 71.737  -18.195 1.00 43.78  ? 231  ILE B CD1   1 
ATOM   8736  N  N     . GLY B 2 208  ? -40.315 68.571  -20.244 1.00 71.20  ? 232  GLY B N     1 
ATOM   8737  C  CA    . GLY B 2 208  ? -39.522 67.725  -19.371 1.00 75.24  ? 232  GLY B CA    1 
ATOM   8738  C  C     . GLY B 2 208  ? -38.405 68.465  -18.664 1.00 64.30  ? 232  GLY B C     1 
ATOM   8739  O  O     . GLY B 2 208  ? -37.671 69.233  -19.279 1.00 69.84  ? 232  GLY B O     1 
ATOM   8740  N  N     . GLU B 2 209  ? -38.271 68.225  -17.364 1.00 67.72  ? 233  GLU B N     1 
ATOM   8741  C  CA    . GLU B 2 209  ? -37.234 68.874  -16.573 1.00 86.87  ? 233  GLU B CA    1 
ATOM   8742  C  C     . GLU B 2 209  ? -36.090 67.913  -16.259 1.00 85.42  ? 233  GLU B C     1 
ATOM   8743  O  O     . GLU B 2 209  ? -36.305 66.712  -16.086 1.00 40.58  ? 233  GLU B O     1 
ATOM   8744  C  CB    . GLU B 2 209  ? -37.823 69.433  -15.277 1.00 90.29  ? 233  GLU B CB    1 
ATOM   8745  C  CG    . GLU B 2 209  ? -38.366 68.376  -14.335 1.00 43.98  ? 233  GLU B CG    1 
ATOM   8746  C  CD    . GLU B 2 209  ? -38.928 68.969  -13.059 1.00 67.62  ? 233  GLU B CD    1 
ATOM   8747  O  OE1   . GLU B 2 209  ? -38.605 68.448  -11.971 1.00 74.21  ? 233  GLU B OE1   1 
ATOM   8748  O  OE2   . GLU B 2 209  ? -39.695 69.951  -13.145 1.00 55.62  ? 233  GLU B OE2   1 
ATOM   8749  N  N     . LYS B 2 210  ? -34.873 68.444  -16.191 1.00 90.90  ? 234  LYS B N     1 
ATOM   8750  C  CA    . LYS B 2 210  ? -33.707 67.625  -15.870 1.00 93.72  ? 234  LYS B CA    1 
ATOM   8751  C  C     . LYS B 2 210  ? -32.577 68.439  -15.242 1.00 40.71  ? 234  LYS B C     1 
ATOM   8752  O  O     . LYS B 2 210  ? -32.274 69.550  -15.680 1.00 93.82  ? 234  LYS B O     1 
ATOM   8753  C  CB    . LYS B 2 210  ? -33.203 66.901  -17.122 1.00 93.51  ? 234  LYS B CB    1 
ATOM   8754  C  CG    . LYS B 2 210  ? -33.057 67.776  -18.354 1.00 68.25  ? 234  LYS B CG    1 
ATOM   8755  C  CD    . LYS B 2 210  ? -32.776 66.918  -19.578 1.00 68.75  ? 234  LYS B CD    1 
ATOM   8756  C  CE    . LYS B 2 210  ? -32.747 67.743  -20.853 1.00 60.60  ? 234  LYS B CE    1 
ATOM   8757  N  NZ    . LYS B 2 210  ? -32.553 66.881  -22.053 1.00 55.06  ? 234  LYS B NZ    1 
ATOM   8758  N  N     . THR B 2 211  ? -31.962 67.871  -14.208 1.00 68.24  ? 235  THR B N     1 
ATOM   8759  C  CA    . THR B 2 211  ? -30.883 68.529  -13.478 1.00 77.08  ? 235  THR B CA    1 
ATOM   8760  C  C     . THR B 2 211  ? -29.632 68.682  -14.334 1.00 44.77  ? 235  THR B C     1 
ATOM   8761  O  O     . THR B 2 211  ? -29.132 67.708  -14.895 1.00 43.69  ? 235  THR B O     1 
ATOM   8762  C  CB    . THR B 2 211  ? -30.517 67.751  -12.199 1.00 68.86  ? 235  THR B CB    1 
ATOM   8763  O  OG1   . THR B 2 211  ? -31.639 67.732  -11.308 1.00 81.51  ? 235  THR B OG1   1 
ATOM   8764  C  CG2   . THR B 2 211  ? -29.333 68.401  -11.499 1.00 68.03  ? 235  THR B CG2   1 
ATOM   8765  N  N     . GLU B 2 212  ? -29.129 69.909  -14.426 1.00 42.42  ? 236  GLU B N     1 
ATOM   8766  C  CA    . GLU B 2 212  ? -27.933 70.190  -15.212 1.00 40.00  ? 236  GLU B CA    1 
ATOM   8767  C  C     . GLU B 2 212  ? -26.889 70.944  -14.391 1.00 41.49  ? 236  GLU B C     1 
ATOM   8768  O  O     . GLU B 2 212  ? -27.213 71.884  -13.665 1.00 42.50  ? 236  GLU B O     1 
ATOM   8769  C  CB    . GLU B 2 212  ? -28.295 70.990  -16.466 1.00 69.52  ? 236  GLU B CB    1 
ATOM   8770  C  CG    . GLU B 2 212  ? -29.266 70.276  -17.397 1.00 40.18  ? 236  GLU B CG    1 
ATOM   8771  C  CD    . GLU B 2 212  ? -29.623 71.098  -18.622 1.00 44.79  ? 236  GLU B CD    1 
ATOM   8772  O  OE1   . GLU B 2 212  ? -29.342 72.315  -18.629 1.00 65.91  ? 236  GLU B OE1   1 
ATOM   8773  O  OE2   . GLU B 2 212  ? -30.184 70.525  -19.580 1.00 43.71  ? 236  GLU B OE2   1 
ATOM   8774  N  N     . ALA B 2 213  ? -25.637 70.517  -14.506 1.00 48.00  ? 237  ALA B N     1 
ATOM   8775  C  CA    . ALA B 2 213  ? -24.531 71.194  -13.842 1.00 44.61  ? 237  ALA B CA    1 
ATOM   8776  C  C     . ALA B 2 213  ? -23.749 72.028  -14.851 1.00 49.14  ? 237  ALA B C     1 
ATOM   8777  O  O     . ALA B 2 213  ? -23.089 71.484  -15.738 1.00 68.04  ? 237  ALA B O     1 
ATOM   8778  C  CB    . ALA B 2 213  ? -23.621 70.188  -13.158 1.00 72.53  ? 237  ALA B CB    1 
ATOM   8779  N  N     . SER B 2 214  ? -23.827 73.348  -14.714 1.00 41.39  ? 238  SER B N     1 
ATOM   8780  C  CA    . SER B 2 214  ? -23.206 74.245  -15.683 1.00 84.22  ? 238  SER B CA    1 
ATOM   8781  C  C     . SER B 2 214  ? -22.107 75.115  -15.089 1.00 86.31  ? 238  SER B C     1 
ATOM   8782  O  O     . SER B 2 214  ? -22.250 75.665  -13.996 1.00 42.02  ? 238  SER B O     1 
ATOM   8783  C  CB    . SER B 2 214  ? -24.263 75.145  -16.324 1.00 69.60  ? 238  SER B CB    1 
ATOM   8784  O  OG    . SER B 2 214  ? -23.660 76.111  -17.167 1.00 76.10  ? 238  SER B OG    1 
ATOM   8785  N  N     . LEU B 2 215  ? -21.011 75.231  -15.831 1.00 41.20  ? 239  LEU B N     1 
ATOM   8786  C  CA    . LEU B 2 215  ? -19.939 76.164  -15.515 1.00 86.54  ? 239  LEU B CA    1 
ATOM   8787  C  C     . LEU B 2 215  ? -19.707 77.106  -16.691 1.00 44.22  ? 239  LEU B C     1 
ATOM   8788  O  O     . LEU B 2 215  ? -19.445 76.662  -17.811 1.00 73.00  ? 239  LEU B O     1 
ATOM   8789  C  CB    . LEU B 2 215  ? -18.648 75.419  -15.175 1.00 76.40  ? 239  LEU B CB    1 
ATOM   8790  C  CG    . LEU B 2 215  ? -17.373 76.266  -15.151 1.00 74.11  ? 239  LEU B CG    1 
ATOM   8791  C  CD1   . LEU B 2 215  ? -17.416 77.282  -14.019 1.00 92.83  ? 239  LEU B CD1   1 
ATOM   8792  C  CD2   . LEU B 2 215  ? -16.135 75.388  -15.046 1.00 74.15  ? 239  LEU B CD2   1 
ATOM   8793  N  N     . VAL B 2 216  ? -19.823 78.405  -16.438 1.00 40.04  ? 240  VAL B N     1 
ATOM   8794  C  CA    . VAL B 2 216  ? -19.515 79.403  -17.453 1.00 44.71  ? 240  VAL B CA    1 
ATOM   8795  C  C     . VAL B 2 216  ? -18.155 80.026  -17.151 1.00 44.01  ? 240  VAL B C     1 
ATOM   8796  O  O     . VAL B 2 216  ? -17.960 80.677  -16.123 1.00 77.83  ? 240  VAL B O     1 
ATOM   8797  C  CB    . VAL B 2 216  ? -20.605 80.496  -17.543 1.00 91.73  ? 240  VAL B CB    1 
ATOM   8798  C  CG1   . VAL B 2 216  ? -21.055 80.932  -16.160 1.00 91.25  ? 240  VAL B CG1   1 
ATOM   8799  C  CG2   . VAL B 2 216  ? -20.105 81.677  -18.361 1.00 69.52  ? 240  VAL B CG2   1 
ATOM   8800  N  N     . TRP B 2 217  ? -17.214 79.799  -18.060 1.00 47.43  ? 241  TRP B N     1 
ATOM   8801  C  CA    . TRP B 2 217  ? -15.821 80.175  -17.864 1.00 92.83  ? 241  TRP B CA    1 
ATOM   8802  C  C     . TRP B 2 217  ? -15.463 81.419  -18.668 1.00 92.23  ? 241  TRP B C     1 
ATOM   8803  O  O     . TRP B 2 217  ? -15.228 81.343  -19.873 1.00 86.74  ? 241  TRP B O     1 
ATOM   8804  C  CB    . TRP B 2 217  ? -14.915 79.002  -18.253 1.00 84.49  ? 241  TRP B CB    1 
ATOM   8805  C  CG    . TRP B 2 217  ? -13.454 79.209  -17.990 1.00 85.26  ? 241  TRP B CG    1 
ATOM   8806  C  CD1   . TRP B 2 217  ? -12.494 79.522  -18.905 1.00 40.60  ? 241  TRP B CD1   1 
ATOM   8807  C  CD2   . TRP B 2 217  ? -12.784 79.097  -16.729 1.00 81.83  ? 241  TRP B CD2   1 
ATOM   8808  N  NE1   . TRP B 2 217  ? -11.268 79.620  -18.293 1.00 90.24  ? 241  TRP B NE1   1 
ATOM   8809  C  CE2   . TRP B 2 217  ? -11.420 79.363  -16.956 1.00 86.45  ? 241  TRP B CE2   1 
ATOM   8810  C  CE3   . TRP B 2 217  ? -13.206 78.802  -15.429 1.00 90.52  ? 241  TRP B CE3   1 
ATOM   8811  C  CZ2   . TRP B 2 217  ? -10.476 79.343  -15.933 1.00 87.66  ? 241  TRP B CZ2   1 
ATOM   8812  C  CZ3   . TRP B 2 217  ? -12.267 78.782  -14.416 1.00 81.86  ? 241  TRP B CZ3   1 
ATOM   8813  C  CH2   . TRP B 2 217  ? -10.918 79.052  -14.673 1.00 86.36  ? 241  TRP B CH2   1 
ATOM   8814  N  N     . PHE B 2 218  ? -15.435 82.567  -17.998 1.00 43.58  ? 242  PHE B N     1 
ATOM   8815  C  CA    . PHE B 2 218  ? -15.039 83.817  -18.637 1.00 40.69  ? 242  PHE B CA    1 
ATOM   8816  C  C     . PHE B 2 218  ? -13.525 83.860  -18.802 1.00 42.28  ? 242  PHE B C     1 
ATOM   8817  O  O     . PHE B 2 218  ? -12.789 83.935  -17.816 1.00 60.95  ? 242  PHE B O     1 
ATOM   8818  C  CB    . PHE B 2 218  ? -15.521 85.019  -17.823 1.00 47.15  ? 242  PHE B CB    1 
ATOM   8819  C  CG    . PHE B 2 218  ? -17.000 85.022  -17.567 1.00 41.57  ? 242  PHE B CG    1 
ATOM   8820  C  CD1   . PHE B 2 218  ? -17.886 85.437  -18.547 1.00 92.83  ? 242  PHE B CD1   1 
ATOM   8821  C  CD2   . PHE B 2 218  ? -17.505 84.609  -16.345 1.00 40.81  ? 242  PHE B CD2   1 
ATOM   8822  C  CE1   . PHE B 2 218  ? -19.249 85.438  -18.314 1.00 47.94  ? 242  PHE B CE1   1 
ATOM   8823  C  CE2   . PHE B 2 218  ? -18.867 84.608  -16.105 1.00 90.99  ? 242  PHE B CE2   1 
ATOM   8824  C  CZ    . PHE B 2 218  ? -19.740 85.024  -17.091 1.00 40.14  ? 242  PHE B CZ    1 
ATOM   8825  N  N     . THR B 2 219  ? -13.068 83.812  -20.051 1.00 43.89  ? 243  THR B N     1 
ATOM   8826  C  CA    . THR B 2 219  ? -11.642 83.703  -20.340 1.00 45.44  ? 243  THR B CA    1 
ATOM   8827  C  C     . THR B 2 219  ? -11.220 84.590  -21.508 1.00 66.93  ? 243  THR B C     1 
ATOM   8828  O  O     . THR B 2 219  ? -11.953 84.717  -22.485 1.00 73.38  ? 243  THR B O     1 
ATOM   8829  C  CB    . THR B 2 219  ? -11.250 82.246  -20.655 1.00 68.05  ? 243  THR B CB    1 
ATOM   8830  O  OG1   . THR B 2 219  ? -9.923  82.210  -21.191 1.00 68.12  ? 243  THR B OG1   1 
ATOM   8831  C  CG2   . THR B 2 219  ? -12.210 81.642  -21.670 1.00 69.11  ? 243  THR B CG2   1 
ATOM   8832  N  N     . PRO B 2 220  ? -10.030 85.203  -21.407 1.00 65.01  ? 244  PRO B N     1 
ATOM   8833  C  CA    . PRO B 2 220  ? -9.476  86.068  -22.456 1.00 49.21  ? 244  PRO B CA    1 
ATOM   8834  C  C     . PRO B 2 220  ? -9.389  85.373  -23.813 1.00 60.74  ? 244  PRO B C     1 
ATOM   8835  O  O     . PRO B 2 220  ? -9.106  84.177  -23.864 1.00 56.96  ? 244  PRO B O     1 
ATOM   8836  C  CB    . PRO B 2 220  ? -8.077  86.400  -21.932 1.00 55.96  ? 244  PRO B CB    1 
ATOM   8837  C  CG    . PRO B 2 220  ? -8.188  86.262  -20.460 1.00 48.47  ? 244  PRO B CG    1 
ATOM   8838  C  CD    . PRO B 2 220  ? -9.146  85.136  -20.230 1.00 43.15  ? 244  PRO B CD    1 
ATOM   8839  N  N     . PRO B 2 221  ? -9.630  86.121  -24.900 1.00 65.23  ? 245  PRO B N     1 
ATOM   8840  C  CA    . PRO B 2 221  ? -9.602  85.606  -26.274 1.00 67.91  ? 245  PRO B CA    1 
ATOM   8841  C  C     . PRO B 2 221  ? -8.265  84.972  -26.645 1.00 70.80  ? 245  PRO B C     1 
ATOM   8842  O  O     . PRO B 2 221  ? -8.226  84.048  -27.457 1.00 68.22  ? 245  PRO B O     1 
ATOM   8843  C  CB    . PRO B 2 221  ? -9.857  86.856  -27.122 1.00 73.93  ? 245  PRO B CB    1 
ATOM   8844  C  CG    . PRO B 2 221  ? -10.580 87.786  -26.214 1.00 77.20  ? 245  PRO B CG    1 
ATOM   8845  C  CD    . PRO B 2 221  ? -9.997  87.547  -24.856 1.00 68.62  ? 245  PRO B CD    1 
ATOM   8846  N  N     . ARG B 2 222  ? -7.186  85.472  -26.050 1.00 76.37  ? 246  ARG B N     1 
ATOM   8847  C  CA    . ARG B 2 222  ? -5.843  84.981  -26.334 1.00 72.80  ? 246  ARG B CA    1 
ATOM   8848  C  C     . ARG B 2 222  ? -5.676  83.519  -25.927 1.00 71.60  ? 246  ARG B C     1 
ATOM   8849  O  O     . ARG B 2 222  ? -4.914  82.775  -26.546 1.00 69.78  ? 246  ARG B O     1 
ATOM   8850  C  CB    . ARG B 2 222  ? -4.803  85.846  -25.617 1.00 67.98  ? 246  ARG B CB    1 
ATOM   8851  C  CG    . ARG B 2 222  ? -3.362  85.445  -25.878 1.00 76.79  ? 246  ARG B CG    1 
ATOM   8852  C  CD    . ARG B 2 222  ? -2.410  86.207  -24.974 1.00 69.08  ? 246  ARG B CD    1 
ATOM   8853  N  NE    . ARG B 2 222  ? -2.709  85.981  -23.563 1.00 68.65  ? 246  ARG B NE    1 
ATOM   8854  C  CZ    . ARG B 2 222  ? -2.213  84.978  -22.847 1.00 65.69  ? 246  ARG B CZ    1 
ATOM   8855  N  NH1   . ARG B 2 222  ? -1.391  84.103  -23.410 1.00 67.34  ? 246  ARG B NH1   1 
ATOM   8856  N  NH2   . ARG B 2 222  ? -2.538  84.849  -21.568 1.00 55.62  ? 246  ARG B NH2   1 
ATOM   8857  N  N     . THR B 2 223  ? -6.398  83.108  -24.889 1.00 56.71  ? 247  THR B N     1 
ATOM   8858  C  CA    . THR B 2 223  ? -6.269  81.754  -24.365 1.00 67.31  ? 247  THR B CA    1 
ATOM   8859  C  C     . THR B 2 223  ? -7.609  81.022  -24.282 1.00 69.05  ? 247  THR B C     1 
ATOM   8860  O  O     . THR B 2 223  ? -7.813  80.186  -23.403 1.00 73.85  ? 247  THR B O     1 
ATOM   8861  C  CB    . THR B 2 223  ? -5.617  81.764  -22.968 1.00 77.04  ? 247  THR B CB    1 
ATOM   8862  O  OG1   . THR B 2 223  ? -5.681  80.451  -22.397 1.00 70.66  ? 247  THR B OG1   1 
ATOM   8863  C  CG2   . THR B 2 223  ? -6.331  82.745  -22.050 1.00 47.29  ? 247  THR B CG2   1 
ATOM   8864  N  N     . SER B 2 224  ? -8.516  81.329  -25.204 1.00 75.43  ? 248  SER B N     1 
ATOM   8865  C  CA    . SER B 2 224  ? -9.834  80.699  -25.219 1.00 55.36  ? 248  SER B CA    1 
ATOM   8866  C  C     . SER B 2 224  ? -9.758  79.218  -25.576 1.00 67.54  ? 248  SER B C     1 
ATOM   8867  O  O     . SER B 2 224  ? -10.250 78.364  -24.836 1.00 56.74  ? 248  SER B O     1 
ATOM   8868  C  CB    . SER B 2 224  ? -10.759 81.420  -26.200 1.00 73.50  ? 248  SER B CB    1 
ATOM   8869  O  OG    . SER B 2 224  ? -11.035 82.738  -25.763 1.00 68.58  ? 248  SER B OG    1 
ATOM   8870  N  N     . ASN B 2 225  ? -9.141  78.924  -26.717 1.00 47.51  ? 249  ASN B N     1 
ATOM   8871  C  CA    . ASN B 2 225  ? -9.017  77.554  -27.203 1.00 47.55  ? 249  ASN B CA    1 
ATOM   8872  C  C     . ASN B 2 225  ? -8.268  76.657  -26.224 1.00 64.26  ? 249  ASN B C     1 
ATOM   8873  O  O     . ASN B 2 225  ? -8.619  75.490  -26.043 1.00 74.37  ? 249  ASN B O     1 
ATOM   8874  C  CB    . ASN B 2 225  ? -8.315  77.538  -28.561 1.00 65.89  ? 249  ASN B CB    1 
ATOM   8875  C  CG    . ASN B 2 225  ? -8.992  78.435  -29.577 1.00 69.77  ? 249  ASN B CG    1 
ATOM   8876  O  OD1   . ASN B 2 225  ? -8.370  79.338  -30.137 1.00 69.01  ? 249  ASN B OD1   1 
ATOM   8877  N  ND2   . ASN B 2 225  ? -10.275 78.191  -29.819 1.00 76.61  ? 249  ASN B ND2   1 
ATOM   8878  N  N     . GLN B 2 226  ? -7.235  77.212  -25.597 1.00 69.46  ? 250  GLN B N     1 
ATOM   8879  C  CA    . GLN B 2 226  ? -6.437  76.474  -24.627 1.00 47.49  ? 250  GLN B CA    1 
ATOM   8880  C  C     . GLN B 2 226  ? -7.289  76.044  -23.438 1.00 47.37  ? 250  GLN B C     1 
ATOM   8881  O  O     . GLN B 2 226  ? -7.196  74.905  -22.979 1.00 56.87  ? 250  GLN B O     1 
ATOM   8882  C  CB    . GLN B 2 226  ? -5.251  77.315  -24.151 1.00 71.69  ? 250  GLN B CB    1 
ATOM   8883  C  CG    . GLN B 2 226  ? -4.275  77.690  -25.255 1.00 71.08  ? 250  GLN B CG    1 
ATOM   8884  C  CD    . GLN B 2 226  ? -3.023  78.362  -24.725 1.00 73.24  ? 250  GLN B CD    1 
ATOM   8885  O  OE1   . GLN B 2 226  ? -2.859  78.531  -23.517 1.00 70.48  ? 250  GLN B OE1   1 
ATOM   8886  N  NE2   . GLN B 2 226  ? -2.129  78.748  -25.629 1.00 76.91  ? 250  GLN B NE2   1 
ATOM   8887  N  N     . TRP B 2 227  ? -8.123  76.957  -22.948 1.00 44.93  ? 251  TRP B N     1 
ATOM   8888  C  CA    . TRP B 2 227  ? -9.030  76.643  -21.850 1.00 42.68  ? 251  TRP B CA    1 
ATOM   8889  C  C     . TRP B 2 227  ? -10.120 75.679  -22.300 1.00 92.30  ? 251  TRP B C     1 
ATOM   8890  O  O     . TRP B 2 227  ? -10.624 74.888  -21.503 1.00 87.44  ? 251  TRP B O     1 
ATOM   8891  C  CB    . TRP B 2 227  ? -9.658  77.917  -21.279 1.00 40.18  ? 251  TRP B CB    1 
ATOM   8892  C  CG    . TRP B 2 227  ? -8.774  78.640  -20.307 1.00 47.40  ? 251  TRP B CG    1 
ATOM   8893  C  CD1   . TRP B 2 227  ? -8.178  79.853  -20.484 1.00 44.89  ? 251  TRP B CD1   1 
ATOM   8894  C  CD2   . TRP B 2 227  ? -8.383  78.188  -19.004 1.00 43.12  ? 251  TRP B CD2   1 
ATOM   8895  N  NE1   . TRP B 2 227  ? -7.444  80.188  -19.372 1.00 45.60  ? 251  TRP B NE1   1 
ATOM   8896  C  CE2   . TRP B 2 227  ? -7.553  79.181  -18.450 1.00 42.89  ? 251  TRP B CE2   1 
ATOM   8897  C  CE3   . TRP B 2 227  ? -8.656  77.041  -18.254 1.00 47.68  ? 251  TRP B CE3   1 
ATOM   8898  C  CZ2   . TRP B 2 227  ? -6.993  79.062  -17.181 1.00 40.41  ? 251  TRP B CZ2   1 
ATOM   8899  C  CZ3   . TRP B 2 227  ? -8.098  76.925  -16.994 1.00 47.91  ? 251  TRP B CZ3   1 
ATOM   8900  C  CH2   . TRP B 2 227  ? -7.277  77.929  -16.470 1.00 40.72  ? 251  TRP B CH2   1 
ATOM   8901  N  N     . LEU B 2 228  ? -10.483 75.746  -23.577 1.00 43.89  ? 252  LEU B N     1 
ATOM   8902  C  CA    . LEU B 2 228  ? -11.479 74.834  -24.128 1.00 48.72  ? 252  LEU B CA    1 
ATOM   8903  C  C     . LEU B 2 228  ? -10.957 73.401  -24.117 1.00 67.41  ? 252  LEU B C     1 
ATOM   8904  O  O     . LEU B 2 228  ? -11.642 72.488  -23.658 1.00 47.15  ? 252  LEU B O     1 
ATOM   8905  C  CB    . LEU B 2 228  ? -11.871 75.246  -25.549 1.00 49.15  ? 252  LEU B CB    1 
ATOM   8906  C  CG    . LEU B 2 228  ? -12.865 74.335  -26.276 1.00 40.53  ? 252  LEU B CG    1 
ATOM   8907  C  CD1   . LEU B 2 228  ? -14.120 74.124  -25.445 1.00 90.56  ? 252  LEU B CD1   1 
ATOM   8908  C  CD2   . LEU B 2 228  ? -13.218 74.907  -27.641 1.00 44.27  ? 252  LEU B CD2   1 
ATOM   8909  N  N     . ASP B 2 229  ? -9.741  73.210  -24.621 1.00 41.17  ? 253  ASP B N     1 
ATOM   8910  C  CA    . ASP B 2 229  ? -9.111  71.893  -24.617 1.00 41.59  ? 253  ASP B CA    1 
ATOM   8911  C  C     . ASP B 2 229  ? -8.855  71.426  -23.187 1.00 93.33  ? 253  ASP B C     1 
ATOM   8912  O  O     . ASP B 2 229  ? -9.007  70.242  -22.868 1.00 46.03  ? 253  ASP B O     1 
ATOM   8913  C  CB    . ASP B 2 229  ? -7.803  71.918  -25.410 1.00 48.02  ? 253  ASP B CB    1 
ATOM   8914  C  CG    . ASP B 2 229  ? -7.098  70.576  -25.416 1.00 69.12  ? 253  ASP B CG    1 
ATOM   8915  O  OD1   . ASP B 2 229  ? -7.441  69.729  -26.267 1.00 68.22  ? 253  ASP B OD1   1 
ATOM   8916  O  OD2   . ASP B 2 229  ? -6.201  70.369  -24.571 1.00 56.55  ? 253  ASP B OD2   1 
ATOM   8917  N  N     . PHE B 2 230  ? -8.468  72.373  -22.337 1.00 93.20  ? 254  PHE B N     1 
ATOM   8918  C  CA    . PHE B 2 230  ? -8.265  72.125  -20.913 1.00 91.69  ? 254  PHE B CA    1 
ATOM   8919  C  C     . PHE B 2 230  ? -9.502  71.500  -20.286 1.00 67.45  ? 254  PHE B C     1 
ATOM   8920  O  O     . PHE B 2 230  ? -9.454  70.389  -19.749 1.00 49.33  ? 254  PHE B O     1 
ATOM   8921  C  CB    . PHE B 2 230  ? -7.914  73.434  -20.200 1.00 92.26  ? 254  PHE B CB    1 
ATOM   8922  C  CG    . PHE B 2 230  ? -7.833  73.319  -18.703 1.00 91.14  ? 254  PHE B CG    1 
ATOM   8923  C  CD1   . PHE B 2 230  ? -6.652  72.947  -18.089 1.00 49.49  ? 254  PHE B CD1   1 
ATOM   8924  C  CD2   . PHE B 2 230  ? -8.931  73.609  -17.909 1.00 86.53  ? 254  PHE B CD2   1 
ATOM   8925  C  CE1   . PHE B 2 230  ? -6.571  72.851  -16.714 1.00 49.20  ? 254  PHE B CE1   1 
ATOM   8926  C  CE2   . PHE B 2 230  ? -8.856  73.512  -16.536 1.00 86.24  ? 254  PHE B CE2   1 
ATOM   8927  C  CZ    . PHE B 2 230  ? -7.675  73.133  -15.937 1.00 90.57  ? 254  PHE B CZ    1 
ATOM   8928  N  N     . TRP B 2 231  ? -10.613 72.223  -20.365 1.00 67.23  ? 255  TRP B N     1 
ATOM   8929  C  CA    . TRP B 2 231  ? -11.862 71.763  -19.781 1.00 48.00  ? 255  TRP B CA    1 
ATOM   8930  C  C     . TRP B 2 231  ? -12.365 70.499  -20.464 1.00 81.89  ? 255  TRP B C     1 
ATOM   8931  O  O     . TRP B 2 231  ? -12.992 69.666  -19.827 1.00 45.71  ? 255  TRP B O     1 
ATOM   8932  C  CB    . TRP B 2 231  ? -12.923 72.862  -19.843 1.00 93.63  ? 255  TRP B CB    1 
ATOM   8933  C  CG    . TRP B 2 231  ? -12.710 73.935  -18.821 1.00 68.60  ? 255  TRP B CG    1 
ATOM   8934  C  CD1   . TRP B 2 231  ? -12.424 75.246  -19.056 1.00 90.03  ? 255  TRP B CD1   1 
ATOM   8935  C  CD2   . TRP B 2 231  ? -12.752 73.782  -17.397 1.00 77.75  ? 255  TRP B CD2   1 
ATOM   8936  N  NE1   . TRP B 2 231  ? -12.294 75.923  -17.868 1.00 40.33  ? 255  TRP B NE1   1 
ATOM   8937  C  CE2   . TRP B 2 231  ? -12.489 75.045  -16.834 1.00 68.60  ? 255  TRP B CE2   1 
ATOM   8938  C  CE3   . TRP B 2 231  ? -12.989 72.699  -16.544 1.00 76.92  ? 255  TRP B CE3   1 
ATOM   8939  C  CZ2   . TRP B 2 231  ? -12.458 75.257  -15.458 1.00 68.63  ? 255  TRP B CZ2   1 
ATOM   8940  C  CZ3   . TRP B 2 231  ? -12.957 72.911  -15.179 1.00 77.13  ? 255  TRP B CZ3   1 
ATOM   8941  C  CH2   . TRP B 2 231  ? -12.694 74.180  -14.649 1.00 77.96  ? 255  TRP B CH2   1 
ATOM   8942  N  N     . LEU B 2 232  ? -12.085 70.352  -21.754 1.00 81.25  ? 256  LEU B N     1 
ATOM   8943  C  CA    . LEU B 2 232  ? -12.422 69.118  -22.457 1.00 40.29  ? 256  LEU B CA    1 
ATOM   8944  C  C     . LEU B 2 232  ? -11.763 67.922  -21.776 1.00 46.72  ? 256  LEU B C     1 
ATOM   8945  O  O     . LEU B 2 232  ? -12.443 66.999  -21.308 1.00 90.93  ? 256  LEU B O     1 
ATOM   8946  C  CB    . LEU B 2 232  ? -11.990 69.190  -23.922 1.00 86.73  ? 256  LEU B CB    1 
ATOM   8947  C  CG    . LEU B 2 232  ? -12.038 67.866  -24.689 1.00 87.78  ? 256  LEU B CG    1 
ATOM   8948  C  CD1   . LEU B 2 232  ? -13.467 67.355  -24.786 1.00 85.96  ? 256  LEU B CD1   1 
ATOM   8949  C  CD2   . LEU B 2 232  ? -11.415 68.012  -26.069 1.00 43.08  ? 256  LEU B CD2   1 
ATOM   8950  N  N     . ARG B 2 233  ? -10.435 67.962  -21.710 1.00 48.40  ? 257  ARG B N     1 
ATOM   8951  C  CA    . ARG B 2 233  ? -9.661  66.884  -21.107 1.00 46.49  ? 257  ARG B CA    1 
ATOM   8952  C  C     . ARG B 2 233  ? -10.051 66.640  -19.652 1.00 42.50  ? 257  ARG B C     1 
ATOM   8953  O  O     . ARG B 2 233  ? -10.138 65.495  -19.212 1.00 56.49  ? 257  ARG B O     1 
ATOM   8954  C  CB    . ARG B 2 233  ? -8.163  67.188  -21.199 1.00 44.24  ? 257  ARG B CB    1 
ATOM   8955  C  CG    . ARG B 2 233  ? -7.624  67.251  -22.621 1.00 41.26  ? 257  ARG B CG    1 
ATOM   8956  C  CD    . ARG B 2 233  ? -6.116  67.483  -22.648 1.00 64.91  ? 257  ARG B CD    1 
ATOM   8957  N  NE    . ARG B 2 233  ? -5.742  68.813  -22.172 1.00 67.67  ? 257  ARG B NE    1 
ATOM   8958  C  CZ    . ARG B 2 233  ? -5.275  69.072  -20.954 1.00 69.40  ? 257  ARG B CZ    1 
ATOM   8959  N  NH1   . ARG B 2 233  ? -4.962  70.315  -20.612 1.00 40.65  ? 257  ARG B NH1   1 
ATOM   8960  N  NH2   . ARG B 2 233  ? -5.120  68.089  -20.077 1.00 55.99  ? 257  ARG B NH2   1 
ATOM   8961  N  N     . HIS B 2 234  ? -10.299 67.715  -18.910 1.00 85.89  ? 258  HIS B N     1 
ATOM   8962  C  CA    . HIS B 2 234  ? -10.563 67.592  -17.479 1.00 87.44  ? 258  HIS B CA    1 
ATOM   8963  C  C     . HIS B 2 234  ? -11.961 67.054  -17.173 1.00 69.93  ? 258  HIS B C     1 
ATOM   8964  O  O     . HIS B 2 234  ? -12.124 66.217  -16.284 1.00 47.59  ? 258  HIS B O     1 
ATOM   8965  C  CB    . HIS B 2 234  ? -10.347 68.939  -16.787 1.00 47.22  ? 258  HIS B CB    1 
ATOM   8966  C  CG    . HIS B 2 234  ? -8.910  69.229  -16.483 1.00 44.44  ? 258  HIS B CG    1 
ATOM   8967  N  ND1   . HIS B 2 234  ? -8.393  69.174  -15.207 1.00 47.64  ? 258  HIS B ND1   1 
ATOM   8968  C  CD2   . HIS B 2 234  ? -7.876  69.556  -17.294 1.00 46.43  ? 258  HIS B CD2   1 
ATOM   8969  C  CE1   . HIS B 2 234  ? -7.105  69.465  -15.242 1.00 65.82  ? 258  HIS B CE1   1 
ATOM   8970  N  NE2   . HIS B 2 234  ? -6.766  69.699  -16.497 1.00 68.16  ? 258  HIS B NE2   1 
ATOM   8971  N  N     . ARG B 2 235  ? -12.963 67.529  -17.906 1.00 68.15  ? 259  ARG B N     1 
ATOM   8972  C  CA    . ARG B 2 235  ? -14.321 67.017  -17.753 1.00 76.70  ? 259  ARG B CA    1 
ATOM   8973  C  C     . ARG B 2 235  ? -14.370 65.555  -18.179 1.00 85.67  ? 259  ARG B C     1 
ATOM   8974  O  O     . ARG B 2 235  ? -14.900 64.707  -17.455 1.00 43.71  ? 259  ARG B O     1 
ATOM   8975  C  CB    . ARG B 2 235  ? -15.321 67.840  -18.572 1.00 75.18  ? 259  ARG B CB    1 
ATOM   8976  C  CG    . ARG B 2 235  ? -15.462 69.297  -18.142 1.00 74.31  ? 259  ARG B CG    1 
ATOM   8977  C  CD    . ARG B 2 235  ? -16.582 69.514  -17.142 1.00 73.01  ? 259  ARG B CD    1 
ATOM   8978  N  NE    . ARG B 2 235  ? -16.276 68.971  -15.825 1.00 73.73  ? 259  ARG B NE    1 
ATOM   8979  C  CZ    . ARG B 2 235  ? -16.795 67.847  -15.345 1.00 46.34  ? 259  ARG B CZ    1 
ATOM   8980  N  NH1   . ARG B 2 235  ? -17.652 67.146  -16.075 1.00 73.66  ? 259  ARG B NH1   1 
ATOM   8981  N  NH2   . ARG B 2 235  ? -16.463 67.430  -14.132 1.00 67.23  ? 259  ARG B NH2   1 
ATOM   8982  N  N     . LEU B 2 236  ? -13.805 65.263  -19.350 1.00 45.28  ? 260  LEU B N     1 
ATOM   8983  C  CA    . LEU B 2 236  ? -13.759 63.890  -19.847 1.00 90.64  ? 260  LEU B CA    1 
ATOM   8984  C  C     . LEU B 2 236  ? -13.030 62.974  -18.865 1.00 84.47  ? 260  LEU B C     1 
ATOM   8985  O  O     . LEU B 2 236  ? -13.397 61.812  -18.703 1.00 85.59  ? 260  LEU B O     1 
ATOM   8986  C  CB    . LEU B 2 236  ? -13.088 63.830  -21.221 1.00 86.70  ? 260  LEU B CB    1 
ATOM   8987  C  CG    . LEU B 2 236  ? -13.029 62.449  -21.878 1.00 86.46  ? 260  LEU B CG    1 
ATOM   8988  C  CD1   . LEU B 2 236  ? -14.421 61.853  -21.991 1.00 85.52  ? 260  LEU B CD1   1 
ATOM   8989  C  CD2   . LEU B 2 236  ? -12.367 62.525  -23.245 1.00 90.64  ? 260  LEU B CD2   1 
ATOM   8990  N  N     . GLN B 2 237  ? -12.004 63.505  -18.206 1.00 44.24  ? 261  GLN B N     1 
ATOM   8991  C  CA    . GLN B 2 237  ? -11.285 62.752  -17.184 1.00 48.39  ? 261  GLN B CA    1 
ATOM   8992  C  C     . GLN B 2 237  ? -12.185 62.501  -15.981 1.00 49.65  ? 261  GLN B C     1 
ATOM   8993  O  O     . GLN B 2 237  ? -12.171 61.416  -15.399 1.00 44.16  ? 261  GLN B O     1 
ATOM   8994  C  CB    . GLN B 2 237  ? -10.015 63.495  -16.753 1.00 56.50  ? 261  GLN B CB    1 
ATOM   8995  C  CG    . GLN B 2 237  ? -9.157  62.754  -15.730 1.00 67.95  ? 261  GLN B CG    1 
ATOM   8996  C  CD    . GLN B 2 237  ? -9.558  63.044  -14.294 1.00 67.17  ? 261  GLN B CD    1 
ATOM   8997  O  OE1   . GLN B 2 237  ? -10.312 63.980  -14.022 1.00 56.40  ? 261  GLN B OE1   1 
ATOM   8998  N  NE2   . GLN B 2 237  ? -9.055  62.238  -13.366 1.00 64.52  ? 261  GLN B NE2   1 
ATOM   8999  N  N     . TRP B 2 238  ? -12.964 63.514  -15.612 1.00 45.92  ? 262  TRP B N     1 
ATOM   9000  C  CA    . TRP B 2 238  ? -13.855 63.419  -14.461 1.00 40.28  ? 262  TRP B CA    1 
ATOM   9001  C  C     . TRP B 2 238  ? -14.958 62.400  -14.697 1.00 48.53  ? 262  TRP B C     1 
ATOM   9002  O  O     . TRP B 2 238  ? -15.445 61.769  -13.758 1.00 86.33  ? 262  TRP B O     1 
ATOM   9003  C  CB    . TRP B 2 238  ? -14.469 64.783  -14.141 1.00 44.97  ? 262  TRP B CB    1 
ATOM   9004  C  CG    . TRP B 2 238  ? -15.404 64.765  -12.965 1.00 93.44  ? 262  TRP B CG    1 
ATOM   9005  C  CD1   . TRP B 2 238  ? -15.074 64.938  -11.652 1.00 93.21  ? 262  TRP B CD1   1 
ATOM   9006  C  CD2   . TRP B 2 238  ? -16.823 64.568  -12.999 1.00 69.60  ? 262  TRP B CD2   1 
ATOM   9007  N  NE1   . TRP B 2 238  ? -16.198 64.859  -10.866 1.00 84.93  ? 262  TRP B NE1   1 
ATOM   9008  C  CE2   . TRP B 2 238  ? -17.285 64.633  -11.669 1.00 81.03  ? 262  TRP B CE2   1 
ATOM   9009  C  CE3   . TRP B 2 238  ? -17.747 64.345  -14.024 1.00 68.04  ? 262  TRP B CE3   1 
ATOM   9010  C  CZ2   . TRP B 2 238  ? -18.629 64.481  -11.337 1.00 86.94  ? 262  TRP B CZ2   1 
ATOM   9011  C  CZ3   . TRP B 2 238  ? -19.081 64.194  -13.692 1.00 77.82  ? 262  TRP B CZ3   1 
ATOM   9012  C  CH2   . TRP B 2 238  ? -19.509 64.263  -12.361 1.00 90.92  ? 262  TRP B CH2   1 
ATOM   9013  N  N     . TRP B 2 239  ? -15.353 62.240  -15.955 1.00 56.51  ? 263  TRP B N     1 
ATOM   9014  C  CA    . TRP B 2 239  ? -16.423 61.309  -16.282 1.00 45.84  ? 263  TRP B CA    1 
ATOM   9015  C  C     . TRP B 2 239  ? -15.890 59.911  -16.590 1.00 48.26  ? 263  TRP B C     1 
ATOM   9016  O  O     . TRP B 2 239  ? -16.620 58.928  -16.468 1.00 40.06  ? 263  TRP B O     1 
ATOM   9017  C  CB    . TRP B 2 239  ? -17.247 61.831  -17.461 1.00 46.24  ? 263  TRP B CB    1 
ATOM   9018  C  CG    . TRP B 2 239  ? -18.709 61.925  -17.150 1.00 67.61  ? 263  TRP B CG    1 
ATOM   9019  C  CD1   . TRP B 2 239  ? -19.561 60.890  -16.908 1.00 75.74  ? 263  TRP B CD1   1 
ATOM   9020  C  CD2   . TRP B 2 239  ? -19.492 63.120  -17.045 1.00 45.31  ? 263  TRP B CD2   1 
ATOM   9021  N  NE1   . TRP B 2 239  ? -20.826 61.362  -16.659 1.00 65.86  ? 263  TRP B NE1   1 
ATOM   9022  C  CE2   . TRP B 2 239  ? -20.810 62.729  -16.737 1.00 41.98  ? 263  TRP B CE2   1 
ATOM   9023  C  CE3   . TRP B 2 239  ? -19.207 64.481  -17.181 1.00 56.75  ? 263  TRP B CE3   1 
ATOM   9024  C  CZ2   . TRP B 2 239  ? -21.840 63.648  -16.563 1.00 45.82  ? 263  TRP B CZ2   1 
ATOM   9025  C  CZ3   . TRP B 2 239  ? -20.231 65.392  -17.005 1.00 68.57  ? 263  TRP B CZ3   1 
ATOM   9026  C  CH2   . TRP B 2 239  ? -21.531 64.972  -16.702 1.00 69.03  ? 263  TRP B CH2   1 
ATOM   9027  N  N     . ARG B 2 240  ? -14.621 59.821  -16.979 1.00 47.33  ? 264  ARG B N     1 
ATOM   9028  C  CA    . ARG B 2 240  ? -14.020 58.527  -17.298 1.00 93.12  ? 264  ARG B CA    1 
ATOM   9029  C  C     . ARG B 2 240  ? -13.568 57.782  -16.046 1.00 42.20  ? 264  ARG B C     1 
ATOM   9030  O  O     . ARG B 2 240  ? -13.282 56.587  -16.102 1.00 60.80  ? 264  ARG B O     1 
ATOM   9031  C  CB    . ARG B 2 240  ? -12.847 58.695  -18.265 1.00 93.88  ? 264  ARG B CB    1 
ATOM   9032  C  CG    . ARG B 2 240  ? -13.265 58.660  -19.727 1.00 93.23  ? 264  ARG B CG    1 
ATOM   9033  C  CD    . ARG B 2 240  ? -12.090 58.876  -20.666 1.00 42.66  ? 264  ARG B CD    1 
ATOM   9034  N  NE    . ARG B 2 240  ? -12.490 58.752  -22.065 1.00 40.95  ? 264  ARG B NE    1 
ATOM   9035  C  CZ    . ARG B 2 240  ? -11.685 58.985  -23.098 1.00 68.31  ? 264  ARG B CZ    1 
ATOM   9036  N  NH1   . ARG B 2 240  ? -10.430 59.360  -22.893 1.00 72.50  ? 264  ARG B NH1   1 
ATOM   9037  N  NH2   . ARG B 2 240  ? -12.137 58.845  -24.337 1.00 43.40  ? 264  ARG B NH2   1 
ATOM   9038  N  N     . LYS B 2 241  ? -13.496 58.482  -14.919 1.00 45.78  ? 265  LYS B N     1 
ATOM   9039  C  CA    . LYS B 2 241  ? -13.346 57.803  -13.638 1.00 45.22  ? 265  LYS B CA    1 
ATOM   9040  C  C     . LYS B 2 241  ? -14.746 57.476  -13.127 1.00 55.73  ? 265  LYS B C     1 
ATOM   9041  O  O     . LYS B 2 241  ? -15.734 57.774  -13.800 1.00 43.08  ? 265  LYS B O     1 
ATOM   9042  C  CB    . LYS B 2 241  ? -12.558 58.649  -12.632 1.00 45.79  ? 265  LYS B CB    1 
ATOM   9043  C  CG    . LYS B 2 241  ? -13.117 60.035  -12.372 1.00 48.64  ? 265  LYS B CG    1 
ATOM   9044  C  CD    . LYS B 2 241  ? -12.293 60.776  -11.325 1.00 43.76  ? 265  LYS B CD    1 
ATOM   9045  C  CE    . LYS B 2 241  ? -12.815 62.189  -11.106 1.00 44.59  ? 265  LYS B CE    1 
ATOM   9046  N  NZ    . LYS B 2 241  ? -12.065 62.923  -10.048 1.00 42.44  ? 265  LYS B NZ    1 
ATOM   9047  N  N     . PHE B 2 242  ? -14.822 56.841  -11.959 1.00 69.88  ? 266  PHE B N     1 
ATOM   9048  C  CA    . PHE B 2 242  ? -16.076 56.319  -11.402 1.00 65.96  ? 266  PHE B CA    1 
ATOM   9049  C  C     . PHE B 2 242  ? -16.702 55.228  -12.279 1.00 56.49  ? 266  PHE B C     1 
ATOM   9050  O  O     . PHE B 2 242  ? -17.728 54.652  -11.919 1.00 75.62  ? 266  PHE B O     1 
ATOM   9051  C  CB    . PHE B 2 242  ? -17.106 57.437  -11.186 1.00 56.43  ? 266  PHE B CB    1 
ATOM   9052  C  CG    . PHE B 2 242  ? -16.569 58.640  -10.467 1.00 45.82  ? 266  PHE B CG    1 
ATOM   9053  C  CD1   . PHE B 2 242  ? -16.067 58.532  -9.181  1.00 49.31  ? 266  PHE B CD1   1 
ATOM   9054  C  CD2   . PHE B 2 242  ? -16.592 59.888  -11.069 1.00 41.38  ? 266  PHE B CD2   1 
ATOM   9055  C  CE1   . PHE B 2 242  ? -15.582 59.642  -8.517  1.00 48.66  ? 266  PHE B CE1   1 
ATOM   9056  C  CE2   . PHE B 2 242  ? -16.111 61.000  -10.411 1.00 40.70  ? 266  PHE B CE2   1 
ATOM   9057  C  CZ    . PHE B 2 242  ? -15.604 60.876  -9.135  1.00 44.26  ? 266  PHE B CZ    1 
ATOM   9058  N  N     . ALA B 2 243  ? -16.084 54.947  -13.422 1.00 40.31  ? 267  ALA B N     1 
ATOM   9059  C  CA    . ALA B 2 243  ? -16.623 53.983  -14.373 1.00 41.23  ? 267  ALA B CA    1 
ATOM   9060  C  C     . ALA B 2 243  ? -15.839 52.678  -14.357 1.00 65.33  ? 267  ALA B C     1 
ATOM   9061  O  O     . ALA B 2 243  ? -14.624 52.672  -14.164 1.00 68.51  ? 267  ALA B O     1 
ATOM   9062  C  CB    . ALA B 2 243  ? -16.631 54.573  -15.774 1.00 47.64  ? 267  ALA B CB    1 
ATOM   9063  N  N     . MET B 2 244  ? -16.546 51.571  -14.563 1.00 56.88  ? 268  MET B N     1 
ATOM   9064  C  CA    . MET B 2 244  ? -15.915 50.261  -14.615 1.00 56.86  ? 268  MET B CA    1 
ATOM   9065  C  C     . MET B 2 244  ? -15.272 50.055  -15.982 1.00 72.89  ? 268  MET B C     1 
ATOM   9066  O  O     . MET B 2 244  ? -14.272 49.349  -16.114 1.00 71.74  ? 268  MET B O     1 
ATOM   9067  C  CB    . MET B 2 244  ? -16.937 49.160  -14.325 1.00 67.67  ? 268  MET B CB    1 
ATOM   9068  C  CG    . MET B 2 244  ? -16.343 47.913  -13.697 1.00 64.22  ? 268  MET B CG    1 
ATOM   9069  S  SD    . MET B 2 244  ? -15.442 48.283  -12.179 1.00 71.40  ? 268  MET B SD    1 
ATOM   9070  C  CE    . MET B 2 244  ? -16.701 49.129  -11.227 1.00 64.60  ? 268  MET B CE    1 
ATOM   9071  N  N     . SER B 2 245  ? -15.857 50.685  -16.994 1.00 49.22  ? 269  SER B N     1 
ATOM   9072  C  CA    . SER B 2 245  ? -15.323 50.647  -18.349 1.00 48.66  ? 269  SER B CA    1 
ATOM   9073  C  C     . SER B 2 245  ? -15.311 52.050  -18.946 1.00 56.25  ? 269  SER B C     1 
ATOM   9074  O  O     . SER B 2 245  ? -16.266 52.453  -19.611 1.00 41.40  ? 269  SER B O     1 
ATOM   9075  C  CB    . SER B 2 245  ? -16.141 49.701  -19.228 1.00 69.41  ? 269  SER B CB    1 
ATOM   9076  O  OG    . SER B 2 245  ? -17.486 50.135  -19.327 1.00 72.98  ? 269  SER B OG    1 
ATOM   9077  N  N     . PRO B 2 246  ? -14.224 52.798  -18.706 1.00 55.89  ? 270  PRO B N     1 
ATOM   9078  C  CA    . PRO B 2 246  ? -14.068 54.194  -19.137 1.00 44.91  ? 270  PRO B CA    1 
ATOM   9079  C  C     . PRO B 2 246  ? -14.109 54.375  -20.654 1.00 65.72  ? 270  PRO B C     1 
ATOM   9080  O  O     . PRO B 2 246  ? -14.231 55.503  -21.130 1.00 56.46  ? 270  PRO B O     1 
ATOM   9081  C  CB    . PRO B 2 246  ? -12.687 54.576  -18.592 1.00 49.82  ? 270  PRO B CB    1 
ATOM   9082  C  CG    . PRO B 2 246  ? -12.434 53.616  -17.479 1.00 64.04  ? 270  PRO B CG    1 
ATOM   9083  C  CD    . PRO B 2 246  ? -13.069 52.337  -17.918 1.00 56.63  ? 270  PRO B CD    1 
ATOM   9084  N  N     . SER B 2 247  ? -14.012 53.277  -21.396 1.00 41.20  ? 271  SER B N     1 
ATOM   9085  C  CA    . SER B 2 247  ? -13.990 53.330  -22.853 1.00 66.27  ? 271  SER B CA    1 
ATOM   9086  C  C     . SER B 2 247  ? -15.306 53.835  -23.444 1.00 46.28  ? 271  SER B C     1 
ATOM   9087  O  O     . SER B 2 247  ? -15.342 54.302  -24.582 1.00 48.29  ? 271  SER B O     1 
ATOM   9088  C  CB    . SER B 2 247  ? -13.662 51.948  -23.423 1.00 69.62  ? 271  SER B CB    1 
ATOM   9089  O  OG    . SER B 2 247  ? -13.693 51.959  -24.840 1.00 73.74  ? 271  SER B OG    1 
ATOM   9090  N  N     . ASN B 2 248  ? -16.382 53.742  -22.669 1.00 64.18  ? 272  ASN B N     1 
ATOM   9091  C  CA    . ASN B 2 248  ? -17.704 54.143  -23.143 1.00 66.15  ? 272  ASN B CA    1 
ATOM   9092  C  C     . ASN B 2 248  ? -17.860 55.656  -23.276 1.00 64.41  ? 272  ASN B C     1 
ATOM   9093  O  O     . ASN B 2 248  ? -18.631 56.135  -24.107 1.00 60.07  ? 272  ASN B O     1 
ATOM   9094  C  CB    . ASN B 2 248  ? -18.789 53.594  -22.214 1.00 56.23  ? 272  ASN B CB    1 
ATOM   9095  C  CG    . ASN B 2 248  ? -18.958 52.093  -22.341 1.00 60.55  ? 272  ASN B CG    1 
ATOM   9096  O  OD1   . ASN B 2 248  ? -18.727 51.519  -23.405 1.00 42.92  ? 272  ASN B OD1   1 
ATOM   9097  N  ND2   . ASN B 2 248  ? -19.368 51.450  -21.254 1.00 60.42  ? 272  ASN B ND2   1 
ATOM   9098  N  N     . PHE B 2 249  ? -17.129 56.404  -22.456 1.00 60.70  ? 273  PHE B N     1 
ATOM   9099  C  CA    . PHE B 2 249  ? -17.193 57.861  -22.499 1.00 91.72  ? 273  PHE B CA    1 
ATOM   9100  C  C     . PHE B 2 249  ? -16.266 58.415  -23.572 1.00 92.34  ? 273  PHE B C     1 
ATOM   9101  O  O     . PHE B 2 249  ? -15.065 58.149  -23.564 1.00 49.00  ? 273  PHE B O     1 
ATOM   9102  C  CB    . PHE B 2 249  ? -16.838 58.455  -21.137 1.00 90.13  ? 273  PHE B CB    1 
ATOM   9103  C  CG    . PHE B 2 249  ? -17.741 58.005  -20.029 1.00 90.11  ? 273  PHE B CG    1 
ATOM   9104  C  CD1   . PHE B 2 249  ? -18.911 58.689  -19.751 1.00 86.00  ? 273  PHE B CD1   1 
ATOM   9105  C  CD2   . PHE B 2 249  ? -17.423 56.894  -19.268 1.00 92.80  ? 273  PHE B CD2   1 
ATOM   9106  C  CE1   . PHE B 2 249  ? -19.745 58.274  -18.734 1.00 40.75  ? 273  PHE B CE1   1 
ATOM   9107  C  CE2   . PHE B 2 249  ? -18.254 56.476  -18.249 1.00 93.55  ? 273  PHE B CE2   1 
ATOM   9108  C  CZ    . PHE B 2 249  ? -19.415 57.167  -17.981 1.00 91.43  ? 273  PHE B CZ    1 
ATOM   9109  N  N     . SER B 2 250  ? -16.829 59.186  -24.495 1.00 91.52  ? 274  SER B N     1 
ATOM   9110  C  CA    . SER B 2 250  ? -16.056 59.707  -25.615 1.00 92.95  ? 274  SER B CA    1 
ATOM   9111  C  C     . SER B 2 250  ? -16.226 61.212  -25.779 1.00 91.01  ? 274  SER B C     1 
ATOM   9112  O  O     . SER B 2 250  ? -17.106 61.822  -25.171 1.00 40.58  ? 274  SER B O     1 
ATOM   9113  C  CB    . SER B 2 250  ? -16.453 58.997  -26.911 1.00 44.98  ? 274  SER B CB    1 
ATOM   9114  O  OG    . SER B 2 250  ? -17.809 59.248  -27.237 1.00 64.06  ? 274  SER B OG    1 
ATOM   9115  N  N     . SER B 2 251  ? -15.371 61.801  -26.607 1.00 92.65  ? 275  SER B N     1 
ATOM   9116  C  CA    . SER B 2 251  ? -15.434 63.226  -26.892 1.00 91.78  ? 275  SER B CA    1 
ATOM   9117  C  C     . SER B 2 251  ? -15.448 63.465  -28.396 1.00 40.92  ? 275  SER B C     1 
ATOM   9118  O  O     . SER B 2 251  ? -14.757 62.781  -29.151 1.00 44.08  ? 275  SER B O     1 
ATOM   9119  C  CB    . SER B 2 251  ? -14.257 63.960  -26.249 1.00 47.13  ? 275  SER B CB    1 
ATOM   9120  O  OG    . SER B 2 251  ? -13.025 63.519  -26.792 1.00 69.48  ? 275  SER B OG    1 
ATOM   9121  N  N     . SER B 2 252  ? -16.242 64.439  -28.825 1.00 40.56  ? 276  SER B N     1 
ATOM   9122  C  CA    . SER B 2 252  ? -16.369 64.754  -30.239 1.00 65.08  ? 276  SER B CA    1 
ATOM   9123  C  C     . SER B 2 252  ? -16.077 66.226  -30.496 1.00 56.96  ? 276  SER B C     1 
ATOM   9124  O  O     . SER B 2 252  ? -16.719 67.108  -29.921 1.00 64.89  ? 276  SER B O     1 
ATOM   9125  C  CB    . SER B 2 252  ? -17.768 64.395  -30.743 1.00 76.58  ? 276  SER B CB    1 
ATOM   9126  O  OG    . SER B 2 252  ? -17.910 64.701  -32.119 1.00 68.10  ? 276  SER B OG    1 
ATOM   9127  N  N     . ASP B 2 253  ? -15.098 66.483  -31.357 1.00 67.90  ? 277  ASP B N     1 
ATOM   9128  C  CA    . ASP B 2 253  ? -14.750 67.843  -31.739 1.00 66.70  ? 277  ASP B CA    1 
ATOM   9129  C  C     . ASP B 2 253  ? -15.659 68.317  -32.867 1.00 73.48  ? 277  ASP B C     1 
ATOM   9130  O  O     . ASP B 2 253  ? -15.774 67.659  -33.901 1.00 77.03  ? 277  ASP B O     1 
ATOM   9131  C  CB    . ASP B 2 253  ? -13.281 67.927  -32.160 1.00 74.96  ? 277  ASP B CB    1 
ATOM   9132  C  CG    . ASP B 2 253  ? -12.331 67.556  -31.036 1.00 68.66  ? 277  ASP B CG    1 
ATOM   9133  O  OD1   . ASP B 2 253  ? -12.710 66.727  -30.182 1.00 76.14  ? 277  ASP B OD1   1 
ATOM   9134  O  OD2   . ASP B 2 253  ? -11.205 68.095  -31.005 1.00 68.31  ? 277  ASP B OD2   1 
ATOM   9135  N  N     . CYS B 2 254  ? -16.307 69.459  -32.661 1.00 75.57  ? 278  CYS B N     1 
ATOM   9136  C  CA    . CYS B 2 254  ? -17.261 69.982  -33.632 1.00 75.79  ? 278  CYS B CA    1 
ATOM   9137  C  C     . CYS B 2 254  ? -17.208 71.504  -33.717 1.00 67.41  ? 278  CYS B C     1 
ATOM   9138  O  O     . CYS B 2 254  ? -16.840 72.177  -32.756 1.00 44.33  ? 278  CYS B O     1 
ATOM   9139  C  CB    . CYS B 2 254  ? -18.677 69.528  -33.277 1.00 69.36  ? 278  CYS B CB    1 
ATOM   9140  S  SG    . CYS B 2 254  ? -19.152 69.873  -31.566 1.00 66.96  ? 278  CYS B SG    1 
ATOM   9141  N  N     . GLN B 2 255  ? -17.581 72.042  -34.874 1.00 65.51  ? 279  GLN B N     1 
ATOM   9142  C  CA    . GLN B 2 255  ? -17.610 73.487  -35.067 1.00 70.26  ? 279  GLN B CA    1 
ATOM   9143  C  C     . GLN B 2 255  ? -19.045 74.003  -35.108 1.00 68.76  ? 279  GLN B C     1 
ATOM   9144  O  O     . GLN B 2 255  ? -19.993 73.226  -35.223 1.00 70.71  ? 279  GLN B O     1 
ATOM   9145  C  CB    . GLN B 2 255  ? -16.869 73.875  -36.349 1.00 73.84  ? 279  GLN B CB    1 
ATOM   9146  C  CG    . GLN B 2 255  ? -17.452 73.271  -37.616 1.00 72.98  ? 279  GLN B CG    1 
ATOM   9147  C  CD    . GLN B 2 255  ? -16.695 73.690  -38.862 1.00 86.43  ? 279  GLN B CD    1 
ATOM   9148  O  OE1   . GLN B 2 255  ? -15.700 74.410  -38.784 1.00 86.37  ? 279  GLN B OE1   1 
ATOM   9149  N  NE2   . GLN B 2 255  ? -17.166 73.240  -40.019 1.00 90.64  ? 279  GLN B NE2   1 
ATOM   9150  N  N     . ASP B 2 256  ? -19.194 75.320  -35.010 1.00 70.65  ? 280  ASP B N     1 
ATOM   9151  C  CA    . ASP B 2 256  ? -20.505 75.958  -35.008 1.00 70.17  ? 280  ASP B CA    1 
ATOM   9152  C  C     . ASP B 2 256  ? -20.959 76.260  -36.435 1.00 70.57  ? 280  ASP B C     1 
ATOM   9153  O  O     . ASP B 2 256  ? -20.273 75.915  -37.397 1.00 68.32  ? 280  ASP B O     1 
ATOM   9154  C  CB    . ASP B 2 256  ? -20.465 77.242  -34.177 1.00 67.80  ? 280  ASP B CB    1 
ATOM   9155  C  CG    . ASP B 2 256  ? -21.794 77.560  -33.524 1.00 77.61  ? 280  ASP B CG    1 
ATOM   9156  O  OD1   . ASP B 2 256  ? -22.076 78.756  -33.305 1.00 68.27  ? 280  ASP B OD1   1 
ATOM   9157  O  OD2   . ASP B 2 256  ? -22.552 76.614  -33.224 1.00 75.39  ? 280  ASP B OD2   1 
ATOM   9158  N  N     . GLU B 2 257  ? -22.114 76.905  -36.568 1.00 74.44  ? 281  GLU B N     1 
ATOM   9159  C  CA    . GLU B 2 257  ? -22.620 77.292  -37.880 1.00 71.42  ? 281  GLU B CA    1 
ATOM   9160  C  C     . GLU B 2 257  ? -21.845 78.488  -38.424 1.00 71.99  ? 281  GLU B C     1 
ATOM   9161  O  O     . GLU B 2 257  ? -21.795 78.710  -39.634 1.00 69.79  ? 281  GLU B O     1 
ATOM   9162  C  CB    . GLU B 2 257  ? -24.116 77.613  -37.817 1.00 68.89  ? 281  GLU B CB    1 
ATOM   9163  C  CG    . GLU B 2 257  ? -24.512 78.594  -36.724 1.00 74.76  ? 281  GLU B CG    1 
ATOM   9164  C  CD    . GLU B 2 257  ? -24.840 77.906  -35.412 1.00 69.29  ? 281  GLU B CD    1 
ATOM   9165  O  OE1   . GLU B 2 257  ? -24.823 76.657  -35.373 1.00 64.15  ? 281  GLU B OE1   1 
ATOM   9166  O  OE2   . GLU B 2 257  ? -25.118 78.613  -34.420 1.00 66.72  ? 281  GLU B OE2   1 
ATOM   9167  N  N     . GLU B 2 258  ? -21.242 79.254  -37.520 1.00 90.19  ? 282  GLU B N     1 
ATOM   9168  C  CA    . GLU B 2 258  ? -20.414 80.391  -37.905 1.00 90.89  ? 282  GLU B CA    1 
ATOM   9169  C  C     . GLU B 2 258  ? -18.940 80.003  -37.941 1.00 93.02  ? 282  GLU B C     1 
ATOM   9170  O  O     . GLU B 2 258  ? -18.171 80.526  -38.747 1.00 69.94  ? 282  GLU B O     1 
ATOM   9171  C  CB    . GLU B 2 258  ? -20.628 81.565  -36.946 1.00 69.31  ? 282  GLU B CB    1 
ATOM   9172  C  CG    . GLU B 2 258  ? -21.961 82.277  -37.120 1.00 77.73  ? 282  GLU B CG    1 
ATOM   9173  C  CD    . GLU B 2 258  ? -22.051 83.042  -38.428 1.00 90.99  ? 282  GLU B CD    1 
ATOM   9174  O  OE1   . GLU B 2 258  ? -20.992 83.375  -39.001 1.00 86.27  ? 282  GLU B OE1   1 
ATOM   9175  O  OE2   . GLU B 2 258  ? -23.182 83.310  -38.885 1.00 87.44  ? 282  GLU B OE2   1 
ATOM   9176  N  N     . GLY B 2 259  ? -18.553 79.085  -37.062 1.00 68.39  ? 283  GLY B N     1 
ATOM   9177  C  CA    . GLY B 2 259  ? -17.186 78.599  -37.030 1.00 72.95  ? 283  GLY B CA    1 
ATOM   9178  C  C     . GLY B 2 259  ? -16.631 78.412  -35.632 1.00 66.93  ? 283  GLY B C     1 
ATOM   9179  O  O     . GLY B 2 259  ? -15.486 77.993  -35.466 1.00 69.04  ? 283  GLY B O     1 
ATOM   9180  N  N     . ARG B 2 260  ? -17.440 78.722  -34.624 1.00 55.90  ? 284  ARG B N     1 
ATOM   9181  C  CA    . ARG B 2 260  ? -17.012 78.605  -33.233 1.00 65.73  ? 284  ARG B CA    1 
ATOM   9182  C  C     . ARG B 2 260  ? -16.719 77.153  -32.857 1.00 55.65  ? 284  ARG B C     1 
ATOM   9183  O  O     . ARG B 2 260  ? -17.527 76.261  -33.112 1.00 72.33  ? 284  ARG B O     1 
ATOM   9184  C  CB    . ARG B 2 260  ? -18.074 79.187  -32.295 1.00 55.94  ? 284  ARG B CB    1 
ATOM   9185  C  CG    . ARG B 2 260  ? -18.352 80.669  -32.509 1.00 68.50  ? 284  ARG B CG    1 
ATOM   9186  C  CD    . ARG B 2 260  ? -19.481 81.161  -31.612 1.00 77.11  ? 284  ARG B CD    1 
ATOM   9187  N  NE    . ARG B 2 260  ? -19.719 82.595  -31.764 1.00 76.11  ? 284  ARG B NE    1 
ATOM   9188  C  CZ    . ARG B 2 260  ? -20.534 83.128  -32.669 1.00 68.26  ? 284  ARG B CZ    1 
ATOM   9189  N  NH1   . ARG B 2 260  ? -21.194 82.346  -33.512 1.00 91.91  ? 284  ARG B NH1   1 
ATOM   9190  N  NH2   . ARG B 2 260  ? -20.689 84.444  -32.733 1.00 72.29  ? 284  ARG B NH2   1 
ATOM   9191  N  N     . LYS B 2 261  ? -15.556 76.924  -32.254 1.00 56.37  ? 285  LYS B N     1 
ATOM   9192  C  CA    . LYS B 2 261  ? -15.151 75.582  -31.847 1.00 55.92  ? 285  LYS B CA    1 
ATOM   9193  C  C     . LYS B 2 261  ? -15.946 75.105  -30.637 1.00 41.40  ? 285  LYS B C     1 
ATOM   9194  O  O     . LYS B 2 261  ? -16.456 75.910  -29.858 1.00 49.84  ? 285  LYS B O     1 
ATOM   9195  C  CB    . LYS B 2 261  ? -13.652 75.543  -31.536 1.00 68.98  ? 285  LYS B CB    1 
ATOM   9196  C  CG    . LYS B 2 261  ? -12.754 75.649  -32.760 1.00 73.87  ? 285  LYS B CG    1 
ATOM   9197  C  CD    . LYS B 2 261  ? -12.914 74.439  -33.668 1.00 71.18  ? 285  LYS B CD    1 
ATOM   9198  C  CE    . LYS B 2 261  ? -11.990 74.520  -34.874 1.00 75.76  ? 285  LYS B CE    1 
ATOM   9199  N  NZ    . LYS B 2 261  ? -12.309 75.685  -35.746 1.00 68.71  ? 285  LYS B NZ    1 
ATOM   9200  N  N     . GLY B 2 262  ? -16.046 73.789  -30.486 1.00 46.77  ? 286  GLY B N     1 
ATOM   9201  C  CA    . GLY B 2 262  ? -16.791 73.203  -29.388 1.00 43.41  ? 286  GLY B CA    1 
ATOM   9202  C  C     . GLY B 2 262  ? -16.587 71.705  -29.280 1.00 42.05  ? 286  GLY B C     1 
ATOM   9203  O  O     . GLY B 2 262  ? -16.176 71.054  -30.240 1.00 45.07  ? 286  GLY B O     1 
ATOM   9204  N  N     . ASN B 2 263  ? -16.877 71.157  -28.106 1.00 92.03  ? 287  ASN B N     1 
ATOM   9205  C  CA    . ASN B 2 263  ? -16.712 69.729  -27.870 1.00 47.14  ? 287  ASN B CA    1 
ATOM   9206  C  C     . ASN B 2 263  ? -17.919 69.115  -27.174 1.00 47.57  ? 287  ASN B C     1 
ATOM   9207  O  O     . ASN B 2 263  ? -18.476 69.700  -26.245 1.00 46.76  ? 287  ASN B O     1 
ATOM   9208  C  CB    . ASN B 2 263  ? -15.451 69.468  -27.043 1.00 90.14  ? 287  ASN B CB    1 
ATOM   9209  C  CG    . ASN B 2 263  ? -14.183 69.847  -27.779 1.00 45.33  ? 287  ASN B CG    1 
ATOM   9210  O  OD1   . ASN B 2 263  ? -13.609 69.037  -28.507 1.00 47.35  ? 287  ASN B OD1   1 
ATOM   9211  N  ND2   . ASN B 2 263  ? -13.739 71.084  -27.594 1.00 48.27  ? 287  ASN B ND2   1 
ATOM   9212  N  N     . LYS B 2 264  ? -18.320 67.932  -27.630 1.00 45.71  ? 288  LYS B N     1 
ATOM   9213  C  CA    . LYS B 2 264  ? -19.420 67.208  -27.004 1.00 40.43  ? 288  LYS B CA    1 
ATOM   9214  C  C     . LYS B 2 264  ? -18.904 65.968  -26.284 1.00 91.06  ? 288  LYS B C     1 
ATOM   9215  O  O     . LYS B 2 264  ? -17.869 65.418  -26.651 1.00 40.26  ? 288  LYS B O     1 
ATOM   9216  C  CB    . LYS B 2 264  ? -20.471 66.813  -28.043 1.00 42.90  ? 288  LYS B CB    1 
ATOM   9217  C  CG    . LYS B 2 264  ? -21.092 67.981  -28.793 1.00 45.82  ? 288  LYS B CG    1 
ATOM   9218  C  CD    . LYS B 2 264  ? -22.223 67.504  -29.693 1.00 66.21  ? 288  LYS B CD    1 
ATOM   9219  C  CE    . LYS B 2 264  ? -22.863 68.655  -30.455 1.00 75.52  ? 288  LYS B CE    1 
ATOM   9220  N  NZ    . LYS B 2 264  ? -21.922 69.272  -31.430 1.00 77.35  ? 288  LYS B NZ    1 
ATOM   9221  N  N     . LEU B 2 265  ? -19.623 65.534  -25.255 1.00 48.30  ? 289  LEU B N     1 
ATOM   9222  C  CA    . LEU B 2 265  ? -19.261 64.320  -24.531 1.00 86.75  ? 289  LEU B CA    1 
ATOM   9223  C  C     . LEU B 2 265  ? -20.370 63.284  -24.625 1.00 43.32  ? 289  LEU B C     1 
ATOM   9224  O  O     . LEU B 2 265  ? -21.539 63.588  -24.395 1.00 42.03  ? 289  LEU B O     1 
ATOM   9225  C  CB    . LEU B 2 265  ? -18.954 64.627  -23.065 1.00 77.60  ? 289  LEU B CB    1 
ATOM   9226  C  CG    . LEU B 2 265  ? -17.501 64.959  -22.727 1.00 77.93  ? 289  LEU B CG    1 
ATOM   9227  C  CD1   . LEU B 2 265  ? -17.093 66.298  -23.318 1.00 44.87  ? 289  LEU B CD1   1 
ATOM   9228  C  CD2   . LEU B 2 265  ? -17.282 64.938  -21.222 1.00 76.72  ? 289  LEU B CD2   1 
ATOM   9229  N  N     . TYR B 2 266  ? -19.996 62.055  -24.960 1.00 41.38  ? 290  TYR B N     1 
ATOM   9230  C  CA    . TYR B 2 266  ? -20.970 60.989  -25.141 1.00 90.05  ? 290  TYR B CA    1 
ATOM   9231  C  C     . TYR B 2 266  ? -20.735 59.829  -24.182 1.00 46.76  ? 290  TYR B C     1 
ATOM   9232  O  O     . TYR B 2 266  ? -19.608 59.589  -23.748 1.00 42.29  ? 290  TYR B O     1 
ATOM   9233  C  CB    . TYR B 2 266  ? -20.934 60.475  -26.582 1.00 90.42  ? 290  TYR B CB    1 
ATOM   9234  C  CG    . TYR B 2 266  ? -21.270 61.512  -27.630 1.00 92.03  ? 290  TYR B CG    1 
ATOM   9235  C  CD1   . TYR B 2 266  ? -22.259 62.461  -27.409 1.00 87.46  ? 290  TYR B CD1   1 
ATOM   9236  C  CD2   . TYR B 2 266  ? -20.597 61.540  -28.845 1.00 55.89  ? 290  TYR B CD2   1 
ATOM   9237  C  CE1   . TYR B 2 266  ? -22.569 63.406  -28.368 1.00 40.14  ? 290  TYR B CE1   1 
ATOM   9238  C  CE2   . TYR B 2 266  ? -20.899 62.481  -29.809 1.00 65.24  ? 290  TYR B CE2   1 
ATOM   9239  C  CZ    . TYR B 2 266  ? -21.885 63.412  -29.566 1.00 67.64  ? 290  TYR B CZ    1 
ATOM   9240  O  OH    . TYR B 2 266  ? -22.188 64.351  -30.526 1.00 68.71  ? 290  TYR B OH    1 
ATOM   9241  N  N     . TYR B 2 267  ? -21.808 59.118  -23.852 1.00 41.34  ? 291  TYR B N     1 
ATOM   9242  C  CA    . TYR B 2 267  ? -21.698 57.845  -23.149 1.00 41.98  ? 291  TYR B CA    1 
ATOM   9243  C  C     . TYR B 2 267  ? -22.296 56.739  -24.005 1.00 47.53  ? 291  TYR B C     1 
ATOM   9244  O  O     . TYR B 2 267  ? -23.390 56.886  -24.547 1.00 43.17  ? 291  TYR B O     1 
ATOM   9245  C  CB    . TYR B 2 267  ? -22.396 57.890  -21.790 1.00 87.16  ? 291  TYR B CB    1 
ATOM   9246  C  CG    . TYR B 2 267  ? -22.479 56.534  -21.123 1.00 91.85  ? 291  TYR B CG    1 
ATOM   9247  C  CD1   . TYR B 2 267  ? -23.677 55.833  -21.073 1.00 46.04  ? 291  TYR B CD1   1 
ATOM   9248  C  CD2   . TYR B 2 267  ? -21.355 55.944  -20.563 1.00 41.53  ? 291  TYR B CD2   1 
ATOM   9249  C  CE1   . TYR B 2 267  ? -23.754 54.591  -20.469 1.00 46.88  ? 291  TYR B CE1   1 
ATOM   9250  C  CE2   . TYR B 2 267  ? -21.422 54.704  -19.957 1.00 45.57  ? 291  TYR B CE2   1 
ATOM   9251  C  CZ    . TYR B 2 267  ? -22.623 54.032  -19.913 1.00 45.37  ? 291  TYR B CZ    1 
ATOM   9252  O  OH    . TYR B 2 267  ? -22.693 52.795  -19.312 1.00 56.58  ? 291  TYR B OH    1 
ATOM   9253  N  N     . ASN B 2 268  ? -21.577 55.628  -24.122 1.00 46.09  ? 292  ASN B N     1 
ATOM   9254  C  CA    . ASN B 2 268  ? -22.028 54.528  -24.961 1.00 45.07  ? 292  ASN B CA    1 
ATOM   9255  C  C     . ASN B 2 268  ? -23.043 53.634  -24.256 1.00 46.63  ? 292  ASN B C     1 
ATOM   9256  O  O     . ASN B 2 268  ? -22.682 52.638  -23.631 1.00 48.85  ? 292  ASN B O     1 
ATOM   9257  C  CB    . ASN B 2 268  ? -20.835 53.694  -25.427 1.00 68.84  ? 292  ASN B CB    1 
ATOM   9258  C  CG    . ASN B 2 268  ? -21.217 52.666  -26.472 1.00 60.78  ? 292  ASN B CG    1 
ATOM   9259  O  OD1   . ASN B 2 268  ? -21.342 52.985  -27.654 1.00 42.56  ? 292  ASN B OD1   1 
ATOM   9260  N  ND2   . ASN B 2 268  ? -21.403 51.424  -26.042 1.00 72.43  ? 292  ASN B ND2   1 
ATOM   9261  N  N     . PHE B 2 269  ? -24.316 54.003  -24.358 1.00 41.32  ? 293  PHE B N     1 
ATOM   9262  C  CA    . PHE B 2 269  ? -25.402 53.168  -23.860 1.00 48.13  ? 293  PHE B CA    1 
ATOM   9263  C  C     . PHE B 2 269  ? -25.513 51.906  -24.715 1.00 73.32  ? 293  PHE B C     1 
ATOM   9264  O  O     . PHE B 2 269  ? -24.987 51.868  -25.828 1.00 77.94  ? 293  PHE B O     1 
ATOM   9265  C  CB    . PHE B 2 269  ? -26.719 53.950  -23.860 1.00 46.71  ? 293  PHE B CB    1 
ATOM   9266  C  CG    . PHE B 2 269  ? -26.860 54.895  -22.702 1.00 43.67  ? 293  PHE B CG    1 
ATOM   9267  C  CD1   . PHE B 2 269  ? -27.145 54.418  -21.434 1.00 44.65  ? 293  PHE B CD1   1 
ATOM   9268  C  CD2   . PHE B 2 269  ? -26.709 56.259  -22.880 1.00 40.43  ? 293  PHE B CD2   1 
ATOM   9269  C  CE1   . PHE B 2 269  ? -27.274 55.282  -20.364 1.00 42.41  ? 293  PHE B CE1   1 
ATOM   9270  C  CE2   . PHE B 2 269  ? -26.838 57.130  -21.815 1.00 92.01  ? 293  PHE B CE2   1 
ATOM   9271  C  CZ    . PHE B 2 269  ? -27.120 56.640  -20.555 1.00 92.99  ? 293  PHE B CZ    1 
ATOM   9272  N  N     . PRO B 2 270  ? -26.183 50.860  -24.196 1.00 65.42  ? 294  PRO B N     1 
ATOM   9273  C  CA    . PRO B 2 270  ? -26.351 49.609  -24.948 1.00 68.40  ? 294  PRO B CA    1 
ATOM   9274  C  C     . PRO B 2 270  ? -27.006 49.775  -26.323 1.00 68.45  ? 294  PRO B C     1 
ATOM   9275  O  O     . PRO B 2 270  ? -26.918 48.865  -27.147 1.00 75.22  ? 294  PRO B O     1 
ATOM   9276  C  CB    . PRO B 2 270  ? -27.246 48.775  -24.029 1.00 56.76  ? 294  PRO B CB    1 
ATOM   9277  C  CG    . PRO B 2 270  ? -26.917 49.255  -22.667 1.00 60.43  ? 294  PRO B CG    1 
ATOM   9278  C  CD    . PRO B 2 270  ? -26.664 50.728  -22.808 1.00 48.35  ? 294  PRO B CD    1 
ATOM   9279  N  N     . TRP B 2 271  ? -27.645 50.915  -26.567 1.00 56.99  ? 295  TRP B N     1 
ATOM   9280  C  CA    . TRP B 2 271  ? -28.311 51.155  -27.844 1.00 60.05  ? 295  TRP B CA    1 
ATOM   9281  C  C     . TRP B 2 271  ? -27.583 52.194  -28.693 1.00 71.11  ? 295  TRP B C     1 
ATOM   9282  O  O     . TRP B 2 271  ? -28.070 52.590  -29.753 1.00 73.70  ? 295  TRP B O     1 
ATOM   9283  C  CB    . TRP B 2 271  ? -29.754 51.597  -27.611 1.00 49.64  ? 295  TRP B CB    1 
ATOM   9284  C  CG    . TRP B 2 271  ? -29.877 52.816  -26.755 1.00 45.23  ? 295  TRP B CG    1 
ATOM   9285  C  CD1   . TRP B 2 271  ? -29.879 54.114  -27.175 1.00 60.99  ? 295  TRP B CD1   1 
ATOM   9286  C  CD2   . TRP B 2 271  ? -30.020 52.855  -25.330 1.00 43.59  ? 295  TRP B CD2   1 
ATOM   9287  N  NE1   . TRP B 2 271  ? -30.013 54.959  -26.100 1.00 49.40  ? 295  TRP B NE1   1 
ATOM   9288  C  CE2   . TRP B 2 271  ? -30.103 54.211  -24.956 1.00 65.19  ? 295  TRP B CE2   1 
ATOM   9289  C  CE3   . TRP B 2 271  ? -30.085 51.876  -24.334 1.00 45.57  ? 295  TRP B CE3   1 
ATOM   9290  C  CZ2   . TRP B 2 271  ? -30.248 54.612  -23.629 1.00 47.79  ? 295  TRP B CZ2   1 
ATOM   9291  C  CZ3   . TRP B 2 271  ? -30.230 52.277  -23.017 1.00 43.81  ? 295  TRP B CZ3   1 
ATOM   9292  C  CH2   . TRP B 2 271  ? -30.310 53.633  -22.677 1.00 49.91  ? 295  TRP B CH2   1 
ATOM   9293  N  N     . GLY B 2 272  ? -26.418 52.630  -28.226 1.00 77.64  ? 296  GLY B N     1 
ATOM   9294  C  CA    . GLY B 2 272  ? -25.630 53.620  -28.938 1.00 77.33  ? 296  GLY B CA    1 
ATOM   9295  C  C     . GLY B 2 272  ? -25.170 54.745  -28.033 1.00 73.60  ? 296  GLY B C     1 
ATOM   9296  O  O     . GLY B 2 272  ? -25.541 54.798  -26.860 1.00 76.46  ? 296  GLY B O     1 
ATOM   9297  N  N     . LYS B 2 273  ? -24.360 55.649  -28.576 1.00 73.53  ? 297  LYS B N     1 
ATOM   9298  C  CA    . LYS B 2 273  ? -23.854 56.779  -27.803 1.00 55.04  ? 297  LYS B CA    1 
ATOM   9299  C  C     . LYS B 2 273  ? -24.950 57.810  -27.547 1.00 48.92  ? 297  LYS B C     1 
ATOM   9300  O  O     . LYS B 2 273  ? -25.892 57.936  -28.330 1.00 47.07  ? 297  LYS B O     1 
ATOM   9301  C  CB    . LYS B 2 273  ? -22.671 57.436  -28.519 1.00 48.65  ? 297  LYS B CB    1 
ATOM   9302  C  CG    . LYS B 2 273  ? -21.484 56.511  -28.742 1.00 64.39  ? 297  LYS B CG    1 
ATOM   9303  C  CD    . LYS B 2 273  ? -20.279 57.270  -29.280 1.00 69.89  ? 297  LYS B CD    1 
ATOM   9304  C  CE    . LYS B 2 273  ? -20.601 57.974  -30.589 1.00 73.42  ? 297  LYS B CE    1 
ATOM   9305  N  NZ    . LYS B 2 273  ? -19.440 58.751  -31.106 1.00 66.36  ? 297  LYS B NZ    1 
ATOM   9306  N  N     . GLU B 2 274  ? -24.821 58.544  -26.446 1.00 40.15  ? 298  GLU B N     1 
ATOM   9307  C  CA    . GLU B 2 274  ? -25.796 59.566  -26.085 1.00 43.68  ? 298  GLU B CA    1 
ATOM   9308  C  C     . GLU B 2 274  ? -25.103 60.768  -25.449 1.00 43.30  ? 298  GLU B C     1 
ATOM   9309  O  O     . GLU B 2 274  ? -24.147 60.614  -24.688 1.00 48.37  ? 298  GLU B O     1 
ATOM   9310  C  CB    . GLU B 2 274  ? -26.846 58.994  -25.131 1.00 42.07  ? 298  GLU B CB    1 
ATOM   9311  C  CG    . GLU B 2 274  ? -28.238 59.573  -25.317 1.00 68.28  ? 298  GLU B CG    1 
ATOM   9312  C  CD    . GLU B 2 274  ? -28.914 59.068  -26.579 1.00 76.18  ? 298  GLU B CD    1 
ATOM   9313  O  OE1   . GLU B 2 274  ? -28.519 57.993  -27.078 1.00 60.57  ? 298  GLU B OE1   1 
ATOM   9314  O  OE2   . GLU B 2 274  ? -29.842 59.745  -27.071 1.00 74.14  ? 298  GLU B OE2   1 
ATOM   9315  N  N     . LEU B 2 275  ? -25.591 61.964  -25.762 1.00 46.06  ? 299  LEU B N     1 
ATOM   9316  C  CA    . LEU B 2 275  ? -24.991 63.196  -25.260 1.00 93.49  ? 299  LEU B CA    1 
ATOM   9317  C  C     . LEU B 2 275  ? -25.190 63.346  -23.755 1.00 41.65  ? 299  LEU B C     1 
ATOM   9318  O  O     . LEU B 2 275  ? -26.304 63.207  -23.251 1.00 64.57  ? 299  LEU B O     1 
ATOM   9319  C  CB    . LEU B 2 275  ? -25.575 64.405  -25.991 1.00 81.40  ? 299  LEU B CB    1 
ATOM   9320  C  CG    . LEU B 2 275  ? -25.016 65.774  -25.605 1.00 84.15  ? 299  LEU B CG    1 
ATOM   9321  C  CD1   . LEU B 2 275  ? -23.521 65.833  -25.866 1.00 48.40  ? 299  LEU B CD1   1 
ATOM   9322  C  CD2   . LEU B 2 275  ? -25.739 66.879  -26.362 1.00 46.53  ? 299  LEU B CD2   1 
ATOM   9323  N  N     . ILE B 2 276  ? -24.104 63.630  -23.041 1.00 77.45  ? 300  ILE B N     1 
ATOM   9324  C  CA    . ILE B 2 276  ? -24.158 63.771  -21.590 1.00 76.00  ? 300  ILE B CA    1 
ATOM   9325  C  C     . ILE B 2 276  ? -23.584 65.104  -21.118 1.00 91.65  ? 300  ILE B C     1 
ATOM   9326  O  O     . ILE B 2 276  ? -23.861 65.541  -20.004 1.00 73.28  ? 300  ILE B O     1 
ATOM   9327  C  CB    . ILE B 2 276  ? -23.403 62.629  -20.884 1.00 42.96  ? 300  ILE B CB    1 
ATOM   9328  C  CG1   . ILE B 2 276  ? -21.931 62.622  -21.302 1.00 49.59  ? 300  ILE B CG1   1 
ATOM   9329  C  CG2   . ILE B 2 276  ? -24.054 61.291  -21.194 1.00 47.41  ? 300  ILE B CG2   1 
ATOM   9330  C  CD1   . ILE B 2 276  ? -21.102 61.556  -20.620 1.00 44.28  ? 300  ILE B CD1   1 
ATOM   9331  N  N     . GLU B 2 277  ? -22.780 65.742  -21.964 1.00 91.90  ? 301  GLU B N     1 
ATOM   9332  C  CA    . GLU B 2 277  ? -22.177 67.029  -21.626 1.00 90.58  ? 301  GLU B CA    1 
ATOM   9333  C  C     . GLU B 2 277  ? -21.727 67.759  -22.887 1.00 47.21  ? 301  GLU B C     1 
ATOM   9334  O  O     . GLU B 2 277  ? -21.303 67.133  -23.857 1.00 49.91  ? 301  GLU B O     1 
ATOM   9335  C  CB    . GLU B 2 277  ? -20.994 66.841  -20.670 1.00 81.08  ? 301  GLU B CB    1 
ATOM   9336  C  CG    . GLU B 2 277  ? -20.453 68.138  -20.080 1.00 41.99  ? 301  GLU B CG    1 
ATOM   9337  C  CD    . GLU B 2 277  ? -19.453 67.905  -18.963 1.00 45.71  ? 301  GLU B CD    1 
ATOM   9338  O  OE1   . GLU B 2 277  ? -19.553 68.586  -17.920 1.00 75.64  ? 301  GLU B OE1   1 
ATOM   9339  O  OE2   . GLU B 2 277  ? -18.567 67.041  -19.124 1.00 46.72  ? 301  GLU B OE2   1 
ATOM   9340  N  N     . THR B 2 278  ? -21.822 69.085  -22.868 1.00 46.77  ? 302  THR B N     1 
ATOM   9341  C  CA    . THR B 2 278  ? -21.455 69.894  -24.023 1.00 48.25  ? 302  THR B CA    1 
ATOM   9342  C  C     . THR B 2 278  ? -20.566 71.078  -23.638 1.00 43.30  ? 302  THR B C     1 
ATOM   9343  O  O     . THR B 2 278  ? -20.793 71.737  -22.623 1.00 46.99  ? 302  THR B O     1 
ATOM   9344  C  CB    . THR B 2 278  ? -22.709 70.414  -24.754 1.00 47.44  ? 302  THR B CB    1 
ATOM   9345  O  OG1   . THR B 2 278  ? -22.322 71.366  -25.751 1.00 41.74  ? 302  THR B OG1   1 
ATOM   9346  C  CG2   . THR B 2 278  ? -23.666 71.075  -23.773 1.00 47.61  ? 302  THR B CG2   1 
ATOM   9347  N  N     . LEU B 2 279  ? -19.546 71.334  -24.453 1.00 42.04  ? 303  LEU B N     1 
ATOM   9348  C  CA    . LEU B 2 279  ? -18.625 72.444  -24.221 1.00 92.42  ? 303  LEU B CA    1 
ATOM   9349  C  C     . LEU B 2 279  ? -18.500 73.326  -25.460 1.00 44.38  ? 303  LEU B C     1 
ATOM   9350  O  O     . LEU B 2 279  ? -18.079 72.862  -26.519 1.00 48.16  ? 303  LEU B O     1 
ATOM   9351  C  CB    . LEU B 2 279  ? -17.240 71.931  -23.811 1.00 68.42  ? 303  LEU B CB    1 
ATOM   9352  C  CG    . LEU B 2 279  ? -17.065 71.292  -22.431 1.00 86.51  ? 303  LEU B CG    1 
ATOM   9353  C  CD1   . LEU B 2 279  ? -17.541 69.846  -22.413 1.00 44.63  ? 303  LEU B CD1   1 
ATOM   9354  C  CD2   . LEU B 2 279  ? -15.615 71.385  -21.986 1.00 77.06  ? 303  LEU B CD2   1 
ATOM   9355  N  N     . TRP B 2 280  ? -18.860 74.598  -25.321 1.00 45.51  ? 304  TRP B N     1 
ATOM   9356  C  CA    . TRP B 2 280  ? -18.816 75.533  -26.441 1.00 87.72  ? 304  TRP B CA    1 
ATOM   9357  C  C     . TRP B 2 280  ? -18.077 76.820  -26.101 1.00 48.48  ? 304  TRP B C     1 
ATOM   9358  O  O     . TRP B 2 280  ? -18.039 77.246  -24.946 1.00 93.91  ? 304  TRP B O     1 
ATOM   9359  C  CB    . TRP B 2 280  ? -20.230 75.871  -26.912 1.00 90.54  ? 304  TRP B CB    1 
ATOM   9360  C  CG    . TRP B 2 280  ? -20.851 74.813  -27.760 1.00 91.39  ? 304  TRP B CG    1 
ATOM   9361  C  CD1   . TRP B 2 280  ? -21.657 73.799  -27.341 1.00 86.96  ? 304  TRP B CD1   1 
ATOM   9362  C  CD2   . TRP B 2 280  ? -20.720 74.664  -29.178 1.00 41.54  ? 304  TRP B CD2   1 
ATOM   9363  N  NE1   . TRP B 2 280  ? -22.037 73.024  -28.409 1.00 45.66  ? 304  TRP B NE1   1 
ATOM   9364  C  CE2   . TRP B 2 280  ? -21.474 73.535  -29.549 1.00 49.19  ? 304  TRP B CE2   1 
ATOM   9365  C  CE3   . TRP B 2 280  ? -20.038 75.376  -30.169 1.00 45.97  ? 304  TRP B CE3   1 
ATOM   9366  C  CZ2   . TRP B 2 280  ? -21.566 73.100  -30.870 1.00 67.88  ? 304  TRP B CZ2   1 
ATOM   9367  C  CZ3   . TRP B 2 280  ? -20.130 74.943  -31.479 1.00 56.38  ? 304  TRP B CZ3   1 
ATOM   9368  C  CH2   . TRP B 2 280  ? -20.888 73.816  -31.817 1.00 66.50  ? 304  TRP B CH2   1 
ATOM   9369  N  N     . ASN B 2 281  ? -17.501 77.438  -27.128 1.00 70.28  ? 305  ASN B N     1 
ATOM   9370  C  CA    . ASN B 2 281  ? -16.792 78.701  -26.978 1.00 74.98  ? 305  ASN B CA    1 
ATOM   9371  C  C     . ASN B 2 281  ? -17.569 79.850  -27.615 1.00 77.04  ? 305  ASN B C     1 
ATOM   9372  O  O     . ASN B 2 281  ? -17.560 80.019  -28.835 1.00 68.52  ? 305  ASN B O     1 
ATOM   9373  C  CB    . ASN B 2 281  ? -15.395 78.601  -27.594 1.00 74.79  ? 305  ASN B CB    1 
ATOM   9374  C  CG    . ASN B 2 281  ? -14.523 79.793  -27.259 1.00 85.45  ? 305  ASN B CG    1 
ATOM   9375  O  OD1   . ASN B 2 281  ? -14.687 80.422  -26.214 1.00 85.33  ? 305  ASN B OD1   1 
ATOM   9376  N  ND2   . ASN B 2 281  ? -13.587 80.109  -28.146 1.00 91.05  ? 305  ASN B ND2   1 
ATOM   9377  N  N     . LEU B 2 282  ? -18.243 80.635  -26.780 1.00 69.73  ? 306  LEU B N     1 
ATOM   9378  C  CA    . LEU B 2 282  ? -19.069 81.743  -27.249 1.00 67.18  ? 306  LEU B CA    1 
ATOM   9379  C  C     . LEU B 2 282  ? -18.259 83.032  -27.364 1.00 76.85  ? 306  LEU B C     1 
ATOM   9380  O  O     . LEU B 2 282  ? -17.788 83.573  -26.362 1.00 64.28  ? 306  LEU B O     1 
ATOM   9381  C  CB    . LEU B 2 282  ? -20.257 81.948  -26.308 1.00 67.06  ? 306  LEU B CB    1 
ATOM   9382  C  CG    . LEU B 2 282  ? -21.011 80.673  -25.925 1.00 46.27  ? 306  LEU B CG    1 
ATOM   9383  C  CD1   . LEU B 2 282  ? -22.057 80.958  -24.858 1.00 92.59  ? 306  LEU B CD1   1 
ATOM   9384  C  CD2   . LEU B 2 282  ? -21.649 80.040  -27.153 1.00 40.63  ? 306  LEU B CD2   1 
ATOM   9385  N  N     . GLY B 2 283  ? -18.107 83.524  -28.589 1.00 70.18  ? 307  GLY B N     1 
ATOM   9386  C  CA    . GLY B 2 283  ? -17.279 84.688  -28.850 1.00 71.19  ? 307  GLY B CA    1 
ATOM   9387  C  C     . GLY B 2 283  ? -17.872 86.011  -28.402 1.00 68.51  ? 307  GLY B C     1 
ATOM   9388  O  O     . GLY B 2 283  ? -18.208 86.852  -29.235 1.00 85.16  ? 307  GLY B O     1 
ATOM   9389  N  N     . ASP B 2 284  ? -17.988 86.185  -27.085 1.00 70.26  ? 308  ASP B N     1 
ATOM   9390  C  CA    . ASP B 2 284  ? -18.441 87.427  -26.442 1.00 72.39  ? 308  ASP B CA    1 
ATOM   9391  C  C     . ASP B 2 284  ? -19.579 88.167  -27.152 1.00 75.82  ? 308  ASP B C     1 
ATOM   9392  O  O     . ASP B 2 284  ? -19.636 89.395  -27.132 1.00 76.20  ? 308  ASP B O     1 
ATOM   9393  C  CB    . ASP B 2 284  ? -17.256 88.387  -26.263 1.00 74.14  ? 308  ASP B CB    1 
ATOM   9394  C  CG    . ASP B 2 284  ? -16.630 88.808  -27.582 1.00 70.27  ? 308  ASP B CG    1 
ATOM   9395  O  OD1   . ASP B 2 284  ? -15.690 88.125  -28.040 1.00 76.64  ? 308  ASP B OD1   1 
ATOM   9396  O  OD2   . ASP B 2 284  ? -17.071 89.825  -28.157 1.00 77.85  ? 308  ASP B OD2   1 
ATOM   9397  N  N     . HIS B 2 285  ? -20.489 87.418  -27.766 1.00 76.47  ? 309  HIS B N     1 
ATOM   9398  C  CA    . HIS B 2 285  ? -21.618 88.016  -28.468 1.00 55.22  ? 309  HIS B CA    1 
ATOM   9399  C  C     . HIS B 2 285  ? -22.734 88.390  -27.499 1.00 46.64  ? 309  HIS B C     1 
ATOM   9400  O  O     . HIS B 2 285  ? -23.221 89.525  -27.503 1.00 48.74  ? 309  HIS B O     1 
ATOM   9401  C  CB    . HIS B 2 285  ? -22.149 87.061  -29.538 1.00 77.76  ? 309  HIS B CB    1 
ATOM   9402  C  CG    . HIS B 2 285  ? -23.401 87.536  -30.207 1.00 77.17  ? 309  HIS B CG    1 
ATOM   9403  N  ND1   . HIS B 2 285  ? -23.505 88.777  -30.798 1.00 81.20  ? 309  HIS B ND1   1 
ATOM   9404  C  CD2   . HIS B 2 285  ? -24.603 86.936  -30.378 1.00 84.54  ? 309  HIS B CD2   1 
ATOM   9405  C  CE1   . HIS B 2 285  ? -24.717 88.921  -31.304 1.00 86.57  ? 309  HIS B CE1   1 
ATOM   9406  N  NE2   . HIS B 2 285  ? -25.403 87.819  -31.063 1.00 91.54  ? 309  HIS B NE2   1 
ATOM   9407  N  N     . GLU B 2 286  ? -23.129 87.432  -26.667 1.00 56.15  ? 310  GLU B N     1 
ATOM   9408  C  CA    . GLU B 2 286  ? -24.244 87.625  -25.747 1.00 71.83  ? 310  GLU B CA    1 
ATOM   9409  C  C     . GLU B 2 286  ? -23.945 88.699  -24.706 1.00 74.65  ? 310  GLU B C     1 
ATOM   9410  O  O     . GLU B 2 286  ? -24.823 89.482  -24.349 1.00 71.84  ? 310  GLU B O     1 
ATOM   9411  C  CB    . GLU B 2 286  ? -24.601 86.310  -25.052 1.00 77.81  ? 310  GLU B CB    1 
ATOM   9412  C  CG    . GLU B 2 286  ? -25.875 86.377  -24.224 1.00 73.23  ? 310  GLU B CG    1 
ATOM   9413  C  CD    . GLU B 2 286  ? -27.104 86.682  -25.063 1.00 93.97  ? 310  GLU B CD    1 
ATOM   9414  O  OE1   . GLU B 2 286  ? -27.124 86.306  -26.254 1.00 90.51  ? 310  GLU B OE1   1 
ATOM   9415  O  OE2   . GLU B 2 286  ? -28.051 87.299  -24.531 1.00 90.67  ? 310  GLU B OE2   1 
ATOM   9416  N  N     . LEU B 2 287  ? -22.707 88.733  -24.221 1.00 67.45  ? 311  LEU B N     1 
ATOM   9417  C  CA    . LEU B 2 287  ? -22.301 89.754  -23.262 1.00 55.62  ? 311  LEU B CA    1 
ATOM   9418  C  C     . LEU B 2 287  ? -22.339 91.138  -23.897 1.00 69.39  ? 311  LEU B C     1 
ATOM   9419  O  O     . LEU B 2 287  ? -22.714 92.118  -23.254 1.00 69.31  ? 311  LEU B O     1 
ATOM   9420  C  CB    . LEU B 2 287  ? -20.901 89.467  -22.716 1.00 45.12  ? 311  LEU B CB    1 
ATOM   9421  C  CG    . LEU B 2 287  ? -20.771 88.341  -21.691 1.00 47.21  ? 311  LEU B CG    1 
ATOM   9422  C  CD1   . LEU B 2 287  ? -19.413 88.408  -21.011 1.00 47.97  ? 311  LEU B CD1   1 
ATOM   9423  C  CD2   . LEU B 2 287  ? -21.892 88.407  -20.666 1.00 69.43  ? 311  LEU B CD2   1 
ATOM   9424  N  N     . LEU B 2 288  ? -21.946 91.210  -25.165 1.00 56.05  ? 312  LEU B N     1 
ATOM   9425  C  CA    . LEU B 2 288  ? -22.000 92.458  -25.914 1.00 46.43  ? 312  LEU B CA    1 
ATOM   9426  C  C     . LEU B 2 288  ? -23.438 92.917  -26.104 1.00 45.07  ? 312  LEU B C     1 
ATOM   9427  O  O     . LEU B 2 288  ? -23.731 94.110  -26.045 1.00 75.62  ? 312  LEU B O     1 
ATOM   9428  C  CB    . LEU B 2 288  ? -21.319 92.300  -27.273 1.00 56.79  ? 312  LEU B CB    1 
ATOM   9429  C  CG    . LEU B 2 288  ? -19.933 92.924  -27.424 1.00 45.75  ? 312  LEU B CG    1 
ATOM   9430  C  CD1   . LEU B 2 288  ? -19.010 92.460  -26.310 1.00 44.03  ? 312  LEU B CD1   1 
ATOM   9431  C  CD2   . LEU B 2 288  ? -19.353 92.584  -28.788 1.00 43.14  ? 312  LEU B CD2   1 
ATOM   9432  N  N     . HIS B 2 289  ? -24.334 91.962  -26.334 1.00 45.97  ? 313  HIS B N     1 
ATOM   9433  C  CA    . HIS B 2 289  ? -25.739 92.283  -26.548 1.00 56.30  ? 313  HIS B CA    1 
ATOM   9434  C  C     . HIS B 2 289  ? -26.432 92.680  -25.246 1.00 60.28  ? 313  HIS B C     1 
ATOM   9435  O  O     . HIS B 2 289  ? -27.384 93.461  -25.254 1.00 71.73  ? 313  HIS B O     1 
ATOM   9436  C  CB    . HIS B 2 289  ? -26.466 91.102  -27.190 1.00 60.53  ? 313  HIS B CB    1 
ATOM   9437  C  CG    . HIS B 2 289  ? -27.907 91.374  -27.489 1.00 69.16  ? 313  HIS B CG    1 
ATOM   9438  N  ND1   . HIS B 2 289  ? -28.925 91.010  -26.636 1.00 69.94  ? 313  HIS B ND1   1 
ATOM   9439  C  CD2   . HIS B 2 289  ? -28.499 91.982  -28.544 1.00 71.29  ? 313  HIS B CD2   1 
ATOM   9440  C  CE1   . HIS B 2 289  ? -30.084 91.378  -27.154 1.00 72.57  ? 313  HIS B CE1   1 
ATOM   9441  N  NE2   . HIS B 2 289  ? -29.853 91.970  -28.311 1.00 68.00  ? 313  HIS B NE2   1 
ATOM   9442  N  N     . MET B 2 290  ? -25.949 92.143  -24.130 1.00 56.16  ? 314  MET B N     1 
ATOM   9443  C  CA    . MET B 2 290  ? -26.527 92.441  -22.823 1.00 67.18  ? 314  MET B CA    1 
ATOM   9444  C  C     . MET B 2 290  ? -26.127 93.826  -22.328 1.00 66.97  ? 314  MET B C     1 
ATOM   9445  O  O     . MET B 2 290  ? -26.855 94.456  -21.560 1.00 60.94  ? 314  MET B O     1 
ATOM   9446  C  CB    . MET B 2 290  ? -26.110 91.386  -21.797 1.00 56.79  ? 314  MET B CB    1 
ATOM   9447  C  CG    . MET B 2 290  ? -26.817 90.052  -21.947 1.00 56.92  ? 314  MET B CG    1 
ATOM   9448  S  SD    . MET B 2 290  ? -26.271 88.856  -20.715 1.00 72.18  ? 314  MET B SD    1 
ATOM   9449  C  CE    . MET B 2 290  ? -26.647 89.739  -19.203 1.00 56.40  ? 314  MET B CE    1 
ATOM   9450  N  N     . TYR B 2 291  ? -24.964 94.294  -22.765 1.00 64.26  ? 315  TYR B N     1 
ATOM   9451  C  CA    . TYR B 2 291  ? -24.471 95.603  -22.358 1.00 67.58  ? 315  TYR B CA    1 
ATOM   9452  C  C     . TYR B 2 291  ? -24.066 96.436  -23.570 1.00 67.66  ? 315  TYR B C     1 
ATOM   9453  O  O     . TYR B 2 291  ? -22.881 96.559  -23.877 1.00 67.70  ? 315  TYR B O     1 
ATOM   9454  C  CB    . TYR B 2 291  ? -23.290 95.453  -21.396 1.00 67.12  ? 315  TYR B CB    1 
ATOM   9455  C  CG    . TYR B 2 291  ? -23.638 94.752  -20.101 1.00 66.51  ? 315  TYR B CG    1 
ATOM   9456  C  CD1   . TYR B 2 291  ? -23.620 93.365  -20.010 1.00 64.74  ? 315  TYR B CD1   1 
ATOM   9457  C  CD2   . TYR B 2 291  ? -23.980 95.477  -18.967 1.00 69.46  ? 315  TYR B CD2   1 
ATOM   9458  C  CE1   . TYR B 2 291  ? -23.935 92.721  -18.827 1.00 64.33  ? 315  TYR B CE1   1 
ATOM   9459  C  CE2   . TYR B 2 291  ? -24.296 94.842  -17.780 1.00 68.81  ? 315  TYR B CE2   1 
ATOM   9460  C  CZ    . TYR B 2 291  ? -24.272 93.465  -17.716 1.00 73.46  ? 315  TYR B CZ    1 
ATOM   9461  O  OH    . TYR B 2 291  ? -24.587 92.830  -16.537 1.00 74.99  ? 315  TYR B OH    1 
ATOM   9462  N  N     . PRO B 2 292  ? -25.058 97.010  -24.267 1.00 68.24  ? 316  PRO B N     1 
ATOM   9463  C  CA    . PRO B 2 292  ? -24.798 97.799  -25.474 1.00 68.10  ? 316  PRO B CA    1 
ATOM   9464  C  C     . PRO B 2 292  ? -24.339 99.221  -25.161 1.00 68.79  ? 316  PRO B C     1 
ATOM   9465  O  O     . PRO B 2 292  ? -23.598 99.813  -25.946 1.00 71.02  ? 316  PRO B O     1 
ATOM   9466  C  CB    . PRO B 2 292  ? -26.154 97.804  -26.176 1.00 55.23  ? 316  PRO B CB    1 
ATOM   9467  C  CG    . PRO B 2 292  ? -27.137 97.731  -25.063 1.00 64.81  ? 316  PRO B CG    1 
ATOM   9468  C  CD    . PRO B 2 292  ? -26.500 96.890  -23.987 1.00 56.16  ? 316  PRO B CD    1 
ATOM   9469  N  N     . GLY B 2 293  ? -24.776 99.757  -24.026 1.00 77.26  ? 317  GLY B N     1 
ATOM   9470  C  CA    . GLY B 2 293  ? -24.413 101.105 -23.630 1.00 76.92  ? 317  GLY B CA    1 
ATOM   9471  C  C     . GLY B 2 293  ? -22.945 101.224 -23.276 1.00 77.62  ? 317  GLY B C     1 
ATOM   9472  O  O     . GLY B 2 293  ? -22.125 101.620 -24.104 1.00 72.74  ? 317  GLY B O     1 
ATOM   9473  N  N     . ASN B 2 294  ? -22.614 100.876 -22.037 1.00 91.44  ? 318  ASN B N     1 
ATOM   9474  C  CA    . ASN B 2 294  ? -21.236 100.935 -21.572 1.00 90.99  ? 318  ASN B CA    1 
ATOM   9475  C  C     . ASN B 2 294  ? -20.588 99.554  -21.553 1.00 91.28  ? 318  ASN B C     1 
ATOM   9476  O  O     . ASN B 2 294  ? -20.928 98.712  -20.722 1.00 69.69  ? 318  ASN B O     1 
ATOM   9477  C  CB    . ASN B 2 294  ? -21.171 101.565 -20.179 1.00 70.15  ? 318  ASN B CB    1 
ATOM   9478  C  CG    . ASN B 2 294  ? -21.824 102.934 -20.126 1.00 84.09  ? 318  ASN B CG    1 
ATOM   9479  O  OD1   . ASN B 2 294  ? -21.834 103.668 -21.115 1.00 90.00  ? 318  ASN B OD1   1 
ATOM   9480  N  ND2   . ASN B 2 294  ? -22.374 103.283 -18.969 1.00 92.16  ? 318  ASN B ND2   1 
ATOM   9481  N  N     . VAL B 2 295  ? -19.660 99.326  -22.476 1.00 69.51  ? 319  VAL B N     1 
ATOM   9482  C  CA    . VAL B 2 295  ? -18.936 98.062  -22.536 1.00 73.59  ? 319  VAL B CA    1 
ATOM   9483  C  C     . VAL B 2 295  ? -17.698 98.113  -21.651 1.00 69.00  ? 319  VAL B C     1 
ATOM   9484  O  O     . VAL B 2 295  ? -16.964 97.131  -21.534 1.00 45.19  ? 319  VAL B O     1 
ATOM   9485  C  CB    . VAL B 2 295  ? -18.515 97.711  -23.975 1.00 74.97  ? 319  VAL B CB    1 
ATOM   9486  C  CG1   . VAL B 2 295  ? -19.738 97.586  -24.869 1.00 75.68  ? 319  VAL B CG1   1 
ATOM   9487  C  CG2   . VAL B 2 295  ? -17.556 98.759  -24.517 1.00 70.90  ? 319  VAL B CG2   1 
ATOM   9488  N  N     . SER B 2 296  ? -17.473 99.267  -21.030 1.00 69.62  ? 320  SER B N     1 
ATOM   9489  C  CA    . SER B 2 296  ? -16.335 99.453  -20.140 1.00 77.51  ? 320  SER B CA    1 
ATOM   9490  C  C     . SER B 2 296  ? -16.495 98.628  -18.868 1.00 75.50  ? 320  SER B C     1 
ATOM   9491  O  O     . SER B 2 296  ? -15.512 98.293  -18.207 1.00 73.09  ? 320  SER B O     1 
ATOM   9492  C  CB    . SER B 2 296  ? -16.163 100.932 -19.790 1.00 77.00  ? 320  SER B CB    1 
ATOM   9493  O  OG    . SER B 2 296  ? -15.058 101.125 -18.925 1.00 93.21  ? 320  SER B OG    1 
ATOM   9494  N  N     . LYS B 2 297  ? -17.739 98.301  -18.531 1.00 75.51  ? 321  LYS B N     1 
ATOM   9495  C  CA    . LYS B 2 297  ? -18.020 97.491  -17.352 1.00 66.15  ? 321  LYS B CA    1 
ATOM   9496  C  C     . LYS B 2 297  ? -17.929 96.007  -17.685 1.00 55.68  ? 321  LYS B C     1 
ATOM   9497  O  O     . LYS B 2 297  ? -18.311 95.156  -16.884 1.00 68.50  ? 321  LYS B O     1 
ATOM   9498  C  CB    . LYS B 2 297  ? -19.401 97.822  -16.781 1.00 60.51  ? 321  LYS B CB    1 
ATOM   9499  C  CG    . LYS B 2 297  ? -20.554 97.530  -17.725 1.00 69.70  ? 321  LYS B CG    1 
ATOM   9500  C  CD    . LYS B 2 297  ? -21.888 97.574  -16.995 1.00 66.37  ? 321  LYS B CD    1 
ATOM   9501  C  CE    . LYS B 2 297  ? -22.185 98.961  -16.449 1.00 77.42  ? 321  LYS B CE    1 
ATOM   9502  N  NZ    . LYS B 2 297  ? -22.408 99.946  -17.541 1.00 70.80  ? 321  LYS B NZ    1 
ATOM   9503  N  N     . LEU B 2 298  ? -17.421 95.706  -18.876 1.00 47.73  ? 322  LEU B N     1 
ATOM   9504  C  CA    . LEU B 2 298  ? -17.227 94.327  -19.306 1.00 56.15  ? 322  LEU B CA    1 
ATOM   9505  C  C     . LEU B 2 298  ? -15.746 93.985  -19.403 1.00 72.81  ? 322  LEU B C     1 
ATOM   9506  O  O     . LEU B 2 298  ? -15.370 92.814  -19.385 1.00 67.58  ? 322  LEU B O     1 
ATOM   9507  C  CB    . LEU B 2 298  ? -17.908 94.079  -20.653 1.00 41.90  ? 322  LEU B CB    1 
ATOM   9508  C  CG    . LEU B 2 298  ? -19.288 93.423  -20.603 1.00 47.50  ? 322  LEU B CG    1 
ATOM   9509  C  CD1   . LEU B 2 298  ? -20.218 94.210  -19.699 1.00 69.42  ? 322  LEU B CD1   1 
ATOM   9510  C  CD2   . LEU B 2 298  ? -19.871 93.301  -22.001 1.00 42.00  ? 322  LEU B CD2   1 
ATOM   9511  N  N     . HIS B 2 299  ? -14.912 95.016  -19.507 1.00 72.81  ? 323  HIS B N     1 
ATOM   9512  C  CA    . HIS B 2 299  ? -13.470 94.837  -19.626 1.00 64.70  ? 323  HIS B CA    1 
ATOM   9513  C  C     . HIS B 2 299  ? -12.888 94.105  -18.422 1.00 40.78  ? 323  HIS B C     1 
ATOM   9514  O  O     . HIS B 2 299  ? -13.171 94.454  -17.275 1.00 44.28  ? 323  HIS B O     1 
ATOM   9515  C  CB    . HIS B 2 299  ? -12.775 96.189  -19.798 1.00 67.66  ? 323  HIS B CB    1 
ATOM   9516  C  CG    . HIS B 2 299  ? -12.950 96.791  -21.157 1.00 67.91  ? 323  HIS B CG    1 
ATOM   9517  N  ND1   . HIS B 2 299  ? -12.522 98.063  -21.469 1.00 73.86  ? 323  HIS B ND1   1 
ATOM   9518  C  CD2   . HIS B 2 299  ? -13.502 96.292  -22.289 1.00 70.47  ? 323  HIS B CD2   1 
ATOM   9519  C  CE1   . HIS B 2 299  ? -12.805 98.324  -22.733 1.00 76.06  ? 323  HIS B CE1   1 
ATOM   9520  N  NE2   . HIS B 2 299  ? -13.400 97.265  -23.253 1.00 73.75  ? 323  HIS B NE2   1 
ATOM   9521  N  N     . GLY B 2 300  ? -12.079 93.086  -18.693 1.00 46.24  ? 324  GLY B N     1 
ATOM   9522  C  CA    . GLY B 2 300  ? -11.426 92.330  -17.641 1.00 46.71  ? 324  GLY B CA    1 
ATOM   9523  C  C     . GLY B 2 300  ? -9.921  92.328  -17.821 1.00 42.17  ? 324  GLY B C     1 
ATOM   9524  O  O     . GLY B 2 300  ? -9.427  92.193  -18.938 1.00 49.12  ? 324  GLY B O     1 
ATOM   9525  N  N     . ARG B 2 301  ? -9.190  92.468  -16.719 1.00 43.20  ? 325  ARG B N     1 
ATOM   9526  C  CA    . ARG B 2 301  ? -7.733  92.535  -16.777 1.00 49.37  ? 325  ARG B CA    1 
ATOM   9527  C  C     . ARG B 2 301  ? -7.112  91.194  -17.163 1.00 49.86  ? 325  ARG B C     1 
ATOM   9528  O  O     . ARG B 2 301  ? -7.031  90.277  -16.345 1.00 46.03  ? 325  ARG B O     1 
ATOM   9529  C  CB    . ARG B 2 301  ? -7.159  93.007  -15.437 1.00 60.70  ? 325  ARG B CB    1 
ATOM   9530  C  CG    . ARG B 2 301  ? -7.585  94.411  -15.029 1.00 68.88  ? 325  ARG B CG    1 
ATOM   9531  C  CD    . ARG B 2 301  ? -6.589  95.037  -14.060 1.00 77.52  ? 325  ARG B CD    1 
ATOM   9532  N  NE    . ARG B 2 301  ? -6.342  94.199  -12.889 1.00 75.47  ? 325  ARG B NE    1 
ATOM   9533  C  CZ    . ARG B 2 301  ? -6.940  94.358  -11.713 1.00 81.63  ? 325  ARG B CZ    1 
ATOM   9534  N  NH1   . ARG B 2 301  ? -7.827  95.329  -11.542 1.00 92.48  ? 325  ARG B NH1   1 
ATOM   9535  N  NH2   . ARG B 2 301  ? -6.649  93.547  -10.705 1.00 73.70  ? 325  ARG B NH2   1 
ATOM   9536  N  N     . ASP B 2 302  ? -6.679  91.089  -18.416 1.00 47.34  ? 326  ASP B N     1 
ATOM   9537  C  CA    . ASP B 2 302  ? -5.975  89.906  -18.901 1.00 91.10  ? 326  ASP B CA    1 
ATOM   9538  C  C     . ASP B 2 302  ? -4.588  89.827  -18.271 1.00 60.21  ? 326  ASP B C     1 
ATOM   9539  O  O     . ASP B 2 302  ? -4.016  88.746  -18.123 1.00 56.08  ? 326  ASP B O     1 
ATOM   9540  C  CB    . ASP B 2 302  ? -5.871  89.935  -20.430 1.00 91.95  ? 326  ASP B CB    1 
ATOM   9541  C  CG    . ASP B 2 302  ? -5.168  88.714  -20.996 1.00 56.00  ? 326  ASP B CG    1 
ATOM   9542  O  OD1   . ASP B 2 302  ? -4.536  88.835  -22.067 1.00 56.15  ? 326  ASP B OD1   1 
ATOM   9543  O  OD2   . ASP B 2 302  ? -5.251  87.633  -20.378 1.00 60.78  ? 326  ASP B OD2   1 
ATOM   9544  N  N     . GLY B 2 303  ? -4.057  90.986  -17.895 1.00 56.32  ? 327  GLY B N     1 
ATOM   9545  C  CA    . GLY B 2 303  ? -2.754  91.070  -17.266 1.00 66.26  ? 327  GLY B CA    1 
ATOM   9546  C  C     . GLY B 2 303  ? -2.233  92.492  -17.276 1.00 76.28  ? 327  GLY B C     1 
ATOM   9547  O  O     . GLY B 2 303  ? -2.365  93.221  -16.293 1.00 70.54  ? 327  GLY B O     1 
ATOM   9548  N  N     . ARG B 2 304  ? -1.642  92.888  -18.398 1.00 70.88  ? 328  ARG B N     1 
ATOM   9549  C  CA    . ARG B 2 304  ? -1.123  94.239  -18.561 1.00 81.35  ? 328  ARG B CA    1 
ATOM   9550  C  C     . ARG B 2 304  ? -2.107  95.083  -19.362 1.00 86.14  ? 328  ARG B C     1 
ATOM   9551  O  O     . ARG B 2 304  ? -1.819  96.226  -19.717 1.00 91.39  ? 328  ARG B O     1 
ATOM   9552  C  CB    . ARG B 2 304  ? 0.243   94.222  -19.255 1.00 40.41  ? 328  ARG B CB    1 
ATOM   9553  C  CG    . ARG B 2 304  ? 1.276   93.302  -18.616 1.00 47.58  ? 328  ARG B CG    1 
ATOM   9554  C  CD    . ARG B 2 304  ? 1.259   91.913  -19.244 1.00 46.18  ? 328  ARG B CD    1 
ATOM   9555  N  NE    . ARG B 2 304  ? 2.286   91.043  -18.679 1.00 47.81  ? 328  ARG B NE    1 
ATOM   9556  C  CZ    . ARG B 2 304  ? 3.502   90.891  -19.194 1.00 66.68  ? 328  ARG B CZ    1 
ATOM   9557  N  NH1   . ARG B 2 304  ? 3.847   91.551  -20.292 1.00 67.40  ? 328  ARG B NH1   1 
ATOM   9558  N  NH2   . ARG B 2 304  ? 4.373   90.079  -18.613 1.00 55.12  ? 328  ARG B NH2   1 
ATOM   9559  N  N     . LYS B 2 305  ? -3.272  94.507  -19.642 1.00 75.50  ? 329  LYS B N     1 
ATOM   9560  C  CA    . LYS B 2 305  ? -4.275  95.160  -20.474 1.00 86.59  ? 329  LYS B CA    1 
ATOM   9561  C  C     . LYS B 2 305  ? -5.659  94.568  -20.231 1.00 68.56  ? 329  LYS B C     1 
ATOM   9562  O  O     . LYS B 2 305  ? -5.796  93.373  -19.970 1.00 74.42  ? 329  LYS B O     1 
ATOM   9563  C  CB    . LYS B 2 305  ? -3.906  95.044  -21.958 1.00 76.62  ? 329  LYS B CB    1 
ATOM   9564  C  CG    . LYS B 2 305  ? -3.803  93.613  -22.485 1.00 69.33  ? 329  LYS B CG    1 
ATOM   9565  C  CD    . LYS B 2 305  ? -2.415  93.019  -22.268 1.00 73.45  ? 329  LYS B CD    1 
ATOM   9566  C  CE    . LYS B 2 305  ? -2.372  91.546  -22.647 1.00 75.57  ? 329  LYS B CE    1 
ATOM   9567  N  NZ    . LYS B 2 305  ? -1.045  90.931  -22.356 1.00 75.53  ? 329  LYS B NZ    1 
ATOM   9568  N  N     . ASN B 2 306  ? -6.683  95.412  -20.314 1.00 74.10  ? 330  ASN B N     1 
ATOM   9569  C  CA    . ASN B 2 306  ? -8.058  94.963  -20.129 1.00 65.30  ? 330  ASN B CA    1 
ATOM   9570  C  C     . ASN B 2 306  ? -8.719  94.611  -21.459 1.00 44.51  ? 330  ASN B C     1 
ATOM   9571  O  O     . ASN B 2 306  ? -8.791  95.436  -22.369 1.00 66.77  ? 330  ASN B O     1 
ATOM   9572  C  CB    . ASN B 2 306  ? -8.873  96.031  -19.395 1.00 43.42  ? 330  ASN B CB    1 
ATOM   9573  C  CG    . ASN B 2 306  ? -8.744  97.403  -20.026 1.00 73.08  ? 330  ASN B CG    1 
ATOM   9574  O  OD1   . ASN B 2 306  ? -7.719  97.730  -20.625 1.00 76.29  ? 330  ASN B OD1   1 
ATOM   9575  N  ND2   . ASN B 2 306  ? -9.785  98.216  -19.892 1.00 70.95  ? 330  ASN B ND2   1 
ATOM   9576  N  N     . VAL B 2 307  ? -9.197  93.376  -21.563 1.00 42.18  ? 331  VAL B N     1 
ATOM   9577  C  CA    . VAL B 2 307  ? -9.788  92.878  -22.798 1.00 43.20  ? 331  VAL B CA    1 
ATOM   9578  C  C     . VAL B 2 307  ? -11.224 92.409  -22.557 1.00 64.61  ? 331  VAL B C     1 
ATOM   9579  O  O     . VAL B 2 307  ? -11.617 92.148  -21.417 1.00 92.76  ? 331  VAL B O     1 
ATOM   9580  C  CB    . VAL B 2 307  ? -8.945  91.720  -23.388 1.00 66.88  ? 331  VAL B CB    1 
ATOM   9581  C  CG1   . VAL B 2 307  ? -9.183  90.433  -22.610 1.00 90.55  ? 331  VAL B CG1   1 
ATOM   9582  C  CG2   . VAL B 2 307  ? -9.238  91.523  -24.872 1.00 76.82  ? 331  VAL B CG2   1 
ATOM   9583  N  N     . VAL B 2 308  ? -12.005 92.326  -23.631 1.00 66.28  ? 332  VAL B N     1 
ATOM   9584  C  CA    . VAL B 2 308  ? -13.364 91.802  -23.569 1.00 67.55  ? 332  VAL B CA    1 
ATOM   9585  C  C     . VAL B 2 308  ? -13.340 90.278  -23.461 1.00 75.12  ? 332  VAL B C     1 
ATOM   9586  O  O     . VAL B 2 308  ? -12.743 89.598  -24.296 1.00 75.82  ? 332  VAL B O     1 
ATOM   9587  C  CB    . VAL B 2 308  ? -14.191 92.229  -24.803 1.00 67.08  ? 332  VAL B CB    1 
ATOM   9588  C  CG1   . VAL B 2 308  ? -13.352 92.141  -26.072 1.00 68.67  ? 332  VAL B CG1   1 
ATOM   9589  C  CG2   . VAL B 2 308  ? -15.457 91.391  -24.923 1.00 60.17  ? 332  VAL B CG2   1 
ATOM   9590  N  N     . PRO B 2 309  ? -13.995 89.738  -22.423 1.00 56.18  ? 333  PRO B N     1 
ATOM   9591  C  CA    . PRO B 2 309  ? -13.953 88.306  -22.111 1.00 45.49  ? 333  PRO B CA    1 
ATOM   9592  C  C     . PRO B 2 309  ? -14.689 87.443  -23.126 1.00 43.73  ? 333  PRO B C     1 
ATOM   9593  O  O     . PRO B 2 309  ? -15.816 87.754  -23.504 1.00 90.27  ? 333  PRO B O     1 
ATOM   9594  C  CB    . PRO B 2 309  ? -14.645 88.232  -20.749 1.00 92.80  ? 333  PRO B CB    1 
ATOM   9595  C  CG    . PRO B 2 309  ? -15.593 89.368  -20.770 1.00 41.20  ? 333  PRO B CG    1 
ATOM   9596  C  CD    . PRO B 2 309  ? -14.876 90.469  -21.498 1.00 60.73  ? 333  PRO B CD    1 
ATOM   9597  N  N     . CYS B 2 310  ? -14.045 86.368  -23.563 1.00 43.82  ? 334  CYS B N     1 
ATOM   9598  C  CA    . CYS B 2 310  ? -14.709 85.347  -24.359 1.00 67.97  ? 334  CYS B CA    1 
ATOM   9599  C  C     . CYS B 2 310  ? -15.387 84.362  -23.410 1.00 56.13  ? 334  CYS B C     1 
ATOM   9600  O  O     . CYS B 2 310  ? -14.806 83.963  -22.397 1.00 71.67  ? 334  CYS B O     1 
ATOM   9601  C  CB    . CYS B 2 310  ? -13.713 84.634  -25.275 1.00 67.41  ? 334  CYS B CB    1 
ATOM   9602  S  SG    . CYS B 2 310  ? -14.468 83.579  -26.532 1.00 75.40  ? 334  CYS B SG    1 
ATOM   9603  N  N     . VAL B 2 311  ? -16.617 83.978  -23.737 1.00 56.86  ? 335  VAL B N     1 
ATOM   9604  C  CA    . VAL B 2 311  ? -17.446 83.206  -22.818 1.00 49.32  ? 335  VAL B CA    1 
ATOM   9605  C  C     . VAL B 2 311  ? -17.437 81.707  -23.109 1.00 44.27  ? 335  VAL B C     1 
ATOM   9606  O  O     . VAL B 2 311  ? -18.196 81.225  -23.947 1.00 90.86  ? 335  VAL B O     1 
ATOM   9607  C  CB    . VAL B 2 311  ? -18.904 83.699  -22.852 1.00 40.62  ? 335  VAL B CB    1 
ATOM   9608  C  CG1   . VAL B 2 311  ? -19.714 83.044  -21.745 1.00 44.38  ? 335  VAL B CG1   1 
ATOM   9609  C  CG2   . VAL B 2 311  ? -18.949 85.211  -22.725 1.00 67.06  ? 335  VAL B CG2   1 
ATOM   9610  N  N     . LEU B 2 312  ? -16.581 80.973  -22.407 1.00 40.99  ? 336  LEU B N     1 
ATOM   9611  C  CA    . LEU B 2 312  ? -16.579 79.519  -22.499 1.00 42.82  ? 336  LEU B CA    1 
ATOM   9612  C  C     . LEU B 2 312  ? -17.761 78.971  -21.706 1.00 42.58  ? 336  LEU B C     1 
ATOM   9613  O  O     . LEU B 2 312  ? -18.213 79.601  -20.754 1.00 43.73  ? 336  LEU B O     1 
ATOM   9614  C  CB    . LEU B 2 312  ? -15.261 78.942  -21.979 1.00 44.85  ? 336  LEU B CB    1 
ATOM   9615  C  CG    . LEU B 2 312  ? -14.964 77.488  -22.343 1.00 46.97  ? 336  LEU B CG    1 
ATOM   9616  C  CD1   . LEU B 2 312  ? -14.926 77.325  -23.851 1.00 48.02  ? 336  LEU B CD1   1 
ATOM   9617  C  CD2   . LEU B 2 312  ? -13.654 77.042  -21.723 1.00 43.24  ? 336  LEU B CD2   1 
ATOM   9618  N  N     . SER B 2 313  ? -18.271 77.809  -22.099 1.00 60.13  ? 337  SER B N     1 
ATOM   9619  C  CA    . SER B 2 313  ? -19.437 77.246  -21.427 1.00 45.95  ? 337  SER B CA    1 
ATOM   9620  C  C     . SER B 2 313  ? -19.460 75.726  -21.453 1.00 43.59  ? 337  SER B C     1 
ATOM   9621  O  O     . SER B 2 313  ? -19.331 75.113  -22.511 1.00 48.96  ? 337  SER B O     1 
ATOM   9622  C  CB    . SER B 2 313  ? -20.721 77.783  -22.059 1.00 47.62  ? 337  SER B CB    1 
ATOM   9623  O  OG    . SER B 2 313  ? -21.858 77.132  -21.519 1.00 42.87  ? 337  SER B OG    1 
ATOM   9624  N  N     . VAL B 2 314  ? -19.632 75.121  -20.283 1.00 74.03  ? 338  VAL B N     1 
ATOM   9625  C  CA    . VAL B 2 314  ? -19.753 73.672  -20.196 1.00 76.85  ? 338  VAL B CA    1 
ATOM   9626  C  C     . VAL B 2 314  ? -20.997 73.280  -19.406 1.00 45.73  ? 338  VAL B C     1 
ATOM   9627  O  O     . VAL B 2 314  ? -21.167 73.678  -18.256 1.00 46.24  ? 338  VAL B O     1 
ATOM   9628  C  CB    . VAL B 2 314  ? -18.503 73.033  -19.557 1.00 85.50  ? 338  VAL B CB    1 
ATOM   9629  C  CG1   . VAL B 2 314  ? -18.002 73.870  -18.391 1.00 71.54  ? 338  VAL B CG1   1 
ATOM   9630  C  CG2   . VAL B 2 314  ? -18.795 71.602  -19.126 1.00 84.97  ? 338  VAL B CG2   1 
ATOM   9631  N  N     . ASN B 2 315  ? -21.870 72.504  -20.040 1.00 91.61  ? 339  ASN B N     1 
ATOM   9632  C  CA    . ASN B 2 315  ? -23.118 72.085  -19.418 1.00 72.14  ? 339  ASN B CA    1 
ATOM   9633  C  C     . ASN B 2 315  ? -23.234 70.567  -19.399 1.00 93.26  ? 339  ASN B C     1 
ATOM   9634  O  O     . ASN B 2 315  ? -23.169 69.921  -20.444 1.00 42.77  ? 339  ASN B O     1 
ATOM   9635  C  CB    . ASN B 2 315  ? -24.309 72.702  -20.155 1.00 76.27  ? 339  ASN B CB    1 
ATOM   9636  C  CG    . ASN B 2 315  ? -25.633 72.409  -19.477 1.00 56.90  ? 339  ASN B CG    1 
ATOM   9637  O  OD1   . ASN B 2 315  ? -26.084 73.166  -18.617 1.00 74.23  ? 339  ASN B OD1   1 
ATOM   9638  N  ND2   . ASN B 2 315  ? -26.268 71.308  -19.867 1.00 70.56  ? 339  ASN B ND2   1 
ATOM   9639  N  N     . GLY B 2 316  ? -23.405 69.999  -18.209 1.00 85.92  ? 340  GLY B N     1 
ATOM   9640  C  CA    . GLY B 2 316  ? -23.469 68.556  -18.065 1.00 43.15  ? 340  GLY B CA    1 
ATOM   9641  C  C     . GLY B 2 316  ? -24.777 68.032  -17.502 1.00 45.19  ? 340  GLY B C     1 
ATOM   9642  O  O     . GLY B 2 316  ? -25.162 68.366  -16.383 1.00 56.89  ? 340  GLY B O     1 
ATOM   9643  N  N     . ASP B 2 317  ? -25.460 67.205  -18.286 1.00 48.16  ? 341  ASP B N     1 
ATOM   9644  C  CA    . ASP B 2 317  ? -26.683 66.543  -17.845 1.00 46.64  ? 341  ASP B CA    1 
ATOM   9645  C  C     . ASP B 2 317  ? -26.357 65.469  -16.810 1.00 77.88  ? 341  ASP B C     1 
ATOM   9646  O  O     . ASP B 2 317  ? -25.787 64.430  -17.142 1.00 87.15  ? 341  ASP B O     1 
ATOM   9647  C  CB    . ASP B 2 317  ? -27.418 65.928  -19.041 1.00 42.62  ? 341  ASP B CB    1 
ATOM   9648  C  CG    . ASP B 2 317  ? -28.868 65.593  -18.734 1.00 67.15  ? 341  ASP B CG    1 
ATOM   9649  O  OD1   . ASP B 2 317  ? -29.726 65.831  -19.610 1.00 73.88  ? 341  ASP B OD1   1 
ATOM   9650  O  OD2   . ASP B 2 317  ? -29.153 65.091  -17.626 1.00 41.84  ? 341  ASP B OD2   1 
ATOM   9651  N  N     . LEU B 2 318  ? -26.726 65.721  -15.559 1.00 72.15  ? 342  LEU B N     1 
ATOM   9652  C  CA    . LEU B 2 318  ? -26.413 64.799  -14.473 1.00 68.52  ? 342  LEU B CA    1 
ATOM   9653  C  C     . LEU B 2 318  ? -27.459 63.700  -14.317 1.00 49.04  ? 342  LEU B C     1 
ATOM   9654  O  O     . LEU B 2 318  ? -27.230 62.719  -13.612 1.00 48.56  ? 342  LEU B O     1 
ATOM   9655  C  CB    . LEU B 2 318  ? -26.260 65.558  -13.154 1.00 86.11  ? 342  LEU B CB    1 
ATOM   9656  C  CG    . LEU B 2 318  ? -25.042 66.477  -13.053 1.00 77.68  ? 342  LEU B CG    1 
ATOM   9657  C  CD1   . LEU B 2 318  ? -24.854 66.961  -11.626 1.00 47.14  ? 342  LEU B CD1   1 
ATOM   9658  C  CD2   . LEU B 2 318  ? -23.789 65.774  -13.554 1.00 48.56  ? 342  LEU B CD2   1 
ATOM   9659  N  N     . ASP B 2 319  ? -28.608 63.864  -14.965 1.00 55.70  ? 343  ASP B N     1 
ATOM   9660  C  CA    . ASP B 2 319  ? -29.607 62.802  -14.984 1.00 66.29  ? 343  ASP B CA    1 
ATOM   9661  C  C     . ASP B 2 319  ? -29.150 61.699  -15.927 1.00 45.43  ? 343  ASP B C     1 
ATOM   9662  O  O     . ASP B 2 319  ? -29.104 60.525  -15.554 1.00 60.29  ? 343  ASP B O     1 
ATOM   9663  C  CB    . ASP B 2 319  ? -30.978 63.335  -15.405 1.00 56.60  ? 343  ASP B CB    1 
ATOM   9664  C  CG    . ASP B 2 319  ? -31.658 64.129  -14.306 1.00 56.32  ? 343  ASP B CG    1 
ATOM   9665  O  OD1   . ASP B 2 319  ? -31.186 64.074  -13.152 1.00 56.63  ? 343  ASP B OD1   1 
ATOM   9666  O  OD2   . ASP B 2 319  ? -32.671 64.799  -14.593 1.00 67.13  ? 343  ASP B OD2   1 
ATOM   9667  N  N     . ARG B 2 320  ? -28.800 62.088  -17.150 1.00 85.57  ? 344  ARG B N     1 
ATOM   9668  C  CA    . ARG B 2 320  ? -28.265 61.150  -18.128 1.00 77.76  ? 344  ARG B CA    1 
ATOM   9669  C  C     . ARG B 2 320  ? -26.942 60.567  -17.652 1.00 90.68  ? 344  ARG B C     1 
ATOM   9670  O  O     . ARG B 2 320  ? -26.570 59.462  -18.040 1.00 47.38  ? 344  ARG B O     1 
ATOM   9671  C  CB    . ARG B 2 320  ? -28.077 61.827  -19.487 1.00 76.31  ? 344  ARG B CB    1 
ATOM   9672  C  CG    . ARG B 2 320  ? -29.369 62.107  -20.231 1.00 81.97  ? 344  ARG B CG    1 
ATOM   9673  C  CD    . ARG B 2 320  ? -29.083 62.608  -21.637 1.00 90.06  ? 344  ARG B CD    1 
ATOM   9674  N  NE    . ARG B 2 320  ? -30.305 62.782  -22.416 1.00 43.68  ? 344  ARG B NE    1 
ATOM   9675  C  CZ    . ARG B 2 320  ? -30.330 63.173  -23.685 1.00 56.60  ? 344  ARG B CZ    1 
ATOM   9676  N  NH1   . ARG B 2 320  ? -29.197 63.432  -24.323 1.00 67.41  ? 344  ARG B NH1   1 
ATOM   9677  N  NH2   . ARG B 2 320  ? -31.488 63.305  -24.318 1.00 70.87  ? 344  ARG B NH2   1 
ATOM   9678  N  N     . GLY B 2 321  ? -26.231 61.320  -16.818 1.00 90.74  ? 345  GLY B N     1 
ATOM   9679  C  CA    . GLY B 2 321  ? -24.971 60.862  -16.264 1.00 86.66  ? 345  GLY B CA    1 
ATOM   9680  C  C     . GLY B 2 321  ? -25.188 59.852  -15.156 1.00 77.41  ? 345  GLY B C     1 
ATOM   9681  O  O     . GLY B 2 321  ? -24.462 58.862  -15.051 1.00 76.88  ? 345  GLY B O     1 
ATOM   9682  N  N     . MET B 2 322  ? -26.193 60.105  -14.326 1.00 74.50  ? 346  MET B N     1 
ATOM   9683  C  CA    . MET B 2 322  ? -26.543 59.183  -13.256 1.00 81.38  ? 346  MET B CA    1 
ATOM   9684  C  C     . MET B 2 322  ? -27.053 57.874  -13.851 1.00 43.29  ? 346  MET B C     1 
ATOM   9685  O  O     . MET B 2 322  ? -26.743 56.791  -13.353 1.00 56.58  ? 346  MET B O     1 
ATOM   9686  C  CB    . MET B 2 322  ? -27.585 59.809  -12.327 1.00 73.48  ? 346  MET B CB    1 
ATOM   9687  C  CG    . MET B 2 322  ? -27.884 58.997  -11.083 1.00 77.93  ? 346  MET B CG    1 
ATOM   9688  S  SD    . MET B 2 322  ? -29.244 57.840  -11.314 1.00 70.48  ? 346  MET B SD    1 
ATOM   9689  C  CE    . MET B 2 322  ? -30.614 58.975  -11.510 1.00 56.75  ? 346  MET B CE    1 
ATOM   9690  N  N     . LEU B 2 323  ? -27.827 57.983  -14.927 1.00 44.78  ? 347  LEU B N     1 
ATOM   9691  C  CA    . LEU B 2 323  ? -28.285 56.806  -15.658 1.00 42.77  ? 347  LEU B CA    1 
ATOM   9692  C  C     . LEU B 2 323  ? -27.115 56.112  -16.346 1.00 44.72  ? 347  LEU B C     1 
ATOM   9693  O  O     . LEU B 2 323  ? -27.099 54.888  -16.480 1.00 47.35  ? 347  LEU B O     1 
ATOM   9694  C  CB    . LEU B 2 323  ? -29.351 57.185  -16.689 1.00 43.56  ? 347  LEU B CB    1 
ATOM   9695  C  CG    . LEU B 2 323  ? -30.814 57.072  -16.255 1.00 55.89  ? 347  LEU B CG    1 
ATOM   9696  C  CD1   . LEU B 2 323  ? -31.161 55.631  -15.919 1.00 46.12  ? 347  LEU B CD1   1 
ATOM   9697  C  CD2   . LEU B 2 323  ? -31.107 57.984  -15.074 1.00 66.81  ? 347  LEU B CD2   1 
ATOM   9698  N  N     . ALA B 2 324  ? -26.138 56.902  -16.778 1.00 69.98  ? 348  ALA B N     1 
ATOM   9699  C  CA    . ALA B 2 324  ? -24.952 56.369  -17.438 1.00 85.76  ? 348  ALA B CA    1 
ATOM   9700  C  C     . ALA B 2 324  ? -24.149 55.505  -16.478 1.00 74.48  ? 348  ALA B C     1 
ATOM   9701  O  O     . ALA B 2 324  ? -23.719 54.407  -16.827 1.00 70.85  ? 348  ALA B O     1 
ATOM   9702  C  CB    . ALA B 2 324  ? -24.089 57.497  -17.985 1.00 75.00  ? 348  ALA B CB    1 
ATOM   9703  N  N     . TYR B 2 325  ? -23.952 56.007  -15.264 1.00 75.30  ? 349  TYR B N     1 
ATOM   9704  C  CA    . TYR B 2 325  ? -23.229 55.261  -14.243 1.00 84.07  ? 349  TYR B CA    1 
ATOM   9705  C  C     . TYR B 2 325  ? -24.063 54.085  -13.756 1.00 92.22  ? 349  TYR B C     1 
ATOM   9706  O  O     . TYR B 2 325  ? -23.528 53.053  -13.350 1.00 93.39  ? 349  TYR B O     1 
ATOM   9707  C  CB    . TYR B 2 325  ? -22.850 56.172  -13.074 1.00 84.36  ? 349  TYR B CB    1 
ATOM   9708  C  CG    . TYR B 2 325  ? -21.699 57.104  -13.379 1.00 81.32  ? 349  TYR B CG    1 
ATOM   9709  C  CD1   . TYR B 2 325  ? -20.815 56.830  -14.413 1.00 74.92  ? 349  TYR B CD1   1 
ATOM   9710  C  CD2   . TYR B 2 325  ? -21.495 58.254  -12.632 1.00 90.65  ? 349  TYR B CD2   1 
ATOM   9711  C  CE1   . TYR B 2 325  ? -19.762 57.676  -14.694 1.00 75.46  ? 349  TYR B CE1   1 
ATOM   9712  C  CE2   . TYR B 2 325  ? -20.443 59.105  -12.907 1.00 90.90  ? 349  TYR B CE2   1 
ATOM   9713  C  CZ    . TYR B 2 325  ? -19.580 58.812  -13.939 1.00 44.58  ? 349  TYR B CZ    1 
ATOM   9714  O  OH    . TYR B 2 325  ? -18.531 59.656  -14.217 1.00 56.12  ? 349  TYR B OH    1 
ATOM   9715  N  N     . LEU B 2 326  ? -25.380 54.250  -13.806 1.00 46.17  ? 350  LEU B N     1 
ATOM   9716  C  CA    . LEU B 2 326  ? -26.297 53.187  -13.422 1.00 76.78  ? 350  LEU B CA    1 
ATOM   9717  C  C     . LEU B 2 326  ? -26.166 51.999  -14.371 1.00 87.99  ? 350  LEU B C     1 
ATOM   9718  O  O     . LEU B 2 326  ? -26.126 50.848  -13.938 1.00 46.18  ? 350  LEU B O     1 
ATOM   9719  C  CB    . LEU B 2 326  ? -27.735 53.705  -13.406 1.00 68.79  ? 350  LEU B CB    1 
ATOM   9720  C  CG    . LEU B 2 326  ? -28.730 52.910  -12.566 1.00 48.56  ? 350  LEU B CG    1 
ATOM   9721  C  CD1   . LEU B 2 326  ? -28.226 52.789  -11.140 1.00 93.80  ? 350  LEU B CD1   1 
ATOM   9722  C  CD2   . LEU B 2 326  ? -30.094 53.578  -12.600 1.00 67.68  ? 350  LEU B CD2   1 
ATOM   9723  N  N     . TYR B 2 327  ? -26.096 52.286  -15.667 1.00 87.95  ? 351  TYR B N     1 
ATOM   9724  C  CA    . TYR B 2 327  ? -25.905 51.242  -16.668 1.00 48.08  ? 351  TYR B CA    1 
ATOM   9725  C  C     . TYR B 2 327  ? -24.490 50.677  -16.612 1.00 45.23  ? 351  TYR B C     1 
ATOM   9726  O  O     . TYR B 2 327  ? -24.283 49.477  -16.786 1.00 48.90  ? 351  TYR B O     1 
ATOM   9727  C  CB    . TYR B 2 327  ? -26.196 51.780  -18.071 1.00 49.09  ? 351  TYR B CB    1 
ATOM   9728  C  CG    . TYR B 2 327  ? -27.647 51.682  -18.479 1.00 49.06  ? 351  TYR B CG    1 
ATOM   9729  C  CD1   . TYR B 2 327  ? -28.562 52.656  -18.105 1.00 56.44  ? 351  TYR B CD1   1 
ATOM   9730  C  CD2   . TYR B 2 327  ? -28.101 50.615  -19.243 1.00 87.39  ? 351  TYR B CD2   1 
ATOM   9731  C  CE1   . TYR B 2 327  ? -29.889 52.569  -18.477 1.00 67.20  ? 351  TYR B CE1   1 
ATOM   9732  C  CE2   . TYR B 2 327  ? -29.425 50.521  -19.621 1.00 91.69  ? 351  TYR B CE2   1 
ATOM   9733  C  CZ    . TYR B 2 327  ? -30.315 51.500  -19.235 1.00 47.32  ? 351  TYR B CZ    1 
ATOM   9734  O  OH    . TYR B 2 327  ? -31.636 51.409  -19.609 1.00 65.23  ? 351  TYR B OH    1 
ATOM   9735  N  N     . ASP B 2 328  ? -23.521 51.553  -16.366 1.00 56.68  ? 352  ASP B N     1 
ATOM   9736  C  CA    . ASP B 2 328  ? -22.116 51.165  -16.350 1.00 64.83  ? 352  ASP B CA    1 
ATOM   9737  C  C     . ASP B 2 328  ? -21.792 50.251  -15.172 1.00 45.85  ? 352  ASP B C     1 
ATOM   9738  O  O     . ASP B 2 328  ? -20.898 49.409  -15.257 1.00 44.44  ? 352  ASP B O     1 
ATOM   9739  C  CB    . ASP B 2 328  ? -21.226 52.411  -16.308 1.00 66.26  ? 352  ASP B CB    1 
ATOM   9740  C  CG    . ASP B 2 328  ? -19.749 52.076  -16.341 1.00 69.84  ? 352  ASP B CG    1 
ATOM   9741  O  OD1   . ASP B 2 328  ? -19.195 51.933  -17.452 1.00 60.92  ? 352  ASP B OD1   1 
ATOM   9742  O  OD2   . ASP B 2 328  ? -19.140 51.961  -15.257 1.00 47.09  ? 352  ASP B OD2   1 
ATOM   9743  N  N     . SER B 2 329  ? -22.526 50.420  -14.076 1.00 84.56  ? 353  SER B N     1 
ATOM   9744  C  CA    . SER B 2 329  ? -22.299 49.636  -12.866 1.00 69.47  ? 353  SER B CA    1 
ATOM   9745  C  C     . SER B 2 329  ? -22.637 48.162  -13.055 1.00 41.40  ? 353  SER B C     1 
ATOM   9746  O  O     . SER B 2 329  ? -21.998 47.290  -12.467 1.00 45.44  ? 353  SER B O     1 
ATOM   9747  C  CB    . SER B 2 329  ? -23.119 50.203  -11.708 1.00 46.96  ? 353  SER B CB    1 
ATOM   9748  O  OG    . SER B 2 329  ? -24.501 50.201  -12.019 1.00 46.36  ? 353  SER B OG    1 
ATOM   9749  N  N     . PHE B 2 330  ? -23.646 47.890  -13.874 1.00 66.23  ? 354  PHE B N     1 
ATOM   9750  C  CA    . PHE B 2 330  ? -24.107 46.525  -14.088 1.00 56.64  ? 354  PHE B CA    1 
ATOM   9751  C  C     . PHE B 2 330  ? -23.257 45.806  -15.133 1.00 71.10  ? 354  PHE B C     1 
ATOM   9752  O  O     . PHE B 2 330  ? -22.725 46.431  -16.050 1.00 69.97  ? 354  PHE B O     1 
ATOM   9753  C  CB    . PHE B 2 330  ? -25.579 46.522  -14.509 1.00 67.97  ? 354  PHE B CB    1 
ATOM   9754  C  CG    . PHE B 2 330  ? -26.209 45.160  -14.495 1.00 72.12  ? 354  PHE B CG    1 
ATOM   9755  C  CD1   . PHE B 2 330  ? -26.648 44.600  -13.307 1.00 67.26  ? 354  PHE B CD1   1 
ATOM   9756  C  CD2   . PHE B 2 330  ? -26.363 44.442  -15.668 1.00 68.80  ? 354  PHE B CD2   1 
ATOM   9757  C  CE1   . PHE B 2 330  ? -27.227 43.347  -13.289 1.00 60.37  ? 354  PHE B CE1   1 
ATOM   9758  C  CE2   . PHE B 2 330  ? -26.941 43.188  -15.657 1.00 74.32  ? 354  PHE B CE2   1 
ATOM   9759  C  CZ    . PHE B 2 330  ? -27.374 42.640  -14.466 1.00 71.36  ? 354  PHE B CZ    1 
ATOM   9760  N  N     . GLN B 2 331  ? -23.132 44.491  -14.986 1.00 69.50  ? 355  GLN B N     1 
ATOM   9761  C  CA    . GLN B 2 331  ? -22.350 43.687  -15.919 1.00 77.48  ? 355  GLN B CA    1 
ATOM   9762  C  C     . GLN B 2 331  ? -23.045 43.581  -17.273 1.00 71.07  ? 355  GLN B C     1 
ATOM   9763  O  O     . GLN B 2 331  ? -22.404 43.325  -18.293 1.00 74.62  ? 355  GLN B O     1 
ATOM   9764  C  CB    . GLN B 2 331  ? -22.100 42.290  -15.345 1.00 90.08  ? 355  GLN B CB    1 
ATOM   9765  C  CG    . GLN B 2 331  ? -21.306 42.281  -14.045 1.00 81.00  ? 355  GLN B CG    1 
ATOM   9766  C  CD    . GLN B 2 331  ? -19.868 42.728  -14.231 1.00 91.18  ? 355  GLN B CD    1 
ATOM   9767  O  OE1   . GLN B 2 331  ? -19.315 42.643  -15.327 1.00 86.34  ? 355  GLN B OE1   1 
ATOM   9768  N  NE2   . GLN B 2 331  ? -19.254 43.209  -13.155 1.00 90.21  ? 355  GLN B NE2   1 
ATOM   9769  N  N     . THR B 2 338  ? -18.590 39.492  -20.602 1.00 72.19  ? 362  THR B N     1 
ATOM   9770  C  CA    . THR B 2 338  ? -19.889 38.911  -20.282 1.00 70.55  ? 362  THR B CA    1 
ATOM   9771  C  C     . THR B 2 338  ? -20.088 37.567  -20.982 1.00 74.98  ? 362  THR B C     1 
ATOM   9772  O  O     . THR B 2 338  ? -21.117 37.326  -21.614 1.00 70.95  ? 362  THR B O     1 
ATOM   9773  C  CB    . THR B 2 338  ? -21.040 39.866  -20.664 1.00 77.01  ? 362  THR B CB    1 
ATOM   9774  O  OG1   . THR B 2 338  ? -22.282 39.150  -20.652 1.00 69.19  ? 362  THR B OG1   1 
ATOM   9775  C  CG2   . THR B 2 338  ? -20.813 40.460  -22.048 1.00 70.88  ? 362  THR B CG2   1 
ATOM   9776  N  N     . ARG B 2 339  ? -19.096 36.692  -20.850 1.00 77.24  ? 363  ARG B N     1 
ATOM   9777  C  CA    . ARG B 2 339  ? -19.142 35.366  -21.456 1.00 68.67  ? 363  ARG B CA    1 
ATOM   9778  C  C     . ARG B 2 339  ? -18.181 34.432  -20.718 1.00 77.27  ? 363  ARG B C     1 
ATOM   9779  O  O     . ARG B 2 339  ? -17.225 34.891  -20.092 1.00 68.89  ? 363  ARG B O     1 
ATOM   9780  C  CB    . ARG B 2 339  ? -18.804 35.454  -22.952 1.00 71.98  ? 363  ARG B CB    1 
ATOM   9781  C  CG    . ARG B 2 339  ? -18.840 34.139  -23.732 1.00 68.64  ? 363  ARG B CG    1 
ATOM   9782  C  CD    . ARG B 2 339  ? -20.113 33.333  -23.486 1.00 70.60  ? 363  ARG B CD    1 
ATOM   9783  N  NE    . ARG B 2 339  ? -21.332 34.113  -23.672 1.00 69.63  ? 363  ARG B NE    1 
ATOM   9784  C  CZ    . ARG B 2 339  ? -22.310 34.187  -22.774 1.00 74.14  ? 363  ARG B CZ    1 
ATOM   9785  N  NH1   . ARG B 2 339  ? -22.210 33.527  -21.628 1.00 71.97  ? 363  ARG B NH1   1 
ATOM   9786  N  NH2   . ARG B 2 339  ? -23.388 34.918  -23.021 1.00 72.90  ? 363  ARG B NH2   1 
ATOM   9787  N  N     . LYS B 2 340  ? -18.465 33.131  -20.786 1.00 68.60  ? 364  LYS B N     1 
ATOM   9788  C  CA    . LYS B 2 340  ? -17.702 32.054  -20.137 1.00 77.09  ? 364  LYS B CA    1 
ATOM   9789  C  C     . LYS B 2 340  ? -17.276 32.356  -18.696 1.00 76.85  ? 364  LYS B C     1 
ATOM   9790  O  O     . LYS B 2 340  ? -16.264 31.846  -18.216 1.00 70.85  ? 364  LYS B O     1 
ATOM   9791  C  CB    . LYS B 2 340  ? -16.475 31.670  -20.991 1.00 76.79  ? 364  LYS B CB    1 
ATOM   9792  C  CG    . LYS B 2 340  ? -15.404 32.741  -21.218 1.00 74.22  ? 364  LYS B CG    1 
ATOM   9793  C  CD    . LYS B 2 340  ? -14.192 32.523  -20.327 1.00 70.65  ? 364  LYS B CD    1 
ATOM   9794  C  CE    . LYS B 2 340  ? -13.735 31.075  -20.375 1.00 69.30  ? 364  LYS B CE    1 
ATOM   9795  N  NZ    . LYS B 2 340  ? -13.229 30.618  -19.053 1.00 76.64  ? 364  LYS B NZ    1 
ATOM   9796  N  N     . LYS B 2 341  ? -18.074 33.155  -17.995 1.00 72.11  ? 365  LYS B N     1 
ATOM   9797  C  CA    . LYS B 2 341  ? -17.826 33.431  -16.585 1.00 72.97  ? 365  LYS B CA    1 
ATOM   9798  C  C     . LYS B 2 341  ? -18.231 32.228  -15.735 1.00 76.53  ? 365  LYS B C     1 
ATOM   9799  O  O     . LYS B 2 341  ? -17.842 32.119  -14.572 1.00 93.07  ? 365  LYS B O     1 
ATOM   9800  C  CB    . LYS B 2 341  ? -18.582 34.685  -16.131 1.00 90.16  ? 365  LYS B CB    1 
ATOM   9801  C  CG    . LYS B 2 341  ? -20.035 34.447  -15.721 1.00 93.73  ? 365  LYS B CG    1 
ATOM   9802  C  CD    . LYS B 2 341  ? -20.932 34.071  -16.898 1.00 92.57  ? 365  LYS B CD    1 
ATOM   9803  C  CE    . LYS B 2 341  ? -21.515 35.296  -17.589 1.00 86.92  ? 365  LYS B CE    1 
ATOM   9804  N  NZ    . LYS B 2 341  ? -20.484 36.138  -18.253 1.00 85.98  ? 365  LYS B NZ    1 
ATOM   9805  N  N     . ASN B 2 342  ? -19.033 31.347  -16.332 1.00 77.84  ? 366  ASN B N     1 
ATOM   9806  C  CA    . ASN B 2 342  ? -19.468 30.084  -15.726 1.00 73.70  ? 366  ASN B CA    1 
ATOM   9807  C  C     . ASN B 2 342  ? -20.359 30.227  -14.487 1.00 69.99  ? 366  ASN B C     1 
ATOM   9808  O  O     . ASN B 2 342  ? -20.980 29.255  -14.056 1.00 90.41  ? 366  ASN B O     1 
ATOM   9809  C  CB    . ASN B 2 342  ? -18.250 29.221  -15.376 1.00 73.56  ? 366  ASN B CB    1 
ATOM   9810  C  CG    . ASN B 2 342  ? -17.478 28.779  -16.605 1.00 71.95  ? 366  ASN B CG    1 
ATOM   9811  O  OD1   . ASN B 2 342  ? -17.641 29.338  -17.690 1.00 73.14  ? 366  ASN B OD1   1 
ATOM   9812  N  ND2   . ASN B 2 342  ? -16.629 27.772  -16.439 1.00 77.57  ? 366  ASN B ND2   1 
ATOM   9813  N  N     . LEU B 2 343  ? -20.429 31.429  -13.923 1.00 90.16  ? 367  LEU B N     1 
ATOM   9814  C  CA    . LEU B 2 343  ? -21.262 31.676  -12.749 1.00 68.47  ? 367  LEU B CA    1 
ATOM   9815  C  C     . LEU B 2 343  ? -21.552 33.167  -12.602 1.00 71.43  ? 367  LEU B C     1 
ATOM   9816  O  O     . LEU B 2 343  ? -20.633 33.985  -12.566 1.00 69.04  ? 367  LEU B O     1 
ATOM   9817  C  CB    . LEU B 2 343  ? -20.586 31.140  -11.486 1.00 73.82  ? 367  LEU B CB    1 
ATOM   9818  C  CG    . LEU B 2 343  ? -21.517 30.585  -10.407 1.00 71.50  ? 367  LEU B CG    1 
ATOM   9819  C  CD1   . LEU B 2 343  ? -22.240 29.342  -10.910 1.00 73.39  ? 367  LEU B CD1   1 
ATOM   9820  C  CD2   . LEU B 2 343  ? -20.745 30.282  -9.133  1.00 70.54  ? 367  LEU B CD2   1 
ATOM   9821  N  N     . HIS B 2 344  ? -22.832 33.517  -12.512 1.00 70.24  ? 368  HIS B N     1 
ATOM   9822  C  CA    . HIS B 2 344  ? -23.234 34.919  -12.499 1.00 74.97  ? 368  HIS B CA    1 
ATOM   9823  C  C     . HIS B 2 344  ? -24.028 35.303  -11.252 1.00 81.18  ? 368  HIS B C     1 
ATOM   9824  O  O     . HIS B 2 344  ? -24.853 34.531  -10.762 1.00 86.59  ? 368  HIS B O     1 
ATOM   9825  C  CB    . HIS B 2 344  ? -24.057 35.240  -13.748 1.00 73.24  ? 368  HIS B CB    1 
ATOM   9826  C  CG    . HIS B 2 344  ? -23.540 36.408  -14.529 1.00 76.54  ? 368  HIS B CG    1 
ATOM   9827  N  ND1   . HIS B 2 344  ? -22.446 37.143  -14.131 1.00 74.01  ? 368  HIS B ND1   1 
ATOM   9828  C  CD2   . HIS B 2 344  ? -23.968 36.964  -15.688 1.00 70.45  ? 368  HIS B CD2   1 
ATOM   9829  C  CE1   . HIS B 2 344  ? -22.221 38.105  -15.010 1.00 73.86  ? 368  HIS B CE1   1 
ATOM   9830  N  NE2   . HIS B 2 344  ? -23.130 38.018  -15.963 1.00 69.59  ? 368  HIS B NE2   1 
ATOM   9831  N  N     . ARG B 2 345  ? -23.766 36.505  -10.748 1.00 84.56  ? 369  ARG B N     1 
ATOM   9832  C  CA    . ARG B 2 345  ? -24.520 37.064  -9.632  1.00 75.44  ? 369  ARG B CA    1 
ATOM   9833  C  C     . ARG B 2 345  ? -24.955 38.488  -9.960  1.00 75.53  ? 369  ARG B C     1 
ATOM   9834  O  O     . ARG B 2 345  ? -24.177 39.275  -10.500 1.00 74.05  ? 369  ARG B O     1 
ATOM   9835  C  CB    . ARG B 2 345  ? -23.690 37.041  -8.345  1.00 75.07  ? 369  ARG B CB    1 
ATOM   9836  C  CG    . ARG B 2 345  ? -22.309 37.666  -8.477  1.00 70.81  ? 369  ARG B CG    1 
ATOM   9837  C  CD    . ARG B 2 345  ? -21.549 37.614  -7.160  1.00 71.99  ? 369  ARG B CD    1 
ATOM   9838  N  NE    . ARG B 2 345  ? -21.915 38.701  -6.258  1.00 72.08  ? 369  ARG B NE    1 
ATOM   9839  C  CZ    . ARG B 2 345  ? -21.207 39.816  -6.106  1.00 77.20  ? 369  ARG B CZ    1 
ATOM   9840  N  NH1   . ARG B 2 345  ? -20.089 39.994  -6.797  1.00 49.41  ? 369  ARG B NH1   1 
ATOM   9841  N  NH2   . ARG B 2 345  ? -21.615 40.754  -5.262  1.00 71.34  ? 369  ARG B NH2   1 
ATOM   9842  N  N     . LYS B 2 346  ? -26.202 38.815  -9.638  1.00 69.92  ? 370  LYS B N     1 
ATOM   9843  C  CA    . LYS B 2 346  ? -26.736 40.139  -9.934  1.00 74.17  ? 370  LYS B CA    1 
ATOM   9844  C  C     . LYS B 2 346  ? -26.210 41.190  -8.962  1.00 56.58  ? 370  LYS B C     1 
ATOM   9845  O  O     . LYS B 2 346  ? -26.574 41.208  -7.785  1.00 55.71  ? 370  LYS B O     1 
ATOM   9846  C  CB    . LYS B 2 346  ? -28.266 40.119  -9.914  1.00 69.35  ? 370  LYS B CB    1 
ATOM   9847  C  CG    . LYS B 2 346  ? -28.875 39.295  -8.792  1.00 76.48  ? 370  LYS B CG    1 
ATOM   9848  C  CD    . LYS B 2 346  ? -30.379 39.498  -8.725  1.00 70.19  ? 370  LYS B CD    1 
ATOM   9849  C  CE    . LYS B 2 346  ? -31.030 39.258  -10.078 1.00 71.83  ? 370  LYS B CE    1 
ATOM   9850  N  NZ    . LYS B 2 346  ? -32.485 39.572  -10.057 1.00 72.83  ? 370  LYS B NZ    1 
ATOM   9851  N  N     . VAL B 2 347  ? -25.346 42.064  -9.467  1.00 44.16  ? 371  VAL B N     1 
ATOM   9852  C  CA    . VAL B 2 347  ? -24.772 43.134  -8.663  1.00 93.16  ? 371  VAL B CA    1 
ATOM   9853  C  C     . VAL B 2 347  ? -24.291 44.275  -9.555  1.00 44.07  ? 371  VAL B C     1 
ATOM   9854  O  O     . VAL B 2 347  ? -23.609 44.049  -10.555 1.00 45.28  ? 371  VAL B O     1 
ATOM   9855  C  CB    . VAL B 2 347  ? -23.599 42.623  -7.793  1.00 44.41  ? 371  VAL B CB    1 
ATOM   9856  C  CG1   . VAL B 2 347  ? -22.622 41.806  -8.628  1.00 64.93  ? 371  VAL B CG1   1 
ATOM   9857  C  CG2   . VAL B 2 347  ? -22.890 43.782  -7.102  1.00 76.83  ? 371  VAL B CG2   1 
ATOM   9858  N  N     . LEU B 2 348  ? -24.667 45.499  -9.200  1.00 42.71  ? 372  LEU B N     1 
ATOM   9859  C  CA    . LEU B 2 348  ? -24.177 46.677  -9.904  1.00 69.86  ? 372  LEU B CA    1 
ATOM   9860  C  C     . LEU B 2 348  ? -23.007 47.291  -9.141  1.00 49.80  ? 372  LEU B C     1 
ATOM   9861  O  O     . LEU B 2 348  ? -23.081 47.502  -7.931  1.00 45.27  ? 372  LEU B O     1 
ATOM   9862  C  CB    . LEU B 2 348  ? -25.297 47.703  -10.104 1.00 56.67  ? 372  LEU B CB    1 
ATOM   9863  C  CG    . LEU B 2 348  ? -26.575 47.571  -9.272  1.00 68.47  ? 372  LEU B CG    1 
ATOM   9864  C  CD1   . LEU B 2 348  ? -26.330 47.944  -7.821  1.00 56.37  ? 372  LEU B CD1   1 
ATOM   9865  C  CD2   . LEU B 2 348  ? -27.687 48.423  -9.864  1.00 65.39  ? 372  LEU B CD2   1 
ATOM   9866  N  N     . LYS B 2 349  ? -21.924 47.567  -9.859  1.00 48.04  ? 373  LYS B N     1 
ATOM   9867  C  CA    . LYS B 2 349  ? -20.701 48.063  -9.241  1.00 66.34  ? 373  LYS B CA    1 
ATOM   9868  C  C     . LYS B 2 349  ? -20.525 49.567  -9.430  1.00 64.63  ? 373  LYS B C     1 
ATOM   9869  O  O     . LYS B 2 349  ? -19.839 50.008  -10.353 1.00 73.34  ? 373  LYS B O     1 
ATOM   9870  C  CB    . LYS B 2 349  ? -19.485 47.327  -9.808  1.00 74.09  ? 373  LYS B CB    1 
ATOM   9871  C  CG    . LYS B 2 349  ? -19.480 45.827  -9.559  1.00 70.27  ? 373  LYS B CG    1 
ATOM   9872  C  CD    . LYS B 2 349  ? -18.304 45.164  -10.263 1.00 69.02  ? 373  LYS B CD    1 
ATOM   9873  C  CE    . LYS B 2 349  ? -18.237 43.676  -9.960  1.00 68.61  ? 373  LYS B CE    1 
ATOM   9874  N  NZ    . LYS B 2 349  ? -17.954 43.408  -8.523  1.00 75.59  ? 373  LYS B NZ    1 
ATOM   9875  N  N     . LEU B 2 350  ? -21.146 50.351  -8.554  1.00 56.64  ? 374  LEU B N     1 
ATOM   9876  C  CA    . LEU B 2 350  ? -20.973 51.799  -8.570  1.00 47.29  ? 374  LEU B CA    1 
ATOM   9877  C  C     . LEU B 2 350  ? -19.729 52.190  -7.782  1.00 43.40  ? 374  LEU B C     1 
ATOM   9878  O  O     . LEU B 2 350  ? -19.333 51.492  -6.848  1.00 86.51  ? 374  LEU B O     1 
ATOM   9879  C  CB    . LEU B 2 350  ? -22.204 52.502  -7.995  1.00 87.36  ? 374  LEU B CB    1 
ATOM   9880  C  CG    . LEU B 2 350  ? -23.460 52.553  -8.868  1.00 69.71  ? 374  LEU B CG    1 
ATOM   9881  C  CD1   . LEU B 2 350  ? -24.654 53.024  -8.056  1.00 92.73  ? 374  LEU B CD1   1 
ATOM   9882  C  CD2   . LEU B 2 350  ? -23.239 53.463  -10.066 1.00 68.52  ? 374  LEU B CD2   1 
ATOM   9883  N  N     . HIS B 2 351  ? -19.116 53.305  -8.167  1.00 43.75  ? 375  HIS B N     1 
ATOM   9884  C  CA    . HIS B 2 351  ? -17.936 53.809  -7.473  1.00 47.13  ? 375  HIS B CA    1 
ATOM   9885  C  C     . HIS B 2 351  ? -18.284 54.148  -6.026  1.00 46.63  ? 375  HIS B C     1 
ATOM   9886  O  O     . HIS B 2 351  ? -19.322 54.755  -5.763  1.00 65.59  ? 375  HIS B O     1 
ATOM   9887  C  CB    . HIS B 2 351  ? -17.373 55.037  -8.193  1.00 93.42  ? 375  HIS B CB    1 
ATOM   9888  C  CG