data_4ZZ7
# 
_entry.id   4ZZ7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ZZ7         
WWPDB D_1000210106 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4ZZ7 
_pdbx_database_status.recvd_initial_deposition_date   2015-05-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Do, H.'     1 
'Lee, C.W.'  2 
'Lee, S.G.'  3 
'Kang, H.'   4 
'Park, C.M.' 5 
'Kim, H.J.'  6 
'Park, H.'   7 
'Park, H.'   8 
'Lee, J.H.'  9 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Microbiol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1976-3794 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            54 
_citation.language                  ? 
_citation.page_first                114 
_citation.page_last                 121 
_citation.title                     
;Crystal structure and modeling of the tetrahedral intermediate state of methylmalonate-semialdehyde dehydrogenase (MMSDH) from Oceanimonas doudoroffii.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1007/s12275-016-5549-2 
_citation.pdbx_database_id_PubMed   26832667 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Do, H.'     1 
primary 'Lee, C.W.'  2 
primary 'Lee, S.G.'  3 
primary 'Kang, H.'   4 
primary 'Park, C.M.' 5 
primary 'Kim, H.J.'  6 
primary 'Park, H.'   7 
primary 'Park, H.'   8 
primary 'Lee, J.H.'  9 
# 
_cell.entry_id           4ZZ7 
_cell.length_a           156.700 
_cell.length_b           160.300 
_cell.length_c           238.920 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4ZZ7 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Methylmalonate-semialdehyde dehydrogenase' 54374.512 12  ? ? ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE           663.425   6   ? ? ? ? 
3 water       nat water                                       18.015    709 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMTTIGHLINGQLVTENTRSQNVFNPATGEIGKQLDLASTKTVEQAISAAQHAFPTWRNTPPLKRARVMFRFKELLEQ
HADEICRLIGEEHGKIAHDAMGELQRGIENVEYACGAPELLKGEHSRNVGPGIDSWSEFQPMGVVAGITPFNFPVMVPLW
MFPMAIVCGNCFVLKPSERDPSSTLYIAQLLQEAGLPDGVMNVVNGDKEAVDALLHDDRVKAVSFVGSTPIAEYIYRTAS
ANGKRCQALGGAKNHAIVMPDADMDNAVNQLLGAAFGSSGERCMALSVAVAVGDAAGDALVSKMTQAMQKLKVGPSTDSG
NDFGPVITRQHQEKVIGYINSAEQQGATIVVDGRQPKVPNHENGFFVGGTLIDHVTPEMTSYQEEIFGPVLQVVRVATMQ
DAMDLIDAHEYGNGTCIFTRDGEAARYFSDNIQVGMVGINIPLPVPVAYHSFGGWKRSLFGDLHAYGPDAVRFYTKRKTV
TQRWPSAGVREGAEFSMPTMK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMTTIGHLINGQLVTENTRSQNVFNPATGEIGKQLDLASTKTVEQAISAAQHAFPTWRNTPPLKRARVMFRFKELLEQ
HADEICRLIGEEHGKIAHDAMGELQRGIENVEYACGAPELLKGEHSRNVGPGIDSWSEFQPMGVVAGITPFNFPVMVPLW
MFPMAIVCGNCFVLKPSERDPSSTLYIAQLLQEAGLPDGVMNVVNGDKEAVDALLHDDRVKAVSFVGSTPIAEYIYRTAS
ANGKRCQALGGAKNHAIVMPDADMDNAVNQLLGAAFGSSGERCMALSVAVAVGDAAGDALVSKMTQAMQKLKVGPSTDSG
NDFGPVITRQHQEKVIGYINSAEQQGATIVVDGRQPKVPNHENGFFVGGTLIDHVTPEMTSYQEEIFGPVLQVVRVATMQ
DAMDLIDAHEYGNGTCIFTRDGEAARYFSDNIQVGMVGINIPLPVPVAYHSFGGWKRSLFGDLHAYGPDAVRFYTKRKTV
TQRWPSAGVREGAEFSMPTMK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   THR n 
1 6   THR n 
1 7   ILE n 
1 8   GLY n 
1 9   HIS n 
1 10  LEU n 
1 11  ILE n 
1 12  ASN n 
1 13  GLY n 
1 14  GLN n 
1 15  LEU n 
1 16  VAL n 
1 17  THR n 
1 18  GLU n 
1 19  ASN n 
1 20  THR n 
1 21  ARG n 
1 22  SER n 
1 23  GLN n 
1 24  ASN n 
1 25  VAL n 
1 26  PHE n 
1 27  ASN n 
1 28  PRO n 
1 29  ALA n 
1 30  THR n 
1 31  GLY n 
1 32  GLU n 
1 33  ILE n 
1 34  GLY n 
1 35  LYS n 
1 36  GLN n 
1 37  LEU n 
1 38  ASP n 
1 39  LEU n 
1 40  ALA n 
1 41  SER n 
1 42  THR n 
1 43  LYS n 
1 44  THR n 
1 45  VAL n 
1 46  GLU n 
1 47  GLN n 
1 48  ALA n 
1 49  ILE n 
1 50  SER n 
1 51  ALA n 
1 52  ALA n 
1 53  GLN n 
1 54  HIS n 
1 55  ALA n 
1 56  PHE n 
1 57  PRO n 
1 58  THR n 
1 59  TRP n 
1 60  ARG n 
1 61  ASN n 
1 62  THR n 
1 63  PRO n 
1 64  PRO n 
1 65  LEU n 
1 66  LYS n 
1 67  ARG n 
1 68  ALA n 
1 69  ARG n 
1 70  VAL n 
1 71  MET n 
1 72  PHE n 
1 73  ARG n 
1 74  PHE n 
1 75  LYS n 
1 76  GLU n 
1 77  LEU n 
1 78  LEU n 
1 79  GLU n 
1 80  GLN n 
1 81  HIS n 
1 82  ALA n 
1 83  ASP n 
1 84  GLU n 
1 85  ILE n 
1 86  CYS n 
1 87  ARG n 
1 88  LEU n 
1 89  ILE n 
1 90  GLY n 
1 91  GLU n 
1 92  GLU n 
1 93  HIS n 
1 94  GLY n 
1 95  LYS n 
1 96  ILE n 
1 97  ALA n 
1 98  HIS n 
1 99  ASP n 
1 100 ALA n 
1 101 MET n 
1 102 GLY n 
1 103 GLU n 
1 104 LEU n 
1 105 GLN n 
1 106 ARG n 
1 107 GLY n 
1 108 ILE n 
1 109 GLU n 
1 110 ASN n 
1 111 VAL n 
1 112 GLU n 
1 113 TYR n 
1 114 ALA n 
1 115 CYS n 
1 116 GLY n 
1 117 ALA n 
1 118 PRO n 
1 119 GLU n 
1 120 LEU n 
1 121 LEU n 
1 122 LYS n 
1 123 GLY n 
1 124 GLU n 
1 125 HIS n 
1 126 SER n 
1 127 ARG n 
1 128 ASN n 
1 129 VAL n 
1 130 GLY n 
1 131 PRO n 
1 132 GLY n 
1 133 ILE n 
1 134 ASP n 
1 135 SER n 
1 136 TRP n 
1 137 SER n 
1 138 GLU n 
1 139 PHE n 
1 140 GLN n 
1 141 PRO n 
1 142 MET n 
1 143 GLY n 
1 144 VAL n 
1 145 VAL n 
1 146 ALA n 
1 147 GLY n 
1 148 ILE n 
1 149 THR n 
1 150 PRO n 
1 151 PHE n 
1 152 ASN n 
1 153 PHE n 
1 154 PRO n 
1 155 VAL n 
1 156 MET n 
1 157 VAL n 
1 158 PRO n 
1 159 LEU n 
1 160 TRP n 
1 161 MET n 
1 162 PHE n 
1 163 PRO n 
1 164 MET n 
1 165 ALA n 
1 166 ILE n 
1 167 VAL n 
1 168 CYS n 
1 169 GLY n 
1 170 ASN n 
1 171 CYS n 
1 172 PHE n 
1 173 VAL n 
1 174 LEU n 
1 175 LYS n 
1 176 PRO n 
1 177 SER n 
1 178 GLU n 
1 179 ARG n 
1 180 ASP n 
1 181 PRO n 
1 182 SER n 
1 183 SER n 
1 184 THR n 
1 185 LEU n 
1 186 TYR n 
1 187 ILE n 
1 188 ALA n 
1 189 GLN n 
1 190 LEU n 
1 191 LEU n 
1 192 GLN n 
1 193 GLU n 
1 194 ALA n 
1 195 GLY n 
1 196 LEU n 
1 197 PRO n 
1 198 ASP n 
1 199 GLY n 
1 200 VAL n 
1 201 MET n 
1 202 ASN n 
1 203 VAL n 
1 204 VAL n 
1 205 ASN n 
1 206 GLY n 
1 207 ASP n 
1 208 LYS n 
1 209 GLU n 
1 210 ALA n 
1 211 VAL n 
1 212 ASP n 
1 213 ALA n 
1 214 LEU n 
1 215 LEU n 
1 216 HIS n 
1 217 ASP n 
1 218 ASP n 
1 219 ARG n 
1 220 VAL n 
1 221 LYS n 
1 222 ALA n 
1 223 VAL n 
1 224 SER n 
1 225 PHE n 
1 226 VAL n 
1 227 GLY n 
1 228 SER n 
1 229 THR n 
1 230 PRO n 
1 231 ILE n 
1 232 ALA n 
1 233 GLU n 
1 234 TYR n 
1 235 ILE n 
1 236 TYR n 
1 237 ARG n 
1 238 THR n 
1 239 ALA n 
1 240 SER n 
1 241 ALA n 
1 242 ASN n 
1 243 GLY n 
1 244 LYS n 
1 245 ARG n 
1 246 CYS n 
1 247 GLN n 
1 248 ALA n 
1 249 LEU n 
1 250 GLY n 
1 251 GLY n 
1 252 ALA n 
1 253 LYS n 
1 254 ASN n 
1 255 HIS n 
1 256 ALA n 
1 257 ILE n 
1 258 VAL n 
1 259 MET n 
1 260 PRO n 
1 261 ASP n 
1 262 ALA n 
1 263 ASP n 
1 264 MET n 
1 265 ASP n 
1 266 ASN n 
1 267 ALA n 
1 268 VAL n 
1 269 ASN n 
1 270 GLN n 
1 271 LEU n 
1 272 LEU n 
1 273 GLY n 
1 274 ALA n 
1 275 ALA n 
1 276 PHE n 
1 277 GLY n 
1 278 SER n 
1 279 SER n 
1 280 GLY n 
1 281 GLU n 
1 282 ARG n 
1 283 CYS n 
1 284 MET n 
1 285 ALA n 
1 286 LEU n 
1 287 SER n 
1 288 VAL n 
1 289 ALA n 
1 290 VAL n 
1 291 ALA n 
1 292 VAL n 
1 293 GLY n 
1 294 ASP n 
1 295 ALA n 
1 296 ALA n 
1 297 GLY n 
1 298 ASP n 
1 299 ALA n 
1 300 LEU n 
1 301 VAL n 
1 302 SER n 
1 303 LYS n 
1 304 MET n 
1 305 THR n 
1 306 GLN n 
1 307 ALA n 
1 308 MET n 
1 309 GLN n 
1 310 LYS n 
1 311 LEU n 
1 312 LYS n 
1 313 VAL n 
1 314 GLY n 
1 315 PRO n 
1 316 SER n 
1 317 THR n 
1 318 ASP n 
1 319 SER n 
1 320 GLY n 
1 321 ASN n 
1 322 ASP n 
1 323 PHE n 
1 324 GLY n 
1 325 PRO n 
1 326 VAL n 
1 327 ILE n 
1 328 THR n 
1 329 ARG n 
1 330 GLN n 
1 331 HIS n 
1 332 GLN n 
1 333 GLU n 
1 334 LYS n 
1 335 VAL n 
1 336 ILE n 
1 337 GLY n 
1 338 TYR n 
1 339 ILE n 
1 340 ASN n 
1 341 SER n 
1 342 ALA n 
1 343 GLU n 
1 344 GLN n 
1 345 GLN n 
1 346 GLY n 
1 347 ALA n 
1 348 THR n 
1 349 ILE n 
1 350 VAL n 
1 351 VAL n 
1 352 ASP n 
1 353 GLY n 
1 354 ARG n 
1 355 GLN n 
1 356 PRO n 
1 357 LYS n 
1 358 VAL n 
1 359 PRO n 
1 360 ASN n 
1 361 HIS n 
1 362 GLU n 
1 363 ASN n 
1 364 GLY n 
1 365 PHE n 
1 366 PHE n 
1 367 VAL n 
1 368 GLY n 
1 369 GLY n 
1 370 THR n 
1 371 LEU n 
1 372 ILE n 
1 373 ASP n 
1 374 HIS n 
1 375 VAL n 
1 376 THR n 
1 377 PRO n 
1 378 GLU n 
1 379 MET n 
1 380 THR n 
1 381 SER n 
1 382 TYR n 
1 383 GLN n 
1 384 GLU n 
1 385 GLU n 
1 386 ILE n 
1 387 PHE n 
1 388 GLY n 
1 389 PRO n 
1 390 VAL n 
1 391 LEU n 
1 392 GLN n 
1 393 VAL n 
1 394 VAL n 
1 395 ARG n 
1 396 VAL n 
1 397 ALA n 
1 398 THR n 
1 399 MET n 
1 400 GLN n 
1 401 ASP n 
1 402 ALA n 
1 403 MET n 
1 404 ASP n 
1 405 LEU n 
1 406 ILE n 
1 407 ASP n 
1 408 ALA n 
1 409 HIS n 
1 410 GLU n 
1 411 TYR n 
1 412 GLY n 
1 413 ASN n 
1 414 GLY n 
1 415 THR n 
1 416 CYS n 
1 417 ILE n 
1 418 PHE n 
1 419 THR n 
1 420 ARG n 
1 421 ASP n 
1 422 GLY n 
1 423 GLU n 
1 424 ALA n 
1 425 ALA n 
1 426 ARG n 
1 427 TYR n 
1 428 PHE n 
1 429 SER n 
1 430 ASP n 
1 431 ASN n 
1 432 ILE n 
1 433 GLN n 
1 434 VAL n 
1 435 GLY n 
1 436 MET n 
1 437 VAL n 
1 438 GLY n 
1 439 ILE n 
1 440 ASN n 
1 441 ILE n 
1 442 PRO n 
1 443 LEU n 
1 444 PRO n 
1 445 VAL n 
1 446 PRO n 
1 447 VAL n 
1 448 ALA n 
1 449 TYR n 
1 450 HIS n 
1 451 SER n 
1 452 PHE n 
1 453 GLY n 
1 454 GLY n 
1 455 TRP n 
1 456 LYS n 
1 457 ARG n 
1 458 SER n 
1 459 LEU n 
1 460 PHE n 
1 461 GLY n 
1 462 ASP n 
1 463 LEU n 
1 464 HIS n 
1 465 ALA n 
1 466 TYR n 
1 467 GLY n 
1 468 PRO n 
1 469 ASP n 
1 470 ALA n 
1 471 VAL n 
1 472 ARG n 
1 473 PHE n 
1 474 TYR n 
1 475 THR n 
1 476 LYS n 
1 477 ARG n 
1 478 LYS n 
1 479 THR n 
1 480 VAL n 
1 481 THR n 
1 482 GLN n 
1 483 ARG n 
1 484 TRP n 
1 485 PRO n 
1 486 SER n 
1 487 ALA n 
1 488 GLY n 
1 489 VAL n 
1 490 ARG n 
1 491 GLU n 
1 492 GLY n 
1 493 ALA n 
1 494 GLU n 
1 495 PHE n 
1 496 SER n 
1 497 MET n 
1 498 PRO n 
1 499 THR n 
1 500 MET n 
1 501 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   501 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 dddC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Oceanimonas doudoroffii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     84158 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.db_code                    G5CZI2_9GAMM 
_struct_ref.db_name                    UNP 
_struct_ref.details                    ? 
_struct_ref.entity_id                  1 
_struct_ref.id                         1 
_struct_ref.seq_align                  ? 
_struct_ref.seq_dif                    ? 
_struct_ref.pdbx_db_accession          G5CZI2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   
;MTTIGHLINGQLVTENTRSQNVFNPATGEIGKQLDLASTKTVEQAISAAQHAFPTWRNTPPLKRARVMFRFKELLEQHAD
EICRLIGEEHGKIAHDAMGELQRGIENVEYACGAPELLKGEHSRNVGPGIDSWSEFQPMGVVAGITPFNFPVMVPLWMFP
MAIVCGNCFVLKPSERDPSSTLYIAQLLQEAGLPDGVMNVVNGDKEAVDALLHDDRVKAVSFVGSTPIAEYIYRTASANG
KRCQALGGAKNHAIVMPDADMDNAVNQLLGAAFGSSGERCMALSVAVAVGDAAGDALVSKMTQAMQKLKVGPSTDSGNDF
GPVITRQHQEKVIGYINSAEQQGATIVVDGRQPKVPNHENGFFVGGTLIDHVTPEMTSYQEEIFGPVLQVVRVATMQDAM
DLIDAHEYGNGTCIFTRDGEAARYFSDNIQVGMVGINIPLPVPVAYHSFGGWKRSLFGDLHAYGPDAVRFYTKRKTVTQR
WPSAGVREGAEFSMPTMK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_align_end             ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4ZZ7 A 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
2  1 4ZZ7 B 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
3  1 4ZZ7 C 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
4  1 4ZZ7 D 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
5  1 4ZZ7 E 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
6  1 4ZZ7 F 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
7  1 4ZZ7 G 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
8  1 4ZZ7 H 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
9  1 4ZZ7 I 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
10 1 4ZZ7 J 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
11 1 4ZZ7 K 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
12 1 4ZZ7 L 4 ? 501 ? G5CZI2 1 ? 498 ? 1 498 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  4ZZ7 GLY A 1 ? UNP G5CZI2 ? ? 'expression tag' -2 1  
1  4ZZ7 SER A 2 ? UNP G5CZI2 ? ? 'expression tag' -1 2  
1  4ZZ7 HIS A 3 ? UNP G5CZI2 ? ? 'expression tag' 0  3  
2  4ZZ7 GLY B 1 ? UNP G5CZI2 ? ? 'expression tag' -2 4  
2  4ZZ7 SER B 2 ? UNP G5CZI2 ? ? 'expression tag' -1 5  
2  4ZZ7 HIS B 3 ? UNP G5CZI2 ? ? 'expression tag' 0  6  
3  4ZZ7 GLY C 1 ? UNP G5CZI2 ? ? 'expression tag' -2 7  
3  4ZZ7 SER C 2 ? UNP G5CZI2 ? ? 'expression tag' -1 8  
3  4ZZ7 HIS C 3 ? UNP G5CZI2 ? ? 'expression tag' 0  9  
4  4ZZ7 GLY D 1 ? UNP G5CZI2 ? ? 'expression tag' -2 10 
4  4ZZ7 SER D 2 ? UNP G5CZI2 ? ? 'expression tag' -1 11 
4  4ZZ7 HIS D 3 ? UNP G5CZI2 ? ? 'expression tag' 0  12 
5  4ZZ7 GLY E 1 ? UNP G5CZI2 ? ? 'expression tag' -2 13 
5  4ZZ7 SER E 2 ? UNP G5CZI2 ? ? 'expression tag' -1 14 
5  4ZZ7 HIS E 3 ? UNP G5CZI2 ? ? 'expression tag' 0  15 
6  4ZZ7 GLY F 1 ? UNP G5CZI2 ? ? 'expression tag' -2 16 
6  4ZZ7 SER F 2 ? UNP G5CZI2 ? ? 'expression tag' -1 17 
6  4ZZ7 HIS F 3 ? UNP G5CZI2 ? ? 'expression tag' 0  18 
7  4ZZ7 GLY G 1 ? UNP G5CZI2 ? ? 'expression tag' -2 19 
7  4ZZ7 SER G 2 ? UNP G5CZI2 ? ? 'expression tag' -1 20 
7  4ZZ7 HIS G 3 ? UNP G5CZI2 ? ? 'expression tag' 0  21 
8  4ZZ7 GLY H 1 ? UNP G5CZI2 ? ? 'expression tag' -2 22 
8  4ZZ7 SER H 2 ? UNP G5CZI2 ? ? 'expression tag' -1 23 
8  4ZZ7 HIS H 3 ? UNP G5CZI2 ? ? 'expression tag' 0  24 
9  4ZZ7 GLY I 1 ? UNP G5CZI2 ? ? 'expression tag' -2 25 
9  4ZZ7 SER I 2 ? UNP G5CZI2 ? ? 'expression tag' -1 26 
9  4ZZ7 HIS I 3 ? UNP G5CZI2 ? ? 'expression tag' 0  27 
10 4ZZ7 GLY J 1 ? UNP G5CZI2 ? ? 'expression tag' -2 28 
10 4ZZ7 SER J 2 ? UNP G5CZI2 ? ? 'expression tag' -1 29 
10 4ZZ7 HIS J 3 ? UNP G5CZI2 ? ? 'expression tag' 0  30 
11 4ZZ7 GLY K 1 ? UNP G5CZI2 ? ? 'expression tag' -2 31 
11 4ZZ7 SER K 2 ? UNP G5CZI2 ? ? 'expression tag' -1 32 
11 4ZZ7 HIS K 3 ? UNP G5CZI2 ? ? 'expression tag' 0  33 
12 4ZZ7 GLY L 1 ? UNP G5CZI2 ? ? 'expression tag' -2 34 
12 4ZZ7 SER L 2 ? UNP G5CZI2 ? ? 'expression tag' -1 35 
12 4ZZ7 HIS L 3 ? UNP G5CZI2 ? ? 'expression tag' 0  36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4ZZ7 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.3 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         46.6 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '21% PEG 3350, 0.2 M potassium sodium tartrate pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         FUJI 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-12-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4ZZ7 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.9 
_reflns.d_resolution_low                 50.01 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       126662 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.9 
_reflns.pdbx_Rmerge_I_obs                0.094 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            57.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.9 
_reflns_shell.d_res_low                   3.0 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         9.1 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.407 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             12.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4ZZ7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     125831 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.01 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    99.22 
_refine.ls_R_factor_obs                          0.18802 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18497 
_refine.ls_R_factor_R_free                       0.24597 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  6657 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.929 
_refine.correlation_coeff_Fo_to_Fc_free          0.874 
_refine.B_iso_mean                               33.815 
_refine.aniso_B[1][1]                            -0.01 
_refine.aniso_B[2][2]                            0.02 
_refine.aniso_B[3][3]                            -0.02 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.438 
_refine.overall_SU_ML                            0.335 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             18.098 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        44565 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         264 
_refine_hist.number_atoms_solvent             709 
_refine_hist.number_atoms_total               45538 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        50.01 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.019  ? 45837 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 43242 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.440  1.954  ? 62260 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.277  3.000  ? 99395 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.188  5.000  ? 5841  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.470 24.440 ? 2072  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.436 15.000 ? 7345  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.815 15.000 ? 276   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.075  0.200  ? 6859  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 52985 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 10569 'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.990  3.309  ? 23397 'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.990  3.309  ? 23396 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.333  4.957  ? 29227 'X-RAY DIFFRACTION' ? 
r_mcangle_other              3.333  4.957  ? 29228 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.183  3.479  ? 22439 'X-RAY DIFFRACTION' ? 
r_scbond_other               2.183  3.479  ? 22440 'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              3.688  5.136  ? 33034 'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       6.395  25.975 ? 51264 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         6.395  25.976 ? 51265 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.900 
_refine_ls_shell.d_res_low                        2.975 
_refine_ls_shell.number_reflns_R_work             9222 
_refine_ls_shell.R_factor_R_work                  0.267 
_refine_ls_shell.percent_reflns_obs               99.62 
_refine_ls_shell.R_factor_R_free                  0.348 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             488 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     4ZZ7 
_struct.title                        
'Crystal structure of methylmalonate-semialdehyde dehydrogenase (DddC) from Oceanimonas doudoroffii' 
_struct.pdbx_descriptor              'Methylmalonate-semialdehyde dehydrogenase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4ZZ7 
_struct_keywords.text            'DddC, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A 41  ? THR A 62  ? SER A 38  THR A 59  1 ? 22 
HELX_P HELX_P2   AA2 PRO A 63  ? HIS A 81  ? PRO A 60  HIS A 78  1 ? 19 
HELX_P HELX_P3   AA3 HIS A 81  ? HIS A 93  ? HIS A 78  HIS A 90  1 ? 13 
HELX_P HELX_P4   AA4 ILE A 96  ? GLY A 116 ? ILE A 93  GLY A 113 1 ? 21 
HELX_P HELX_P5   AA5 GLY A 116 ? LEU A 121 ? GLY A 113 LEU A 118 1 ? 6  
HELX_P HELX_P6   AA6 VAL A 155 ? CYS A 168 ? VAL A 152 CYS A 165 1 ? 14 
HELX_P HELX_P7   AA7 PRO A 181 ? ALA A 194 ? PRO A 178 ALA A 191 1 ? 14 
HELX_P HELX_P8   AA8 ASP A 207 ? ASP A 217 ? ASP A 204 ASP A 214 1 ? 11 
HELX_P HELX_P9   AA9 SER A 228 ? ASN A 242 ? SER A 225 ASN A 239 1 ? 15 
HELX_P HELX_P10  AB1 ASP A 263 ? GLY A 277 ? ASP A 260 GLY A 274 1 ? 15 
HELX_P HELX_P11  AB2 SER A 278 ? GLU A 281 ? SER A 275 GLU A 278 5 ? 4  
HELX_P HELX_P12  AB3 ALA A 295 ? GLN A 309 ? ALA A 292 GLN A 306 1 ? 15 
HELX_P HELX_P13  AB4 THR A 328 ? GLN A 345 ? THR A 325 GLN A 342 1 ? 18 
HELX_P HELX_P14  AB5 MET A 379 ? GLU A 384 ? MET A 376 GLU A 381 1 ? 6  
HELX_P HELX_P15  AB6 THR A 398 ? HIS A 409 ? THR A 395 HIS A 406 1 ? 12 
HELX_P HELX_P16  AB7 ASP A 421 ? ILE A 432 ? ASP A 418 ILE A 429 1 ? 12 
HELX_P HELX_P17  AB8 TYR A 466 ? TYR A 474 ? TYR A 463 TYR A 471 1 ? 9  
HELX_P HELX_P18  AB9 SER B 41  ? ASN B 61  ? SER B 38  ASN B 58  1 ? 21 
HELX_P HELX_P19  AC1 PRO B 63  ? HIS B 81  ? PRO B 60  HIS B 78  1 ? 19 
HELX_P HELX_P20  AC2 HIS B 81  ? HIS B 93  ? HIS B 78  HIS B 90  1 ? 13 
HELX_P HELX_P21  AC3 ILE B 96  ? CYS B 115 ? ILE B 93  CYS B 112 1 ? 20 
HELX_P HELX_P22  AC4 GLY B 116 ? LEU B 121 ? GLY B 113 LEU B 118 1 ? 6  
HELX_P HELX_P23  AC5 VAL B 155 ? CYS B 168 ? VAL B 152 CYS B 165 1 ? 14 
HELX_P HELX_P24  AC6 ASP B 180 ? ALA B 194 ? ASP B 177 ALA B 191 1 ? 15 
HELX_P HELX_P25  AC7 ASP B 207 ? ASP B 217 ? ASP B 204 ASP B 214 1 ? 11 
HELX_P HELX_P26  AC8 SER B 228 ? ASN B 242 ? SER B 225 ASN B 239 1 ? 15 
HELX_P HELX_P27  AC9 ASP B 263 ? GLY B 277 ? ASP B 260 GLY B 274 1 ? 15 
HELX_P HELX_P28  AD1 SER B 278 ? GLU B 281 ? SER B 275 GLU B 278 5 ? 4  
HELX_P HELX_P29  AD2 ALA B 295 ? GLN B 309 ? ALA B 292 GLN B 306 1 ? 15 
HELX_P HELX_P30  AD3 THR B 328 ? GLN B 345 ? THR B 325 GLN B 342 1 ? 18 
HELX_P HELX_P31  AD4 MET B 379 ? GLU B 384 ? MET B 376 GLU B 381 1 ? 6  
HELX_P HELX_P32  AD5 THR B 398 ? HIS B 409 ? THR B 395 HIS B 406 1 ? 12 
HELX_P HELX_P33  AD6 ASP B 421 ? ILE B 432 ? ASP B 418 ILE B 429 1 ? 12 
HELX_P HELX_P34  AD7 TYR B 466 ? TYR B 474 ? TYR B 463 TYR B 471 1 ? 9  
HELX_P HELX_P35  AD8 SER C 41  ? ASN C 61  ? SER C 38  ASN C 58  1 ? 21 
HELX_P HELX_P36  AD9 PRO C 63  ? HIS C 81  ? PRO C 60  HIS C 78  1 ? 19 
HELX_P HELX_P37  AE1 HIS C 81  ? HIS C 93  ? HIS C 78  HIS C 90  1 ? 13 
HELX_P HELX_P38  AE2 ILE C 96  ? CYS C 115 ? ILE C 93  CYS C 112 1 ? 20 
HELX_P HELX_P39  AE3 GLY C 116 ? LEU C 121 ? GLY C 113 LEU C 118 1 ? 6  
HELX_P HELX_P40  AE4 VAL C 155 ? CYS C 168 ? VAL C 152 CYS C 165 1 ? 14 
HELX_P HELX_P41  AE5 ASP C 180 ? ALA C 194 ? ASP C 177 ALA C 191 1 ? 15 
HELX_P HELX_P42  AE6 ASP C 207 ? HIS C 216 ? ASP C 204 HIS C 213 1 ? 10 
HELX_P HELX_P43  AE7 SER C 228 ? ASN C 242 ? SER C 225 ASN C 239 1 ? 15 
HELX_P HELX_P44  AE8 ASP C 263 ? GLY C 277 ? ASP C 260 GLY C 274 1 ? 15 
HELX_P HELX_P45  AE9 SER C 278 ? GLU C 281 ? SER C 275 GLU C 278 5 ? 4  
HELX_P HELX_P46  AF1 ALA C 295 ? LYS C 310 ? ALA C 292 LYS C 307 1 ? 16 
HELX_P HELX_P47  AF2 THR C 328 ? GLN C 345 ? THR C 325 GLN C 342 1 ? 18 
HELX_P HELX_P48  AF3 MET C 379 ? GLU C 384 ? MET C 376 GLU C 381 1 ? 6  
HELX_P HELX_P49  AF4 THR C 398 ? HIS C 409 ? THR C 395 HIS C 406 1 ? 12 
HELX_P HELX_P50  AF5 ASP C 421 ? ILE C 432 ? ASP C 418 ILE C 429 1 ? 12 
HELX_P HELX_P51  AF6 TYR C 466 ? TYR C 474 ? TYR C 463 TYR C 471 1 ? 9  
HELX_P HELX_P52  AF7 SER D 41  ? ASN D 61  ? SER D 38  ASN D 58  1 ? 21 
HELX_P HELX_P53  AF8 PRO D 63  ? HIS D 81  ? PRO D 60  HIS D 78  1 ? 19 
HELX_P HELX_P54  AF9 HIS D 81  ? HIS D 93  ? HIS D 78  HIS D 90  1 ? 13 
HELX_P HELX_P55  AG1 ILE D 96  ? GLY D 116 ? ILE D 93  GLY D 113 1 ? 21 
HELX_P HELX_P56  AG2 GLY D 116 ? LEU D 121 ? GLY D 113 LEU D 118 1 ? 6  
HELX_P HELX_P57  AG3 VAL D 155 ? CYS D 168 ? VAL D 152 CYS D 165 1 ? 14 
HELX_P HELX_P58  AG4 PRO D 181 ? ALA D 194 ? PRO D 178 ALA D 191 1 ? 14 
HELX_P HELX_P59  AG5 ASP D 207 ? ASP D 217 ? ASP D 204 ASP D 214 1 ? 11 
HELX_P HELX_P60  AG6 SER D 228 ? ASN D 242 ? SER D 225 ASN D 239 1 ? 15 
HELX_P HELX_P61  AG7 ASP D 263 ? GLY D 277 ? ASP D 260 GLY D 274 1 ? 15 
HELX_P HELX_P62  AG8 SER D 278 ? GLU D 281 ? SER D 275 GLU D 278 5 ? 4  
HELX_P HELX_P63  AG9 ALA D 295 ? GLN D 309 ? ALA D 292 GLN D 306 1 ? 15 
HELX_P HELX_P64  AH1 THR D 328 ? GLN D 345 ? THR D 325 GLN D 342 1 ? 18 
HELX_P HELX_P65  AH2 MET D 379 ? GLU D 384 ? MET D 376 GLU D 381 1 ? 6  
HELX_P HELX_P66  AH3 THR D 398 ? HIS D 409 ? THR D 395 HIS D 406 1 ? 12 
HELX_P HELX_P67  AH4 ASP D 421 ? ILE D 432 ? ASP D 418 ILE D 429 1 ? 12 
HELX_P HELX_P68  AH5 TYR D 466 ? TYR D 474 ? TYR D 463 TYR D 471 1 ? 9  
HELX_P HELX_P69  AH6 SER E 41  ? ASN E 61  ? SER E 38  ASN E 58  1 ? 21 
HELX_P HELX_P70  AH7 PRO E 63  ? HIS E 81  ? PRO E 60  HIS E 78  1 ? 19 
HELX_P HELX_P71  AH8 HIS E 81  ? HIS E 93  ? HIS E 78  HIS E 90  1 ? 13 
HELX_P HELX_P72  AH9 ILE E 96  ? CYS E 115 ? ILE E 93  CYS E 112 1 ? 20 
HELX_P HELX_P73  AI1 GLY E 116 ? LEU E 121 ? GLY E 113 LEU E 118 1 ? 6  
HELX_P HELX_P74  AI2 VAL E 155 ? CYS E 168 ? VAL E 152 CYS E 165 1 ? 14 
HELX_P HELX_P75  AI3 ASP E 180 ? ALA E 194 ? ASP E 177 ALA E 191 1 ? 15 
HELX_P HELX_P76  AI4 ASP E 207 ? HIS E 216 ? ASP E 204 HIS E 213 1 ? 10 
HELX_P HELX_P77  AI5 SER E 228 ? ASN E 242 ? SER E 225 ASN E 239 1 ? 15 
HELX_P HELX_P78  AI6 ASP E 263 ? GLY E 277 ? ASP E 260 GLY E 274 1 ? 15 
HELX_P HELX_P79  AI7 SER E 278 ? GLU E 281 ? SER E 275 GLU E 278 5 ? 4  
HELX_P HELX_P80  AI8 ALA E 295 ? GLN E 309 ? ALA E 292 GLN E 306 1 ? 15 
HELX_P HELX_P81  AI9 THR E 328 ? GLN E 345 ? THR E 325 GLN E 342 1 ? 18 
HELX_P HELX_P82  AJ1 MET E 379 ? GLU E 384 ? MET E 376 GLU E 381 1 ? 6  
HELX_P HELX_P83  AJ2 THR E 398 ? HIS E 409 ? THR E 395 HIS E 406 1 ? 12 
HELX_P HELX_P84  AJ3 ASP E 421 ? ILE E 432 ? ASP E 418 ILE E 429 1 ? 12 
HELX_P HELX_P85  AJ4 TYR E 466 ? TYR E 474 ? TYR E 463 TYR E 471 1 ? 9  
HELX_P HELX_P86  AJ5 ALA E 487 ? GLU E 491 ? ALA E 484 GLU E 488 5 ? 5  
HELX_P HELX_P87  AJ6 SER F 41  ? ASN F 61  ? SER F 38  ASN F 58  1 ? 21 
HELX_P HELX_P88  AJ7 PRO F 63  ? HIS F 81  ? PRO F 60  HIS F 78  1 ? 19 
HELX_P HELX_P89  AJ8 HIS F 81  ? HIS F 93  ? HIS F 78  HIS F 90  1 ? 13 
HELX_P HELX_P90  AJ9 ILE F 96  ? GLY F 116 ? ILE F 93  GLY F 113 1 ? 21 
HELX_P HELX_P91  AK1 GLY F 116 ? LEU F 121 ? GLY F 113 LEU F 118 1 ? 6  
HELX_P HELX_P92  AK2 VAL F 155 ? CYS F 168 ? VAL F 152 CYS F 165 1 ? 14 
HELX_P HELX_P93  AK3 PRO F 181 ? ALA F 194 ? PRO F 178 ALA F 191 1 ? 14 
HELX_P HELX_P94  AK4 ASP F 207 ? HIS F 216 ? ASP F 204 HIS F 213 1 ? 10 
HELX_P HELX_P95  AK5 SER F 228 ? ASN F 242 ? SER F 225 ASN F 239 1 ? 15 
HELX_P HELX_P96  AK6 ASP F 263 ? GLY F 277 ? ASP F 260 GLY F 274 1 ? 15 
HELX_P HELX_P97  AK7 SER F 278 ? GLU F 281 ? SER F 275 GLU F 278 5 ? 4  
HELX_P HELX_P98  AK8 ALA F 295 ? MET F 308 ? ALA F 292 MET F 305 1 ? 14 
HELX_P HELX_P99  AK9 THR F 328 ? GLN F 345 ? THR F 325 GLN F 342 1 ? 18 
HELX_P HELX_P100 AL1 MET F 379 ? GLU F 384 ? MET F 376 GLU F 381 1 ? 6  
HELX_P HELX_P101 AL2 THR F 398 ? HIS F 409 ? THR F 395 HIS F 406 1 ? 12 
HELX_P HELX_P102 AL3 ASP F 421 ? ILE F 432 ? ASP F 418 ILE F 429 1 ? 12 
HELX_P HELX_P103 AL4 TYR F 466 ? TYR F 474 ? TYR F 463 TYR F 471 1 ? 9  
HELX_P HELX_P104 AL5 SER G 41  ? ASN G 61  ? SER G 38  ASN G 58  1 ? 21 
HELX_P HELX_P105 AL6 PRO G 63  ? HIS G 81  ? PRO G 60  HIS G 78  1 ? 19 
HELX_P HELX_P106 AL7 HIS G 81  ? HIS G 93  ? HIS G 78  HIS G 90  1 ? 13 
HELX_P HELX_P107 AL8 ILE G 96  ? GLY G 116 ? ILE G 93  GLY G 113 1 ? 21 
HELX_P HELX_P108 AL9 GLY G 116 ? LEU G 121 ? GLY G 113 LEU G 118 1 ? 6  
HELX_P HELX_P109 AM1 VAL G 155 ? CYS G 168 ? VAL G 152 CYS G 165 1 ? 14 
HELX_P HELX_P110 AM2 ASP G 180 ? ALA G 194 ? ASP G 177 ALA G 191 1 ? 15 
HELX_P HELX_P111 AM3 ASP G 207 ? ASP G 217 ? ASP G 204 ASP G 214 1 ? 11 
HELX_P HELX_P112 AM4 SER G 228 ? ASN G 242 ? SER G 225 ASN G 239 1 ? 15 
HELX_P HELX_P113 AM5 ASP G 263 ? GLY G 277 ? ASP G 260 GLY G 274 1 ? 15 
HELX_P HELX_P114 AM6 SER G 278 ? GLU G 281 ? SER G 275 GLU G 278 5 ? 4  
HELX_P HELX_P115 AM7 ALA G 295 ? GLN G 309 ? ALA G 292 GLN G 306 1 ? 15 
HELX_P HELX_P116 AM8 THR G 328 ? GLN G 345 ? THR G 325 GLN G 342 1 ? 18 
HELX_P HELX_P117 AM9 MET G 379 ? GLU G 384 ? MET G 376 GLU G 381 1 ? 6  
HELX_P HELX_P118 AN1 THR G 398 ? HIS G 409 ? THR G 395 HIS G 406 1 ? 12 
HELX_P HELX_P119 AN2 ASP G 421 ? ILE G 432 ? ASP G 418 ILE G 429 1 ? 12 
HELX_P HELX_P120 AN3 TRP G 455 ? ARG G 457 ? TRP G 452 ARG G 454 5 ? 3  
HELX_P HELX_P121 AN4 TYR G 466 ? TYR G 474 ? TYR G 463 TYR G 471 1 ? 9  
HELX_P HELX_P122 AN5 SER H 41  ? ASN H 61  ? SER H 38  ASN H 58  1 ? 21 
HELX_P HELX_P123 AN6 PRO H 63  ? HIS H 81  ? PRO H 60  HIS H 78  1 ? 19 
HELX_P HELX_P124 AN7 HIS H 81  ? HIS H 93  ? HIS H 78  HIS H 90  1 ? 13 
HELX_P HELX_P125 AN8 ILE H 96  ? CYS H 115 ? ILE H 93  CYS H 112 1 ? 20 
HELX_P HELX_P126 AN9 GLY H 116 ? LEU H 121 ? GLY H 113 LEU H 118 1 ? 6  
HELX_P HELX_P127 AO1 VAL H 155 ? CYS H 168 ? VAL H 152 CYS H 165 1 ? 14 
HELX_P HELX_P128 AO2 ASP H 180 ? ALA H 194 ? ASP H 177 ALA H 191 1 ? 15 
HELX_P HELX_P129 AO3 ASP H 207 ? ASP H 217 ? ASP H 204 ASP H 214 1 ? 11 
HELX_P HELX_P130 AO4 SER H 228 ? ASN H 242 ? SER H 225 ASN H 239 1 ? 15 
HELX_P HELX_P131 AO5 ASP H 263 ? GLY H 277 ? ASP H 260 GLY H 274 1 ? 15 
HELX_P HELX_P132 AO6 SER H 278 ? GLU H 281 ? SER H 275 GLU H 278 5 ? 4  
HELX_P HELX_P133 AO7 GLY H 293 ? GLN H 309 ? GLY H 290 GLN H 306 1 ? 17 
HELX_P HELX_P134 AO8 THR H 328 ? GLN H 345 ? THR H 325 GLN H 342 1 ? 18 
HELX_P HELX_P135 AO9 MET H 379 ? GLU H 384 ? MET H 376 GLU H 381 1 ? 6  
HELX_P HELX_P136 AP1 THR H 398 ? HIS H 409 ? THR H 395 HIS H 406 1 ? 12 
HELX_P HELX_P137 AP2 ASP H 421 ? ILE H 432 ? ASP H 418 ILE H 429 1 ? 12 
HELX_P HELX_P138 AP3 TYR H 466 ? TYR H 474 ? TYR H 463 TYR H 471 1 ? 9  
HELX_P HELX_P139 AP4 SER I 41  ? ASN I 61  ? SER I 38  ASN I 58  1 ? 21 
HELX_P HELX_P140 AP5 PRO I 63  ? HIS I 81  ? PRO I 60  HIS I 78  1 ? 19 
HELX_P HELX_P141 AP6 HIS I 81  ? HIS I 93  ? HIS I 78  HIS I 90  1 ? 13 
HELX_P HELX_P142 AP7 ILE I 96  ? CYS I 115 ? ILE I 93  CYS I 112 1 ? 20 
HELX_P HELX_P143 AP8 GLY I 116 ? LEU I 121 ? GLY I 113 LEU I 118 1 ? 6  
HELX_P HELX_P144 AP9 VAL I 155 ? CYS I 168 ? VAL I 152 CYS I 165 1 ? 14 
HELX_P HELX_P145 AQ1 PRO I 181 ? ALA I 194 ? PRO I 178 ALA I 191 1 ? 14 
HELX_P HELX_P146 AQ2 ASP I 207 ? ASP I 217 ? ASP I 204 ASP I 214 1 ? 11 
HELX_P HELX_P147 AQ3 SER I 228 ? ASN I 242 ? SER I 225 ASN I 239 1 ? 15 
HELX_P HELX_P148 AQ4 ASP I 263 ? GLY I 277 ? ASP I 260 GLY I 274 1 ? 15 
HELX_P HELX_P149 AQ5 SER I 278 ? GLU I 281 ? SER I 275 GLU I 278 5 ? 4  
HELX_P HELX_P150 AQ6 GLY I 293 ? GLN I 309 ? GLY I 290 GLN I 306 1 ? 17 
HELX_P HELX_P151 AQ7 THR I 328 ? GLN I 345 ? THR I 325 GLN I 342 1 ? 18 
HELX_P HELX_P152 AQ8 MET I 379 ? GLU I 384 ? MET I 376 GLU I 381 1 ? 6  
HELX_P HELX_P153 AQ9 THR I 398 ? HIS I 409 ? THR I 395 HIS I 406 1 ? 12 
HELX_P HELX_P154 AR1 ASP I 421 ? ILE I 432 ? ASP I 418 ILE I 429 1 ? 12 
HELX_P HELX_P155 AR2 TYR I 466 ? TYR I 474 ? TYR I 463 TYR I 471 1 ? 9  
HELX_P HELX_P156 AR3 SER J 41  ? ASN J 61  ? SER J 38  ASN J 58  1 ? 21 
HELX_P HELX_P157 AR4 PRO J 63  ? HIS J 81  ? PRO J 60  HIS J 78  1 ? 19 
HELX_P HELX_P158 AR5 HIS J 81  ? HIS J 93  ? HIS J 78  HIS J 90  1 ? 13 
HELX_P HELX_P159 AR6 ILE J 96  ? CYS J 115 ? ILE J 93  CYS J 112 1 ? 20 
HELX_P HELX_P160 AR7 GLY J 116 ? LEU J 121 ? GLY J 113 LEU J 118 1 ? 6  
HELX_P HELX_P161 AR8 VAL J 155 ? CYS J 168 ? VAL J 152 CYS J 165 1 ? 14 
HELX_P HELX_P162 AR9 ASP J 180 ? ALA J 194 ? ASP J 177 ALA J 191 1 ? 15 
HELX_P HELX_P163 AS1 ASP J 207 ? ASP J 217 ? ASP J 204 ASP J 214 1 ? 11 
HELX_P HELX_P164 AS2 SER J 228 ? ASN J 242 ? SER J 225 ASN J 239 1 ? 15 
HELX_P HELX_P165 AS3 ASP J 263 ? PHE J 276 ? ASP J 260 PHE J 273 1 ? 14 
HELX_P HELX_P166 AS4 GLY J 277 ? GLU J 281 ? GLY J 274 GLU J 278 5 ? 5  
HELX_P HELX_P167 AS5 GLY J 293 ? LYS J 310 ? GLY J 290 LYS J 307 1 ? 18 
HELX_P HELX_P168 AS6 THR J 328 ? GLN J 345 ? THR J 325 GLN J 342 1 ? 18 
HELX_P HELX_P169 AS7 MET J 379 ? GLU J 384 ? MET J 376 GLU J 381 1 ? 6  
HELX_P HELX_P170 AS8 THR J 398 ? HIS J 409 ? THR J 395 HIS J 406 1 ? 12 
HELX_P HELX_P171 AS9 ASP J 421 ? ILE J 432 ? ASP J 418 ILE J 429 1 ? 12 
HELX_P HELX_P172 AT1 TYR J 466 ? TYR J 474 ? TYR J 463 TYR J 471 1 ? 9  
HELX_P HELX_P173 AT2 SER K 41  ? ASN K 61  ? SER K 38  ASN K 58  1 ? 21 
HELX_P HELX_P174 AT3 PRO K 63  ? HIS K 81  ? PRO K 60  HIS K 78  1 ? 19 
HELX_P HELX_P175 AT4 HIS K 81  ? HIS K 93  ? HIS K 78  HIS K 90  1 ? 13 
HELX_P HELX_P176 AT5 ILE K 96  ? GLY K 116 ? ILE K 93  GLY K 113 1 ? 21 
HELX_P HELX_P177 AT6 GLY K 116 ? LEU K 121 ? GLY K 113 LEU K 118 1 ? 6  
HELX_P HELX_P178 AT7 VAL K 155 ? CYS K 168 ? VAL K 152 CYS K 165 1 ? 14 
HELX_P HELX_P179 AT8 PRO K 181 ? ALA K 194 ? PRO K 178 ALA K 191 1 ? 14 
HELX_P HELX_P180 AT9 ASP K 207 ? ASP K 217 ? ASP K 204 ASP K 214 1 ? 11 
HELX_P HELX_P181 AU1 SER K 228 ? ASN K 242 ? SER K 225 ASN K 239 1 ? 15 
HELX_P HELX_P182 AU2 ASP K 263 ? GLY K 277 ? ASP K 260 GLY K 274 1 ? 15 
HELX_P HELX_P183 AU3 SER K 278 ? GLU K 281 ? SER K 275 GLU K 278 5 ? 4  
HELX_P HELX_P184 AU4 ALA K 295 ? LYS K 310 ? ALA K 292 LYS K 307 1 ? 16 
HELX_P HELX_P185 AU5 THR K 328 ? GLN K 345 ? THR K 325 GLN K 342 1 ? 18 
HELX_P HELX_P186 AU6 MET K 379 ? GLU K 384 ? MET K 376 GLU K 381 1 ? 6  
HELX_P HELX_P187 AU7 THR K 398 ? ALA K 408 ? THR K 395 ALA K 405 1 ? 11 
HELX_P HELX_P188 AU8 ASP K 421 ? ILE K 432 ? ASP K 418 ILE K 429 1 ? 12 
HELX_P HELX_P189 AU9 TYR K 466 ? TYR K 474 ? TYR K 463 TYR K 471 1 ? 9  
HELX_P HELX_P190 AV1 SER L 41  ? ASN L 61  ? SER L 38  ASN L 58  1 ? 21 
HELX_P HELX_P191 AV2 PRO L 63  ? HIS L 81  ? PRO L 60  HIS L 78  1 ? 19 
HELX_P HELX_P192 AV3 HIS L 81  ? HIS L 93  ? HIS L 78  HIS L 90  1 ? 13 
HELX_P HELX_P193 AV4 ILE L 96  ? GLY L 116 ? ILE L 93  GLY L 113 1 ? 21 
HELX_P HELX_P194 AV5 GLY L 116 ? LEU L 121 ? GLY L 113 LEU L 118 1 ? 6  
HELX_P HELX_P195 AV6 VAL L 155 ? CYS L 168 ? VAL L 152 CYS L 165 1 ? 14 
HELX_P HELX_P196 AV7 ASP L 180 ? ALA L 194 ? ASP L 177 ALA L 191 1 ? 15 
HELX_P HELX_P197 AV8 ASP L 207 ? ASP L 217 ? ASP L 204 ASP L 214 1 ? 11 
HELX_P HELX_P198 AV9 SER L 228 ? ASN L 242 ? SER L 225 ASN L 239 1 ? 15 
HELX_P HELX_P199 AW1 ASP L 263 ? GLY L 277 ? ASP L 260 GLY L 274 1 ? 15 
HELX_P HELX_P200 AW2 SER L 278 ? GLU L 281 ? SER L 275 GLU L 278 5 ? 4  
HELX_P HELX_P201 AW3 ALA L 295 ? LYS L 310 ? ALA L 292 LYS L 307 1 ? 16 
HELX_P HELX_P202 AW4 THR L 328 ? GLN L 345 ? THR L 325 GLN L 342 1 ? 18 
HELX_P HELX_P203 AW5 MET L 379 ? GLU L 384 ? MET L 376 GLU L 381 1 ? 6  
HELX_P HELX_P204 AW6 THR L 398 ? HIS L 409 ? THR L 395 HIS L 406 1 ? 12 
HELX_P HELX_P205 AW7 ASP L 421 ? ILE L 432 ? ASP L 418 ILE L 429 1 ? 12 
HELX_P HELX_P206 AW8 TRP L 455 ? ARG L 457 ? TRP L 452 ARG L 454 5 ? 3  
HELX_P HELX_P207 AW9 TYR L 466 ? TYR L 474 ? TYR L 463 TYR L 471 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 294 A . ? ASP 291 A ALA 295 A ? ALA 292 A 1 -5.20  
2  PRO 359 A . ? PRO 356 A ASN 360 A ? ASN 357 A 1 13.49  
3  GLU 491 A . ? GLU 488 A GLY 492 A ? GLY 489 A 1 7.60   
4  ASP 294 B . ? ASP 291 B ALA 295 B ? ALA 292 B 1 -12.20 
5  PRO 359 B . ? PRO 356 B ASN 360 B ? ASN 357 B 1 11.03  
6  ASP 294 C . ? ASP 291 C ALA 295 C ? ALA 292 C 1 -3.64  
7  PRO 359 C . ? PRO 356 C ASN 360 C ? ASN 357 C 1 15.07  
8  ASP 294 D . ? ASP 291 D ALA 295 D ? ALA 292 D 1 0.73   
9  PRO 359 D . ? PRO 356 D ASN 360 D ? ASN 357 D 1 6.20   
10 ASP 294 E . ? ASP 291 E ALA 295 E ? ALA 292 E 1 -7.82  
11 PRO 359 E . ? PRO 356 E ASN 360 E ? ASN 357 E 1 18.26  
12 ASP 294 F . ? ASP 291 F ALA 295 F ? ALA 292 F 1 -6.22  
13 PRO 359 F . ? PRO 356 F ASN 360 F ? ASN 357 F 1 19.95  
14 ARG 490 F . ? ARG 487 F GLU 491 F ? GLU 488 F 1 6.32   
15 ASP 294 G . ? ASP 291 G ALA 295 G ? ALA 292 G 1 -4.88  
16 PRO 359 G . ? PRO 356 G ASN 360 G ? ASN 357 G 1 17.75  
17 ASP 294 H . ? ASP 291 H ALA 295 H ? ALA 292 H 1 -9.13  
18 PRO 359 H . ? PRO 356 H ASN 360 H ? ASN 357 H 1 17.19  
19 ASP 294 I . ? ASP 291 I ALA 295 I ? ALA 292 I 1 -7.59  
20 PRO 359 I . ? PRO 356 I ASN 360 I ? ASN 357 I 1 16.37  
21 ASP 294 J . ? ASP 291 J ALA 295 J ? ALA 292 J 1 1.28   
22 PRO 359 J . ? PRO 356 J ASN 360 J ? ASN 357 J 1 10.69  
23 ASP 294 K . ? ASP 291 K ALA 295 K ? ALA 292 K 1 -1.35  
24 PRO 359 K . ? PRO 356 K ASN 360 K ? ASN 357 K 1 12.58  
25 ASP 294 L . ? ASP 291 L ALA 295 L ? ALA 292 L 1 -4.67  
26 PRO 359 L . ? PRO 356 L ASN 360 L ? ASN 357 L 1 9.79   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 2  ? 
AA3 ? 20 ? 
AA4 ? 6  ? 
AA5 ? 20 ? 
AA6 ? 2  ? 
AA7 ? 3  ? 
AA8 ? 2  ? 
AA9 ? 6  ? 
AB1 ? 2  ? 
AB2 ? 3  ? 
AB3 ? 2  ? 
AB4 ? 6  ? 
AB5 ? 2  ? 
AB6 ? 3  ? 
AB7 ? 2  ? 
AB8 ? 6  ? 
AB9 ? 2  ? 
AC1 ? 3  ? 
AC2 ? 2  ? 
AC3 ? 20 ? 
AC4 ? 5  ? 
AC5 ? 20 ? 
AC6 ? 2  ? 
AC7 ? 3  ? 
AC8 ? 2  ? 
AC9 ? 5  ? 
AD1 ? 2  ? 
AD2 ? 6  ? 
AD3 ? 2  ? 
AD4 ? 6  ? 
AD5 ? 6  ? 
AD6 ? 2  ? 
AD7 ? 6  ? 
AD8 ? 2  ? 
AD9 ? 3  ? 
AE1 ? 2  ? 
AE2 ? 20 ? 
AE3 ? 6  ? 
AE4 ? 20 ? 
AE5 ? 2  ? 
AE6 ? 2  ? 
AE7 ? 6  ? 
AE8 ? 2  ? 
AE9 ? 2  ? 
AF1 ? 6  ? 
AF2 ? 2  ? 
AF3 ? 3  ? 
AF4 ? 2  ? 
AF5 ? 6  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? parallel      
AA1 2  3  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? parallel      
AA3 3  4  ? parallel      
AA3 4  5  ? parallel      
AA3 5  6  ? parallel      
AA3 6  7  ? parallel      
AA3 7  8  ? parallel      
AA3 8  9  ? anti-parallel 
AA3 9  10 ? anti-parallel 
AA3 10 11 ? anti-parallel 
AA3 11 12 ? anti-parallel 
AA3 12 13 ? anti-parallel 
AA3 13 14 ? parallel      
AA3 14 15 ? parallel      
AA3 15 16 ? parallel      
AA3 16 17 ? parallel      
AA3 17 18 ? parallel      
AA3 18 19 ? parallel      
AA3 19 20 ? anti-parallel 
AA4 1  2  ? parallel      
AA4 2  3  ? parallel      
AA4 3  4  ? parallel      
AA4 4  5  ? parallel      
AA4 5  6  ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA5 2  3  ? parallel      
AA5 3  4  ? parallel      
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? anti-parallel 
AA5 9  10 ? anti-parallel 
AA5 10 11 ? anti-parallel 
AA5 11 12 ? anti-parallel 
AA5 12 13 ? anti-parallel 
AA5 13 14 ? parallel      
AA5 14 15 ? parallel      
AA5 15 16 ? parallel      
AA5 16 17 ? parallel      
AA5 17 18 ? parallel      
AA5 18 19 ? parallel      
AA5 19 20 ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA7 1  2  ? parallel      
AA7 2  3  ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA9 1  2  ? parallel      
AA9 2  3  ? parallel      
AA9 3  4  ? parallel      
AA9 4  5  ? parallel      
AA9 5  6  ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB2 1  2  ? parallel      
AB2 2  3  ? anti-parallel 
AB3 1  2  ? anti-parallel 
AB4 1  2  ? parallel      
AB4 2  3  ? parallel      
AB4 3  4  ? parallel      
AB4 4  5  ? parallel      
AB4 5  6  ? anti-parallel 
AB5 1  2  ? anti-parallel 
AB6 1  2  ? parallel      
AB6 2  3  ? anti-parallel 
AB7 1  2  ? anti-parallel 
AB8 1  2  ? parallel      
AB8 2  3  ? parallel      
AB8 3  4  ? parallel      
AB8 4  5  ? parallel      
AB8 5  6  ? anti-parallel 
AB9 1  2  ? anti-parallel 
AC1 1  2  ? parallel      
AC1 2  3  ? anti-parallel 
AC2 1  2  ? anti-parallel 
AC3 1  2  ? anti-parallel 
AC3 2  3  ? parallel      
AC3 3  4  ? parallel      
AC3 4  5  ? parallel      
AC3 5  6  ? parallel      
AC3 6  7  ? parallel      
AC3 7  8  ? parallel      
AC3 8  9  ? anti-parallel 
AC3 9  10 ? anti-parallel 
AC3 10 11 ? anti-parallel 
AC3 11 12 ? anti-parallel 
AC3 12 13 ? anti-parallel 
AC3 13 14 ? parallel      
AC3 14 15 ? parallel      
AC3 15 16 ? parallel      
AC3 16 17 ? parallel      
AC3 17 18 ? parallel      
AC3 18 19 ? parallel      
AC3 19 20 ? anti-parallel 
AC4 1  2  ? parallel      
AC4 2  3  ? parallel      
AC4 3  4  ? parallel      
AC4 4  5  ? anti-parallel 
AC5 1  2  ? anti-parallel 
AC5 2  3  ? parallel      
AC5 3  4  ? parallel      
AC5 4  5  ? parallel      
AC5 5  6  ? parallel      
AC5 6  7  ? parallel      
AC5 7  8  ? parallel      
AC5 8  9  ? anti-parallel 
AC5 9  10 ? anti-parallel 
AC5 10 11 ? anti-parallel 
AC5 11 12 ? anti-parallel 
AC5 12 13 ? anti-parallel 
AC5 13 14 ? parallel      
AC5 14 15 ? parallel      
AC5 15 16 ? parallel      
AC5 16 17 ? parallel      
AC5 17 18 ? parallel      
AC5 18 19 ? parallel      
AC5 19 20 ? anti-parallel 
AC6 1  2  ? anti-parallel 
AC7 1  2  ? parallel      
AC7 2  3  ? anti-parallel 
AC8 1  2  ? anti-parallel 
AC9 1  2  ? parallel      
AC9 2  3  ? parallel      
AC9 3  4  ? parallel      
AC9 4  5  ? anti-parallel 
AD1 1  2  ? anti-parallel 
AD2 1  2  ? parallel      
AD2 2  3  ? anti-parallel 
AD2 3  4  ? anti-parallel 
AD2 4  5  ? anti-parallel 
AD2 5  6  ? parallel      
AD3 1  2  ? anti-parallel 
AD4 1  2  ? parallel      
AD4 2  3  ? parallel      
AD4 3  4  ? parallel      
AD4 4  5  ? parallel      
AD4 5  6  ? anti-parallel 
AD5 1  2  ? parallel      
AD5 2  3  ? anti-parallel 
AD5 3  4  ? anti-parallel 
AD5 4  5  ? anti-parallel 
AD5 5  6  ? parallel      
AD6 1  2  ? anti-parallel 
AD7 1  2  ? parallel      
AD7 2  3  ? parallel      
AD7 3  4  ? parallel      
AD7 4  5  ? parallel      
AD7 5  6  ? anti-parallel 
AD8 1  2  ? anti-parallel 
AD9 1  2  ? parallel      
AD9 2  3  ? anti-parallel 
AE1 1  2  ? anti-parallel 
AE2 1  2  ? anti-parallel 
AE2 2  3  ? parallel      
AE2 3  4  ? parallel      
AE2 4  5  ? parallel      
AE2 5  6  ? parallel      
AE2 6  7  ? parallel      
AE2 7  8  ? parallel      
AE2 8  9  ? anti-parallel 
AE2 9  10 ? anti-parallel 
AE2 10 11 ? anti-parallel 
AE2 11 12 ? anti-parallel 
AE2 12 13 ? anti-parallel 
AE2 13 14 ? parallel      
AE2 14 15 ? parallel      
AE2 15 16 ? parallel      
AE2 16 17 ? parallel      
AE2 17 18 ? parallel      
AE2 18 19 ? parallel      
AE2 19 20 ? anti-parallel 
AE3 1  2  ? parallel      
AE3 2  3  ? parallel      
AE3 3  4  ? parallel      
AE3 4  5  ? parallel      
AE3 5  6  ? anti-parallel 
AE4 1  2  ? anti-parallel 
AE4 2  3  ? parallel      
AE4 3  4  ? parallel      
AE4 4  5  ? parallel      
AE4 5  6  ? parallel      
AE4 6  7  ? parallel      
AE4 7  8  ? parallel      
AE4 8  9  ? anti-parallel 
AE4 9  10 ? anti-parallel 
AE4 10 11 ? anti-parallel 
AE4 11 12 ? anti-parallel 
AE4 12 13 ? anti-parallel 
AE4 13 14 ? parallel      
AE4 14 15 ? parallel      
AE4 15 16 ? parallel      
AE4 16 17 ? parallel      
AE4 17 18 ? parallel      
AE4 18 19 ? parallel      
AE4 19 20 ? anti-parallel 
AE5 1  2  ? anti-parallel 
AE6 1  2  ? anti-parallel 
AE7 1  2  ? parallel      
AE7 2  3  ? parallel      
AE7 3  4  ? parallel      
AE7 4  5  ? parallel      
AE7 5  6  ? anti-parallel 
AE8 1  2  ? anti-parallel 
AE9 1  2  ? anti-parallel 
AF1 1  2  ? parallel      
AF1 2  3  ? parallel      
AF1 3  4  ? parallel      
AF1 4  5  ? parallel      
AF1 5  6  ? anti-parallel 
AF2 1  2  ? anti-parallel 
AF3 1  2  ? parallel      
AF3 2  3  ? anti-parallel 
AF4 1  2  ? anti-parallel 
AF5 1  2  ? parallel      
AF5 2  3  ? parallel      
AF5 3  4  ? parallel      
AF5 4  5  ? parallel      
AF5 5  6  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  THR A 6   ? ILE A 7   ? THR A 3   ILE A 4   
AA1 2  GLU A 32  ? ASP A 38  ? GLU A 29  ASP A 35  
AA1 3  SER A 22  ? ASN A 27  ? SER A 19  ASN A 24  
AA2 1  HIS A 9   ? LEU A 10  ? HIS A 6   LEU A 7   
AA2 2  LEU A 15  ? VAL A 16  ? LEU A 12  VAL A 13  
AA3 1  THR B 348 ? VAL B 351 ? THR B 345 VAL B 348 
AA3 2  THR B 370 ? ASP B 373 ? THR B 367 ASP B 370 
AA3 3  VAL B 390 ? VAL B 396 ? VAL B 387 VAL B 393 
AA3 4  LEU B 286 ? VAL B 292 ? LEU B 283 VAL B 289 
AA3 5  ASN B 254 ? VAL B 258 ? ASN B 251 VAL B 255 
AA3 6  GLY B 414 ? PHE B 418 ? GLY B 411 PHE B 415 
AA3 7  MET B 436 ? ILE B 439 ? MET B 433 ILE B 436 
AA3 8  THR A 475 ? ARG A 483 ? THR A 472 ARG A 480 
AA3 9  ILE A 133 ? PRO A 141 ? ILE A 130 PRO A 138 
AA3 10 GLY A 123 ? GLY A 130 ? GLY A 120 GLY A 127 
AA3 11 GLY D 123 ? GLY D 130 ? GLY D 120 GLY D 127 
AA3 12 ILE D 133 ? PRO D 141 ? ILE D 130 PRO D 138 
AA3 13 THR D 475 ? GLN D 482 ? THR D 472 GLN D 479 
AA3 14 MET C 436 ? ILE C 439 ? MET C 433 ILE C 436 
AA3 15 GLY C 414 ? PHE C 418 ? GLY C 411 PHE C 415 
AA3 16 ASN C 254 ? VAL C 258 ? ASN C 251 VAL C 255 
AA3 17 LEU C 286 ? VAL C 292 ? LEU C 283 VAL C 289 
AA3 18 VAL C 390 ? VAL C 396 ? VAL C 387 VAL C 393 
AA3 19 THR C 370 ? ASP C 373 ? THR C 367 ASP C 370 
AA3 20 THR C 348 ? VAL C 351 ? THR C 345 VAL C 348 
AA4 1  MET A 201 ? VAL A 203 ? MET A 198 VAL A 200 
AA4 2  CYS A 171 ? LYS A 175 ? CYS A 168 LYS A 172 
AA4 3  VAL A 144 ? ILE A 148 ? VAL A 141 ILE A 145 
AA4 4  VAL A 220 ? VAL A 226 ? VAL A 217 VAL A 223 
AA4 5  ARG A 245 ? LEU A 249 ? ARG A 242 LEU A 246 
AA4 6  LEU A 459 ? PHE A 460 ? LEU A 456 PHE A 457 
AA5 1  THR A 348 ? VAL A 351 ? THR A 345 VAL A 348 
AA5 2  THR A 370 ? ASP A 373 ? THR A 367 ASP A 370 
AA5 3  VAL A 390 ? VAL A 396 ? VAL A 387 VAL A 393 
AA5 4  LEU A 286 ? VAL A 292 ? LEU A 283 VAL A 289 
AA5 5  ASN A 254 ? VAL A 258 ? ASN A 251 VAL A 255 
AA5 6  GLY A 414 ? PHE A 418 ? GLY A 411 PHE A 415 
AA5 7  MET A 436 ? ILE A 439 ? MET A 433 ILE A 436 
AA5 8  THR B 475 ? ARG B 483 ? THR B 472 ARG B 480 
AA5 9  ILE B 133 ? PRO B 141 ? ILE B 130 PRO B 138 
AA5 10 GLY B 123 ? GLY B 130 ? GLY B 120 GLY B 127 
AA5 11 GLY C 123 ? GLY C 130 ? GLY C 120 GLY C 127 
AA5 12 ILE C 133 ? PRO C 141 ? ILE C 130 PRO C 138 
AA5 13 THR C 475 ? GLN C 482 ? THR C 472 GLN C 479 
AA5 14 MET D 436 ? ILE D 439 ? MET D 433 ILE D 436 
AA5 15 GLY D 414 ? PHE D 418 ? GLY D 411 PHE D 415 
AA5 16 ASN D 254 ? VAL D 258 ? ASN D 251 VAL D 255 
AA5 17 LEU D 286 ? VAL D 292 ? LEU D 283 VAL D 289 
AA5 18 VAL D 390 ? VAL D 396 ? VAL D 387 VAL D 393 
AA5 19 THR D 370 ? ASP D 373 ? THR D 367 ASP D 370 
AA5 20 THR D 348 ? VAL D 351 ? THR D 345 VAL D 348 
AA6 1  TYR A 411 ? GLY A 412 ? TYR A 408 GLY A 409 
AA6 2  TRP A 455 ? LYS A 456 ? TRP A 452 LYS A 453 
AA7 1  THR B 6   ? ILE B 7   ? THR B 3   ILE B 4   
AA7 2  GLU B 32  ? ASP B 38  ? GLU B 29  ASP B 35  
AA7 3  SER B 22  ? ASN B 27  ? SER B 19  ASN B 24  
AA8 1  HIS B 9   ? ILE B 11  ? HIS B 6   ILE B 8   
AA8 2  GLN B 14  ? VAL B 16  ? GLN B 11  VAL B 13  
AA9 1  MET B 201 ? VAL B 203 ? MET B 198 VAL B 200 
AA9 2  CYS B 171 ? LYS B 175 ? CYS B 168 LYS B 172 
AA9 3  VAL B 144 ? ILE B 148 ? VAL B 141 ILE B 145 
AA9 4  VAL B 220 ? VAL B 226 ? VAL B 217 VAL B 223 
AA9 5  ARG B 245 ? LEU B 249 ? ARG B 242 LEU B 246 
AA9 6  LEU B 459 ? PHE B 460 ? LEU B 456 PHE B 457 
AB1 1  TYR B 411 ? GLY B 412 ? TYR B 408 GLY B 409 
AB1 2  TRP B 455 ? LYS B 456 ? TRP B 452 LYS B 453 
AB2 1  THR C 6   ? ILE C 7   ? THR C 3   ILE C 4   
AB2 2  ILE C 33  ? ASP C 38  ? ILE C 30  ASP C 35  
AB2 3  SER C 22  ? PHE C 26  ? SER C 19  PHE C 23  
AB3 1  HIS C 9   ? ILE C 11  ? HIS C 6   ILE C 8   
AB3 2  GLN C 14  ? VAL C 16  ? GLN C 11  VAL C 13  
AB4 1  MET C 201 ? VAL C 203 ? MET C 198 VAL C 200 
AB4 2  CYS C 171 ? LYS C 175 ? CYS C 168 LYS C 172 
AB4 3  VAL C 144 ? ILE C 148 ? VAL C 141 ILE C 145 
AB4 4  VAL C 220 ? VAL C 226 ? VAL C 217 VAL C 223 
AB4 5  ARG C 245 ? LEU C 249 ? ARG C 242 LEU C 246 
AB4 6  LEU C 459 ? PHE C 460 ? LEU C 456 PHE C 457 
AB5 1  TYR C 411 ? GLY C 412 ? TYR C 408 GLY C 409 
AB5 2  TRP C 455 ? LYS C 456 ? TRP C 452 LYS C 453 
AB6 1  THR D 6   ? ILE D 7   ? THR D 3   ILE D 4   
AB6 2  ILE D 33  ? ASP D 38  ? ILE D 30  ASP D 35  
AB6 3  SER D 22  ? PHE D 26  ? SER D 19  PHE D 23  
AB7 1  HIS D 9   ? ILE D 11  ? HIS D 6   ILE D 8   
AB7 2  GLN D 14  ? VAL D 16  ? GLN D 11  VAL D 13  
AB8 1  MET D 201 ? VAL D 203 ? MET D 198 VAL D 200 
AB8 2  CYS D 171 ? LYS D 175 ? CYS D 168 LYS D 172 
AB8 3  VAL D 144 ? ILE D 148 ? VAL D 141 ILE D 145 
AB8 4  VAL D 220 ? VAL D 226 ? VAL D 217 VAL D 223 
AB8 5  ARG D 245 ? LEU D 249 ? ARG D 242 LEU D 246 
AB8 6  LEU D 459 ? PHE D 460 ? LEU D 456 PHE D 457 
AB9 1  TYR D 411 ? GLY D 412 ? TYR D 408 GLY D 409 
AB9 2  TRP D 455 ? LYS D 456 ? TRP D 452 LYS D 453 
AC1 1  THR E 6   ? ILE E 7   ? THR E 3   ILE E 4   
AC1 2  GLU E 32  ? ASP E 38  ? GLU E 29  ASP E 35  
AC1 3  SER E 22  ? ASN E 27  ? SER E 19  ASN E 24  
AC2 1  HIS E 9   ? ILE E 11  ? HIS E 6   ILE E 8   
AC2 2  GLN E 14  ? VAL E 16  ? GLN E 11  VAL E 13  
AC3 1  THR F 348 ? VAL F 351 ? THR F 345 VAL F 348 
AC3 2  THR F 370 ? ASP F 373 ? THR F 367 ASP F 370 
AC3 3  VAL F 390 ? VAL F 396 ? VAL F 387 VAL F 393 
AC3 4  VAL F 288 ? VAL F 292 ? VAL F 285 VAL F 289 
AC3 5  HIS F 255 ? VAL F 258 ? HIS F 252 VAL F 255 
AC3 6  GLY F 414 ? PHE F 418 ? GLY F 411 PHE F 415 
AC3 7  MET F 436 ? ILE F 439 ? MET F 433 ILE F 436 
AC3 8  THR E 475 ? ARG E 483 ? THR E 472 ARG E 480 
AC3 9  ILE E 133 ? PRO E 141 ? ILE E 130 PRO E 138 
AC3 10 GLY E 123 ? GLY E 130 ? GLY E 120 GLY E 127 
AC3 11 GLY H 123 ? GLY H 130 ? GLY H 120 GLY H 127 
AC3 12 ILE H 133 ? PRO H 141 ? ILE H 130 PRO H 138 
AC3 13 THR H 475 ? ARG H 483 ? THR H 472 ARG H 480 
AC3 14 MET G 436 ? ILE G 439 ? MET G 433 ILE G 436 
AC3 15 GLY G 414 ? PHE G 418 ? GLY G 411 PHE G 415 
AC3 16 ASN G 254 ? VAL G 258 ? ASN G 251 VAL G 255 
AC3 17 LEU G 286 ? VAL G 292 ? LEU G 283 VAL G 289 
AC3 18 VAL G 390 ? VAL G 396 ? VAL G 387 VAL G 393 
AC3 19 THR G 370 ? ASP G 373 ? THR G 367 ASP G 370 
AC3 20 THR G 348 ? VAL G 351 ? THR G 345 VAL G 348 
AC4 1  CYS E 171 ? PRO E 176 ? CYS E 168 PRO E 173 
AC4 2  VAL E 144 ? THR E 149 ? VAL E 141 THR E 146 
AC4 3  VAL E 220 ? VAL E 226 ? VAL E 217 VAL E 223 
AC4 4  ARG E 245 ? LEU E 249 ? ARG E 242 LEU E 246 
AC4 5  LEU E 459 ? PHE E 460 ? LEU E 456 PHE E 457 
AC5 1  THR E 348 ? VAL E 351 ? THR E 345 VAL E 348 
AC5 2  THR E 370 ? ASP E 373 ? THR E 367 ASP E 370 
AC5 3  VAL E 390 ? VAL E 396 ? VAL E 387 VAL E 393 
AC5 4  LEU E 286 ? VAL E 292 ? LEU E 283 VAL E 289 
AC5 5  ASN E 254 ? VAL E 258 ? ASN E 251 VAL E 255 
AC5 6  GLY E 414 ? PHE E 418 ? GLY E 411 PHE E 415 
AC5 7  MET E 436 ? ILE E 439 ? MET E 433 ILE E 436 
AC5 8  THR F 475 ? ARG F 483 ? THR F 472 ARG F 480 
AC5 9  ILE F 133 ? PRO F 141 ? ILE F 130 PRO F 138 
AC5 10 GLY F 123 ? GLY F 130 ? GLY F 120 GLY F 127 
AC5 11 GLY G 123 ? GLY G 130 ? GLY G 120 GLY G 127 
AC5 12 ILE G 133 ? PRO G 141 ? ILE G 130 PRO G 138 
AC5 13 THR G 475 ? ARG G 483 ? THR G 472 ARG G 480 
AC5 14 MET H 436 ? ILE H 439 ? MET H 433 ILE H 436 
AC5 15 GLY H 414 ? PHE H 418 ? GLY H 411 PHE H 415 
AC5 16 ASN H 254 ? VAL H 258 ? ASN H 251 VAL H 255 
AC5 17 LEU H 286 ? VAL H 292 ? LEU H 283 VAL H 289 
AC5 18 VAL H 390 ? VAL H 396 ? VAL H 387 VAL H 393 
AC5 19 THR H 370 ? ASP H 373 ? THR H 367 ASP H 370 
AC5 20 THR H 348 ? VAL H 351 ? THR H 345 VAL H 348 
AC6 1  TYR E 411 ? GLY E 412 ? TYR E 408 GLY E 409 
AC6 2  TRP E 455 ? LYS E 456 ? TRP E 452 LYS E 453 
AC7 1  THR F 6   ? ILE F 7   ? THR F 3   ILE F 4   
AC7 2  GLU F 32  ? ASP F 38  ? GLU F 29  ASP F 35  
AC7 3  SER F 22  ? ASN F 27  ? SER F 19  ASN F 24  
AC8 1  HIS F 9   ? ILE F 11  ? HIS F 6   ILE F 8   
AC8 2  GLN F 14  ? VAL F 16  ? GLN F 11  VAL F 13  
AC9 1  CYS F 171 ? LYS F 175 ? CYS F 168 LYS F 172 
AC9 2  VAL F 144 ? ILE F 148 ? VAL F 141 ILE F 145 
AC9 3  VAL F 220 ? VAL F 226 ? VAL F 217 VAL F 223 
AC9 4  ARG F 245 ? LEU F 249 ? ARG F 242 LEU F 246 
AC9 5  LEU F 459 ? PHE F 460 ? LEU F 456 PHE F 457 
AD1 1  TYR F 411 ? GLY F 412 ? TYR F 408 GLY F 409 
AD1 2  TRP F 455 ? LYS F 456 ? TRP F 452 LYS F 453 
AD2 1  THR G 6   ? ILE G 7   ? THR G 3   ILE G 4   
AD2 2  GLU G 32  ? ASP G 38  ? GLU G 29  ASP G 35  
AD2 3  ARG G 21  ? ASN G 27  ? ARG G 18  ASN G 24  
AD2 4  ARG J 21  ? ASN J 27  ? ARG J 18  ASN J 24  
AD2 5  GLU J 32  ? ASP J 38  ? GLU J 29  ASP J 35  
AD2 6  THR J 6   ? ILE J 7   ? THR J 3   ILE J 4   
AD3 1  HIS G 9   ? ILE G 11  ? HIS G 6   ILE G 8   
AD3 2  GLN G 14  ? VAL G 16  ? GLN G 11  VAL G 13  
AD4 1  MET G 201 ? VAL G 203 ? MET G 198 VAL G 200 
AD4 2  CYS G 171 ? LYS G 175 ? CYS G 168 LYS G 172 
AD4 3  VAL G 144 ? ILE G 148 ? VAL G 141 ILE G 145 
AD4 4  VAL G 220 ? VAL G 226 ? VAL G 217 VAL G 223 
AD4 5  ARG G 245 ? LEU G 249 ? ARG G 242 LEU G 246 
AD4 6  LEU G 459 ? PHE G 460 ? LEU G 456 PHE G 457 
AD5 1  THR H 6   ? ILE H 7   ? THR H 3   ILE H 4   
AD5 2  ILE H 33  ? ASP H 38  ? ILE H 30  ASP H 35  
AD5 3  ARG H 21  ? PHE H 26  ? ARG H 18  PHE H 23  
AD5 4  SER K 22  ? PHE K 26  ? SER K 19  PHE K 23  
AD5 5  ILE K 33  ? ASP K 38  ? ILE K 30  ASP K 35  
AD5 6  THR K 6   ? ILE K 7   ? THR K 3   ILE K 4   
AD6 1  HIS H 9   ? LEU H 10  ? HIS H 6   LEU H 7   
AD6 2  LEU H 15  ? VAL H 16  ? LEU H 12  VAL H 13  
AD7 1  MET H 201 ? VAL H 203 ? MET H 198 VAL H 200 
AD7 2  CYS H 171 ? LYS H 175 ? CYS H 168 LYS H 172 
AD7 3  VAL H 144 ? ILE H 148 ? VAL H 141 ILE H 145 
AD7 4  VAL H 220 ? VAL H 226 ? VAL H 217 VAL H 223 
AD7 5  ARG H 245 ? LEU H 249 ? ARG H 242 LEU H 246 
AD7 6  LEU H 459 ? PHE H 460 ? LEU H 456 PHE H 457 
AD8 1  TYR H 411 ? GLY H 412 ? TYR H 408 GLY H 409 
AD8 2  TRP H 455 ? LYS H 456 ? TRP H 452 LYS H 453 
AD9 1  THR I 6   ? ILE I 7   ? THR I 3   ILE I 4   
AD9 2  GLU I 32  ? ASP I 38  ? GLU I 29  ASP I 35  
AD9 3  SER I 22  ? ASN I 27  ? SER I 19  ASN I 24  
AE1 1  HIS I 9   ? ILE I 11  ? HIS I 6   ILE I 8   
AE1 2  GLN I 14  ? VAL I 16  ? GLN I 11  VAL I 13  
AE2 1  THR K 348 ? VAL K 351 ? THR K 345 VAL K 348 
AE2 2  THR K 370 ? VAL K 375 ? THR K 367 VAL K 372 
AE2 3  VAL K 390 ? VAL K 396 ? VAL K 387 VAL K 393 
AE2 4  LEU K 286 ? VAL K 292 ? LEU K 283 VAL K 289 
AE2 5  ASN K 254 ? VAL K 258 ? ASN K 251 VAL K 255 
AE2 6  GLY K 414 ? PHE K 418 ? GLY K 411 PHE K 415 
AE2 7  MET K 436 ? ILE K 439 ? MET K 433 ILE K 436 
AE2 8  THR J 475 ? ARG J 483 ? THR J 472 ARG J 480 
AE2 9  ILE J 133 ? PRO J 141 ? ILE J 130 PRO J 138 
AE2 10 GLY J 123 ? GLY J 130 ? GLY J 120 GLY J 127 
AE2 11 GLY I 123 ? GLY I 130 ? GLY I 120 GLY I 127 
AE2 12 ILE I 133 ? PRO I 141 ? ILE I 130 PRO I 138 
AE2 13 THR I 475 ? GLN I 482 ? THR I 472 GLN I 479 
AE2 14 MET L 436 ? ILE L 439 ? MET L 433 ILE L 436 
AE2 15 GLY L 414 ? PHE L 418 ? GLY L 411 PHE L 415 
AE2 16 ASN L 254 ? VAL L 258 ? ASN L 251 VAL L 255 
AE2 17 LEU L 286 ? VAL L 292 ? LEU L 283 VAL L 289 
AE2 18 VAL L 390 ? VAL L 396 ? VAL L 387 VAL L 393 
AE2 19 THR L 370 ? ASP L 373 ? THR L 367 ASP L 370 
AE2 20 THR L 348 ? VAL L 351 ? THR L 345 VAL L 348 
AE3 1  MET I 201 ? VAL I 203 ? MET I 198 VAL I 200 
AE3 2  CYS I 171 ? LYS I 175 ? CYS I 168 LYS I 172 
AE3 3  VAL I 144 ? ILE I 148 ? VAL I 141 ILE I 145 
AE3 4  VAL I 220 ? VAL I 226 ? VAL I 217 VAL I 223 
AE3 5  ARG I 245 ? LEU I 249 ? ARG I 242 LEU I 246 
AE3 6  LEU I 459 ? PHE I 460 ? LEU I 456 PHE I 457 
AE4 1  THR I 348 ? VAL I 351 ? THR I 345 VAL I 348 
AE4 2  THR I 370 ? VAL I 375 ? THR I 367 VAL I 372 
AE4 3  VAL I 390 ? VAL I 396 ? VAL I 387 VAL I 393 
AE4 4  LEU I 286 ? VAL I 292 ? LEU I 283 VAL I 289 
AE4 5  ASN I 254 ? VAL I 258 ? ASN I 251 VAL I 255 
AE4 6  GLY I 414 ? PHE I 418 ? GLY I 411 PHE I 415 
AE4 7  MET I 436 ? ILE I 439 ? MET I 433 ILE I 436 
AE4 8  THR L 475 ? GLN L 482 ? THR L 472 GLN L 479 
AE4 9  ILE L 133 ? PRO L 141 ? ILE L 130 PRO L 138 
AE4 10 GLY L 123 ? GLY L 130 ? GLY L 120 GLY L 127 
AE4 11 GLY K 123 ? GLY K 130 ? GLY K 120 GLY K 127 
AE4 12 ILE K 133 ? PRO K 141 ? ILE K 130 PRO K 138 
AE4 13 THR K 475 ? GLN K 482 ? THR K 472 GLN K 479 
AE4 14 MET J 436 ? ILE J 439 ? MET J 433 ILE J 436 
AE4 15 GLY J 414 ? PHE J 418 ? GLY J 411 PHE J 415 
AE4 16 HIS J 255 ? VAL J 258 ? HIS J 252 VAL J 255 
AE4 17 VAL J 288 ? VAL J 292 ? VAL J 285 VAL J 289 
AE4 18 VAL J 390 ? VAL J 396 ? VAL J 387 VAL J 393 
AE4 19 THR J 370 ? ASP J 373 ? THR J 367 ASP J 370 
AE4 20 THR J 348 ? VAL J 351 ? THR J 345 VAL J 348 
AE5 1  TYR I 411 ? GLY I 412 ? TYR I 408 GLY I 409 
AE5 2  TRP I 455 ? LYS I 456 ? TRP I 452 LYS I 453 
AE6 1  HIS J 9   ? ILE J 11  ? HIS J 6   ILE J 8   
AE6 2  GLN J 14  ? VAL J 16  ? GLN J 11  VAL J 13  
AE7 1  MET J 201 ? VAL J 203 ? MET J 198 VAL J 200 
AE7 2  CYS J 171 ? LYS J 175 ? CYS J 168 LYS J 172 
AE7 3  VAL J 144 ? ILE J 148 ? VAL J 141 ILE J 145 
AE7 4  VAL J 220 ? VAL J 226 ? VAL J 217 VAL J 223 
AE7 5  ARG J 245 ? LEU J 249 ? ARG J 242 LEU J 246 
AE7 6  LEU J 459 ? PHE J 460 ? LEU J 456 PHE J 457 
AE8 1  TYR J 411 ? GLY J 412 ? TYR J 408 GLY J 409 
AE8 2  TRP J 455 ? LYS J 456 ? TRP J 452 LYS J 453 
AE9 1  HIS K 9   ? LEU K 10  ? HIS K 6   LEU K 7   
AE9 2  LEU K 15  ? VAL K 16  ? LEU K 12  VAL K 13  
AF1 1  MET K 201 ? VAL K 203 ? MET K 198 VAL K 200 
AF1 2  CYS K 171 ? PRO K 176 ? CYS K 168 PRO K 173 
AF1 3  VAL K 144 ? THR K 149 ? VAL K 141 THR K 146 
AF1 4  VAL K 220 ? VAL K 226 ? VAL K 217 VAL K 223 
AF1 5  ARG K 245 ? LEU K 249 ? ARG K 242 LEU K 246 
AF1 6  LEU K 459 ? PHE K 460 ? LEU K 456 PHE K 457 
AF2 1  TYR K 411 ? GLY K 412 ? TYR K 408 GLY K 409 
AF2 2  TRP K 455 ? LYS K 456 ? TRP K 452 LYS K 453 
AF3 1  THR L 6   ? ILE L 7   ? THR L 3   ILE L 4   
AF3 2  ILE L 33  ? ASP L 38  ? ILE L 30  ASP L 35  
AF3 3  SER L 22  ? PHE L 26  ? SER L 19  PHE L 23  
AF4 1  HIS L 9   ? ILE L 11  ? HIS L 6   ILE L 8   
AF4 2  GLN L 14  ? VAL L 16  ? GLN L 11  VAL L 13  
AF5 1  MET L 201 ? VAL L 203 ? MET L 198 VAL L 200 
AF5 2  CYS L 171 ? LYS L 175 ? CYS L 168 LYS L 172 
AF5 3  VAL L 144 ? ILE L 148 ? VAL L 141 ILE L 145 
AF5 4  VAL L 220 ? VAL L 226 ? VAL L 217 VAL L 223 
AF5 5  ARG L 245 ? LEU L 249 ? ARG L 242 LEU L 246 
AF5 6  LEU L 459 ? PHE L 460 ? LEU L 456 PHE L 457 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N ILE A 7   ? N ILE A 4   O GLN A 36  ? O GLN A 33  
AA1 2  3  O LEU A 37  ? O LEU A 34  N GLN A 23  ? N GLN A 20  
AA2 1  2  N HIS A 9   ? N HIS A 6   O VAL A 16  ? O VAL A 13  
AA3 1  2  N THR B 348 ? N THR B 345 O ASP B 373 ? O ASP B 370 
AA3 2  3  N ILE B 372 ? N ILE B 369 O LEU B 391 ? O LEU B 388 
AA3 3  4  O GLN B 392 ? O GLN B 389 N ALA B 289 ? N ALA B 286 
AA3 4  5  O VAL B 290 ? O VAL B 287 N ALA B 256 ? N ALA B 253 
AA3 5  6  N ILE B 257 ? N ILE B 254 O PHE B 418 ? O PHE B 415 
AA3 6  7  N THR B 415 ? N THR B 412 O MET B 436 ? O MET B 433 
AA3 7  8  O VAL B 437 ? O VAL B 434 N THR A 479 ? N THR A 476 
AA3 8  9  O GLN A 482 ? O GLN A 479 N ASP A 134 ? N ASP A 131 
AA3 9  10 O SER A 135 ? O SER A 132 N SER A 126 ? N SER A 123 
AA3 10 11 N HIS A 125 ? N HIS A 122 O GLY D 123 ? O GLY D 120 
AA3 11 12 N SER D 126 ? N SER D 123 O SER D 135 ? O SER D 132 
AA3 12 13 N ASP D 134 ? N ASP D 131 O GLN D 482 ? O GLN D 479 
AA3 13 14 O THR D 481 ? O THR D 478 N VAL C 437 ? N VAL C 434 
AA3 14 15 O GLY C 438 ? O GLY C 435 N THR C 415 ? N THR C 412 
AA3 15 16 O PHE C 418 ? O PHE C 415 N ILE C 257 ? N ILE C 254 
AA3 16 17 N ALA C 256 ? N ALA C 253 O VAL C 290 ? O VAL C 287 
AA3 17 18 N ALA C 289 ? N ALA C 286 O GLN C 392 ? O GLN C 389 
AA3 18 19 O LEU C 391 ? O LEU C 388 N ILE C 372 ? N ILE C 369 
AA3 19 20 O ASP C 373 ? O ASP C 370 N THR C 348 ? N THR C 345 
AA4 1  2  O ASN A 202 ? O ASN A 199 N LEU A 174 ? N LEU A 171 
AA4 2  3  O LYS A 175 ? O LYS A 172 N GLY A 147 ? N GLY A 144 
AA4 3  4  N ILE A 148 ? N ILE A 145 O SER A 224 ? O SER A 221 
AA4 4  5  N PHE A 225 ? N PHE A 222 O GLN A 247 ? O GLN A 244 
AA4 5  6  N ALA A 248 ? N ALA A 245 O PHE A 460 ? O PHE A 457 
AA5 1  2  N THR A 348 ? N THR A 345 O ASP A 373 ? O ASP A 370 
AA5 2  3  N ILE A 372 ? N ILE A 369 O LEU A 391 ? O LEU A 388 
AA5 3  4  O GLN A 392 ? O GLN A 389 N ALA A 289 ? N ALA A 286 
AA5 4  5  O VAL A 290 ? O VAL A 287 N ALA A 256 ? N ALA A 253 
AA5 5  6  N ILE A 257 ? N ILE A 254 O PHE A 418 ? O PHE A 415 
AA5 6  7  N THR A 415 ? N THR A 412 O MET A 436 ? O MET A 433 
AA5 7  8  N ILE A 439 ? N ILE A 436 O THR B 481 ? O THR B 478 
AA5 8  9  O GLN B 482 ? O GLN B 479 N ASP B 134 ? N ASP B 131 
AA5 9  10 O SER B 135 ? O SER B 132 N SER B 126 ? N SER B 123 
AA5 10 11 N GLY B 123 ? N GLY B 120 O HIS C 125 ? O HIS C 122 
AA5 11 12 N SER C 126 ? N SER C 123 O SER C 135 ? O SER C 132 
AA5 12 13 N GLU C 138 ? N GLU C 135 O LYS C 478 ? O LYS C 475 
AA5 13 14 N THR C 481 ? N THR C 478 O VAL D 437 ? O VAL D 434 
AA5 14 15 O MET D 436 ? O MET D 433 N THR D 415 ? N THR D 412 
AA5 15 16 O PHE D 418 ? O PHE D 415 N ILE D 257 ? N ILE D 254 
AA5 16 17 N ALA D 256 ? N ALA D 253 O VAL D 290 ? O VAL D 287 
AA5 17 18 N ALA D 291 ? N ALA D 288 O VAL D 394 ? O VAL D 391 
AA5 18 19 O LEU D 391 ? O LEU D 388 N ILE D 372 ? N ILE D 369 
AA5 19 20 O ASP D 373 ? O ASP D 370 N THR D 348 ? N THR D 345 
AA6 1  2  N GLY A 412 ? N GLY A 409 O TRP A 455 ? O TRP A 452 
AA7 1  2  N ILE B 7   ? N ILE B 4   O GLN B 36  ? O GLN B 33  
AA7 2  3  O LEU B 37  ? O LEU B 34  N GLN B 23  ? N GLN B 20  
AA8 1  2  N HIS B 9   ? N HIS B 6   O VAL B 16  ? O VAL B 13  
AA9 1  2  O ASN B 202 ? O ASN B 199 N LEU B 174 ? N LEU B 171 
AA9 2  3  O LYS B 175 ? O LYS B 172 N GLY B 147 ? N GLY B 144 
AA9 3  4  N VAL B 144 ? N VAL B 141 O LYS B 221 ? O LYS B 218 
AA9 4  5  N PHE B 225 ? N PHE B 222 O GLN B 247 ? O GLN B 244 
AA9 5  6  N ALA B 248 ? N ALA B 245 O PHE B 460 ? O PHE B 457 
AB1 1  2  O GLY B 412 ? O GLY B 409 N TRP B 455 ? N TRP B 452 
AB2 1  2  N ILE C 7   ? N ILE C 4   O GLN C 36  ? O GLN C 33  
AB2 2  3  O LEU C 37  ? O LEU C 34  N GLN C 23  ? N GLN C 20  
AB3 1  2  N HIS C 9   ? N HIS C 6   O VAL C 16  ? O VAL C 13  
AB4 1  2  O ASN C 202 ? O ASN C 199 N LEU C 174 ? N LEU C 171 
AB4 2  3  O CYS C 171 ? O CYS C 168 N VAL C 145 ? N VAL C 142 
AB4 3  4  N ALA C 146 ? N ALA C 143 O ALA C 222 ? O ALA C 219 
AB4 4  5  N PHE C 225 ? N PHE C 222 O LEU C 249 ? O LEU C 246 
AB4 5  6  N ALA C 248 ? N ALA C 245 O PHE C 460 ? O PHE C 457 
AB5 1  2  N GLY C 412 ? N GLY C 409 O TRP C 455 ? O TRP C 452 
AB6 1  2  N ILE D 7   ? N ILE D 4   O GLN D 36  ? O GLN D 33  
AB6 2  3  O LEU D 37  ? O LEU D 34  N GLN D 23  ? N GLN D 20  
AB7 1  2  N ILE D 11  ? N ILE D 8   O GLN D 14  ? O GLN D 11  
AB8 1  2  O ASN D 202 ? O ASN D 199 N LEU D 174 ? N LEU D 171 
AB8 2  3  O CYS D 171 ? O CYS D 168 N VAL D 145 ? N VAL D 142 
AB8 3  4  N ALA D 146 ? N ALA D 143 O ALA D 222 ? O ALA D 219 
AB8 4  5  N PHE D 225 ? N PHE D 222 O LEU D 249 ? O LEU D 246 
AB8 5  6  N ALA D 248 ? N ALA D 245 O PHE D 460 ? O PHE D 457 
AB9 1  2  N GLY D 412 ? N GLY D 409 O TRP D 455 ? O TRP D 452 
AC1 1  2  N ILE E 7   ? N ILE E 4   O GLN E 36  ? O GLN E 33  
AC1 2  3  O LEU E 37  ? O LEU E 34  N GLN E 23  ? N GLN E 20  
AC2 1  2  N HIS E 9   ? N HIS E 6   O VAL E 16  ? O VAL E 13  
AC3 1  2  N THR F 348 ? N THR F 345 O ASP F 373 ? O ASP F 370 
AC3 2  3  N ILE F 372 ? N ILE F 369 O LEU F 391 ? O LEU F 388 
AC3 3  4  O VAL F 394 ? O VAL F 391 N ALA F 291 ? N ALA F 288 
AC3 4  5  O VAL F 290 ? O VAL F 287 N VAL F 258 ? N VAL F 255 
AC3 5  6  N ILE F 257 ? N ILE F 254 O PHE F 418 ? O PHE F 415 
AC3 6  7  N THR F 415 ? N THR F 412 O GLY F 438 ? O GLY F 435 
AC3 7  8  O VAL F 437 ? O VAL F 434 N THR E 481 ? N THR E 478 
AC3 8  9  O LYS E 478 ? O LYS E 475 N GLU E 138 ? N GLU E 135 
AC3 9  10 O SER E 135 ? O SER E 132 N SER E 126 ? N SER E 123 
AC3 10 11 N GLY E 123 ? N GLY E 120 O HIS H 125 ? O HIS H 122 
AC3 11 12 N SER H 126 ? N SER H 123 O SER H 135 ? O SER H 132 
AC3 12 13 N GLU H 138 ? N GLU H 135 O LYS H 478 ? O LYS H 475 
AC3 13 14 O THR H 481 ? O THR H 478 N VAL G 437 ? N VAL G 434 
AC3 14 15 O GLY G 438 ? O GLY G 435 N THR G 415 ? N THR G 412 
AC3 15 16 O PHE G 418 ? O PHE G 415 N ILE G 257 ? N ILE G 254 
AC3 16 17 N ALA G 256 ? N ALA G 253 O VAL G 290 ? O VAL G 287 
AC3 17 18 N ALA G 289 ? N ALA G 286 O GLN G 392 ? O GLN G 389 
AC3 18 19 O LEU G 391 ? O LEU G 388 N THR G 370 ? N THR G 367 
AC3 19 20 O ASP G 373 ? O ASP G 370 N THR G 348 ? N THR G 345 
AC4 1  2  O LYS E 175 ? O LYS E 172 N GLY E 147 ? N GLY E 144 
AC4 2  3  N ALA E 146 ? N ALA E 143 O ALA E 222 ? O ALA E 219 
AC4 3  4  N PHE E 225 ? N PHE E 222 O LEU E 249 ? O LEU E 246 
AC4 4  5  N ALA E 248 ? N ALA E 245 O PHE E 460 ? O PHE E 457 
AC5 1  2  N THR E 348 ? N THR E 345 O ASP E 373 ? O ASP E 370 
AC5 2  3  N ILE E 372 ? N ILE E 369 O LEU E 391 ? O LEU E 388 
AC5 3  4  O GLN E 392 ? O GLN E 389 N SER E 287 ? N SER E 284 
AC5 4  5  O VAL E 290 ? O VAL E 287 N VAL E 258 ? N VAL E 255 
AC5 5  6  N ILE E 257 ? N ILE E 254 O PHE E 418 ? O PHE E 415 
AC5 6  7  N THR E 415 ? N THR E 412 O MET E 436 ? O MET E 433 
AC5 7  8  N VAL E 437 ? N VAL E 434 O THR F 481 ? O THR F 478 
AC5 8  9  O LYS F 478 ? O LYS F 475 N GLU F 138 ? N GLU F 135 
AC5 9  10 O SER F 135 ? O SER F 132 N SER F 126 ? N SER F 123 
AC5 10 11 N HIS F 125 ? N HIS F 122 O GLY G 123 ? O GLY G 120 
AC5 11 12 N SER G 126 ? N SER G 123 O SER G 135 ? O SER G 132 
AC5 12 13 N GLU G 138 ? N GLU G 135 O LYS G 478 ? O LYS G 475 
AC5 13 14 N THR G 481 ? N THR G 478 O ILE H 439 ? O ILE H 436 
AC5 14 15 O MET H 436 ? O MET H 433 N THR H 415 ? N THR H 412 
AC5 15 16 O CYS H 416 ? O CYS H 413 N ILE H 257 ? N ILE H 254 
AC5 16 17 N VAL H 258 ? N VAL H 255 O VAL H 290 ? O VAL H 287 
AC5 17 18 N ALA H 291 ? N ALA H 288 O VAL H 394 ? O VAL H 391 
AC5 18 19 O LEU H 391 ? O LEU H 388 N ILE H 372 ? N ILE H 369 
AC5 19 20 O ASP H 373 ? O ASP H 370 N THR H 348 ? N THR H 345 
AC6 1  2  N GLY E 412 ? N GLY E 409 O TRP E 455 ? O TRP E 452 
AC7 1  2  N ILE F 7   ? N ILE F 4   O GLN F 36  ? O GLN F 33  
AC7 2  3  O LEU F 37  ? O LEU F 34  N GLN F 23  ? N GLN F 20  
AC8 1  2  N HIS F 9   ? N HIS F 6   O VAL F 16  ? O VAL F 13  
AC9 1  2  O CYS F 171 ? O CYS F 168 N VAL F 145 ? N VAL F 142 
AC9 2  3  N ALA F 146 ? N ALA F 143 O SER F 224 ? O SER F 221 
AC9 3  4  N PHE F 225 ? N PHE F 222 O LEU F 249 ? O LEU F 246 
AC9 4  5  N ALA F 248 ? N ALA F 245 O PHE F 460 ? O PHE F 457 
AD1 1  2  N GLY F 412 ? N GLY F 409 O TRP F 455 ? O TRP F 452 
AD2 1  2  N ILE G 7   ? N ILE G 4   O GLN G 36  ? O GLN G 33  
AD2 2  3  O LEU G 37  ? O LEU G 34  N GLN G 23  ? N GLN G 20  
AD2 3  4  N SER G 22  ? N SER G 19  O SER J 22  ? O SER J 19  
AD2 4  5  N GLN J 23  ? N GLN J 20  O LEU J 37  ? O LEU J 34  
AD2 5  6  O GLN J 36  ? O GLN J 33  N ILE J 7   ? N ILE J 4   
AD3 1  2  N ILE G 11  ? N ILE G 8   O GLN G 14  ? O GLN G 11  
AD4 1  2  O ASN G 202 ? O ASN G 199 N LEU G 174 ? N LEU G 171 
AD4 2  3  O LYS G 175 ? O LYS G 172 N GLY G 147 ? N GLY G 144 
AD4 3  4  N ALA G 146 ? N ALA G 143 O ALA G 222 ? O ALA G 219 
AD4 4  5  N PHE G 225 ? N PHE G 222 O GLN G 247 ? O GLN G 244 
AD4 5  6  N ALA G 248 ? N ALA G 245 O PHE G 460 ? O PHE G 457 
AD5 1  2  N ILE H 7   ? N ILE H 4   O GLN H 36  ? O GLN H 33  
AD5 2  3  O LEU H 37  ? O LEU H 34  N GLN H 23  ? N GLN H 20  
AD5 3  4  N SER H 22  ? N SER H 19  O SER K 22  ? O SER K 19  
AD5 4  5  N GLN K 23  ? N GLN K 20  O LEU K 37  ? O LEU K 34  
AD5 5  6  O GLN K 36  ? O GLN K 33  N ILE K 7   ? N ILE K 4   
AD6 1  2  N HIS H 9   ? N HIS H 6   O VAL H 16  ? O VAL H 13  
AD7 1  2  O ASN H 202 ? O ASN H 199 N LEU H 174 ? N LEU H 171 
AD7 2  3  O CYS H 171 ? O CYS H 168 N VAL H 145 ? N VAL H 142 
AD7 3  4  N ALA H 146 ? N ALA H 143 O ALA H 222 ? O ALA H 219 
AD7 4  5  N PHE H 225 ? N PHE H 222 O LEU H 249 ? O LEU H 246 
AD7 5  6  N ALA H 248 ? N ALA H 245 O PHE H 460 ? O PHE H 457 
AD8 1  2  O GLY H 412 ? O GLY H 409 N TRP H 455 ? N TRP H 452 
AD9 1  2  N ILE I 7   ? N ILE I 4   O ASP I 38  ? O ASP I 35  
AD9 2  3  O LYS I 35  ? O LYS I 32  N VAL I 25  ? N VAL I 22  
AE1 1  2  N HIS I 9   ? N HIS I 6   O VAL I 16  ? O VAL I 13  
AE2 1  2  N THR K 348 ? N THR K 345 O ASP K 373 ? O ASP K 370 
AE2 2  3  N ILE K 372 ? N ILE K 369 O LEU K 391 ? O LEU K 388 
AE2 3  4  O GLN K 392 ? O GLN K 389 N ALA K 289 ? N ALA K 286 
AE2 4  5  O VAL K 290 ? O VAL K 287 N VAL K 258 ? N VAL K 255 
AE2 5  6  N ILE K 257 ? N ILE K 254 O PHE K 418 ? O PHE K 415 
AE2 6  7  N THR K 415 ? N THR K 412 O GLY K 438 ? O GLY K 435 
AE2 7  8  O VAL K 437 ? O VAL K 434 N THR J 481 ? N THR J 478 
AE2 8  9  O LYS J 476 ? O LYS J 473 N GLN J 140 ? N GLN J 137 
AE2 9  10 O SER J 135 ? O SER J 132 N SER J 126 ? N SER J 123 
AE2 10 11 O GLY J 123 ? O GLY J 120 N HIS I 125 ? N HIS I 122 
AE2 11 12 N SER I 126 ? N SER I 123 O SER I 135 ? O SER I 132 
AE2 12 13 N ASP I 134 ? N ASP I 131 O GLN I 482 ? O GLN I 479 
AE2 13 14 N THR I 481 ? N THR I 478 O ILE L 439 ? O ILE L 436 
AE2 14 15 O MET L 436 ? O MET L 433 N THR L 415 ? N THR L 412 
AE2 15 16 O PHE L 418 ? O PHE L 415 N ILE L 257 ? N ILE L 254 
AE2 16 17 N ALA L 256 ? N ALA L 253 O VAL L 290 ? O VAL L 287 
AE2 17 18 N ALA L 289 ? N ALA L 286 O GLN L 392 ? O GLN L 389 
AE2 18 19 O LEU L 391 ? O LEU L 388 N THR L 370 ? N THR L 367 
AE2 19 20 O ASP L 373 ? O ASP L 370 N THR L 348 ? N THR L 345 
AE3 1  2  O ASN I 202 ? O ASN I 199 N LEU I 174 ? N LEU I 171 
AE3 2  3  O LYS I 175 ? O LYS I 172 N GLY I 147 ? N GLY I 144 
AE3 3  4  N ALA I 146 ? N ALA I 143 O ALA I 222 ? O ALA I 219 
AE3 4  5  N PHE I 225 ? N PHE I 222 O GLN I 247 ? O GLN I 244 
AE3 5  6  N ALA I 248 ? N ALA I 245 O PHE I 460 ? O PHE I 457 
AE4 1  2  N THR I 348 ? N THR I 345 O ASP I 373 ? O ASP I 370 
AE4 2  3  N ILE I 372 ? N ILE I 369 O LEU I 391 ? O LEU I 388 
AE4 3  4  O GLN I 392 ? O GLN I 389 N SER I 287 ? N SER I 284 
AE4 4  5  O VAL I 290 ? O VAL I 287 N VAL I 258 ? N VAL I 255 
AE4 5  6  N ILE I 257 ? N ILE I 254 O PHE I 418 ? O PHE I 415 
AE4 6  7  N THR I 415 ? N THR I 412 O MET I 436 ? O MET I 433 
AE4 7  8  N VAL I 437 ? N VAL I 434 O THR L 481 ? O THR L 478 
AE4 8  9  O GLN L 482 ? O GLN L 479 N ASP L 134 ? N ASP L 131 
AE4 9  10 O SER L 135 ? O SER L 132 N SER L 126 ? N SER L 123 
AE4 10 11 O HIS L 125 ? O HIS L 122 N GLY K 123 ? N GLY K 120 
AE4 11 12 N SER K 126 ? N SER K 123 O SER K 135 ? O SER K 132 
AE4 12 13 N GLU K 138 ? N GLU K 135 O LYS K 478 ? O LYS K 475 
AE4 13 14 O THR K 479 ? O THR K 476 N VAL J 437 ? N VAL J 434 
AE4 14 15 O GLY J 438 ? O GLY J 435 N THR J 415 ? N THR J 412 
AE4 15 16 O PHE J 418 ? O PHE J 415 N ILE J 257 ? N ILE J 254 
AE4 16 17 N ALA J 256 ? N ALA J 253 O VAL J 290 ? O VAL J 287 
AE4 17 18 N ALA J 289 ? N ALA J 286 O GLN J 392 ? O GLN J 389 
AE4 18 19 O VAL J 393 ? O VAL J 390 N ILE J 372 ? N ILE J 369 
AE4 19 20 O ASP J 373 ? O ASP J 370 N THR J 348 ? N THR J 345 
AE5 1  2  N GLY I 412 ? N GLY I 409 O TRP I 455 ? O TRP I 452 
AE6 1  2  N ILE J 11  ? N ILE J 8   O GLN J 14  ? O GLN J 11  
AE7 1  2  O ASN J 202 ? O ASN J 199 N LEU J 174 ? N LEU J 171 
AE7 2  3  O CYS J 171 ? O CYS J 168 N VAL J 145 ? N VAL J 142 
AE7 3  4  N ALA J 146 ? N ALA J 143 O ALA J 222 ? O ALA J 219 
AE7 4  5  N PHE J 225 ? N PHE J 222 O LEU J 249 ? O LEU J 246 
AE7 5  6  N ALA J 248 ? N ALA J 245 O PHE J 460 ? O PHE J 457 
AE8 1  2  N GLY J 412 ? N GLY J 409 O TRP J 455 ? O TRP J 452 
AE9 1  2  N HIS K 9   ? N HIS K 6   O VAL K 16  ? O VAL K 13  
AF1 1  2  O ASN K 202 ? O ASN K 199 N LEU K 174 ? N LEU K 171 
AF1 2  3  O CYS K 171 ? O CYS K 168 N VAL K 145 ? N VAL K 142 
AF1 3  4  N ALA K 146 ? N ALA K 143 O SER K 224 ? O SER K 221 
AF1 4  5  N PHE K 225 ? N PHE K 222 O LEU K 249 ? O LEU K 246 
AF1 5  6  N ALA K 248 ? N ALA K 245 O PHE K 460 ? O PHE K 457 
AF2 1  2  N GLY K 412 ? N GLY K 409 O TRP K 455 ? O TRP K 452 
AF3 1  2  N ILE L 7   ? N ILE L 4   O ASP L 38  ? O ASP L 35  
AF3 2  3  O LEU L 37  ? O LEU L 34  N GLN L 23  ? N GLN L 20  
AF4 1  2  N HIS L 9   ? N HIS L 6   O VAL L 16  ? O VAL L 13  
AF5 1  2  O ASN L 202 ? O ASN L 199 N LEU L 174 ? N LEU L 171 
AF5 2  3  O LYS L 175 ? O LYS L 172 N GLY L 147 ? N GLY L 144 
AF5 3  4  N ALA L 146 ? N ALA L 143 O ALA L 222 ? O ALA L 219 
AF5 4  5  N PHE L 225 ? N PHE L 222 O GLN L 247 ? O GLN L 244 
AF5 5  6  N ALA L 248 ? N ALA L 245 O PHE L 460 ? O PHE L 457 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NAD 501 ? 24 'binding site for residue NAD A 501' 
AC2 Software C NAD 501 ? 21 'binding site for residue NAD C 501' 
AC3 Software D NAD 501 ? 21 'binding site for residue NAD D 501' 
AC4 Software E NAD 501 ? 25 'binding site for residue NAD E 501' 
AC5 Software I NAD 501 ? 26 'binding site for residue NAD I 501' 
AC6 Software L NAD 501 ? 25 'binding site for residue NAD L 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 24 THR A  149 ? THR A 146 . ? 1_555 ? 
2   AC1 24 PRO A  150 ? PRO A 147 . ? 1_555 ? 
3   AC1 24 PHE A  151 ? PHE A 148 . ? 1_555 ? 
4   AC1 24 ASN A  152 ? ASN A 149 . ? 1_555 ? 
5   AC1 24 LYS A  175 ? LYS A 172 . ? 1_555 ? 
6   AC1 24 PRO A  176 ? PRO A 173 . ? 1_555 ? 
7   AC1 24 SER A  177 ? SER A 174 . ? 1_555 ? 
8   AC1 24 GLU A  178 ? GLU A 175 . ? 1_555 ? 
9   AC1 24 ARG A  179 ? ARG A 176 . ? 1_555 ? 
10  AC1 24 LYS A  208 ? LYS A 205 . ? 1_555 ? 
11  AC1 24 VAL A  211 ? VAL A 208 . ? 1_555 ? 
12  AC1 24 PHE A  225 ? PHE A 222 . ? 1_555 ? 
13  AC1 24 VAL A  226 ? VAL A 223 . ? 1_555 ? 
14  AC1 24 GLY A  227 ? GLY A 224 . ? 1_555 ? 
15  AC1 24 SER A  228 ? SER A 225 . ? 1_555 ? 
16  AC1 24 ILE A  231 ? ILE A 228 . ? 1_555 ? 
17  AC1 24 LEU A  249 ? LEU A 246 . ? 1_555 ? 
18  AC1 24 GLY A  250 ? GLY A 247 . ? 1_555 ? 
19  AC1 24 GLY A  251 ? GLY A 248 . ? 1_555 ? 
20  AC1 24 CYS A  283 ? CYS A 280 . ? 1_555 ? 
21  AC1 24 GLU A  385 ? GLU A 382 . ? 1_555 ? 
22  AC1 24 PHE A  387 ? PHE A 384 . ? 1_555 ? 
23  AC1 24 ASN A  413 ? ASN A 410 . ? 1_555 ? 
24  AC1 24 PHE A  452 ? PHE A 449 . ? 1_555 ? 
25  AC2 21 THR C  149 ? THR C 146 . ? 1_555 ? 
26  AC2 21 PRO C  150 ? PRO C 147 . ? 1_555 ? 
27  AC2 21 PHE C  151 ? PHE C 148 . ? 1_555 ? 
28  AC2 21 ASN C  152 ? ASN C 149 . ? 1_555 ? 
29  AC2 21 LYS C  175 ? LYS C 172 . ? 1_555 ? 
30  AC2 21 GLU C  178 ? GLU C 175 . ? 1_555 ? 
31  AC2 21 ARG C  179 ? ARG C 176 . ? 1_555 ? 
32  AC2 21 LYS C  208 ? LYS C 205 . ? 1_555 ? 
33  AC2 21 PHE C  225 ? PHE C 222 . ? 1_555 ? 
34  AC2 21 VAL C  226 ? VAL C 223 . ? 1_555 ? 
35  AC2 21 GLY C  227 ? GLY C 224 . ? 1_555 ? 
36  AC2 21 SER C  228 ? SER C 225 . ? 1_555 ? 
37  AC2 21 ILE C  231 ? ILE C 228 . ? 1_555 ? 
38  AC2 21 LEU C  249 ? LEU C 246 . ? 1_555 ? 
39  AC2 21 GLY C  250 ? GLY C 247 . ? 1_555 ? 
40  AC2 21 GLY C  251 ? GLY C 248 . ? 1_555 ? 
41  AC2 21 CYS C  283 ? CYS C 280 . ? 1_555 ? 
42  AC2 21 GLU C  385 ? GLU C 382 . ? 1_555 ? 
43  AC2 21 PHE C  387 ? PHE C 384 . ? 1_555 ? 
44  AC2 21 ASN C  413 ? ASN C 410 . ? 1_555 ? 
45  AC2 21 PHE C  452 ? PHE C 449 . ? 1_555 ? 
46  AC3 21 THR D  149 ? THR D 146 . ? 1_555 ? 
47  AC3 21 PRO D  150 ? PRO D 147 . ? 1_555 ? 
48  AC3 21 PHE D  151 ? PHE D 148 . ? 1_555 ? 
49  AC3 21 ASN D  152 ? ASN D 149 . ? 1_555 ? 
50  AC3 21 LYS D  175 ? LYS D 172 . ? 1_555 ? 
51  AC3 21 GLU D  178 ? GLU D 175 . ? 1_555 ? 
52  AC3 21 ARG D  179 ? ARG D 176 . ? 1_555 ? 
53  AC3 21 LYS D  208 ? LYS D 205 . ? 1_555 ? 
54  AC3 21 PHE D  225 ? PHE D 222 . ? 1_555 ? 
55  AC3 21 VAL D  226 ? VAL D 223 . ? 1_555 ? 
56  AC3 21 GLY D  227 ? GLY D 224 . ? 1_555 ? 
57  AC3 21 SER D  228 ? SER D 225 . ? 1_555 ? 
58  AC3 21 ILE D  231 ? ILE D 228 . ? 1_555 ? 
59  AC3 21 LEU D  249 ? LEU D 246 . ? 1_555 ? 
60  AC3 21 GLY D  250 ? GLY D 247 . ? 1_555 ? 
61  AC3 21 GLY D  251 ? GLY D 248 . ? 1_555 ? 
62  AC3 21 CYS D  283 ? CYS D 280 . ? 1_555 ? 
63  AC3 21 GLU D  385 ? GLU D 382 . ? 1_555 ? 
64  AC3 21 PHE D  387 ? PHE D 384 . ? 1_555 ? 
65  AC3 21 ASN D  413 ? ASN D 410 . ? 1_555 ? 
66  AC3 21 PHE D  452 ? PHE D 449 . ? 1_555 ? 
67  AC4 25 ILE E  148 ? ILE E 145 . ? 1_555 ? 
68  AC4 25 THR E  149 ? THR E 146 . ? 1_555 ? 
69  AC4 25 PRO E  150 ? PRO E 147 . ? 1_555 ? 
70  AC4 25 PHE E  151 ? PHE E 148 . ? 1_555 ? 
71  AC4 25 ASN E  152 ? ASN E 149 . ? 1_555 ? 
72  AC4 25 LYS E  175 ? LYS E 172 . ? 1_555 ? 
73  AC4 25 SER E  177 ? SER E 174 . ? 1_555 ? 
74  AC4 25 GLU E  178 ? GLU E 175 . ? 1_555 ? 
75  AC4 25 ARG E  179 ? ARG E 176 . ? 1_555 ? 
76  AC4 25 LYS E  208 ? LYS E 205 . ? 1_555 ? 
77  AC4 25 VAL E  211 ? VAL E 208 . ? 1_555 ? 
78  AC4 25 PHE E  225 ? PHE E 222 . ? 1_555 ? 
79  AC4 25 VAL E  226 ? VAL E 223 . ? 1_555 ? 
80  AC4 25 GLY E  227 ? GLY E 224 . ? 1_555 ? 
81  AC4 25 SER E  228 ? SER E 225 . ? 1_555 ? 
82  AC4 25 ILE E  231 ? ILE E 228 . ? 1_555 ? 
83  AC4 25 LEU E  249 ? LEU E 246 . ? 1_555 ? 
84  AC4 25 GLY E  250 ? GLY E 247 . ? 1_555 ? 
85  AC4 25 GLY E  251 ? GLY E 248 . ? 1_555 ? 
86  AC4 25 CYS E  283 ? CYS E 280 . ? 1_555 ? 
87  AC4 25 GLU E  385 ? GLU E 382 . ? 1_555 ? 
88  AC4 25 PHE E  387 ? PHE E 384 . ? 1_555 ? 
89  AC4 25 ASN E  413 ? ASN E 410 . ? 1_555 ? 
90  AC4 25 PHE E  452 ? PHE E 449 . ? 1_555 ? 
91  AC4 25 HOH W  .   ? HOH E 608 . ? 1_555 ? 
92  AC5 26 ILE I  148 ? ILE I 145 . ? 1_555 ? 
93  AC5 26 THR I  149 ? THR I 146 . ? 1_555 ? 
94  AC5 26 PRO I  150 ? PRO I 147 . ? 1_555 ? 
95  AC5 26 PHE I  151 ? PHE I 148 . ? 1_555 ? 
96  AC5 26 ASN I  152 ? ASN I 149 . ? 1_555 ? 
97  AC5 26 LYS I  175 ? LYS I 172 . ? 1_555 ? 
98  AC5 26 PRO I  176 ? PRO I 173 . ? 1_555 ? 
99  AC5 26 SER I  177 ? SER I 174 . ? 1_555 ? 
100 AC5 26 GLU I  178 ? GLU I 175 . ? 1_555 ? 
101 AC5 26 ARG I  179 ? ARG I 176 . ? 1_555 ? 
102 AC5 26 LYS I  208 ? LYS I 205 . ? 1_555 ? 
103 AC5 26 VAL I  211 ? VAL I 208 . ? 1_555 ? 
104 AC5 26 PHE I  225 ? PHE I 222 . ? 1_555 ? 
105 AC5 26 VAL I  226 ? VAL I 223 . ? 1_555 ? 
106 AC5 26 GLY I  227 ? GLY I 224 . ? 1_555 ? 
107 AC5 26 SER I  228 ? SER I 225 . ? 1_555 ? 
108 AC5 26 ILE I  231 ? ILE I 228 . ? 1_555 ? 
109 AC5 26 LEU I  249 ? LEU I 246 . ? 1_555 ? 
110 AC5 26 GLY I  250 ? GLY I 247 . ? 1_555 ? 
111 AC5 26 GLY I  251 ? GLY I 248 . ? 1_555 ? 
112 AC5 26 CYS I  283 ? CYS I 280 . ? 1_555 ? 
113 AC5 26 GLU I  385 ? GLU I 382 . ? 1_555 ? 
114 AC5 26 PHE I  387 ? PHE I 384 . ? 1_555 ? 
115 AC5 26 ASN I  413 ? ASN I 410 . ? 1_555 ? 
116 AC5 26 PHE I  452 ? PHE I 449 . ? 1_555 ? 
117 AC5 26 HOH AA .   ? HOH I 639 . ? 1_555 ? 
118 AC6 25 ILE L  148 ? ILE L 145 . ? 1_555 ? 
119 AC6 25 THR L  149 ? THR L 146 . ? 1_555 ? 
120 AC6 25 PRO L  150 ? PRO L 147 . ? 1_555 ? 
121 AC6 25 PHE L  151 ? PHE L 148 . ? 1_555 ? 
122 AC6 25 ASN L  152 ? ASN L 149 . ? 1_555 ? 
123 AC6 25 LYS L  175 ? LYS L 172 . ? 1_555 ? 
124 AC6 25 PRO L  176 ? PRO L 173 . ? 1_555 ? 
125 AC6 25 GLU L  178 ? GLU L 175 . ? 1_555 ? 
126 AC6 25 ARG L  179 ? ARG L 176 . ? 1_555 ? 
127 AC6 25 LYS L  208 ? LYS L 205 . ? 1_555 ? 
128 AC6 25 VAL L  211 ? VAL L 208 . ? 1_555 ? 
129 AC6 25 PHE L  225 ? PHE L 222 . ? 1_555 ? 
130 AC6 25 VAL L  226 ? VAL L 223 . ? 1_555 ? 
131 AC6 25 GLY L  227 ? GLY L 224 . ? 1_555 ? 
132 AC6 25 SER L  228 ? SER L 225 . ? 1_555 ? 
133 AC6 25 ILE L  231 ? ILE L 228 . ? 1_555 ? 
134 AC6 25 LEU L  249 ? LEU L 246 . ? 1_555 ? 
135 AC6 25 GLY L  250 ? GLY L 247 . ? 1_555 ? 
136 AC6 25 GLY L  251 ? GLY L 248 . ? 1_555 ? 
137 AC6 25 CYS L  283 ? CYS L 280 . ? 1_555 ? 
138 AC6 25 GLU L  385 ? GLU L 382 . ? 1_555 ? 
139 AC6 25 PHE L  387 ? PHE L 384 . ? 1_555 ? 
140 AC6 25 ASN L  413 ? ASN L 410 . ? 1_555 ? 
141 AC6 25 PHE L  452 ? PHE L 449 . ? 1_555 ? 
142 AC6 25 HOH DA .   ? HOH L 606 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ZZ7 
_atom_sites.fract_transf_matrix[1][1]   0.006382 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006238 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004186 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A  1 4   ? 159.257 10.074  -32.099 1.00 52.48  ? 1   MET A N   1 
ATOM   2     C CA  . MET A  1 4   ? 158.512 11.368  -31.857 1.00 53.17  ? 1   MET A CA  1 
ATOM   3     C C   . MET A  1 4   ? 157.046 11.128  -31.444 1.00 52.73  ? 1   MET A C   1 
ATOM   4     O O   . MET A  1 4   ? 156.200 10.761  -32.275 1.00 45.21  ? 1   MET A O   1 
ATOM   5     C CB  . MET A  1 4   ? 158.579 12.319  -33.080 1.00 51.34  ? 1   MET A CB  1 
ATOM   6     C CG  . MET A  1 4   ? 157.837 13.643  -32.868 1.00 49.57  ? 1   MET A CG  1 
ATOM   7     S SD  . MET A  1 4   ? 158.263 15.057  -33.920 1.00 47.45  ? 1   MET A SD  1 
ATOM   8     C CE  . MET A  1 4   ? 157.888 14.407  -35.549 1.00 48.08  ? 1   MET A CE  1 
ATOM   9     N N   . THR A  1 5   ? 156.762 11.379  -30.162 1.00 54.44  ? 2   THR A N   1 
ATOM   10    C CA  . THR A  1 5   ? 155.456 11.064  -29.548 1.00 56.26  ? 2   THR A CA  1 
ATOM   11    C C   . THR A  1 5   ? 154.326 11.966  -30.081 1.00 54.17  ? 2   THR A C   1 
ATOM   12    O O   . THR A  1 5   ? 154.578 13.103  -30.509 1.00 57.48  ? 2   THR A O   1 
ATOM   13    C CB  . THR A  1 5   ? 155.511 11.179  -27.995 1.00 58.06  ? 2   THR A CB  1 
ATOM   14    O OG1 . THR A  1 5   ? 155.778 12.537  -27.616 1.00 59.08  ? 2   THR A OG1 1 
ATOM   15    C CG2 . THR A  1 5   ? 156.588 10.234  -27.377 1.00 56.95  ? 2   THR A CG2 1 
ATOM   16    N N   . THR A  1 6   ? 153.089 11.461  -30.058 1.00 48.24  ? 3   THR A N   1 
ATOM   17    C CA  . THR A  1 6   ? 151.916 12.250  -30.494 1.00 44.21  ? 3   THR A CA  1 
ATOM   18    C C   . THR A  1 6   ? 150.978 12.589  -29.324 1.00 38.09  ? 3   THR A C   1 
ATOM   19    O O   . THR A  1 6   ? 150.488 11.709  -28.628 1.00 37.29  ? 3   THR A O   1 
ATOM   20    C CB  . THR A  1 6   ? 151.144 11.550  -31.628 1.00 47.28  ? 3   THR A CB  1 
ATOM   21    O OG1 . THR A  1 6   ? 152.053 11.249  -32.685 1.00 52.87  ? 3   THR A OG1 1 
ATOM   22    C CG2 . THR A  1 6   ? 150.051 12.443  -32.211 1.00 47.48  ? 3   THR A CG2 1 
ATOM   23    N N   . ILE A  1 7   ? 150.734 13.883  -29.132 1.00 33.68  ? 4   ILE A N   1 
ATOM   24    C CA  . ILE A  1 7   ? 149.908 14.395  -28.027 1.00 30.24  ? 4   ILE A CA  1 
ATOM   25    C C   . ILE A  1 7   ? 148.415 14.317  -28.354 1.00 27.88  ? 4   ILE A C   1 
ATOM   26    O O   . ILE A  1 7   ? 147.940 14.826  -29.391 1.00 29.32  ? 4   ILE A O   1 
ATOM   27    C CB  . ILE A  1 7   ? 150.251 15.861  -27.700 1.00 28.30  ? 4   ILE A CB  1 
ATOM   28    C CG1 . ILE A  1 7   ? 151.722 15.982  -27.299 1.00 27.91  ? 4   ILE A CG1 1 
ATOM   29    C CG2 . ILE A  1 7   ? 149.344 16.383  -26.587 1.00 27.88  ? 4   ILE A CG2 1 
ATOM   30    C CD1 . ILE A  1 7   ? 152.250 17.393  -27.371 1.00 27.57  ? 4   ILE A CD1 1 
ATOM   31    N N   . GLY A  1 8   ? 147.667 13.718  -27.450 1.00 24.36  ? 5   GLY A N   1 
ATOM   32    C CA  . GLY A  1 8   ? 146.282 13.418  -27.741 1.00 24.00  ? 5   GLY A CA  1 
ATOM   33    C C   . GLY A  1 8   ? 145.295 14.343  -27.065 1.00 22.64  ? 5   GLY A C   1 
ATOM   34    O O   . GLY A  1 8   ? 145.537 15.530  -26.904 1.00 20.13  ? 5   GLY A O   1 
ATOM   35    N N   . HIS A  1 9   ? 144.180 13.745  -26.668 1.00 22.84  ? 6   HIS A N   1 
ATOM   36    C CA  . HIS A  1 9   ? 143.047 14.433  -26.107 1.00 23.62  ? 6   HIS A CA  1 
ATOM   37    C C   . HIS A  1 9   ? 142.535 13.634  -24.933 1.00 24.09  ? 6   HIS A C   1 
ATOM   38    O O   . HIS A  1 9   ? 142.610 12.420  -24.926 1.00 25.62  ? 6   HIS A O   1 
ATOM   39    C CB  . HIS A  1 9   ? 141.916 14.521  -27.120 1.00 24.21  ? 6   HIS A CB  1 
ATOM   40    C CG  . HIS A  1 9   ? 142.346 14.929  -28.487 1.00 25.04  ? 6   HIS A CG  1 
ATOM   41    N ND1 . HIS A  1 9   ? 142.967 16.126  -28.739 1.00 25.31  ? 6   HIS A ND1 1 
ATOM   42    C CD2 . HIS A  1 9   ? 142.224 14.308  -29.685 1.00 26.19  ? 6   HIS A CD2 1 
ATOM   43    C CE1 . HIS A  1 9   ? 143.223 16.230  -30.031 1.00 26.24  ? 6   HIS A CE1 1 
ATOM   44    N NE2 . HIS A  1 9   ? 142.781 15.138  -30.629 1.00 27.07  ? 6   HIS A NE2 1 
ATOM   45    N N   . LEU A  1 10  ? 141.988 14.327  -23.950 1.00 24.52  ? 7   LEU A N   1 
ATOM   46    C CA  . LEU A  1 10  ? 141.383 13.707  -22.792 1.00 24.15  ? 7   LEU A CA  1 
ATOM   47    C C   . LEU A  1 10  ? 139.881 13.769  -22.983 1.00 23.22  ? 7   LEU A C   1 
ATOM   48    O O   . LEU A  1 10  ? 139.282 14.843  -22.889 1.00 22.10  ? 7   LEU A O   1 
ATOM   49    C CB  . LEU A  1 10  ? 141.804 14.470  -21.538 1.00 25.26  ? 7   LEU A CB  1 
ATOM   50    C CG  . LEU A  1 10  ? 141.232 14.022  -20.197 1.00 26.25  ? 7   LEU A CG  1 
ATOM   51    C CD1 . LEU A  1 10  ? 141.521 12.556  -19.933 1.00 25.94  ? 7   LEU A CD1 1 
ATOM   52    C CD2 . LEU A  1 10  ? 141.827 14.892  -19.096 1.00 27.48  ? 7   LEU A CD2 1 
ATOM   53    N N   . ILE A  1 11  ? 139.278 12.623  -23.276 1.00 22.45  ? 8   ILE A N   1 
ATOM   54    C CA  . ILE A  1 11  ? 137.830 12.547  -23.446 1.00 23.54  ? 8   ILE A CA  1 
ATOM   55    C C   . ILE A  1 11  ? 137.232 11.387  -22.668 1.00 24.46  ? 8   ILE A C   1 
ATOM   56    O O   . ILE A  1 11  ? 137.498 10.230  -22.956 1.00 24.43  ? 8   ILE A O   1 
ATOM   57    C CB  . ILE A  1 11  ? 137.430 12.397  -24.922 1.00 24.27  ? 8   ILE A CB  1 
ATOM   58    C CG1 . ILE A  1 11  ? 137.948 13.590  -25.728 1.00 25.37  ? 8   ILE A CG1 1 
ATOM   59    C CG2 . ILE A  1 11  ? 135.916 12.286  -25.048 1.00 24.17  ? 8   ILE A CG2 1 
ATOM   60    C CD1 . ILE A  1 11  ? 137.650 13.537  -27.215 1.00 25.94  ? 8   ILE A CD1 1 
ATOM   61    N N   . ASN A  1 12  ? 136.378 11.718  -21.710 1.00 26.65  ? 9   ASN A N   1 
ATOM   62    C CA  . ASN A  1 12  ? 135.792 10.745  -20.793 1.00 28.30  ? 9   ASN A CA  1 
ATOM   63    C C   . ASN A  1 12  ? 136.869 9.926   -20.061 1.00 30.30  ? 9   ASN A C   1 
ATOM   64    O O   . ASN A  1 12  ? 136.798 8.706   -19.984 1.00 27.95  ? 9   ASN A O   1 
ATOM   65    C CB  . ASN A  1 12  ? 134.785 9.857   -21.529 1.00 28.24  ? 9   ASN A CB  1 
ATOM   66    C CG  . ASN A  1 12  ? 133.629 9.405   -20.638 1.00 28.51  ? 9   ASN A CG  1 
ATOM   67    O OD1 . ASN A  1 12  ? 132.821 10.212  -20.183 1.00 30.64  ? 9   ASN A OD1 1 
ATOM   68    N ND2 . ASN A  1 12  ? 133.528 8.119   -20.416 1.00 28.46  ? 9   ASN A ND2 1 
ATOM   69    N N   . GLY A  1 13  ? 137.868 10.633  -19.532 1.00 34.33  ? 10  GLY A N   1 
ATOM   70    C CA  . GLY A  1 13  ? 138.886 10.042  -18.652 1.00 37.43  ? 10  GLY A CA  1 
ATOM   71    C C   . GLY A  1 13  ? 139.885 9.140   -19.352 1.00 39.81  ? 10  GLY A C   1 
ATOM   72    O O   . GLY A  1 13  ? 140.485 8.255   -18.727 1.00 40.74  ? 10  GLY A O   1 
ATOM   73    N N   . GLN A  1 14  ? 140.068 9.358   -20.649 1.00 41.46  ? 11  GLN A N   1 
ATOM   74    C CA  . GLN A  1 14  ? 140.936 8.514   -21.426 1.00 44.17  ? 11  GLN A CA  1 
ATOM   75    C C   . GLN A  1 14  ? 141.606 9.278   -22.520 1.00 42.34  ? 11  GLN A C   1 
ATOM   76    O O   . GLN A  1 14  ? 140.986 10.137  -23.137 1.00 41.24  ? 11  GLN A O   1 
ATOM   77    C CB  . GLN A  1 14  ? 140.130 7.384   -22.021 1.00 50.42  ? 11  GLN A CB  1 
ATOM   78    C CG  . GLN A  1 14  ? 139.710 6.363   -20.981 1.00 56.74  ? 11  GLN A CG  1 
ATOM   79    C CD  . GLN A  1 14  ? 139.217 5.098   -21.604 1.00 66.24  ? 11  GLN A CD  1 
ATOM   80    O OE1 . GLN A  1 14  ? 139.101 5.000   -22.830 1.00 75.81  ? 11  GLN A OE1 1 
ATOM   81    N NE2 . GLN A  1 14  ? 138.920 4.107   -20.769 1.00 74.12  ? 11  GLN A NE2 1 
ATOM   82    N N   . LEU A  1 15  ? 142.880 8.957   -22.744 1.00 41.95  ? 12  LEU A N   1 
ATOM   83    C CA  . LEU A  1 15  ? 143.661 9.529   -23.837 1.00 41.95  ? 12  LEU A CA  1 
ATOM   84    C C   . LEU A  1 15  ? 143.252 8.952   -25.172 1.00 36.66  ? 12  LEU A C   1 
ATOM   85    O O   . LEU A  1 15  ? 143.306 7.757   -25.370 1.00 36.87  ? 12  LEU A O   1 
ATOM   86    C CB  . LEU A  1 15  ? 145.152 9.258   -23.646 1.00 46.07  ? 12  LEU A CB  1 
ATOM   87    C CG  . LEU A  1 15  ? 145.852 10.043  -22.553 1.00 51.55  ? 12  LEU A CG  1 
ATOM   88    C CD1 . LEU A  1 15  ? 147.327 9.684   -22.599 1.00 54.56  ? 12  LEU A CD1 1 
ATOM   89    C CD2 . LEU A  1 15  ? 145.660 11.550  -22.734 1.00 55.15  ? 12  LEU A CD2 1 
ATOM   90    N N   . VAL A  1 16  ? 142.855 9.804   -26.096 1.00 34.13  ? 13  VAL A N   1 
ATOM   91    C CA  . VAL A  1 16  ? 142.499 9.358   -27.442 1.00 34.48  ? 13  VAL A CA  1 
ATOM   92    C C   . VAL A  1 16  ? 143.145 10.235  -28.507 1.00 33.65  ? 13  VAL A C   1 
ATOM   93    O O   . VAL A  1 16  ? 143.515 11.389  -28.274 1.00 32.78  ? 13  VAL A O   1 
ATOM   94    C CB  . VAL A  1 16  ? 140.967 9.310   -27.666 1.00 34.43  ? 13  VAL A CB  1 
ATOM   95    C CG1 . VAL A  1 16  ? 140.298 8.389   -26.643 1.00 34.45  ? 13  VAL A CG1 1 
ATOM   96    C CG2 . VAL A  1 16  ? 140.356 10.704  -27.620 1.00 34.54  ? 13  VAL A CG2 1 
ATOM   97    N N   . THR A  1 17  ? 143.277 9.679   -29.696 1.00 33.20  ? 14  THR A N   1 
ATOM   98    C CA  . THR A  1 17  ? 143.908 10.422  -30.755 1.00 32.34  ? 14  THR A CA  1 
ATOM   99    C C   . THR A  1 17  ? 143.282 10.104  -32.090 1.00 29.98  ? 14  THR A C   1 
ATOM   100   O O   . THR A  1 17  ? 143.128 8.947   -32.448 1.00 28.18  ? 14  THR A O   1 
ATOM   101   C CB  . THR A  1 17  ? 145.419 10.206  -30.739 1.00 33.26  ? 14  THR A CB  1 
ATOM   102   O OG1 . THR A  1 17  ? 145.980 10.855  -31.884 1.00 35.21  ? 14  THR A OG1 1 
ATOM   103   C CG2 . THR A  1 17  ? 145.775 8.712   -30.707 1.00 33.35  ? 14  THR A CG2 1 
ATOM   104   N N   . GLU A  1 18  ? 142.905 11.157  -32.802 1.00 31.13  ? 15  GLU A N   1 
ATOM   105   C CA  . GLU A  1 18  ? 142.089 11.041  -33.996 1.00 34.36  ? 15  GLU A CA  1 
ATOM   106   C C   . GLU A  1 18  ? 142.907 10.613  -35.195 1.00 37.82  ? 15  GLU A C   1 
ATOM   107   O O   . GLU A  1 18  ? 142.460 9.757   -35.954 1.00 43.05  ? 15  GLU A O   1 
ATOM   108   C CB  . GLU A  1 18  ? 141.413 12.364  -34.308 1.00 34.42  ? 15  GLU A CB  1 
ATOM   109   C CG  . GLU A  1 18  ? 140.404 12.286  -35.444 1.00 34.81  ? 15  GLU A CG  1 
ATOM   110   C CD  . GLU A  1 18  ? 139.903 13.650  -35.860 1.00 35.36  ? 15  GLU A CD  1 
ATOM   111   O OE1 . GLU A  1 18  ? 139.522 14.438  -34.972 1.00 38.10  ? 15  GLU A OE1 1 
ATOM   112   O OE2 . GLU A  1 18  ? 139.891 13.951  -37.071 1.00 34.62  ? 15  GLU A OE2 1 
ATOM   113   N N   . ASN A  1 19  ? 144.067 11.247  -35.379 1.00 38.04  ? 16  ASN A N   1 
ATOM   114   C CA  . ASN A  1 19  ? 145.059 10.856  -36.397 1.00 39.12  ? 16  ASN A CA  1 
ATOM   115   C C   . ASN A  1 19  ? 144.708 11.178  -37.847 1.00 37.49  ? 16  ASN A C   1 
ATOM   116   O O   . ASN A  1 19  ? 145.096 10.438  -38.758 1.00 37.78  ? 16  ASN A O   1 
ATOM   117   C CB  . ASN A  1 19  ? 145.438 9.368   -36.274 1.00 39.37  ? 16  ASN A CB  1 
ATOM   118   C CG  . ASN A  1 19  ? 146.236 9.085   -35.027 1.00 42.12  ? 16  ASN A CG  1 
ATOM   119   O OD1 . ASN A  1 19  ? 147.243 9.768   -34.754 1.00 41.84  ? 16  ASN A OD1 1 
ATOM   120   N ND2 . ASN A  1 19  ? 145.816 8.064   -34.264 1.00 43.81  ? 16  ASN A ND2 1 
ATOM   121   N N   . THR A  1 20  ? 143.998 12.279  -38.061 1.00 35.21  ? 17  THR A N   1 
ATOM   122   C CA  . THR A  1 20  ? 143.730 12.750  -39.421 1.00 34.25  ? 17  THR A CA  1 
ATOM   123   C C   . THR A  1 20  ? 144.543 13.990  -39.778 1.00 34.53  ? 17  THR A C   1 
ATOM   124   O O   . THR A  1 20  ? 144.706 14.303  -40.954 1.00 35.24  ? 17  THR A O   1 
ATOM   125   C CB  . THR A  1 20  ? 142.215 12.967  -39.699 1.00 33.24  ? 17  THR A CB  1 
ATOM   126   O OG1 . THR A  1 20  ? 141.757 14.161  -39.079 1.00 31.72  ? 17  THR A OG1 1 
ATOM   127   C CG2 . THR A  1 20  ? 141.370 11.748  -39.234 1.00 33.44  ? 17  THR A CG2 1 
ATOM   128   N N   . ARG A  1 21  ? 145.083 14.677  -38.778 1.00 35.78  ? 18  ARG A N   1 
ATOM   129   C CA  . ARG A  1 21  ? 145.824 15.919  -39.011 1.00 36.38  ? 18  ARG A CA  1 
ATOM   130   C C   . ARG A  1 21  ? 146.682 16.256  -37.799 1.00 35.31  ? 18  ARG A C   1 
ATOM   131   O O   . ARG A  1 21  ? 146.257 16.045  -36.666 1.00 33.25  ? 18  ARG A O   1 
ATOM   132   C CB  . ARG A  1 21  ? 144.816 17.037  -39.276 1.00 37.52  ? 18  ARG A CB  1 
ATOM   133   C CG  . ARG A  1 21  ? 145.418 18.379  -39.642 1.00 39.38  ? 18  ARG A CG  1 
ATOM   134   C CD  . ARG A  1 21  ? 144.382 19.204  -40.382 1.00 40.89  ? 18  ARG A CD  1 
ATOM   135   N NE  . ARG A  1 21  ? 143.156 19.403  -39.598 1.00 40.55  ? 18  ARG A NE  1 
ATOM   136   C CZ  . ARG A  1 21  ? 142.884 20.491  -38.866 1.00 41.94  ? 18  ARG A CZ  1 
ATOM   137   N NH1 . ARG A  1 21  ? 143.753 21.517  -38.777 1.00 40.77  ? 18  ARG A NH1 1 
ATOM   138   N NH2 . ARG A  1 21  ? 141.725 20.561  -38.217 1.00 39.81  ? 18  ARG A NH2 1 
ATOM   139   N N   . SER A  1 22  ? 147.883 16.770  -38.017 1.00 35.20  ? 19  SER A N   1 
ATOM   140   C CA  . SER A  1 22  ? 148.730 17.125  -36.874 1.00 36.85  ? 19  SER A CA  1 
ATOM   141   C C   . SER A  1 22  ? 149.630 18.326  -37.111 1.00 36.00  ? 19  SER A C   1 
ATOM   142   O O   . SER A  1 22  ? 149.766 18.834  -38.233 1.00 35.46  ? 19  SER A O   1 
ATOM   143   C CB  . SER A  1 22  ? 149.581 15.927  -36.436 1.00 37.92  ? 19  SER A CB  1 
ATOM   144   O OG  . SER A  1 22  ? 150.852 15.961  -37.056 1.00 40.76  ? 19  SER A OG  1 
ATOM   145   N N   . GLN A  1 23  ? 150.267 18.750  -36.028 1.00 35.24  ? 20  GLN A N   1 
ATOM   146   C CA  . GLN A  1 23  ? 151.034 19.978  -36.025 1.00 34.79  ? 20  GLN A CA  1 
ATOM   147   C C   . GLN A  1 23  ? 152.241 19.908  -35.088 1.00 32.08  ? 20  GLN A C   1 
ATOM   148   O O   . GLN A  1 23  ? 152.227 19.250  -34.052 1.00 29.35  ? 20  GLN A O   1 
ATOM   149   C CB  . GLN A  1 23  ? 150.118 21.134  -35.643 1.00 35.91  ? 20  GLN A CB  1 
ATOM   150   C CG  . GLN A  1 23  ? 150.779 22.486  -35.808 1.00 39.07  ? 20  GLN A CG  1 
ATOM   151   C CD  . GLN A  1 23  ? 149.824 23.621  -35.558 1.00 40.80  ? 20  GLN A CD  1 
ATOM   152   O OE1 . GLN A  1 23  ? 148.639 23.517  -35.869 1.00 43.79  ? 20  GLN A OE1 1 
ATOM   153   N NE2 . GLN A  1 23  ? 150.325 24.715  -35.003 1.00 40.40  ? 20  GLN A NE2 1 
ATOM   154   N N   . ASN A  1 24  ? 153.292 20.609  -35.466 1.00 31.59  ? 21  ASN A N   1 
ATOM   155   C CA  . ASN A  1 24  ? 154.523 20.543  -34.716 1.00 33.19  ? 21  ASN A CA  1 
ATOM   156   C C   . ASN A  1 24  ? 154.376 21.380  -33.489 1.00 31.26  ? 21  ASN A C   1 
ATOM   157   O O   . ASN A  1 24  ? 153.868 22.477  -33.572 1.00 32.49  ? 21  ASN A O   1 
ATOM   158   C CB  . ASN A  1 24  ? 155.715 21.089  -35.529 1.00 35.15  ? 21  ASN A CB  1 
ATOM   159   C CG  . ASN A  1 24  ? 155.957 20.331  -36.823 1.00 35.21  ? 21  ASN A CG  1 
ATOM   160   O OD1 . ASN A  1 24  ? 155.580 19.167  -36.963 1.00 35.75  ? 21  ASN A OD1 1 
ATOM   161   N ND2 . ASN A  1 24  ? 156.581 20.997  -37.779 1.00 34.88  ? 21  ASN A ND2 1 
ATOM   162   N N   . VAL A  1 25  ? 154.833 20.872  -32.359 1.00 30.75  ? 22  VAL A N   1 
ATOM   163   C CA  . VAL A  1 25  ? 155.144 21.730  -31.229 1.00 31.70  ? 22  VAL A CA  1 
ATOM   164   C C   . VAL A  1 25  ? 156.660 21.770  -31.137 1.00 32.30  ? 22  VAL A C   1 
ATOM   165   O O   . VAL A  1 25  ? 157.326 20.741  -31.284 1.00 32.56  ? 22  VAL A O   1 
ATOM   166   C CB  . VAL A  1 25  ? 154.477 21.275  -29.899 1.00 33.38  ? 22  VAL A CB  1 
ATOM   167   C CG1 . VAL A  1 25  ? 153.066 20.751  -30.177 1.00 33.37  ? 22  VAL A CG1 1 
ATOM   168   C CG2 . VAL A  1 25  ? 155.314 20.243  -29.123 1.00 34.14  ? 22  VAL A CG2 1 
ATOM   169   N N   . PHE A  1 26  ? 157.191 22.962  -30.892 1.00 33.04  ? 23  PHE A N   1 
ATOM   170   C CA  . PHE A  1 26  ? 158.624 23.202  -30.878 1.00 32.24  ? 23  PHE A CA  1 
ATOM   171   C C   . PHE A  1 26  ? 159.175 23.231  -29.459 1.00 31.11  ? 23  PHE A C   1 
ATOM   172   O O   . PHE A  1 26  ? 158.439 23.409  -28.503 1.00 31.02  ? 23  PHE A O   1 
ATOM   173   C CB  . PHE A  1 26  ? 158.904 24.549  -31.536 1.00 33.97  ? 23  PHE A CB  1 
ATOM   174   C CG  . PHE A  1 26  ? 158.681 24.558  -33.012 1.00 36.21  ? 23  PHE A CG  1 
ATOM   175   C CD1 . PHE A  1 26  ? 157.400 24.695  -33.538 1.00 36.95  ? 23  PHE A CD1 1 
ATOM   176   C CD2 . PHE A  1 26  ? 159.757 24.445  -33.881 1.00 37.90  ? 23  PHE A CD2 1 
ATOM   177   C CE1 . PHE A  1 26  ? 157.195 24.708  -34.907 1.00 39.17  ? 23  PHE A CE1 1 
ATOM   178   C CE2 . PHE A  1 26  ? 159.560 24.458  -35.247 1.00 40.52  ? 23  PHE A CE2 1 
ATOM   179   C CZ  . PHE A  1 26  ? 158.274 24.586  -35.766 1.00 40.58  ? 23  PHE A CZ  1 
ATOM   180   N N   . ASN A  1 27  ? 160.479 23.029  -29.340 1.00 30.81  ? 24  ASN A N   1 
ATOM   181   C CA  . ASN A  1 27  ? 161.235 23.540  -28.212 1.00 30.44  ? 24  ASN A CA  1 
ATOM   182   C C   . ASN A  1 27  ? 161.762 24.920  -28.665 1.00 29.77  ? 24  ASN A C   1 
ATOM   183   O O   . ASN A  1 27  ? 162.656 24.983  -29.504 1.00 28.46  ? 24  ASN A O   1 
ATOM   184   C CB  . ASN A  1 27  ? 162.383 22.589  -27.860 1.00 29.80  ? 24  ASN A CB  1 
ATOM   185   C CG  . ASN A  1 27  ? 163.156 23.031  -26.626 1.00 29.73  ? 24  ASN A CG  1 
ATOM   186   O OD1 . ASN A  1 27  ? 163.169 24.213  -26.239 1.00 28.64  ? 24  ASN A OD1 1 
ATOM   187   N ND2 . ASN A  1 27  ? 163.817 22.081  -26.005 1.00 30.45  ? 24  ASN A ND2 1 
ATOM   188   N N   . PRO A  1 28  ? 161.202 26.019  -28.135 1.00 30.34  ? 25  PRO A N   1 
ATOM   189   C CA  . PRO A  1 28  ? 161.574 27.355  -28.640 1.00 31.33  ? 25  PRO A CA  1 
ATOM   190   C C   . PRO A  1 28  ? 162.975 27.842  -28.266 1.00 33.54  ? 25  PRO A C   1 
ATOM   191   O O   . PRO A  1 28  ? 163.442 28.826  -28.861 1.00 34.45  ? 25  PRO A O   1 
ATOM   192   C CB  . PRO A  1 28  ? 160.512 28.273  -28.036 1.00 31.10  ? 25  PRO A CB  1 
ATOM   193   C CG  . PRO A  1 28  ? 160.083 27.570  -26.793 1.00 31.37  ? 25  PRO A CG  1 
ATOM   194   C CD  . PRO A  1 28  ? 160.173 26.097  -27.084 1.00 30.68  ? 25  PRO A CD  1 
ATOM   195   N N   . ALA A  1 29  ? 163.622 27.178  -27.294 1.00 34.86  ? 26  ALA A N   1 
ATOM   196   C CA  . ALA A  1 29  ? 165.051 27.421  -26.961 1.00 34.55  ? 26  ALA A CA  1 
ATOM   197   C C   . ALA A  1 29  ? 166.000 26.969  -28.078 1.00 34.89  ? 26  ALA A C   1 
ATOM   198   O O   . ALA A  1 29  ? 166.828 27.747  -28.536 1.00 35.64  ? 26  ALA A O   1 
ATOM   199   C CB  . ALA A  1 29  ? 165.430 26.722  -25.663 1.00 33.51  ? 26  ALA A CB  1 
ATOM   200   N N   . THR A  1 30  ? 165.861 25.713  -28.502 1.00 33.75  ? 27  THR A N   1 
ATOM   201   C CA  . THR A  1 30  ? 166.676 25.132  -29.567 1.00 32.76  ? 27  THR A CA  1 
ATOM   202   C C   . THR A  1 30  ? 166.132 25.443  -30.968 1.00 34.16  ? 27  THR A C   1 
ATOM   203   O O   . THR A  1 30  ? 166.897 25.542  -31.930 1.00 37.24  ? 27  THR A O   1 
ATOM   204   C CB  . THR A  1 30  ? 166.749 23.619  -29.417 1.00 31.81  ? 27  THR A CB  1 
ATOM   205   O OG1 . THR A  1 30  ? 165.450 23.065  -29.605 1.00 32.56  ? 27  THR A OG1 1 
ATOM   206   C CG2 . THR A  1 30  ? 167.245 23.233  -28.035 1.00 31.48  ? 27  THR A CG2 1 
ATOM   207   N N   . GLY A  1 31  ? 164.819 25.603  -31.084 1.00 33.52  ? 28  GLY A N   1 
ATOM   208   C CA  . GLY A  1 31  ? 164.175 25.814  -32.384 1.00 34.40  ? 28  GLY A CA  1 
ATOM   209   C C   . GLY A  1 31  ? 163.825 24.521  -33.116 1.00 36.71  ? 28  GLY A C   1 
ATOM   210   O O   . GLY A  1 31  ? 163.415 24.558  -34.279 1.00 35.96  ? 28  GLY A O   1 
ATOM   211   N N   . GLU A  1 32  ? 163.946 23.386  -32.420 1.00 40.49  ? 29  GLU A N   1 
ATOM   212   C CA  . GLU A  1 32  ? 163.734 22.045  -32.994 1.00 44.08  ? 29  GLU A CA  1 
ATOM   213   C C   . GLU A  1 32  ? 162.340 21.481  -32.667 1.00 41.08  ? 29  GLU A C   1 
ATOM   214   O O   . GLU A  1 32  ? 161.783 21.732  -31.602 1.00 41.00  ? 29  GLU A O   1 
ATOM   215   C CB  . GLU A  1 32  ? 164.829 21.078  -32.496 1.00 48.13  ? 29  GLU A CB  1 
ATOM   216   C CG  . GLU A  1 32  ? 166.239 21.441  -32.970 1.00 52.16  ? 29  GLU A CG  1 
ATOM   217   C CD  . GLU A  1 32  ? 167.346 20.656  -32.275 1.00 57.78  ? 29  GLU A CD  1 
ATOM   218   O OE1 . GLU A  1 32  ? 168.529 21.025  -32.451 1.00 61.52  ? 29  GLU A OE1 1 
ATOM   219   O OE2 . GLU A  1 32  ? 167.057 19.685  -31.543 1.00 61.27  ? 29  GLU A OE2 1 
ATOM   220   N N   . ILE A  1 33  ? 161.793 20.704  -33.593 1.00 38.66  ? 30  ILE A N   1 
ATOM   221   C CA  . ILE A  1 33  ? 160.486 20.082  -33.415 1.00 35.66  ? 30  ILE A CA  1 
ATOM   222   C C   . ILE A  1 33  ? 160.572 19.008  -32.350 1.00 35.22  ? 30  ILE A C   1 
ATOM   223   O O   . ILE A  1 33  ? 161.221 17.989  -32.537 1.00 37.34  ? 30  ILE A O   1 
ATOM   224   C CB  . ILE A  1 33  ? 159.991 19.436  -34.720 1.00 34.82  ? 30  ILE A CB  1 
ATOM   225   C CG1 . ILE A  1 33  ? 159.658 20.518  -35.750 1.00 33.70  ? 30  ILE A CG1 1 
ATOM   226   C CG2 . ILE A  1 33  ? 158.774 18.555  -34.467 1.00 34.85  ? 30  ILE A CG2 1 
ATOM   227   C CD1 . ILE A  1 33  ? 159.482 19.974  -37.148 1.00 32.59  ? 30  ILE A CD1 1 
ATOM   228   N N   . GLY A  1 34  ? 159.894 19.235  -31.241 1.00 35.52  ? 31  GLY A N   1 
ATOM   229   C CA  . GLY A  1 34  ? 159.862 18.278  -30.143 1.00 36.58  ? 31  GLY A CA  1 
ATOM   230   C C   . GLY A  1 34  ? 158.827 17.194  -30.346 1.00 36.40  ? 31  GLY A C   1 
ATOM   231   O O   . GLY A  1 34  ? 159.162 16.019  -30.383 1.00 38.60  ? 31  GLY A O   1 
ATOM   232   N N   . LYS A  1 35  ? 157.570 17.597  -30.496 1.00 36.47  ? 32  LYS A N   1 
ATOM   233   C CA  . LYS A  1 35  ? 156.433 16.670  -30.447 1.00 37.67  ? 32  LYS A CA  1 
ATOM   234   C C   . LYS A  1 35  ? 155.395 17.027  -31.511 1.00 35.62  ? 32  LYS A C   1 
ATOM   235   O O   . LYS A  1 35  ? 155.374 18.147  -32.019 1.00 31.96  ? 32  LYS A O   1 
ATOM   236   C CB  . LYS A  1 35  ? 155.775 16.675  -29.052 1.00 42.12  ? 32  LYS A CB  1 
ATOM   237   C CG  . LYS A  1 35  ? 156.735 16.965  -27.896 1.00 48.80  ? 32  LYS A CG  1 
ATOM   238   C CD  . LYS A  1 35  ? 156.095 16.937  -26.511 1.00 54.58  ? 32  LYS A CD  1 
ATOM   239   C CE  . LYS A  1 35  ? 155.715 15.514  -26.084 1.00 59.40  ? 32  LYS A CE  1 
ATOM   240   N NZ  . LYS A  1 35  ? 155.043 15.450  -24.749 1.00 59.18  ? 32  LYS A NZ  1 
ATOM   241   N N   . GLN A  1 36  ? 154.552 16.047  -31.849 1.00 35.46  ? 33  GLN A N   1 
ATOM   242   C CA  . GLN A  1 36  ? 153.421 16.229  -32.772 1.00 34.04  ? 33  GLN A CA  1 
ATOM   243   C C   . GLN A  1 36  ? 152.130 16.353  -31.975 1.00 32.41  ? 33  GLN A C   1 
ATOM   244   O O   . GLN A  1 36  ? 151.834 15.530  -31.099 1.00 32.07  ? 33  GLN A O   1 
ATOM   245   C CB  . GLN A  1 36  ? 153.275 15.031  -33.721 1.00 35.42  ? 33  GLN A CB  1 
ATOM   246   C CG  . GLN A  1 36  ? 154.349 14.917  -34.782 1.00 36.50  ? 33  GLN A CG  1 
ATOM   247   C CD  . GLN A  1 36  ? 154.366 16.115  -35.708 1.00 36.85  ? 33  GLN A CD  1 
ATOM   248   O OE1 . GLN A  1 36  ? 153.363 16.431  -36.354 1.00 38.29  ? 33  GLN A OE1 1 
ATOM   249   N NE2 . GLN A  1 36  ? 155.499 16.802  -35.767 1.00 36.40  ? 33  GLN A NE2 1 
ATOM   250   N N   . LEU A  1 37  ? 151.345 17.369  -32.295 1.00 29.50  ? 34  LEU A N   1 
ATOM   251   C CA  . LEU A  1 37  ? 150.070 17.563  -31.638 1.00 26.10  ? 34  LEU A CA  1 
ATOM   252   C C   . LEU A  1 37  ? 148.950 17.156  -32.553 1.00 25.17  ? 34  LEU A C   1 
ATOM   253   O O   . LEU A  1 37  ? 148.777 17.735  -33.618 1.00 22.39  ? 34  LEU A O   1 
ATOM   254   C CB  . LEU A  1 37  ? 149.901 19.020  -31.257 1.00 24.96  ? 34  LEU A CB  1 
ATOM   255   C CG  . LEU A  1 37  ? 148.585 19.333  -30.559 1.00 24.16  ? 34  LEU A CG  1 
ATOM   256   C CD1 . LEU A  1 37  ? 148.426 18.523  -29.272 1.00 23.07  ? 34  LEU A CD1 1 
ATOM   257   C CD2 . LEU A  1 37  ? 148.530 20.831  -30.328 1.00 23.51  ? 34  LEU A CD2 1 
ATOM   258   N N   . ASP A  1 38  ? 148.179 16.168  -32.118 1.00 27.02  ? 35  ASP A N   1 
ATOM   259   C CA  . ASP A  1 38  ? 146.976 15.759  -32.842 1.00 29.31  ? 35  ASP A CA  1 
ATOM   260   C C   . ASP A  1 38  ? 145.940 16.885  -32.844 1.00 29.77  ? 35  ASP A C   1 
ATOM   261   O O   . ASP A  1 38  ? 145.678 17.462  -31.809 1.00 31.56  ? 35  ASP A O   1 
ATOM   262   C CB  . ASP A  1 38  ? 146.371 14.519  -32.199 1.00 29.41  ? 35  ASP A CB  1 
ATOM   263   C CG  . ASP A  1 38  ? 145.296 13.904  -33.053 1.00 30.48  ? 35  ASP A CG  1 
ATOM   264   O OD1 . ASP A  1 38  ? 145.599 13.517  -34.204 1.00 30.77  ? 35  ASP A OD1 1 
ATOM   265   O OD2 . ASP A  1 38  ? 144.149 13.787  -32.576 1.00 31.94  ? 35  ASP A OD2 1 
ATOM   266   N N   . LEU A  1 39  ? 145.378 17.209  -34.000 1.00 29.84  ? 36  LEU A N   1 
ATOM   267   C CA  . LEU A  1 39  ? 144.356 18.244  -34.079 1.00 31.71  ? 36  LEU A CA  1 
ATOM   268   C C   . LEU A  1 39  ? 142.967 17.630  -34.210 1.00 31.74  ? 36  LEU A C   1 
ATOM   269   O O   . LEU A  1 39  ? 142.696 16.853  -35.124 1.00 31.57  ? 36  LEU A O   1 
ATOM   270   C CB  . LEU A  1 39  ? 144.628 19.215  -35.229 1.00 33.78  ? 36  LEU A CB  1 
ATOM   271   C CG  . LEU A  1 39  ? 145.982 19.937  -35.177 1.00 35.78  ? 36  LEU A CG  1 
ATOM   272   C CD1 . LEU A  1 39  ? 146.066 20.947  -36.305 1.00 36.06  ? 36  LEU A CD1 1 
ATOM   273   C CD2 . LEU A  1 39  ? 146.249 20.644  -33.847 1.00 35.83  ? 36  LEU A CD2 1 
ATOM   274   N N   . ALA A  1 40  ? 142.085 18.003  -33.289 1.00 31.10  ? 37  ALA A N   1 
ATOM   275   C CA  . ALA A  1 40  ? 140.762 17.411  -33.218 1.00 31.21  ? 37  ALA A CA  1 
ATOM   276   C C   . ALA A  1 40  ? 139.814 18.073  -34.179 1.00 29.47  ? 37  ALA A C   1 
ATOM   277   O O   . ALA A  1 40  ? 139.821 19.283  -34.360 1.00 28.20  ? 37  ALA A O   1 
ATOM   278   C CB  . ALA A  1 40  ? 140.208 17.503  -31.809 1.00 32.97  ? 37  ALA A CB  1 
ATOM   279   N N   . SER A  1 41  ? 138.973 17.251  -34.771 1.00 29.90  ? 38  SER A N   1 
ATOM   280   C CA  . SER A  1 41  ? 138.066 17.687  -35.805 1.00 31.10  ? 38  SER A CA  1 
ATOM   281   C C   . SER A  1 41  ? 136.721 17.847  -35.156 1.00 30.41  ? 38  SER A C   1 
ATOM   282   O O   . SER A  1 41  ? 136.534 17.424  -34.020 1.00 29.18  ? 38  SER A O   1 
ATOM   283   C CB  . SER A  1 41  ? 137.997 16.607  -36.885 1.00 32.38  ? 38  SER A CB  1 
ATOM   284   O OG  . SER A  1 41  ? 137.517 15.386  -36.312 1.00 32.59  ? 38  SER A OG  1 
ATOM   285   N N   . THR A  1 42  ? 135.764 18.391  -35.890 1.00 30.53  ? 39  THR A N   1 
ATOM   286   C CA  . THR A  1 42  ? 134.444 18.629  -35.319 1.00 32.87  ? 39  THR A CA  1 
ATOM   287   C C   . THR A  1 42  ? 133.784 17.333  -34.788 1.00 32.38  ? 39  THR A C   1 
ATOM   288   O O   . THR A  1 42  ? 132.950 17.391  -33.899 1.00 33.22  ? 39  THR A O   1 
ATOM   289   C CB  . THR A  1 42  ? 133.475 19.330  -36.298 1.00 34.20  ? 39  THR A CB  1 
ATOM   290   O OG1 . THR A  1 42  ? 133.190 18.456  -37.376 1.00 41.68  ? 39  THR A OG1 1 
ATOM   291   C CG2 . THR A  1 42  ? 134.061 20.573  -36.892 1.00 34.78  ? 39  THR A CG2 1 
ATOM   292   N N   . LYS A  1 43  ? 134.143 16.174  -35.319 1.00 32.64  ? 40  LYS A N   1 
ATOM   293   C CA  . LYS A  1 43  ? 133.594 14.907  -34.815 1.00 35.61  ? 40  LYS A CA  1 
ATOM   294   C C   . LYS A  1 43  ? 134.154 14.501  -33.448 1.00 33.79  ? 40  LYS A C   1 
ATOM   295   O O   . LYS A  1 43  ? 133.462 13.868  -32.629 1.00 33.02  ? 40  LYS A O   1 
ATOM   296   C CB  . LYS A  1 43  ? 133.887 13.787  -35.808 1.00 41.95  ? 40  LYS A CB  1 
ATOM   297   C CG  . LYS A  1 43  ? 133.352 12.432  -35.369 1.00 48.37  ? 40  LYS A CG  1 
ATOM   298   C CD  . LYS A  1 43  ? 133.808 11.312  -36.282 1.00 54.71  ? 40  LYS A CD  1 
ATOM   299   C CE  . LYS A  1 43  ? 133.405 9.962   -35.701 1.00 58.03  ? 40  LYS A CE  1 
ATOM   300   N NZ  . LYS A  1 43  ? 133.836 8.828   -36.562 1.00 62.41  ? 40  LYS A NZ  1 
ATOM   301   N N   . THR A  1 44  ? 135.431 14.819  -33.242 1.00 32.35  ? 41  THR A N   1 
ATOM   302   C CA  . THR A  1 44  ? 136.142 14.496  -32.014 1.00 29.76  ? 41  THR A CA  1 
ATOM   303   C C   . THR A  1 44  ? 135.696 15.421  -30.896 1.00 30.05  ? 41  THR A C   1 
ATOM   304   O O   . THR A  1 44  ? 135.422 14.976  -29.795 1.00 30.20  ? 41  THR A O   1 
ATOM   305   C CB  . THR A  1 44  ? 137.660 14.616  -32.223 1.00 28.46  ? 41  THR A CB  1 
ATOM   306   O OG1 . THR A  1 44  ? 138.066 13.705  -33.249 1.00 26.72  ? 41  THR A OG1 1 
ATOM   307   C CG2 . THR A  1 44  ? 138.422 14.298  -30.922 1.00 28.71  ? 41  THR A CG2 1 
ATOM   308   N N   . VAL A  1 45  ? 135.645 16.717  -31.180 1.00 31.03  ? 42  VAL A N   1 
ATOM   309   C CA  . VAL A  1 45  ? 135.127 17.694  -30.223 1.00 30.55  ? 42  VAL A CA  1 
ATOM   310   C C   . VAL A  1 45  ? 133.738 17.237  -29.752 1.00 31.10  ? 42  VAL A C   1 
ATOM   311   O O   . VAL A  1 45  ? 133.476 17.201  -28.556 1.00 32.08  ? 42  VAL A O   1 
ATOM   312   C CB  . VAL A  1 45  ? 135.059 19.128  -30.819 1.00 29.86  ? 42  VAL A CB  1 
ATOM   313   C CG1 . VAL A  1 45  ? 134.399 20.090  -29.853 1.00 29.74  ? 42  VAL A CG1 1 
ATOM   314   C CG2 . VAL A  1 45  ? 136.444 19.654  -31.155 1.00 29.50  ? 42  VAL A CG2 1 
ATOM   315   N N   . GLU A  1 46  ? 132.873 16.864  -30.693 1.00 31.68  ? 43  GLU A N   1 
ATOM   316   C CA  . GLU A  1 46  ? 131.505 16.442  -30.380 1.00 32.49  ? 43  GLU A CA  1 
ATOM   317   C C   . GLU A  1 46  ? 131.463 15.236  -29.447 1.00 32.74  ? 43  GLU A C   1 
ATOM   318   O O   . GLU A  1 46  ? 130.576 15.150  -28.623 1.00 33.71  ? 43  GLU A O   1 
ATOM   319   C CB  . GLU A  1 46  ? 130.709 16.163  -31.660 1.00 33.40  ? 43  GLU A CB  1 
ATOM   320   C CG  . GLU A  1 46  ? 130.233 17.417  -32.399 1.00 33.92  ? 43  GLU A CG  1 
ATOM   321   C CD  . GLU A  1 46  ? 129.685 17.134  -33.804 1.00 35.14  ? 43  GLU A CD  1 
ATOM   322   O OE1 . GLU A  1 46  ? 129.369 18.084  -34.543 1.00 33.40  ? 43  GLU A OE1 1 
ATOM   323   O OE2 . GLU A  1 46  ? 129.557 15.956  -34.195 1.00 37.56  ? 43  GLU A OE2 1 
ATOM   324   N N   . GLN A  1 47  ? 132.411 14.311  -29.575 1.00 34.18  ? 44  GLN A N   1 
ATOM   325   C CA  . GLN A  1 47  ? 132.565 13.231  -28.582 1.00 34.62  ? 44  GLN A CA  1 
ATOM   326   C C   . GLN A  1 47  ? 132.815 13.802  -27.179 1.00 32.31  ? 44  GLN A C   1 
ATOM   327   O O   . GLN A  1 47  ? 132.220 13.327  -26.214 1.00 31.65  ? 44  GLN A O   1 
ATOM   328   C CB  . GLN A  1 47  ? 133.708 12.260  -28.953 1.00 37.18  ? 44  GLN A CB  1 
ATOM   329   C CG  . GLN A  1 47  ? 133.481 11.425  -30.207 1.00 39.05  ? 44  GLN A CG  1 
ATOM   330   C CD  . GLN A  1 47  ? 134.674 10.542  -30.583 1.00 38.70  ? 44  GLN A CD  1 
ATOM   331   O OE1 . GLN A  1 47  ? 135.602 10.330  -29.797 1.00 35.29  ? 44  GLN A OE1 1 
ATOM   332   N NE2 . GLN A  1 47  ? 134.640 10.018  -31.798 1.00 39.81  ? 44  GLN A NE2 1 
ATOM   333   N N   . ALA A  1 48  ? 133.702 14.801  -27.077 1.00 30.25  ? 45  ALA A N   1 
ATOM   334   C CA  . ALA A  1 48  ? 134.037 15.436  -25.785 1.00 28.87  ? 45  ALA A CA  1 
ATOM   335   C C   . ALA A  1 48  ? 132.813 16.134  -25.162 1.00 26.69  ? 45  ALA A C   1 
ATOM   336   O O   . ALA A  1 48  ? 132.493 15.935  -23.997 1.00 26.14  ? 45  ALA A O   1 
ATOM   337   C CB  . ALA A  1 48  ? 135.200 16.412  -25.944 1.00 28.70  ? 45  ALA A CB  1 
ATOM   338   N N   . ILE A  1 49  ? 132.121 16.920  -25.970 1.00 24.02  ? 46  ILE A N   1 
ATOM   339   C CA  . ILE A  1 49  ? 130.862 17.533  -25.576 1.00 22.24  ? 46  ILE A CA  1 
ATOM   340   C C   . ILE A  1 49  ? 129.824 16.487  -25.133 1.00 21.95  ? 46  ILE A C   1 
ATOM   341   O O   . ILE A  1 49  ? 129.085 16.729  -24.174 1.00 23.07  ? 46  ILE A O   1 
ATOM   342   C CB  . ILE A  1 49  ? 130.271 18.381  -26.724 1.00 21.47  ? 46  ILE A CB  1 
ATOM   343   C CG1 . ILE A  1 49  ? 131.200 19.552  -27.082 1.00 20.95  ? 46  ILE A CG1 1 
ATOM   344   C CG2 . ILE A  1 49  ? 128.914 18.941  -26.344 1.00 21.41  ? 46  ILE A CG2 1 
ATOM   345   C CD1 . ILE A  1 49  ? 130.957 20.124  -28.466 1.00 20.18  ? 46  ILE A CD1 1 
ATOM   346   N N   . SER A  1 50  ? 129.755 15.342  -25.825 1.00 21.33  ? 47  SER A N   1 
ATOM   347   C CA  . SER A  1 50  ? 128.834 14.234  -25.452 1.00 20.01  ? 47  SER A CA  1 
ATOM   348   C C   . SER A  1 50  ? 129.212 13.559  -24.138 1.00 20.67  ? 47  SER A C   1 
ATOM   349   O O   . SER A  1 50  ? 128.329 13.180  -23.364 1.00 21.14  ? 47  SER A O   1 
ATOM   350   C CB  . SER A  1 50  ? 128.782 13.177  -26.526 1.00 19.13  ? 47  SER A CB  1 
ATOM   351   O OG  . SER A  1 50  ? 128.211 13.712  -27.687 1.00 18.65  ? 47  SER A OG  1 
ATOM   352   N N   . ALA A  1 51  ? 130.515 13.411  -23.896 1.00 20.48  ? 48  ALA A N   1 
ATOM   353   C CA  . ALA A  1 51  ? 131.027 12.952  -22.603 1.00 20.46  ? 48  ALA A CA  1 
ATOM   354   C C   . ALA A  1 51  ? 130.666 13.913  -21.486 1.00 21.26  ? 48  ALA A C   1 
ATOM   355   O O   . ALA A  1 51  ? 130.273 13.478  -20.392 1.00 22.64  ? 48  ALA A O   1 
ATOM   356   C CB  . ALA A  1 51  ? 132.532 12.800  -22.658 1.00 20.75  ? 48  ALA A CB  1 
ATOM   357   N N   . ALA A  1 52  ? 130.823 15.212  -21.764 1.00 20.86  ? 49  ALA A N   1 
ATOM   358   C CA  . ALA A  1 52  ? 130.478 16.268  -20.823 1.00 20.38  ? 49  ALA A CA  1 
ATOM   359   C C   . ALA A  1 52  ? 128.990 16.196  -20.502 1.00 20.29  ? 49  ALA A C   1 
ATOM   360   O O   . ALA A  1 52  ? 128.607 16.006  -19.356 1.00 19.39  ? 49  ALA A O   1 
ATOM   361   C CB  . ALA A  1 52  ? 130.843 17.635  -21.391 1.00 19.93  ? 49  ALA A CB  1 
ATOM   362   N N   . GLN A  1 53  ? 128.166 16.304  -21.534 1.00 20.32  ? 50  GLN A N   1 
ATOM   363   C CA  . GLN A  1 53  ? 126.722 16.274  -21.369 1.00 21.01  ? 50  GLN A CA  1 
ATOM   364   C C   . GLN A  1 53  ? 126.240 15.022  -20.655 1.00 21.82  ? 50  GLN A C   1 
ATOM   365   O O   . GLN A  1 53  ? 125.336 15.080  -19.849 1.00 20.77  ? 50  GLN A O   1 
ATOM   366   C CB  . GLN A  1 53  ? 126.036 16.370  -22.728 1.00 21.45  ? 50  GLN A CB  1 
ATOM   367   C CG  . GLN A  1 53  ? 124.526 16.582  -22.673 1.00 21.78  ? 50  GLN A CG  1 
ATOM   368   C CD  . GLN A  1 53  ? 124.113 17.918  -22.047 1.00 22.61  ? 50  GLN A CD  1 
ATOM   369   O OE1 . GLN A  1 53  ? 124.579 18.983  -22.446 1.00 24.51  ? 50  GLN A OE1 1 
ATOM   370   N NE2 . GLN A  1 53  ? 123.226 17.866  -21.069 1.00 23.23  ? 50  GLN A NE2 1 
ATOM   371   N N   . HIS A  1 54  ? 126.839 13.883  -20.955 1.00 24.14  ? 51  HIS A N   1 
ATOM   372   C CA  . HIS A  1 54  ? 126.455 12.651  -20.289 1.00 26.24  ? 51  HIS A CA  1 
ATOM   373   C C   . HIS A  1 54  ? 126.750 12.714  -18.793 1.00 25.88  ? 51  HIS A C   1 
ATOM   374   O O   . HIS A  1 54  ? 125.900 12.342  -18.007 1.00 26.82  ? 51  HIS A O   1 
ATOM   375   C CB  . HIS A  1 54  ? 127.156 11.457  -20.924 1.00 28.86  ? 51  HIS A CB  1 
ATOM   376   C CG  . HIS A  1 54  ? 126.738 10.127  -20.365 1.00 32.52  ? 51  HIS A CG  1 
ATOM   377   N ND1 . HIS A  1 54  ? 125.482 9.596   -20.571 1.00 34.98  ? 51  HIS A ND1 1 
ATOM   378   C CD2 . HIS A  1 54  ? 127.425 9.199   -19.649 1.00 33.68  ? 51  HIS A CD2 1 
ATOM   379   C CE1 . HIS A  1 54  ? 125.406 8.410   -19.988 1.00 35.07  ? 51  HIS A CE1 1 
ATOM   380   N NE2 . HIS A  1 54  ? 126.571 8.146   -19.423 1.00 34.15  ? 51  HIS A NE2 1 
ATOM   381   N N   . ALA A  1 55  ? 127.932 13.202  -18.406 1.00 25.54  ? 52  ALA A N   1 
ATOM   382   C CA  . ALA A  1 55  ? 128.345 13.257  -16.983 1.00 24.71  ? 52  ALA A CA  1 
ATOM   383   C C   . ALA A  1 55  ? 127.649 14.353  -16.145 1.00 24.54  ? 52  ALA A C   1 
ATOM   384   O O   . ALA A  1 55  ? 127.605 14.259  -14.909 1.00 24.96  ? 52  ALA A O   1 
ATOM   385   C CB  . ALA A  1 55  ? 129.859 13.420  -16.881 1.00 24.81  ? 52  ALA A CB  1 
ATOM   386   N N   . PHE A  1 56  ? 127.123 15.378  -16.823 1.00 23.33  ? 53  PHE A N   1 
ATOM   387   C CA  . PHE A  1 56  ? 126.502 16.549  -16.196 1.00 21.98  ? 53  PHE A CA  1 
ATOM   388   C C   . PHE A  1 56  ? 125.369 16.292  -15.193 1.00 22.41  ? 53  PHE A C   1 
ATOM   389   O O   . PHE A  1 56  ? 125.449 16.814  -14.100 1.00 24.37  ? 53  PHE A O   1 
ATOM   390   C CB  . PHE A  1 56  ? 126.031 17.542  -17.271 1.00 21.99  ? 53  PHE A CB  1 
ATOM   391   C CG  . PHE A  1 56  ? 125.289 18.734  -16.720 1.00 21.47  ? 53  PHE A CG  1 
ATOM   392   C CD1 . PHE A  1 56  ? 125.918 19.628  -15.888 1.00 21.45  ? 53  PHE A CD1 1 
ATOM   393   C CD2 . PHE A  1 56  ? 123.964 18.951  -17.035 1.00 21.26  ? 53  PHE A CD2 1 
ATOM   394   C CE1 . PHE A  1 56  ? 125.240 20.705  -15.367 1.00 21.32  ? 53  PHE A CE1 1 
ATOM   395   C CE2 . PHE A  1 56  ? 123.287 20.033  -16.528 1.00 20.59  ? 53  PHE A CE2 1 
ATOM   396   C CZ  . PHE A  1 56  ? 123.925 20.911  -15.693 1.00 21.01  ? 53  PHE A CZ  1 
ATOM   397   N N   . PRO A  1 57  ? 124.315 15.513  -15.547 1.00 21.46  ? 54  PRO A N   1 
ATOM   398   C CA  . PRO A  1 57  ? 123.184 15.334  -14.627 1.00 20.66  ? 54  PRO A CA  1 
ATOM   399   C C   . PRO A  1 57  ? 123.550 14.930  -13.201 1.00 19.84  ? 54  PRO A C   1 
ATOM   400   O O   . PRO A  1 57  ? 123.070 15.538  -12.234 1.00 19.75  ? 54  PRO A O   1 
ATOM   401   C CB  . PRO A  1 57  ? 122.371 14.226  -15.285 1.00 20.72  ? 54  PRO A CB  1 
ATOM   402   C CG  . PRO A  1 57  ? 122.641 14.397  -16.727 1.00 21.11  ? 54  PRO A CG  1 
ATOM   403   C CD  . PRO A  1 57  ? 124.071 14.821  -16.822 1.00 21.35  ? 54  PRO A CD  1 
ATOM   404   N N   . THR A  1 58  ? 124.398 13.926  -13.064 1.00 19.13  ? 55  THR A N   1 
ATOM   405   C CA  . THR A  1 58  ? 124.772 13.486  -11.724 1.00 19.26  ? 55  THR A CA  1 
ATOM   406   C C   . THR A  1 58  ? 125.682 14.523  -11.087 1.00 19.23  ? 55  THR A C   1 
ATOM   407   O O   . THR A  1 58  ? 125.542 14.808  -9.894  1.00 20.53  ? 55  THR A O   1 
ATOM   408   C CB  . THR A  1 58  ? 125.390 12.072  -11.680 1.00 18.24  ? 55  THR A CB  1 
ATOM   409   O OG1 . THR A  1 58  ? 126.483 11.990  -12.596 1.00 19.32  ? 55  THR A OG1 1 
ATOM   410   C CG2 . THR A  1 58  ? 124.355 11.057  -12.063 1.00 17.71  ? 55  THR A CG2 1 
ATOM   411   N N   . TRP A  1 59  ? 126.560 15.136  -11.877 1.00 18.42  ? 56  TRP A N   1 
ATOM   412   C CA  . TRP A  1 59  ? 127.506 16.118  -11.335 1.00 18.09  ? 56  TRP A CA  1 
ATOM   413   C C   . TRP A  1 59  ? 126.796 17.401  -10.843 1.00 18.09  ? 56  TRP A C   1 
ATOM   414   O O   . TRP A  1 59  ? 127.107 17.945  -9.778  1.00 17.71  ? 56  TRP A O   1 
ATOM   415   C CB  . TRP A  1 59  ? 128.612 16.414  -12.356 1.00 17.54  ? 56  TRP A CB  1 
ATOM   416   C CG  . TRP A  1 59  ? 129.703 17.294  -11.817 1.00 17.10  ? 56  TRP A CG  1 
ATOM   417   C CD1 . TRP A  1 59  ? 129.992 18.574  -12.207 1.00 16.44  ? 56  TRP A CD1 1 
ATOM   418   C CD2 . TRP A  1 59  ? 130.621 16.978  -10.765 1.00 16.78  ? 56  TRP A CD2 1 
ATOM   419   N NE1 . TRP A  1 59  ? 131.034 19.065  -11.480 1.00 15.99  ? 56  TRP A NE1 1 
ATOM   420   C CE2 . TRP A  1 59  ? 131.445 18.112  -10.584 1.00 16.47  ? 56  TRP A CE2 1 
ATOM   421   C CE3 . TRP A  1 59  ? 130.827 15.850  -9.956  1.00 16.51  ? 56  TRP A CE3 1 
ATOM   422   C CZ2 . TRP A  1 59  ? 132.475 18.148  -9.628  1.00 16.52  ? 56  TRP A CZ2 1 
ATOM   423   C CZ3 . TRP A  1 59  ? 131.843 15.885  -9.011  1.00 16.53  ? 56  TRP A CZ3 1 
ATOM   424   C CH2 . TRP A  1 59  ? 132.664 17.024  -8.864  1.00 16.63  ? 56  TRP A CH2 1 
ATOM   425   N N   . ARG A  1 60  ? 125.816 17.841  -11.605 1.00 18.91  ? 57  ARG A N   1 
ATOM   426   C CA  . ARG A  1 60  ? 124.916 18.920  -11.206 1.00 20.65  ? 57  ARG A CA  1 
ATOM   427   C C   . ARG A  1 60  ? 124.319 18.680  -9.833  1.00 19.83  ? 57  ARG A C   1 
ATOM   428   O O   . ARG A  1 60  ? 124.250 19.584  -9.028  1.00 19.56  ? 57  ARG A O   1 
ATOM   429   C CB  . ARG A  1 60  ? 123.772 19.058  -12.235 1.00 22.90  ? 57  ARG A CB  1 
ATOM   430   C CG  . ARG A  1 60  ? 122.700 20.104  -11.937 1.00 24.38  ? 57  ARG A CG  1 
ATOM   431   C CD  . ARG A  1 60  ? 121.432 19.908  -12.771 1.00 26.41  ? 57  ARG A CD  1 
ATOM   432   N NE  . ARG A  1 60  ? 120.228 20.034  -11.925 1.00 27.86  ? 57  ARG A NE  1 
ATOM   433   C CZ  . ARG A  1 60  ? 119.470 21.134  -11.786 1.00 28.62  ? 57  ARG A CZ  1 
ATOM   434   N NH1 . ARG A  1 60  ? 119.722 22.291  -12.429 1.00 28.47  ? 57  ARG A NH1 1 
ATOM   435   N NH2 . ARG A  1 60  ? 118.433 21.081  -10.969 1.00 28.96  ? 57  ARG A NH2 1 
ATOM   436   N N   . ASN A  1 61  ? 123.865 17.470  -9.573  1.00 19.98  ? 58  ASN A N   1 
ATOM   437   C CA  . ASN A  1 61  ? 123.173 17.195  -8.315  1.00 20.39  ? 58  ASN A CA  1 
ATOM   438   C C   . ASN A  1 61  ? 124.120 16.766  -7.206  1.00 19.12  ? 58  ASN A C   1 
ATOM   439   O O   . ASN A  1 61  ? 123.675 16.520  -6.077  1.00 17.73  ? 58  ASN A O   1 
ATOM   440   C CB  . ASN A  1 61  ? 122.047 16.158  -8.502  1.00 21.65  ? 58  ASN A CB  1 
ATOM   441   C CG  . ASN A  1 61  ? 120.790 16.732  -9.167  1.00 23.11  ? 58  ASN A CG  1 
ATOM   442   O OD1 . ASN A  1 61  ? 120.543 17.951  -9.264  1.00 24.36  ? 58  ASN A OD1 1 
ATOM   443   N ND2 . ASN A  1 61  ? 119.971 15.828  -9.628  1.00 25.39  ? 58  ASN A ND2 1 
ATOM   444   N N   . THR A  1 62  ? 125.412 16.680  -7.515  1.00 18.87  ? 59  THR A N   1 
ATOM   445   C CA  . THR A  1 62  ? 126.423 16.454  -6.480  1.00 19.39  ? 59  THR A CA  1 
ATOM   446   C C   . THR A  1 62  ? 126.527 17.680  -5.558  1.00 19.82  ? 59  THR A C   1 
ATOM   447   O O   . THR A  1 62  ? 126.547 18.823  -6.036  1.00 19.84  ? 59  THR A O   1 
ATOM   448   C CB  . THR A  1 62  ? 127.809 16.135  -7.061  1.00 19.21  ? 59  THR A CB  1 
ATOM   449   O OG1 . THR A  1 62  ? 127.725 14.975  -7.877  1.00 18.63  ? 59  THR A OG1 1 
ATOM   450   C CG2 . THR A  1 62  ? 128.793 15.812  -5.965  1.00 19.57  ? 59  THR A CG2 1 
ATOM   451   N N   . PRO A  1 63  ? 126.584 17.445  -4.235  1.00 19.50  ? 60  PRO A N   1 
ATOM   452   C CA  . PRO A  1 63  ? 126.725 18.581  -3.335  1.00 19.39  ? 60  PRO A CA  1 
ATOM   453   C C   . PRO A  1 63  ? 128.031 19.356  -3.538  1.00 18.89  ? 60  PRO A C   1 
ATOM   454   O O   . PRO A  1 63  ? 129.081 18.751  -3.752  1.00 18.30  ? 60  PRO A O   1 
ATOM   455   C CB  . PRO A  1 63  ? 126.686 17.931  -1.947  1.00 19.55  ? 60  PRO A CB  1 
ATOM   456   C CG  . PRO A  1 63  ? 125.833 16.730  -2.141  1.00 19.50  ? 60  PRO A CG  1 
ATOM   457   C CD  . PRO A  1 63  ? 126.233 16.217  -3.500  1.00 19.35  ? 60  PRO A CD  1 
ATOM   458   N N   . PRO A  1 64  ? 127.961 20.690  -3.474  1.00 18.73  ? 61  PRO A N   1 
ATOM   459   C CA  . PRO A  1 64  ? 129.123 21.570  -3.515  1.00 18.84  ? 61  PRO A CA  1 
ATOM   460   C C   . PRO A  1 64  ? 130.265 21.124  -2.602  1.00 18.97  ? 61  PRO A C   1 
ATOM   461   O O   . PRO A  1 64  ? 131.420 21.284  -2.939  1.00 18.55  ? 61  PRO A O   1 
ATOM   462   C CB  . PRO A  1 64  ? 128.571 22.893  -2.988  1.00 18.89  ? 61  PRO A CB  1 
ATOM   463   C CG  . PRO A  1 64  ? 127.147 22.869  -3.344  1.00 19.13  ? 61  PRO A CG  1 
ATOM   464   C CD  . PRO A  1 64  ? 126.711 21.443  -3.314  1.00 18.74  ? 61  PRO A CD  1 
ATOM   465   N N   . LEU A  1 65  ? 129.944 20.620  -1.426  1.00 20.15  ? 62  LEU A N   1 
ATOM   466   C CA  . LEU A  1 65  ? 130.993 20.160  -0.521  1.00 21.51  ? 62  LEU A CA  1 
ATOM   467   C C   . LEU A  1 65  ? 131.806 19.060  -1.167  1.00 23.15  ? 62  LEU A C   1 
ATOM   468   O O   . LEU A  1 65  ? 133.032 19.123  -1.207  1.00 24.80  ? 62  LEU A O   1 
ATOM   469   C CB  . LEU A  1 65  ? 130.428 19.665  0.803   1.00 20.78  ? 62  LEU A CB  1 
ATOM   470   C CG  . LEU A  1 65  ? 130.424 20.771  1.858   1.00 20.98  ? 62  LEU A CG  1 
ATOM   471   C CD1 . LEU A  1 65  ? 129.439 20.500  2.997   1.00 20.42  ? 62  LEU A CD1 1 
ATOM   472   C CD2 . LEU A  1 65  ? 131.853 20.939  2.361   1.00 21.73  ? 62  LEU A CD2 1 
ATOM   473   N N   . LYS A  1 66  ? 131.101 18.072  -1.698  1.00 23.78  ? 63  LYS A N   1 
ATOM   474   C CA  . LYS A  1 66  ? 131.726 16.941  -2.349  1.00 23.17  ? 63  LYS A CA  1 
ATOM   475   C C   . LYS A  1 66  ? 132.463 17.364  -3.631  1.00 21.54  ? 63  LYS A C   1 
ATOM   476   O O   . LYS A  1 66  ? 133.564 16.886  -3.910  1.00 21.36  ? 63  LYS A O   1 
ATOM   477   C CB  . LYS A  1 66  ? 130.677 15.851  -2.622  1.00 24.24  ? 63  LYS A CB  1 
ATOM   478   C CG  . LYS A  1 66  ? 131.290 14.523  -3.037  1.00 26.19  ? 63  LYS A CG  1 
ATOM   479   C CD  . LYS A  1 66  ? 130.283 13.460  -3.435  1.00 27.55  ? 63  LYS A CD  1 
ATOM   480   C CE  . LYS A  1 66  ? 131.039 12.227  -3.901  1.00 29.02  ? 63  LYS A CE  1 
ATOM   481   N NZ  . LYS A  1 66  ? 130.113 11.158  -4.319  1.00 31.29  ? 63  LYS A NZ  1 
ATOM   482   N N   . ARG A  1 67  ? 131.868 18.254  -4.410  1.00 20.18  ? 64  ARG A N   1 
ATOM   483   C CA  . ARG A  1 67  ? 132.561 18.761  -5.595  1.00 19.89  ? 64  ARG A CA  1 
ATOM   484   C C   . ARG A  1 67  ? 133.853 19.478  -5.209  1.00 19.99  ? 64  ARG A C   1 
ATOM   485   O O   . ARG A  1 67  ? 134.847 19.356  -5.906  1.00 20.46  ? 64  ARG A O   1 
ATOM   486   C CB  . ARG A  1 67  ? 131.691 19.724  -6.407  1.00 19.41  ? 64  ARG A CB  1 
ATOM   487   C CG  . ARG A  1 67  ? 130.403 19.121  -6.895  1.00 19.66  ? 64  ARG A CG  1 
ATOM   488   C CD  . ARG A  1 67  ? 129.843 19.890  -8.072  1.00 19.75  ? 64  ARG A CD  1 
ATOM   489   N NE  . ARG A  1 67  ? 129.370 21.228  -7.722  1.00 19.14  ? 64  ARG A NE  1 
ATOM   490   C CZ  . ARG A  1 67  ? 128.100 21.590  -7.609  1.00 18.57  ? 64  ARG A CZ  1 
ATOM   491   N NH1 . ARG A  1 67  ? 127.117 20.723  -7.778  1.00 19.05  ? 64  ARG A NH1 1 
ATOM   492   N NH2 . ARG A  1 67  ? 127.810 22.840  -7.312  1.00 18.71  ? 64  ARG A NH2 1 
ATOM   493   N N   . ALA A  1 68  ? 133.822 20.238  -4.114  1.00 20.05  ? 65  ALA A N   1 
ATOM   494   C CA  . ALA A  1 68  ? 134.958 21.056  -3.707  1.00 20.57  ? 65  ALA A CA  1 
ATOM   495   C C   . ALA A  1 68  ? 136.123 20.212  -3.222  1.00 21.07  ? 65  ALA A C   1 
ATOM   496   O O   . ALA A  1 68  ? 137.284 20.568  -3.446  1.00 20.69  ? 65  ALA A O   1 
ATOM   497   C CB  . ALA A  1 68  ? 134.550 22.037  -2.635  1.00 21.11  ? 65  ALA A CB  1 
ATOM   498   N N   . ARG A  1 69  ? 135.809 19.079  -2.600  1.00 21.45  ? 66  ARG A N   1 
ATOM   499   C CA  . ARG A  1 69  ? 136.832 18.146  -2.145  1.00 22.17  ? 66  ARG A CA  1 
ATOM   500   C C   . ARG A  1 69  ? 137.674 17.607  -3.327  1.00 22.11  ? 66  ARG A C   1 
ATOM   501   O O   . ARG A  1 69  ? 138.833 17.169  -3.153  1.00 23.34  ? 66  ARG A O   1 
ATOM   502   C CB  . ARG A  1 69  ? 136.215 16.992  -1.334  1.00 22.68  ? 66  ARG A CB  1 
ATOM   503   C CG  . ARG A  1 69  ? 135.604 17.385  0.006   1.00 23.24  ? 66  ARG A CG  1 
ATOM   504   C CD  . ARG A  1 69  ? 135.170 16.154  0.783   1.00 24.36  ? 66  ARG A CD  1 
ATOM   505   N NE  . ARG A  1 69  ? 133.814 16.302  1.303   1.00 25.41  ? 66  ARG A NE  1 
ATOM   506   C CZ  . ARG A  1 69  ? 133.485 16.879  2.450   1.00 25.75  ? 66  ARG A CZ  1 
ATOM   507   N NH1 . ARG A  1 69  ? 134.409 17.379  3.253   1.00 26.09  ? 66  ARG A NH1 1 
ATOM   508   N NH2 . ARG A  1 69  ? 132.205 16.960  2.789   1.00 26.47  ? 66  ARG A NH2 1 
ATOM   509   N N   . VAL A  1 70  ? 137.117 17.633  -4.529  1.00 20.36  ? 67  VAL A N   1 
ATOM   510   C CA  . VAL A  1 70  ? 137.921 17.266  -5.668  1.00 20.22  ? 67  VAL A CA  1 
ATOM   511   C C   . VAL A  1 70  ? 139.015 18.298  -5.838  1.00 19.44  ? 67  VAL A C   1 
ATOM   512   O O   . VAL A  1 70  ? 140.148 17.945  -6.101  1.00 19.04  ? 67  VAL A O   1 
ATOM   513   C CB  . VAL A  1 70  ? 137.105 17.128  -6.960  1.00 20.70  ? 67  VAL A CB  1 
ATOM   514   C CG1 . VAL A  1 70  ? 138.016 16.756  -8.130  1.00 21.20  ? 67  VAL A CG1 1 
ATOM   515   C CG2 . VAL A  1 70  ? 136.040 16.057  -6.799  1.00 20.60  ? 67  VAL A CG2 1 
ATOM   516   N N   . MET A  1 71  ? 138.669 19.565  -5.665  1.00 19.72  ? 68  MET A N   1 
ATOM   517   C CA  . MET A  1 71  ? 139.630 20.663  -5.828  1.00 20.33  ? 68  MET A CA  1 
ATOM   518   C C   . MET A  1 71  ? 140.666 20.749  -4.710  1.00 19.76  ? 68  MET A C   1 
ATOM   519   O O   . MET A  1 71  ? 141.793 21.187  -4.931  1.00 18.29  ? 68  MET A O   1 
ATOM   520   C CB  . MET A  1 71  ? 138.908 22.001  -5.967  1.00 20.82  ? 68  MET A CB  1 
ATOM   521   C CG  . MET A  1 71  ? 137.893 22.063  -7.121  1.00 21.67  ? 68  MET A CG  1 
ATOM   522   S SD  . MET A  1 71  ? 138.373 21.567  -8.813  1.00 21.26  ? 68  MET A SD  1 
ATOM   523   C CE  . MET A  1 71  ? 139.952 22.364  -8.813  1.00 22.42  ? 68  MET A CE  1 
ATOM   524   N N   . PHE A  1 72  ? 140.257 20.329  -3.520  1.00 20.30  ? 69  PHE A N   1 
ATOM   525   C CA  . PHE A  1 72  ? 141.153 20.161  -2.371  1.00 20.67  ? 69  PHE A CA  1 
ATOM   526   C C   . PHE A  1 72  ? 142.243 19.125  -2.657  1.00 21.22  ? 69  PHE A C   1 
ATOM   527   O O   . PHE A  1 72  ? 143.399 19.347  -2.352  1.00 21.30  ? 69  PHE A O   1 
ATOM   528   C CB  . PHE A  1 72  ? 140.352 19.718  -1.134  1.00 19.86  ? 69  PHE A CB  1 
ATOM   529   C CG  . PHE A  1 72  ? 139.849 20.844  -0.290  1.00 19.15  ? 69  PHE A CG  1 
ATOM   530   C CD1 . PHE A  1 72  ? 140.727 21.619  0.455   1.00 19.49  ? 69  PHE A CD1 1 
ATOM   531   C CD2 . PHE A  1 72  ? 138.500 21.104  -0.198  1.00 18.93  ? 69  PHE A CD2 1 
ATOM   532   C CE1 . PHE A  1 72  ? 140.255 22.636  1.271   1.00 19.04  ? 69  PHE A CE1 1 
ATOM   533   C CE2 . PHE A  1 72  ? 138.019 22.127  0.601   1.00 18.72  ? 69  PHE A CE2 1 
ATOM   534   C CZ  . PHE A  1 72  ? 138.895 22.889  1.341   1.00 18.82  ? 69  PHE A CZ  1 
ATOM   535   N N   . ARG A  1 73  ? 141.842 17.988  -3.215  1.00 22.71  ? 70  ARG A N   1 
ATOM   536   C CA  . ARG A  1 73  ? 142.765 16.910  -3.617  1.00 23.91  ? 70  ARG A CA  1 
ATOM   537   C C   . ARG A  1 73  ? 143.619 17.306  -4.813  1.00 22.04  ? 70  ARG A C   1 
ATOM   538   O O   . ARG A  1 73  ? 144.786 16.980  -4.887  1.00 22.15  ? 70  ARG A O   1 
ATOM   539   C CB  . ARG A  1 73  ? 141.987 15.627  -3.958  1.00 25.67  ? 70  ARG A CB  1 
ATOM   540   C CG  . ARG A  1 73  ? 141.512 14.849  -2.743  1.00 27.75  ? 70  ARG A CG  1 
ATOM   541   C CD  . ARG A  1 73  ? 140.663 13.655  -3.144  1.00 29.68  ? 70  ARG A CD  1 
ATOM   542   N NE  . ARG A  1 73  ? 139.457 13.499  -2.315  1.00 32.49  ? 70  ARG A NE  1 
ATOM   543   C CZ  . ARG A  1 73  ? 138.178 13.593  -2.732  1.00 33.38  ? 70  ARG A CZ  1 
ATOM   544   N NH1 . ARG A  1 73  ? 137.857 13.859  -4.011  1.00 32.70  ? 70  ARG A NH1 1 
ATOM   545   N NH2 . ARG A  1 73  ? 137.192 13.411  -1.844  1.00 32.88  ? 70  ARG A NH2 1 
ATOM   546   N N   . PHE A  1 74  ? 142.996 17.990  -5.750  1.00 20.74  ? 71  PHE A N   1 
ATOM   547   C CA  . PHE A  1 74  ? 143.681 18.591  -6.868  1.00 20.67  ? 71  PHE A CA  1 
ATOM   548   C C   . PHE A  1 74  ? 144.778 19.585  -6.421  1.00 20.92  ? 71  PHE A C   1 
ATOM   549   O O   . PHE A  1 74  ? 145.876 19.578  -6.958  1.00 20.54  ? 71  PHE A O   1 
ATOM   550   C CB  . PHE A  1 74  ? 142.627 19.288  -7.743  1.00 20.32  ? 71  PHE A CB  1 
ATOM   551   C CG  . PHE A  1 74  ? 143.123 19.715  -9.090  1.00 20.00  ? 71  PHE A CG  1 
ATOM   552   C CD1 . PHE A  1 74  ? 143.845 18.849  -9.887  1.00 20.39  ? 71  PHE A CD1 1 
ATOM   553   C CD2 . PHE A  1 74  ? 142.834 20.975  -9.580  1.00 20.00  ? 71  PHE A CD2 1 
ATOM   554   C CE1 . PHE A  1 74  ? 144.299 19.245  -11.134 1.00 20.57  ? 71  PHE A CE1 1 
ATOM   555   C CE2 . PHE A  1 74  ? 143.270 21.388  -10.826 1.00 20.34  ? 71  PHE A CE2 1 
ATOM   556   C CZ  . PHE A  1 74  ? 144.011 20.520  -11.607 1.00 20.78  ? 71  PHE A CZ  1 
ATOM   557   N N   . LYS A  1 75  ? 144.474 20.418  -5.425  1.00 21.59  ? 72  LYS A N   1 
ATOM   558   C CA  . LYS A  1 75  ? 145.428 21.381  -4.844  1.00 21.54  ? 72  LYS A CA  1 
ATOM   559   C C   . LYS A  1 75  ? 146.774 20.709  -4.575  1.00 22.91  ? 72  LYS A C   1 
ATOM   560   O O   . LYS A  1 75  ? 147.829 21.207  -4.947  1.00 22.65  ? 72  LYS A O   1 
ATOM   561   C CB  . LYS A  1 75  ? 144.858 21.932  -3.535  1.00 20.84  ? 72  LYS A CB  1 
ATOM   562   C CG  . LYS A  1 75  ? 145.167 23.377  -3.262  1.00 20.60  ? 72  LYS A CG  1 
ATOM   563   C CD  . LYS A  1 75  ? 146.457 23.539  -2.493  1.00 21.05  ? 72  LYS A CD  1 
ATOM   564   C CE  . LYS A  1 75  ? 146.218 23.787  -1.024  1.00 20.87  ? 72  LYS A CE  1 
ATOM   565   N NZ  . LYS A  1 75  ? 147.038 24.967  -0.666  1.00 21.52  ? 72  LYS A NZ  1 
ATOM   566   N N   . GLU A  1 76  ? 146.685 19.539  -3.960  1.00 24.69  ? 73  GLU A N   1 
ATOM   567   C CA  . GLU A  1 76  ? 147.824 18.739  -3.543  1.00 25.94  ? 73  GLU A CA  1 
ATOM   568   C C   . GLU A  1 76  ? 148.624 18.198  -4.696  1.00 23.53  ? 73  GLU A C   1 
ATOM   569   O O   . GLU A  1 76  ? 149.829 18.294  -4.717  1.00 24.36  ? 73  GLU A O   1 
ATOM   570   C CB  . GLU A  1 76  ? 147.323 17.548  -2.724  1.00 29.62  ? 73  GLU A CB  1 
ATOM   571   C CG  . GLU A  1 76  ? 146.587 17.942  -1.463  1.00 33.38  ? 73  GLU A CG  1 
ATOM   572   C CD  . GLU A  1 76  ? 147.489 18.740  -0.569  1.00 38.72  ? 73  GLU A CD  1 
ATOM   573   O OE1 . GLU A  1 76  ? 147.162 19.934  -0.305  1.00 43.29  ? 73  GLU A OE1 1 
ATOM   574   O OE2 . GLU A  1 76  ? 148.551 18.176  -0.176  1.00 40.96  ? 73  GLU A OE2 1 
ATOM   575   N N   . LEU A  1 77  ? 147.937 17.599  -5.643  1.00 21.81  ? 74  LEU A N   1 
ATOM   576   C CA  . LEU A  1 77  ? 148.574 16.977  -6.782  1.00 20.70  ? 74  LEU A CA  1 
ATOM   577   C C   . LEU A  1 77  ? 149.379 17.973  -7.566  1.00 20.38  ? 74  LEU A C   1 
ATOM   578   O O   . LEU A  1 77  ? 150.435 17.650  -8.088  1.00 19.66  ? 74  LEU A O   1 
ATOM   579   C CB  . LEU A  1 77  ? 147.514 16.399  -7.704  1.00 20.51  ? 74  LEU A CB  1 
ATOM   580   C CG  . LEU A  1 77  ? 146.692 15.294  -7.093  1.00 20.09  ? 74  LEU A CG  1 
ATOM   581   C CD1 . LEU A  1 77  ? 145.689 14.807  -8.097  1.00 20.09  ? 74  LEU A CD1 1 
ATOM   582   C CD2 . LEU A  1 77  ? 147.599 14.161  -6.666  1.00 20.24  ? 74  LEU A CD2 1 
ATOM   583   N N   . LEU A  1 78  ? 148.860 19.188  -7.665  1.00 20.42  ? 75  LEU A N   1 
ATOM   584   C CA  . LEU A  1 78  ? 149.505 20.204  -8.448  1.00 20.89  ? 75  LEU A CA  1 
ATOM   585   C C   . LEU A  1 78  ? 150.832 20.568  -7.819  1.00 22.96  ? 75  LEU A C   1 
ATOM   586   O O   . LEU A  1 78  ? 151.829 20.694  -8.518  1.00 24.46  ? 75  LEU A O   1 
ATOM   587   C CB  . LEU A  1 78  ? 148.603 21.412  -8.566  1.00 20.11  ? 75  LEU A CB  1 
ATOM   588   C CG  . LEU A  1 78  ? 147.364 21.229  -9.439  1.00 19.15  ? 75  LEU A CG  1 
ATOM   589   C CD1 . LEU A  1 78  ? 146.558 22.523  -9.474  1.00 18.62  ? 75  LEU A CD1 1 
ATOM   590   C CD2 . LEU A  1 78  ? 147.736 20.806  -10.844 1.00 18.70  ? 75  LEU A CD2 1 
ATOM   591   N N   . GLU A  1 79  ? 150.832 20.681  -6.493  1.00 25.12  ? 76  GLU A N   1 
ATOM   592   C CA  . GLU A  1 79  ? 152.023 21.001  -5.698  1.00 26.39  ? 76  GLU A CA  1 
ATOM   593   C C   . GLU A  1 79  ? 152.984 19.827  -5.658  1.00 27.95  ? 76  GLU A C   1 
ATOM   594   O O   . GLU A  1 79  ? 154.209 20.007  -5.682  1.00 28.61  ? 76  GLU A O   1 
ATOM   595   C CB  . GLU A  1 79  ? 151.635 21.385  -4.263  1.00 27.10  ? 76  GLU A CB  1 
ATOM   596   C CG  . GLU A  1 79  ? 150.553 22.470  -4.142  1.00 27.57  ? 76  GLU A CG  1 
ATOM   597   C CD  . GLU A  1 79  ? 150.209 22.889  -2.708  1.00 27.72  ? 76  GLU A CD  1 
ATOM   598   O OE1 . GLU A  1 79  ? 150.515 22.106  -1.776  1.00 29.07  ? 76  GLU A OE1 1 
ATOM   599   O OE2 . GLU A  1 79  ? 149.612 23.988  -2.511  1.00 24.84  ? 76  GLU A OE2 1 
ATOM   600   N N   . GLN A  1 80  ? 152.427 18.627  -5.581  1.00 30.13  ? 77  GLN A N   1 
ATOM   601   C CA  . GLN A  1 80  ? 153.224 17.412  -5.652  1.00 33.37  ? 77  GLN A CA  1 
ATOM   602   C C   . GLN A  1 80  ? 153.966 17.260  -6.960  1.00 31.79  ? 77  GLN A C   1 
ATOM   603   O O   . GLN A  1 80  ? 155.120 16.871  -6.945  1.00 33.29  ? 77  GLN A O   1 
ATOM   604   C CB  . GLN A  1 80  ? 152.357 16.190  -5.426  1.00 37.37  ? 77  GLN A CB  1 
ATOM   605   C CG  . GLN A  1 80  ? 151.919 16.096  -3.973  1.00 43.80  ? 77  GLN A CG  1 
ATOM   606   C CD  . GLN A  1 80  ? 151.142 14.822  -3.645  1.00 50.73  ? 77  GLN A CD  1 
ATOM   607   O OE1 . GLN A  1 80  ? 151.022 13.893  -4.471  1.00 52.51  ? 77  GLN A OE1 1 
ATOM   608   N NE2 . GLN A  1 80  ? 150.607 14.770  -2.423  1.00 50.47  ? 77  GLN A NE2 1 
ATOM   609   N N   . HIS A  1 81  ? 153.315 17.584  -8.073  1.00 30.01  ? 78  HIS A N   1 
ATOM   610   C CA  . HIS A  1 81  ? 153.920 17.464  -9.407  1.00 29.26  ? 78  HIS A CA  1 
ATOM   611   C C   . HIS A  1 81  ? 154.448 18.811  -9.928  1.00 28.70  ? 78  HIS A C   1 
ATOM   612   O O   . HIS A  1 81  ? 154.587 19.024  -11.144 1.00 27.14  ? 78  HIS A O   1 
ATOM   613   C CB  . HIS A  1 81  ? 152.899 16.876  -10.391 1.00 28.82  ? 78  HIS A CB  1 
ATOM   614   C CG  . HIS A  1 81  ? 152.363 15.549  -9.967  1.00 28.84  ? 78  HIS A CG  1 
ATOM   615   N ND1 . HIS A  1 81  ? 153.025 14.371  -10.216 1.00 29.39  ? 78  HIS A ND1 1 
ATOM   616   C CD2 . HIS A  1 81  ? 151.246 15.211  -9.284  1.00 28.98  ? 78  HIS A CD2 1 
ATOM   617   C CE1 . HIS A  1 81  ? 152.337 13.364  -9.709  1.00 29.37  ? 78  HIS A CE1 1 
ATOM   618   N NE2 . HIS A  1 81  ? 151.251 13.846  -9.140  1.00 28.68  ? 78  HIS A NE2 1 
ATOM   619   N N   . ALA A  1 82  ? 154.769 19.714  -9.009  1.00 27.79  ? 79  ALA A N   1 
ATOM   620   C CA  . ALA A  1 82  ? 155.082 21.081  -9.388  1.00 27.46  ? 79  ALA A CA  1 
ATOM   621   C C   . ALA A  1 82  ? 156.323 21.173  -10.286 1.00 27.59  ? 79  ALA A C   1 
ATOM   622   O O   . ALA A  1 82  ? 156.341 21.961  -11.228 1.00 27.43  ? 79  ALA A O   1 
ATOM   623   C CB  . ALA A  1 82  ? 155.231 21.952  -8.154  1.00 26.60  ? 79  ALA A CB  1 
ATOM   624   N N   . ASP A  1 83  ? 157.345 20.367  -10.019 1.00 28.20  ? 80  ASP A N   1 
ATOM   625   C CA  . ASP A  1 83  ? 158.557 20.402  -10.855 1.00 29.47  ? 80  ASP A CA  1 
ATOM   626   C C   . ASP A  1 83  ? 158.293 19.930  -12.276 1.00 30.81  ? 80  ASP A C   1 
ATOM   627   O O   . ASP A  1 83  ? 158.732 20.562  -13.235 1.00 30.44  ? 80  ASP A O   1 
ATOM   628   C CB  . ASP A  1 83  ? 159.665 19.554  -10.260 1.00 29.18  ? 80  ASP A CB  1 
ATOM   629   C CG  . ASP A  1 83  ? 160.194 20.120  -8.981  1.00 29.15  ? 80  ASP A CG  1 
ATOM   630   O OD1 . ASP A  1 83  ? 160.254 21.348  -8.852  1.00 28.65  ? 80  ASP A OD1 1 
ATOM   631   O OD2 . ASP A  1 83  ? 160.562 19.333  -8.097  1.00 30.26  ? 80  ASP A OD2 1 
ATOM   632   N N   . GLU A  1 84  ? 157.570 18.823  -12.404 1.00 31.12  ? 81  GLU A N   1 
ATOM   633   C CA  . GLU A  1 84  ? 157.270 18.257  -13.710 1.00 30.94  ? 81  GLU A CA  1 
ATOM   634   C C   . GLU A  1 84  ? 156.456 19.228  -14.558 1.00 27.30  ? 81  GLU A C   1 
ATOM   635   O O   . GLU A  1 84  ? 156.767 19.439  -15.724 1.00 26.20  ? 81  GLU A O   1 
ATOM   636   C CB  . GLU A  1 84  ? 156.530 16.920  -13.540 1.00 34.56  ? 81  GLU A CB  1 
ATOM   637   C CG  . GLU A  1 84  ? 156.267 16.153  -14.826 1.00 37.45  ? 81  GLU A CG  1 
ATOM   638   C CD  . GLU A  1 84  ? 157.525 15.682  -15.510 1.00 38.95  ? 81  GLU A CD  1 
ATOM   639   O OE1 . GLU A  1 84  ? 158.632 15.637  -14.893 1.00 38.74  ? 81  GLU A OE1 1 
ATOM   640   O OE2 . GLU A  1 84  ? 157.387 15.387  -16.720 1.00 40.29  ? 81  GLU A OE2 1 
ATOM   641   N N   . ILE A  1 85  ? 155.418 19.810  -13.959 1.00 24.70  ? 82  ILE A N   1 
ATOM   642   C CA  . ILE A  1 85  ? 154.556 20.800  -14.627 1.00 22.24  ? 82  ILE A CA  1 
ATOM   643   C C   . ILE A  1 85  ? 155.411 21.968  -15.140 1.00 21.02  ? 82  ILE A C   1 
ATOM   644   O O   . ILE A  1 85  ? 155.297 22.372  -16.293 1.00 19.81  ? 82  ILE A O   1 
ATOM   645   C CB  . ILE A  1 85  ? 153.443 21.306  -13.669 1.00 21.38  ? 82  ILE A CB  1 
ATOM   646   C CG1 . ILE A  1 85  ? 152.404 20.213  -13.437 1.00 21.48  ? 82  ILE A CG1 1 
ATOM   647   C CG2 . ILE A  1 85  ? 152.737 22.538  -14.201 1.00 20.76  ? 82  ILE A CG2 1 
ATOM   648   C CD1 . ILE A  1 85  ? 151.576 20.384  -12.173 1.00 21.40  ? 82  ILE A CD1 1 
ATOM   649   N N   . CYS A  1 86  ? 156.277 22.486  -14.281 1.00 20.28  ? 83  CYS A N   1 
ATOM   650   C CA  . CYS A  1 86  ? 157.171 23.575  -14.653 1.00 20.42  ? 83  CYS A CA  1 
ATOM   651   C C   . CYS A  1 86  ? 158.151 23.222  -15.806 1.00 20.79  ? 83  CYS A C   1 
ATOM   652   O O   . CYS A  1 86  ? 158.532 24.080  -16.584 1.00 19.39  ? 83  CYS A O   1 
ATOM   653   C CB  . CYS A  1 86  ? 157.906 24.077  -13.402 1.00 20.06  ? 83  CYS A CB  1 
ATOM   654   S SG  . CYS A  1 86  ? 156.820 24.940  -12.217 1.00 19.48  ? 83  CYS A SG  1 
ATOM   655   N N   . ARG A  1 87  ? 158.530 21.951  -15.899 1.00 22.68  ? 84  ARG A N   1 
ATOM   656   C CA  . ARG A  1 87  ? 159.395 21.414  -16.966 1.00 23.47  ? 84  ARG A CA  1 
ATOM   657   C C   . ARG A  1 87  ? 158.629 21.298  -18.279 1.00 23.45  ? 84  ARG A C   1 
ATOM   658   O O   . ARG A  1 87  ? 159.150 21.608  -19.331 1.00 23.21  ? 84  ARG A O   1 
ATOM   659   C CB  . ARG A  1 87  ? 159.887 20.022  -16.556 1.00 25.30  ? 84  ARG A CB  1 
ATOM   660   C CG  . ARG A  1 87  ? 161.221 19.598  -17.120 1.00 27.41  ? 84  ARG A CG  1 
ATOM   661   C CD  . ARG A  1 87  ? 161.395 18.083  -17.162 1.00 29.08  ? 84  ARG A CD  1 
ATOM   662   N NE  . ARG A  1 87  ? 160.831 17.504  -18.407 1.00 32.56  ? 84  ARG A NE  1 
ATOM   663   C CZ  . ARG A  1 87  ? 159.708 16.775  -18.492 1.00 35.38  ? 84  ARG A CZ  1 
ATOM   664   N NH1 . ARG A  1 87  ? 158.994 16.511  -17.415 1.00 38.65  ? 84  ARG A NH1 1 
ATOM   665   N NH2 . ARG A  1 87  ? 159.280 16.306  -19.663 1.00 33.97  ? 84  ARG A NH2 1 
ATOM   666   N N   . LEU A  1 88  ? 157.393 20.817  -18.196 1.00 23.91  ? 85  LEU A N   1 
ATOM   667   C CA  . LEU A  1 88  ? 156.469 20.779  -19.340 1.00 24.32  ? 85  LEU A CA  1 
ATOM   668   C C   . LEU A  1 88  ? 156.072 22.155  -19.874 1.00 24.74  ? 85  LEU A C   1 
ATOM   669   O O   . LEU A  1 88  ? 155.706 22.295  -21.047 1.00 26.33  ? 85  LEU A O   1 
ATOM   670   C CB  . LEU A  1 88  ? 155.194 20.001  -18.978 1.00 24.70  ? 85  LEU A CB  1 
ATOM   671   C CG  . LEU A  1 88  ? 155.063 18.505  -19.349 1.00 25.63  ? 85  LEU A CG  1 
ATOM   672   C CD1 . LEU A  1 88  ? 156.350 17.702  -19.209 1.00 26.93  ? 85  LEU A CD1 1 
ATOM   673   C CD2 . LEU A  1 88  ? 153.956 17.861  -18.521 1.00 25.37  ? 85  LEU A CD2 1 
ATOM   674   N N   . ILE A  1 89  ? 156.076 23.158  -19.003 1.00 24.95  ? 86  ILE A N   1 
ATOM   675   C CA  . ILE A  1 89  ? 155.895 24.550  -19.431 1.00 23.93  ? 86  ILE A CA  1 
ATOM   676   C C   . ILE A  1 89  ? 157.181 25.070  -20.072 1.00 23.16  ? 86  ILE A C   1 
ATOM   677   O O   . ILE A  1 89  ? 157.131 25.656  -21.127 1.00 23.18  ? 86  ILE A O   1 
ATOM   678   C CB  . ILE A  1 89  ? 155.492 25.483  -18.271 1.00 23.63  ? 86  ILE A CB  1 
ATOM   679   C CG1 . ILE A  1 89  ? 154.060 25.193  -17.782 1.00 22.56  ? 86  ILE A CG1 1 
ATOM   680   C CG2 . ILE A  1 89  ? 155.594 26.940  -18.703 1.00 24.16  ? 86  ILE A CG2 1 
ATOM   681   C CD1 . ILE A  1 89  ? 153.756 25.822  -16.428 1.00 21.69  ? 86  ILE A CD1 1 
ATOM   682   N N   . GLY A  1 90  ? 158.322 24.862  -19.426 1.00 23.17  ? 87  GLY A N   1 
ATOM   683   C CA  . GLY A  1 90  ? 159.614 25.294  -19.968 1.00 22.70  ? 87  GLY A CA  1 
ATOM   684   C C   . GLY A  1 90  ? 159.972 24.629  -21.288 1.00 23.22  ? 87  GLY A C   1 
ATOM   685   O O   . GLY A  1 90  ? 160.682 25.191  -22.111 1.00 24.55  ? 87  GLY A O   1 
ATOM   686   N N   . GLU A  1 91  ? 159.473 23.427  -21.510 1.00 23.40  ? 88  GLU A N   1 
ATOM   687   C CA  . GLU A  1 91  ? 159.859 22.670  -22.688 1.00 23.93  ? 88  GLU A CA  1 
ATOM   688   C C   . GLU A  1 91  ? 159.211 23.203  -23.975 1.00 23.28  ? 88  GLU A C   1 
ATOM   689   O O   . GLU A  1 91  ? 159.791 23.058  -25.068 1.00 24.64  ? 88  GLU A O   1 
ATOM   690   C CB  . GLU A  1 91  ? 159.513 21.186  -22.481 1.00 25.49  ? 88  GLU A CB  1 
ATOM   691   C CG  . GLU A  1 91  ? 160.088 20.226  -23.515 1.00 26.82  ? 88  GLU A CG  1 
ATOM   692   C CD  . GLU A  1 91  ? 159.957 18.771  -23.083 1.00 29.07  ? 88  GLU A CD  1 
ATOM   693   O OE1 . GLU A  1 91  ? 160.985 18.090  -22.920 1.00 31.08  ? 88  GLU A OE1 1 
ATOM   694   O OE2 . GLU A  1 91  ? 158.830 18.293  -22.876 1.00 31.53  ? 88  GLU A OE2 1 
ATOM   695   N N   . GLU A  1 92  ? 158.021 23.800  -23.850 1.00 21.20  ? 89  GLU A N   1 
ATOM   696   C CA  . GLU A  1 92  ? 157.197 24.180  -25.014 1.00 19.81  ? 89  GLU A CA  1 
ATOM   697   C C   . GLU A  1 92  ? 156.938 25.686  -25.115 1.00 19.69  ? 89  GLU A C   1 
ATOM   698   O O   . GLU A  1 92  ? 156.941 26.233  -26.206 1.00 19.83  ? 89  GLU A O   1 
ATOM   699   C CB  . GLU A  1 92  ? 155.870 23.419  -25.022 1.00 19.07  ? 89  GLU A CB  1 
ATOM   700   C CG  . GLU A  1 92  ? 156.007 21.903  -25.104 1.00 18.85  ? 89  GLU A CG  1 
ATOM   701   C CD  . GLU A  1 92  ? 154.681 21.150  -24.976 1.00 18.42  ? 89  GLU A CD  1 
ATOM   702   O OE1 . GLU A  1 92  ? 154.546 20.068  -25.567 1.00 17.35  ? 89  GLU A OE1 1 
ATOM   703   O OE2 . GLU A  1 92  ? 153.772 21.619  -24.258 1.00 19.29  ? 89  GLU A OE2 1 
ATOM   704   N N   . HIS A  1 93  ? 156.682 26.341  -23.993 1.00 19.69  ? 90  HIS A N   1 
ATOM   705   C CA  . HIS A  1 93  ? 156.657 27.805  -23.924 1.00 20.47  ? 90  HIS A CA  1 
ATOM   706   C C   . HIS A  1 93  ? 158.078 28.419  -23.839 1.00 22.48  ? 90  HIS A C   1 
ATOM   707   O O   . HIS A  1 93  ? 158.361 29.427  -24.491 1.00 22.06  ? 90  HIS A O   1 
ATOM   708   C CB  . HIS A  1 93  ? 155.859 28.230  -22.703 1.00 19.62  ? 90  HIS A CB  1 
ATOM   709   C CG  . HIS A  1 93  ? 155.749 29.710  -22.528 1.00 18.49  ? 90  HIS A CG  1 
ATOM   710   N ND1 . HIS A  1 93  ? 156.793 30.494  -22.102 1.00 18.17  ? 90  HIS A ND1 1 
ATOM   711   C CD2 . HIS A  1 93  ? 154.694 30.536  -22.670 1.00 18.04  ? 90  HIS A CD2 1 
ATOM   712   C CE1 . HIS A  1 93  ? 156.387 31.745  -22.012 1.00 18.55  ? 90  HIS A CE1 1 
ATOM   713   N NE2 . HIS A  1 93  ? 155.115 31.797  -22.345 1.00 18.02  ? 90  HIS A NE2 1 
ATOM   714   N N   . GLY A  1 94  ? 158.928 27.840  -22.982 1.00 24.32  ? 91  GLY A N   1 
ATOM   715   C CA  . GLY A  1 94  ? 160.321 28.245  -22.843 1.00 26.54  ? 91  GLY A CA  1 
ATOM   716   C C   . GLY A  1 94  ? 160.682 28.938  -21.544 1.00 27.90  ? 91  GLY A C   1 
ATOM   717   O O   . GLY A  1 94  ? 161.877 29.197  -21.279 1.00 27.44  ? 91  GLY A O   1 
ATOM   718   N N   . LYS A  1 95  ? 159.666 29.214  -20.722 1.00 28.62  ? 92  LYS A N   1 
ATOM   719   C CA  . LYS A  1 95  ? 159.856 30.069  -19.528 1.00 29.53  ? 92  LYS A CA  1 
ATOM   720   C C   . LYS A  1 95  ? 160.598 29.360  -18.405 1.00 29.35  ? 92  LYS A C   1 
ATOM   721   O O   . LYS A  1 95  ? 160.475 28.149  -18.230 1.00 28.37  ? 92  LYS A O   1 
ATOM   722   C CB  . LYS A  1 95  ? 158.545 30.694  -19.013 1.00 27.77  ? 92  LYS A CB  1 
ATOM   723   C CG  . LYS A  1 95  ? 157.479 29.731  -18.558 1.00 26.63  ? 92  LYS A CG  1 
ATOM   724   C CD  . LYS A  1 95  ? 156.317 30.466  -17.903 1.00 25.40  ? 92  LYS A CD  1 
ATOM   725   C CE  . LYS A  1 95  ? 155.413 31.177  -18.898 1.00 23.96  ? 92  LYS A CE  1 
ATOM   726   N NZ  . LYS A  1 95  ? 154.182 31.696  -18.243 1.00 23.32  ? 92  LYS A NZ  1 
ATOM   727   N N   . ILE A  1 96  ? 161.375 30.118  -17.647 1.00 30.98  ? 93  ILE A N   1 
ATOM   728   C CA  . ILE A  1 96  ? 162.347 29.465  -16.785 1.00 33.73  ? 93  ILE A CA  1 
ATOM   729   C C   . ILE A  1 96  ? 161.655 29.118  -15.456 1.00 32.61  ? 93  ILE A C   1 
ATOM   730   O O   . ILE A  1 96  ? 160.595 29.655  -15.147 1.00 30.12  ? 93  ILE A O   1 
ATOM   731   C CB  . ILE A  1 96  ? 163.735 30.197  -16.711 1.00 35.25  ? 93  ILE A CB  1 
ATOM   732   C CG1 . ILE A  1 96  ? 163.887 31.025  -15.444 1.00 39.12  ? 93  ILE A CG1 1 
ATOM   733   C CG2 . ILE A  1 96  ? 164.056 30.991  -17.987 1.00 34.05  ? 93  ILE A CG2 1 
ATOM   734   C CD1 . ILE A  1 96  ? 164.829 30.376  -14.440 1.00 42.66  ? 93  ILE A CD1 1 
ATOM   735   N N   . ALA A  1 97  ? 162.240 28.164  -14.728 1.00 33.68  ? 94  ALA A N   1 
ATOM   736   C CA  . ALA A  1 97  ? 161.663 27.602  -13.496 1.00 31.93  ? 94  ALA A CA  1 
ATOM   737   C C   . ALA A  1 97  ? 160.821 28.592  -12.685 1.00 32.11  ? 94  ALA A C   1 
ATOM   738   O O   . ALA A  1 97  ? 159.644 28.353  -12.451 1.00 32.52  ? 94  ALA A O   1 
ATOM   739   C CB  . ALA A  1 97  ? 162.759 27.017  -12.626 1.00 31.43  ? 94  ALA A CB  1 
ATOM   740   N N   . HIS A  1 98  ? 161.410 29.707  -12.271 1.00 31.89  ? 95  HIS A N   1 
ATOM   741   C CA  . HIS A  1 98  ? 160.695 30.650  -11.400 1.00 29.98  ? 95  HIS A CA  1 
ATOM   742   C C   . HIS A  1 98  ? 159.430 31.245  -12.031 1.00 30.88  ? 95  HIS A C   1 
ATOM   743   O O   . HIS A  1 98  ? 158.448 31.412  -11.321 1.00 33.91  ? 95  HIS A O   1 
ATOM   744   C CB  . HIS A  1 98  ? 161.604 31.780  -10.917 1.00 28.56  ? 95  HIS A CB  1 
ATOM   745   C CG  . HIS A  1 98  ? 162.004 32.729  -11.996 1.00 27.08  ? 95  HIS A CG  1 
ATOM   746   N ND1 . HIS A  1 98  ? 163.213 32.643  -12.645 1.00 26.49  ? 95  HIS A ND1 1 
ATOM   747   C CD2 . HIS A  1 98  ? 161.344 33.759  -12.567 1.00 26.03  ? 95  HIS A CD2 1 
ATOM   748   C CE1 . HIS A  1 98  ? 163.292 33.596  -13.554 1.00 25.50  ? 95  HIS A CE1 1 
ATOM   749   N NE2 . HIS A  1 98  ? 162.165 34.275  -13.539 1.00 25.34  ? 95  HIS A NE2 1 
ATOM   750   N N   . ASP A  1 99  ? 159.441 31.572  -13.327 1.00 30.30  ? 96  ASP A N   1 
ATOM   751   C CA  . ASP A  1 99  ? 158.232 32.081  -13.991 1.00 30.10  ? 96  ASP A CA  1 
ATOM   752   C C   . ASP A  1 99  ? 157.183 30.994  -14.092 1.00 28.52  ? 96  ASP A C   1 
ATOM   753   O O   . ASP A  1 99  ? 156.007 31.272  -13.968 1.00 28.92  ? 96  ASP A O   1 
ATOM   754   C CB  . ASP A  1 99  ? 158.498 32.615  -15.404 1.00 32.73  ? 96  ASP A CB  1 
ATOM   755   C CG  . ASP A  1 99  ? 158.870 34.088  -15.426 1.00 36.01  ? 96  ASP A CG  1 
ATOM   756   O OD1 . ASP A  1 99  ? 158.121 34.907  -14.840 1.00 36.72  ? 96  ASP A OD1 1 
ATOM   757   O OD2 . ASP A  1 99  ? 159.898 34.437  -16.071 1.00 41.00  ? 96  ASP A OD2 1 
ATOM   758   N N   . ALA A  1 100 ? 157.594 29.761  -14.357 1.00 27.73  ? 97  ALA A N   1 
ATOM   759   C CA  . ALA A  1 100 ? 156.637 28.644  -14.414 1.00 26.64  ? 97  ALA A CA  1 
ATOM   760   C C   . ALA A  1 100 ? 156.026 28.398  -13.022 1.00 25.47  ? 97  ALA A C   1 
ATOM   761   O O   . ALA A  1 100 ? 154.824 28.271  -12.894 1.00 24.05  ? 97  ALA A O   1 
ATOM   762   C CB  . ALA A  1 100 ? 157.307 27.382  -14.965 1.00 26.15  ? 97  ALA A CB  1 
ATOM   763   N N   . MET A  1 101 ? 156.873 28.347  -11.991 1.00 26.31  ? 98  MET A N   1 
ATOM   764   C CA  . MET A  1 101 ? 156.428 28.220  -10.591 1.00 25.77  ? 98  MET A CA  1 
ATOM   765   C C   . MET A  1 101 ? 155.506 29.361  -10.190 1.00 23.25  ? 98  MET A C   1 
ATOM   766   O O   . MET A  1 101 ? 154.498 29.124  -9.534  1.00 24.15  ? 98  MET A O   1 
ATOM   767   C CB  . MET A  1 101 ? 157.613 28.160  -9.615  1.00 26.37  ? 98  MET A CB  1 
ATOM   768   C CG  . MET A  1 101 ? 158.225 26.780  -9.451  1.00 27.73  ? 98  MET A CG  1 
ATOM   769   S SD  . MET A  1 101 ? 157.150 25.487  -8.782  1.00 30.49  ? 98  MET A SD  1 
ATOM   770   C CE  . MET A  1 101 ? 156.445 26.247  -7.309  1.00 31.09  ? 98  MET A CE  1 
ATOM   771   N N   . GLY A  1 102 ? 155.860 30.578  -10.575 1.00 20.66  ? 99  GLY A N   1 
ATOM   772   C CA  . GLY A  1 102 ? 154.985 31.722  -10.398 1.00 20.48  ? 99  GLY A CA  1 
ATOM   773   C C   . GLY A  1 102 ? 153.614 31.484  -11.003 1.00 21.13  ? 99  GLY A C   1 
ATOM   774   O O   . GLY A  1 102 ? 152.585 31.691  -10.348 1.00 21.58  ? 99  GLY A O   1 
ATOM   775   N N   . GLU A  1 103 ? 153.608 31.034  -12.258 1.00 21.98  ? 100 GLU A N   1 
ATOM   776   C CA  . GLU A  1 103 ? 152.389 30.715  -13.005 1.00 21.31  ? 100 GLU A CA  1 
ATOM   777   C C   . GLU A  1 103 ? 151.601 29.637  -12.275 1.00 21.55  ? 100 GLU A C   1 
ATOM   778   O O   . GLU A  1 103 ? 150.403 29.797  -12.021 1.00 22.07  ? 100 GLU A O   1 
ATOM   779   C CB  . GLU A  1 103 ? 152.718 30.238  -14.441 1.00 20.98  ? 100 GLU A CB  1 
ATOM   780   C CG  . GLU A  1 103 ? 151.498 29.675  -15.186 1.00 21.03  ? 100 GLU A CG  1 
ATOM   781   C CD  . GLU A  1 103 ? 151.686 29.378  -16.662 1.00 20.24  ? 100 GLU A CD  1 
ATOM   782   O OE1 . GLU A  1 103 ? 152.745 29.660  -17.249 1.00 20.70  ? 100 GLU A OE1 1 
ATOM   783   O OE2 . GLU A  1 103 ? 150.728 28.862  -17.243 1.00 19.61  ? 100 GLU A OE2 1 
ATOM   784   N N   . LEU A  1 104 ? 152.274 28.535  -11.970 1.00 21.62  ? 101 LEU A N   1 
ATOM   785   C CA  . LEU A  1 104 ? 151.648 27.416  -11.270 1.00 22.48  ? 101 LEU A CA  1 
ATOM   786   C C   . LEU A  1 104 ? 151.042 27.823  -9.914  1.00 23.40  ? 101 LEU A C   1 
ATOM   787   O O   . LEU A  1 104 ? 149.957 27.376  -9.562  1.00 21.11  ? 101 LEU A O   1 
ATOM   788   C CB  . LEU A  1 104 ? 152.648 26.262  -11.082 1.00 21.67  ? 101 LEU A CB  1 
ATOM   789   C CG  . LEU A  1 104 ? 152.102 25.061  -10.306 1.00 21.50  ? 101 LEU A CG  1 
ATOM   790   C CD1 . LEU A  1 104 ? 150.859 24.467  -10.964 1.00 21.38  ? 101 LEU A CD1 1 
ATOM   791   C CD2 . LEU A  1 104 ? 153.169 23.996  -10.148 1.00 21.84  ? 101 LEU A CD2 1 
ATOM   792   N N   . GLN A  1 105 ? 151.748 28.670  -9.174  1.00 26.61  ? 102 GLN A N   1 
ATOM   793   C CA  . GLN A  1 105 ? 151.288 29.110  -7.858  1.00 30.51  ? 102 GLN A CA  1 
ATOM   794   C C   . GLN A  1 105 ? 150.013 29.947  -7.926  1.00 28.43  ? 102 GLN A C   1 
ATOM   795   O O   . GLN A  1 105 ? 149.161 29.840  -7.067  1.00 27.03  ? 102 GLN A O   1 
ATOM   796   C CB  . GLN A  1 105 ? 152.371 29.912  -7.145  1.00 35.47  ? 102 GLN A CB  1 
ATOM   797   C CG  . GLN A  1 105 ? 152.143 30.040  -5.648  1.00 42.09  ? 102 GLN A CG  1 
ATOM   798   C CD  . GLN A  1 105 ? 152.407 28.720  -4.907  1.00 51.15  ? 102 GLN A CD  1 
ATOM   799   O OE1 . GLN A  1 105 ? 153.344 27.954  -5.245  1.00 54.90  ? 102 GLN A OE1 1 
ATOM   800   N NE2 . GLN A  1 105 ? 151.593 28.450  -3.878  1.00 52.96  ? 102 GLN A NE2 1 
ATOM   801   N N   . ARG A  1 106 ? 149.901 30.790  -8.939  1.00 28.19  ? 103 ARG A N   1 
ATOM   802   C CA  . ARG A  1 106 ? 148.697 31.600  -9.133  1.00 29.52  ? 103 ARG A CA  1 
ATOM   803   C C   . ARG A  1 106 ? 147.505 30.735  -9.567  1.00 25.46  ? 103 ARG A C   1 
ATOM   804   O O   . ARG A  1 106 ? 146.362 30.967  -9.186  1.00 23.62  ? 103 ARG A O   1 
ATOM   805   C CB  . ARG A  1 106 ? 148.969 32.742  -10.144 1.00 34.54  ? 103 ARG A CB  1 
ATOM   806   C CG  . ARG A  1 106 ? 149.992 33.783  -9.670  1.00 38.58  ? 103 ARG A CG  1 
ATOM   807   C CD  . ARG A  1 106 ? 149.487 35.217  -9.799  1.00 43.72  ? 103 ARG A CD  1 
ATOM   808   N NE  . ARG A  1 106 ? 149.066 35.612  -11.162 1.00 50.43  ? 103 ARG A NE  1 
ATOM   809   C CZ  . ARG A  1 106 ? 149.877 36.018  -12.155 1.00 52.88  ? 103 ARG A CZ  1 
ATOM   810   N NH1 . ARG A  1 106 ? 151.206 36.055  -11.998 1.00 54.92  ? 103 ARG A NH1 1 
ATOM   811   N NH2 . ARG A  1 106 ? 149.357 36.377  -13.334 1.00 50.30  ? 103 ARG A NH2 1 
ATOM   812   N N   . GLY A  1 107 ? 147.787 29.724  -10.365 1.00 23.70  ? 104 GLY A N   1 
ATOM   813   C CA  . GLY A  1 107 ? 146.779 28.747  -10.738 1.00 22.80  ? 104 GLY A CA  1 
ATOM   814   C C   . GLY A  1 107 ? 146.231 27.983  -9.554  1.00 21.67  ? 104 GLY A C   1 
ATOM   815   O O   . GLY A  1 107 ? 145.030 27.878  -9.383  1.00 20.99  ? 104 GLY A O   1 
ATOM   816   N N   . ILE A  1 108 ? 147.128 27.458  -8.727  1.00 21.51  ? 105 ILE A N   1 
ATOM   817   C CA  . ILE A  1 108 ? 146.746 26.784  -7.497  1.00 21.25  ? 105 ILE A CA  1 
ATOM   818   C C   . ILE A  1 108 ? 145.920 27.727  -6.658  1.00 21.49  ? 105 ILE A C   1 
ATOM   819   O O   . ILE A  1 108 ? 144.960 27.302  -6.031  1.00 22.43  ? 105 ILE A O   1 
ATOM   820   C CB  . ILE A  1 108 ? 147.972 26.328  -6.679  1.00 21.86  ? 105 ILE A CB  1 
ATOM   821   C CG1 . ILE A  1 108 ? 148.740 25.204  -7.403  1.00 21.67  ? 105 ILE A CG1 1 
ATOM   822   C CG2 . ILE A  1 108 ? 147.556 25.829  -5.290  1.00 22.01  ? 105 ILE A CG2 1 
ATOM   823   C CD1 . ILE A  1 108 ? 150.189 25.107  -6.957  1.00 21.23  ? 105 ILE A CD1 1 
ATOM   824   N N   . GLU A  1 109 ? 146.282 29.008  -6.653  1.00 21.84  ? 106 GLU A N   1 
ATOM   825   C CA  . GLU A  1 109 ? 145.494 30.018  -5.946  1.00 22.04  ? 106 GLU A CA  1 
ATOM   826   C C   . GLU A  1 109 ? 144.048 30.001  -6.402  1.00 21.54  ? 106 GLU A C   1 
ATOM   827   O O   . GLU A  1 109 ? 143.144 30.010  -5.568  1.00 22.35  ? 106 GLU A O   1 
ATOM   828   C CB  . GLU A  1 109 ? 146.120 31.412  -6.050  1.00 22.36  ? 106 GLU A CB  1 
ATOM   829   C CG  . GLU A  1 109 ? 147.339 31.525  -5.129  1.00 23.35  ? 106 GLU A CG  1 
ATOM   830   C CD  . GLU A  1 109 ? 147.961 32.909  -5.035  1.00 23.88  ? 106 GLU A CD  1 
ATOM   831   O OE1 . GLU A  1 109 ? 148.909 33.067  -4.227  1.00 21.65  ? 106 GLU A OE1 1 
ATOM   832   O OE2 . GLU A  1 109 ? 147.490 33.827  -5.745  1.00 25.62  ? 106 GLU A OE2 1 
ATOM   833   N N   . ASN A  1 110 ? 143.835 29.910  -7.712  1.00 20.84  ? 107 ASN A N   1 
ATOM   834   C CA  . ASN A  1 110 ? 142.473 29.769  -8.278  1.00 20.41  ? 107 ASN A CA  1 
ATOM   835   C C   . ASN A  1 110 ? 141.759 28.498  -7.840  1.00 20.07  ? 107 ASN A C   1 
ATOM   836   O O   . ASN A  1 110 ? 140.518 28.467  -7.823  1.00 20.82  ? 107 ASN A O   1 
ATOM   837   C CB  . ASN A  1 110 ? 142.485 29.754  -9.811  1.00 20.33  ? 107 ASN A CB  1 
ATOM   838   C CG  . ASN A  1 110 ? 142.858 31.089  -10.431 1.00 19.93  ? 107 ASN A CG  1 
ATOM   839   O OD1 . ASN A  1 110 ? 143.797 31.164  -11.226 1.00 19.29  ? 107 ASN A OD1 1 
ATOM   840   N ND2 . ASN A  1 110 ? 142.102 32.132  -10.113 1.00 19.64  ? 107 ASN A ND2 1 
ATOM   841   N N   . VAL A  1 111 ? 142.540 27.450  -7.555  1.00 18.74  ? 108 VAL A N   1 
ATOM   842   C CA  . VAL A  1 111 ? 142.018 26.170  -7.075  1.00 17.76  ? 108 VAL A CA  1 
ATOM   843   C C   . VAL A  1 111 ? 141.614 26.331  -5.628  1.00 17.09  ? 108 VAL A C   1 
ATOM   844   O O   . VAL A  1 111 ? 140.570 25.822  -5.218  1.00 16.95  ? 108 VAL A O   1 
ATOM   845   C CB  . VAL A  1 111 ? 143.066 25.038  -7.241  1.00 17.63  ? 108 VAL A CB  1 
ATOM   846   C CG1 . VAL A  1 111 ? 142.598 23.726  -6.628  1.00 17.50  ? 108 VAL A CG1 1 
ATOM   847   C CG2 . VAL A  1 111 ? 143.369 24.826  -8.713  1.00 17.78  ? 108 VAL A CG2 1 
ATOM   848   N N   . GLU A  1 112 ? 142.445 27.044  -4.864  1.00 16.53  ? 109 GLU A N   1 
ATOM   849   C CA  . GLU A  1 112 ? 142.163 27.307  -3.465  1.00 16.15  ? 109 GLU A CA  1 
ATOM   850   C C   . GLU A  1 112 ? 140.842 28.014  -3.357  1.00 16.26  ? 109 GLU A C   1 
ATOM   851   O O   . GLU A  1 112 ? 139.960 27.586  -2.636  1.00 16.76  ? 109 GLU A O   1 
ATOM   852   C CB  . GLU A  1 112 ? 143.250 28.165  -2.864  1.00 16.13  ? 109 GLU A CB  1 
ATOM   853   C CG  . GLU A  1 112 ? 144.553 27.412  -2.706  1.00 16.06  ? 109 GLU A CG  1 
ATOM   854   C CD  . GLU A  1 112 ? 145.674 28.254  -2.162  1.00 15.59  ? 109 GLU A CD  1 
ATOM   855   O OE1 . GLU A  1 112 ? 146.723 27.648  -1.833  1.00 15.32  ? 109 GLU A OE1 1 
ATOM   856   O OE2 . GLU A  1 112 ? 145.519 29.495  -2.073  1.00 14.78  ? 109 GLU A OE2 1 
ATOM   857   N N   . TYR A  1 113 ? 140.682 29.073  -4.127  1.00 16.27  ? 110 TYR A N   1 
ATOM   858   C CA  . TYR A  1 113 ? 139.421 29.796  -4.123  1.00 16.74  ? 110 TYR A CA  1 
ATOM   859   C C   . TYR A  1 113 ? 138.216 28.892  -4.448  1.00 17.31  ? 110 TYR A C   1 
ATOM   860   O O   . TYR A  1 113 ? 137.172 29.004  -3.830  1.00 18.65  ? 110 TYR A O   1 
ATOM   861   C CB  . TYR A  1 113 ? 139.492 31.026  -5.042  1.00 16.68  ? 110 TYR A CB  1 
ATOM   862   C CG  . TYR A  1 113 ? 138.321 31.992  -4.881  1.00 16.76  ? 110 TYR A CG  1 
ATOM   863   C CD1 . TYR A  1 113 ? 138.046 32.599  -3.661  1.00 16.51  ? 110 TYR A CD1 1 
ATOM   864   C CD2 . TYR A  1 113 ? 137.491 32.291  -5.950  1.00 16.70  ? 110 TYR A CD2 1 
ATOM   865   C CE1 . TYR A  1 113 ? 136.979 33.463  -3.513  1.00 16.37  ? 110 TYR A CE1 1 
ATOM   866   C CE2 . TYR A  1 113 ? 136.428 33.162  -5.808  1.00 16.59  ? 110 TYR A CE2 1 
ATOM   867   C CZ  . TYR A  1 113 ? 136.166 33.739  -4.587  1.00 16.72  ? 110 TYR A CZ  1 
ATOM   868   O OH  . TYR A  1 113 ? 135.094 34.607  -4.453  1.00 17.02  ? 110 TYR A OH  1 
ATOM   869   N N   . ALA A  1 114 ? 138.377 27.968  -5.377  1.00 18.25  ? 111 ALA A N   1 
ATOM   870   C CA  . ALA A  1 114 ? 137.281 27.069  -5.800  1.00 18.47  ? 111 ALA A CA  1 
ATOM   871   C C   . ALA A  1 114 ? 136.881 26.086  -4.715  1.00 18.31  ? 111 ALA A C   1 
ATOM   872   O O   . ALA A  1 114 ? 135.735 25.612  -4.683  1.00 16.61  ? 111 ALA A O   1 
ATOM   873   C CB  . ALA A  1 114 ? 137.693 26.296  -7.047  1.00 18.89  ? 111 ALA A CB  1 
ATOM   874   N N   . CYS A  1 115 ? 137.839 25.784  -3.830  1.00 18.30  ? 112 CYS A N   1 
ATOM   875   C CA  . CYS A  1 115 ? 137.572 24.908  -2.708  1.00 17.97  ? 112 CYS A CA  1 
ATOM   876   C C   . CYS A  1 115 ? 136.442 25.483  -1.844  1.00 17.24  ? 112 CYS A C   1 
ATOM   877   O O   . CYS A  1 115 ? 135.673 24.721  -1.242  1.00 18.10  ? 112 CYS A O   1 
ATOM   878   C CB  . CYS A  1 115 ? 138.854 24.650  -1.907  1.00 18.32  ? 112 CYS A CB  1 
ATOM   879   S SG  . CYS A  1 115 ? 140.136 23.691  -2.794  1.00 19.33  ? 112 CYS A SG  1 
ATOM   880   N N   . GLY A  1 116 ? 136.313 26.813  -1.825  1.00 15.96  ? 113 GLY A N   1 
ATOM   881   C CA  . GLY A  1 116 ? 135.247 27.487  -1.085  1.00 15.59  ? 113 GLY A CA  1 
ATOM   882   C C   . GLY A  1 116 ? 133.877 27.583  -1.762  1.00 15.20  ? 113 GLY A C   1 
ATOM   883   O O   . GLY A  1 116 ? 133.060 28.424  -1.393  1.00 14.72  ? 113 GLY A O   1 
ATOM   884   N N   . ALA A  1 117 ? 133.587 26.684  -2.702  1.00 14.87  ? 114 ALA A N   1 
ATOM   885   C CA  . ALA A  1 117 ? 132.351 26.755  -3.501  1.00 14.37  ? 114 ALA A CA  1 
ATOM   886   C C   . ALA A  1 117 ? 131.100 26.929  -2.697  1.00 14.30  ? 114 ALA A C   1 
ATOM   887   O O   . ALA A  1 117 ? 130.224 27.655  -3.103  1.00 13.93  ? 114 ALA A O   1 
ATOM   888   C CB  . ALA A  1 117 ? 132.196 25.530  -4.375  1.00 14.14  ? 114 ALA A CB  1 
ATOM   889   N N   . PRO A  1 118 ? 130.992 26.235  -1.562  1.00 14.90  ? 115 PRO A N   1 
ATOM   890   C CA  . PRO A  1 118 ? 129.702 26.320  -0.842  1.00 14.57  ? 115 PRO A CA  1 
ATOM   891   C C   . PRO A  1 118 ? 129.341 27.694  -0.372  1.00 13.85  ? 115 PRO A C   1 
ATOM   892   O O   . PRO A  1 118 ? 128.184 28.057  -0.408  1.00 14.78  ? 115 PRO A O   1 
ATOM   893   C CB  . PRO A  1 118 ? 129.911 25.417  0.373   1.00 14.95  ? 115 PRO A CB  1 
ATOM   894   C CG  . PRO A  1 118 ? 130.983 24.442  -0.055  1.00 15.27  ? 115 PRO A CG  1 
ATOM   895   C CD  . PRO A  1 118 ? 131.884 25.198  -0.990  1.00 15.04  ? 115 PRO A CD  1 
ATOM   896   N N   . GLU A  1 119 ? 130.327 28.435  0.106   1.00 13.26  ? 116 GLU A N   1 
ATOM   897   C CA  . GLU A  1 119 ? 130.148 29.852  0.484   1.00 12.45  ? 116 GLU A CA  1 
ATOM   898   C C   . GLU A  1 119 ? 129.813 30.678  -0.762  1.00 11.59  ? 116 GLU A C   1 
ATOM   899   O O   . GLU A  1 119 ? 128.828 31.395  -0.816  1.00 10.64  ? 116 GLU A O   1 
ATOM   900   C CB  . GLU A  1 119 ? 131.433 30.347  1.174   1.00 12.35  ? 116 GLU A CB  1 
ATOM   901   C CG  . GLU A  1 119 ? 131.569 31.836  1.431   1.00 12.20  ? 116 GLU A CG  1 
ATOM   902   C CD  . GLU A  1 119 ? 130.623 32.405  2.458   1.00 12.21  ? 116 GLU A CD  1 
ATOM   903   O OE1 . GLU A  1 119 ? 130.091 31.650  3.310   1.00 12.21  ? 116 GLU A OE1 1 
ATOM   904   O OE2 . GLU A  1 119 ? 130.449 33.649  2.425   1.00 12.44  ? 116 GLU A OE2 1 
ATOM   905   N N   . LEU A  1 120 ? 130.633 30.500  -1.780  1.00 11.34  ? 117 LEU A N   1 
ATOM   906   C CA  . LEU A  1 120 ? 130.473 31.214  -3.046  1.00 11.36  ? 117 LEU A CA  1 
ATOM   907   C C   . LEU A  1 120 ? 129.145 31.018  -3.774  1.00 11.47  ? 117 LEU A C   1 
ATOM   908   O O   . LEU A  1 120 ? 128.758 31.885  -4.533  1.00 11.28  ? 117 LEU A O   1 
ATOM   909   C CB  . LEU A  1 120 ? 131.586 30.826  -4.002  1.00 11.04  ? 117 LEU A CB  1 
ATOM   910   C CG  . LEU A  1 120 ? 132.990 31.111  -3.512  1.00 10.98  ? 117 LEU A CG  1 
ATOM   911   C CD1 . LEU A  1 120 ? 133.931 30.827  -4.654  1.00 10.92  ? 117 LEU A CD1 1 
ATOM   912   C CD2 . LEU A  1 120 ? 133.157 32.539  -3.025  1.00 11.06  ? 117 LEU A CD2 1 
ATOM   913   N N   . LEU A  1 121 ? 128.477 29.881  -3.544  1.00 11.80  ? 118 LEU A N   1 
ATOM   914   C CA  . LEU A  1 121 ? 127.235 29.490  -4.250  1.00 11.53  ? 118 LEU A CA  1 
ATOM   915   C C   . LEU A  1 121 ? 125.988 29.800  -3.464  1.00 11.53  ? 118 LEU A C   1 
ATOM   916   O O   . LEU A  1 121 ? 124.903 29.407  -3.890  1.00 11.65  ? 118 LEU A O   1 
ATOM   917   C CB  . LEU A  1 121 ? 127.255 27.991  -4.569  1.00 11.28  ? 118 LEU A CB  1 
ATOM   918   C CG  . LEU A  1 121 ? 128.209 27.579  -5.675  1.00 11.18  ? 118 LEU A CG  1 
ATOM   919   C CD1 . LEU A  1 121 ? 128.395 26.075  -5.674  1.00 11.17  ? 118 LEU A CD1 1 
ATOM   920   C CD2 . LEU A  1 121 ? 127.676 28.066  -7.014  1.00 11.22  ? 118 LEU A CD2 1 
ATOM   921   N N   . LYS A  1 122 ? 126.150 30.480  -2.318  1.00 11.56  ? 119 LYS A N   1 
ATOM   922   C CA  . LYS A  1 122 ? 125.009 30.973  -1.515  1.00 11.34  ? 119 LYS A CA  1 
ATOM   923   C C   . LYS A  1 122 ? 124.167 31.910  -2.341  1.00 11.57  ? 119 LYS A C   1 
ATOM   924   O O   . LYS A  1 122 ? 124.676 32.866  -2.941  1.00 11.48  ? 119 LYS A O   1 
ATOM   925   C CB  . LYS A  1 122 ? 125.450 31.709  -0.248  1.00 11.02  ? 119 LYS A CB  1 
ATOM   926   C CG  . LYS A  1 122 ? 126.093 30.810  0.798   1.00 11.07  ? 119 LYS A CG  1 
ATOM   927   C CD  . LYS A  1 122 ? 126.613 31.579  1.991   1.00 10.90  ? 119 LYS A CD  1 
ATOM   928   C CE  . LYS A  1 122 ? 126.973 30.633  3.115   1.00 11.13  ? 119 LYS A CE  1 
ATOM   929   N NZ  . LYS A  1 122 ? 127.539 31.339  4.296   1.00 11.21  ? 119 LYS A NZ  1 
ATOM   930   N N   . GLY A  1 123 ? 122.881 31.577  -2.412  1.00 11.94  ? 120 GLY A N   1 
ATOM   931   C CA  . GLY A  1 123 ? 121.871 32.476  -2.928  1.00 12.01  ? 120 GLY A CA  1 
ATOM   932   C C   . GLY A  1 123 ? 121.363 33.342  -1.792  1.00 12.23  ? 120 GLY A C   1 
ATOM   933   O O   . GLY A  1 123 ? 121.810 33.206  -0.660  1.00 11.48  ? 120 GLY A O   1 
ATOM   934   N N   . GLU A  1 124 ? 120.414 34.220  -2.113  1.00 13.21  ? 121 GLU A N   1 
ATOM   935   C CA  . GLU A  1 124 ? 119.797 35.163  -1.175  1.00 13.84  ? 121 GLU A CA  1 
ATOM   936   C C   . GLU A  1 124 ? 118.351 34.756  -0.875  1.00 14.86  ? 121 GLU A C   1 
ATOM   937   O O   . GLU A  1 124 ? 117.568 34.562  -1.813  1.00 14.85  ? 121 GLU A O   1 
ATOM   938   C CB  . GLU A  1 124 ? 119.780 36.551  -1.796  1.00 13.89  ? 121 GLU A CB  1 
ATOM   939   C CG  . GLU A  1 124 ? 121.128 37.205  -1.935  1.00 14.02  ? 121 GLU A CG  1 
ATOM   940   C CD  . GLU A  1 124 ? 121.044 38.509  -2.711  1.00 14.77  ? 121 GLU A CD  1 
ATOM   941   O OE1 . GLU A  1 124 ? 120.371 38.504  -3.813  1.00 15.80  ? 121 GLU A OE1 1 
ATOM   942   O OE2 . GLU A  1 124 ? 121.657 39.511  -2.234  1.00 13.90  ? 121 GLU A OE2 1 
ATOM   943   N N   . HIS A  1 125 ? 118.006 34.662  0.419   1.00 16.00  ? 122 HIS A N   1 
ATOM   944   C CA  . HIS A  1 125 ? 116.678 34.211  0.889   1.00 16.82  ? 122 HIS A CA  1 
ATOM   945   C C   . HIS A  1 125 ? 115.946 35.368  1.478   1.00 17.85  ? 122 HIS A C   1 
ATOM   946   O O   . HIS A  1 125 ? 116.504 36.088  2.287   1.00 19.78  ? 122 HIS A O   1 
ATOM   947   C CB  . HIS A  1 125 ? 116.808 33.159  1.981   1.00 17.07  ? 122 HIS A CB  1 
ATOM   948   C CG  . HIS A  1 125 ? 115.510 32.518  2.385   1.00 17.26  ? 122 HIS A CG  1 
ATOM   949   N ND1 . HIS A  1 125 ? 115.092 31.293  1.895   1.00 17.18  ? 122 HIS A ND1 1 
ATOM   950   C CD2 . HIS A  1 125 ? 114.563 32.906  3.274   1.00 17.43  ? 122 HIS A CD2 1 
ATOM   951   C CE1 . HIS A  1 125 ? 113.939 30.964  2.450   1.00 17.32  ? 122 HIS A CE1 1 
ATOM   952   N NE2 . HIS A  1 125 ? 113.597 31.924  3.293   1.00 17.33  ? 122 HIS A NE2 1 
ATOM   953   N N   . SER A  1 126 ? 114.683 35.525  1.108   1.00 18.52  ? 123 SER A N   1 
ATOM   954   C CA  . SER A  1 126 ? 113.880 36.676  1.532   1.00 18.57  ? 123 SER A CA  1 
ATOM   955   C C   . SER A  1 126 ? 112.593 36.178  2.173   1.00 19.58  ? 123 SER A C   1 
ATOM   956   O O   . SER A  1 126 ? 111.825 35.455  1.547   1.00 18.73  ? 123 SER A O   1 
ATOM   957   C CB  . SER A  1 126 ? 113.559 37.595  0.332   1.00 17.59  ? 123 SER A CB  1 
ATOM   958   O OG  . SER A  1 126 ? 114.654 38.391  -0.064  1.00 15.97  ? 123 SER A OG  1 
ATOM   959   N N   . ARG A  1 127 ? 112.371 36.578  3.419   1.00 22.18  ? 124 ARG A N   1 
ATOM   960   C CA  . ARG A  1 127 ? 111.169 36.218  4.174   1.00 24.49  ? 124 ARG A CA  1 
ATOM   961   C C   . ARG A  1 127 ? 110.085 37.256  3.925   1.00 22.71  ? 124 ARG A C   1 
ATOM   962   O O   . ARG A  1 127 ? 110.321 38.469  4.020   1.00 23.06  ? 124 ARG A O   1 
ATOM   963   C CB  . ARG A  1 127 ? 111.507 36.161  5.667   1.00 29.67  ? 124 ARG A CB  1 
ATOM   964   C CG  . ARG A  1 127 ? 110.366 35.827  6.618   1.00 36.09  ? 124 ARG A CG  1 
ATOM   965   C CD  . ARG A  1 127 ? 110.833 35.811  8.083   1.00 40.24  ? 124 ARG A CD  1 
ATOM   966   N NE  . ARG A  1 127 ? 109.704 35.608  9.019   1.00 47.10  ? 124 ARG A NE  1 
ATOM   967   C CZ  . ARG A  1 127 ? 109.059 36.559  9.720   1.00 48.06  ? 124 ARG A CZ  1 
ATOM   968   N NH1 . ARG A  1 127 ? 109.422 37.839  9.650   1.00 51.40  ? 124 ARG A NH1 1 
ATOM   969   N NH2 . ARG A  1 127 ? 108.036 36.228  10.515  1.00 45.75  ? 124 ARG A NH2 1 
ATOM   970   N N   . ASN A  1 128 ? 108.893 36.771  3.601   1.00 21.00  ? 125 ASN A N   1 
ATOM   971   C CA  . ASN A  1 128 ? 107.687 37.607  3.447   1.00 19.64  ? 125 ASN A CA  1 
ATOM   972   C C   . ASN A  1 128 ? 107.811 38.723  2.411   1.00 18.12  ? 125 ASN A C   1 
ATOM   973   O O   . ASN A  1 128 ? 107.627 39.888  2.717   1.00 18.01  ? 125 ASN A O   1 
ATOM   974   C CB  . ASN A  1 128 ? 107.214 38.175  4.796   1.00 19.73  ? 125 ASN A CB  1 
ATOM   975   C CG  . ASN A  1 128 ? 106.502 37.149  5.662   1.00 20.59  ? 125 ASN A CG  1 
ATOM   976   O OD1 . ASN A  1 128 ? 106.053 36.095  5.193   1.00 21.73  ? 125 ASN A OD1 1 
ATOM   977   N ND2 . ASN A  1 128 ? 106.364 37.473  6.945   1.00 21.14  ? 125 ASN A ND2 1 
ATOM   978   N N   . VAL A  1 129 ? 108.090 38.370  1.170   1.00 16.67  ? 126 VAL A N   1 
ATOM   979   C CA  . VAL A  1 129 ? 108.090 39.382  0.116   1.00 16.72  ? 126 VAL A CA  1 
ATOM   980   C C   . VAL A  1 129 ? 106.681 39.933  -0.054  1.00 17.56  ? 126 VAL A C   1 
ATOM   981   O O   . VAL A  1 129 ? 106.471 41.046  -0.553  1.00 17.64  ? 126 VAL A O   1 
ATOM   982   C CB  . VAL A  1 129 ? 108.601 38.847  -1.237  1.00 16.16  ? 126 VAL A CB  1 
ATOM   983   C CG1 . VAL A  1 129 ? 110.027 38.360  -1.096  1.00 15.91  ? 126 VAL A CG1 1 
ATOM   984   C CG2 . VAL A  1 129 ? 107.694 37.764  -1.832  1.00 15.90  ? 126 VAL A CG2 1 
ATOM   985   N N   . GLY A  1 130 ? 105.723 39.084  0.292   1.00 18.24  ? 127 GLY A N   1 
ATOM   986   C CA  . GLY A  1 130 ? 104.355 39.474  0.549   1.00 18.85  ? 127 GLY A CA  1 
ATOM   987   C C   . GLY A  1 130 ? 103.901 38.654  1.730   1.00 20.13  ? 127 GLY A C   1 
ATOM   988   O O   . GLY A  1 130 ? 104.656 37.811  2.243   1.00 20.59  ? 127 GLY A O   1 
ATOM   989   N N   . PRO A  1 131 ? 102.662 38.856  2.166   1.00 21.41  ? 128 PRO A N   1 
ATOM   990   C CA  . PRO A  1 131 ? 102.256 38.213  3.415   1.00 21.97  ? 128 PRO A CA  1 
ATOM   991   C C   . PRO A  1 131 ? 102.243 36.704  3.253   1.00 21.89  ? 128 PRO A C   1 
ATOM   992   O O   . PRO A  1 131 ? 101.563 36.196  2.377   1.00 21.41  ? 128 PRO A O   1 
ATOM   993   C CB  . PRO A  1 131 ? 100.856 38.784  3.678   1.00 22.53  ? 128 PRO A CB  1 
ATOM   994   C CG  . PRO A  1 131 ? 100.765 39.996  2.809   1.00 22.93  ? 128 PRO A CG  1 
ATOM   995   C CD  . PRO A  1 131 ? 101.593 39.674  1.593   1.00 22.48  ? 128 PRO A CD  1 
ATOM   996   N N   . GLY A  1 132 ? 103.036 36.013  4.066   1.00 22.61  ? 129 GLY A N   1 
ATOM   997   C CA  . GLY A  1 132 ? 103.179 34.561  3.958   1.00 23.12  ? 129 GLY A CA  1 
ATOM   998   C C   . GLY A  1 132 ? 103.604 34.086  2.570   1.00 23.31  ? 129 GLY A C   1 
ATOM   999   O O   . GLY A  1 132 ? 103.096 33.078  2.069   1.00 24.18  ? 129 GLY A O   1 
ATOM   1000  N N   . ILE A  1 133 ? 104.524 34.831  1.949   1.00 22.42  ? 130 ILE A N   1 
ATOM   1001  C CA  . ILE A  1 133 ? 105.145 34.457  0.675   1.00 20.59  ? 130 ILE A CA  1 
ATOM   1002  C C   . ILE A  1 133 ? 106.645 34.686  0.815   1.00 19.38  ? 130 ILE A C   1 
ATOM   1003  O O   . ILE A  1 133 ? 107.078 35.793  1.027   1.00 19.43  ? 130 ILE A O   1 
ATOM   1004  C CB  . ILE A  1 133 ? 104.607 35.299  -0.505  1.00 20.51  ? 130 ILE A CB  1 
ATOM   1005  C CG1 . ILE A  1 133 ? 103.088 35.145  -0.612  1.00 20.34  ? 130 ILE A CG1 1 
ATOM   1006  C CG2 . ILE A  1 133 ? 105.291 34.905  -1.819  1.00 20.16  ? 130 ILE A CG2 1 
ATOM   1007  C CD1 . ILE A  1 133 ? 102.443 35.922  -1.744  1.00 19.91  ? 130 ILE A CD1 1 
ATOM   1008  N N   . ASP A  1 134 ? 107.428 33.629  0.699   1.00 18.92  ? 131 ASP A N   1 
ATOM   1009  C CA  . ASP A  1 134 ? 108.882 33.719  0.728   1.00 18.00  ? 131 ASP A CA  1 
ATOM   1010  C C   . ASP A  1 134 ? 109.426 33.585  -0.681  1.00 16.98  ? 131 ASP A C   1 
ATOM   1011  O O   . ASP A  1 134 ? 108.776 33.010  -1.549  1.00 15.99  ? 131 ASP A O   1 
ATOM   1012  C CB  . ASP A  1 134 ? 109.466 32.620  1.604   1.00 17.84  ? 131 ASP A CB  1 
ATOM   1013  C CG  . ASP A  1 134 ? 109.043 32.733  3.045   1.00 18.61  ? 131 ASP A CG  1 
ATOM   1014  O OD1 . ASP A  1 134 ? 108.609 33.828  3.487   1.00 18.51  ? 131 ASP A OD1 1 
ATOM   1015  O OD2 . ASP A  1 134 ? 109.148 31.702  3.753   1.00 19.09  ? 131 ASP A OD2 1 
ATOM   1016  N N   . SER A  1 135 ? 110.637 34.091  -0.888  1.00 16.19  ? 132 SER A N   1 
ATOM   1017  C CA  . SER A  1 135 ? 111.306 33.959  -2.183  1.00 16.10  ? 132 SER A CA  1 
ATOM   1018  C C   . SER A  1 135 ? 112.794 33.889  -1.954  1.00 16.14  ? 132 SER A C   1 
ATOM   1019  O O   . SER A  1 135 ? 113.271 34.405  -0.959  1.00 15.47  ? 132 SER A O   1 
ATOM   1020  C CB  . SER A  1 135 ? 110.941 35.130  -3.123  1.00 15.52  ? 132 SER A CB  1 
ATOM   1021  O OG  . SER A  1 135 ? 111.505 34.990  -4.407  1.00 14.47  ? 132 SER A OG  1 
ATOM   1022  N N   . TRP A  1 136 ? 113.507 33.233  -2.872  1.00 17.09  ? 133 TRP A N   1 
ATOM   1023  C CA  . TRP A  1 136 ? 114.969 33.049  -2.765  1.00 17.87  ? 133 TRP A CA  1 
ATOM   1024  C C   . TRP A  1 136 ? 115.632 32.790  -4.100  1.00 17.83  ? 133 TRP A C   1 
ATOM   1025  O O   . TRP A  1 136 ? 115.015 32.209  -5.000  1.00 18.14  ? 133 TRP A O   1 
ATOM   1026  C CB  . TRP A  1 136 ? 115.333 31.908  -1.792  1.00 18.42  ? 133 TRP A CB  1 
ATOM   1027  C CG  . TRP A  1 136 ? 114.954 30.555  -2.272  1.00 19.12  ? 133 TRP A CG  1 
ATOM   1028  C CD1 . TRP A  1 136 ? 115.723 29.707  -3.007  1.00 19.34  ? 133 TRP A CD1 1 
ATOM   1029  C CD2 . TRP A  1 136 ? 113.704 29.881  -2.053  1.00 20.13  ? 133 TRP A CD2 1 
ATOM   1030  N NE1 . TRP A  1 136 ? 115.039 28.550  -3.263  1.00 20.07  ? 133 TRP A NE1 1 
ATOM   1031  C CE2 . TRP A  1 136 ? 113.793 28.625  -2.688  1.00 19.85  ? 133 TRP A CE2 1 
ATOM   1032  C CE3 . TRP A  1 136 ? 112.509 30.218  -1.384  1.00 20.21  ? 133 TRP A CE3 1 
ATOM   1033  C CZ2 . TRP A  1 136 ? 112.729 27.696  -2.680  1.00 18.93  ? 133 TRP A CZ2 1 
ATOM   1034  C CZ3 . TRP A  1 136 ? 111.442 29.277  -1.388  1.00 19.26  ? 133 TRP A CZ3 1 
ATOM   1035  C CH2 . TRP A  1 136 ? 111.574 28.042  -2.033  1.00 18.53  ? 133 TRP A CH2 1 
ATOM   1036  N N   . SER A  1 137 ? 116.904 33.192  -4.216  1.00 17.86  ? 134 SER A N   1 
ATOM   1037  C CA  . SER A  1 137 ? 117.671 32.939  -5.445  1.00 17.28  ? 134 SER A CA  1 
ATOM   1038  C C   . SER A  1 137 ? 118.505 31.670  -5.340  1.00 17.43  ? 134 SER A C   1 
ATOM   1039  O O   . SER A  1 137 ? 118.911 31.253  -4.249  1.00 17.44  ? 134 SER A O   1 
ATOM   1040  C CB  . SER A  1 137 ? 118.532 34.144  -5.862  1.00 16.81  ? 134 SER A CB  1 
ATOM   1041  O OG  . SER A  1 137 ? 119.484 34.514  -4.904  1.00 16.44  ? 134 SER A OG  1 
ATOM   1042  N N   . GLU A  1 138 ? 118.729 31.043  -6.483  1.00 17.64  ? 135 GLU A N   1 
ATOM   1043  C CA  . GLU A  1 138 ? 119.647 29.938  -6.572  1.00 18.19  ? 135 GLU A CA  1 
ATOM   1044  C C   . GLU A  1 138 ? 120.521 30.157  -7.791  1.00 18.71  ? 135 GLU A C   1 
ATOM   1045  O O   . GLU A  1 138 ? 120.041 30.627  -8.833  1.00 18.47  ? 135 GLU A O   1 
ATOM   1046  C CB  . GLU A  1 138 ? 118.892 28.616  -6.685  1.00 18.75  ? 135 GLU A CB  1 
ATOM   1047  C CG  . GLU A  1 138 ? 118.060 28.219  -5.463  1.00 19.07  ? 135 GLU A CG  1 
ATOM   1048  C CD  . GLU A  1 138 ? 117.717 26.732  -5.455  1.00 19.49  ? 135 GLU A CD  1 
ATOM   1049  O OE1 . GLU A  1 138 ? 117.955 26.050  -6.466  1.00 19.84  ? 135 GLU A OE1 1 
ATOM   1050  O OE2 . GLU A  1 138 ? 117.235 26.217  -4.435  1.00 20.50  ? 135 GLU A OE2 1 
ATOM   1051  N N   . PHE A  1 139 ? 121.804 29.819  -7.655  1.00 19.48  ? 136 PHE A N   1 
ATOM   1052  C CA  . PHE A  1 139 ? 122.769 29.905  -8.771  1.00 19.79  ? 136 PHE A CA  1 
ATOM   1053  C C   . PHE A  1 139 ? 123.149 28.513  -9.276  1.00 20.31  ? 136 PHE A C   1 
ATOM   1054  O O   . PHE A  1 139 ? 124.155 27.907  -8.869  1.00 21.50  ? 136 PHE A O   1 
ATOM   1055  C CB  . PHE A  1 139 ? 123.978 30.746  -8.375  1.00 19.31  ? 136 PHE A CB  1 
ATOM   1056  C CG  . PHE A  1 139 ? 123.608 32.131  -7.960  1.00 19.11  ? 136 PHE A CG  1 
ATOM   1057  C CD1 . PHE A  1 139 ? 123.076 33.020  -8.877  1.00 19.43  ? 136 PHE A CD1 1 
ATOM   1058  C CD2 . PHE A  1 139 ? 123.764 32.536  -6.650  1.00 19.92  ? 136 PHE A CD2 1 
ATOM   1059  C CE1 . PHE A  1 139 ? 122.709 34.298  -8.498  1.00 20.19  ? 136 PHE A CE1 1 
ATOM   1060  C CE2 . PHE A  1 139 ? 123.409 33.813  -6.253  1.00 20.60  ? 136 PHE A CE2 1 
ATOM   1061  C CZ  . PHE A  1 139 ? 122.885 34.702  -7.181  1.00 20.66  ? 136 PHE A CZ  1 
ATOM   1062  N N   . GLN A  1 140 ? 122.317 28.019  -10.187 1.00 20.45  ? 137 GLN A N   1 
ATOM   1063  C CA  . GLN A  1 140 ? 122.387 26.641  -10.627 1.00 19.19  ? 137 GLN A CA  1 
ATOM   1064  C C   . GLN A  1 140 ? 123.326 26.525  -11.789 1.00 18.73  ? 137 GLN A C   1 
ATOM   1065  O O   . GLN A  1 140 ? 123.672 27.536  -12.407 1.00 18.48  ? 137 GLN A O   1 
ATOM   1066  C CB  . GLN A  1 140 ? 121.007 26.155  -11.005 1.00 19.02  ? 137 GLN A CB  1 
ATOM   1067  C CG  . GLN A  1 140 ? 120.091 26.148  -9.803  1.00 19.12  ? 137 GLN A CG  1 
ATOM   1068  C CD  . GLN A  1 140 ? 118.797 25.419  -10.040 1.00 19.03  ? 137 GLN A CD  1 
ATOM   1069  O OE1 . GLN A  1 140 ? 118.434 25.093  -11.174 1.00 18.55  ? 137 GLN A OE1 1 
ATOM   1070  N NE2 . GLN A  1 140 ? 118.089 25.148  -8.958  1.00 19.21  ? 137 GLN A NE2 1 
ATOM   1071  N N   . PRO A  1 141 ? 123.748 25.293  -12.099 1.00 18.72  ? 138 PRO A N   1 
ATOM   1072  C CA  . PRO A  1 141 ? 124.753 25.157  -13.144 1.00 19.33  ? 138 PRO A CA  1 
ATOM   1073  C C   . PRO A  1 141 ? 124.219 25.362  -14.570 1.00 19.30  ? 138 PRO A C   1 
ATOM   1074  O O   . PRO A  1 141 ? 123.047 25.123  -14.836 1.00 18.94  ? 138 PRO A O   1 
ATOM   1075  C CB  . PRO A  1 141 ? 125.276 23.733  -12.938 1.00 19.54  ? 138 PRO A CB  1 
ATOM   1076  C CG  . PRO A  1 141 ? 124.850 23.352  -11.555 1.00 19.43  ? 138 PRO A CG  1 
ATOM   1077  C CD  . PRO A  1 141 ? 123.532 24.019  -11.397 1.00 18.84  ? 138 PRO A CD  1 
ATOM   1078  N N   . MET A  1 142 ? 125.105 25.809  -15.453 1.00 19.20  ? 139 MET A N   1 
ATOM   1079  C CA  . MET A  1 142 ? 124.804 25.997  -16.865 1.00 19.45  ? 139 MET A CA  1 
ATOM   1080  C C   . MET A  1 142 ? 124.628 24.661  -17.618 1.00 19.50  ? 139 MET A C   1 
ATOM   1081  O O   . MET A  1 142 ? 123.618 24.426  -18.300 1.00 20.11  ? 139 MET A O   1 
ATOM   1082  C CB  . MET A  1 142 ? 125.932 26.805  -17.525 1.00 19.43  ? 139 MET A CB  1 
ATOM   1083  C CG  . MET A  1 142 ? 126.132 28.227  -16.988 1.00 19.28  ? 139 MET A CG  1 
ATOM   1084  S SD  . MET A  1 142 ? 124.651 29.247  -17.189 1.00 19.82  ? 139 MET A SD  1 
ATOM   1085  C CE  . MET A  1 142 ? 124.445 29.390  -18.975 1.00 19.74  ? 139 MET A CE  1 
ATOM   1086  N N   . GLY A  1 143 ? 125.619 23.792  -17.497 1.00 18.89  ? 140 GLY A N   1 
ATOM   1087  C CA  . GLY A  1 143 ? 125.658 22.568  -18.287 1.00 18.34  ? 140 GLY A CA  1 
ATOM   1088  C C   . GLY A  1 143 ? 127.062 22.312  -18.740 1.00 17.50  ? 140 GLY A C   1 
ATOM   1089  O O   . GLY A  1 143 ? 127.950 22.217  -17.902 1.00 16.76  ? 140 GLY A O   1 
ATOM   1090  N N   . VAL A  1 144 ? 127.254 22.214  -20.058 1.00 17.75  ? 141 VAL A N   1 
ATOM   1091  C CA  . VAL A  1 144 ? 128.591 22.027  -20.632 1.00 17.88  ? 141 VAL A CA  1 
ATOM   1092  C C   . VAL A  1 144 ? 129.135 23.393  -20.939 1.00 17.97  ? 141 VAL A C   1 
ATOM   1093  O O   . VAL A  1 144 ? 128.472 24.214  -21.580 1.00 17.22  ? 141 VAL A O   1 
ATOM   1094  C CB  . VAL A  1 144 ? 128.635 21.163  -21.912 1.00 18.15  ? 141 VAL A CB  1 
ATOM   1095  C CG1 . VAL A  1 144 ? 130.073 21.002  -22.386 1.00 18.05  ? 141 VAL A CG1 1 
ATOM   1096  C CG2 . VAL A  1 144 ? 128.044 19.772  -21.680 1.00 18.27  ? 141 VAL A CG2 1 
ATOM   1097  N N   . VAL A  1 145 ? 130.360 23.608  -20.471 1.00 18.53  ? 142 VAL A N   1 
ATOM   1098  C CA  . VAL A  1 145 ? 131.029 24.889  -20.557 1.00 18.77  ? 142 VAL A CA  1 
ATOM   1099  C C   . VAL A  1 145 ? 132.326 24.696  -21.276 1.00 18.25  ? 142 VAL A C   1 
ATOM   1100  O O   . VAL A  1 145 ? 133.027 23.716  -21.024 1.00 18.52  ? 142 VAL A O   1 
ATOM   1101  C CB  . VAL A  1 145 ? 131.338 25.444  -19.170 1.00 19.65  ? 142 VAL A CB  1 
ATOM   1102  C CG1 . VAL A  1 145 ? 132.128 26.748  -19.283 1.00 20.57  ? 142 VAL A CG1 1 
ATOM   1103  C CG2 . VAL A  1 145 ? 130.036 25.699  -18.429 1.00 19.87  ? 142 VAL A CG2 1 
ATOM   1104  N N   . ALA A  1 146 ? 132.644 25.646  -22.152 1.00 17.71  ? 143 ALA A N   1 
ATOM   1105  C CA  . ALA A  1 146 ? 133.805 25.544  -23.017 1.00 17.78  ? 143 ALA A CA  1 
ATOM   1106  C C   . ALA A  1 146 ? 134.799 26.629  -22.663 1.00 17.89  ? 143 ALA A C   1 
ATOM   1107  O O   . ALA A  1 146 ? 134.408 27.775  -22.416 1.00 17.78  ? 143 ALA A O   1 
ATOM   1108  C CB  . ALA A  1 146 ? 133.390 25.658  -24.471 1.00 17.55  ? 143 ALA A CB  1 
ATOM   1109  N N   . GLY A  1 147 ? 136.078 26.258  -22.644 1.00 17.69  ? 144 GLY A N   1 
ATOM   1110  C CA  . GLY A  1 147 ? 137.162 27.182  -22.303 1.00 17.50  ? 144 GLY A CA  1 
ATOM   1111  C C   . GLY A  1 147 ? 138.225 27.191  -23.375 1.00 17.23  ? 144 GLY A C   1 
ATOM   1112  O O   . GLY A  1 147 ? 138.607 26.133  -23.855 1.00 16.96  ? 144 GLY A O   1 
ATOM   1113  N N   . ILE A  1 148 ? 138.695 28.381  -23.753 1.00 16.97  ? 145 ILE A N   1 
ATOM   1114  C CA  . ILE A  1 148 ? 139.670 28.520  -24.821 1.00 17.04  ? 145 ILE A CA  1 
ATOM   1115  C C   . ILE A  1 148 ? 140.770 29.434  -24.357 1.00 17.24  ? 145 ILE A C   1 
ATOM   1116  O O   . ILE A  1 148 ? 140.485 30.579  -23.997 1.00 17.26  ? 145 ILE A O   1 
ATOM   1117  C CB  . ILE A  1 148 ? 139.033 29.095  -26.079 1.00 17.17  ? 145 ILE A CB  1 
ATOM   1118  C CG1 . ILE A  1 148 ? 137.938 28.157  -26.559 1.00 17.20  ? 145 ILE A CG1 1 
ATOM   1119  C CG2 . ILE A  1 148 ? 140.088 29.273  -27.176 1.00 17.32  ? 145 ILE A CG2 1 
ATOM   1120  C CD1 . ILE A  1 148 ? 137.017 28.779  -27.559 1.00 17.81  ? 145 ILE A CD1 1 
ATOM   1121  N N   . THR A  1 149 ? 142.012 28.936  -24.391 1.00 17.00  ? 146 THR A N   1 
ATOM   1122  C CA  . THR A  1 149 ? 143.104 29.558  -23.653 1.00 17.39  ? 146 THR A CA  1 
ATOM   1123  C C   . THR A  1 149 ? 144.307 29.852  -24.524 1.00 18.09  ? 146 THR A C   1 
ATOM   1124  O O   . THR A  1 149 ? 144.471 29.267  -25.587 1.00 18.00  ? 146 THR A O   1 
ATOM   1125  C CB  . THR A  1 149 ? 143.525 28.699  -22.440 1.00 17.63  ? 146 THR A CB  1 
ATOM   1126  O OG1 . THR A  1 149 ? 144.244 27.520  -22.853 1.00 18.46  ? 146 THR A OG1 1 
ATOM   1127  C CG2 . THR A  1 149 ? 142.315 28.319  -21.635 1.00 17.40  ? 146 THR A CG2 1 
ATOM   1128  N N   . PRO A  1 150 ? 145.162 30.771  -24.076 1.00 19.33  ? 147 PRO A N   1 
ATOM   1129  C CA  . PRO A  1 150 ? 146.311 31.145  -24.885 1.00 20.78  ? 147 PRO A CA  1 
ATOM   1130  C C   . PRO A  1 150 ? 147.609 30.352  -24.565 1.00 22.24  ? 147 PRO A C   1 
ATOM   1131  O O   . PRO A  1 150 ? 147.619 29.456  -23.679 1.00 22.17  ? 147 PRO A O   1 
ATOM   1132  C CB  . PRO A  1 150 ? 146.468 32.626  -24.556 1.00 20.32  ? 147 PRO A CB  1 
ATOM   1133  C CG  . PRO A  1 150 ? 146.058 32.718  -23.127 1.00 20.31  ? 147 PRO A CG  1 
ATOM   1134  C CD  . PRO A  1 150 ? 145.095 31.583  -22.850 1.00 19.63  ? 147 PRO A CD  1 
ATOM   1135  N N   . PHE A  1 151 ? 148.668 30.685  -25.311 1.00 22.41  ? 148 PHE A N   1 
ATOM   1136  C CA  . PHE A  1 151 ? 149.939 30.001  -25.196 1.00 23.32  ? 148 PHE A CA  1 
ATOM   1137  C C   . PHE A  1 151 ? 150.729 30.475  -23.997 1.00 24.16  ? 148 PHE A C   1 
ATOM   1138  O O   . PHE A  1 151 ? 151.464 29.700  -23.414 1.00 25.27  ? 148 PHE A O   1 
ATOM   1139  C CB  . PHE A  1 151 ? 150.791 30.173  -26.470 1.00 23.54  ? 148 PHE A CB  1 
ATOM   1140  C CG  . PHE A  1 151 ? 151.509 31.490  -26.559 1.00 23.48  ? 148 PHE A CG  1 
ATOM   1141  C CD1 . PHE A  1 151 ? 152.687 31.721  -25.851 1.00 24.11  ? 148 PHE A CD1 1 
ATOM   1142  C CD2 . PHE A  1 151 ? 151.020 32.493  -27.352 1.00 23.94  ? 148 PHE A CD2 1 
ATOM   1143  C CE1 . PHE A  1 151 ? 153.336 32.944  -25.921 1.00 24.31  ? 148 PHE A CE1 1 
ATOM   1144  C CE2 . PHE A  1 151 ? 151.658 33.724  -27.429 1.00 24.38  ? 148 PHE A CE2 1 
ATOM   1145  C CZ  . PHE A  1 151 ? 152.823 33.948  -26.716 1.00 24.29  ? 148 PHE A CZ  1 
ATOM   1146  N N   . ASN A  1 152 ? 150.623 31.754  -23.664 1.00 24.95  ? 149 ASN A N   1 
ATOM   1147  C CA  . ASN A  1 152 ? 151.521 32.349  -22.664 1.00 25.48  ? 149 ASN A CA  1 
ATOM   1148  C C   . ASN A  1 152 ? 151.374 31.852  -21.230 1.00 22.45  ? 149 ASN A C   1 
ATOM   1149  O O   . ASN A  1 152 ? 152.343 31.891  -20.469 1.00 21.74  ? 149 ASN A O   1 
ATOM   1150  C CB  . ASN A  1 152 ? 151.483 33.884  -22.704 1.00 28.42  ? 149 ASN A CB  1 
ATOM   1151  C CG  . ASN A  1 152 ? 150.113 34.477  -22.382 1.00 29.96  ? 149 ASN A CG  1 
ATOM   1152  O OD1 . ASN A  1 152 ? 149.114 34.192  -23.040 1.00 32.29  ? 149 ASN A OD1 1 
ATOM   1153  N ND2 . ASN A  1 152 ? 150.085 35.356  -21.396 1.00 31.49  ? 149 ASN A ND2 1 
ATOM   1154  N N   . PHE A  1 153 ? 150.178 31.378  -20.887 1.00 20.25  ? 150 PHE A N   1 
ATOM   1155  C CA  . PHE A  1 153 ? 149.908 30.778  -19.581 1.00 19.09  ? 150 PHE A CA  1 
ATOM   1156  C C   . PHE A  1 153 ? 149.135 29.478  -19.735 1.00 18.04  ? 150 PHE A C   1 
ATOM   1157  O O   . PHE A  1 153 ? 147.957 29.392  -19.415 1.00 17.14  ? 150 PHE A O   1 
ATOM   1158  C CB  . PHE A  1 153 ? 149.079 31.701  -18.723 1.00 19.04  ? 150 PHE A CB  1 
ATOM   1159  C CG  . PHE A  1 153 ? 149.799 32.911  -18.249 1.00 19.49  ? 150 PHE A CG  1 
ATOM   1160  C CD1 . PHE A  1 153 ? 150.839 32.796  -17.339 1.00 20.49  ? 150 PHE A CD1 1 
ATOM   1161  C CD2 . PHE A  1 153 ? 149.405 34.175  -18.652 1.00 19.22  ? 150 PHE A CD2 1 
ATOM   1162  C CE1 . PHE A  1 153 ? 151.500 33.930  -16.871 1.00 20.29  ? 150 PHE A CE1 1 
ATOM   1163  C CE2 . PHE A  1 153 ? 150.059 35.301  -18.186 1.00 19.41  ? 150 PHE A CE2 1 
ATOM   1164  C CZ  . PHE A  1 153 ? 151.103 35.180  -17.295 1.00 19.35  ? 150 PHE A CZ  1 
ATOM   1165  N N   . PRO A  1 154 ? 149.807 28.439  -20.172 1.00 17.28  ? 151 PRO A N   1 
ATOM   1166  C CA  . PRO A  1 154 ? 149.104 27.235  -20.509 1.00 18.01  ? 151 PRO A CA  1 
ATOM   1167  C C   . PRO A  1 154 ? 148.576 26.476  -19.307 1.00 18.13  ? 151 PRO A C   1 
ATOM   1168  O O   . PRO A  1 154 ? 147.817 25.513  -19.472 1.00 17.15  ? 151 PRO A O   1 
ATOM   1169  C CB  . PRO A  1 154 ? 150.178 26.417  -21.193 1.00 18.69  ? 151 PRO A CB  1 
ATOM   1170  C CG  . PRO A  1 154 ? 151.423 26.821  -20.479 1.00 18.38  ? 151 PRO A CG  1 
ATOM   1171  C CD  . PRO A  1 154 ? 151.256 28.281  -20.267 1.00 17.72  ? 151 PRO A CD  1 
ATOM   1172  N N   . VAL A  1 155 ? 149.012 26.873  -18.118 1.00 19.00  ? 152 VAL A N   1 
ATOM   1173  C CA  . VAL A  1 155 ? 148.524 26.281  -16.870 1.00 19.81  ? 152 VAL A CA  1 
ATOM   1174  C C   . VAL A  1 155 ? 147.554 27.196  -16.117 1.00 19.85  ? 152 VAL A C   1 
ATOM   1175  O O   . VAL A  1 155 ? 146.420 26.794  -15.813 1.00 18.98  ? 152 VAL A O   1 
ATOM   1176  C CB  . VAL A  1 155 ? 149.715 25.883  -15.976 1.00 20.30  ? 152 VAL A CB  1 
ATOM   1177  C CG1 . VAL A  1 155 ? 149.300 25.670  -14.520 1.00 20.73  ? 152 VAL A CG1 1 
ATOM   1178  C CG2 . VAL A  1 155 ? 150.355 24.612  -16.527 1.00 20.34  ? 152 VAL A CG2 1 
ATOM   1179  N N   . MET A  1 156 ? 148.004 28.417  -15.828 1.00 19.87  ? 153 MET A N   1 
ATOM   1180  C CA  . MET A  1 156 ? 147.257 29.308  -14.970 1.00 20.07  ? 153 MET A CA  1 
ATOM   1181  C C   . MET A  1 156 ? 145.965 29.732  -15.595 1.00 19.43  ? 153 MET A C   1 
ATOM   1182  O O   . MET A  1 156 ? 144.938 29.715  -14.927 1.00 20.35  ? 153 MET A O   1 
ATOM   1183  C CB  . MET A  1 156 ? 148.061 30.548  -14.644 1.00 21.67  ? 153 MET A CB  1 
ATOM   1184  C CG  . MET A  1 156 ? 147.359 31.540  -13.704 1.00 22.68  ? 153 MET A CG  1 
ATOM   1185  S SD  . MET A  1 156 ? 148.232 33.120  -13.650 1.00 23.59  ? 153 MET A SD  1 
ATOM   1186  C CE  . MET A  1 156 ? 147.801 33.723  -15.286 1.00 23.15  ? 153 MET A CE  1 
ATOM   1187  N N   . VAL A  1 157 ? 146.000 30.129  -16.862 1.00 18.58  ? 154 VAL A N   1 
ATOM   1188  C CA  . VAL A  1 157 ? 144.774 30.631  -17.500 1.00 17.90  ? 154 VAL A CA  1 
ATOM   1189  C C   . VAL A  1 157 ? 143.718 29.511  -17.573 1.00 17.33  ? 154 VAL A C   1 
ATOM   1190  O O   . VAL A  1 157 ? 142.571 29.759  -17.254 1.00 17.39  ? 154 VAL A O   1 
ATOM   1191  C CB  . VAL A  1 157 ? 145.014 31.370  -18.849 1.00 17.42  ? 154 VAL A CB  1 
ATOM   1192  C CG1 . VAL A  1 157 ? 143.718 31.481  -19.626 1.00 17.94  ? 154 VAL A CG1 1 
ATOM   1193  C CG2 . VAL A  1 157 ? 145.545 32.788  -18.604 1.00 17.05  ? 154 VAL A CG2 1 
ATOM   1194  N N   . PRO A  1 158 ? 144.099 28.271  -17.936 1.00 16.98  ? 155 PRO A N   1 
ATOM   1195  C CA  . PRO A  1 158 ? 143.071 27.222  -17.826 1.00 16.99  ? 155 PRO A CA  1 
ATOM   1196  C C   . PRO A  1 158 ? 142.518 27.033  -16.408 1.00 16.87  ? 155 PRO A C   1 
ATOM   1197  O O   . PRO A  1 158 ? 141.333 26.728  -16.258 1.00 16.74  ? 155 PRO A O   1 
ATOM   1198  C CB  . PRO A  1 158 ? 143.792 25.973  -18.333 1.00 17.01  ? 155 PRO A CB  1 
ATOM   1199  C CG  . PRO A  1 158 ? 144.751 26.512  -19.338 1.00 16.95  ? 155 PRO A CG  1 
ATOM   1200  C CD  . PRO A  1 158 ? 145.235 27.821  -18.756 1.00 16.93  ? 155 PRO A CD  1 
ATOM   1201  N N   . LEU A  1 159 ? 143.358 27.248  -15.391 1.00 16.71  ? 156 LEU A N   1 
ATOM   1202  C CA  . LEU A  1 159 ? 142.914 27.208  -13.989 1.00 16.34  ? 156 LEU A CA  1 
ATOM   1203  C C   . LEU A  1 159 ? 142.039 28.408  -13.617 1.00 16.20  ? 156 LEU A C   1 
ATOM   1204  O O   . LEU A  1 159 ? 141.313 28.400  -12.633 1.00 16.35  ? 156 LEU A O   1 
ATOM   1205  C CB  . LEU A  1 159 ? 144.105 27.087  -13.051 1.00 16.32  ? 156 LEU A CB  1 
ATOM   1206  C CG  . LEU A  1 159 ? 144.816 25.731  -13.148 1.00 16.63  ? 156 LEU A CG  1 
ATOM   1207  C CD1 . LEU A  1 159 ? 146.194 25.822  -12.483 1.00 16.43  ? 156 LEU A CD1 1 
ATOM   1208  C CD2 . LEU A  1 159 ? 143.981 24.558  -12.595 1.00 16.36  ? 156 LEU A CD2 1 
ATOM   1209  N N   . TRP A  1 160 ? 142.078 29.444  -14.426 1.00 16.29  ? 157 TRP A N   1 
ATOM   1210  C CA  . TRP A  1 160 ? 141.084 30.492  -14.318 1.00 16.65  ? 157 TRP A CA  1 
ATOM   1211  C C   . TRP A  1 160 ? 139.679 29.963  -14.492 1.00 16.74  ? 157 TRP A C   1 
ATOM   1212  O O   . TRP A  1 160 ? 138.742 30.472  -13.884 1.00 17.56  ? 157 TRP A O   1 
ATOM   1213  C CB  . TRP A  1 160 ? 141.332 31.576  -15.372 1.00 16.70  ? 157 TRP A CB  1 
ATOM   1214  C CG  . TRP A  1 160 ? 142.491 32.472  -15.070 1.00 17.04  ? 157 TRP A CG  1 
ATOM   1215  C CD1 . TRP A  1 160 ? 143.402 32.344  -14.061 1.00 17.46  ? 157 TRP A CD1 1 
ATOM   1216  C CD2 . TRP A  1 160 ? 142.855 33.650  -15.785 1.00 17.22  ? 157 TRP A CD2 1 
ATOM   1217  N NE1 . TRP A  1 160 ? 144.307 33.382  -14.099 1.00 17.80  ? 157 TRP A NE1 1 
ATOM   1218  C CE2 . TRP A  1 160 ? 143.994 34.193  -15.152 1.00 17.20  ? 157 TRP A CE2 1 
ATOM   1219  C CE3 . TRP A  1 160 ? 142.326 34.303  -16.896 1.00 16.64  ? 157 TRP A CE3 1 
ATOM   1220  C CZ2 . TRP A  1 160 ? 144.600 35.347  -15.589 1.00 17.12  ? 157 TRP A CZ2 1 
ATOM   1221  C CZ3 . TRP A  1 160 ? 142.922 35.444  -17.321 1.00 16.75  ? 157 TRP A CZ3 1 
ATOM   1222  C CH2 . TRP A  1 160 ? 144.054 35.963  -16.676 1.00 17.01  ? 157 TRP A CH2 1 
ATOM   1223  N N   . MET A  1 161 ? 139.531 28.951  -15.334 1.00 16.73  ? 158 MET A N   1 
ATOM   1224  C CA  . MET A  1 161 ? 138.228 28.577  -15.859 1.00 16.65  ? 158 MET A CA  1 
ATOM   1225  C C   . MET A  1 161 ? 137.632 27.323  -15.238 1.00 16.32  ? 158 MET A C   1 
ATOM   1226  O O   . MET A  1 161 ? 136.582 27.382  -14.592 1.00 16.06  ? 158 MET A O   1 
ATOM   1227  C CB  . MET A  1 161 ? 138.340 28.394  -17.376 1.00 17.12  ? 158 MET A CB  1 
ATOM   1228  C CG  . MET A  1 161 ? 138.785 29.645  -18.120 1.00 17.19  ? 158 MET A CG  1 
ATOM   1229  S SD  . MET A  1 161 ? 138.901 29.355  -19.896 1.00 18.10  ? 158 MET A SD  1 
ATOM   1230  C CE  . MET A  1 161 ? 139.778 30.829  -20.435 1.00 17.51  ? 158 MET A CE  1 
ATOM   1231  N N   . PHE A  1 162 ? 138.294 26.191  -15.446 1.00 16.01  ? 159 PHE A N   1 
ATOM   1232  C CA  . PHE A  1 162 ? 137.677 24.906  -15.118 1.00 16.09  ? 159 PHE A CA  1 
ATOM   1233  C C   . PHE A  1 162 ? 137.599 24.494  -13.649 1.00 16.03  ? 159 PHE A C   1 
ATOM   1234  O O   . PHE A  1 162 ? 136.668 23.796  -13.275 1.00 15.98  ? 159 PHE A O   1 
ATOM   1235  C CB  . PHE A  1 162 ? 138.237 23.772  -15.978 1.00 16.29  ? 159 PHE A CB  1 
ATOM   1236  C CG  . PHE A  1 162 ? 139.629 23.336  -15.647 1.00 16.09  ? 159 PHE A CG  1 
ATOM   1237  C CD1 . PHE A  1 162 ? 139.862 22.430  -14.627 1.00 16.28  ? 159 PHE A CD1 1 
ATOM   1238  C CD2 . PHE A  1 162 ? 140.691 23.751  -16.422 1.00 15.88  ? 159 PHE A CD2 1 
ATOM   1239  C CE1 . PHE A  1 162 ? 141.141 21.971  -14.368 1.00 16.50  ? 159 PHE A CE1 1 
ATOM   1240  C CE2 . PHE A  1 162 ? 141.968 23.312  -16.163 1.00 16.21  ? 159 PHE A CE2 1 
ATOM   1241  C CZ  . PHE A  1 162 ? 142.197 22.411  -15.140 1.00 16.52  ? 159 PHE A CZ  1 
ATOM   1242  N N   . PRO A  1 163 ? 138.563 24.904  -12.810 1.00 16.18  ? 160 PRO A N   1 
ATOM   1243  C CA  . PRO A  1 163 ? 138.317 24.656  -11.393 1.00 15.81  ? 160 PRO A CA  1 
ATOM   1244  C C   . PRO A  1 163 ? 136.965 25.231  -10.977 1.00 15.26  ? 160 PRO A C   1 
ATOM   1245  O O   . PRO A  1 163 ? 136.115 24.497  -10.506 1.00 14.15  ? 160 PRO A O   1 
ATOM   1246  C CB  . PRO A  1 163 ? 139.485 25.366  -10.704 1.00 15.70  ? 160 PRO A CB  1 
ATOM   1247  C CG  . PRO A  1 163 ? 140.574 25.279  -11.699 1.00 16.25  ? 160 PRO A CG  1 
ATOM   1248  C CD  . PRO A  1 163 ? 139.896 25.485  -13.028 1.00 16.42  ? 160 PRO A CD  1 
ATOM   1249  N N   . MET A  1 164 ? 136.755 26.516  -11.230 1.00 15.66  ? 161 MET A N   1 
ATOM   1250  C CA  . MET A  1 164 ? 135.558 27.196  -10.726 1.00 15.79  ? 161 MET A CA  1 
ATOM   1251  C C   . MET A  1 164 ? 134.320 26.700  -11.461 1.00 15.76  ? 161 MET A C   1 
ATOM   1252  O O   . MET A  1 164 ? 133.271 26.513  -10.844 1.00 16.78  ? 161 MET A O   1 
ATOM   1253  C CB  . MET A  1 164 ? 135.665 28.725  -10.855 1.00 15.68  ? 161 MET A CB  1 
ATOM   1254  C CG  . MET A  1 164 ? 134.424 29.488  -10.367 1.00 15.50  ? 161 MET A CG  1 
ATOM   1255  S SD  . MET A  1 164 ? 134.024 29.223  -8.628  1.00 15.44  ? 161 MET A SD  1 
ATOM   1256  C CE  . MET A  1 164 ? 135.347 30.165  -7.892  1.00 15.91  ? 161 MET A CE  1 
ATOM   1257  N N   . ALA A  1 165 ? 134.439 26.486  -12.768 1.00 14.89  ? 162 ALA A N   1 
ATOM   1258  C CA  . ALA A  1 165 ? 133.310 26.030  -13.557 1.00 14.04  ? 162 ALA A CA  1 
ATOM   1259  C C   . ALA A  1 165 ? 132.839 24.665  -13.068 1.00 13.67  ? 162 ALA A C   1 
ATOM   1260  O O   . ALA A  1 165 ? 131.633 24.439  -12.897 1.00 13.27  ? 162 ALA A O   1 
ATOM   1261  C CB  . ALA A  1 165 ? 133.686 25.984  -15.023 1.00 14.15  ? 162 ALA A CB  1 
ATOM   1262  N N   . ILE A  1 166 ? 133.794 23.771  -12.818 1.00 13.51  ? 163 ILE A N   1 
ATOM   1263  C CA  . ILE A  1 166 ? 133.478 22.399  -12.421 1.00 13.44  ? 163 ILE A CA  1 
ATOM   1264  C C   . ILE A  1 166 ? 132.848 22.399  -11.033 1.00 13.99  ? 163 ILE A C   1 
ATOM   1265  O O   . ILE A  1 166 ? 131.779 21.844  -10.817 1.00 13.91  ? 163 ILE A O   1 
ATOM   1266  C CB  . ILE A  1 166 ? 134.717 21.493  -12.464 1.00 12.96  ? 163 ILE A CB  1 
ATOM   1267  C CG1 . ILE A  1 166 ? 135.051 21.172  -13.924 1.00 13.05  ? 163 ILE A CG1 1 
ATOM   1268  C CG2 . ILE A  1 166 ? 134.480 20.201  -11.707 1.00 12.68  ? 163 ILE A CG2 1 
ATOM   1269  C CD1 . ILE A  1 166 ? 136.437 20.612  -14.150 1.00 13.15  ? 163 ILE A CD1 1 
ATOM   1270  N N   . VAL A  1 167 ? 133.493 23.067  -10.097 1.00 14.73  ? 164 VAL A N   1 
ATOM   1271  C CA  . VAL A  1 167 ? 133.004 23.088  -8.731  1.00 14.80  ? 164 VAL A CA  1 
ATOM   1272  C C   . VAL A  1 167 ? 131.614 23.732  -8.666  1.00 15.43  ? 164 VAL A C   1 
ATOM   1273  O O   . VAL A  1 167 ? 130.833 23.401  -7.778  1.00 16.03  ? 164 VAL A O   1 
ATOM   1274  C CB  . VAL A  1 167 ? 134.017 23.785  -7.796  1.00 14.79  ? 164 VAL A CB  1 
ATOM   1275  C CG1 . VAL A  1 167 ? 133.754 25.292  -7.676  1.00 14.94  ? 164 VAL A CG1 1 
ATOM   1276  C CG2 . VAL A  1 167 ? 134.007 23.130  -6.438  1.00 15.10  ? 164 VAL A CG2 1 
ATOM   1277  N N   . CYS A  1 168 ? 131.309 24.638  -9.604  1.00 15.51  ? 165 CYS A N   1 
ATOM   1278  C CA  . CYS A  1 168 ? 129.950 25.188  -9.756  1.00 15.80  ? 165 CYS A CA  1 
ATOM   1279  C C   . CYS A  1 168 ? 128.828 24.236  -10.349 1.00 16.97  ? 165 CYS A C   1 
ATOM   1280  O O   . CYS A  1 168 ? 127.663 24.665  -10.577 1.00 17.04  ? 165 CYS A O   1 
ATOM   1281  C CB  . CYS A  1 168 ? 130.030 26.468  -10.569 1.00 15.39  ? 165 CYS A CB  1 
ATOM   1282  S SG  . CYS A  1 168 ? 130.740 27.818  -9.618  1.00 15.01  ? 165 CYS A SG  1 
ATOM   1283  N N   . GLY A  1 169 ? 129.181 22.967  -10.597 1.00 16.88  ? 166 GLY A N   1 
ATOM   1284  C CA  . GLY A  1 169 ? 128.241 21.959  -11.058 1.00 15.89  ? 166 GLY A CA  1 
ATOM   1285  C C   . GLY A  1 169 ? 128.240 21.721  -12.555 1.00 15.81  ? 166 GLY A C   1 
ATOM   1286  O O   . GLY A  1 169 ? 127.362 21.022  -13.041 1.00 15.58  ? 166 GLY A O   1 
ATOM   1287  N N   . ASN A  1 170 ? 129.208 22.274  -13.293 1.00 15.79  ? 167 ASN A N   1 
ATOM   1288  C CA  . ASN A  1 170 ? 129.263 22.101  -14.753 1.00 16.14  ? 167 ASN A CA  1 
ATOM   1289  C C   . ASN A  1 170 ? 130.197 20.973  -15.203 1.00 17.08  ? 167 ASN A C   1 
ATOM   1290  O O   . ASN A  1 170 ? 131.012 20.455  -14.440 1.00 17.92  ? 167 ASN A O   1 
ATOM   1291  C CB  . ASN A  1 170 ? 129.760 23.382  -15.414 1.00 15.79  ? 167 ASN A CB  1 
ATOM   1292  C CG  . ASN A  1 170 ? 128.890 24.568  -15.121 1.00 15.60  ? 167 ASN A CG  1 
ATOM   1293  O OD1 . ASN A  1 170 ? 127.733 24.602  -15.526 1.00 15.63  ? 167 ASN A OD1 1 
ATOM   1294  N ND2 . ASN A  1 170 ? 129.442 25.565  -14.433 1.00 15.60  ? 167 ASN A ND2 1 
ATOM   1295  N N   . CYS A  1 171 ? 130.106 20.619  -16.469 1.00 17.30  ? 168 CYS A N   1 
ATOM   1296  C CA  . CYS A  1 171 ? 131.163 19.864  -17.108 1.00 17.97  ? 168 CYS A CA  1 
ATOM   1297  C C   . CYS A  1 171 ? 131.877 20.788  -18.073 1.00 17.54  ? 168 CYS A C   1 
ATOM   1298  O O   . CYS A  1 171 ? 131.305 21.773  -18.505 1.00 18.50  ? 168 CYS A O   1 
ATOM   1299  C CB  . CYS A  1 171 ? 130.580 18.656  -17.820 1.00 19.09  ? 168 CYS A CB  1 
ATOM   1300  S SG  . CYS A  1 171 ? 129.788 17.491  -16.678 1.00 20.23  ? 168 CYS A SG  1 
ATOM   1301  N N   . PHE A  1 172 ? 133.117 20.465  -18.415 1.00 17.20  ? 169 PHE A N   1 
ATOM   1302  C CA  . PHE A  1 172 ? 134.010 21.405  -19.089 1.00 16.92  ? 169 PHE A CA  1 
ATOM   1303  C C   . PHE A  1 172 ? 134.672 20.748  -20.263 1.00 18.17  ? 169 PHE A C   1 
ATOM   1304  O O   . PHE A  1 172 ? 135.114 19.595  -20.147 1.00 18.37  ? 169 PHE A O   1 
ATOM   1305  C CB  . PHE A  1 172 ? 135.128 21.852  -18.139 1.00 16.16  ? 169 PHE A CB  1 
ATOM   1306  C CG  . PHE A  1 172 ? 135.721 23.156  -18.497 1.00 14.81  ? 169 PHE A CG  1 
ATOM   1307  C CD1 . PHE A  1 172 ? 136.769 23.232  -19.356 1.00 14.65  ? 169 PHE A CD1 1 
ATOM   1308  C CD2 . PHE A  1 172 ? 135.188 24.318  -17.981 1.00 14.55  ? 169 PHE A CD2 1 
ATOM   1309  C CE1 . PHE A  1 172 ? 137.293 24.469  -19.698 1.00 14.90  ? 169 PHE A CE1 1 
ATOM   1310  C CE2 . PHE A  1 172 ? 135.700 25.547  -18.305 1.00 14.29  ? 169 PHE A CE2 1 
ATOM   1311  C CZ  . PHE A  1 172 ? 136.756 25.629  -19.166 1.00 14.47  ? 169 PHE A CZ  1 
ATOM   1312  N N   . VAL A  1 173 ? 134.783 21.495  -21.366 1.00 19.16  ? 170 VAL A N   1 
ATOM   1313  C CA  . VAL A  1 173 ? 135.624 21.101  -22.508 1.00 19.08  ? 170 VAL A CA  1 
ATOM   1314  C C   . VAL A  1 173 ? 136.606 22.216  -22.784 1.00 19.21  ? 170 VAL A C   1 
ATOM   1315  O O   . VAL A  1 173 ? 136.193 23.349  -23.069 1.00 18.26  ? 170 VAL A O   1 
ATOM   1316  C CB  . VAL A  1 173 ? 134.798 20.854  -23.762 1.00 19.32  ? 170 VAL A CB  1 
ATOM   1317  C CG1 . VAL A  1 173 ? 135.694 20.411  -24.913 1.00 19.25  ? 170 VAL A CG1 1 
ATOM   1318  C CG2 . VAL A  1 173 ? 133.728 19.809  -23.468 1.00 19.61  ? 170 VAL A CG2 1 
ATOM   1319  N N   . LEU A  1 174 ? 137.895 21.871  -22.693 1.00 19.42  ? 171 LEU A N   1 
ATOM   1320  C CA  . LEU A  1 174 ? 138.991 22.828  -22.777 1.00 19.72  ? 171 LEU A CA  1 
ATOM   1321  C C   . LEU A  1 174 ? 139.772 22.672  -24.087 1.00 20.46  ? 171 LEU A C   1 
ATOM   1322  O O   . LEU A  1 174 ? 140.256 21.584  -24.412 1.00 21.39  ? 171 LEU A O   1 
ATOM   1323  C CB  . LEU A  1 174 ? 139.935 22.657  -21.584 1.00 19.17  ? 171 LEU A CB  1 
ATOM   1324  C CG  . LEU A  1 174 ? 141.159 23.569  -21.604 1.00 18.98  ? 171 LEU A CG  1 
ATOM   1325  C CD1 . LEU A  1 174 ? 140.732 25.005  -21.364 1.00 18.70  ? 171 LEU A CD1 1 
ATOM   1326  C CD2 . LEU A  1 174 ? 142.186 23.108  -20.587 1.00 18.78  ? 171 LEU A CD2 1 
ATOM   1327  N N   . LYS A  1 175 ? 139.921 23.785  -24.803 1.00 20.59  ? 172 LYS A N   1 
ATOM   1328  C CA  . LYS A  1 175 ? 140.698 23.863  -26.036 1.00 19.90  ? 172 LYS A CA  1 
ATOM   1329  C C   . LYS A  1 175 ? 141.901 24.813  -25.828 1.00 20.12  ? 172 LYS A C   1 
ATOM   1330  O O   . LYS A  1 175 ? 141.794 26.027  -25.994 1.00 19.06  ? 172 LYS A O   1 
ATOM   1331  C CB  . LYS A  1 175 ? 139.775 24.317  -27.148 1.00 19.40  ? 172 LYS A CB  1 
ATOM   1332  C CG  . LYS A  1 175 ? 140.167 23.858  -28.537 1.00 19.69  ? 172 LYS A CG  1 
ATOM   1333  C CD  . LYS A  1 175 ? 140.956 24.920  -29.291 1.00 19.91  ? 172 LYS A CD  1 
ATOM   1334  C CE  . LYS A  1 175 ? 142.427 24.645  -29.195 1.00 20.03  ? 172 LYS A CE  1 
ATOM   1335  N NZ  . LYS A  1 175 ? 143.195 25.855  -29.533 1.00 20.34  ? 172 LYS A NZ  1 
ATOM   1336  N N   . PRO A  1 176 ? 143.051 24.250  -25.437 1.00 20.99  ? 173 PRO A N   1 
ATOM   1337  C CA  . PRO A  1 176 ? 144.234 25.037  -25.156 1.00 21.65  ? 173 PRO A CA  1 
ATOM   1338  C C   . PRO A  1 176 ? 145.078 25.350  -26.351 1.00 22.58  ? 173 PRO A C   1 
ATOM   1339  O O   . PRO A  1 176 ? 144.864 24.815  -27.424 1.00 23.51  ? 173 PRO A O   1 
ATOM   1340  C CB  . PRO A  1 176 ? 145.034 24.132  -24.243 1.00 22.14  ? 173 PRO A CB  1 
ATOM   1341  C CG  . PRO A  1 176 ? 144.702 22.767  -24.707 1.00 22.13  ? 173 PRO A CG  1 
ATOM   1342  C CD  . PRO A  1 176 ? 143.263 22.821  -25.133 1.00 21.86  ? 173 PRO A CD  1 
ATOM   1343  N N   . SER A  1 177 ? 146.072 26.199  -26.139 1.00 23.98  ? 174 SER A N   1 
ATOM   1344  C CA  . SER A  1 177 ? 146.916 26.644  -27.227 1.00 24.45  ? 174 SER A CA  1 
ATOM   1345  C C   . SER A  1 177 ? 147.653 25.461  -27.774 1.00 24.88  ? 174 SER A C   1 
ATOM   1346  O O   . SER A  1 177 ? 148.135 24.631  -27.037 1.00 25.58  ? 174 SER A O   1 
ATOM   1347  C CB  . SER A  1 177 ? 147.902 27.714  -26.774 1.00 24.77  ? 174 SER A CB  1 
ATOM   1348  O OG  . SER A  1 177 ? 148.774 28.057  -27.828 1.00 25.67  ? 174 SER A OG  1 
ATOM   1349  N N   . GLU A  1 178 ? 147.721 25.405  -29.087 1.00 27.32  ? 175 GLU A N   1 
ATOM   1350  C CA  . GLU A  1 178 ? 148.379 24.322  -29.810 1.00 29.02  ? 175 GLU A CA  1 
ATOM   1351  C C   . GLU A  1 178 ? 149.935 24.442  -29.790 1.00 30.18  ? 175 GLU A C   1 
ATOM   1352  O O   . GLU A  1 178 ? 150.659 23.522  -30.163 1.00 30.15  ? 175 GLU A O   1 
ATOM   1353  C CB  . GLU A  1 178 ? 147.806 24.232  -31.237 1.00 28.44  ? 175 GLU A CB  1 
ATOM   1354  C CG  . GLU A  1 178 ? 147.866 25.506  -32.066 1.00 30.28  ? 175 GLU A CG  1 
ATOM   1355  C CD  . GLU A  1 178 ? 146.608 26.377  -31.977 1.00 32.87  ? 175 GLU A CD  1 
ATOM   1356  O OE1 . GLU A  1 178 ? 146.057 26.478  -30.871 1.00 36.67  ? 175 GLU A OE1 1 
ATOM   1357  O OE2 . GLU A  1 178 ? 146.166 26.994  -32.981 1.00 32.93  ? 175 GLU A OE2 1 
ATOM   1358  N N   . ARG A  1 179 ? 150.436 25.570  -29.314 1.00 32.37  ? 176 ARG A N   1 
ATOM   1359  C CA  . ARG A  1 179 ? 151.871 25.814  -29.237 1.00 35.19  ? 176 ARG A CA  1 
ATOM   1360  C C   . ARG A  1 179 ? 152.573 25.175  -28.018 1.00 31.66  ? 176 ARG A C   1 
ATOM   1361  O O   . ARG A  1 179 ? 153.769 24.860  -28.097 1.00 30.46  ? 176 ARG A O   1 
ATOM   1362  C CB  . ARG A  1 179 ? 152.105 27.333  -29.297 1.00 40.40  ? 176 ARG A CB  1 
ATOM   1363  C CG  . ARG A  1 179 ? 151.761 27.908  -30.666 1.00 45.41  ? 176 ARG A CG  1 
ATOM   1364  C CD  . ARG A  1 179 ? 151.713 29.417  -30.643 1.00 52.44  ? 176 ARG A CD  1 
ATOM   1365  N NE  . ARG A  1 179 ? 151.029 29.960  -31.817 1.00 59.06  ? 176 ARG A NE  1 
ATOM   1366  C CZ  . ARG A  1 179 ? 150.679 31.240  -31.975 1.00 63.94  ? 176 ARG A CZ  1 
ATOM   1367  N NH1 . ARG A  1 179 ? 150.050 31.610  -33.081 1.00 66.50  ? 176 ARG A NH1 1 
ATOM   1368  N NH2 . ARG A  1 179 ? 150.948 32.160  -31.046 1.00 64.92  ? 176 ARG A NH2 1 
ATOM   1369  N N   . ASP A  1 180 ? 151.828 25.006  -26.915 1.00 29.17  ? 177 ASP A N   1 
ATOM   1370  C CA  . ASP A  1 180 ? 152.324 24.375  -25.684 1.00 27.83  ? 177 ASP A CA  1 
ATOM   1371  C C   . ASP A  1 180 ? 151.230 23.618  -24.916 1.00 27.56  ? 177 ASP A C   1 
ATOM   1372  O O   . ASP A  1 180 ? 150.765 24.063  -23.862 1.00 28.59  ? 177 ASP A O   1 
ATOM   1373  C CB  . ASP A  1 180 ? 153.015 25.395  -24.769 1.00 27.74  ? 177 ASP A CB  1 
ATOM   1374  C CG  . ASP A  1 180 ? 152.165 26.637  -24.465 1.00 27.21  ? 177 ASP A CG  1 
ATOM   1375  O OD1 . ASP A  1 180 ? 150.961 26.685  -24.828 1.00 25.59  ? 177 ASP A OD1 1 
ATOM   1376  O OD2 . ASP A  1 180 ? 152.742 27.568  -23.841 1.00 26.09  ? 177 ASP A OD2 1 
ATOM   1377  N N   . PRO A  1 181 ? 150.828 22.453  -25.438 1.00 26.42  ? 178 PRO A N   1 
ATOM   1378  C CA  . PRO A  1 181 ? 149.705 21.693  -24.907 1.00 25.85  ? 178 PRO A CA  1 
ATOM   1379  C C   . PRO A  1 181 ? 150.006 20.635  -23.857 1.00 24.79  ? 178 PRO A C   1 
ATOM   1380  O O   . PRO A  1 181 ? 149.077 20.125  -23.237 1.00 26.04  ? 178 PRO A O   1 
ATOM   1381  C CB  . PRO A  1 181 ? 149.162 21.007  -26.156 1.00 26.65  ? 178 PRO A CB  1 
ATOM   1382  C CG  . PRO A  1 181 ? 150.389 20.728  -26.942 1.00 27.18  ? 178 PRO A CG  1 
ATOM   1383  C CD  . PRO A  1 181 ? 151.274 21.917  -26.735 1.00 27.05  ? 178 PRO A CD  1 
ATOM   1384  N N   . SER A  1 182 ? 151.262 20.275  -23.669 1.00 24.00  ? 179 SER A N   1 
ATOM   1385  C CA  . SER A  1 182 ? 151.592 19.161  -22.769 1.00 22.91  ? 179 SER A CA  1 
ATOM   1386  C C   . SER A  1 182 ? 151.335 19.483  -21.286 1.00 22.24  ? 179 SER A C   1 
ATOM   1387  O O   . SER A  1 182 ? 150.748 18.677  -20.580 1.00 21.55  ? 179 SER A O   1 
ATOM   1388  C CB  . SER A  1 182 ? 153.037 18.670  -22.993 1.00 22.29  ? 179 SER A CB  1 
ATOM   1389  O OG  . SER A  1 182 ? 153.208 18.097  -24.288 1.00 21.06  ? 179 SER A OG  1 
ATOM   1390  N N   . SER A  1 183 ? 151.768 20.647  -20.816 1.00 22.07  ? 180 SER A N   1 
ATOM   1391  C CA  . SER A  1 183 ? 151.500 21.026  -19.425 1.00 22.72  ? 180 SER A CA  1 
ATOM   1392  C C   . SER A  1 183 ? 149.995 20.949  -19.099 1.00 23.18  ? 180 SER A C   1 
ATOM   1393  O O   . SER A  1 183 ? 149.578 20.405  -18.073 1.00 23.20  ? 180 SER A O   1 
ATOM   1394  C CB  . SER A  1 183 ? 152.028 22.443  -19.137 1.00 22.91  ? 180 SER A CB  1 
ATOM   1395  O OG  . SER A  1 183 ? 151.816 23.326  -20.234 1.00 22.96  ? 180 SER A OG  1 
ATOM   1396  N N   . THR A  1 184 ? 149.199 21.491  -20.011 1.00 22.77  ? 181 THR A N   1 
ATOM   1397  C CA  . THR A  1 184 ? 147.768 21.635  -19.846 1.00 22.40  ? 181 THR A CA  1 
ATOM   1398  C C   . THR A  1 184 ? 147.013 20.309  -19.762 1.00 22.89  ? 181 THR A C   1 
ATOM   1399  O O   . THR A  1 184 ? 146.003 20.214  -19.066 1.00 23.07  ? 181 THR A O   1 
ATOM   1400  C CB  . THR A  1 184 ? 147.219 22.427  -21.032 1.00 22.72  ? 181 THR A CB  1 
ATOM   1401  O OG1 . THR A  1 184 ? 148.089 23.535  -21.310 1.00 23.44  ? 181 THR A OG1 1 
ATOM   1402  C CG2 . THR A  1 184 ? 145.833 22.936  -20.739 1.00 23.31  ? 181 THR A CG2 1 
ATOM   1403  N N   . LEU A  1 185 ? 147.477 19.316  -20.523 1.00 23.37  ? 182 LEU A N   1 
ATOM   1404  C CA  . LEU A  1 185 ? 146.928 17.974  -20.502 1.00 22.55  ? 182 LEU A CA  1 
ATOM   1405  C C   . LEU A  1 185 ? 147.380 17.306  -19.236 1.00 21.80  ? 182 LEU A C   1 
ATOM   1406  O O   . LEU A  1 185 ? 146.608 16.645  -18.561 1.00 20.71  ? 182 LEU A O   1 
ATOM   1407  C CB  . LEU A  1 185 ? 147.437 17.182  -21.697 1.00 23.90  ? 182 LEU A CB  1 
ATOM   1408  C CG  . LEU A  1 185 ? 146.680 15.887  -21.995 1.00 25.25  ? 182 LEU A CG  1 
ATOM   1409  C CD1 . LEU A  1 185 ? 145.266 16.192  -22.501 1.00 25.82  ? 182 LEU A CD1 1 
ATOM   1410  C CD2 . LEU A  1 185 ? 147.467 15.065  -23.009 1.00 25.19  ? 182 LEU A CD2 1 
ATOM   1411  N N   . TYR A  1 186 ? 148.643 17.514  -18.909 1.00 21.71  ? 183 TYR A N   1 
ATOM   1412  C CA  . TYR A  1 186 ? 149.218 16.937  -17.725 1.00 22.49  ? 183 TYR A CA  1 
ATOM   1413  C C   . TYR A  1 186 ? 148.413 17.298  -16.498 1.00 23.23  ? 183 TYR A C   1 
ATOM   1414  O O   . TYR A  1 186 ? 148.166 16.445  -15.654 1.00 23.62  ? 183 TYR A O   1 
ATOM   1415  C CB  . TYR A  1 186 ? 150.657 17.401  -17.542 1.00 22.69  ? 183 TYR A CB  1 
ATOM   1416  C CG  . TYR A  1 186 ? 151.341 16.676  -16.430 1.00 22.64  ? 183 TYR A CG  1 
ATOM   1417  C CD1 . TYR A  1 186 ? 151.999 15.472  -16.660 1.00 22.79  ? 183 TYR A CD1 1 
ATOM   1418  C CD2 . TYR A  1 186 ? 151.310 17.176  -15.139 1.00 22.58  ? 183 TYR A CD2 1 
ATOM   1419  C CE1 . TYR A  1 186 ? 152.627 14.797  -15.628 1.00 23.20  ? 183 TYR A CE1 1 
ATOM   1420  C CE2 . TYR A  1 186 ? 151.931 16.511  -14.103 1.00 22.89  ? 183 TYR A CE2 1 
ATOM   1421  C CZ  . TYR A  1 186 ? 152.587 15.325  -14.354 1.00 22.91  ? 183 TYR A CZ  1 
ATOM   1422  O OH  . TYR A  1 186 ? 153.180 14.668  -13.324 1.00 22.58  ? 183 TYR A OH  1 
ATOM   1423  N N   . ILE A  1 187 ? 148.023 18.566  -16.388 1.00 24.26  ? 184 ILE A N   1 
ATOM   1424  C CA  . ILE A  1 187 ? 147.252 19.010  -15.218 1.00 24.59  ? 184 ILE A CA  1 
ATOM   1425  C C   . ILE A  1 187 ? 145.822 18.513  -15.261 1.00 23.83  ? 184 ILE A C   1 
ATOM   1426  O O   . ILE A  1 187 ? 145.268 18.196  -14.225 1.00 25.33  ? 184 ILE A O   1 
ATOM   1427  C CB  . ILE A  1 187 ? 147.287 20.540  -14.961 1.00 24.75  ? 184 ILE A CB  1 
ATOM   1428  C CG1 . ILE A  1 187 ? 146.600 21.335  -16.087 1.00 25.72  ? 184 ILE A CG1 1 
ATOM   1429  C CG2 . ILE A  1 187 ? 148.718 20.981  -14.698 1.00 23.65  ? 184 ILE A CG2 1 
ATOM   1430  C CD1 . ILE A  1 187 ? 146.504 22.829  -15.818 1.00 25.65  ? 184 ILE A CD1 1 
ATOM   1431  N N   . ALA A  1 188 ? 145.241 18.422  -16.448 1.00 22.81  ? 185 ALA A N   1 
ATOM   1432  C CA  . ALA A  1 188 ? 143.906 17.848  -16.603 1.00 23.08  ? 185 ALA A CA  1 
ATOM   1433  C C   . ALA A  1 188 ? 143.844 16.378  -16.219 1.00 24.19  ? 185 ALA A C   1 
ATOM   1434  O O   . ALA A  1 188 ? 142.807 15.893  -15.769 1.00 24.29  ? 185 ALA A O   1 
ATOM   1435  C CB  . ALA A  1 188 ? 143.409 18.035  -18.018 1.00 22.41  ? 185 ALA A CB  1 
ATOM   1436  N N   . GLN A  1 189 ? 144.953 15.668  -16.394 1.00 25.99  ? 186 GLN A N   1 
ATOM   1437  C CA  . GLN A  1 189 ? 144.985 14.240  -16.084 1.00 26.92  ? 186 GLN A CA  1 
ATOM   1438  C C   . GLN A  1 189 ? 145.141 13.999  -14.607 1.00 25.25  ? 186 GLN A C   1 
ATOM   1439  O O   . GLN A  1 189 ? 144.786 12.932  -14.135 1.00 26.80  ? 186 GLN A O   1 
ATOM   1440  C CB  . GLN A  1 189 ? 146.085 13.512  -16.854 1.00 28.34  ? 186 GLN A CB  1 
ATOM   1441  C CG  . GLN A  1 189 ? 146.035 13.785  -18.347 1.00 30.06  ? 186 GLN A CG  1 
ATOM   1442  C CD  . GLN A  1 189 ? 146.959 12.901  -19.141 1.00 31.35  ? 186 GLN A CD  1 
ATOM   1443  O OE1 . GLN A  1 189 ? 146.560 11.813  -19.534 1.00 32.86  ? 186 GLN A OE1 1 
ATOM   1444  N NE2 . GLN A  1 189 ? 148.199 13.360  -19.392 1.00 31.52  ? 186 GLN A NE2 1 
ATOM   1445  N N   . LEU A  1 190 ? 145.653 14.977  -13.874 1.00 23.79  ? 187 LEU A N   1 
ATOM   1446  C CA  . LEU A  1 190 ? 145.752 14.849  -12.422 1.00 24.37  ? 187 LEU A CA  1 
ATOM   1447  C C   . LEU A  1 190 ? 144.381 14.914  -11.788 1.00 26.35  ? 187 LEU A C   1 
ATOM   1448  O O   . LEU A  1 190 ? 144.169 14.468  -10.665 1.00 26.03  ? 187 LEU A O   1 
ATOM   1449  C CB  . LEU A  1 190 ? 146.626 15.952  -11.843 1.00 23.54  ? 187 LEU A CB  1 
ATOM   1450  C CG  . LEU A  1 190 ? 148.103 15.862  -12.213 1.00 22.78  ? 187 LEU A CG  1 
ATOM   1451  C CD1 . LEU A  1 190 ? 148.853 17.099  -11.734 1.00 21.83  ? 187 LEU A CD1 1 
ATOM   1452  C CD2 . LEU A  1 190 ? 148.707 14.571  -11.656 1.00 22.73  ? 187 LEU A CD2 1 
ATOM   1453  N N   . LEU A  1 191 ? 143.441 15.470  -12.538 1.00 28.64  ? 188 LEU A N   1 
ATOM   1454  C CA  . LEU A  1 191 ? 142.096 15.680  -12.060 1.00 28.97  ? 188 LEU A CA  1 
ATOM   1455  C C   . LEU A  1 191 ? 141.325 14.379  -11.845 1.00 30.02  ? 188 LEU A C   1 
ATOM   1456  O O   . LEU A  1 191 ? 140.553 14.274  -10.903 1.00 29.87  ? 188 LEU A O   1 
ATOM   1457  C CB  . LEU A  1 191 ? 141.382 16.613  -13.018 1.00 28.44  ? 188 LEU A CB  1 
ATOM   1458  C CG  . LEU A  1 191 ? 140.362 17.554  -12.427 1.00 29.52  ? 188 LEU A CG  1 
ATOM   1459  C CD1 . LEU A  1 191 ? 140.819 18.320  -11.191 1.00 29.81  ? 188 LEU A CD1 1 
ATOM   1460  C CD2 . LEU A  1 191 ? 139.979 18.530  -13.532 1.00 30.18  ? 188 LEU A CD2 1 
ATOM   1461  N N   . GLN A  1 192 ? 141.556 13.380  -12.685 1.00 33.22  ? 189 GLN A N   1 
ATOM   1462  C CA  . GLN A  1 192 ? 140.940 12.052  -12.474 1.00 37.34  ? 189 GLN A CA  1 
ATOM   1463  C C   . GLN A  1 192 ? 141.388 11.404  -11.166 1.00 35.29  ? 189 GLN A C   1 
ATOM   1464  O O   . GLN A  1 192 ? 140.564 10.837  -10.440 1.00 31.98  ? 189 GLN A O   1 
ATOM   1465  C CB  . GLN A  1 192 ? 141.224 11.090  -13.640 1.00 43.00  ? 189 GLN A CB  1 
ATOM   1466  C CG  . GLN A  1 192 ? 140.152 11.079  -14.724 1.00 49.43  ? 189 GLN A CG  1 
ATOM   1467  C CD  . GLN A  1 192 ? 139.970 12.432  -15.443 1.00 53.23  ? 189 GLN A CD  1 
ATOM   1468  O OE1 . GLN A  1 192 ? 140.960 13.136  -15.769 1.00 48.44  ? 189 GLN A OE1 1 
ATOM   1469  N NE2 . GLN A  1 192 ? 138.692 12.794  -15.713 1.00 54.33  ? 189 GLN A NE2 1 
ATOM   1470  N N   . GLU A  1 193 ? 142.690 11.496  -10.886 1.00 34.50  ? 190 GLU A N   1 
ATOM   1471  C CA  . GLU A  1 193 ? 143.278 10.985  -9.642  1.00 33.14  ? 190 GLU A CA  1 
ATOM   1472  C C   . GLU A  1 193 ? 142.775 11.742  -8.411  1.00 30.85  ? 190 GLU A C   1 
ATOM   1473  O O   . GLU A  1 193 ? 142.682 11.172  -7.321  1.00 29.68  ? 190 GLU A O   1 
ATOM   1474  C CB  . GLU A  1 193 ? 144.803 11.085  -9.706  1.00 35.89  ? 190 GLU A CB  1 
ATOM   1475  C CG  . GLU A  1 193 ? 145.523 10.404  -8.545  1.00 37.97  ? 190 GLU A CG  1 
ATOM   1476  C CD  . GLU A  1 193 ? 147.006 10.697  -8.523  1.00 40.01  ? 190 GLU A CD  1 
ATOM   1477  O OE1 . GLU A  1 193 ? 147.614 10.426  -7.462  1.00 40.70  ? 190 GLU A OE1 1 
ATOM   1478  O OE2 . GLU A  1 193 ? 147.542 11.200  -9.547  1.00 39.09  ? 190 GLU A OE2 1 
ATOM   1479  N N   . ALA A  1 194 ? 142.451 13.025  -8.586  1.00 28.53  ? 191 ALA A N   1 
ATOM   1480  C CA  . ALA A  1 194 ? 141.860 13.825  -7.511  1.00 26.67  ? 191 ALA A CA  1 
ATOM   1481  C C   . ALA A  1 194 ? 140.430 13.445  -7.233  1.00 24.92  ? 191 ALA A C   1 
ATOM   1482  O O   . ALA A  1 194 ? 139.821 13.986  -6.333  1.00 24.20  ? 191 ALA A O   1 
ATOM   1483  C CB  . ALA A  1 194 ? 141.922 15.301  -7.847  1.00 27.85  ? 191 ALA A CB  1 
ATOM   1484  N N   . GLY A  1 195 ? 139.878 12.542  -8.035  1.00 24.40  ? 192 GLY A N   1 
ATOM   1485  C CA  . GLY A  1 195 ? 138.555 11.964  -7.779  1.00 23.39  ? 192 GLY A CA  1 
ATOM   1486  C C   . GLY A  1 195 ? 137.428 12.534  -8.615  1.00 21.79  ? 192 GLY A C   1 
ATOM   1487  O O   . GLY A  1 195 ? 136.260 12.390  -8.267  1.00 20.65  ? 192 GLY A O   1 
ATOM   1488  N N   . LEU A  1 196 ? 137.769 13.179  -9.722  1.00 20.89  ? 193 LEU A N   1 
ATOM   1489  C CA  . LEU A  1 196 ? 136.746 13.711  -10.595 1.00 20.46  ? 193 LEU A CA  1 
ATOM   1490  C C   . LEU A  1 196 ? 136.147 12.585  -11.428 1.00 19.66  ? 193 LEU A C   1 
ATOM   1491  O O   . LEU A  1 196 ? 136.885 11.744  -11.952 1.00 21.13  ? 193 LEU A O   1 
ATOM   1492  C CB  . LEU A  1 196 ? 137.290 14.825  -11.498 1.00 20.37  ? 193 LEU A CB  1 
ATOM   1493  C CG  . LEU A  1 196 ? 136.196 15.680  -12.173 1.00 20.40  ? 193 LEU A CG  1 
ATOM   1494  C CD1 . LEU A  1 196 ? 135.409 16.509  -11.164 1.00 20.11  ? 193 LEU A CD1 1 
ATOM   1495  C CD2 . LEU A  1 196 ? 136.788 16.596  -13.235 1.00 20.57  ? 193 LEU A CD2 1 
ATOM   1496  N N   . PRO A  1 197 ? 134.817 12.556  -11.549 1.00 18.44  ? 194 PRO A N   1 
ATOM   1497  C CA  . PRO A  1 197 ? 134.217 11.598  -12.461 1.00 18.74  ? 194 PRO A CA  1 
ATOM   1498  C C   . PRO A  1 197 ? 134.553 11.857  -13.926 1.00 19.61  ? 194 PRO A C   1 
ATOM   1499  O O   . PRO A  1 197 ? 134.649 13.025  -14.377 1.00 19.04  ? 194 PRO A O   1 
ATOM   1500  C CB  . PRO A  1 197 ? 132.716 11.756  -12.220 1.00 18.52  ? 194 PRO A CB  1 
ATOM   1501  C CG  . PRO A  1 197 ? 132.614 12.348  -10.872 1.00 18.55  ? 194 PRO A CG  1 
ATOM   1502  C CD  . PRO A  1 197 ? 133.812 13.217  -10.713 1.00 18.43  ? 194 PRO A CD  1 
ATOM   1503  N N   . ASP A  1 198 ? 134.719 10.746  -14.647 1.00 20.75  ? 195 ASP A N   1 
ATOM   1504  C CA  . ASP A  1 198 ? 135.059 10.753  -16.069 1.00 20.98  ? 195 ASP A CA  1 
ATOM   1505  C C   . ASP A  1 198 ? 134.046 11.569  -16.814 1.00 20.86  ? 195 ASP A C   1 
ATOM   1506  O O   . ASP A  1 198 ? 132.856 11.451  -16.553 1.00 22.08  ? 195 ASP A O   1 
ATOM   1507  C CB  . ASP A  1 198 ? 135.065 9.341   -16.645 1.00 20.93  ? 195 ASP A CB  1 
ATOM   1508  C CG  . ASP A  1 198 ? 136.147 8.491   -16.059 1.00 21.87  ? 195 ASP A CG  1 
ATOM   1509  O OD1 . ASP A  1 198 ? 137.004 9.059   -15.307 1.00 23.64  ? 195 ASP A OD1 1 
ATOM   1510  O OD2 . ASP A  1 198 ? 136.123 7.266   -16.339 1.00 20.86  ? 195 ASP A OD2 1 
ATOM   1511  N N   . GLY A  1 199 ? 134.536 12.434  -17.696 1.00 20.37  ? 196 GLY A N   1 
ATOM   1512  C CA  . GLY A  1 199 ? 133.687 13.178  -18.597 1.00 19.91  ? 196 GLY A CA  1 
ATOM   1513  C C   . GLY A  1 199 ? 133.432 14.586  -18.147 1.00 19.38  ? 196 GLY A C   1 
ATOM   1514  O O   . GLY A  1 199 ? 133.129 15.438  -18.980 1.00 19.30  ? 196 GLY A O   1 
ATOM   1515  N N   . VAL A  1 200 ? 133.559 14.835  -16.846 1.00 19.12  ? 197 VAL A N   1 
ATOM   1516  C CA  . VAL A  1 200 ? 133.287 16.167  -16.284 1.00 18.89  ? 197 VAL A CA  1 
ATOM   1517  C C   . VAL A  1 200 ? 134.311 17.175  -16.773 1.00 18.15  ? 197 VAL A C   1 
ATOM   1518  O O   . VAL A  1 200 ? 133.967 18.322  -17.006 1.00 17.82  ? 197 VAL A O   1 
ATOM   1519  C CB  . VAL A  1 200 ? 133.273 16.159  -14.731 1.00 19.48  ? 197 VAL A CB  1 
ATOM   1520  C CG1 . VAL A  1 200 ? 133.103 17.567  -14.165 1.00 19.53  ? 197 VAL A CG1 1 
ATOM   1521  C CG2 . VAL A  1 200 ? 132.164 15.254  -14.202 1.00 19.49  ? 197 VAL A CG2 1 
ATOM   1522  N N   . MET A  1 201 ? 135.568 16.748  -16.896 1.00 17.82  ? 198 MET A N   1 
ATOM   1523  C CA  . MET A  1 201 ? 136.600 17.570  -17.516 1.00 17.22  ? 198 MET A CA  1 
ATOM   1524  C C   . MET A  1 201 ? 137.076 16.894  -18.806 1.00 17.74  ? 198 MET A C   1 
ATOM   1525  O O   . MET A  1 201 ? 137.288 15.690  -18.856 1.00 17.24  ? 198 MET A O   1 
ATOM   1526  C CB  . MET A  1 201 ? 137.761 17.755  -16.553 1.00 16.63  ? 198 MET A CB  1 
ATOM   1527  C CG  . MET A  1 201 ? 138.954 18.488  -17.123 1.00 16.01  ? 198 MET A CG  1 
ATOM   1528  S SD  . MET A  1 201 ? 138.425 20.095  -17.649 1.00 14.98  ? 198 MET A SD  1 
ATOM   1529  C CE  . MET A  1 201 ? 140.006 20.877  -17.942 1.00 15.78  ? 198 MET A CE  1 
ATOM   1530  N N   . ASN A  1 202 ? 137.246 17.693  -19.846 1.00 18.38  ? 199 ASN A N   1 
ATOM   1531  C CA  . ASN A  1 202 ? 137.743 17.211  -21.126 1.00 19.01  ? 199 ASN A CA  1 
ATOM   1532  C C   . ASN A  1 202 ? 138.751 18.210  -21.701 1.00 19.63  ? 199 ASN A C   1 
ATOM   1533  O O   . ASN A  1 202 ? 138.605 19.419  -21.512 1.00 20.61  ? 199 ASN A O   1 
ATOM   1534  C CB  . ASN A  1 202 ? 136.583 17.029  -22.090 1.00 19.26  ? 199 ASN A CB  1 
ATOM   1535  C CG  . ASN A  1 202 ? 135.580 15.998  -21.608 1.00 19.38  ? 199 ASN A CG  1 
ATOM   1536  O OD1 . ASN A  1 202 ? 135.849 14.821  -21.675 1.00 20.58  ? 199 ASN A OD1 1 
ATOM   1537  N ND2 . ASN A  1 202 ? 134.419 16.436  -21.137 1.00 19.15  ? 199 ASN A ND2 1 
ATOM   1538  N N   . VAL A  1 203 ? 139.782 17.703  -22.372 1.00 19.48  ? 200 VAL A N   1 
ATOM   1539  C CA  . VAL A  1 203 ? 140.757 18.552  -23.061 1.00 19.48  ? 200 VAL A CA  1 
ATOM   1540  C C   . VAL A  1 203 ? 140.758 18.131  -24.510 1.00 19.75  ? 200 VAL A C   1 
ATOM   1541  O O   . VAL A  1 203 ? 140.943 16.974  -24.829 1.00 20.80  ? 200 VAL A O   1 
ATOM   1542  C CB  . VAL A  1 203 ? 142.191 18.449  -22.482 1.00 18.80  ? 200 VAL A CB  1 
ATOM   1543  C CG1 . VAL A  1 203 ? 143.136 19.397  -23.223 1.00 18.25  ? 200 VAL A CG1 1 
ATOM   1544  C CG2 . VAL A  1 203 ? 142.178 18.788  -21.009 1.00 19.04  ? 200 VAL A CG2 1 
ATOM   1545  N N   . VAL A  1 204 ? 140.557 19.071  -25.401 1.00 20.35  ? 201 VAL A N   1 
ATOM   1546  C CA  . VAL A  1 204 ? 140.451 18.729  -26.806 1.00 20.89  ? 201 VAL A CA  1 
ATOM   1547  C C   . VAL A  1 204 ? 141.368 19.695  -27.556 1.00 22.23  ? 201 VAL A C   1 
ATOM   1548  O O   . VAL A  1 204 ? 141.118 20.890  -27.627 1.00 23.01  ? 201 VAL A O   1 
ATOM   1549  C CB  . VAL A  1 204 ? 138.959 18.710  -27.213 1.00 20.09  ? 201 VAL A CB  1 
ATOM   1550  C CG1 . VAL A  1 204 ? 138.480 20.044  -27.754 1.00 19.61  ? 201 VAL A CG1 1 
ATOM   1551  C CG2 . VAL A  1 204 ? 138.680 17.572  -28.167 1.00 20.30  ? 201 VAL A CG2 1 
ATOM   1552  N N   . ASN A  1 205 ? 142.514 19.188  -27.989 1.00 24.30  ? 202 ASN A N   1 
ATOM   1553  C CA  . ASN A  1 205 ? 143.517 19.992  -28.725 1.00 24.93  ? 202 ASN A CA  1 
ATOM   1554  C C   . ASN A  1 205 ? 143.150 20.247  -30.180 1.00 24.96  ? 202 ASN A C   1 
ATOM   1555  O O   . ASN A  1 205 ? 142.546 19.392  -30.843 1.00 25.53  ? 202 ASN A O   1 
ATOM   1556  C CB  . ASN A  1 205 ? 144.877 19.321  -28.664 1.00 24.30  ? 202 ASN A CB  1 
ATOM   1557  C CG  . ASN A  1 205 ? 145.538 19.536  -27.354 1.00 25.07  ? 202 ASN A CG  1 
ATOM   1558  O OD1 . ASN A  1 205 ? 145.879 20.665  -27.033 1.00 28.03  ? 202 ASN A OD1 1 
ATOM   1559  N ND2 . ASN A  1 205 ? 145.728 18.473  -26.582 1.00 25.64  ? 202 ASN A ND2 1 
ATOM   1560  N N   . GLY A  1 206 ? 143.533 21.412  -30.682 1.00 24.02  ? 203 GLY A N   1 
ATOM   1561  C CA  . GLY A  1 206 ? 143.197 21.746  -32.040 1.00 24.18  ? 203 GLY A CA  1 
ATOM   1562  C C   . GLY A  1 206 ? 143.464 23.193  -32.377 1.00 25.94  ? 203 GLY A C   1 
ATOM   1563  O O   . GLY A  1 206 ? 144.221 23.905  -31.697 1.00 25.81  ? 203 GLY A O   1 
ATOM   1564  N N   . ASP A  1 207 ? 142.825 23.610  -33.459 1.00 27.83  ? 204 ASP A N   1 
ATOM   1565  C CA  . ASP A  1 207 ? 142.932 24.948  -33.985 1.00 28.19  ? 204 ASP A CA  1 
ATOM   1566  C C   . ASP A  1 207 ? 141.508 25.463  -34.267 1.00 28.32  ? 204 ASP A C   1 
ATOM   1567  O O   . ASP A  1 207 ? 140.523 24.929  -33.742 1.00 27.04  ? 204 ASP A O   1 
ATOM   1568  C CB  . ASP A  1 207 ? 143.813 24.904  -35.240 1.00 28.66  ? 204 ASP A CB  1 
ATOM   1569  C CG  . ASP A  1 207 ? 143.126 24.263  -36.436 1.00 29.89  ? 204 ASP A CG  1 
ATOM   1570  O OD1 . ASP A  1 207 ? 142.173 23.465  -36.297 1.00 28.81  ? 204 ASP A OD1 1 
ATOM   1571  O OD2 . ASP A  1 207 ? 143.568 24.573  -37.553 1.00 33.91  ? 204 ASP A OD2 1 
ATOM   1572  N N   . LYS A  1 208 ? 141.397 26.470  -35.122 1.00 29.25  ? 205 LYS A N   1 
ATOM   1573  C CA  . LYS A  1 208 ? 140.110 27.110  -35.401 1.00 30.53  ? 205 LYS A CA  1 
ATOM   1574  C C   . LYS A  1 208 ? 138.947 26.133  -35.528 1.00 28.54  ? 205 LYS A C   1 
ATOM   1575  O O   . LYS A  1 208 ? 137.858 26.437  -35.084 1.00 27.26  ? 205 LYS A O   1 
ATOM   1576  C CB  . LYS A  1 208 ? 140.190 27.959  -36.677 1.00 32.18  ? 205 LYS A CB  1 
ATOM   1577  C CG  . LYS A  1 208 ? 139.021 28.899  -36.844 1.00 34.29  ? 205 LYS A CG  1 
ATOM   1578  C CD  . LYS A  1 208 ? 138.774 29.301  -38.284 1.00 37.20  ? 205 LYS A CD  1 
ATOM   1579  C CE  . LYS A  1 208 ? 137.585 30.253  -38.384 1.00 39.45  ? 205 LYS A CE  1 
ATOM   1580  N NZ  . LYS A  1 208 ? 137.727 31.489  -37.545 1.00 41.33  ? 205 LYS A NZ  1 
ATOM   1581  N N   . GLU A  1 209 ? 139.179 24.981  -36.147 1.00 28.34  ? 206 GLU A N   1 
ATOM   1582  C CA  . GLU A  1 209 ? 138.101 24.011  -36.382 1.00 28.40  ? 206 GLU A CA  1 
ATOM   1583  C C   . GLU A  1 209 ? 137.484 23.477  -35.075 1.00 26.09  ? 206 GLU A C   1 
ATOM   1584  O O   . GLU A  1 209 ? 136.268 23.254  -34.998 1.00 23.36  ? 206 GLU A O   1 
ATOM   1585  C CB  . GLU A  1 209 ? 138.586 22.854  -37.273 1.00 29.71  ? 206 GLU A CB  1 
ATOM   1586  C CG  . GLU A  1 209 ? 137.470 21.971  -37.829 1.00 31.35  ? 206 GLU A CG  1 
ATOM   1587  C CD  . GLU A  1 209 ? 137.970 20.623  -38.360 1.00 34.92  ? 206 GLU A CD  1 
ATOM   1588  O OE1 . GLU A  1 209 ? 139.048 20.599  -39.030 1.00 39.08  ? 206 GLU A OE1 1 
ATOM   1589  O OE2 . GLU A  1 209 ? 137.278 19.590  -38.113 1.00 32.63  ? 206 GLU A OE2 1 
ATOM   1590  N N   . ALA A  1 210 ? 138.321 23.269  -34.064 1.00 24.33  ? 207 ALA A N   1 
ATOM   1591  C CA  . ALA A  1 210 ? 137.832 22.767  -32.793 1.00 23.55  ? 207 ALA A CA  1 
ATOM   1592  C C   . ALA A  1 210 ? 137.114 23.897  -32.074 1.00 22.57  ? 207 ALA A C   1 
ATOM   1593  O O   . ALA A  1 210 ? 136.098 23.690  -31.418 1.00 21.92  ? 207 ALA A O   1 
ATOM   1594  C CB  . ALA A  1 210 ? 138.971 22.233  -31.944 1.00 23.99  ? 207 ALA A CB  1 
ATOM   1595  N N   . VAL A  1 211 ? 137.644 25.103  -32.213 1.00 21.82  ? 208 VAL A N   1 
ATOM   1596  C CA  . VAL A  1 211 ? 137.017 26.272  -31.617 1.00 21.69  ? 208 VAL A CA  1 
ATOM   1597  C C   . VAL A  1 211 ? 135.608 26.448  -32.161 1.00 22.08  ? 208 VAL A C   1 
ATOM   1598  O O   . VAL A  1 211 ? 134.666 26.537  -31.393 1.00 21.45  ? 208 VAL A O   1 
ATOM   1599  C CB  . VAL A  1 211 ? 137.841 27.553  -31.848 1.00 21.52  ? 208 VAL A CB  1 
ATOM   1600  C CG1 . VAL A  1 211 ? 137.077 28.785  -31.391 1.00 21.70  ? 208 VAL A CG1 1 
ATOM   1601  C CG2 . VAL A  1 211 ? 139.155 27.461  -31.080 1.00 21.74  ? 208 VAL A CG2 1 
ATOM   1602  N N   . ASP A  1 212 ? 135.479 26.475  -33.484 1.00 23.43  ? 209 ASP A N   1 
ATOM   1603  C CA  . ASP A  1 212 ? 134.177 26.647  -34.145 1.00 24.18  ? 209 ASP A CA  1 
ATOM   1604  C C   . ASP A  1 212 ? 133.192 25.496  -33.773 1.00 23.83  ? 209 ASP A C   1 
ATOM   1605  O O   . ASP A  1 212 ? 131.976 25.718  -33.677 1.00 23.16  ? 209 ASP A O   1 
ATOM   1606  C CB  . ASP A  1 212 ? 134.344 26.827  -35.681 1.00 25.59  ? 209 ASP A CB  1 
ATOM   1607  C CG  . ASP A  1 212 ? 134.860 28.247  -36.089 1.00 28.73  ? 209 ASP A CG  1 
ATOM   1608  O OD1 . ASP A  1 212 ? 134.799 29.196  -35.284 1.00 33.12  ? 209 ASP A OD1 1 
ATOM   1609  O OD2 . ASP A  1 212 ? 135.334 28.448  -37.230 1.00 31.05  ? 209 ASP A OD2 1 
ATOM   1610  N N   . ALA A  1 213 ? 133.701 24.292  -33.511 1.00 23.67  ? 210 ALA A N   1 
ATOM   1611  C CA  . ALA A  1 213 ? 132.815 23.182  -33.114 1.00 24.00  ? 210 ALA A CA  1 
ATOM   1612  C C   . ALA A  1 213 ? 132.146 23.503  -31.794 1.00 24.30  ? 210 ALA A C   1 
ATOM   1613  O O   . ALA A  1 213 ? 130.929 23.385  -31.665 1.00 24.83  ? 210 ALA A O   1 
ATOM   1614  C CB  . ALA A  1 213 ? 133.564 21.864  -33.006 1.00 23.95  ? 210 ALA A CB  1 
ATOM   1615  N N   . LEU A  1 214 ? 132.949 23.924  -30.821 1.00 23.63  ? 211 LEU A N   1 
ATOM   1616  C CA  . LEU A  1 214 ? 132.429 24.354  -29.520 1.00 23.23  ? 211 LEU A CA  1 
ATOM   1617  C C   . LEU A  1 214 ? 131.354 25.488  -29.642 1.00 23.82  ? 211 LEU A C   1 
ATOM   1618  O O   . LEU A  1 214 ? 130.224 25.386  -29.090 1.00 23.51  ? 211 LEU A O   1 
ATOM   1619  C CB  . LEU A  1 214 ? 133.580 24.821  -28.624 1.00 22.29  ? 211 LEU A CB  1 
ATOM   1620  C CG  . LEU A  1 214 ? 134.632 23.775  -28.258 1.00 21.75  ? 211 LEU A CG  1 
ATOM   1621  C CD1 . LEU A  1 214 ? 135.864 24.453  -27.676 1.00 21.37  ? 211 LEU A CD1 1 
ATOM   1622  C CD2 . LEU A  1 214 ? 134.067 22.750  -27.290 1.00 21.59  ? 211 LEU A CD2 1 
ATOM   1623  N N   . LEU A  1 215 ? 131.700 26.538  -30.388 1.00 22.22  ? 212 LEU A N   1 
ATOM   1624  C CA  . LEU A  1 215 ? 130.818 27.692  -30.557 1.00 21.43  ? 212 LEU A CA  1 
ATOM   1625  C C   . LEU A  1 215 ? 129.450 27.345  -31.190 1.00 21.71  ? 212 LEU A C   1 
ATOM   1626  O O   . LEU A  1 215 ? 128.415 27.935  -30.856 1.00 18.95  ? 212 LEU A O   1 
ATOM   1627  C CB  . LEU A  1 215 ? 131.524 28.763  -31.383 1.00 20.79  ? 212 LEU A CB  1 
ATOM   1628  C CG  . LEU A  1 215 ? 132.791 29.340  -30.752 1.00 20.63  ? 212 LEU A CG  1 
ATOM   1629  C CD1 . LEU A  1 215 ? 133.534 30.226  -31.733 1.00 20.94  ? 212 LEU A CD1 1 
ATOM   1630  C CD2 . LEU A  1 215 ? 132.485 30.111  -29.494 1.00 20.41  ? 212 LEU A CD2 1 
ATOM   1631  N N   . HIS A  1 216 ? 129.452 26.369  -32.092 1.00 23.31  ? 213 HIS A N   1 
ATOM   1632  C CA  . HIS A  1 216 ? 128.260 26.050  -32.879 1.00 23.22  ? 213 HIS A CA  1 
ATOM   1633  C C   . HIS A  1 216 ? 127.434 24.881  -32.339 1.00 23.69  ? 213 HIS A C   1 
ATOM   1634  O O   . HIS A  1 216 ? 126.279 24.736  -32.710 1.00 25.52  ? 213 HIS A O   1 
ATOM   1635  C CB  . HIS A  1 216 ? 128.673 25.840  -34.329 1.00 22.70  ? 213 HIS A CB  1 
ATOM   1636  C CG  . HIS A  1 216 ? 129.103 27.101  -35.014 1.00 22.45  ? 213 HIS A CG  1 
ATOM   1637  N ND1 . HIS A  1 216 ? 130.353 27.652  -34.852 1.00 22.11  ? 213 HIS A ND1 1 
ATOM   1638  C CD2 . HIS A  1 216 ? 128.437 27.929  -35.853 1.00 23.11  ? 213 HIS A CD2 1 
ATOM   1639  C CE1 . HIS A  1 216 ? 130.444 28.754  -35.577 1.00 22.63  ? 213 HIS A CE1 1 
ATOM   1640  N NE2 . HIS A  1 216 ? 129.291 28.950  -36.188 1.00 22.32  ? 213 HIS A NE2 1 
ATOM   1641  N N   . ASP A  1 217 ? 128.006 24.065  -31.453 1.00 23.86  ? 214 ASP A N   1 
ATOM   1642  C CA  . ASP A  1 217 ? 127.247 22.994  -30.786 1.00 22.83  ? 214 ASP A CA  1 
ATOM   1643  C C   . ASP A  1 217 ? 126.280 23.559  -29.735 1.00 24.49  ? 214 ASP A C   1 
ATOM   1644  O O   . ASP A  1 217 ? 126.676 24.229  -28.806 1.00 24.86  ? 214 ASP A O   1 
ATOM   1645  C CB  . ASP A  1 217 ? 128.189 22.001  -30.123 1.00 21.06  ? 214 ASP A CB  1 
ATOM   1646  C CG  . ASP A  1 217 ? 127.495 20.721  -29.707 1.00 19.94  ? 214 ASP A CG  1 
ATOM   1647  O OD1 . ASP A  1 217 ? 126.607 20.752  -28.817 1.00 19.00  ? 214 ASP A OD1 1 
ATOM   1648  O OD2 . ASP A  1 217 ? 127.863 19.670  -30.259 1.00 18.55  ? 214 ASP A OD2 1 
ATOM   1649  N N   . ASP A  1 218 ? 125.010 23.231  -29.872 1.00 27.67  ? 215 ASP A N   1 
ATOM   1650  C CA  . ASP A  1 218 ? 123.963 23.789  -29.021 1.00 29.75  ? 215 ASP A CA  1 
ATOM   1651  C C   . ASP A  1 218 ? 124.051 23.362  -27.561 1.00 27.72  ? 215 ASP A C   1 
ATOM   1652  O O   . ASP A  1 218 ? 123.517 24.063  -26.689 1.00 26.98  ? 215 ASP A O   1 
ATOM   1653  C CB  . ASP A  1 218 ? 122.572 23.457  -29.589 1.00 32.86  ? 215 ASP A CB  1 
ATOM   1654  C CG  . ASP A  1 218 ? 122.316 24.134  -30.936 1.00 37.48  ? 215 ASP A CG  1 
ATOM   1655  O OD1 . ASP A  1 218 ? 123.245 24.804  -31.471 1.00 42.17  ? 215 ASP A OD1 1 
ATOM   1656  O OD2 . ASP A  1 218 ? 121.191 23.987  -31.471 1.00 40.56  ? 215 ASP A OD2 1 
ATOM   1657  N N   . ARG A  1 219 ? 124.724 22.242  -27.288 1.00 25.25  ? 216 ARG A N   1 
ATOM   1658  C CA  . ARG A  1 219 ? 124.921 21.792  -25.890 1.00 23.40  ? 216 ARG A CA  1 
ATOM   1659  C C   . ARG A  1 219 ? 125.900 22.670  -25.063 1.00 21.78  ? 216 ARG A C   1 
ATOM   1660  O O   . ARG A  1 219 ? 125.887 22.613  -23.837 1.00 20.91  ? 216 ARG A O   1 
ATOM   1661  C CB  . ARG A  1 219 ? 125.377 20.331  -25.847 1.00 22.51  ? 216 ARG A CB  1 
ATOM   1662  C CG  . ARG A  1 219 ? 124.383 19.365  -26.427 1.00 22.23  ? 216 ARG A CG  1 
ATOM   1663  C CD  . ARG A  1 219 ? 124.982 18.003  -26.709 1.00 21.76  ? 216 ARG A CD  1 
ATOM   1664  N NE  . ARG A  1 219 ? 125.921 18.025  -27.816 1.00 21.42  ? 216 ARG A NE  1 
ATOM   1665  C CZ  . ARG A  1 219 ? 126.595 16.960  -28.239 1.00 22.41  ? 216 ARG A CZ  1 
ATOM   1666  N NH1 . ARG A  1 219 ? 126.431 15.776  -27.657 1.00 22.04  ? 216 ARG A NH1 1 
ATOM   1667  N NH2 . ARG A  1 219 ? 127.457 17.071  -29.249 1.00 24.15  ? 216 ARG A NH2 1 
ATOM   1668  N N   . VAL A  1 220 ? 126.757 23.437  -25.736 1.00 20.51  ? 217 VAL A N   1 
ATOM   1669  C CA  . VAL A  1 220 ? 127.704 24.307  -25.076 1.00 20.24  ? 217 VAL A CA  1 
ATOM   1670  C C   . VAL A  1 220 ? 126.935 25.549  -24.715 1.00 19.84  ? 217 VAL A C   1 
ATOM   1671  O O   . VAL A  1 220 ? 126.525 26.297  -25.590 1.00 20.56  ? 217 VAL A O   1 
ATOM   1672  C CB  . VAL A  1 220 ? 128.902 24.693  -25.985 1.00 20.68  ? 217 VAL A CB  1 
ATOM   1673  C CG1 . VAL A  1 220 ? 129.853 25.628  -25.261 1.00 20.46  ? 217 VAL A CG1 1 
ATOM   1674  C CG2 . VAL A  1 220 ? 129.673 23.461  -26.434 1.00 21.15  ? 217 VAL A CG2 1 
ATOM   1675  N N   . LYS A  1 221 ? 126.792 25.776  -23.420 1.00 19.65  ? 218 LYS A N   1 
ATOM   1676  C CA  . LYS A  1 221 ? 125.998 26.849  -22.884 1.00 19.51  ? 218 LYS A CA  1 
ATOM   1677  C C   . LYS A  1 221 ? 126.779 28.091  -22.457 1.00 18.71  ? 218 LYS A C   1 
ATOM   1678  O O   . LYS A  1 221 ? 126.157 29.105  -22.166 1.00 19.09  ? 218 LYS A O   1 
ATOM   1679  C CB  . LYS A  1 221 ? 125.211 26.324  -21.687 1.00 21.43  ? 218 LYS A CB  1 
ATOM   1680  C CG  . LYS A  1 221 ? 123.800 25.885  -22.033 1.00 23.42  ? 218 LYS A CG  1 
ATOM   1681  C CD  . LYS A  1 221 ? 123.748 24.503  -22.633 1.00 25.13  ? 218 LYS A CD  1 
ATOM   1682  C CE  . LYS A  1 221 ? 122.662 24.398  -23.707 1.00 27.70  ? 218 LYS A CE  1 
ATOM   1683  N NZ  . LYS A  1 221 ? 121.264 24.552  -23.216 1.00 29.57  ? 218 LYS A NZ  1 
ATOM   1684  N N   . ALA A  1 222 ? 128.107 28.024  -22.382 1.00 17.80  ? 219 ALA A N   1 
ATOM   1685  C CA  . ALA A  1 222 ? 128.909 29.201  -22.037 1.00 17.46  ? 219 ALA A CA  1 
ATOM   1686  C C   . ALA A  1 222 ? 130.328 29.063  -22.527 1.00 17.48  ? 219 ALA A C   1 
ATOM   1687  O O   . ALA A  1 222 ? 130.895 27.979  -22.491 1.00 18.17  ? 219 ALA A O   1 
ATOM   1688  C CB  . ALA A  1 222 ? 128.907 29.428  -20.530 1.00 17.57  ? 219 ALA A CB  1 
ATOM   1689  N N   . VAL A  1 223 ? 130.918 30.172  -22.944 1.00 17.51  ? 220 VAL A N   1 
ATOM   1690  C CA  . VAL A  1 223 ? 132.277 30.159  -23.473 1.00 18.02  ? 220 VAL A CA  1 
ATOM   1691  C C   . VAL A  1 223 ? 133.186 31.200  -22.803 1.00 18.28  ? 220 VAL A C   1 
ATOM   1692  O O   . VAL A  1 223 ? 132.931 32.400  -22.899 1.00 18.06  ? 220 VAL A O   1 
ATOM   1693  C CB  . VAL A  1 223 ? 132.251 30.400  -24.996 1.00 18.15  ? 220 VAL A CB  1 
ATOM   1694  C CG1 . VAL A  1 223 ? 133.667 30.366  -25.576 1.00 18.19  ? 220 VAL A CG1 1 
ATOM   1695  C CG2 . VAL A  1 223 ? 131.342 29.371  -25.675 1.00 17.68  ? 220 VAL A CG2 1 
ATOM   1696  N N   . SER A  1 224 ? 134.249 30.724  -22.151 1.00 18.87  ? 221 SER A N   1 
ATOM   1697  C CA  . SER A  1 224 ? 135.319 31.582  -21.586 1.00 18.96  ? 221 SER A CA  1 
ATOM   1698  C C   . SER A  1 224 ? 136.543 31.612  -22.511 1.00 18.45  ? 221 SER A C   1 
ATOM   1699  O O   . SER A  1 224 ? 137.245 30.601  -22.654 1.00 17.61  ? 221 SER A O   1 
ATOM   1700  C CB  . SER A  1 224 ? 135.763 31.067  -20.208 1.00 19.31  ? 221 SER A CB  1 
ATOM   1701  O OG  . SER A  1 224 ? 134.793 31.308  -19.199 1.00 19.82  ? 221 SER A OG  1 
ATOM   1702  N N   . PHE A  1 225 ? 136.789 32.766  -23.136 1.00 18.15  ? 222 PHE A N   1 
ATOM   1703  C CA  . PHE A  1 225 ? 137.949 32.937  -24.015 1.00 18.01  ? 222 PHE A CA  1 
ATOM   1704  C C   . PHE A  1 225 ? 138.910 33.889  -23.398 1.00 18.51  ? 222 PHE A C   1 
ATOM   1705  O O   . PHE A  1 225 ? 138.494 34.906  -22.863 1.00 18.42  ? 222 PHE A O   1 
ATOM   1706  C CB  . PHE A  1 225 ? 137.584 33.492  -25.398 1.00 17.86  ? 222 PHE A CB  1 
ATOM   1707  C CG  . PHE A  1 225 ? 138.786 33.741  -26.286 1.00 16.87  ? 222 PHE A CG  1 
ATOM   1708  C CD1 . PHE A  1 225 ? 139.375 32.713  -26.965 1.00 16.67  ? 222 PHE A CD1 1 
ATOM   1709  C CD2 . PHE A  1 225 ? 139.336 35.012  -26.412 1.00 16.69  ? 222 PHE A CD2 1 
ATOM   1710  C CE1 . PHE A  1 225 ? 140.488 32.934  -27.754 1.00 16.76  ? 222 PHE A CE1 1 
ATOM   1711  C CE2 . PHE A  1 225 ? 140.449 35.241  -27.202 1.00 16.25  ? 222 PHE A CE2 1 
ATOM   1712  C CZ  . PHE A  1 225 ? 141.025 34.201  -27.874 1.00 16.30  ? 222 PHE A CZ  1 
ATOM   1713  N N   . VAL A  1 226 ? 140.196 33.544  -23.506 1.00 19.93  ? 223 VAL A N   1 
ATOM   1714  C CA  . VAL A  1 226 ? 141.321 34.417  -23.142 1.00 20.96  ? 223 VAL A CA  1 
ATOM   1715  C C   . VAL A  1 226 ? 142.308 34.361  -24.311 1.00 22.01  ? 223 VAL A C   1 
ATOM   1716  O O   . VAL A  1 226 ? 142.686 33.284  -24.752 1.00 23.62  ? 223 VAL A O   1 
ATOM   1717  C CB  . VAL A  1 226 ? 142.001 33.965  -21.822 1.00 20.28  ? 223 VAL A CB  1 
ATOM   1718  C CG1 . VAL A  1 226 ? 143.255 34.771  -21.529 1.00 20.12  ? 223 VAL A CG1 1 
ATOM   1719  C CG2 . VAL A  1 226 ? 141.035 34.132  -20.672 1.00 20.49  ? 223 VAL A CG2 1 
ATOM   1720  N N   . GLY A  1 227 ? 142.701 35.518  -24.826 1.00 22.61  ? 224 GLY A N   1 
ATOM   1721  C CA  . GLY A  1 227 ? 143.627 35.576  -25.953 1.00 23.15  ? 224 GLY A CA  1 
ATOM   1722  C C   . GLY A  1 227 ? 143.728 36.975  -26.534 1.00 23.28  ? 224 GLY A C   1 
ATOM   1723  O O   . GLY A  1 227 ? 143.572 37.958  -25.807 1.00 23.56  ? 224 GLY A O   1 
ATOM   1724  N N   . SER A  1 228 ? 144.030 37.060  -27.829 1.00 22.96  ? 225 SER A N   1 
ATOM   1725  C CA  . SER A  1 228 ? 144.159 38.350  -28.541 1.00 22.29  ? 225 SER A CA  1 
ATOM   1726  C C   . SER A  1 228 ? 142.804 39.036  -28.787 1.00 21.48  ? 225 SER A C   1 
ATOM   1727  O O   . SER A  1 228 ? 141.760 38.383  -28.861 1.00 19.03  ? 225 SER A O   1 
ATOM   1728  C CB  . SER A  1 228 ? 144.876 38.160  -29.875 1.00 21.71  ? 225 SER A CB  1 
ATOM   1729  O OG  . SER A  1 228 ? 144.065 37.412  -30.766 1.00 21.28  ? 225 SER A OG  1 
ATOM   1730  N N   . THR A  1 229 ? 142.845 40.359  -28.929 1.00 21.81  ? 226 THR A N   1 
ATOM   1731  C CA  . THR A  1 229 ? 141.619 41.130  -29.144 1.00 22.45  ? 226 THR A CA  1 
ATOM   1732  C C   . THR A  1 229 ? 140.914 40.710  -30.432 1.00 22.27  ? 226 THR A C   1 
ATOM   1733  O O   . THR A  1 229 ? 139.699 40.459  -30.404 1.00 23.15  ? 226 THR A O   1 
ATOM   1734  C CB  . THR A  1 229 ? 141.870 42.654  -29.102 1.00 23.18  ? 226 THR A CB  1 
ATOM   1735  O OG1 . THR A  1 229 ? 142.221 43.035  -27.762 1.00 25.11  ? 226 THR A OG1 1 
ATOM   1736  C CG2 . THR A  1 229 ? 140.633 43.442  -29.470 1.00 23.03  ? 226 THR A CG2 1 
ATOM   1737  N N   . PRO A  1 230 ? 141.656 40.606  -31.557 1.00 21.50  ? 227 PRO A N   1 
ATOM   1738  C CA  . PRO A  1 230 ? 140.975 40.198  -32.799 1.00 21.05  ? 227 PRO A CA  1 
ATOM   1739  C C   . PRO A  1 230 ? 140.154 38.924  -32.634 1.00 21.20  ? 227 PRO A C   1 
ATOM   1740  O O   . PRO A  1 230 ? 138.973 38.922  -32.958 1.00 21.29  ? 227 PRO A O   1 
ATOM   1741  C CB  . PRO A  1 230 ? 142.119 40.027  -33.793 1.00 20.73  ? 227 PRO A CB  1 
ATOM   1742  C CG  . PRO A  1 230 ? 143.164 40.976  -33.298 1.00 21.09  ? 227 PRO A CG  1 
ATOM   1743  C CD  . PRO A  1 230 ? 143.070 40.950  -31.800 1.00 21.30  ? 227 PRO A CD  1 
ATOM   1744  N N   . ILE A  1 231 ? 140.758 37.886  -32.062 1.00 21.70  ? 228 ILE A N   1 
ATOM   1745  C CA  . ILE A  1 231 ? 140.092 36.582  -31.846 1.00 21.77  ? 228 ILE A CA  1 
ATOM   1746  C C   . ILE A  1 231 ? 139.056 36.637  -30.719 1.00 21.45  ? 228 ILE A C   1 
ATOM   1747  O O   . ILE A  1 231 ? 138.009 36.009  -30.807 1.00 20.84  ? 228 ILE A O   1 
ATOM   1748  C CB  . ILE A  1 231 ? 141.127 35.488  -31.519 1.00 21.95  ? 228 ILE A CB  1 
ATOM   1749  C CG1 . ILE A  1 231 ? 142.186 35.407  -32.630 1.00 23.50  ? 228 ILE A CG1 1 
ATOM   1750  C CG2 . ILE A  1 231 ? 140.469 34.137  -31.296 1.00 21.13  ? 228 ILE A CG2 1 
ATOM   1751  C CD1 . ILE A  1 231 ? 141.642 35.220  -34.040 1.00 24.13  ? 228 ILE A CD1 1 
ATOM   1752  N N   . ALA A  1 232 ? 139.346 37.373  -29.656 1.00 21.52  ? 229 ALA A N   1 
ATOM   1753  C CA  . ALA A  1 232 ? 138.343 37.597  -28.607 1.00 22.88  ? 229 ALA A CA  1 
ATOM   1754  C C   . ALA A  1 232 ? 137.052 38.139  -29.200 1.00 22.94  ? 229 ALA A C   1 
ATOM   1755  O O   . ALA A  1 232 ? 135.966 37.641  -28.872 1.00 21.37  ? 229 ALA A O   1 
ATOM   1756  C CB  . ALA A  1 232 ? 138.854 38.560  -27.540 1.00 23.49  ? 229 ALA A CB  1 
ATOM   1757  N N   . GLU A  1 233 ? 137.197 39.147  -30.070 1.00 23.33  ? 230 GLU A N   1 
ATOM   1758  C CA  . GLU A  1 233 ? 136.065 39.766  -30.771 1.00 24.30  ? 230 GLU A CA  1 
ATOM   1759  C C   . GLU A  1 233 ? 135.314 38.772  -31.627 1.00 21.78  ? 230 GLU A C   1 
ATOM   1760  O O   . GLU A  1 233 ? 134.096 38.796  -31.651 1.00 20.29  ? 230 GLU A O   1 
ATOM   1761  C CB  . GLU A  1 233 ? 136.533 40.900  -31.666 1.00 27.99  ? 230 GLU A CB  1 
ATOM   1762  C CG  . GLU A  1 233 ? 135.430 41.849  -32.089 1.00 31.78  ? 230 GLU A CG  1 
ATOM   1763  C CD  . GLU A  1 233 ? 135.911 42.891  -33.094 1.00 37.16  ? 230 GLU A CD  1 
ATOM   1764  O OE1 . GLU A  1 233 ? 137.037 42.777  -33.635 1.00 41.76  ? 230 GLU A OE1 1 
ATOM   1765  O OE2 . GLU A  1 233 ? 135.151 43.838  -33.372 1.00 43.84  ? 230 GLU A OE2 1 
ATOM   1766  N N   . TYR A  1 234 ? 136.056 37.921  -32.338 1.00 20.06  ? 231 TYR A N   1 
ATOM   1767  C CA  . TYR A  1 234 ? 135.472 36.879  -33.165 1.00 19.02  ? 231 TYR A CA  1 
ATOM   1768  C C   . TYR A  1 234 ? 134.663 35.930  -32.283 1.00 19.05  ? 231 TYR A C   1 
ATOM   1769  O O   . TYR A  1 234 ? 133.481 35.669  -32.544 1.00 17.29  ? 231 TYR A O   1 
ATOM   1770  C CB  . TYR A  1 234 ? 136.554 36.127  -33.969 1.00 18.84  ? 231 TYR A CB  1 
ATOM   1771  C CG  . TYR A  1 234 ? 136.022 34.870  -34.594 1.00 18.94  ? 231 TYR A CG  1 
ATOM   1772  C CD1 . TYR A  1 234 ? 135.331 34.906  -35.779 1.00 19.18  ? 231 TYR A CD1 1 
ATOM   1773  C CD2 . TYR A  1 234 ? 136.160 33.645  -33.956 1.00 19.55  ? 231 TYR A CD2 1 
ATOM   1774  C CE1 . TYR A  1 234 ? 134.786 33.755  -36.333 1.00 19.70  ? 231 TYR A CE1 1 
ATOM   1775  C CE2 . TYR A  1 234 ? 135.631 32.485  -34.499 1.00 19.98  ? 231 TYR A CE2 1 
ATOM   1776  C CZ  . TYR A  1 234 ? 134.929 32.542  -35.693 1.00 20.09  ? 231 TYR A CZ  1 
ATOM   1777  O OH  . TYR A  1 234 ? 134.378 31.393  -36.264 1.00 20.58  ? 231 TYR A OH  1 
ATOM   1778  N N   . ILE A  1 235 ? 135.315 35.437  -31.228 1.00 20.44  ? 232 ILE A N   1 
ATOM   1779  C CA  . ILE A  1 235 ? 134.705 34.449  -30.308 1.00 21.30  ? 232 ILE A CA  1 
ATOM   1780  C C   . ILE A  1 235 ? 133.458 35.025  -29.651 1.00 21.56  ? 232 ILE A C   1 
ATOM   1781  O O   . ILE A  1 235 ? 132.440 34.356  -29.610 1.00 20.79  ? 232 ILE A O   1 
ATOM   1782  C CB  . ILE A  1 235 ? 135.640 34.009  -29.157 1.00 21.29  ? 232 ILE A CB  1 
ATOM   1783  C CG1 . ILE A  1 235 ? 136.919 33.348  -29.673 1.00 21.78  ? 232 ILE A CG1 1 
ATOM   1784  C CG2 . ILE A  1 235 ? 134.915 33.056  -28.217 1.00 20.61  ? 232 ILE A CG2 1 
ATOM   1785  C CD1 . ILE A  1 235 ? 136.774 31.925  -30.165 1.00 22.45  ? 232 ILE A CD1 1 
ATOM   1786  N N   . TYR A  1 236 ? 133.564 36.249  -29.125 1.00 21.96  ? 233 TYR A N   1 
ATOM   1787  C CA  . TYR A  1 236 ? 132.411 36.957  -28.548 1.00 23.16  ? 233 TYR A CA  1 
ATOM   1788  C C   . TYR A  1 236 ? 131.244 37.134  -29.535 1.00 25.74  ? 233 TYR A C   1 
ATOM   1789  O O   . TYR A  1 236 ? 130.069 36.898  -29.189 1.00 24.31  ? 233 TYR A O   1 
ATOM   1790  C CB  . TYR A  1 236 ? 132.819 38.333  -28.001 1.00 22.41  ? 233 TYR A CB  1 
ATOM   1791  C CG  . TYR A  1 236 ? 131.781 38.945  -27.072 1.00 21.56  ? 233 TYR A CG  1 
ATOM   1792  C CD1 . TYR A  1 236 ? 131.567 38.418  -25.798 1.00 20.90  ? 233 TYR A CD1 1 
ATOM   1793  C CD2 . TYR A  1 236 ? 130.999 40.037  -27.469 1.00 21.12  ? 233 TYR A CD2 1 
ATOM   1794  C CE1 . TYR A  1 236 ? 130.617 38.960  -24.943 1.00 20.44  ? 233 TYR A CE1 1 
ATOM   1795  C CE2 . TYR A  1 236 ? 130.042 40.586  -26.614 1.00 20.54  ? 233 TYR A CE2 1 
ATOM   1796  C CZ  . TYR A  1 236 ? 129.853 40.042  -25.349 1.00 20.19  ? 233 TYR A CZ  1 
ATOM   1797  O OH  . TYR A  1 236 ? 128.901 40.543  -24.476 1.00 18.94  ? 233 TYR A OH  1 
ATOM   1798  N N   . ARG A  1 237 ? 131.575 37.538  -30.762 1.00 29.73  ? 234 ARG A N   1 
ATOM   1799  C CA  . ARG A  1 237 ? 130.564 37.780  -31.781 1.00 31.60  ? 234 ARG A CA  1 
ATOM   1800  C C   . ARG A  1 237 ? 129.860 36.490  -32.110 1.00 27.41  ? 234 ARG A C   1 
ATOM   1801  O O   . ARG A  1 237 ? 128.637 36.413  -32.032 1.00 24.31  ? 234 ARG A O   1 
ATOM   1802  C CB  . ARG A  1 237 ? 131.177 38.393  -33.031 1.00 39.47  ? 234 ARG A CB  1 
ATOM   1803  C CG  . ARG A  1 237 ? 130.115 38.890  -34.004 1.00 53.48  ? 234 ARG A CG  1 
ATOM   1804  C CD  . ARG A  1 237 ? 130.678 39.558  -35.251 1.00 65.64  ? 234 ARG A CD  1 
ATOM   1805  N NE  . ARG A  1 237 ? 131.538 40.687  -34.900 1.00 74.48  ? 234 ARG A NE  1 
ATOM   1806  C CZ  . ARG A  1 237 ? 132.866 40.716  -35.020 1.00 88.94  ? 234 ARG A CZ  1 
ATOM   1807  N NH1 . ARG A  1 237 ? 133.571 39.682  -35.523 1.00 94.68  ? 234 ARG A NH1 1 
ATOM   1808  N NH2 . ARG A  1 237 ? 133.499 41.821  -34.650 1.00 90.97  ? 234 ARG A NH2 1 
ATOM   1809  N N   . THR A  1 238 ? 130.657 35.477  -32.427 1.00 25.89  ? 235 THR A N   1 
ATOM   1810  C CA  . THR A  1 238 ? 130.147 34.180  -32.864 1.00 26.56  ? 235 THR A CA  1 
ATOM   1811  C C   . THR A  1 238 ? 129.272 33.545  -31.794 1.00 27.23  ? 235 THR A C   1 
ATOM   1812  O O   . THR A  1 238 ? 128.137 33.130  -32.061 1.00 25.04  ? 235 THR A O   1 
ATOM   1813  C CB  . THR A  1 238 ? 131.304 33.206  -33.208 1.00 26.95  ? 235 THR A CB  1 
ATOM   1814  O OG1 . THR A  1 238 ? 132.210 33.829  -34.136 1.00 29.01  ? 235 THR A OG1 1 
ATOM   1815  C CG2 . THR A  1 238 ? 130.781 31.896  -33.801 1.00 25.30  ? 235 THR A CG2 1 
ATOM   1816  N N   . ALA A  1 239 ? 129.814 33.464  -30.580 1.00 29.19  ? 236 ALA A N   1 
ATOM   1817  C CA  . ALA A  1 239 ? 129.061 32.947  -29.428 1.00 30.40  ? 236 ALA A CA  1 
ATOM   1818  C C   . ALA A  1 239 ? 127.728 33.666  -29.280 1.00 30.66  ? 236 ALA A C   1 
ATOM   1819  O O   . ALA A  1 239 ? 126.696 33.027  -29.122 1.00 29.03  ? 236 ALA A O   1 
ATOM   1820  C CB  . ALA A  1 239 ? 129.863 33.103  -28.144 1.00 31.32  ? 236 ALA A CB  1 
ATOM   1821  N N   . SER A  1 240 ? 127.766 34.994  -29.352 1.00 31.20  ? 237 SER A N   1 
ATOM   1822  C CA  . SER A  1 240 ? 126.562 35.806  -29.207 1.00 32.98  ? 237 SER A CA  1 
ATOM   1823  C C   . SER A  1 240 ? 125.544 35.587  -30.318 1.00 31.98  ? 237 SER A C   1 
ATOM   1824  O O   . SER A  1 240 ? 124.338 35.688  -30.088 1.00 31.33  ? 237 SER A O   1 
ATOM   1825  C CB  . SER A  1 240 ? 126.933 37.283  -29.111 1.00 35.75  ? 237 SER A CB  1 
ATOM   1826  O OG  . SER A  1 240 ? 127.715 37.530  -27.935 1.00 38.64  ? 237 SER A OG  1 
ATOM   1827  N N   . ALA A  1 241 ? 126.035 35.291  -31.518 1.00 31.56  ? 238 ALA A N   1 
ATOM   1828  C CA  . ALA A  1 241 ? 125.162 34.890  -32.642 1.00 30.23  ? 238 ALA A CA  1 
ATOM   1829  C C   . ALA A  1 241 ? 124.506 33.531  -32.440 1.00 28.52  ? 238 ALA A C   1 
ATOM   1830  O O   . ALA A  1 241 ? 123.460 33.280  -32.998 1.00 26.63  ? 238 ALA A O   1 
ATOM   1831  C CB  . ALA A  1 241 ? 125.924 34.892  -33.964 1.00 29.51  ? 238 ALA A CB  1 
ATOM   1832  N N   . ASN A  1 242 ? 125.135 32.655  -31.664 1.00 29.54  ? 239 ASN A N   1 
ATOM   1833  C CA  . ASN A  1 242 ? 124.576 31.321  -31.360 1.00 30.74  ? 239 ASN A CA  1 
ATOM   1834  C C   . ASN A  1 242 ? 123.911 31.222  -29.959 1.00 33.40  ? 239 ASN A C   1 
ATOM   1835  O O   . ASN A  1 242 ? 123.866 30.133  -29.351 1.00 29.48  ? 239 ASN A O   1 
ATOM   1836  C CB  . ASN A  1 242 ? 125.648 30.246  -31.527 1.00 29.95  ? 239 ASN A CB  1 
ATOM   1837  C CG  . ASN A  1 242 ? 126.043 30.033  -32.987 1.00 30.47  ? 239 ASN A CG  1 
ATOM   1838  O OD1 . ASN A  1 242 ? 125.848 28.951  -33.547 1.00 31.01  ? 239 ASN A OD1 1 
ATOM   1839  N ND2 . ASN A  1 242 ? 126.609 31.057  -33.607 1.00 30.17  ? 239 ASN A ND2 1 
ATOM   1840  N N   . GLY A  1 243 ? 123.424 32.373  -29.454 1.00 36.58  ? 240 GLY A N   1 
ATOM   1841  C CA  . GLY A  1 243 ? 122.601 32.452  -28.231 1.00 37.00  ? 240 GLY A CA  1 
ATOM   1842  C C   . GLY A  1 243 ? 123.298 32.300  -26.871 1.00 37.32  ? 240 GLY A C   1 
ATOM   1843  O O   . GLY A  1 243 ? 122.818 32.852  -25.852 1.00 36.10  ? 240 GLY A O   1 
ATOM   1844  N N   . LYS A  1 244 ? 124.412 31.552  -26.843 1.00 34.04  ? 241 LYS A N   1 
ATOM   1845  C CA  . LYS A  1 244 ? 125.178 31.317  -25.609 1.00 30.49  ? 241 LYS A CA  1 
ATOM   1846  C C   . LYS A  1 244 ? 126.032 32.499  -25.096 1.00 26.75  ? 241 LYS A C   1 
ATOM   1847  O O   . LYS A  1 244 ? 126.623 33.261  -25.864 1.00 24.50  ? 241 LYS A O   1 
ATOM   1848  C CB  . LYS A  1 244 ? 126.051 30.073  -25.732 1.00 30.41  ? 241 LYS A CB  1 
ATOM   1849  C CG  . LYS A  1 244 ? 127.251 30.242  -26.653 1.00 31.29  ? 241 LYS A CG  1 
ATOM   1850  C CD  . LYS A  1 244 ? 127.735 28.901  -27.188 1.00 30.51  ? 241 LYS A CD  1 
ATOM   1851  C CE  . LYS A  1 244 ? 126.759 28.299  -28.182 1.00 29.94  ? 241 LYS A CE  1 
ATOM   1852  N NZ  . LYS A  1 244 ? 127.146 26.911  -28.500 1.00 30.48  ? 241 LYS A NZ  1 
ATOM   1853  N N   . ARG A  1 245 ? 126.069 32.605  -23.764 1.00 23.14  ? 242 ARG A N   1 
ATOM   1854  C CA  . ARG A  1 245 ? 126.794 33.640  -23.065 1.00 20.49  ? 242 ARG A CA  1 
ATOM   1855  C C   . ARG A  1 245 ? 128.289 33.462  -23.264 1.00 20.21  ? 242 ARG A C   1 
ATOM   1856  O O   . ARG A  1 245 ? 128.752 32.362  -23.598 1.00 20.67  ? 242 ARG A O   1 
ATOM   1857  C CB  . ARG A  1 245 ? 126.457 33.597  -21.591 1.00 19.14  ? 242 ARG A CB  1 
ATOM   1858  C CG  . ARG A  1 245 ? 126.796 32.285  -20.905 1.00 18.39  ? 242 ARG A CG  1 
ATOM   1859  C CD  . ARG A  1 245 ? 126.714 32.393  -19.391 1.00 17.62  ? 242 ARG A CD  1 
ATOM   1860  N NE  . ARG A  1 245 ? 125.346 32.487  -18.881 1.00 16.49  ? 242 ARG A NE  1 
ATOM   1861  C CZ  . ARG A  1 245 ? 125.027 32.694  -17.603 1.00 15.98  ? 242 ARG A CZ  1 
ATOM   1862  N NH1 . ARG A  1 245 ? 125.974 32.819  -16.665 1.00 15.46  ? 242 ARG A NH1 1 
ATOM   1863  N NH2 . ARG A  1 245 ? 123.746 32.766  -17.250 1.00 15.84  ? 242 ARG A NH2 1 
ATOM   1864  N N   . CYS A  1 246 ? 129.039 34.537  -23.037 1.00 18.87  ? 243 CYS A N   1 
ATOM   1865  C CA  . CYS A  1 246 ? 130.461 34.551  -23.343 1.00 18.29  ? 243 CYS A CA  1 
ATOM   1866  C C   . CYS A  1 246 ? 131.181 35.662  -22.587 1.00 17.75  ? 243 CYS A C   1 
ATOM   1867  O O   . CYS A  1 246 ? 130.595 36.695  -22.260 1.00 16.19  ? 243 CYS A O   1 
ATOM   1868  C CB  . CYS A  1 246 ? 130.669 34.715  -24.870 1.00 19.06  ? 243 CYS A CB  1 
ATOM   1869  S SG  . CYS A  1 246 ? 132.386 34.809  -25.487 1.00 19.02  ? 243 CYS A SG  1 
ATOM   1870  N N   . GLN A  1 247 ? 132.459 35.407  -22.300 1.00 17.85  ? 244 GLN A N   1 
ATOM   1871  C CA  . GLN A  1 247 ? 133.412 36.407  -21.798 1.00 17.62  ? 244 GLN A CA  1 
ATOM   1872  C C   . GLN A  1 247 ? 134.694 36.194  -22.616 1.00 17.57  ? 244 GLN A C   1 
ATOM   1873  O O   . GLN A  1 247 ? 135.256 35.095  -22.637 1.00 18.28  ? 244 GLN A O   1 
ATOM   1874  C CB  . GLN A  1 247 ? 133.658 36.276  -20.269 1.00 17.41  ? 244 GLN A CB  1 
ATOM   1875  C CG  . GLN A  1 247 ? 134.214 34.911  -19.808 1.00 17.92  ? 244 GLN A CG  1 
ATOM   1876  C CD  . GLN A  1 247 ? 134.328 34.668  -18.292 1.00 17.90  ? 244 GLN A CD  1 
ATOM   1877  O OE1 . GLN A  1 247 ? 134.710 33.561  -17.874 1.00 17.86  ? 244 GLN A OE1 1 
ATOM   1878  N NE2 . GLN A  1 247 ? 134.034 35.679  -17.469 1.00 17.86  ? 244 GLN A NE2 1 
ATOM   1879  N N   . ALA A  1 248 ? 135.135 37.225  -23.315 1.00 17.15  ? 245 ALA A N   1 
ATOM   1880  C CA  . ALA A  1 248 ? 136.338 37.131  -24.089 1.00 17.57  ? 245 ALA A CA  1 
ATOM   1881  C C   . ALA A  1 248 ? 137.296 38.231  -23.698 1.00 18.46  ? 245 ALA A C   1 
ATOM   1882  O O   . ALA A  1 248 ? 137.023 39.414  -23.878 1.00 18.19  ? 245 ALA A O   1 
ATOM   1883  C CB  . ALA A  1 248 ? 136.012 37.231  -25.553 1.00 18.17  ? 245 ALA A CB  1 
ATOM   1884  N N   . LEU A  1 249 ? 138.439 37.822  -23.175 1.00 20.04  ? 246 LEU A N   1 
ATOM   1885  C CA  . LEU A  1 249 ? 139.497 38.736  -22.785 1.00 20.64  ? 246 LEU A CA  1 
ATOM   1886  C C   . LEU A  1 249 ? 140.553 38.806  -23.882 1.00 20.45  ? 246 LEU A C   1 
ATOM   1887  O O   . LEU A  1 249 ? 140.856 37.808  -24.517 1.00 18.97  ? 246 LEU A O   1 
ATOM   1888  C CB  . LEU A  1 249 ? 140.109 38.277  -21.465 1.00 21.00  ? 246 LEU A CB  1 
ATOM   1889  C CG  . LEU A  1 249 ? 139.255 38.563  -20.229 1.00 20.73  ? 246 LEU A CG  1 
ATOM   1890  C CD1 . LEU A  1 249 ? 138.046 37.667  -20.183 1.00 20.54  ? 246 LEU A CD1 1 
ATOM   1891  C CD2 . LEU A  1 249 ? 140.059 38.374  -18.955 1.00 21.62  ? 246 LEU A CD2 1 
ATOM   1892  N N   . GLY A  1 250 ? 141.128 39.992  -24.042 1.00 21.62  ? 247 GLY A N   1 
ATOM   1893  C CA  . GLY A  1 250 ? 141.879 40.374  -25.233 1.00 22.71  ? 247 GLY A CA  1 
ATOM   1894  C C   . GLY A  1 250 ? 143.262 40.924  -24.938 1.00 23.91  ? 247 GLY A C   1 
ATOM   1895  O O   . GLY A  1 250 ? 143.867 40.595  -23.930 1.00 24.64  ? 247 GLY A O   1 
ATOM   1896  N N   . GLY A  1 251 ? 143.753 41.782  -25.826 1.00 24.73  ? 248 GLY A N   1 
ATOM   1897  C CA  . GLY A  1 251 ? 145.096 42.335  -25.704 1.00 25.99  ? 248 GLY A CA  1 
ATOM   1898  C C   . GLY A  1 251 ? 145.261 43.475  -24.727 1.00 26.17  ? 248 GLY A C   1 
ATOM   1899  O O   . GLY A  1 251 ? 144.314 43.864  -24.038 1.00 27.18  ? 248 GLY A O   1 
ATOM   1900  N N   . ALA A  1 252 ? 146.474 44.026  -24.698 1.00 26.23  ? 249 ALA A N   1 
ATOM   1901  C CA  . ALA A  1 252 ? 146.853 45.023  -23.698 1.00 25.31  ? 249 ALA A CA  1 
ATOM   1902  C C   . ALA A  1 252 ? 148.061 45.893  -24.087 1.00 24.65  ? 249 ALA A C   1 
ATOM   1903  O O   . ALA A  1 252 ? 148.954 45.448  -24.792 1.00 23.36  ? 249 ALA A O   1 
ATOM   1904  C CB  . ALA A  1 252 ? 147.128 44.303  -22.403 1.00 24.76  ? 249 ALA A CB  1 
ATOM   1905  N N   . LYS A  1 253 ? 148.046 47.144  -23.644 1.00 25.17  ? 250 LYS A N   1 
ATOM   1906  C CA  . LYS A  1 253 ? 149.235 48.021  -23.649 1.00 27.53  ? 250 LYS A CA  1 
ATOM   1907  C C   . LYS A  1 253 ? 149.336 48.735  -22.295 1.00 28.78  ? 250 LYS A C   1 
ATOM   1908  O O   . LYS A  1 253 ? 148.799 49.845  -22.093 1.00 26.98  ? 250 LYS A O   1 
ATOM   1909  C CB  . LYS A  1 253 ? 149.211 49.047  -24.799 1.00 27.75  ? 250 LYS A CB  1 
ATOM   1910  C CG  . LYS A  1 253 ? 150.253 48.800  -25.894 1.00 28.19  ? 250 LYS A CG  1 
ATOM   1911  C CD  . LYS A  1 253 ? 151.628 49.359  -25.548 1.00 27.89  ? 250 LYS A CD  1 
ATOM   1912  C CE  . LYS A  1 253 ? 152.619 49.199  -26.701 1.00 28.44  ? 250 LYS A CE  1 
ATOM   1913  N NZ  . LYS A  1 253 ? 153.271 47.871  -26.761 1.00 29.64  ? 250 LYS A NZ  1 
ATOM   1914  N N   . ASN A  1 254 ? 150.022 48.083  -21.359 1.00 29.05  ? 251 ASN A N   1 
ATOM   1915  C CA  . ASN A  1 254 ? 149.980 48.539  -19.972 1.00 28.88  ? 251 ASN A CA  1 
ATOM   1916  C C   . ASN A  1 254 ? 150.971 49.660  -19.728 1.00 27.17  ? 251 ASN A C   1 
ATOM   1917  O O   . ASN A  1 254 ? 152.156 49.482  -19.942 1.00 27.76  ? 251 ASN A O   1 
ATOM   1918  C CB  . ASN A  1 254 ? 150.222 47.372  -19.016 1.00 30.09  ? 251 ASN A CB  1 
ATOM   1919  C CG  . ASN A  1 254 ? 149.005 46.428  -18.877 1.00 30.08  ? 251 ASN A CG  1 
ATOM   1920  O OD1 . ASN A  1 254 ? 148.860 45.754  -17.867 1.00 31.88  ? 251 ASN A OD1 1 
ATOM   1921  N ND2 . ASN A  1 254 ? 148.139 46.389  -19.854 1.00 29.76  ? 251 ASN A ND2 1 
ATOM   1922  N N   . HIS A  1 255 ? 150.460 50.810  -19.287 1.00 25.65  ? 252 HIS A N   1 
ATOM   1923  C CA  . HIS A  1 255 ? 151.258 52.007  -19.038 1.00 24.44  ? 252 HIS A CA  1 
ATOM   1924  C C   . HIS A  1 255 ? 151.513 52.203  -17.547 1.00 23.40  ? 252 HIS A C   1 
ATOM   1925  O O   . HIS A  1 255 ? 150.639 51.946  -16.744 1.00 22.59  ? 252 HIS A O   1 
ATOM   1926  C CB  . HIS A  1 255 ? 150.527 53.258  -19.532 1.00 24.86  ? 252 HIS A CB  1 
ATOM   1927  C CG  . HIS A  1 255 ? 150.434 53.393  -21.025 1.00 24.41  ? 252 HIS A CG  1 
ATOM   1928  N ND1 . HIS A  1 255 ? 149.922 52.401  -21.838 1.00 25.41  ? 252 HIS A ND1 1 
ATOM   1929  C CD2 . HIS A  1 255 ? 150.726 54.430  -21.842 1.00 23.00  ? 252 HIS A CD2 1 
ATOM   1930  C CE1 . HIS A  1 255 ? 149.932 52.811  -23.093 1.00 23.89  ? 252 HIS A CE1 1 
ATOM   1931  N NE2 . HIS A  1 255 ? 150.418 54.037  -23.121 1.00 23.30  ? 252 HIS A NE2 1 
ATOM   1932  N N   . ALA A  1 256 ? 152.701 52.698  -17.203 1.00 23.48  ? 253 ALA A N   1 
ATOM   1933  C CA  . ALA A  1 256 ? 153.035 53.111  -15.839 1.00 23.49  ? 253 ALA A CA  1 
ATOM   1934  C C   . ALA A  1 256 ? 153.465 54.577  -15.831 1.00 22.97  ? 253 ALA A C   1 
ATOM   1935  O O   . ALA A  1 256 ? 154.419 54.952  -16.523 1.00 25.56  ? 253 ALA A O   1 
ATOM   1936  C CB  . ALA A  1 256 ? 154.145 52.244  -15.265 1.00 23.55  ? 253 ALA A CB  1 
ATOM   1937  N N   . ILE A  1 257 ? 152.781 55.389  -15.043 1.00 21.18  ? 254 ILE A N   1 
ATOM   1938  C CA  . ILE A  1 257 ? 153.125 56.787  -14.884 1.00 20.57  ? 254 ILE A CA  1 
ATOM   1939  C C   . ILE A  1 257 ? 154.159 56.869  -13.786 1.00 20.50  ? 254 ILE A C   1 
ATOM   1940  O O   . ILE A  1 257 ? 153.869 56.502  -12.650 1.00 20.22  ? 254 ILE A O   1 
ATOM   1941  C CB  . ILE A  1 257 ? 151.891 57.615  -14.488 1.00 20.55  ? 254 ILE A CB  1 
ATOM   1942  C CG1 . ILE A  1 257 ? 150.829 57.492  -15.576 1.00 20.36  ? 254 ILE A CG1 1 
ATOM   1943  C CG2 . ILE A  1 257 ? 152.254 59.079  -14.236 1.00 20.42  ? 254 ILE A CG2 1 
ATOM   1944  C CD1 . ILE A  1 257 ? 149.527 58.167  -15.240 1.00 20.36  ? 254 ILE A CD1 1 
ATOM   1945  N N   . VAL A  1 258 ? 155.361 57.329  -14.133 1.00 21.00  ? 255 VAL A N   1 
ATOM   1946  C CA  . VAL A  1 258 ? 156.429 57.581  -13.154 1.00 21.24  ? 255 VAL A CA  1 
ATOM   1947  C C   . VAL A  1 258 ? 156.392 59.080  -12.797 1.00 22.13  ? 255 VAL A C   1 
ATOM   1948  O O   . VAL A  1 258 ? 156.805 59.930  -13.586 1.00 21.84  ? 255 VAL A O   1 
ATOM   1949  C CB  . VAL A  1 258 ? 157.811 57.161  -13.689 1.00 20.13  ? 255 VAL A CB  1 
ATOM   1950  C CG1 . VAL A  1 258 ? 158.858 57.319  -12.611 1.00 20.01  ? 255 VAL A CG1 1 
ATOM   1951  C CG2 . VAL A  1 258 ? 157.771 55.726  -14.184 1.00 19.90  ? 255 VAL A CG2 1 
ATOM   1952  N N   . MET A  1 259 ? 155.865 59.383  -11.615 1.00 23.00  ? 256 MET A N   1 
ATOM   1953  C CA  . MET A  1 259 ? 155.765 60.748  -11.137 1.00 23.71  ? 256 MET A CA  1 
ATOM   1954  C C   . MET A  1 259 ? 157.118 61.193  -10.608 1.00 26.54  ? 256 MET A C   1 
ATOM   1955  O O   . MET A  1 259 ? 157.984 60.362  -10.302 1.00 26.93  ? 256 MET A O   1 
ATOM   1956  C CB  . MET A  1 259 ? 154.740 60.851  -10.008 1.00 23.15  ? 256 MET A CB  1 
ATOM   1957  C CG  . MET A  1 259 ? 153.304 60.515  -10.395 1.00 22.05  ? 256 MET A CG  1 
ATOM   1958  S SD  . MET A  1 259 ? 152.461 61.718  -11.456 1.00 20.62  ? 256 MET A SD  1 
ATOM   1959  C CE  . MET A  1 259 ? 152.291 63.133  -10.377 1.00 20.87  ? 256 MET A CE  1 
ATOM   1960  N N   . PRO A  1 260 ? 157.305 62.514  -10.486 1.00 29.52  ? 257 PRO A N   1 
ATOM   1961  C CA  . PRO A  1 260 ? 158.547 63.033  -9.890  1.00 30.22  ? 257 PRO A CA  1 
ATOM   1962  C C   . PRO A  1 260 ? 158.841 62.452  -8.518  1.00 30.07  ? 257 PRO A C   1 
ATOM   1963  O O   . PRO A  1 260 ? 159.934 61.953  -8.310  1.00 34.93  ? 257 PRO A O   1 
ATOM   1964  C CB  . PRO A  1 260 ? 158.297 64.548  -9.825  1.00 29.94  ? 257 PRO A CB  1 
ATOM   1965  C CG  . PRO A  1 260 ? 157.349 64.809  -10.969 1.00 29.16  ? 257 PRO A CG  1 
ATOM   1966  C CD  . PRO A  1 260 ? 156.457 63.596  -11.036 1.00 28.75  ? 257 PRO A CD  1 
ATOM   1967  N N   . ASP A  1 261 ? 157.862 62.440  -7.626  1.00 29.92  ? 258 ASP A N   1 
ATOM   1968  C CA  . ASP A  1 261 ? 158.085 62.007  -6.231  1.00 30.96  ? 258 ASP A CA  1 
ATOM   1969  C C   . ASP A  1 261 ? 158.302 60.529  -6.055  1.00 33.32  ? 258 ASP A C   1 
ATOM   1970  O O   . ASP A  1 261 ? 158.663 60.092  -4.971  1.00 37.38  ? 258 ASP A O   1 
ATOM   1971  C CB  . ASP A  1 261 ? 156.947 62.442  -5.301  1.00 30.96  ? 258 ASP A CB  1 
ATOM   1972  C CG  . ASP A  1 261 ? 155.600 61.811  -5.654  1.00 31.67  ? 258 ASP A CG  1 
ATOM   1973  O OD1 . ASP A  1 261 ? 155.289 61.593  -6.850  1.00 34.13  ? 258 ASP A OD1 1 
ATOM   1974  O OD2 . ASP A  1 261 ? 154.823 61.544  -4.725  1.00 29.95  ? 258 ASP A OD2 1 
ATOM   1975  N N   . ALA A  1 262 ? 158.100 59.756  -7.112  1.00 35.22  ? 259 ALA A N   1 
ATOM   1976  C CA  . ALA A  1 262 ? 158.326 58.309  -7.077  1.00 36.93  ? 259 ALA A CA  1 
ATOM   1977  C C   . ALA A  1 262 ? 159.719 57.892  -6.624  1.00 36.31  ? 259 ALA A C   1 
ATOM   1978  O O   . ALA A  1 262 ? 160.681 58.567  -6.938  1.00 36.61  ? 259 ALA A O   1 
ATOM   1979  C CB  . ALA A  1 262 ? 158.063 57.727  -8.454  1.00 37.60  ? 259 ALA A CB  1 
ATOM   1980  N N   . ASP A  1 263 ? 159.790 56.774  -5.898  1.00 37.77  ? 260 ASP A N   1 
ATOM   1981  C CA  . ASP A  1 263 ? 161.042 56.109  -5.564  1.00 40.79  ? 260 ASP A CA  1 
ATOM   1982  C C   . ASP A  1 263 ? 161.527 55.455  -6.850  1.00 39.04  ? 260 ASP A C   1 
ATOM   1983  O O   . ASP A  1 263 ? 160.992 54.428  -7.247  1.00 37.27  ? 260 ASP A O   1 
ATOM   1984  C CB  . ASP A  1 263 ? 160.817 55.079  -4.432  1.00 43.53  ? 260 ASP A CB  1 
ATOM   1985  C CG  . ASP A  1 263 ? 162.105 54.391  -3.953  1.00 49.41  ? 260 ASP A CG  1 
ATOM   1986  O OD1 . ASP A  1 263 ? 163.250 54.697  -4.410  1.00 54.79  ? 260 ASP A OD1 1 
ATOM   1987  O OD2 . ASP A  1 263 ? 161.941 53.513  -3.082  1.00 52.08  ? 260 ASP A OD2 1 
ATOM   1988  N N   . MET A  1 264 ? 162.522 56.078  -7.490  1.00 37.96  ? 261 MET A N   1 
ATOM   1989  C CA  . MET A  1 264 ? 163.017 55.645  -8.789  1.00 37.11  ? 261 MET A CA  1 
ATOM   1990  C C   . MET A  1 264 ? 163.682 54.262  -8.717  1.00 35.11  ? 261 MET A C   1 
ATOM   1991  O O   . MET A  1 264 ? 163.510 53.440  -9.623  1.00 32.16  ? 261 MET A O   1 
ATOM   1992  C CB  . MET A  1 264 ? 163.967 56.701  -9.385  1.00 38.48  ? 261 MET A CB  1 
ATOM   1993  C CG  . MET A  1 264 ? 164.138 56.591  -10.902 1.00 41.56  ? 261 MET A CG  1 
ATOM   1994  S SD  . MET A  1 264 ? 162.589 56.730  -11.837 1.00 42.41  ? 261 MET A SD  1 
ATOM   1995  C CE  . MET A  1 264 ? 162.078 58.390  -11.367 1.00 40.79  ? 261 MET A CE  1 
ATOM   1996  N N   . ASP A  1 265 ? 164.415 54.004  -7.634  1.00 34.65  ? 262 ASP A N   1 
ATOM   1997  C CA  . ASP A  1 265 ? 165.106 52.720  -7.473  1.00 34.85  ? 262 ASP A CA  1 
ATOM   1998  C C   . ASP A  1 265 ? 164.137 51.562  -7.345  1.00 32.68  ? 262 ASP A C   1 
ATOM   1999  O O   . ASP A  1 265 ? 164.367 50.502  -7.904  1.00 31.08  ? 262 ASP A O   1 
ATOM   2000  C CB  . ASP A  1 265 ? 166.057 52.748  -6.275  1.00 36.07  ? 262 ASP A CB  1 
ATOM   2001  C CG  . ASP A  1 265 ? 167.335 53.541  -6.551  1.00 37.38  ? 262 ASP A CG  1 
ATOM   2002  O OD1 . ASP A  1 265 ? 167.656 53.813  -7.732  1.00 37.51  ? 262 ASP A OD1 1 
ATOM   2003  O OD2 . ASP A  1 265 ? 168.032 53.883  -5.574  1.00 38.79  ? 262 ASP A OD2 1 
ATOM   2004  N N   . ASN A  1 266 ? 163.050 51.780  -6.621  1.00 31.74  ? 263 ASN A N   1 
ATOM   2005  C CA  . ASN A  1 266 ? 161.996 50.783  -6.508  1.00 32.54  ? 263 ASN A CA  1 
ATOM   2006  C C   . ASN A  1 266 ? 161.224 50.554  -7.805  1.00 32.02  ? 263 ASN A C   1 
ATOM   2007  O O   . ASN A  1 266 ? 160.837 49.441  -8.113  1.00 32.85  ? 263 ASN A O   1 
ATOM   2008  C CB  . ASN A  1 266 ? 161.016 51.196  -5.409  1.00 35.41  ? 263 ASN A CB  1 
ATOM   2009  C CG  . ASN A  1 266 ? 159.937 50.141  -5.143  1.00 37.90  ? 263 ASN A CG  1 
ATOM   2010  O OD1 . ASN A  1 266 ? 158.788 50.264  -5.618  1.00 40.80  ? 263 ASN A OD1 1 
ATOM   2011  N ND2 . ASN A  1 266 ? 160.308 49.082  -4.408  1.00 37.39  ? 263 ASN A ND2 1 
ATOM   2012  N N   . ALA A  1 267 ? 160.975 51.621  -8.547  1.00 32.88  ? 264 ALA A N   1 
ATOM   2013  C CA  . ALA A  1 267 ? 160.251 51.547  -9.811  1.00 31.34  ? 264 ALA A CA  1 
ATOM   2014  C C   . ALA A  1 267 ? 161.036 50.727  -10.850 1.00 30.74  ? 264 ALA A C   1 
ATOM   2015  O O   . ALA A  1 267 ? 160.486 49.799  -11.459 1.00 29.59  ? 264 ALA A O   1 
ATOM   2016  C CB  . ALA A  1 267 ? 159.965 52.957  -10.332 1.00 30.86  ? 264 ALA A CB  1 
ATOM   2017  N N   . VAL A  1 268 ? 162.316 51.066  -11.030 1.00 29.14  ? 265 VAL A N   1 
ATOM   2018  C CA  . VAL A  1 268 ? 163.181 50.385  -11.996 1.00 28.30  ? 265 VAL A CA  1 
ATOM   2019  C C   . VAL A  1 268 ? 163.206 48.919  -11.623 1.00 28.90  ? 265 VAL A C   1 
ATOM   2020  O O   . VAL A  1 268 ? 162.930 48.056  -12.438 1.00 29.93  ? 265 VAL A O   1 
ATOM   2021  C CB  . VAL A  1 268 ? 164.611 50.988  -12.001 1.00 27.25  ? 265 VAL A CB  1 
ATOM   2022  C CG1 . VAL A  1 268 ? 165.626 50.102  -12.701 1.00 26.45  ? 265 VAL A CG1 1 
ATOM   2023  C CG2 . VAL A  1 268 ? 164.597 52.349  -12.663 1.00 27.81  ? 265 VAL A CG2 1 
ATOM   2024  N N   . ASN A  1 269 ? 163.501 48.650  -10.369 1.00 30.37  ? 266 ASN A N   1 
ATOM   2025  C CA  . ASN A  1 269 ? 163.625 47.289  -9.914  1.00 36.00  ? 266 ASN A CA  1 
ATOM   2026  C C   . ASN A  1 269 ? 162.334 46.491  -10.149 1.00 35.65  ? 266 ASN A C   1 
ATOM   2027  O O   . ASN A  1 269 ? 162.373 45.322  -10.564 1.00 37.85  ? 266 ASN A O   1 
ATOM   2028  C CB  . ASN A  1 269 ? 164.041 47.261  -8.433  1.00 40.44  ? 266 ASN A CB  1 
ATOM   2029  C CG  . ASN A  1 269 ? 164.523 45.882  -7.968  1.00 44.22  ? 266 ASN A CG  1 
ATOM   2030  O OD1 . ASN A  1 269 ? 165.229 45.159  -8.686  1.00 51.50  ? 266 ASN A OD1 1 
ATOM   2031  N ND2 . ASN A  1 269 ? 164.159 45.521  -6.754  1.00 45.21  ? 266 ASN A ND2 1 
ATOM   2032  N N   . GLN A  1 270 ? 161.195 47.128  -9.922  1.00 34.07  ? 267 GLN A N   1 
ATOM   2033  C CA  . GLN A  1 270 ? 159.925 46.483  -10.200 1.00 33.60  ? 267 GLN A CA  1 
ATOM   2034  C C   . GLN A  1 270 ? 159.608 46.410  -11.692 1.00 33.56  ? 267 GLN A C   1 
ATOM   2035  O O   . GLN A  1 270 ? 159.020 45.427  -12.142 1.00 34.07  ? 267 GLN A O   1 
ATOM   2036  C CB  . GLN A  1 270 ? 158.801 47.154  -9.436  1.00 35.31  ? 267 GLN A CB  1 
ATOM   2037  C CG  . GLN A  1 270 ? 158.718 46.715  -7.979  1.00 36.46  ? 267 GLN A CG  1 
ATOM   2038  C CD  . GLN A  1 270 ? 157.416 47.149  -7.321  1.00 38.26  ? 267 GLN A CD  1 
ATOM   2039  O OE1 . GLN A  1 270 ? 156.569 46.317  -7.021  1.00 42.48  ? 267 GLN A OE1 1 
ATOM   2040  N NE2 . GLN A  1 270 ? 157.233 48.460  -7.133  1.00 37.89  ? 267 GLN A NE2 1 
ATOM   2041  N N   . LEU A  1 271 ? 160.026 47.413  -12.463 1.00 33.07  ? 268 LEU A N   1 
ATOM   2042  C CA  . LEU A  1 271 ? 159.786 47.426  -13.923 1.00 32.76  ? 268 LEU A CA  1 
ATOM   2043  C C   . LEU A  1 271 ? 160.575 46.384  -14.725 1.00 31.81  ? 268 LEU A C   1 
ATOM   2044  O O   . LEU A  1 271 ? 160.221 46.089  -15.860 1.00 31.72  ? 268 LEU A O   1 
ATOM   2045  C CB  . LEU A  1 271 ? 160.016 48.831  -14.500 1.00 34.43  ? 268 LEU A CB  1 
ATOM   2046  C CG  . LEU A  1 271 ? 158.907 49.865  -14.179 1.00 34.82  ? 268 LEU A CG  1 
ATOM   2047  C CD1 . LEU A  1 271 ? 159.405 51.272  -14.462 1.00 35.46  ? 268 LEU A CD1 1 
ATOM   2048  C CD2 . LEU A  1 271 ? 157.617 49.600  -14.947 1.00 33.29  ? 268 LEU A CD2 1 
ATOM   2049  N N   . LEU A  1 272 ? 161.645 45.853  -14.142 1.00 31.71  ? 269 LEU A N   1 
ATOM   2050  C CA  . LEU A  1 272 ? 162.415 44.756  -14.734 1.00 31.05  ? 269 LEU A CA  1 
ATOM   2051  C C   . LEU A  1 272 ? 161.566 43.524  -14.915 1.00 29.27  ? 269 LEU A C   1 
ATOM   2052  O O   . LEU A  1 272 ? 161.497 42.958  -15.998 1.00 28.64  ? 269 LEU A O   1 
ATOM   2053  C CB  . LEU A  1 272 ? 163.592 44.366  -13.823 1.00 32.88  ? 269 LEU A CB  1 
ATOM   2054  C CG  . LEU A  1 272 ? 164.904 45.127  -13.938 1.00 33.03  ? 269 LEU A CG  1 
ATOM   2055  C CD1 . LEU A  1 272 ? 165.790 44.824  -12.749 1.00 33.21  ? 269 LEU A CD1 1 
ATOM   2056  C CD2 . LEU A  1 272 ? 165.601 44.733  -15.228 1.00 33.80  ? 269 LEU A CD2 1 
ATOM   2057  N N   . GLY A  1 273 ? 160.957 43.093  -13.814 1.00 28.67  ? 270 GLY A N   1 
ATOM   2058  C CA  . GLY A  1 273 ? 160.116 41.895  -13.803 1.00 27.18  ? 270 GLY A CA  1 
ATOM   2059  C C   . GLY A  1 273 ? 158.829 42.090  -14.582 1.00 26.40  ? 270 GLY A C   1 
ATOM   2060  O O   . GLY A  1 273 ? 158.347 41.173  -15.234 1.00 26.86  ? 270 GLY A O   1 
ATOM   2061  N N   . ALA A  1 274 ? 158.281 43.301  -14.536 1.00 24.76  ? 271 ALA A N   1 
ATOM   2062  C CA  . ALA A  1 274 ? 157.022 43.599  -15.209 1.00 23.40  ? 271 ALA A CA  1 
ATOM   2063  C C   . ALA A  1 274 ? 157.133 43.777  -16.739 1.00 23.09  ? 271 ALA A C   1 
ATOM   2064  O O   . ALA A  1 274 ? 156.206 43.434  -17.489 1.00 23.46  ? 271 ALA A O   1 
ATOM   2065  C CB  . ALA A  1 274 ? 156.405 44.820  -14.578 1.00 23.33  ? 271 ALA A CB  1 
ATOM   2066  N N   . ALA A  1 275 ? 158.247 44.337  -17.195 1.00 22.24  ? 272 ALA A N   1 
ATOM   2067  C CA  . ALA A  1 275 ? 158.478 44.543  -18.615 1.00 21.37  ? 272 ALA A CA  1 
ATOM   2068  C C   . ALA A  1 275 ? 159.017 43.291  -19.294 1.00 20.57  ? 272 ALA A C   1 
ATOM   2069  O O   . ALA A  1 275 ? 158.500 42.875  -20.310 1.00 19.86  ? 272 ALA A O   1 
ATOM   2070  C CB  . ALA A  1 275 ? 159.427 45.709  -18.811 1.00 21.20  ? 272 ALA A CB  1 
ATOM   2071  N N   . PHE A  1 276 ? 160.050 42.695  -18.708 1.00 21.18  ? 273 PHE A N   1 
ATOM   2072  C CA  . PHE A  1 276 ? 160.835 41.608  -19.345 1.00 21.40  ? 273 PHE A CA  1 
ATOM   2073  C C   . PHE A  1 276 ? 160.584 40.204  -18.792 1.00 21.56  ? 273 PHE A C   1 
ATOM   2074  O O   . PHE A  1 276 ? 161.059 39.207  -19.366 1.00 21.37  ? 273 PHE A O   1 
ATOM   2075  C CB  . PHE A  1 276 ? 162.320 41.938  -19.229 1.00 20.68  ? 273 PHE A CB  1 
ATOM   2076  C CG  . PHE A  1 276 ? 162.625 43.336  -19.604 1.00 20.68  ? 273 PHE A CG  1 
ATOM   2077  C CD1 . PHE A  1 276 ? 162.428 43.751  -20.910 1.00 21.34  ? 273 PHE A CD1 1 
ATOM   2078  C CD2 . PHE A  1 276 ? 163.053 44.256  -18.661 1.00 20.80  ? 273 PHE A CD2 1 
ATOM   2079  C CE1 . PHE A  1 276 ? 162.690 45.059  -21.285 1.00 22.03  ? 273 PHE A CE1 1 
ATOM   2080  C CE2 . PHE A  1 276 ? 163.306 45.575  -19.023 1.00 21.55  ? 273 PHE A CE2 1 
ATOM   2081  C CZ  . PHE A  1 276 ? 163.125 45.979  -20.337 1.00 21.68  ? 273 PHE A CZ  1 
ATOM   2082  N N   . GLY A  1 277 ? 159.849 40.124  -17.686 1.00 21.42  ? 274 GLY A N   1 
ATOM   2083  C CA  . GLY A  1 277 ? 159.428 38.839  -17.145 1.00 21.62  ? 274 GLY A CA  1 
ATOM   2084  C C   . GLY A  1 277 ? 158.632 38.082  -18.174 1.00 21.63  ? 274 GLY A C   1 
ATOM   2085  O O   . GLY A  1 277 ? 157.989 38.680  -19.045 1.00 20.87  ? 274 GLY A O   1 
ATOM   2086  N N   . SER A  1 278 ? 158.715 36.760  -18.099 1.00 22.27  ? 275 SER A N   1 
ATOM   2087  C CA  . SER A  1 278 ? 158.122 35.878  -19.108 1.00 22.69  ? 275 SER A CA  1 
ATOM   2088  C C   . SER A  1 278 ? 158.327 36.440  -20.531 1.00 22.97  ? 275 SER A C   1 
ATOM   2089  O O   . SER A  1 278 ? 157.432 36.349  -21.384 1.00 23.07  ? 275 SER A O   1 
ATOM   2090  C CB  . SER A  1 278 ? 156.630 35.598  -18.800 1.00 22.82  ? 275 SER A CB  1 
ATOM   2091  O OG  . SER A  1 278 ? 156.461 34.924  -17.556 1.00 22.95  ? 275 SER A OG  1 
ATOM   2092  N N   . SER A  1 279 ? 159.514 37.016  -20.757 1.00 23.24  ? 276 SER A N   1 
ATOM   2093  C CA  . SER A  1 279 ? 159.938 37.563  -22.050 1.00 23.72  ? 276 SER A CA  1 
ATOM   2094  C C   . SER A  1 279 ? 158.939 38.575  -22.614 1.00 24.83  ? 276 SER A C   1 
ATOM   2095  O O   . SER A  1 279 ? 158.754 38.655  -23.830 1.00 24.41  ? 276 SER A O   1 
ATOM   2096  C CB  . SER A  1 279 ? 160.174 36.434  -23.054 1.00 24.16  ? 276 SER A CB  1 
ATOM   2097  O OG  . SER A  1 279 ? 160.836 35.338  -22.437 1.00 25.93  ? 276 SER A OG  1 
ATOM   2098  N N   . GLY A  1 280 ? 158.293 39.336  -21.719 1.00 25.67  ? 277 GLY A N   1 
ATOM   2099  C CA  . GLY A  1 280 ? 157.218 40.270  -22.075 1.00 25.30  ? 277 GLY A CA  1 
ATOM   2100  C C   . GLY A  1 280 ? 155.920 39.688  -22.645 1.00 26.02  ? 277 GLY A C   1 
ATOM   2101  O O   . GLY A  1 280 ? 155.031 40.441  -23.041 1.00 26.85  ? 277 GLY A O   1 
ATOM   2102  N N   . GLU A  1 281 ? 155.792 38.360  -22.671 1.00 26.71  ? 278 GLU A N   1 
ATOM   2103  C CA  . GLU A  1 281 ? 154.686 37.660  -23.342 1.00 27.02  ? 278 GLU A CA  1 
ATOM   2104  C C   . GLU A  1 281 ? 153.597 37.422  -22.329 1.00 27.60  ? 278 GLU A C   1 
ATOM   2105  O O   . GLU A  1 281 ? 153.349 36.297  -21.912 1.00 26.23  ? 278 GLU A O   1 
ATOM   2106  C CB  . GLU A  1 281 ? 155.151 36.301  -23.882 1.00 27.84  ? 278 GLU A CB  1 
ATOM   2107  C CG  . GLU A  1 281 ? 156.151 36.301  -25.033 1.00 27.01  ? 278 GLU A CG  1 
ATOM   2108  C CD  . GLU A  1 281 ? 156.536 34.884  -25.426 1.00 26.52  ? 278 GLU A CD  1 
ATOM   2109  O OE1 . GLU A  1 281 ? 156.894 34.111  -24.523 1.00 24.85  ? 278 GLU A OE1 1 
ATOM   2110  O OE2 . GLU A  1 281 ? 156.462 34.528  -26.625 1.00 28.00  ? 278 GLU A OE2 1 
ATOM   2111  N N   . ARG A  1 282 ? 152.970 38.513  -21.928 1.00 30.71  ? 279 ARG A N   1 
ATOM   2112  C CA  . ARG A  1 282 ? 152.107 38.558  -20.754 1.00 32.47  ? 279 ARG A CA  1 
ATOM   2113  C C   . ARG A  1 282 ? 151.107 39.684  -21.029 1.00 32.69  ? 279 ARG A C   1 
ATOM   2114  O O   . ARG A  1 282 ? 151.475 40.780  -21.469 1.00 30.19  ? 279 ARG A O   1 
ATOM   2115  C CB  . ARG A  1 282 ? 152.956 38.802  -19.465 1.00 35.40  ? 279 ARG A CB  1 
ATOM   2116  C CG  . ARG A  1 282 ? 152.279 38.508  -18.116 1.00 39.10  ? 279 ARG A CG  1 
ATOM   2117  C CD  . ARG A  1 282 ? 153.207 37.964  -17.017 1.00 41.47  ? 279 ARG A CD  1 
ATOM   2118  N NE  . ARG A  1 282 ? 154.176 38.935  -16.517 1.00 45.61  ? 279 ARG A NE  1 
ATOM   2119  C CZ  . ARG A  1 282 ? 155.282 38.651  -15.806 1.00 47.79  ? 279 ARG A CZ  1 
ATOM   2120  N NH1 . ARG A  1 282 ? 155.614 37.398  -15.479 1.00 46.62  ? 279 ARG A NH1 1 
ATOM   2121  N NH2 . ARG A  1 282 ? 156.093 39.643  -15.428 1.00 46.88  ? 279 ARG A NH2 1 
ATOM   2122  N N   . CYS A  1 283 ? 149.834 39.384  -20.822 1.00 34.30  ? 280 CYS A N   1 
ATOM   2123  C CA  . CYS A  1 283 ? 148.745 40.383  -20.876 1.00 34.40  ? 280 CYS A CA  1 
ATOM   2124  C C   . CYS A  1 283 ? 148.842 41.519  -19.885 1.00 30.22  ? 280 CYS A C   1 
ATOM   2125  O O   . CYS A  1 283 ? 148.129 42.505  -20.031 1.00 27.46  ? 280 CYS A O   1 
ATOM   2126  C CB  . CYS A  1 283 ? 147.449 39.689  -20.545 1.00 37.05  ? 280 CYS A CB  1 
ATOM   2127  S SG  . CYS A  1 283 ? 147.667 38.463  -19.201 1.00 47.16  ? 280 CYS A SG  1 
ATOM   2128  N N   . MET A  1 284 ? 149.633 41.324  -18.828 1.00 28.64  ? 281 MET A N   1 
ATOM   2129  C CA  . MET A  1 284 ? 149.833 42.330  -17.796 1.00 27.19  ? 281 MET A CA  1 
ATOM   2130  C C   . MET A  1 284 ? 151.227 42.898  -17.845 1.00 25.24  ? 281 MET A C   1 
ATOM   2131  O O   . MET A  1 284 ? 151.632 43.644  -16.951 1.00 25.81  ? 281 MET A O   1 
ATOM   2132  C CB  . MET A  1 284 ? 149.537 41.727  -16.429 1.00 27.19  ? 281 MET A CB  1 
ATOM   2133  C CG  . MET A  1 284 ? 148.043 41.511  -16.164 1.00 27.77  ? 281 MET A CG  1 
ATOM   2134  S SD  . MET A  1 284 ? 147.145 42.986  -15.569 1.00 27.36  ? 281 MET A SD  1 
ATOM   2135  C CE  . MET A  1 284 ? 146.370 43.507  -17.083 1.00 28.34  ? 281 MET A CE  1 
ATOM   2136  N N   . ALA A  1 285 ? 151.940 42.568  -18.910 1.00 24.11  ? 282 ALA A N   1 
ATOM   2137  C CA  . ALA A  1 285 ? 153.293 43.041  -19.102 1.00 24.53  ? 282 ALA A CA  1 
ATOM   2138  C C   . ALA A  1 285 ? 153.258 44.546  -19.199 1.00 24.60  ? 282 ALA A C   1 
ATOM   2139  O O   . ALA A  1 285 ? 152.477 45.117  -19.968 1.00 25.49  ? 282 ALA A O   1 
ATOM   2140  C CB  . ALA A  1 285 ? 153.921 42.447  -20.362 1.00 24.25  ? 282 ALA A CB  1 
ATOM   2141  N N   . LEU A  1 286 ? 154.109 45.180  -18.410 1.00 24.33  ? 283 LEU A N   1 
ATOM   2142  C CA  . LEU A  1 286 ? 154.208 46.619  -18.421 1.00 24.71  ? 283 LEU A CA  1 
ATOM   2143  C C   . LEU A  1 286 ? 155.157 47.077  -19.531 1.00 24.72  ? 283 LEU A C   1 
ATOM   2144  O O   . LEU A  1 286 ? 156.379 47.042  -19.367 1.00 25.47  ? 283 LEU A O   1 
ATOM   2145  C CB  . LEU A  1 286 ? 154.662 47.113  -17.063 1.00 24.88  ? 283 LEU A CB  1 
ATOM   2146  C CG  . LEU A  1 286 ? 153.892 48.374  -16.731 1.00 26.42  ? 283 LEU A CG  1 
ATOM   2147  C CD1 . LEU A  1 286 ? 153.949 48.522  -15.251 1.00 28.82  ? 283 LEU A CD1 1 
ATOM   2148  C CD2 . LEU A  1 286 ? 154.454 49.605  -17.414 1.00 26.57  ? 283 LEU A CD2 1 
ATOM   2149  N N   . SER A  1 287 ? 154.567 47.509  -20.651 1.00 23.85  ? 284 SER A N   1 
ATOM   2150  C CA  . SER A  1 287 ? 155.287 47.801  -21.907 1.00 22.29  ? 284 SER A CA  1 
ATOM   2151  C C   . SER A  1 287 ? 155.569 49.285  -22.151 1.00 21.78  ? 284 SER A C   1 
ATOM   2152  O O   . SER A  1 287 ? 156.375 49.627  -23.014 1.00 21.89  ? 284 SER A O   1 
ATOM   2153  C CB  . SER A  1 287 ? 154.497 47.253  -23.087 1.00 21.02  ? 284 SER A CB  1 
ATOM   2154  O OG  . SER A  1 287 ? 153.126 47.460  -22.882 1.00 19.84  ? 284 SER A OG  1 
ATOM   2155  N N   . VAL A  1 288 ? 154.911 50.159  -21.396 1.00 20.95  ? 285 VAL A N   1 
ATOM   2156  C CA  . VAL A  1 288 ? 155.062 51.597  -21.567 1.00 19.97  ? 285 VAL A CA  1 
ATOM   2157  C C   . VAL A  1 288 ? 155.254 52.296  -20.219 1.00 19.90  ? 285 VAL A C   1 
ATOM   2158  O O   . VAL A  1 288 ? 154.429 52.207  -19.319 1.00 18.16  ? 285 VAL A O   1 
ATOM   2159  C CB  . VAL A  1 288 ? 153.849 52.208  -22.294 1.00 19.75  ? 285 VAL A CB  1 
ATOM   2160  C CG1 . VAL A  1 288 ? 154.110 53.662  -22.656 1.00 19.79  ? 285 VAL A CG1 1 
ATOM   2161  C CG2 . VAL A  1 288 ? 153.513 51.422  -23.549 1.00 19.62  ? 285 VAL A CG2 1 
ATOM   2162  N N   . ALA A  1 289 ? 156.360 53.007  -20.093 1.00 21.08  ? 286 ALA A N   1 
ATOM   2163  C CA  . ALA A  1 289 ? 156.596 53.827  -18.920 1.00 22.67  ? 286 ALA A CA  1 
ATOM   2164  C C   . ALA A  1 289 ? 156.384 55.285  -19.338 1.00 23.21  ? 286 ALA A C   1 
ATOM   2165  O O   . ALA A  1 289 ? 157.061 55.804  -20.226 1.00 23.26  ? 286 ALA A O   1 
ATOM   2166  C CB  . ALA A  1 289 ? 158.008 53.599  -18.404 1.00 23.57  ? 286 ALA A CB  1 
ATOM   2167  N N   . VAL A  1 290 ? 155.400 55.934  -18.748 1.00 23.33  ? 287 VAL A N   1 
ATOM   2168  C CA  . VAL A  1 290 ? 155.116 57.324  -19.090 1.00 23.91  ? 287 VAL A CA  1 
ATOM   2169  C C   . VAL A  1 290 ? 155.784 58.249  -18.069 1.00 24.10  ? 287 VAL A C   1 
ATOM   2170  O O   . VAL A  1 290 ? 155.251 58.473  -16.986 1.00 23.93  ? 287 VAL A O   1 
ATOM   2171  C CB  . VAL A  1 290 ? 153.602 57.581  -19.163 1.00 24.36  ? 287 VAL A CB  1 
ATOM   2172  C CG1 . VAL A  1 290 ? 153.309 58.976  -19.697 1.00 24.23  ? 287 VAL A CG1 1 
ATOM   2173  C CG2 . VAL A  1 290 ? 152.944 56.549  -20.058 1.00 24.84  ? 287 VAL A CG2 1 
ATOM   2174  N N   . ALA A  1 291 ? 156.949 58.784  -18.424 1.00 24.29  ? 288 ALA A N   1 
ATOM   2175  C CA  . ALA A  1 291 ? 157.707 59.635  -17.522 1.00 24.65  ? 288 ALA A CA  1 
ATOM   2176  C C   . ALA A  1 291 ? 157.172 61.059  -17.587 1.00 25.58  ? 288 ALA A C   1 
ATOM   2177  O O   . ALA A  1 291 ? 157.203 61.686  -18.627 1.00 24.93  ? 288 ALA A O   1 
ATOM   2178  C CB  . ALA A  1 291 ? 159.175 59.604  -17.880 1.00 24.88  ? 288 ALA A CB  1 
ATOM   2179  N N   . VAL A  1 292 ? 156.661 61.556  -16.471 1.00 27.74  ? 289 VAL A N   1 
ATOM   2180  C CA  . VAL A  1 292 ? 156.111 62.916  -16.413 1.00 29.62  ? 289 VAL A CA  1 
ATOM   2181  C C   . VAL A  1 292 ? 157.239 63.873  -15.991 1.00 31.57  ? 289 VAL A C   1 
ATOM   2182  O O   . VAL A  1 292 ? 157.668 63.897  -14.834 1.00 30.28  ? 289 VAL A O   1 
ATOM   2183  C CB  . VAL A  1 292 ? 154.794 63.032  -15.567 1.00 29.70  ? 289 VAL A CB  1 
ATOM   2184  C CG1 . VAL A  1 292 ? 154.804 62.126  -14.360 1.00 31.18  ? 289 VAL A CG1 1 
ATOM   2185  C CG2 . VAL A  1 292 ? 154.511 64.468  -15.139 1.00 28.73  ? 289 VAL A CG2 1 
ATOM   2186  N N   . GLY A  1 293 ? 157.704 64.657  -16.963 1.00 35.52  ? 290 GLY A N   1 
ATOM   2187  C CA  . GLY A  1 293 ? 158.889 65.499  -16.819 1.00 39.13  ? 290 GLY A CA  1 
ATOM   2188  C C   . GLY A  1 293 ? 160.130 64.724  -17.195 1.00 43.33  ? 290 GLY A C   1 
ATOM   2189  O O   . GLY A  1 293 ? 160.066 63.506  -17.416 1.00 44.79  ? 290 GLY A O   1 
ATOM   2190  N N   . ASP A  1 294 ? 161.263 65.421  -17.259 1.00 47.14  ? 291 ASP A N   1 
ATOM   2191  C CA  . ASP A  1 294 ? 162.527 64.753  -17.546 1.00 48.96  ? 291 ASP A CA  1 
ATOM   2192  C C   . ASP A  1 294 ? 163.754 65.567  -17.191 1.00 55.57  ? 291 ASP A C   1 
ATOM   2193  O O   . ASP A  1 294 ? 164.313 66.211  -18.085 1.00 72.03  ? 291 ASP A O   1 
ATOM   2194  C CB  . ASP A  1 294 ? 162.582 64.341  -19.038 1.00 46.31  ? 291 ASP A CB  1 
ATOM   2195  C CG  . ASP A  1 294 ? 162.143 65.455  -20.028 1.00 39.85  ? 291 ASP A CG  1 
ATOM   2196  O OD1 . ASP A  1 294 ? 162.045 66.623  -19.634 1.00 37.71  ? 291 ASP A OD1 1 
ATOM   2197  O OD2 . ASP A  1 294 ? 161.917 65.153  -21.218 1.00 32.93  ? 291 ASP A OD2 1 
ATOM   2198  N N   . ALA A  1 295 ? 164.231 65.593  -15.941 1.00 56.98  ? 292 ALA A N   1 
ATOM   2199  C CA  . ALA A  1 295 ? 163.676 64.996  -14.726 1.00 51.88  ? 292 ALA A CA  1 
ATOM   2200  C C   . ALA A  1 295 ? 163.544 63.479  -14.788 1.00 50.87  ? 292 ALA A C   1 
ATOM   2201  O O   . ALA A  1 295 ? 164.495 62.790  -15.139 1.00 55.28  ? 292 ALA A O   1 
ATOM   2202  C CB  . ALA A  1 295 ? 162.385 65.710  -14.317 1.00 54.33  ? 292 ALA A CB  1 
ATOM   2203  N N   . ALA A  1 296 ? 162.363 62.963  -14.478 1.00 49.90  ? 293 ALA A N   1 
ATOM   2204  C CA  . ALA A  1 296 ? 162.130 61.536  -14.263 1.00 45.91  ? 293 ALA A CA  1 
ATOM   2205  C C   . ALA A  1 296 ? 162.368 60.661  -15.493 1.00 44.30  ? 293 ALA A C   1 
ATOM   2206  O O   . ALA A  1 296 ? 162.775 59.512  -15.359 1.00 40.75  ? 293 ALA A O   1 
ATOM   2207  C CB  . ALA A  1 296 ? 160.706 61.339  -13.767 1.00 46.29  ? 293 ALA A CB  1 
ATOM   2208  N N   . GLY A  1 297 ? 162.070 61.187  -16.678 1.00 43.05  ? 294 GLY A N   1 
ATOM   2209  C CA  . GLY A  1 297 ? 162.422 60.517  -17.917 1.00 41.89  ? 294 GLY A CA  1 
ATOM   2210  C C   . GLY A  1 297 ? 163.883 60.112  -17.930 1.00 42.79  ? 294 GLY A C   1 
ATOM   2211  O O   . GLY A  1 297 ? 164.196 58.932  -18.119 1.00 42.32  ? 294 GLY A O   1 
ATOM   2212  N N   . ASP A  1 298 ? 164.768 61.087  -17.689 1.00 43.35  ? 295 ASP A N   1 
ATOM   2213  C CA  . ASP A  1 298 ? 166.221 60.881  -17.799 1.00 39.05  ? 295 ASP A CA  1 
ATOM   2214  C C   . ASP A  1 298 ? 166.717 59.938  -16.736 1.00 35.81  ? 295 ASP A C   1 
ATOM   2215  O O   . ASP A  1 298 ? 167.561 59.083  -17.007 1.00 36.00  ? 295 ASP A O   1 
ATOM   2216  C CB  . ASP A  1 298 ? 166.977 62.201  -17.701 1.00 37.74  ? 295 ASP A CB  1 
ATOM   2217  C CG  . ASP A  1 298 ? 166.665 63.136  -18.837 1.00 38.19  ? 295 ASP A CG  1 
ATOM   2218  O OD1 . ASP A  1 298 ? 166.155 62.681  -19.904 1.00 35.30  ? 295 ASP A OD1 1 
ATOM   2219  O OD2 . ASP A  1 298 ? 166.943 64.339  -18.639 1.00 39.54  ? 295 ASP A OD2 1 
ATOM   2220  N N   . ALA A  1 299 ? 166.176 60.093  -15.534 1.00 34.43  ? 296 ALA A N   1 
ATOM   2221  C CA  . ALA A  1 299 ? 166.574 59.267  -14.381 1.00 35.90  ? 296 ALA A CA  1 
ATOM   2222  C C   . ALA A  1 299 ? 166.087 57.810  -14.470 1.00 36.74  ? 296 ALA A C   1 
ATOM   2223  O O   . ALA A  1 299 ? 166.796 56.891  -14.064 1.00 37.91  ? 296 ALA A O   1 
ATOM   2224  C CB  . ALA A  1 299 ? 166.102 59.911  -13.086 1.00 34.79  ? 296 ALA A CB  1 
ATOM   2225  N N   . LEU A  1 300 ? 164.878 57.618  -14.995 1.00 36.36  ? 297 LEU A N   1 
ATOM   2226  C CA  . LEU A  1 300 ? 164.368 56.298  -15.358 1.00 35.35  ? 297 LEU A CA  1 
ATOM   2227  C C   . LEU A  1 300 ? 165.300 55.629  -16.366 1.00 36.70  ? 297 LEU A C   1 
ATOM   2228  O O   . LEU A  1 300 ? 165.845 54.572  -16.071 1.00 37.71  ? 297 LEU A O   1 
ATOM   2229  C CB  . LEU A  1 300 ? 162.946 56.401  -15.946 1.00 35.21  ? 297 LEU A CB  1 
ATOM   2230  C CG  . LEU A  1 300 ? 162.187 55.128  -16.375 1.00 34.19  ? 297 LEU A CG  1 
ATOM   2231  C CD1 . LEU A  1 300 ? 161.868 54.299  -15.165 1.00 34.09  ? 297 LEU A CD1 1 
ATOM   2232  C CD2 . LEU A  1 300 ? 160.885 55.392  -17.125 1.00 34.32  ? 297 LEU A CD2 1 
ATOM   2233  N N   . VAL A  1 301 ? 165.492 56.251  -17.533 1.00 37.36  ? 298 VAL A N   1 
ATOM   2234  C CA  . VAL A  1 301 ? 166.297 55.644  -18.611 1.00 38.37  ? 298 VAL A CA  1 
ATOM   2235  C C   . VAL A  1 301 ? 167.725 55.348  -18.140 1.00 39.60  ? 298 VAL A C   1 
ATOM   2236  O O   . VAL A  1 301 ? 168.286 54.299  -18.463 1.00 40.66  ? 298 VAL A O   1 
ATOM   2237  C CB  . VAL A  1 301 ? 166.311 56.494  -19.904 1.00 36.56  ? 298 VAL A CB  1 
ATOM   2238  C CG1 . VAL A  1 301 ? 167.227 55.882  -20.965 1.00 36.04  ? 298 VAL A CG1 1 
ATOM   2239  C CG2 . VAL A  1 301 ? 164.908 56.581  -20.469 1.00 37.07  ? 298 VAL A CG2 1 
ATOM   2240  N N   . SER A  1 302 ? 168.293 56.271  -17.370 1.00 40.37  ? 299 SER A N   1 
ATOM   2241  C CA  . SER A  1 302 ? 169.620 56.089  -16.805 1.00 39.70  ? 299 SER A CA  1 
ATOM   2242  C C   . SER A  1 302 ? 169.671 54.780  -16.022 1.00 36.36  ? 299 SER A C   1 
ATOM   2243  O O   . SER A  1 302 ? 170.339 53.828  -16.410 1.00 34.00  ? 299 SER A O   1 
ATOM   2244  C CB  . SER A  1 302 ? 169.984 57.285  -15.916 1.00 40.89  ? 299 SER A CB  1 
ATOM   2245  O OG  . SER A  1 302 ? 171.132 57.042  -15.111 1.00 41.79  ? 299 SER A OG  1 
ATOM   2246  N N   . LYS A  1 303 ? 168.897 54.725  -14.959 1.00 37.01  ? 300 LYS A N   1 
ATOM   2247  C CA  . LYS A  1 303 ? 168.924 53.580  -14.030 1.00 38.29  ? 300 LYS A CA  1 
ATOM   2248  C C   . LYS A  1 303 ? 168.456 52.261  -14.624 1.00 36.13  ? 300 LYS A C   1 
ATOM   2249  O O   . LYS A  1 303 ? 168.928 51.203  -14.229 1.00 33.22  ? 300 LYS A O   1 
ATOM   2250  C CB  . LYS A  1 303 ? 168.060 53.892  -12.818 1.00 38.41  ? 300 LYS A CB  1 
ATOM   2251  C CG  . LYS A  1 303 ? 168.578 55.077  -12.045 1.00 39.82  ? 300 LYS A CG  1 
ATOM   2252  C CD  . LYS A  1 303 ? 167.937 55.192  -10.689 1.00 42.15  ? 300 LYS A CD  1 
ATOM   2253  C CE  . LYS A  1 303 ? 168.405 56.460  -9.994  1.00 44.06  ? 300 LYS A CE  1 
ATOM   2254  N NZ  . LYS A  1 303 ? 168.195 56.391  -8.523  1.00 46.34  ? 300 LYS A NZ  1 
ATOM   2255  N N   . MET A  1 304 ? 167.511 52.352  -15.555 1.00 37.23  ? 301 MET A N   1 
ATOM   2256  C CA  . MET A  1 304 ? 166.958 51.197  -16.233 1.00 36.80  ? 301 MET A CA  1 
ATOM   2257  C C   . MET A  1 304 ? 168.001 50.574  -17.127 1.00 36.95  ? 301 MET A C   1 
ATOM   2258  O O   . MET A  1 304 ? 168.115 49.359  -17.134 1.00 40.46  ? 301 MET A O   1 
ATOM   2259  C CB  . MET A  1 304 ? 165.715 51.587  -17.039 1.00 37.34  ? 301 MET A CB  1 
ATOM   2260  C CG  . MET A  1 304 ? 164.825 50.423  -17.459 1.00 38.56  ? 301 MET A CG  1 
ATOM   2261  S SD  . MET A  1 304 ? 164.056 49.405  -16.159 1.00 38.16  ? 301 MET A SD  1 
ATOM   2262  C CE  . MET A  1 304 ? 165.119 47.978  -16.238 1.00 39.73  ? 301 MET A CE  1 
ATOM   2263  N N   . THR A  1 305 ? 168.760 51.404  -17.856 1.00 37.49  ? 302 THR A N   1 
ATOM   2264  C CA  . THR A  1 305 ? 169.884 50.940  -18.697 1.00 38.02  ? 302 THR A CA  1 
ATOM   2265  C C   . THR A  1 305 ? 170.876 50.152  -17.866 1.00 37.53  ? 302 THR A C   1 
ATOM   2266  O O   . THR A  1 305 ? 171.343 49.100  -18.299 1.00 41.51  ? 302 THR A O   1 
ATOM   2267  C CB  . THR A  1 305 ? 170.667 52.090  -19.402 1.00 37.76  ? 302 THR A CB  1 
ATOM   2268  O OG1 . THR A  1 305 ? 169.796 52.837  -20.258 1.00 38.21  ? 302 THR A OG1 1 
ATOM   2269  C CG2 . THR A  1 305 ? 171.791 51.536  -20.274 1.00 37.33  ? 302 THR A CG2 1 
ATOM   2270  N N   . GLN A  1 306 ? 171.188 50.662  -16.682 1.00 37.04  ? 303 GLN A N   1 
ATOM   2271  C CA  . GLN A  1 306 ? 172.175 50.038  -15.806 1.00 39.13  ? 303 GLN A CA  1 
ATOM   2272  C C   . GLN A  1 306 ? 171.728 48.669  -15.323 1.00 37.30  ? 303 GLN A C   1 
ATOM   2273  O O   . GLN A  1 306 ? 172.433 47.680  -15.533 1.00 39.91  ? 303 GLN A O   1 
ATOM   2274  C CB  . GLN A  1 306 ? 172.503 50.929  -14.598 1.00 42.75  ? 303 GLN A CB  1 
ATOM   2275  C CG  . GLN A  1 306 ? 173.371 52.134  -14.928 1.00 47.62  ? 303 GLN A CG  1 
ATOM   2276  C CD  . GLN A  1 306 ? 174.846 51.811  -15.133 1.00 53.36  ? 303 GLN A CD  1 
ATOM   2277  O OE1 . GLN A  1 306 ? 175.255 50.652  -15.251 1.00 56.78  ? 303 GLN A OE1 1 
ATOM   2278  N NE2 . GLN A  1 306 ? 175.661 52.858  -15.173 1.00 59.82  ? 303 GLN A NE2 1 
ATOM   2279  N N   . ALA A  1 307 ? 170.560 48.613  -14.691 1.00 36.00  ? 304 ALA A N   1 
ATOM   2280  C CA  . ALA A  1 307 ? 169.992 47.341  -14.196 1.00 36.34  ? 304 ALA A CA  1 
ATOM   2281  C C   . ALA A  1 307 ? 169.760 46.283  -15.287 1.00 36.36  ? 304 ALA A C   1 
ATOM   2282  O O   . ALA A  1 307 ? 169.823 45.084  -15.009 1.00 32.88  ? 304 ALA A O   1 
ATOM   2283  C CB  . ALA A  1 307 ? 168.689 47.600  -13.465 1.00 35.86  ? 304 ALA A CB  1 
ATOM   2284  N N   . MET A  1 308 ? 169.488 46.752  -16.507 1.00 37.05  ? 305 MET A N   1 
ATOM   2285  C CA  . MET A  1 308 ? 169.216 45.902  -17.652 1.00 38.07  ? 305 MET A CA  1 
ATOM   2286  C C   . MET A  1 308 ? 170.464 45.176  -18.159 1.00 38.86  ? 305 MET A C   1 
ATOM   2287  O O   . MET A  1 308 ? 170.342 44.148  -18.836 1.00 39.23  ? 305 MET A O   1 
ATOM   2288  C CB  . MET A  1 308 ? 168.582 46.734  -18.770 1.00 38.79  ? 305 MET A CB  1 
ATOM   2289  C CG  . MET A  1 308 ? 167.522 45.996  -19.555 1.00 40.57  ? 305 MET A CG  1 
ATOM   2290  S SD  . MET A  1 308 ? 166.779 47.015  -20.831 1.00 41.97  ? 305 MET A SD  1 
ATOM   2291  C CE  . MET A  1 308 ? 166.101 48.285  -19.819 1.00 38.48  ? 305 MET A CE  1 
ATOM   2292  N N   . GLN A  1 309 ? 171.652 45.703  -17.831 1.00 40.23  ? 306 GLN A N   1 
ATOM   2293  C CA  . GLN A  1 309 ? 172.923 45.060  -18.205 1.00 41.51  ? 306 GLN A CA  1 
ATOM   2294  C C   . GLN A  1 309 ? 173.114 43.708  -17.523 1.00 38.62  ? 306 GLN A C   1 
ATOM   2295  O O   . GLN A  1 309 ? 173.773 42.843  -18.062 1.00 37.14  ? 306 GLN A O   1 
ATOM   2296  C CB  . GLN A  1 309 ? 174.148 45.989  -17.989 1.00 44.09  ? 306 GLN A CB  1 
ATOM   2297  C CG  . GLN A  1 309 ? 174.886 46.378  -19.286 1.00 46.16  ? 306 GLN A CG  1 
ATOM   2298  C CD  . GLN A  1 309 ? 174.174 47.474  -20.068 1.00 48.16  ? 306 GLN A CD  1 
ATOM   2299  O OE1 . GLN A  1 309 ? 174.045 48.583  -19.577 1.00 51.51  ? 306 GLN A OE1 1 
ATOM   2300  N NE2 . GLN A  1 309 ? 173.718 47.175  -21.285 1.00 48.43  ? 306 GLN A NE2 1 
ATOM   2301  N N   . LYS A  1 310 ? 172.489 43.530  -16.367 1.00 41.30  ? 307 LYS A N   1 
ATOM   2302  C CA  . LYS A  1 310 ? 172.558 42.290  -15.578 1.00 43.05  ? 307 LYS A CA  1 
ATOM   2303  C C   . LYS A  1 310 ? 171.490 41.215  -15.931 1.00 40.30  ? 307 LYS A C   1 
ATOM   2304  O O   . LYS A  1 310 ? 171.394 40.187  -15.246 1.00 36.45  ? 307 LYS A O   1 
ATOM   2305  C CB  . LYS A  1 310 ? 172.432 42.647  -14.095 1.00 48.21  ? 307 LYS A CB  1 
ATOM   2306  C CG  . LYS A  1 310 ? 173.378 43.754  -13.630 1.00 55.93  ? 307 LYS A CG  1 
ATOM   2307  C CD  . LYS A  1 310 ? 172.996 44.294  -12.247 1.00 64.35  ? 307 LYS A CD  1 
ATOM   2308  C CE  . LYS A  1 310 ? 173.498 43.398  -11.123 1.00 68.22  ? 307 LYS A CE  1 
ATOM   2309  N NZ  . LYS A  1 310 ? 174.969 43.546  -10.936 1.00 72.23  ? 307 LYS A NZ  1 
ATOM   2310  N N   . LEU A  1 311 ? 170.682 41.453  -16.972 1.00 39.93  ? 308 LEU A N   1 
ATOM   2311  C CA  . LEU A  1 311 ? 169.662 40.483  -17.404 1.00 38.70  ? 308 LEU A CA  1 
ATOM   2312  C C   . LEU A  1 311 ? 170.328 39.312  -18.043 1.00 39.89  ? 308 LEU A C   1 
ATOM   2313  O O   . LEU A  1 311 ? 171.353 39.475  -18.719 1.00 45.52  ? 308 LEU A O   1 
ATOM   2314  C CB  . LEU A  1 311 ? 168.699 41.075  -18.427 1.00 38.38  ? 308 LEU A CB  1 
ATOM   2315  C CG  . LEU A  1 311 ? 167.656 42.048  -17.884 1.00 38.78  ? 308 LEU A CG  1 
ATOM   2316  C CD1 . LEU A  1 311 ? 166.863 42.606  -19.049 1.00 38.44  ? 308 LEU A CD1 1 
ATOM   2317  C CD2 . LEU A  1 311 ? 166.728 41.402  -16.863 1.00 37.78  ? 308 LEU A CD2 1 
ATOM   2318  N N   . LYS A  1 312 ? 169.754 38.134  -17.837 1.00 37.75  ? 309 LYS A N   1 
ATOM   2319  C CA  . LYS A  1 312 ? 170.261 36.929  -18.467 1.00 39.70  ? 309 LYS A CA  1 
ATOM   2320  C C   . LYS A  1 312 ? 169.159 36.339  -19.310 1.00 38.50  ? 309 LYS A C   1 
ATOM   2321  O O   . LYS A  1 312 ? 168.092 36.015  -18.791 1.00 38.24  ? 309 LYS A O   1 
ATOM   2322  C CB  . LYS A  1 312 ? 170.734 35.912  -17.437 1.00 43.08  ? 309 LYS A CB  1 
ATOM   2323  C CG  . LYS A  1 312 ? 171.855 36.395  -16.530 1.00 47.04  ? 309 LYS A CG  1 
ATOM   2324  C CD  . LYS A  1 312 ? 172.144 35.378  -15.427 1.00 51.60  ? 309 LYS A CD  1 
ATOM   2325  C CE  . LYS A  1 312 ? 172.500 36.053  -14.105 1.00 57.97  ? 309 LYS A CE  1 
ATOM   2326  N NZ  . LYS A  1 312 ? 172.711 35.066  -13.007 1.00 59.70  ? 309 LYS A NZ  1 
ATOM   2327  N N   . VAL A  1 313 ? 169.415 36.222  -20.614 1.00 37.19  ? 310 VAL A N   1 
ATOM   2328  C CA  . VAL A  1 313 ? 168.496 35.557  -21.537 1.00 33.95  ? 310 VAL A CA  1 
ATOM   2329  C C   . VAL A  1 313 ? 169.108 34.228  -21.937 1.00 30.72  ? 310 VAL A C   1 
ATOM   2330  O O   . VAL A  1 313 ? 170.285 34.159  -22.257 1.00 29.95  ? 310 VAL A O   1 
ATOM   2331  C CB  . VAL A  1 313 ? 168.229 36.386  -22.797 1.00 34.49  ? 310 VAL A CB  1 
ATOM   2332  C CG1 . VAL A  1 313 ? 166.935 35.936  -23.450 1.00 34.46  ? 310 VAL A CG1 1 
ATOM   2333  C CG2 . VAL A  1 313 ? 168.108 37.852  -22.454 1.00 36.02  ? 310 VAL A CG2 1 
ATOM   2334  N N   . GLY A  1 314 ? 168.299 33.178  -21.902 1.00 28.98  ? 311 GLY A N   1 
ATOM   2335  C CA  . GLY A  1 314 ? 168.756 31.839  -22.256 1.00 28.36  ? 311 GLY A CA  1 
ATOM   2336  C C   . GLY A  1 314 ? 167.684 30.774  -22.089 1.00 27.43  ? 311 GLY A C   1 
ATOM   2337  O O   . GLY A  1 314 ? 166.518 31.091  -21.832 1.00 26.12  ? 311 GLY A O   1 
ATOM   2338  N N   . PRO A  1 315 ? 168.075 29.498  -22.236 1.00 26.44  ? 312 PRO A N   1 
ATOM   2339  C CA  . PRO A  1 315 ? 167.123 28.401  -22.121 1.00 26.53  ? 312 PRO A CA  1 
ATOM   2340  C C   . PRO A  1 315 ? 166.743 28.067  -20.682 1.00 27.31  ? 312 PRO A C   1 
ATOM   2341  O O   . PRO A  1 315 ? 167.502 28.308  -19.747 1.00 26.26  ? 312 PRO A O   1 
ATOM   2342  C CB  . PRO A  1 315 ? 167.865 27.235  -22.771 1.00 26.27  ? 312 PRO A CB  1 
ATOM   2343  C CG  . PRO A  1 315 ? 169.305 27.543  -22.560 1.00 25.95  ? 312 PRO A CG  1 
ATOM   2344  C CD  . PRO A  1 315 ? 169.427 29.031  -22.586 1.00 25.61  ? 312 PRO A CD  1 
ATOM   2345  N N   . SER A  1 316 ? 165.559 27.491  -20.525 1.00 30.68  ? 313 SER A N   1 
ATOM   2346  C CA  . SER A  1 316 ? 165.040 27.092  -19.212 1.00 31.70  ? 313 SER A CA  1 
ATOM   2347  C C   . SER A  1 316 ? 165.927 26.056  -18.498 1.00 32.67  ? 313 SER A C   1 
ATOM   2348  O O   . SER A  1 316 ? 165.833 25.893  -17.296 1.00 33.89  ? 313 SER A O   1 
ATOM   2349  C CB  . SER A  1 316 ? 163.641 26.518  -19.376 1.00 31.34  ? 313 SER A CB  1 
ATOM   2350  O OG  . SER A  1 316 ? 163.698 25.370  -20.207 1.00 32.16  ? 313 SER A OG  1 
ATOM   2351  N N   . THR A  1 317 ? 166.774 25.355  -19.249 1.00 34.48  ? 314 THR A N   1 
ATOM   2352  C CA  . THR A  1 317 ? 167.736 24.397  -18.689 1.00 33.69  ? 314 THR A CA  1 
ATOM   2353  C C   . THR A  1 317 ? 168.684 25.052  -17.688 1.00 33.61  ? 314 THR A C   1 
ATOM   2354  O O   . THR A  1 317 ? 169.054 24.458  -16.679 1.00 34.86  ? 314 THR A O   1 
ATOM   2355  C CB  . THR A  1 317 ? 168.553 23.729  -19.803 1.00 32.06  ? 314 THR A CB  1 
ATOM   2356  O OG1 . THR A  1 317 ? 169.116 24.741  -20.652 1.00 31.01  ? 314 THR A OG1 1 
ATOM   2357  C CG2 . THR A  1 317 ? 167.662 22.777  -20.622 1.00 30.42  ? 314 THR A CG2 1 
ATOM   2358  N N   . ASP A  1 318 ? 169.064 26.284  -17.975 1.00 34.85  ? 315 ASP A N   1 
ATOM   2359  C CA  . ASP A  1 318 ? 169.799 27.095  -17.031 1.00 34.81  ? 315 ASP A CA  1 
ATOM   2360  C C   . ASP A  1 318 ? 168.741 27.836  -16.253 1.00 36.03  ? 315 ASP A C   1 
ATOM   2361  O O   . ASP A  1 318 ? 168.095 28.737  -16.782 1.00 36.29  ? 315 ASP A O   1 
ATOM   2362  C CB  . ASP A  1 318 ? 170.758 28.047  -17.779 1.00 33.89  ? 315 ASP A CB  1 
ATOM   2363  C CG  . ASP A  1 318 ? 171.613 28.934  -16.843 1.00 32.82  ? 315 ASP A CG  1 
ATOM   2364  O OD1 . ASP A  1 318 ? 171.790 28.613  -15.653 1.00 30.24  ? 315 ASP A OD1 1 
ATOM   2365  O OD2 . ASP A  1 318 ? 172.135 29.961  -17.316 1.00 30.83  ? 315 ASP A OD2 1 
ATOM   2366  N N   . SER A  1 319 ? 168.526 27.423  -15.006 1.00 38.29  ? 316 SER A N   1 
ATOM   2367  C CA  . SER A  1 319 ? 167.823 28.275  -14.048 1.00 39.53  ? 316 SER A CA  1 
ATOM   2368  C C   . SER A  1 319 ? 168.670 29.520  -13.904 1.00 40.49  ? 316 SER A C   1 
ATOM   2369  O O   . SER A  1 319 ? 169.807 29.559  -14.384 1.00 46.40  ? 316 SER A O   1 
ATOM   2370  C CB  . SER A  1 319 ? 167.694 27.590  -12.702 1.00 39.03  ? 316 SER A CB  1 
ATOM   2371  O OG  . SER A  1 319 ? 166.791 26.522  -12.802 1.00 40.50  ? 316 SER A OG  1 
ATOM   2372  N N   . GLY A  1 320 ? 168.147 30.557  -13.275 1.00 37.07  ? 317 GLY A N   1 
ATOM   2373  C CA  . GLY A  1 320 ? 168.978 31.739  -13.042 1.00 34.86  ? 317 GLY A CA  1 
ATOM   2374  C C   . GLY A  1 320 ? 168.986 32.690  -14.206 1.00 32.98  ? 317 GLY A C   1 
ATOM   2375  O O   . GLY A  1 320 ? 169.339 33.847  -14.036 1.00 35.36  ? 317 GLY A O   1 
ATOM   2376  N N   . ASN A  1 321 ? 168.614 32.212  -15.391 1.00 31.43  ? 318 ASN A N   1 
ATOM   2377  C CA  . ASN A  1 321 ? 168.182 33.100  -16.473 1.00 30.22  ? 318 ASN A CA  1 
ATOM   2378  C C   . ASN A  1 321 ? 166.957 33.907  -16.057 1.00 29.25  ? 318 ASN A C   1 
ATOM   2379  O O   . ASN A  1 321 ? 166.050 33.377  -15.422 1.00 27.43  ? 318 ASN A O   1 
ATOM   2380  C CB  . ASN A  1 321 ? 167.856 32.312  -17.744 1.00 29.39  ? 318 ASN A CB  1 
ATOM   2381  C CG  . ASN A  1 321 ? 169.093 31.906  -18.508 1.00 29.56  ? 318 ASN A CG  1 
ATOM   2382  O OD1 . ASN A  1 321 ? 170.020 32.704  -18.683 1.00 29.20  ? 318 ASN A OD1 1 
ATOM   2383  N ND2 . ASN A  1 321 ? 169.105 30.676  -19.002 1.00 29.86  ? 318 ASN A ND2 1 
ATOM   2384  N N   . ASP A  1 322 ? 166.941 35.189  -16.412 1.00 28.72  ? 319 ASP A N   1 
ATOM   2385  C CA  . ASP A  1 322 ? 165.793 36.047  -16.118 1.00 28.35  ? 319 ASP A CA  1 
ATOM   2386  C C   . ASP A  1 322 ? 164.571 35.688  -16.984 1.00 28.56  ? 319 ASP A C   1 
ATOM   2387  O O   . ASP A  1 322 ? 163.441 35.594  -16.478 1.00 28.62  ? 319 ASP A O   1 
ATOM   2388  C CB  . ASP A  1 322 ? 166.170 37.516  -16.252 1.00 27.72  ? 319 ASP A CB  1 
ATOM   2389  C CG  . ASP A  1 322 ? 166.993 37.992  -15.083 1.00 28.44  ? 319 ASP A CG  1 
ATOM   2390  O OD1 . ASP A  1 322 ? 166.398 38.188  -14.011 1.00 27.04  ? 319 ASP A OD1 1 
ATOM   2391  O OD2 . ASP A  1 322 ? 168.231 38.158  -15.221 1.00 31.55  ? 319 ASP A OD2 1 
ATOM   2392  N N   . PHE A  1 323 ? 164.790 35.456  -18.273 1.00 27.09  ? 320 PHE A N   1 
ATOM   2393  C CA  . PHE A  1 323 ? 163.696 35.019  -19.117 1.00 26.45  ? 320 PHE A CA  1 
ATOM   2394  C C   . PHE A  1 323 ? 164.132 34.155  -20.281 1.00 25.69  ? 320 PHE A C   1 
ATOM   2395  O O   . PHE A  1 323 ? 165.307 34.066  -20.588 1.00 27.78  ? 320 PHE A O   1 
ATOM   2396  C CB  . PHE A  1 323 ? 162.827 36.209  -19.558 1.00 26.60  ? 320 PHE A CB  1 
ATOM   2397  C CG  . PHE A  1 323 ? 163.576 37.325  -20.207 1.00 26.25  ? 320 PHE A CG  1 
ATOM   2398  C CD1 . PHE A  1 323 ? 164.055 38.386  -19.458 1.00 26.39  ? 320 PHE A CD1 1 
ATOM   2399  C CD2 . PHE A  1 323 ? 163.773 37.334  -21.571 1.00 25.82  ? 320 PHE A CD2 1 
ATOM   2400  C CE1 . PHE A  1 323 ? 164.734 39.425  -20.067 1.00 25.80  ? 320 PHE A CE1 1 
ATOM   2401  C CE2 . PHE A  1 323 ? 164.438 38.375  -22.179 1.00 25.37  ? 320 PHE A CE2 1 
ATOM   2402  C CZ  . PHE A  1 323 ? 164.917 39.419  -21.432 1.00 25.20  ? 320 PHE A CZ  1 
ATOM   2403  N N   . GLY A  1 324 ? 163.155 33.503  -20.902 1.00 25.10  ? 321 GLY A N   1 
ATOM   2404  C CA  . GLY A  1 324 ? 163.397 32.532  -21.964 1.00 23.73  ? 321 GLY A CA  1 
ATOM   2405  C C   . GLY A  1 324 ? 163.174 33.055  -23.367 1.00 22.48  ? 321 GLY A C   1 
ATOM   2406  O O   . GLY A  1 324 ? 163.152 34.259  -23.608 1.00 22.02  ? 321 GLY A O   1 
ATOM   2407  N N   . PRO A  1 325 ? 163.003 32.143  -24.314 1.00 22.71  ? 322 PRO A N   1 
ATOM   2408  C CA  . PRO A  1 325 ? 162.768 32.595  -25.650 1.00 23.34  ? 322 PRO A CA  1 
ATOM   2409  C C   . PRO A  1 325 ? 161.338 33.017  -25.851 1.00 24.64  ? 322 PRO A C   1 
ATOM   2410  O O   . PRO A  1 325 ? 160.459 32.800  -25.018 1.00 24.96  ? 322 PRO A O   1 
ATOM   2411  C CB  . PRO A  1 325 ? 163.064 31.359  -26.499 1.00 23.69  ? 322 PRO A CB  1 
ATOM   2412  C CG  . PRO A  1 325 ? 162.720 30.195  -25.614 1.00 24.07  ? 322 PRO A CG  1 
ATOM   2413  C CD  . PRO A  1 325 ? 162.889 30.676  -24.190 1.00 24.12  ? 322 PRO A CD  1 
ATOM   2414  N N   . VAL A  1 326 ? 161.122 33.614  -26.996 1.00 26.35  ? 323 VAL A N   1 
ATOM   2415  C CA  . VAL A  1 326 ? 159.803 33.893  -27.462 1.00 26.63  ? 323 VAL A CA  1 
ATOM   2416  C C   . VAL A  1 326 ? 159.210 32.592  -28.022 1.00 25.81  ? 323 VAL A C   1 
ATOM   2417  O O   . VAL A  1 326 ? 159.909 31.618  -28.250 1.00 25.55  ? 323 VAL A O   1 
ATOM   2418  C CB  . VAL A  1 326 ? 159.875 35.083  -28.427 1.00 28.21  ? 323 VAL A CB  1 
ATOM   2419  C CG1 . VAL A  1 326 ? 159.359 34.732  -29.825 1.00 30.53  ? 323 VAL A CG1 1 
ATOM   2420  C CG2 . VAL A  1 326 ? 159.219 36.305  -27.774 1.00 27.57  ? 323 VAL A CG2 1 
ATOM   2421  N N   . ILE A  1 327 ? 157.904 32.584  -28.196 1.00 26.41  ? 324 ILE A N   1 
ATOM   2422  C CA  . ILE A  1 327 ? 157.157 31.341  -28.437 1.00 27.76  ? 324 ILE A CA  1 
ATOM   2423  C C   . ILE A  1 327 ? 157.431 30.662  -29.791 1.00 27.75  ? 324 ILE A C   1 
ATOM   2424  O O   . ILE A  1 327 ? 157.523 29.429  -29.846 1.00 27.05  ? 324 ILE A O   1 
ATOM   2425  C CB  . ILE A  1 327 ? 155.626 31.560  -28.182 1.00 27.77  ? 324 ILE A CB  1 
ATOM   2426  C CG1 . ILE A  1 327 ? 154.839 30.249  -28.232 1.00 27.15  ? 324 ILE A CG1 1 
ATOM   2427  C CG2 . ILE A  1 327 ? 155.028 32.540  -29.182 1.00 29.23  ? 324 ILE A CG2 1 
ATOM   2428  C CD1 . ILE A  1 327 ? 155.122 29.312  -27.087 1.00 27.47  ? 324 ILE A CD1 1 
ATOM   2429  N N   . THR A  1 328 ? 157.540 31.459  -30.858 1.00 29.16  ? 325 THR A N   1 
ATOM   2430  C CA  . THR A  1 328 ? 157.761 30.949  -32.227 1.00 30.69  ? 325 THR A CA  1 
ATOM   2431  C C   . THR A  1 328 ? 158.697 31.848  -33.007 1.00 32.63  ? 325 THR A C   1 
ATOM   2432  O O   . THR A  1 328 ? 158.895 33.006  -32.650 1.00 32.06  ? 325 THR A O   1 
ATOM   2433  C CB  . THR A  1 328 ? 156.442 30.830  -33.052 1.00 29.94  ? 325 THR A CB  1 
ATOM   2434  O OG1 . THR A  1 328 ? 155.859 32.122  -33.266 1.00 29.84  ? 325 THR A OG1 1 
ATOM   2435  C CG2 . THR A  1 328 ? 155.417 29.917  -32.369 1.00 29.42  ? 325 THR A CG2 1 
ATOM   2436  N N   . ARG A  1 329 ? 159.242 31.308  -34.095 1.00 37.57  ? 326 ARG A N   1 
ATOM   2437  C CA  . ARG A  1 329 ? 160.085 32.075  -35.027 1.00 41.22  ? 326 ARG A CA  1 
ATOM   2438  C C   . ARG A  1 329 ? 159.291 33.211  -35.655 1.00 40.97  ? 326 ARG A C   1 
ATOM   2439  O O   . ARG A  1 329 ? 159.826 34.309  -35.814 1.00 36.64  ? 326 ARG A O   1 
ATOM   2440  C CB  . ARG A  1 329 ? 160.655 31.159  -36.121 1.00 44.85  ? 326 ARG A CB  1 
ATOM   2441  C CG  . ARG A  1 329 ? 161.382 31.875  -37.267 1.00 49.61  ? 326 ARG A CG  1 
ATOM   2442  C CD  . ARG A  1 329 ? 162.729 31.227  -37.565 1.00 55.64  ? 326 ARG A CD  1 
ATOM   2443  N NE  . ARG A  1 329 ? 163.738 31.628  -36.566 1.00 61.08  ? 326 ARG A NE  1 
ATOM   2444  C CZ  . ARG A  1 329 ? 164.796 30.906  -36.178 1.00 61.24  ? 326 ARG A CZ  1 
ATOM   2445  N NH1 . ARG A  1 329 ? 165.034 29.696  -36.686 1.00 60.54  ? 326 ARG A NH1 1 
ATOM   2446  N NH2 . ARG A  1 329 ? 165.624 31.402  -35.253 1.00 61.59  ? 326 ARG A NH2 1 
ATOM   2447  N N   . GLN A  1 330 ? 158.034 32.922  -36.017 1.00 42.85  ? 327 GLN A N   1 
ATOM   2448  C CA  . GLN A  1 330 ? 157.107 33.916  -36.557 1.00 45.28  ? 327 GLN A CA  1 
ATOM   2449  C C   . GLN A  1 330 ? 156.914 35.081  -35.570 1.00 42.64  ? 327 GLN A C   1 
ATOM   2450  O O   . GLN A  1 330 ? 156.929 36.256  -35.966 1.00 40.77  ? 327 GLN A O   1 
ATOM   2451  C CB  . GLN A  1 330 ? 155.763 33.264  -36.894 1.00 50.39  ? 327 GLN A CB  1 
ATOM   2452  C CG  . GLN A  1 330 ? 154.791 34.198  -37.601 1.00 58.16  ? 327 GLN A CG  1 
ATOM   2453  C CD  . GLN A  1 330 ? 153.442 33.560  -37.853 1.00 67.77  ? 327 GLN A CD  1 
ATOM   2454  O OE1 . GLN A  1 330 ? 153.085 32.567  -37.218 1.00 80.65  ? 327 GLN A OE1 1 
ATOM   2455  N NE2 . GLN A  1 330 ? 152.678 34.129  -38.780 1.00 72.50  ? 327 GLN A NE2 1 
ATOM   2456  N N   . HIS A  1 331 ? 156.752 34.745  -34.290 1.00 40.54  ? 328 HIS A N   1 
ATOM   2457  C CA  . HIS A  1 331 ? 156.577 35.752  -33.242 1.00 38.33  ? 328 HIS A CA  1 
ATOM   2458  C C   . HIS A  1 331 ? 157.860 36.512  -32.959 1.00 37.31  ? 328 HIS A C   1 
ATOM   2459  O O   . HIS A  1 331 ? 157.815 37.691  -32.609 1.00 37.40  ? 328 HIS A O   1 
ATOM   2460  C CB  . HIS A  1 331 ? 156.046 35.141  -31.944 1.00 37.69  ? 328 HIS A CB  1 
ATOM   2461  C CG  . HIS A  1 331 ? 155.639 36.170  -30.937 1.00 37.79  ? 328 HIS A CG  1 
ATOM   2462  N ND1 . HIS A  1 331 ? 154.648 37.094  -31.188 1.00 39.34  ? 328 HIS A ND1 1 
ATOM   2463  C CD2 . HIS A  1 331 ? 156.114 36.455  -29.701 1.00 36.36  ? 328 HIS A CD2 1 
ATOM   2464  C CE1 . HIS A  1 331 ? 154.524 37.896  -30.144 1.00 38.22  ? 328 HIS A CE1 1 
ATOM   2465  N NE2 . HIS A  1 331 ? 155.403 37.529  -29.228 1.00 36.46  ? 328 HIS A NE2 1 
ATOM   2466  N N   . GLN A  1 332 ? 158.995 35.833  -33.092 1.00 36.82  ? 329 GLN A N   1 
ATOM   2467  C CA  . GLN A  1 332 ? 160.300 36.482  -32.969 1.00 37.04  ? 329 GLN A CA  1 
ATOM   2468  C C   . GLN A  1 332 ? 160.476 37.536  -34.047 1.00 36.68  ? 329 GLN A C   1 
ATOM   2469  O O   . GLN A  1 332 ? 160.890 38.657  -33.767 1.00 34.56  ? 329 GLN A O   1 
ATOM   2470  C CB  . GLN A  1 332 ? 161.439 35.460  -33.093 1.00 38.09  ? 329 GLN A CB  1 
ATOM   2471  C CG  . GLN A  1 332 ? 162.840 36.037  -32.834 1.00 37.32  ? 329 GLN A CG  1 
ATOM   2472  C CD  . GLN A  1 332 ? 163.960 35.046  -33.107 1.00 37.19  ? 329 GLN A CD  1 
ATOM   2473  O OE1 . GLN A  1 332 ? 163.743 33.979  -33.689 1.00 40.07  ? 329 GLN A OE1 1 
ATOM   2474  N NE2 . GLN A  1 332 ? 165.165 35.395  -32.691 1.00 36.08  ? 329 GLN A NE2 1 
ATOM   2475  N N   . GLU A  1 333 ? 160.184 37.156  -35.285 1.00 38.85  ? 330 GLU A N   1 
ATOM   2476  C CA  . GLU A  1 333 ? 160.298 38.077  -36.399 1.00 40.89  ? 330 GLU A CA  1 
ATOM   2477  C C   . GLU A  1 333 ? 159.399 39.274  -36.150 1.00 40.38  ? 330 GLU A C   1 
ATOM   2478  O O   . GLU A  1 333 ? 159.847 40.418  -36.314 1.00 37.07  ? 330 GLU A O   1 
ATOM   2479  C CB  . GLU A  1 333 ? 159.969 37.384  -37.723 1.00 46.06  ? 330 GLU A CB  1 
ATOM   2480  C CG  . GLU A  1 333 ? 161.116 36.510  -38.254 1.00 49.75  ? 330 GLU A CG  1 
ATOM   2481  C CD  . GLU A  1 333 ? 160.677 35.525  -39.338 1.00 53.16  ? 330 GLU A CD  1 
ATOM   2482  O OE1 . GLU A  1 333 ? 159.774 35.852  -40.162 1.00 51.84  ? 330 GLU A OE1 1 
ATOM   2483  O OE2 . GLU A  1 333 ? 161.247 34.411  -39.348 1.00 55.09  ? 330 GLU A OE2 1 
ATOM   2484  N N   . LYS A  1 334 ? 158.167 39.008  -35.695 1.00 40.65  ? 331 LYS A N   1 
ATOM   2485  C CA  . LYS A  1 334 ? 157.205 40.077  -35.376 1.00 42.04  ? 331 LYS A CA  1 
ATOM   2486  C C   . LYS A  1 334 ? 157.733 41.061  -34.330 1.00 37.98  ? 331 LYS A C   1 
ATOM   2487  O O   . LYS A  1 334 ? 157.590 42.286  -34.479 1.00 36.56  ? 331 LYS A O   1 
ATOM   2488  C CB  . LYS A  1 334 ? 155.852 39.512  -34.911 1.00 48.57  ? 331 LYS A CB  1 
ATOM   2489  C CG  . LYS A  1 334 ? 154.666 40.434  -35.236 1.00 54.97  ? 331 LYS A CG  1 
ATOM   2490  C CD  . LYS A  1 334 ? 153.461 40.205  -34.330 1.00 61.32  ? 331 LYS A CD  1 
ATOM   2491  C CE  . LYS A  1 334 ? 152.873 38.807  -34.499 1.00 65.77  ? 331 LYS A CE  1 
ATOM   2492  N NZ  . LYS A  1 334 ? 151.673 38.617  -33.635 1.00 70.78  ? 331 LYS A NZ  1 
ATOM   2493  N N   . VAL A  1 335 ? 158.337 40.521  -33.276 1.00 34.95  ? 332 VAL A N   1 
ATOM   2494  C CA  . VAL A  1 335 ? 158.881 41.340  -32.193 1.00 32.31  ? 332 VAL A CA  1 
ATOM   2495  C C   . VAL A  1 335 ? 160.098 42.148  -32.647 1.00 31.77  ? 332 VAL A C   1 
ATOM   2496  O O   . VAL A  1 335 ? 160.182 43.340  -32.366 1.00 29.16  ? 332 VAL A O   1 
ATOM   2497  C CB  . VAL A  1 335 ? 159.244 40.474  -30.979 1.00 31.40  ? 332 VAL A CB  1 
ATOM   2498  C CG1 . VAL A  1 335 ? 160.049 41.279  -29.953 1.00 31.42  ? 332 VAL A CG1 1 
ATOM   2499  C CG2 . VAL A  1 335 ? 157.979 39.909  -30.349 1.00 30.54  ? 332 VAL A CG2 1 
ATOM   2500  N N   . ILE A  1 336 ? 161.039 41.477  -33.319 1.00 32.02  ? 333 ILE A N   1 
ATOM   2501  C CA  . ILE A  1 336 ? 162.162 42.137  -33.973 1.00 32.89  ? 333 ILE A CA  1 
ATOM   2502  C C   . ILE A  1 336 ? 161.581 43.270  -34.812 1.00 32.25  ? 333 ILE A C   1 
ATOM   2503  O O   . ILE A  1 336 ? 161.995 44.416  -34.674 1.00 29.87  ? 333 ILE A O   1 
ATOM   2504  C CB  . ILE A  1 336 ? 162.940 41.173  -34.920 1.00 36.46  ? 333 ILE A CB  1 
ATOM   2505  C CG1 . ILE A  1 336 ? 163.659 40.045  -34.162 1.00 36.95  ? 333 ILE A CG1 1 
ATOM   2506  C CG2 . ILE A  1 336 ? 163.962 41.939  -35.763 1.00 38.37  ? 333 ILE A CG2 1 
ATOM   2507  C CD1 . ILE A  1 336 ? 164.807 40.483  -33.275 1.00 36.62  ? 333 ILE A CD1 1 
ATOM   2508  N N   . GLY A  1 337 ? 160.614 42.911  -35.671 1.00 32.60  ? 334 GLY A N   1 
ATOM   2509  C CA  . GLY A  1 337 ? 159.885 43.833  -36.538 1.00 31.87  ? 334 GLY A CA  1 
ATOM   2510  C C   . GLY A  1 337 ? 159.503 45.138  -35.874 1.00 33.84  ? 334 GLY A C   1 
ATOM   2511  O O   . GLY A  1 337 ? 159.871 46.219  -36.364 1.00 34.81  ? 334 GLY A O   1 
ATOM   2512  N N   . TYR A  1 338 ? 158.787 45.038  -34.749 1.00 34.32  ? 335 TYR A N   1 
ATOM   2513  C CA  . TYR A  1 338 ? 158.313 46.225  -34.020 1.00 34.47  ? 335 TYR A CA  1 
ATOM   2514  C C   . TYR A  1 338 ? 159.458 47.123  -33.514 1.00 34.75  ? 335 TYR A C   1 
ATOM   2515  O O   . TYR A  1 338 ? 159.289 48.335  -33.390 1.00 34.03  ? 335 TYR A O   1 
ATOM   2516  C CB  . TYR A  1 338 ? 157.414 45.819  -32.847 1.00 35.69  ? 335 TYR A CB  1 
ATOM   2517  C CG  . TYR A  1 338 ? 156.001 45.365  -33.215 1.00 35.17  ? 335 TYR A CG  1 
ATOM   2518  C CD1 . TYR A  1 338 ? 155.116 46.237  -33.861 1.00 32.37  ? 335 TYR A CD1 1 
ATOM   2519  C CD2 . TYR A  1 338 ? 155.532 44.080  -32.854 1.00 34.09  ? 335 TYR A CD2 1 
ATOM   2520  C CE1 . TYR A  1 338 ? 153.829 45.847  -34.160 1.00 31.75  ? 335 TYR A CE1 1 
ATOM   2521  C CE2 . TYR A  1 338 ? 154.241 43.681  -33.164 1.00 33.44  ? 335 TYR A CE2 1 
ATOM   2522  C CZ  . TYR A  1 338 ? 153.396 44.576  -33.815 1.00 32.22  ? 335 TYR A CZ  1 
ATOM   2523  O OH  . TYR A  1 338 ? 152.119 44.208  -34.127 1.00 31.18  ? 335 TYR A OH  1 
ATOM   2524  N N   . ILE A  1 339 ? 160.620 46.526  -33.238 1.00 35.50  ? 336 ILE A N   1 
ATOM   2525  C CA  . ILE A  1 339 ? 161.781 47.268  -32.762 1.00 35.32  ? 336 ILE A CA  1 
ATOM   2526  C C   . ILE A  1 339 ? 162.444 48.051  -33.883 1.00 37.41  ? 336 ILE A C   1 
ATOM   2527  O O   . ILE A  1 339 ? 162.835 49.211  -33.676 1.00 40.92  ? 336 ILE A O   1 
ATOM   2528  C CB  . ILE A  1 339 ? 162.815 46.363  -32.095 1.00 36.26  ? 336 ILE A CB  1 
ATOM   2529  C CG1 . ILE A  1 339 ? 162.186 45.605  -30.917 1.00 36.07  ? 336 ILE A CG1 1 
ATOM   2530  C CG2 . ILE A  1 339 ? 163.974 47.203  -31.560 1.00 37.16  ? 336 ILE A CG2 1 
ATOM   2531  C CD1 . ILE A  1 339 ? 163.025 44.465  -30.377 1.00 35.97  ? 336 ILE A CD1 1 
ATOM   2532  N N   . ASN A  1 340 ? 162.568 47.439  -35.061 1.00 36.83  ? 337 ASN A N   1 
ATOM   2533  C CA  . ASN A  1 340 ? 163.003 48.177  -36.254 1.00 36.27  ? 337 ASN A CA  1 
ATOM   2534  C C   . ASN A  1 340 ? 162.060 49.342  -36.530 1.00 36.68  ? 337 ASN A C   1 
ATOM   2535  O O   . ASN A  1 340 ? 162.512 50.499  -36.616 1.00 34.74  ? 337 ASN A O   1 
ATOM   2536  C CB  . ASN A  1 340 ? 163.076 47.269  -37.475 1.00 36.44  ? 337 ASN A CB  1 
ATOM   2537  C CG  . ASN A  1 340 ? 164.065 46.137  -37.299 1.00 36.91  ? 337 ASN A CG  1 
ATOM   2538  O OD1 . ASN A  1 340 ? 165.066 46.276  -36.594 1.00 38.32  ? 337 ASN A OD1 1 
ATOM   2539  N ND2 . ASN A  1 340 ? 163.782 44.997  -37.919 1.00 36.11  ? 337 ASN A ND2 1 
ATOM   2540  N N   . SER A  1 341 ? 160.762 49.019  -36.626 1.00 36.17  ? 338 SER A N   1 
ATOM   2541  C CA  . SER A  1 341 ? 159.689 49.997  -36.844 1.00 36.76  ? 338 SER A CA  1 
ATOM   2542  C C   . SER A  1 341 ? 159.808 51.188  -35.919 1.00 36.88  ? 338 SER A C   1 
ATOM   2543  O O   . SER A  1 341 ? 159.576 52.319  -36.341 1.00 36.54  ? 338 SER A O   1 
ATOM   2544  C CB  . SER A  1 341 ? 158.309 49.353  -36.644 1.00 38.32  ? 338 SER A CB  1 
ATOM   2545  O OG  . SER A  1 341 ? 157.275 50.320  -36.472 1.00 39.04  ? 338 SER A OG  1 
ATOM   2546  N N   . ALA A  1 342 ? 160.161 50.938  -34.662 1.00 37.81  ? 339 ALA A N   1 
ATOM   2547  C CA  . ALA A  1 342 ? 160.317 52.027  -33.697 1.00 40.69  ? 339 ALA A CA  1 
ATOM   2548  C C   . ALA A  1 342 ? 161.548 52.871  -34.016 1.00 43.08  ? 339 ALA A C   1 
ATOM   2549  O O   . ALA A  1 342 ? 161.513 54.105  -33.926 1.00 38.58  ? 339 ALA A O   1 
ATOM   2550  C CB  . ALA A  1 342 ? 160.398 51.490  -32.285 1.00 40.91  ? 339 ALA A CB  1 
ATOM   2551  N N   . GLU A  1 343 ? 162.632 52.198  -34.402 1.00 46.94  ? 340 GLU A N   1 
ATOM   2552  C CA  . GLU A  1 343 ? 163.858 52.895  -34.817 1.00 48.33  ? 340 GLU A CA  1 
ATOM   2553  C C   . GLU A  1 343 ? 163.674 53.702  -36.102 1.00 48.02  ? 340 GLU A C   1 
ATOM   2554  O O   . GLU A  1 343 ? 164.109 54.851  -36.189 1.00 40.99  ? 340 GLU A O   1 
ATOM   2555  C CB  . GLU A  1 343 ? 164.985 51.898  -35.016 1.00 47.16  ? 340 GLU A CB  1 
ATOM   2556  C CG  . GLU A  1 343 ? 166.328 52.572  -35.181 1.00 45.73  ? 340 GLU A CG  1 
ATOM   2557  C CD  . GLU A  1 343 ? 167.464 51.593  -35.135 1.00 43.76  ? 340 GLU A CD  1 
ATOM   2558  O OE1 . GLU A  1 343 ? 168.415 51.857  -34.368 1.00 41.95  ? 340 GLU A OE1 1 
ATOM   2559  O OE2 . GLU A  1 343 ? 167.388 50.570  -35.856 1.00 41.28  ? 340 GLU A OE2 1 
ATOM   2560  N N   . GLN A  1 344 ? 163.040 53.067  -37.084 1.00 51.74  ? 341 GLN A N   1 
ATOM   2561  C CA  . GLN A  1 344 ? 162.676 53.717  -38.328 1.00 56.86  ? 341 GLN A CA  1 
ATOM   2562  C C   . GLN A  1 344 ? 161.835 54.975  -38.107 1.00 54.57  ? 341 GLN A C   1 
ATOM   2563  O O   . GLN A  1 344 ? 162.126 55.988  -38.729 1.00 57.99  ? 341 GLN A O   1 
ATOM   2564  C CB  . GLN A  1 344 ? 161.930 52.753  -39.249 1.00 64.67  ? 341 GLN A CB  1 
ATOM   2565  C CG  . GLN A  1 344 ? 161.801 53.260  -40.684 1.00 76.01  ? 341 GLN A CG  1 
ATOM   2566  C CD  . GLN A  1 344 ? 160.759 52.505  -41.500 1.00 85.68  ? 341 GLN A CD  1 
ATOM   2567  O OE1 . GLN A  1 344 ? 160.236 51.471  -41.066 1.00 89.16  ? 341 GLN A OE1 1 
ATOM   2568  N NE2 . GLN A  1 344 ? 160.450 53.021  -42.694 1.00 87.63  ? 341 GLN A NE2 1 
ATOM   2569  N N   . GLN A  1 345 ? 160.822 54.927  -37.230 1.00 49.60  ? 342 GLN A N   1 
ATOM   2570  C CA  . GLN A  1 345 ? 159.929 56.104  -36.994 1.00 45.36  ? 342 GLN A CA  1 
ATOM   2571  C C   . GLN A  1 345 ? 160.494 57.201  -36.063 1.00 40.89  ? 342 GLN A C   1 
ATOM   2572  O O   . GLN A  1 345 ? 159.780 58.117  -35.692 1.00 38.38  ? 342 GLN A O   1 
ATOM   2573  C CB  . GLN A  1 345 ? 158.538 55.654  -36.512 1.00 46.36  ? 342 GLN A CB  1 
ATOM   2574  C CG  . GLN A  1 345 ? 157.751 54.874  -37.563 1.00 48.80  ? 342 GLN A CG  1 
ATOM   2575  C CD  . GLN A  1 345 ? 156.420 54.323  -37.056 1.00 50.19  ? 342 GLN A CD  1 
ATOM   2576  O OE1 . GLN A  1 345 ? 156.334 53.753  -35.962 1.00 58.74  ? 342 GLN A OE1 1 
ATOM   2577  N NE2 . GLN A  1 345 ? 155.383 54.463  -37.861 1.00 48.88  ? 342 GLN A NE2 1 
ATOM   2578  N N   . GLY A  1 346 ? 161.767 57.098  -35.689 1.00 40.13  ? 343 GLY A N   1 
ATOM   2579  C CA  . GLY A  1 346 ? 162.475 58.159  -34.955 1.00 40.11  ? 343 GLY A CA  1 
ATOM   2580  C C   . GLY A  1 346 ? 162.858 57.865  -33.507 1.00 40.28  ? 343 GLY A C   1 
ATOM   2581  O O   . GLY A  1 346 ? 163.460 58.711  -32.853 1.00 37.17  ? 343 GLY A O   1 
ATOM   2582  N N   . ALA A  1 347 ? 162.524 56.673  -33.005 1.00 42.52  ? 344 ALA A N   1 
ATOM   2583  C CA  . ALA A  1 347 ? 162.713 56.336  -31.579 1.00 41.93  ? 344 ALA A CA  1 
ATOM   2584  C C   . ALA A  1 347 ? 164.142 55.924  -31.297 1.00 40.65  ? 344 ALA A C   1 
ATOM   2585  O O   . ALA A  1 347 ? 164.785 55.329  -32.148 1.00 42.92  ? 344 ALA A O   1 
ATOM   2586  C CB  . ALA A  1 347 ? 161.762 55.227  -31.141 1.00 41.02  ? 344 ALA A CB  1 
ATOM   2587  N N   . THR A  1 348 ? 164.615 56.237  -30.093 1.00 40.23  ? 345 THR A N   1 
ATOM   2588  C CA  . THR A  1 348 ? 165.971 55.903  -29.631 1.00 40.69  ? 345 THR A CA  1 
ATOM   2589  C C   . THR A  1 348 ? 166.035 54.453  -29.087 1.00 42.29  ? 345 THR A C   1 
ATOM   2590  O O   . THR A  1 348 ? 165.327 54.098  -28.132 1.00 41.72  ? 345 THR A O   1 
ATOM   2591  C CB  . THR A  1 348 ? 166.440 56.877  -28.506 1.00 41.06  ? 345 THR A CB  1 
ATOM   2592  O OG1 . THR A  1 348 ? 166.156 58.241  -28.855 1.00 40.95  ? 345 THR A OG1 1 
ATOM   2593  C CG2 . THR A  1 348 ? 167.935 56.720  -28.219 1.00 40.06  ? 345 THR A CG2 1 
ATOM   2594  N N   . ILE A  1 349 ? 166.876 53.616  -29.693 1.00 42.61  ? 346 ILE A N   1 
ATOM   2595  C CA  . ILE A  1 349 ? 167.042 52.233  -29.237 1.00 41.38  ? 346 ILE A CA  1 
ATOM   2596  C C   . ILE A  1 349 ? 168.163 52.197  -28.201 1.00 40.03  ? 346 ILE A C   1 
ATOM   2597  O O   . ILE A  1 349 ? 169.274 51.755  -28.473 1.00 38.92  ? 346 ILE A O   1 
ATOM   2598  C CB  . ILE A  1 349 ? 167.319 51.254  -30.403 1.00 43.41  ? 346 ILE A CB  1 
ATOM   2599  C CG1 . ILE A  1 349 ? 166.190 51.295  -31.448 1.00 44.53  ? 346 ILE A CG1 1 
ATOM   2600  C CG2 . ILE A  1 349 ? 167.496 49.819  -29.898 1.00 44.84  ? 346 ILE A CG2 1 
ATOM   2601  C CD1 . ILE A  1 349 ? 164.803 50.937  -30.934 1.00 43.96  ? 346 ILE A CD1 1 
ATOM   2602  N N   . VAL A  1 350 ? 167.828 52.635  -26.990 1.00 39.74  ? 347 VAL A N   1 
ATOM   2603  C CA  . VAL A  1 350 ? 168.790 52.759  -25.877 1.00 37.30  ? 347 VAL A CA  1 
ATOM   2604  C C   . VAL A  1 350 ? 169.492 51.454  -25.530 1.00 35.39  ? 347 VAL A C   1 
ATOM   2605  O O   . VAL A  1 350 ? 170.686 51.466  -25.298 1.00 35.99  ? 347 VAL A O   1 
ATOM   2606  C CB  . VAL A  1 350 ? 168.124 53.280  -24.581 1.00 36.26  ? 347 VAL A CB  1 
ATOM   2607  C CG1 . VAL A  1 350 ? 169.137 53.376  -23.442 1.00 36.54  ? 347 VAL A CG1 1 
ATOM   2608  C CG2 . VAL A  1 350 ? 167.487 54.641  -24.801 1.00 35.63  ? 347 VAL A CG2 1 
ATOM   2609  N N   . VAL A  1 351 ? 168.746 50.357  -25.445 1.00 33.65  ? 348 VAL A N   1 
ATOM   2610  C CA  . VAL A  1 351 ? 169.332 49.026  -25.227 1.00 33.93  ? 348 VAL A CA  1 
ATOM   2611  C C   . VAL A  1 351 ? 168.814 48.084  -26.303 1.00 34.95  ? 348 VAL A C   1 
ATOM   2612  O O   . VAL A  1 351 ? 167.604 47.906  -26.422 1.00 37.93  ? 348 VAL A O   1 
ATOM   2613  C CB  . VAL A  1 351 ? 168.993 48.451  -23.833 1.00 33.19  ? 348 VAL A CB  1 
ATOM   2614  C CG1 . VAL A  1 351 ? 169.763 47.161  -23.581 1.00 33.59  ? 348 VAL A CG1 1 
ATOM   2615  C CG2 . VAL A  1 351 ? 169.328 49.447  -22.735 1.00 33.45  ? 348 VAL A CG2 1 
ATOM   2616  N N   . ASP A  1 352 ? 169.717 47.494  -27.088 1.00 34.67  ? 349 ASP A N   1 
ATOM   2617  C CA  . ASP A  1 352 ? 169.325 46.709  -28.265 1.00 32.87  ? 349 ASP A CA  1 
ATOM   2618  C C   . ASP A  1 352 ? 169.437 45.237  -27.904 1.00 33.74  ? 349 ASP A C   1 
ATOM   2619  O O   . ASP A  1 352 ? 170.497 44.776  -27.468 1.00 33.62  ? 349 ASP A O   1 
ATOM   2620  C CB  . ASP A  1 352 ? 170.208 47.064  -29.466 1.00 30.70  ? 349 ASP A CB  1 
ATOM   2621  C CG  . ASP A  1 352 ? 169.636 46.613  -30.785 1.00 29.50  ? 349 ASP A CG  1 
ATOM   2622  O OD1 . ASP A  1 352 ? 168.631 45.911  -30.869 1.00 30.52  ? 349 ASP A OD1 1 
ATOM   2623  O OD2 . ASP A  1 352 ? 170.208 46.971  -31.802 1.00 31.23  ? 349 ASP A OD2 1 
ATOM   2624  N N   . GLY A  1 353 ? 168.327 44.525  -28.065 1.00 34.35  ? 350 GLY A N   1 
ATOM   2625  C CA  . GLY A  1 353 ? 168.288 43.089  -27.888 1.00 36.13  ? 350 GLY A CA  1 
ATOM   2626  C C   . GLY A  1 353 ? 167.790 42.366  -29.121 1.00 38.68  ? 350 GLY A C   1 
ATOM   2627  O O   . GLY A  1 353 ? 167.300 41.253  -28.993 1.00 41.51  ? 350 GLY A O   1 
ATOM   2628  N N   . ARG A  1 354 ? 167.913 42.980  -30.301 1.00 40.38  ? 351 ARG A N   1 
ATOM   2629  C CA  . ARG A  1 354 ? 167.426 42.382  -31.551 1.00 43.24  ? 351 ARG A CA  1 
ATOM   2630  C C   . ARG A  1 354 ? 168.314 41.216  -31.960 1.00 46.93  ? 351 ARG A C   1 
ATOM   2631  O O   . ARG A  1 354 ? 167.840 40.196  -32.467 1.00 45.78  ? 351 ARG A O   1 
ATOM   2632  C CB  . ARG A  1 354 ? 167.384 43.422  -32.683 1.00 44.77  ? 351 ARG A CB  1 
ATOM   2633  C CG  . ARG A  1 354 ? 166.130 44.282  -32.707 1.00 45.59  ? 351 ARG A CG  1 
ATOM   2634  C CD  . ARG A  1 354 ? 166.237 45.378  -33.747 1.00 45.01  ? 351 ARG A CD  1 
ATOM   2635  N NE  . ARG A  1 354 ? 167.165 46.419  -33.319 1.00 43.21  ? 351 ARG A NE  1 
ATOM   2636  C CZ  . ARG A  1 354 ? 167.357 47.572  -33.958 1.00 42.78  ? 351 ARG A CZ  1 
ATOM   2637  N NH1 . ARG A  1 354 ? 166.694 47.857  -35.090 1.00 41.82  ? 351 ARG A NH1 1 
ATOM   2638  N NH2 . ARG A  1 354 ? 168.214 48.455  -33.455 1.00 40.11  ? 351 ARG A NH2 1 
ATOM   2639  N N   . GLN A  1 355 ? 169.613 41.398  -31.736 1.00 53.94  ? 352 GLN A N   1 
ATOM   2640  C CA  . GLN A  1 355 ? 170.635 40.409  -32.034 1.00 57.38  ? 352 GLN A CA  1 
ATOM   2641  C C   . GLN A  1 355 ? 171.145 39.978  -30.662 1.00 58.18  ? 352 GLN A C   1 
ATOM   2642  O O   . GLN A  1 355 ? 172.224 40.381  -30.243 1.00 57.27  ? 352 GLN A O   1 
ATOM   2643  C CB  . GLN A  1 355 ? 171.738 41.039  -32.918 1.00 58.54  ? 352 GLN A CB  1 
ATOM   2644  C CG  . GLN A  1 355 ? 172.337 40.101  -33.957 1.00 63.13  ? 352 GLN A CG  1 
ATOM   2645  C CD  . GLN A  1 355 ? 171.440 39.899  -35.184 1.00 70.01  ? 352 GLN A CD  1 
ATOM   2646  O OE1 . GLN A  1 355 ? 170.254 40.261  -35.188 1.00 68.68  ? 352 GLN A OE1 1 
ATOM   2647  N NE2 . GLN A  1 355 ? 172.011 39.311  -36.239 1.00 74.68  ? 352 GLN A NE2 1 
ATOM   2648  N N   . PRO A  1 356 ? 170.337 39.188  -29.921 1.00 65.83  ? 353 PRO A N   1 
ATOM   2649  C CA  . PRO A  1 356 ? 170.767 38.855  -28.557 1.00 66.96  ? 353 PRO A CA  1 
ATOM   2650  C C   . PRO A  1 356 ? 172.046 38.059  -28.582 1.00 70.25  ? 353 PRO A C   1 
ATOM   2651  O O   . PRO A  1 356 ? 172.982 38.390  -27.856 1.00 66.26  ? 353 PRO A O   1 
ATOM   2652  C CB  . PRO A  1 356 ? 169.613 38.019  -27.986 1.00 62.54  ? 353 PRO A CB  1 
ATOM   2653  C CG  . PRO A  1 356 ? 168.850 37.533  -29.154 1.00 64.57  ? 353 PRO A CG  1 
ATOM   2654  C CD  . PRO A  1 356 ? 169.098 38.478  -30.296 1.00 66.85  ? 353 PRO A CD  1 
ATOM   2655  N N   . LYS A  1 357 ? 172.085 37.024  -29.425 1.00 80.99  ? 354 LYS A N   1 
ATOM   2656  C CA  . LYS A  1 357 ? 173.313 36.248  -29.657 1.00 90.31  ? 354 LYS A CA  1 
ATOM   2657  C C   . LYS A  1 357 ? 173.971 35.957  -28.303 1.00 85.37  ? 354 LYS A C   1 
ATOM   2658  O O   . LYS A  1 357 ? 175.196 36.009  -28.137 1.00 83.19  ? 354 LYS A O   1 
ATOM   2659  C CB  . LYS A  1 357 ? 174.260 37.018  -30.608 1.00 96.51  ? 354 LYS A CB  1 
ATOM   2660  C CG  . LYS A  1 357 ? 175.118 36.150  -31.528 1.00 95.94  ? 354 LYS A CG  1 
ATOM   2661  C CD  . LYS A  1 357 ? 176.201 36.954  -32.256 1.00 98.59  ? 354 LYS A CD  1 
ATOM   2662  C CE  . LYS A  1 357 ? 175.656 38.051  -33.169 1.00 98.95  ? 354 LYS A CE  1 
ATOM   2663  N NZ  . LYS A  1 357 ? 174.806 37.545  -34.285 1.00 98.75  ? 354 LYS A NZ  1 
ATOM   2664  N N   . VAL A  1 358 ? 173.115 35.701  -27.324 1.00 81.51  ? 355 VAL A N   1 
ATOM   2665  C CA  . VAL A  1 358 ? 173.544 35.367  -25.987 1.00 81.26  ? 355 VAL A CA  1 
ATOM   2666  C C   . VAL A  1 358 ? 173.713 33.848  -25.903 1.00 76.30  ? 355 VAL A C   1 
ATOM   2667  O O   . VAL A  1 358 ? 174.717 33.395  -25.370 1.00 83.72  ? 355 VAL A O   1 
ATOM   2668  C CB  . VAL A  1 358 ? 172.567 35.909  -24.909 1.00 85.97  ? 355 VAL A CB  1 
ATOM   2669  C CG1 . VAL A  1 358 ? 172.781 35.202  -23.572 1.00 84.16  ? 355 VAL A CG1 1 
ATOM   2670  C CG2 . VAL A  1 358 ? 172.692 37.427  -24.776 1.00 85.52  ? 355 VAL A CG2 1 
ATOM   2671  N N   . PRO A  1 359 ? 172.729 33.056  -26.396 1.00 66.87  ? 356 PRO A N   1 
ATOM   2672  C CA  . PRO A  1 359 ? 173.026 31.628  -26.529 1.00 61.77  ? 356 PRO A CA  1 
ATOM   2673  C C   . PRO A  1 359 ? 173.918 31.455  -27.721 1.00 59.12  ? 356 PRO A C   1 
ATOM   2674  O O   . PRO A  1 359 ? 173.664 32.170  -28.690 1.00 64.40  ? 356 PRO A O   1 
ATOM   2675  C CB  . PRO A  1 359 ? 171.668 31.012  -26.822 1.00 64.64  ? 356 PRO A CB  1 
ATOM   2676  C CG  . PRO A  1 359 ? 170.655 32.028  -26.413 1.00 64.04  ? 356 PRO A CG  1 
ATOM   2677  C CD  . PRO A  1 359 ? 171.305 33.336  -26.666 1.00 64.38  ? 356 PRO A CD  1 
ATOM   2678  N N   . ASN A  1 360 ? 174.924 30.570  -27.765 1.00 57.35  ? 357 ASN A N   1 
ATOM   2679  C CA  . ASN A  1 360 ? 175.258 29.429  -26.889 1.00 50.54  ? 357 ASN A CA  1 
ATOM   2680  C C   . ASN A  1 360 ? 174.483 28.194  -27.216 1.00 51.45  ? 357 ASN A C   1 
ATOM   2681  O O   . ASN A  1 360 ? 173.729 27.680  -26.408 1.00 54.09  ? 357 ASN A O   1 
ATOM   2682  C CB  . ASN A  1 360 ? 175.233 29.743  -25.421 1.00 48.02  ? 357 ASN A CB  1 
ATOM   2683  C CG  . ASN A  1 360 ? 176.093 30.916  -25.101 1.00 44.93  ? 357 ASN A CG  1 
ATOM   2684  O OD1 . ASN A  1 360 ? 176.906 31.301  -25.901 1.00 43.45  ? 357 ASN A OD1 1 
ATOM   2685  N ND2 . ASN A  1 360 ? 175.910 31.499  -23.946 1.00 48.38  ? 357 ASN A ND2 1 
ATOM   2686  N N   . HIS A  1 361 ? 174.730 27.706  -28.425 1.00 52.65  ? 358 HIS A N   1 
ATOM   2687  C CA  . HIS A  1 361 ? 174.069 26.526  -28.962 1.00 53.80  ? 358 HIS A CA  1 
ATOM   2688  C C   . HIS A  1 361 ? 172.589 26.728  -28.995 1.00 52.24  ? 358 HIS A C   1 
ATOM   2689  O O   . HIS A  1 361 ? 171.841 25.772  -28.760 1.00 55.87  ? 358 HIS A O   1 
ATOM   2690  C CB  . HIS A  1 361 ? 174.419 25.295  -28.137 1.00 56.67  ? 358 HIS A CB  1 
ATOM   2691  C CG  . HIS A  1 361 ? 175.787 25.371  -27.595 1.00 58.42  ? 358 HIS A CG  1 
ATOM   2692  N ND1 . HIS A  1 361 ? 176.040 25.578  -26.261 1.00 58.44  ? 358 HIS A ND1 1 
ATOM   2693  C CD2 . HIS A  1 361 ? 176.977 25.431  -28.231 1.00 60.90  ? 358 HIS A CD2 1 
ATOM   2694  C CE1 . HIS A  1 361 ? 177.343 25.691  -26.089 1.00 63.80  ? 358 HIS A CE1 1 
ATOM   2695  N NE2 . HIS A  1 361 ? 177.933 25.604  -27.269 1.00 64.77  ? 358 HIS A NE2 1 
ATOM   2696  N N   . GLU A  1 362 ? 172.162 27.962  -29.293 1.00 46.54  ? 359 GLU A N   1 
ATOM   2697  C CA  . GLU A  1 362 ? 170.754 28.199  -29.528 1.00 43.28  ? 359 GLU A CA  1 
ATOM   2698  C C   . GLU A  1 362 ? 170.450 29.287  -30.578 1.00 42.19  ? 359 GLU A C   1 
ATOM   2699  O O   . GLU A  1 362 ? 170.509 30.466  -30.266 1.00 40.80  ? 359 GLU A O   1 
ATOM   2700  C CB  . GLU A  1 362 ? 170.011 28.407  -28.191 1.00 39.78  ? 359 GLU A CB  1 
ATOM   2701  C CG  . GLU A  1 362 ? 169.539 27.120  -27.459 1.00 36.15  ? 359 GLU A CG  1 
ATOM   2702  C CD  . GLU A  1 362 ? 170.270 26.812  -26.166 1.00 32.90  ? 359 GLU A CD  1 
ATOM   2703  O OE1 . GLU A  1 362 ? 170.140 25.706  -25.630 1.00 29.65  ? 359 GLU A OE1 1 
ATOM   2704  O OE2 . GLU A  1 362 ? 170.941 27.691  -25.636 1.00 34.06  ? 359 GLU A OE2 1 
ATOM   2705  N N   . ASN A  1 363 ? 170.158 28.834  -31.821 1.00 43.05  ? 360 ASN A N   1 
ATOM   2706  C CA  . ASN A  1 363 ? 169.357 29.560  -32.850 1.00 39.80  ? 360 ASN A CA  1 
ATOM   2707  C C   . ASN A  1 363 ? 167.841 29.276  -32.667 1.00 39.70  ? 360 ASN A C   1 
ATOM   2708  O O   . ASN A  1 363 ? 167.121 28.949  -33.616 1.00 37.23  ? 360 ASN A O   1 
ATOM   2709  C CB  . ASN A  1 363 ? 169.777 29.152  -34.277 1.00 39.08  ? 360 ASN A CB  1 
ATOM   2710  C CG  . ASN A  1 363 ? 169.112 27.847  -34.760 1.00 37.75  ? 360 ASN A CG  1 
ATOM   2711  O OD1 . ASN A  1 363 ? 168.814 26.947  -33.975 1.00 36.74  ? 360 ASN A OD1 1 
ATOM   2712  N ND2 . ASN A  1 363 ? 168.865 27.759  -36.056 1.00 36.94  ? 360 ASN A ND2 1 
ATOM   2713  N N   . GLY A  1 364 ? 167.371 29.372  -31.430 1.00 38.03  ? 361 GLY A N   1 
ATOM   2714  C CA  . GLY A  1 364 ? 165.950 29.319  -31.133 1.00 37.62  ? 361 GLY A CA  1 
ATOM   2715  C C   . GLY A  1 364 ? 165.431 30.736  -31.108 1.00 36.78  ? 361 GLY A C   1 
ATOM   2716  O O   . GLY A  1 364 ? 166.136 31.660  -31.542 1.00 40.17  ? 361 GLY A O   1 
ATOM   2717  N N   . PHE A  1 365 ? 164.227 30.927  -30.569 1.00 34.29  ? 362 PHE A N   1 
ATOM   2718  C CA  . PHE A  1 365 ? 163.466 32.179  -30.803 1.00 32.53  ? 362 PHE A CA  1 
ATOM   2719  C C   . PHE A  1 365 ? 163.719 33.221  -29.696 1.00 31.31  ? 362 PHE A C   1 
ATOM   2720  O O   . PHE A  1 365 ? 162.807 33.676  -29.012 1.00 31.04  ? 362 PHE A O   1 
ATOM   2721  C CB  . PHE A  1 365 ? 161.971 31.885  -31.035 1.00 32.15  ? 362 PHE A CB  1 
ATOM   2722  C CG  . PHE A  1 365 ? 161.716 30.578  -31.745 1.00 31.38  ? 362 PHE A CG  1 
ATOM   2723  C CD1 . PHE A  1 365 ? 162.407 30.253  -32.898 1.00 29.79  ? 362 PHE A CD1 1 
ATOM   2724  C CD2 . PHE A  1 365 ? 160.810 29.666  -31.240 1.00 30.85  ? 362 PHE A CD2 1 
ATOM   2725  C CE1 . PHE A  1 365 ? 162.200 29.048  -33.528 1.00 29.55  ? 362 PHE A CE1 1 
ATOM   2726  C CE2 . PHE A  1 365 ? 160.587 28.467  -31.887 1.00 30.97  ? 362 PHE A CE2 1 
ATOM   2727  C CZ  . PHE A  1 365 ? 161.289 28.155  -33.028 1.00 29.78  ? 362 PHE A CZ  1 
ATOM   2728  N N   . PHE A  1 366 ? 164.985 33.616  -29.579 1.00 29.50  ? 363 PHE A N   1 
ATOM   2729  C CA  . PHE A  1 366 ? 165.468 34.446  -28.490 1.00 28.38  ? 363 PHE A CA  1 
ATOM   2730  C C   . PHE A  1 366 ? 165.507 35.919  -28.843 1.00 29.68  ? 363 PHE A C   1 
ATOM   2731  O O   . PHE A  1 366 ? 166.055 36.299  -29.877 1.00 31.63  ? 363 PHE A O   1 
ATOM   2732  C CB  . PHE A  1 366 ? 166.866 33.984  -28.060 1.00 26.97  ? 363 PHE A CB  1 
ATOM   2733  C CG  . PHE A  1 366 ? 166.840 32.772  -27.176 1.00 25.01  ? 363 PHE A CG  1 
ATOM   2734  C CD1 . PHE A  1 366 ? 166.459 32.885  -25.846 1.00 23.55  ? 363 PHE A CD1 1 
ATOM   2735  C CD2 . PHE A  1 366 ? 167.161 31.516  -27.674 1.00 24.55  ? 363 PHE A CD2 1 
ATOM   2736  C CE1 . PHE A  1 366 ? 166.397 31.779  -25.023 1.00 22.72  ? 363 PHE A CE1 1 
ATOM   2737  C CE2 . PHE A  1 366 ? 167.110 30.400  -26.851 1.00 23.77  ? 363 PHE A CE2 1 
ATOM   2738  C CZ  . PHE A  1 366 ? 166.719 30.531  -25.524 1.00 23.29  ? 363 PHE A CZ  1 
ATOM   2739  N N   . VAL A  1 367 ? 164.928 36.737  -27.967 1.00 30.52  ? 364 VAL A N   1 
ATOM   2740  C CA  . VAL A  1 367 ? 165.020 38.199  -28.055 1.00 30.73  ? 364 VAL A CA  1 
ATOM   2741  C C   . VAL A  1 367 ? 165.457 38.740  -26.695 1.00 31.49  ? 364 VAL A C   1 
ATOM   2742  O O   . VAL A  1 367 ? 164.922 38.364  -25.648 1.00 30.00  ? 364 VAL A O   1 
ATOM   2743  C CB  . VAL A  1 367 ? 163.679 38.863  -28.437 1.00 31.07  ? 364 VAL A CB  1 
ATOM   2744  C CG1 . VAL A  1 367 ? 163.826 40.382  -28.501 1.00 30.13  ? 364 VAL A CG1 1 
ATOM   2745  C CG2 . VAL A  1 367 ? 163.154 38.319  -29.768 1.00 32.27  ? 364 VAL A CG2 1 
ATOM   2746  N N   . GLY A  1 368 ? 166.435 39.631  -26.718 1.00 32.21  ? 365 GLY A N   1 
ATOM   2747  C CA  . GLY A  1 368 ? 166.988 40.150  -25.486 1.00 31.83  ? 365 GLY A CA  1 
ATOM   2748  C C   . GLY A  1 368 ? 166.192 41.334  -25.018 1.00 31.31  ? 365 GLY A C   1 
ATOM   2749  O O   . GLY A  1 368 ? 165.480 41.958  -25.792 1.00 32.80  ? 365 GLY A O   1 
ATOM   2750  N N   . GLY A  1 369 ? 166.335 41.664  -23.749 1.00 30.42  ? 366 GLY A N   1 
ATOM   2751  C CA  . GLY A  1 369 ? 165.599 42.782  -23.167 1.00 30.48  ? 366 GLY A CA  1 
ATOM   2752  C C   . GLY A  1 369 ? 166.011 44.092  -23.812 1.00 30.87  ? 366 GLY A C   1 
ATOM   2753  O O   . GLY A  1 369 ? 167.176 44.450  -23.777 1.00 30.80  ? 366 GLY A O   1 
ATOM   2754  N N   . THR A  1 370 ? 165.055 44.794  -24.412 1.00 31.64  ? 367 THR A N   1 
ATOM   2755  C CA  . THR A  1 370 ? 165.328 46.035  -25.129 1.00 31.52  ? 367 THR A CA  1 
ATOM   2756  C C   . THR A  1 370 ? 164.621 47.224  -24.479 1.00 29.82  ? 367 THR A C   1 
ATOM   2757  O O   . THR A  1 370 ? 163.531 47.075  -23.947 1.00 27.86  ? 367 THR A O   1 
ATOM   2758  C CB  . THR A  1 370 ? 164.935 45.937  -26.629 1.00 32.04  ? 367 THR A CB  1 
ATOM   2759  O OG1 . THR A  1 370 ? 163.620 46.448  -26.830 1.00 35.92  ? 367 THR A OG1 1 
ATOM   2760  C CG2 . THR A  1 370 ? 164.994 44.530  -27.127 1.00 30.72  ? 367 THR A CG2 1 
ATOM   2761  N N   . LEU A  1 371 ? 165.252 48.396  -24.555 1.00 30.16  ? 368 LEU A N   1 
ATOM   2762  C CA  . LEU A  1 371 ? 164.686 49.656  -24.069 1.00 30.18  ? 368 LEU A CA  1 
ATOM   2763  C C   . LEU A  1 371 ? 164.591 50.606  -25.244 1.00 31.95  ? 368 LEU A C   1 
ATOM   2764  O O   . LEU A  1 371 ? 165.588 50.806  -25.932 1.00 35.71  ? 368 LEU A O   1 
ATOM   2765  C CB  . LEU A  1 371 ? 165.589 50.267  -23.018 1.00 29.58  ? 368 LEU A CB  1 
ATOM   2766  C CG  . LEU A  1 371 ? 164.905 51.077  -21.923 1.00 30.36  ? 368 LEU A CG  1 
ATOM   2767  C CD1 . LEU A  1 371 ? 165.941 51.727  -21.027 1.00 29.78  ? 368 LEU A CD1 1 
ATOM   2768  C CD2 . LEU A  1 371 ? 164.013 52.155  -22.495 1.00 32.41  ? 368 LEU A CD2 1 
ATOM   2769  N N   . ILE A  1 372 ? 163.404 51.165  -25.491 1.00 31.72  ? 369 ILE A N   1 
ATOM   2770  C CA  . ILE A  1 372 ? 163.202 52.190  -26.537 1.00 31.07  ? 369 ILE A CA  1 
ATOM   2771  C C   . ILE A  1 372 ? 162.865 53.504  -25.829 1.00 31.82  ? 369 ILE A C   1 
ATOM   2772  O O   . ILE A  1 372 ? 162.118 53.492  -24.866 1.00 32.33  ? 369 ILE A O   1 
ATOM   2773  C CB  . ILE A  1 372 ? 162.090 51.798  -27.520 1.00 28.99  ? 369 ILE A CB  1 
ATOM   2774  C CG1 . ILE A  1 372 ? 162.382 50.416  -28.102 1.00 29.07  ? 369 ILE A CG1 1 
ATOM   2775  C CG2 . ILE A  1 372 ? 162.030 52.806  -28.643 1.00 29.56  ? 369 ILE A CG2 1 
ATOM   2776  C CD1 . ILE A  1 372 ? 161.310 49.863  -29.020 1.00 28.52  ? 369 ILE A CD1 1 
ATOM   2777  N N   . ASP A  1 373 ? 163.427 54.624  -26.274 1.00 31.57  ? 370 ASP A N   1 
ATOM   2778  C CA  . ASP A  1 373 ? 163.192 55.928  -25.621 1.00 31.24  ? 370 ASP A CA  1 
ATOM   2779  C C   . ASP A  1 373 ? 162.658 56.893  -26.680 1.00 32.87  ? 370 ASP A C   1 
ATOM   2780  O O   . ASP A  1 373 ? 162.786 56.642  -27.885 1.00 33.03  ? 370 ASP A O   1 
ATOM   2781  C CB  . ASP A  1 373 ? 164.488 56.430  -24.936 1.00 30.44  ? 370 ASP A CB  1 
ATOM   2782  C CG  . ASP A  1 373 ? 164.279 57.649  -23.973 1.00 29.48  ? 370 ASP A CG  1 
ATOM   2783  O OD1 . ASP A  1 373 ? 163.147 58.009  -23.589 1.00 27.57  ? 370 ASP A OD1 1 
ATOM   2784  O OD2 . ASP A  1 373 ? 165.293 58.270  -23.594 1.00 27.96  ? 370 ASP A OD2 1 
ATOM   2785  N N   . HIS A  1 374 ? 161.999 57.959  -26.221 1.00 35.39  ? 371 HIS A N   1 
ATOM   2786  C CA  . HIS A  1 374 ? 161.404 58.999  -27.097 1.00 36.84  ? 371 HIS A CA  1 
ATOM   2787  C C   . HIS A  1 374 ? 160.387 58.422  -28.082 1.00 37.26  ? 371 HIS A C   1 
ATOM   2788  O O   . HIS A  1 374 ? 160.437 58.708  -29.286 1.00 37.84  ? 371 HIS A O   1 
ATOM   2789  C CB  . HIS A  1 374 ? 162.490 59.786  -27.849 1.00 37.00  ? 371 HIS A CB  1 
ATOM   2790  C CG  . HIS A  1 374 ? 163.541 60.351  -26.951 1.00 37.83  ? 371 HIS A CG  1 
ATOM   2791  N ND1 . HIS A  1 374 ? 164.833 59.867  -26.921 1.00 38.91  ? 371 HIS A ND1 1 
ATOM   2792  C CD2 . HIS A  1 374 ? 163.483 61.333  -26.020 1.00 37.84  ? 371 HIS A CD2 1 
ATOM   2793  C CE1 . HIS A  1 374 ? 165.531 60.539  -26.021 1.00 38.79  ? 371 HIS A CE1 1 
ATOM   2794  N NE2 . HIS A  1 374 ? 164.733 61.429  -25.455 1.00 38.77  ? 371 HIS A NE2 1 
ATOM   2795  N N   . VAL A  1 375 ? 159.469 57.608  -27.561 1.00 37.75  ? 372 VAL A N   1 
ATOM   2796  C CA  . VAL A  1 375 ? 158.433 57.006  -28.397 1.00 37.46  ? 372 VAL A CA  1 
ATOM   2797  C C   . VAL A  1 375 ? 157.256 57.954  -28.355 1.00 35.79  ? 372 VAL A C   1 
ATOM   2798  O O   . VAL A  1 375 ? 157.087 58.695  -27.373 1.00 34.31  ? 372 VAL A O   1 
ATOM   2799  C CB  . VAL A  1 375 ? 158.032 55.558  -27.983 1.00 36.89  ? 372 VAL A CB  1 
ATOM   2800  C CG1 . VAL A  1 375 ? 159.238 54.740  -27.556 1.00 34.97  ? 372 VAL A CG1 1 
ATOM   2801  C CG2 . VAL A  1 375 ? 157.003 55.555  -26.881 1.00 38.63  ? 372 VAL A CG2 1 
ATOM   2802  N N   . THR A  1 376 ? 156.455 57.926  -29.415 1.00 35.16  ? 373 THR A N   1 
ATOM   2803  C CA  . THR A  1 376 ? 155.333 58.860  -29.551 1.00 36.11  ? 373 THR A CA  1 
ATOM   2804  C C   . THR A  1 376 ? 154.028 58.124  -29.865 1.00 35.78  ? 373 THR A C   1 
ATOM   2805  O O   . THR A  1 376 ? 154.072 57.004  -30.384 1.00 35.59  ? 373 THR A O   1 
ATOM   2806  C CB  . THR A  1 376 ? 155.610 59.950  -30.626 1.00 35.85  ? 373 THR A CB  1 
ATOM   2807  O OG1 . THR A  1 376 ? 155.869 59.347  -31.906 1.00 34.54  ? 373 THR A OG1 1 
ATOM   2808  C CG2 . THR A  1 376 ? 156.789 60.855  -30.206 1.00 34.59  ? 373 THR A CG2 1 
ATOM   2809  N N   . PRO A  1 377 ? 152.864 58.756  -29.575 1.00 35.60  ? 374 PRO A N   1 
ATOM   2810  C CA  . PRO A  1 377 ? 151.584 58.093  -29.823 1.00 35.83  ? 374 PRO A CA  1 
ATOM   2811  C C   . PRO A  1 377 ? 151.331 57.739  -31.274 1.00 36.58  ? 374 PRO A C   1 
ATOM   2812  O O   . PRO A  1 377 ? 150.463 56.913  -31.541 1.00 37.46  ? 374 PRO A O   1 
ATOM   2813  C CB  . PRO A  1 377 ? 150.547 59.114  -29.349 1.00 36.11  ? 374 PRO A CB  1 
ATOM   2814  C CG  . PRO A  1 377 ? 151.274 59.991  -28.399 1.00 36.92  ? 374 PRO A CG  1 
ATOM   2815  C CD  . PRO A  1 377 ? 152.669 60.072  -28.939 1.00 37.17  ? 374 PRO A CD  1 
ATOM   2816  N N   . GLU A  1 378 ? 152.095 58.333  -32.188 1.00 37.48  ? 375 GLU A N   1 
ATOM   2817  C CA  . GLU A  1 378 ? 151.894 58.133  -33.630 1.00 40.73  ? 375 GLU A CA  1 
ATOM   2818  C C   . GLU A  1 378 ? 152.611 56.894  -34.191 1.00 39.72  ? 375 GLU A C   1 
ATOM   2819  O O   . GLU A  1 378 ? 152.354 56.509  -35.333 1.00 38.11  ? 375 GLU A O   1 
ATOM   2820  C CB  . GLU A  1 378 ? 152.225 59.397  -34.462 1.00 43.90  ? 375 GLU A CB  1 
ATOM   2821  C CG  . GLU A  1 378 ? 153.198 60.416  -33.864 1.00 48.07  ? 375 GLU A CG  1 
ATOM   2822  C CD  . GLU A  1 378 ? 152.572 61.320  -32.777 1.00 52.30  ? 375 GLU A CD  1 
ATOM   2823  O OE1 . GLU A  1 378 ? 153.339 61.927  -31.997 1.00 53.52  ? 375 GLU A OE1 1 
ATOM   2824  O OE2 . GLU A  1 378 ? 151.320 61.435  -32.675 1.00 50.50  ? 375 GLU A OE2 1 
ATOM   2825  N N   . MET A  1 379 ? 153.474 56.265  -33.383 1.00 38.72  ? 376 MET A N   1 
ATOM   2826  C CA  . MET A  1 379 ? 154.290 55.118  -33.821 1.00 35.43  ? 376 MET A CA  1 
ATOM   2827  C C   . MET A  1 379 ? 153.491 53.821  -33.757 1.00 34.30  ? 376 MET A C   1 
ATOM   2828  O O   . MET A  1 379 ? 152.704 53.618  -32.858 1.00 32.55  ? 376 MET A O   1 
ATOM   2829  C CB  . MET A  1 379 ? 155.550 54.982  -32.960 1.00 33.95  ? 376 MET A CB  1 
ATOM   2830  C CG  . MET A  1 379 ? 156.401 56.240  -32.842 1.00 33.33  ? 376 MET A CG  1 
ATOM   2831  S SD  . MET A  1 379 ? 157.886 55.995  -31.837 1.00 33.21  ? 376 MET A SD  1 
ATOM   2832  C CE  . MET A  1 379 ? 158.806 57.514  -32.058 1.00 32.31  ? 376 MET A CE  1 
ATOM   2833  N N   . THR A  1 380 ? 153.711 52.939  -34.719 1.00 36.25  ? 377 THR A N   1 
ATOM   2834  C CA  . THR A  1 380 ? 152.949 51.696  -34.831 1.00 37.39  ? 377 THR A CA  1 
ATOM   2835  C C   . THR A  1 380 ? 153.327 50.745  -33.723 1.00 40.50  ? 377 THR A C   1 
ATOM   2836  O O   . THR A  1 380 ? 152.501 49.989  -33.219 1.00 43.65  ? 377 THR A O   1 
ATOM   2837  C CB  . THR A  1 380 ? 153.230 50.986  -36.165 1.00 36.96  ? 377 THR A CB  1 
ATOM   2838  O OG1 . THR A  1 380 ? 153.125 51.928  -37.219 1.00 36.06  ? 377 THR A OG1 1 
ATOM   2839  C CG2 . THR A  1 380 ? 152.229 49.873  -36.431 1.00 38.28  ? 377 THR A CG2 1 
ATOM   2840  N N   . SER A  1 381 ? 154.600 50.765  -33.368 1.00 43.38  ? 378 SER A N   1 
ATOM   2841  C CA  . SER A  1 381 ? 155.104 49.954  -32.269 1.00 41.94  ? 378 SER A CA  1 
ATOM   2842  C C   . SER A  1 381 ? 154.508 50.356  -30.894 1.00 38.76  ? 378 SER A C   1 
ATOM   2843  O O   . SER A  1 381 ? 154.459 49.528  -29.975 1.00 40.31  ? 378 SER A O   1 
ATOM   2844  C CB  . SER A  1 381 ? 156.638 50.009  -32.264 1.00 41.64  ? 378 SER A CB  1 
ATOM   2845  O OG  . SER A  1 381 ? 157.110 51.297  -32.628 1.00 41.14  ? 378 SER A OG  1 
ATOM   2846  N N   . TYR A  1 382 ? 154.074 51.611  -30.752 1.00 33.38  ? 379 TYR A N   1 
ATOM   2847  C CA  . TYR A  1 382 ? 153.351 52.051  -29.550 1.00 31.79  ? 379 TYR A CA  1 
ATOM   2848  C C   . TYR A  1 382 ? 151.853 51.756  -29.590 1.00 31.96  ? 379 TYR A C   1 
ATOM   2849  O O   . TYR A  1 382 ? 151.256 51.440  -28.570 1.00 32.86  ? 379 TYR A O   1 
ATOM   2850  C CB  . TYR A  1 382 ? 153.539 53.552  -29.294 1.00 31.10  ? 379 TYR A CB  1 
ATOM   2851  C CG  . TYR A  1 382 ? 152.564 54.108  -28.273 1.00 28.37  ? 379 TYR A CG  1 
ATOM   2852  C CD1 . TYR A  1 382 ? 152.854 54.068  -26.926 1.00 26.73  ? 379 TYR A CD1 1 
ATOM   2853  C CD2 . TYR A  1 382 ? 151.341 54.647  -28.667 1.00 27.30  ? 379 TYR A CD2 1 
ATOM   2854  C CE1 . TYR A  1 382 ? 151.972 54.564  -25.992 1.00 26.15  ? 379 TYR A CE1 1 
ATOM   2855  C CE2 . TYR A  1 382 ? 150.450 55.139  -27.739 1.00 27.20  ? 379 TYR A CE2 1 
ATOM   2856  C CZ  . TYR A  1 382 ? 150.764 55.097  -26.402 1.00 26.22  ? 379 TYR A CZ  1 
ATOM   2857  O OH  . TYR A  1 382 ? 149.846 55.580  -25.503 1.00 25.35  ? 379 TYR A OH  1 
ATOM   2858  N N   . GLN A  1 383 ? 151.228 51.925  -30.739 1.00 31.85  ? 380 GLN A N   1 
ATOM   2859  C CA  . GLN A  1 383 ? 149.813 51.643  -30.842 1.00 34.34  ? 380 GLN A CA  1 
ATOM   2860  C C   . GLN A  1 383 ? 149.552 50.160  -30.661 1.00 33.57  ? 380 GLN A C   1 
ATOM   2861  O O   . GLN A  1 383 ? 148.600 49.795  -30.003 1.00 36.63  ? 380 GLN A O   1 
ATOM   2862  C CB  . GLN A  1 383 ? 149.242 52.127  -32.183 1.00 37.32  ? 380 GLN A CB  1 
ATOM   2863  C CG  . GLN A  1 383 ? 149.180 53.647  -32.326 1.00 38.64  ? 380 GLN A CG  1 
ATOM   2864  C CD  . GLN A  1 383 ? 149.160 54.127  -33.776 1.00 39.69  ? 380 GLN A CD  1 
ATOM   2865  O OE1 . GLN A  1 383 ? 148.786 53.384  -34.683 1.00 38.56  ? 380 GLN A OE1 1 
ATOM   2866  N NE2 . GLN A  1 383 ? 149.574 55.380  -33.999 1.00 41.02  ? 380 GLN A NE2 1 
ATOM   2867  N N   . GLU A  1 384 ? 150.404 49.317  -31.222 1.00 33.67  ? 381 GLU A N   1 
ATOM   2868  C CA  . GLU A  1 384 ? 150.146 47.883  -31.273 1.00 36.75  ? 381 GLU A CA  1 
ATOM   2869  C C   . GLU A  1 384 ? 150.867 47.131  -30.159 1.00 36.22  ? 381 GLU A C   1 
ATOM   2870  O O   . GLU A  1 384 ? 151.872 47.610  -29.660 1.00 38.62  ? 381 GLU A O   1 
ATOM   2871  C CB  . GLU A  1 384 ? 150.534 47.349  -32.645 1.00 40.65  ? 381 GLU A CB  1 
ATOM   2872  C CG  . GLU A  1 384 ? 149.683 47.960  -33.763 1.00 43.81  ? 381 GLU A CG  1 
ATOM   2873  C CD  . GLU A  1 384 ? 150.045 47.462  -35.152 1.00 46.86  ? 381 GLU A CD  1 
ATOM   2874  O OE1 . GLU A  1 384 ? 150.954 46.605  -35.299 1.00 45.36  ? 381 GLU A OE1 1 
ATOM   2875  O OE2 . GLU A  1 384 ? 149.399 47.943  -36.103 1.00 50.21  ? 381 GLU A OE2 1 
ATOM   2876  N N   . GLU A  1 385 ? 150.320 45.979  -29.750 1.00 34.14  ? 382 GLU A N   1 
ATOM   2877  C CA  . GLU A  1 385 ? 150.872 45.171  -28.658 1.00 31.79  ? 382 GLU A CA  1 
ATOM   2878  C C   . GLU A  1 385 ? 152.013 44.319  -29.198 1.00 32.16  ? 382 GLU A C   1 
ATOM   2879  O O   . GLU A  1 385 ? 151.793 43.437  -30.051 1.00 34.95  ? 382 GLU A O   1 
ATOM   2880  C CB  . GLU A  1 385 ? 149.799 44.249  -28.049 1.00 32.78  ? 382 GLU A CB  1 
ATOM   2881  C CG  . GLU A  1 385 ? 150.338 43.257  -27.007 1.00 32.75  ? 382 GLU A CG  1 
ATOM   2882  C CD  . GLU A  1 385 ? 149.265 42.426  -26.331 1.00 32.82  ? 382 GLU A CD  1 
ATOM   2883  O OE1 . GLU A  1 385 ? 149.282 42.358  -25.077 1.00 35.02  ? 382 GLU A OE1 1 
ATOM   2884  O OE2 . GLU A  1 385 ? 148.412 41.845  -27.041 1.00 30.66  ? 382 GLU A OE2 1 
ATOM   2885  N N   . ILE A  1 386 ? 153.216 44.553  -28.679 1.00 29.60  ? 383 ILE A N   1 
ATOM   2886  C CA  . ILE A  1 386 ? 154.410 43.905  -29.186 1.00 29.51  ? 383 ILE A CA  1 
ATOM   2887  C C   . ILE A  1 386 ? 154.484 42.492  -28.670 1.00 29.61  ? 383 ILE A C   1 
ATOM   2888  O O   . ILE A  1 386 ? 154.757 41.564  -29.435 1.00 32.00  ? 383 ILE A O   1 
ATOM   2889  C CB  . ILE A  1 386 ? 155.681 44.652  -28.764 1.00 30.71  ? 383 ILE A CB  1 
ATOM   2890  C CG1 . ILE A  1 386 ? 155.732 46.032  -29.435 1.00 31.26  ? 383 ILE A CG1 1 
ATOM   2891  C CG2 . ILE A  1 386 ? 156.916 43.853  -29.157 1.00 30.95  ? 383 ILE A CG2 1 
ATOM   2892  C CD1 . ILE A  1 386 ? 156.786 46.967  -28.889 1.00 31.53  ? 383 ILE A CD1 1 
ATOM   2893  N N   . PHE A  1 387 ? 154.283 42.349  -27.363 1.00 29.80  ? 384 PHE A N   1 
ATOM   2894  C CA  . PHE A  1 387 ? 154.215 41.047  -26.697 1.00 29.94  ? 384 PHE A CA  1 
ATOM   2895  C C   . PHE A  1 387 ? 155.599 40.377  -26.767 1.00 28.62  ? 384 PHE A C   1 
ATOM   2896  O O   . PHE A  1 387 ? 155.753 39.216  -27.164 1.00 30.17  ? 384 PHE A O   1 
ATOM   2897  C CB  . PHE A  1 387 ? 153.088 40.188  -27.337 1.00 31.43  ? 384 PHE A CB  1 
ATOM   2898  C CG  . PHE A  1 387 ? 152.331 39.296  -26.365 1.00 32.33  ? 384 PHE A CG  1 
ATOM   2899  C CD1 . PHE A  1 387 ? 151.513 39.853  -25.362 1.00 32.30  ? 384 PHE A CD1 1 
ATOM   2900  C CD2 . PHE A  1 387 ? 152.382 37.900  -26.488 1.00 31.86  ? 384 PHE A CD2 1 
ATOM   2901  C CE1 . PHE A  1 387 ? 150.804 39.042  -24.491 1.00 31.79  ? 384 PHE A CE1 1 
ATOM   2902  C CE2 . PHE A  1 387 ? 151.673 37.087  -25.623 1.00 31.90  ? 384 PHE A CE2 1 
ATOM   2903  C CZ  . PHE A  1 387 ? 150.892 37.656  -24.620 1.00 33.04  ? 384 PHE A CZ  1 
ATOM   2904  N N   . GLY A  1 388 ? 156.610 41.145  -26.398 1.00 26.37  ? 385 GLY A N   1 
ATOM   2905  C CA  . GLY A  1 388 ? 157.976 40.650  -26.309 1.00 25.19  ? 385 GLY A CA  1 
ATOM   2906  C C   . GLY A  1 388 ? 158.720 41.440  -25.247 1.00 24.21  ? 385 GLY A C   1 
ATOM   2907  O O   . GLY A  1 388 ? 158.172 42.373  -24.673 1.00 24.30  ? 385 GLY A O   1 
ATOM   2908  N N   . PRO A  1 389 ? 159.986 41.095  -24.997 1.00 23.64  ? 386 PRO A N   1 
ATOM   2909  C CA  . PRO A  1 389 ? 160.739 41.733  -23.917 1.00 24.11  ? 386 PRO A CA  1 
ATOM   2910  C C   . PRO A  1 389 ? 161.189 43.167  -24.263 1.00 24.45  ? 386 PRO A C   1 
ATOM   2911  O O   . PRO A  1 389 ? 162.373 43.412  -24.470 1.00 25.48  ? 386 PRO A O   1 
ATOM   2912  C CB  . PRO A  1 389 ? 161.928 40.776  -23.715 1.00 23.53  ? 386 PRO A CB  1 
ATOM   2913  C CG  . PRO A  1 389 ? 162.123 40.126  -25.037 1.00 23.35  ? 386 PRO A CG  1 
ATOM   2914  C CD  . PRO A  1 389 ? 160.809 40.142  -25.762 1.00 23.50  ? 386 PRO A CD  1 
ATOM   2915  N N   . VAL A  1 390 ? 160.243 44.106  -24.311 1.00 23.78  ? 387 VAL A N   1 
ATOM   2916  C CA  . VAL A  1 390 ? 160.512 45.453  -24.817 1.00 23.48  ? 387 VAL A CA  1 
ATOM   2917  C C   . VAL A  1 390 ? 159.844 46.462  -23.908 1.00 23.77  ? 387 VAL A C   1 
ATOM   2918  O O   . VAL A  1 390 ? 158.644 46.390  -23.699 1.00 24.50  ? 387 VAL A O   1 
ATOM   2919  C CB  . VAL A  1 390 ? 159.974 45.623  -26.266 1.00 23.24  ? 387 VAL A CB  1 
ATOM   2920  C CG1 . VAL A  1 390 ? 160.219 47.027  -26.812 1.00 22.69  ? 387 VAL A CG1 1 
ATOM   2921  C CG2 . VAL A  1 390 ? 160.576 44.580  -27.204 1.00 22.98  ? 387 VAL A CG2 1 
ATOM   2922  N N   . LEU A  1 391 ? 160.616 47.411  -23.394 1.00 24.47  ? 388 LEU A N   1 
ATOM   2923  C CA  . LEU A  1 391 ? 160.068 48.505  -22.612 1.00 25.75  ? 388 LEU A CA  1 
ATOM   2924  C C   . LEU A  1 391 ? 160.195 49.837  -23.353 1.00 26.29  ? 388 LEU A C   1 
ATOM   2925  O O   . LEU A  1 391 ? 161.294 50.275  -23.638 1.00 26.72  ? 388 LEU A O   1 
ATOM   2926  C CB  . LEU A  1 391 ? 160.807 48.610  -21.295 1.00 27.60  ? 388 LEU A CB  1 
ATOM   2927  C CG  . LEU A  1 391 ? 160.029 49.138  -20.078 1.00 28.87  ? 388 LEU A CG  1 
ATOM   2928  C CD1 . LEU A  1 391 ? 161.012 49.680  -19.042 1.00 28.49  ? 388 LEU A CD1 1 
ATOM   2929  C CD2 . LEU A  1 391 ? 158.969 50.188  -20.398 1.00 29.04  ? 388 LEU A CD2 1 
ATOM   2930  N N   . GLN A  1 392 ? 159.054 50.462  -23.655 1.00 27.35  ? 389 GLN A N   1 
ATOM   2931  C CA  . GLN A  1 392 ? 158.971 51.803  -24.279 1.00 26.29  ? 389 GLN A CA  1 
ATOM   2932  C C   . GLN A  1 392 ? 158.771 52.892  -23.225 1.00 27.09  ? 389 GLN A C   1 
ATOM   2933  O O   . GLN A  1 392 ? 158.041 52.700  -22.259 1.00 28.51  ? 389 GLN A O   1 
ATOM   2934  C CB  . GLN A  1 392 ? 157.819 51.845  -25.290 1.00 24.84  ? 389 GLN A CB  1 
ATOM   2935  C CG  . GLN A  1 392 ? 158.135 51.086  -26.561 1.00 24.58  ? 389 GLN A CG  1 
ATOM   2936  C CD  . GLN A  1 392 ? 156.917 50.719  -27.384 1.00 24.11  ? 389 GLN A CD  1 
ATOM   2937  O OE1 . GLN A  1 392 ? 155.947 50.179  -26.869 1.00 23.84  ? 389 GLN A OE1 1 
ATOM   2938  N NE2 . GLN A  1 392 ? 156.985 50.966  -28.683 1.00 24.30  ? 389 GLN A NE2 1 
ATOM   2939  N N   . VAL A  1 393 ? 159.408 54.041  -23.403 1.00 28.55  ? 390 VAL A N   1 
ATOM   2940  C CA  . VAL A  1 393 ? 159.237 55.164  -22.448 1.00 30.20  ? 390 VAL A CA  1 
ATOM   2941  C C   . VAL A  1 393 ? 158.838 56.439  -23.179 1.00 30.80  ? 390 VAL A C   1 
ATOM   2942  O O   . VAL A  1 393 ? 159.562 56.915  -24.042 1.00 31.78  ? 390 VAL A O   1 
ATOM   2943  C CB  . VAL A  1 393 ? 160.458 55.377  -21.522 1.00 29.79  ? 390 VAL A CB  1 
ATOM   2944  C CG1 . VAL A  1 393 ? 161.719 54.971  -22.225 1.00 33.67  ? 390 VAL A CG1 1 
ATOM   2945  C CG2 . VAL A  1 393 ? 160.576 56.807  -21.017 1.00 28.06  ? 390 VAL A CG2 1 
ATOM   2946  N N   . VAL A  1 394 ? 157.656 56.938  -22.832 1.00 30.72  ? 391 VAL A N   1 
ATOM   2947  C CA  . VAL A  1 394 ? 157.125 58.172  -23.351 1.00 31.32  ? 391 VAL A CA  1 
ATOM   2948  C C   . VAL A  1 394 ? 157.392 59.251  -22.311 1.00 31.66  ? 391 VAL A C   1 
ATOM   2949  O O   . VAL A  1 394 ? 157.376 58.992  -21.106 1.00 28.77  ? 391 VAL A O   1 
ATOM   2950  C CB  . VAL A  1 394 ? 155.598 58.078  -23.591 1.00 32.84  ? 391 VAL A CB  1 
ATOM   2951  C CG1 . VAL A  1 394 ? 155.013 59.416  -24.058 1.00 32.58  ? 391 VAL A CG1 1 
ATOM   2952  C CG2 . VAL A  1 394 ? 155.279 56.989  -24.607 1.00 33.00  ? 391 VAL A CG2 1 
ATOM   2953  N N   . ARG A  1 395 ? 157.632 60.464  -22.804 1.00 33.25  ? 392 ARG A N   1 
ATOM   2954  C CA  . ARG A  1 395 ? 157.826 61.634  -21.968 1.00 32.69  ? 392 ARG A CA  1 
ATOM   2955  C C   . ARG A  1 395 ? 156.619 62.551  -22.175 1.00 30.23  ? 392 ARG A C   1 
ATOM   2956  O O   . ARG A  1 395 ? 156.122 62.680  -23.291 1.00 31.66  ? 392 ARG A O   1 
ATOM   2957  C CB  . ARG A  1 395 ? 159.164 62.299  -22.319 1.00 34.17  ? 392 ARG A CB  1 
ATOM   2958  C CG  . ARG A  1 395 ? 160.375 61.424  -21.963 1.00 35.53  ? 392 ARG A CG  1 
ATOM   2959  C CD  . ARG A  1 395 ? 161.576 61.623  -22.885 1.00 36.30  ? 392 ARG A CD  1 
ATOM   2960  N NE  . ARG A  1 395 ? 162.707 60.762  -22.521 1.00 36.03  ? 392 ARG A NE  1 
ATOM   2961  C CZ  . ARG A  1 395 ? 163.562 61.000  -21.523 1.00 35.06  ? 392 ARG A CZ  1 
ATOM   2962  N NH1 . ARG A  1 395 ? 164.560 60.155  -21.275 1.00 36.01  ? 392 ARG A NH1 1 
ATOM   2963  N NH2 . ARG A  1 395 ? 163.442 62.076  -20.775 1.00 31.88  ? 392 ARG A NH2 1 
ATOM   2964  N N   . VAL A  1 396 ? 156.106 63.108  -21.085 1.00 27.69  ? 393 VAL A N   1 
ATOM   2965  C CA  . VAL A  1 396 ? 155.004 64.077  -21.111 1.00 27.08  ? 393 VAL A CA  1 
ATOM   2966  C C   . VAL A  1 396 ? 155.229 65.175  -20.044 1.00 27.65  ? 393 VAL A C   1 
ATOM   2967  O O   . VAL A  1 396 ? 156.041 65.045  -19.116 1.00 25.23  ? 393 VAL A O   1 
ATOM   2968  C CB  . VAL A  1 396 ? 153.585 63.444  -20.905 1.00 26.26  ? 393 VAL A CB  1 
ATOM   2969  C CG1 . VAL A  1 396 ? 153.219 62.456  -22.000 1.00 25.32  ? 393 VAL A CG1 1 
ATOM   2970  C CG2 . VAL A  1 396 ? 153.469 62.767  -19.553 1.00 26.96  ? 393 VAL A CG2 1 
ATOM   2971  N N   . ALA A  1 397 ? 154.474 66.255  -20.186 1.00 28.48  ? 394 ALA A N   1 
ATOM   2972  C CA  . ALA A  1 397 ? 154.647 67.433  -19.356 1.00 28.48  ? 394 ALA A CA  1 
ATOM   2973  C C   . ALA A  1 397 ? 154.072 67.188  -17.968 1.00 29.00  ? 394 ALA A C   1 
ATOM   2974  O O   . ALA A  1 397 ? 154.748 67.382  -16.971 1.00 26.25  ? 394 ALA A O   1 
ATOM   2975  C CB  . ALA A  1 397 ? 153.974 68.632  -20.012 1.00 27.98  ? 394 ALA A CB  1 
ATOM   2976  N N   . THR A  1 398 ? 152.818 66.745  -17.930 1.00 31.22  ? 395 THR A N   1 
ATOM   2977  C CA  . THR A  1 398 ? 152.040 66.674  -16.690 1.00 32.04  ? 395 THR A CA  1 
ATOM   2978  C C   . THR A  1 398 ? 151.311 65.346  -16.512 1.00 30.39  ? 395 THR A C   1 
ATOM   2979  O O   . THR A  1 398 ? 151.158 64.571  -17.454 1.00 30.37  ? 395 THR A O   1 
ATOM   2980  C CB  . THR A  1 398 ? 151.021 67.837  -16.598 1.00 33.56  ? 395 THR A CB  1 
ATOM   2981  O OG1 . THR A  1 398 ? 150.211 67.669  -15.443 1.00 39.14  ? 395 THR A OG1 1 
ATOM   2982  C CG2 . THR A  1 398 ? 150.089 67.888  -17.782 1.00 33.90  ? 395 THR A CG2 1 
ATOM   2983  N N   . MET A  1 399 ? 150.859 65.105  -15.285 1.00 29.27  ? 396 MET A N   1 
ATOM   2984  C CA  . MET A  1 399 ? 150.210 63.847  -14.911 1.00 29.44  ? 396 MET A CA  1 
ATOM   2985  C C   . MET A  1 399 ? 148.949 63.599  -15.739 1.00 29.25  ? 396 MET A C   1 
ATOM   2986  O O   . MET A  1 399 ? 148.697 62.479  -16.239 1.00 30.00  ? 396 MET A O   1 
ATOM   2987  C CB  . MET A  1 399 ? 149.852 63.851  -13.430 1.00 28.63  ? 396 MET A CB  1 
ATOM   2988  C CG  . MET A  1 399 ? 149.247 62.542  -12.958 1.00 29.12  ? 396 MET A CG  1 
ATOM   2989  S SD  . MET A  1 399 ? 148.713 62.626  -11.246 1.00 29.39  ? 396 MET A SD  1 
ATOM   2990  C CE  . MET A  1 399 ? 147.694 61.174  -11.137 1.00 30.42  ? 396 MET A CE  1 
ATOM   2991  N N   . GLN A  1 400 ? 148.167 64.660  -15.878 1.00 27.29  ? 397 GLN A N   1 
ATOM   2992  C CA  . GLN A  1 400 ? 146.956 64.627  -16.676 1.00 26.36  ? 397 GLN A CA  1 
ATOM   2993  C C   . GLN A  1 400 ? 147.253 64.251  -18.133 1.00 27.55  ? 397 GLN A C   1 
ATOM   2994  O O   . GLN A  1 400 ? 146.450 63.576  -18.751 1.00 27.04  ? 397 GLN A O   1 
ATOM   2995  C CB  . GLN A  1 400 ? 146.213 65.980  -16.578 1.00 25.39  ? 397 GLN A CB  1 
ATOM   2996  C CG  . GLN A  1 400 ? 144.769 66.013  -17.071 1.00 24.48  ? 397 GLN A CG  1 
ATOM   2997  C CD  . GLN A  1 400 ? 143.868 64.957  -16.409 1.00 24.80  ? 397 GLN A CD  1 
ATOM   2998  O OE1 . GLN A  1 400 ? 143.574 65.020  -15.206 1.00 25.26  ? 397 GLN A OE1 1 
ATOM   2999  N NE2 . GLN A  1 400 ? 143.431 63.974  -17.191 1.00 23.69  ? 397 GLN A NE2 1 
ATOM   3000  N N   . ASP A  1 401 ? 148.401 64.664  -18.679 1.00 29.44  ? 398 ASP A N   1 
ATOM   3001  C CA  . ASP A  1 401 ? 148.736 64.324  -20.074 1.00 30.31  ? 398 ASP A CA  1 
ATOM   3002  C C   . ASP A  1 401 ? 149.014 62.842  -20.187 1.00 30.09  ? 398 ASP A C   1 
ATOM   3003  O O   . ASP A  1 401 ? 148.593 62.215  -21.168 1.00 29.13  ? 398 ASP A O   1 
ATOM   3004  C CB  . ASP A  1 401 ? 149.952 65.105  -20.592 1.00 32.04  ? 398 ASP A CB  1 
ATOM   3005  C CG  . ASP A  1 401 ? 149.668 66.580  -20.800 1.00 31.74  ? 398 ASP A CG  1 
ATOM   3006  O OD1 . ASP A  1 401 ? 148.469 66.949  -20.822 1.00 31.86  ? 398 ASP A OD1 1 
ATOM   3007  O OD2 . ASP A  1 401 ? 150.650 67.361  -20.939 1.00 31.29  ? 398 ASP A OD2 1 
ATOM   3008  N N   . ALA A  1 402 ? 149.723 62.302  -19.183 1.00 29.65  ? 399 ALA A N   1 
ATOM   3009  C CA  . ALA A  1 402 ? 149.958 60.857  -19.077 1.00 30.11  ? 399 ALA A CA  1 
ATOM   3010  C C   . ALA A  1 402 ? 148.643 60.073  -18.999 1.00 29.18  ? 399 ALA A C   1 
ATOM   3011  O O   . ALA A  1 402 ? 148.462 59.074  -19.710 1.00 28.95  ? 399 ALA A O   1 
ATOM   3012  C CB  . ALA A  1 402 ? 150.834 60.534  -17.877 1.00 30.15  ? 399 ALA A CB  1 
ATOM   3013  N N   . MET A  1 403 ? 147.729 60.536  -18.150 1.00 27.56  ? 400 MET A N   1 
ATOM   3014  C CA  . MET A  1 403 ? 146.399 59.899  -18.040 1.00 28.13  ? 400 MET A CA  1 
ATOM   3015  C C   . MET A  1 403 ? 145.512 59.964  -19.310 1.00 27.80  ? 400 MET A C   1 
ATOM   3016  O O   . MET A  1 403 ? 144.787 59.015  -19.617 1.00 27.89  ? 400 MET A O   1 
ATOM   3017  C CB  . MET A  1 403 ? 145.628 60.472  -16.851 1.00 27.11  ? 400 MET A CB  1 
ATOM   3018  C CG  . MET A  1 403 ? 146.048 59.860  -15.530 1.00 27.18  ? 400 MET A CG  1 
ATOM   3019  S SD  . MET A  1 403 ? 144.912 60.322  -14.236 1.00 25.71  ? 400 MET A SD  1 
ATOM   3020  C CE  . MET A  1 403 ? 145.576 61.965  -14.074 1.00 28.55  ? 400 MET A CE  1 
ATOM   3021  N N   . ASP A  1 404 ? 145.563 61.091  -20.022 1.00 26.70  ? 401 ASP A N   1 
ATOM   3022  C CA  . ASP A  1 404 ? 144.822 61.261  -21.267 1.00 24.60  ? 401 ASP A CA  1 
ATOM   3023  C C   . ASP A  1 404 ? 145.394 60.298  -22.281 1.00 24.67  ? 401 ASP A C   1 
ATOM   3024  O O   . ASP A  1 404 ? 144.650 59.677  -23.018 1.00 23.83  ? 401 ASP A O   1 
ATOM   3025  C CB  . ASP A  1 404 ? 144.945 62.687  -21.838 1.00 23.70  ? 401 ASP A CB  1 
ATOM   3026  C CG  . ASP A  1 404 ? 144.277 63.753  -20.986 1.00 22.87  ? 401 ASP A CG  1 
ATOM   3027  O OD1 . ASP A  1 404 ? 143.357 63.432  -20.212 1.00 21.65  ? 401 ASP A OD1 1 
ATOM   3028  O OD2 . ASP A  1 404 ? 144.691 64.941  -21.109 1.00 23.12  ? 401 ASP A OD2 1 
ATOM   3029  N N   . LEU A  1 405 ? 146.723 60.192  -22.321 1.00 25.71  ? 402 LEU A N   1 
ATOM   3030  C CA  . LEU A  1 405 ? 147.398 59.292  -23.255 1.00 25.69  ? 402 LEU A CA  1 
ATOM   3031  C C   . LEU A  1 405 ? 146.936 57.836  -23.034 1.00 26.84  ? 402 LEU A C   1 
ATOM   3032  O O   . LEU A  1 405 ? 146.672 57.118  -24.008 1.00 27.52  ? 402 LEU A O   1 
ATOM   3033  C CB  . LEU A  1 405 ? 148.915 59.424  -23.107 1.00 25.37  ? 402 LEU A CB  1 
ATOM   3034  C CG  . LEU A  1 405 ? 149.789 58.459  -23.902 1.00 25.25  ? 402 LEU A CG  1 
ATOM   3035  C CD1 . LEU A  1 405 ? 149.724 58.763  -25.382 1.00 24.52  ? 402 LEU A CD1 1 
ATOM   3036  C CD2 . LEU A  1 405 ? 151.212 58.557  -23.389 1.00 26.32  ? 402 LEU A CD2 1 
ATOM   3037  N N   . ILE A  1 406 ? 146.814 57.423  -21.764 1.00 26.07  ? 403 ILE A N   1 
ATOM   3038  C CA  . ILE A  1 406 ? 146.412 56.053  -21.437 1.00 25.38  ? 403 ILE A CA  1 
ATOM   3039  C C   . ILE A  1 406 ? 144.978 55.809  -21.901 1.00 25.57  ? 403 ILE A C   1 
ATOM   3040  O O   . ILE A  1 406 ? 144.717 54.841  -22.614 1.00 24.54  ? 403 ILE A O   1 
ATOM   3041  C CB  . ILE A  1 406 ? 146.578 55.732  -19.925 1.00 24.73  ? 403 ILE A CB  1 
ATOM   3042  C CG1 . ILE A  1 406 ? 148.060 55.715  -19.548 1.00 24.14  ? 403 ILE A CG1 1 
ATOM   3043  C CG2 . ILE A  1 406 ? 146.010 54.353  -19.592 1.00 24.39  ? 403 ILE A CG2 1 
ATOM   3044  C CD1 . ILE A  1 406 ? 148.355 55.793  -18.067 1.00 23.65  ? 403 ILE A CD1 1 
ATOM   3045  N N   . ASP A  1 407 ? 144.069 56.700  -21.495 1.00 26.41  ? 404 ASP A N   1 
ATOM   3046  C CA  . ASP A  1 407 ? 142.638 56.622  -21.843 1.00 26.62  ? 404 ASP A CA  1 
ATOM   3047  C C   . ASP A  1 407 ? 142.399 56.634  -23.350 1.00 29.00  ? 404 ASP A C   1 
ATOM   3048  O O   . ASP A  1 407 ? 141.433 56.050  -23.834 1.00 31.12  ? 404 ASP A O   1 
ATOM   3049  C CB  . ASP A  1 407 ? 141.850 57.792  -21.239 1.00 25.72  ? 404 ASP A CB  1 
ATOM   3050  C CG  . ASP A  1 407 ? 141.769 57.740  -19.735 1.00 25.63  ? 404 ASP A CG  1 
ATOM   3051  O OD1 . ASP A  1 407 ? 141.783 56.633  -19.156 1.00 25.88  ? 404 ASP A OD1 1 
ATOM   3052  O OD2 . ASP A  1 407 ? 141.700 58.828  -19.132 1.00 25.24  ? 404 ASP A OD2 1 
ATOM   3053  N N   . ALA A  1 408 ? 143.261 57.334  -24.084 1.00 31.32  ? 405 ALA A N   1 
ATOM   3054  C CA  . ALA A  1 408 ? 143.188 57.398  -25.555 1.00 31.02  ? 405 ALA A CA  1 
ATOM   3055  C C   . ALA A  1 408 ? 143.450 56.046  -26.207 1.00 30.95  ? 405 ALA A C   1 
ATOM   3056  O O   . ALA A  1 408 ? 142.860 55.745  -27.233 1.00 32.86  ? 405 ALA A O   1 
ATOM   3057  C CB  . ALA A  1 408 ? 144.174 58.426  -26.100 1.00 30.56  ? 405 ALA A CB  1 
ATOM   3058  N N   . HIS A  1 409 ? 144.321 55.239  -25.602 1.00 30.49  ? 406 HIS A N   1 
ATOM   3059  C CA  . HIS A  1 409 ? 144.748 53.966  -26.183 1.00 29.34  ? 406 HIS A CA  1 
ATOM   3060  C C   . HIS A  1 409 ? 143.593 52.997  -26.418 1.00 29.35  ? 406 HIS A C   1 
ATOM   3061  O O   . HIS A  1 409 ? 142.562 53.040  -25.747 1.00 27.91  ? 406 HIS A O   1 
ATOM   3062  C CB  . HIS A  1 409 ? 145.821 53.286  -25.316 1.00 29.13  ? 406 HIS A CB  1 
ATOM   3063  C CG  . HIS A  1 409 ? 146.733 52.405  -26.100 1.00 29.14  ? 406 HIS A CG  1 
ATOM   3064  N ND1 . HIS A  1 409 ? 146.412 51.110  -26.429 1.00 28.21  ? 406 HIS A ND1 1 
ATOM   3065  C CD2 . HIS A  1 409 ? 147.932 52.652  -26.677 1.00 30.26  ? 406 HIS A CD2 1 
ATOM   3066  C CE1 . HIS A  1 409 ? 147.376 50.585  -27.160 1.00 28.31  ? 406 HIS A CE1 1 
ATOM   3067  N NE2 . HIS A  1 409 ? 148.314 51.498  -27.322 1.00 30.00  ? 406 HIS A NE2 1 
ATOM   3068  N N   . GLU A  1 410 ? 143.775 52.127  -27.398 1.00 30.80  ? 407 GLU A N   1 
ATOM   3069  C CA  . GLU A  1 410 ? 142.769 51.117  -27.718 1.00 32.60  ? 407 GLU A CA  1 
ATOM   3070  C C   . GLU A  1 410 ? 142.430 50.279  -26.471 1.00 32.23  ? 407 GLU A C   1 
ATOM   3071  O O   . GLU A  1 410 ? 141.264 50.232  -26.030 1.00 32.58  ? 407 GLU A O   1 
ATOM   3072  C CB  . GLU A  1 410 ? 143.259 50.241  -28.891 1.00 33.79  ? 407 GLU A CB  1 
ATOM   3073  C CG  . GLU A  1 410 ? 142.214 49.321  -29.528 1.00 34.25  ? 407 GLU A CG  1 
ATOM   3074  C CD  . GLU A  1 410 ? 142.818 48.359  -30.554 1.00 35.28  ? 407 GLU A CD  1 
ATOM   3075  O OE1 . GLU A  1 410 ? 143.973 48.616  -31.007 1.00 34.61  ? 407 GLU A OE1 1 
ATOM   3076  O OE2 . GLU A  1 410 ? 142.145 47.342  -30.895 1.00 32.47  ? 407 GLU A OE2 1 
ATOM   3077  N N   . TYR A  1 411 ? 143.470 49.654  -25.918 1.00 30.24  ? 408 TYR A N   1 
ATOM   3078  C CA  . TYR A  1 411 ? 143.394 48.815  -24.727 1.00 29.34  ? 408 TYR A CA  1 
ATOM   3079  C C   . TYR A  1 411 ? 143.289 49.565  -23.375 1.00 28.16  ? 408 TYR A C   1 
ATOM   3080  O O   . TYR A  1 411 ? 143.656 50.733  -23.242 1.00 27.97  ? 408 TYR A O   1 
ATOM   3081  C CB  . TYR A  1 411 ? 144.609 47.892  -24.690 1.00 29.96  ? 408 TYR A CB  1 
ATOM   3082  C CG  . TYR A  1 411 ? 144.833 47.067  -25.949 1.00 32.45  ? 408 TYR A CG  1 
ATOM   3083  C CD1 . TYR A  1 411 ? 143.801 46.304  -26.529 1.00 35.04  ? 408 TYR A CD1 1 
ATOM   3084  C CD2 . TYR A  1 411 ? 146.080 47.027  -26.561 1.00 32.77  ? 408 TYR A CD2 1 
ATOM   3085  C CE1 . TYR A  1 411 ? 144.020 45.545  -27.684 1.00 33.20  ? 408 TYR A CE1 1 
ATOM   3086  C CE2 . TYR A  1 411 ? 146.299 46.267  -27.708 1.00 32.75  ? 408 TYR A CE2 1 
ATOM   3087  C CZ  . TYR A  1 411 ? 145.270 45.532  -28.264 1.00 32.22  ? 408 TYR A CZ  1 
ATOM   3088  O OH  . TYR A  1 411 ? 145.515 44.773  -29.375 1.00 30.79  ? 408 TYR A OH  1 
ATOM   3089  N N   . GLY A  1 412 ? 142.766 48.863  -22.376 1.00 26.32  ? 409 GLY A N   1 
ATOM   3090  C CA  . GLY A  1 412 ? 142.732 49.354  -20.999 1.00 25.48  ? 409 GLY A CA  1 
ATOM   3091  C C   . GLY A  1 412 ? 142.747 48.195  -20.009 1.00 24.44  ? 409 GLY A C   1 
ATOM   3092  O O   . GLY A  1 412 ? 141.917 48.145  -19.100 1.00 22.94  ? 409 GLY A O   1 
ATOM   3093  N N   . ASN A  1 413 ? 143.695 47.268  -20.189 1.00 23.53  ? 410 ASN A N   1 
ATOM   3094  C CA  . ASN A  1 413 ? 143.744 46.039  -19.394 1.00 22.62  ? 410 ASN A CA  1 
ATOM   3095  C C   . ASN A  1 413 ? 144.263 46.349  -18.009 1.00 23.36  ? 410 ASN A C   1 
ATOM   3096  O O   . ASN A  1 413 ? 143.538 46.178  -17.042 1.00 24.87  ? 410 ASN A O   1 
ATOM   3097  C CB  . ASN A  1 413 ? 144.593 44.950  -20.069 1.00 21.64  ? 410 ASN A CB  1 
ATOM   3098  C CG  . ASN A  1 413 ? 144.116 43.529  -19.755 1.00 21.03  ? 410 ASN A CG  1 
ATOM   3099  O OD1 . ASN A  1 413 ? 142.968 43.307  -19.418 1.00 21.13  ? 410 ASN A OD1 1 
ATOM   3100  N ND2 . ASN A  1 413 ? 145.001 42.557  -19.903 1.00 20.72  ? 410 ASN A ND2 1 
ATOM   3101  N N   . GLY A  1 414 ? 145.489 46.862  -17.923 1.00 23.12  ? 411 GLY A N   1 
ATOM   3102  C CA  . GLY A  1 414 ? 146.143 47.136  -16.639 1.00 22.48  ? 411 GLY A CA  1 
ATOM   3103  C C   . GLY A  1 414 ? 147.037 48.364  -16.687 1.00 23.02  ? 411 GLY A C   1 
ATOM   3104  O O   . GLY A  1 414 ? 147.599 48.678  -17.727 1.00 24.53  ? 411 GLY A O   1 
ATOM   3105  N N   . THR A  1 415 ? 147.180 49.054  -15.559 1.00 21.77  ? 412 THR A N   1 
ATOM   3106  C CA  . THR A  1 415 ? 148.012 50.238  -15.474 1.00 21.27  ? 412 THR A CA  1 
ATOM   3107  C C   . THR A  1 415 ? 148.607 50.346  -14.087 1.00 22.36  ? 412 THR A C   1 
ATOM   3108  O O   . THR A  1 415 ? 148.126 49.680  -13.158 1.00 24.13  ? 412 THR A O   1 
ATOM   3109  C CB  . THR A  1 415 ? 147.205 51.506  -15.734 1.00 21.70  ? 412 THR A CB  1 
ATOM   3110  O OG1 . THR A  1 415 ? 148.094 52.627  -15.816 1.00 22.21  ? 412 THR A OG1 1 
ATOM   3111  C CG2 . THR A  1 415 ? 146.188 51.766  -14.618 1.00 21.76  ? 412 THR A CG2 1 
ATOM   3112  N N   . CYS A  1 416 ? 149.640 51.190  -13.945 1.00 21.93  ? 413 CYS A N   1 
ATOM   3113  C CA  . CYS A  1 416 ? 150.266 51.475  -12.640 1.00 21.03  ? 413 CYS A CA  1 
ATOM   3114  C C   . CYS A  1 416 ? 150.636 52.951  -12.533 1.00 20.73  ? 413 CYS A C   1 
ATOM   3115  O O   . CYS A  1 416 ? 150.824 53.622  -13.533 1.00 20.50  ? 413 CYS A O   1 
ATOM   3116  C CB  . CYS A  1 416 ? 151.513 50.603  -12.383 1.00 20.96  ? 413 CYS A CB  1 
ATOM   3117  S SG  . CYS A  1 416 ? 152.578 51.101  -10.952 1.00 20.92  ? 413 CYS A SG  1 
ATOM   3118  N N   . ILE A  1 417 ? 150.732 53.442  -11.307 1.00 20.05  ? 414 ILE A N   1 
ATOM   3119  C CA  . ILE A  1 417 ? 151.318 54.732  -11.063 1.00 20.75  ? 414 ILE A CA  1 
ATOM   3120  C C   . ILE A  1 417 ? 152.362 54.584  -9.968  1.00 21.90  ? 414 ILE A C   1 
ATOM   3121  O O   . ILE A  1 417 ? 152.083 53.964  -8.944  1.00 24.18  ? 414 ILE A O   1 
ATOM   3122  C CB  . ILE A  1 417 ? 150.262 55.783  -10.678 1.00 20.52  ? 414 ILE A CB  1 
ATOM   3123  C CG1 . ILE A  1 417 ? 150.925 57.149  -10.507 1.00 20.10  ? 414 ILE A CG1 1 
ATOM   3124  C CG2 . ILE A  1 417 ? 149.505 55.397  -9.410  1.00 20.32  ? 414 ILE A CG2 1 
ATOM   3125  C CD1 . ILE A  1 417 ? 149.944 58.293  -10.486 1.00 20.25  ? 414 ILE A CD1 1 
ATOM   3126  N N   . PHE A  1 418 ? 153.559 55.132  -10.189 1.00 21.38  ? 415 PHE A N   1 
ATOM   3127  C CA  . PHE A  1 418 ? 154.563 55.216  -9.153  1.00 20.51  ? 415 PHE A CA  1 
ATOM   3128  C C   . PHE A  1 418 ? 154.493 56.607  -8.546  1.00 21.86  ? 415 PHE A C   1 
ATOM   3129  O O   . PHE A  1 418 ? 154.724 57.592  -9.234  1.00 22.55  ? 415 PHE A O   1 
ATOM   3130  C CB  . PHE A  1 418 ? 155.921 54.953  -9.735  1.00 19.75  ? 415 PHE A CB  1 
ATOM   3131  C CG  . PHE A  1 418 ? 156.079 53.573  -10.263 1.00 19.54  ? 415 PHE A CG  1 
ATOM   3132  C CD1 . PHE A  1 418 ? 156.205 52.508  -9.400  1.00 19.93  ? 415 PHE A CD1 1 
ATOM   3133  C CD2 . PHE A  1 418 ? 156.110 53.337  -11.613 1.00 19.43  ? 415 PHE A CD2 1 
ATOM   3134  C CE1 . PHE A  1 418 ? 156.365 51.223  -9.885  1.00 20.46  ? 415 PHE A CE1 1 
ATOM   3135  C CE2 . PHE A  1 418 ? 156.272 52.066  -12.107 1.00 19.93  ? 415 PHE A CE2 1 
ATOM   3136  C CZ  . PHE A  1 418 ? 156.394 51.002  -11.245 1.00 20.28  ? 415 PHE A CZ  1 
ATOM   3137  N N   . THR A  1 419 ? 154.152 56.686  -7.262  1.00 23.08  ? 416 THR A N   1 
ATOM   3138  C CA  . THR A  1 419 ? 154.175 57.946  -6.511  1.00 23.10  ? 416 THR A CA  1 
ATOM   3139  C C   . THR A  1 419 ? 154.212 57.696  -5.001  1.00 23.91  ? 416 THR A C   1 
ATOM   3140  O O   . THR A  1 419 ? 154.023 56.573  -4.543  1.00 24.89  ? 416 THR A O   1 
ATOM   3141  C CB  . THR A  1 419 ? 152.962 58.819  -6.885  1.00 23.30  ? 416 THR A CB  1 
ATOM   3142  O OG1 . THR A  1 419 ? 153.003 60.067  -6.180  1.00 23.99  ? 416 THR A OG1 1 
ATOM   3143  C CG2 . THR A  1 419 ? 151.650 58.122  -6.576  1.00 23.35  ? 416 THR A CG2 1 
ATOM   3144  N N   . ARG A  1 420 ? 154.489 58.744  -4.243  1.00 25.79  ? 417 ARG A N   1 
ATOM   3145  C CA  . ARG A  1 420 ? 154.401 58.712  -2.778  1.00 28.29  ? 417 ARG A CA  1 
ATOM   3146  C C   . ARG A  1 420 ? 153.139 59.400  -2.308  1.00 25.06  ? 417 ARG A C   1 
ATOM   3147  O O   . ARG A  1 420 ? 152.668 59.135  -1.222  1.00 23.18  ? 417 ARG A O   1 
ATOM   3148  C CB  . ARG A  1 420 ? 155.667 59.327  -2.115  1.00 34.27  ? 417 ARG A CB  1 
ATOM   3149  C CG  . ARG A  1 420 ? 156.974 58.629  -2.534  1.00 43.34  ? 417 ARG A CG  1 
ATOM   3150  C CD  . ARG A  1 420 ? 158.246 58.927  -1.720  1.00 50.40  ? 417 ARG A CD  1 
ATOM   3151  N NE  . ARG A  1 420 ? 158.089 58.385  -0.368  1.00 66.03  ? 417 ARG A NE  1 
ATOM   3152  C CZ  . ARG A  1 420 ? 157.719 59.083  0.716   1.00 81.22  ? 417 ARG A CZ  1 
ATOM   3153  N NH1 . ARG A  1 420 ? 157.486 60.394  0.639   1.00 91.81  ? 417 ARG A NH1 1 
ATOM   3154  N NH2 . ARG A  1 420 ? 157.572 58.466  1.896   1.00 79.56  ? 417 ARG A NH2 1 
ATOM   3155  N N   . ASP A  1 421 ? 152.581 60.262  -3.149  1.00 25.21  ? 418 ASP A N   1 
ATOM   3156  C CA  . ASP A  1 421 ? 151.435 61.121  -2.793  1.00 25.85  ? 418 ASP A CA  1 
ATOM   3157  C C   . ASP A  1 421 ? 150.069 60.426  -2.852  1.00 25.48  ? 418 ASP A C   1 
ATOM   3158  O O   . ASP A  1 421 ? 149.735 59.767  -3.840  1.00 25.88  ? 418 ASP A O   1 
ATOM   3159  C CB  . ASP A  1 421 ? 151.389 62.366  -3.706  1.00 25.43  ? 418 ASP A CB  1 
ATOM   3160  C CG  . ASP A  1 421 ? 150.255 63.301  -3.365  1.00 25.39  ? 418 ASP A CG  1 
ATOM   3161  O OD1 . ASP A  1 421 ? 150.122 63.655  -2.171  1.00 27.12  ? 418 ASP A OD1 1 
ATOM   3162  O OD2 . ASP A  1 421 ? 149.473 63.655  -4.278  1.00 24.76  ? 418 ASP A OD2 1 
ATOM   3163  N N   . GLY A  1 422 ? 149.272 60.647  -1.808  1.00 24.95  ? 419 GLY A N   1 
ATOM   3164  C CA  . GLY A  1 422 ? 147.969 60.019  -1.667  1.00 25.34  ? 419 GLY A CA  1 
ATOM   3165  C C   . GLY A  1 422 ? 146.895 60.581  -2.571  1.00 25.67  ? 419 GLY A C   1 
ATOM   3166  O O   . GLY A  1 422 ? 146.030 59.846  -3.057  1.00 24.01  ? 419 GLY A O   1 
ATOM   3167  N N   . GLU A  1 423 ? 146.955 61.894  -2.775  1.00 27.30  ? 420 GLU A N   1 
ATOM   3168  C CA  . GLU A  1 423 ? 146.031 62.614  -3.657  1.00 28.81  ? 420 GLU A CA  1 
ATOM   3169  C C   . GLU A  1 423 ? 146.160 62.173  -5.107  1.00 26.10  ? 420 GLU A C   1 
ATOM   3170  O O   . GLU A  1 423 ? 145.157 62.089  -5.837  1.00 24.84  ? 420 GLU A O   1 
ATOM   3171  C CB  . GLU A  1 423 ? 146.285 64.128  -3.562  1.00 33.74  ? 420 GLU A CB  1 
ATOM   3172  C CG  . GLU A  1 423 ? 145.116 65.042  -3.957  1.00 38.12  ? 420 GLU A CG  1 
ATOM   3173  C CD  . GLU A  1 423 ? 145.038 65.408  -5.434  1.00 42.10  ? 420 GLU A CD  1 
ATOM   3174  O OE1 . GLU A  1 423 ? 146.073 65.383  -6.135  1.00 50.50  ? 420 GLU A OE1 1 
ATOM   3175  O OE2 . GLU A  1 423 ? 143.930 65.774  -5.895  1.00 45.83  ? 420 GLU A OE2 1 
ATOM   3176  N N   . ALA A  1 424 ? 147.391 61.900  -5.522  1.00 23.64  ? 421 ALA A N   1 
ATOM   3177  C CA  . ALA A  1 424 ? 147.635 61.504  -6.896  1.00 23.10  ? 421 ALA A CA  1 
ATOM   3178  C C   . ALA A  1 424 ? 147.205 60.070  -7.113  1.00 21.12  ? 421 ALA A C   1 
ATOM   3179  O O   . ALA A  1 424 ? 146.553 59.769  -8.118  1.00 19.67  ? 421 ALA A O   1 
ATOM   3180  C CB  . ALA A  1 424 ? 149.095 61.699  -7.270  1.00 24.31  ? 421 ALA A CB  1 
ATOM   3181  N N   . ALA A  1 425 ? 147.550 59.199  -6.165  1.00 20.08  ? 422 ALA A N   1 
ATOM   3182  C CA  . ALA A  1 425 ? 147.121 57.796  -6.231  1.00 20.54  ? 422 ALA A CA  1 
ATOM   3183  C C   . ALA A  1 425 ? 145.606 57.684  -6.409  1.00 20.55  ? 422 ALA A C   1 
ATOM   3184  O O   . ALA A  1 425 ? 145.167 57.059  -7.339  1.00 20.15  ? 422 ALA A O   1 
ATOM   3185  C CB  . ALA A  1 425 ? 147.567 57.020  -4.999  1.00 20.97  ? 422 ALA A CB  1 
ATOM   3186  N N   . ARG A  1 426 ? 144.819 58.338  -5.557  1.00 21.89  ? 423 ARG A N   1 
ATOM   3187  C CA  . ARG A  1 426 ? 143.358 58.235  -5.634  1.00 23.50  ? 423 ARG A CA  1 
ATOM   3188  C C   . ARG A  1 426 ? 142.786 58.779  -6.929  1.00 22.98  ? 423 ARG A C   1 
ATOM   3189  O O   . ARG A  1 426 ? 141.921 58.148  -7.539  1.00 22.65  ? 423 ARG A O   1 
ATOM   3190  C CB  . ARG A  1 426 ? 142.641 58.952  -4.479  1.00 25.23  ? 423 ARG A CB  1 
ATOM   3191  C CG  . ARG A  1 426 ? 141.218 58.412  -4.306  1.00 26.83  ? 423 ARG A CG  1 
ATOM   3192  C CD  . ARG A  1 426 ? 140.234 59.385  -3.707  1.00 28.83  ? 423 ARG A CD  1 
ATOM   3193  N NE  . ARG A  1 426 ? 139.366 60.002  -4.718  1.00 31.42  ? 423 ARG A NE  1 
ATOM   3194  C CZ  . ARG A  1 426 ? 138.151 59.569  -5.096  1.00 32.15  ? 423 ARG A CZ  1 
ATOM   3195  N NH1 . ARG A  1 426 ? 137.475 60.253  -6.015  1.00 32.44  ? 423 ARG A NH1 1 
ATOM   3196  N NH2 . ARG A  1 426 ? 137.598 58.467  -4.589  1.00 31.23  ? 423 ARG A NH2 1 
ATOM   3197  N N   . TYR A  1 427 ? 143.243 59.965  -7.316  1.00 22.21  ? 424 TYR A N   1 
ATOM   3198  C CA  . TYR A  1 427 ? 142.760 60.598  -8.539  1.00 21.54  ? 424 TYR A CA  1 
ATOM   3199  C C   . TYR A  1 427 ? 143.023 59.717  -9.770  1.00 20.70  ? 424 TYR A C   1 
ATOM   3200  O O   . TYR A  1 427 ? 142.165 59.613  -10.651 1.00 19.38  ? 424 TYR A O   1 
ATOM   3201  C CB  . TYR A  1 427 ? 143.400 61.972  -8.709  1.00 21.76  ? 424 TYR A CB  1 
ATOM   3202  C CG  . TYR A  1 427 ? 142.897 62.709  -9.921  1.00 22.10  ? 424 TYR A CG  1 
ATOM   3203  C CD1 . TYR A  1 427 ? 141.686 63.411  -9.877  1.00 23.13  ? 424 TYR A CD1 1 
ATOM   3204  C CD2 . TYR A  1 427 ? 143.613 62.712  -11.114 1.00 22.25  ? 424 TYR A CD2 1 
ATOM   3205  C CE1 . TYR A  1 427 ? 141.203 64.100  -10.983 1.00 22.69  ? 424 TYR A CE1 1 
ATOM   3206  C CE2 . TYR A  1 427 ? 143.122 63.389  -12.232 1.00 22.79  ? 424 TYR A CE2 1 
ATOM   3207  C CZ  . TYR A  1 427 ? 141.930 64.080  -12.153 1.00 22.78  ? 424 TYR A CZ  1 
ATOM   3208  O OH  . TYR A  1 427 ? 141.485 64.741  -13.256 1.00 22.97  ? 424 TYR A OH  1 
ATOM   3209  N N   . PHE A  1 428 ? 144.213 59.098  -9.812  1.00 19.67  ? 425 PHE A N   1 
ATOM   3210  C CA  . PHE A  1 428 ? 144.572 58.168  -10.873 1.00 18.42  ? 425 PHE A CA  1 
ATOM   3211  C C   . PHE A  1 428 ? 143.668 56.924  -10.823 1.00 18.73  ? 425 PHE A C   1 
ATOM   3212  O O   . PHE A  1 428 ? 142.979 56.604  -11.791 1.00 18.40  ? 425 PHE A O   1 
ATOM   3213  C CB  . PHE A  1 428 ? 146.033 57.768  -10.731 1.00 17.86  ? 425 PHE A CB  1 
ATOM   3214  C CG  . PHE A  1 428 ? 146.490 56.737  -11.732 1.00 17.12  ? 425 PHE A CG  1 
ATOM   3215  C CD1 . PHE A  1 428 ? 146.705 57.081  -13.050 1.00 16.44  ? 425 PHE A CD1 1 
ATOM   3216  C CD2 . PHE A  1 428 ? 146.712 55.427  -11.348 1.00 16.83  ? 425 PHE A CD2 1 
ATOM   3217  C CE1 . PHE A  1 428 ? 147.129 56.148  -13.971 1.00 16.27  ? 425 PHE A CE1 1 
ATOM   3218  C CE2 . PHE A  1 428 ? 147.130 54.485  -12.272 1.00 16.78  ? 425 PHE A CE2 1 
ATOM   3219  C CZ  . PHE A  1 428 ? 147.343 54.850  -13.591 1.00 16.41  ? 425 PHE A CZ  1 
ATOM   3220  N N   . SER A  1 429 ? 143.648 56.247  -9.679  1.00 18.49  ? 426 SER A N   1 
ATOM   3221  C CA  . SER A  1 429 ? 142.876 55.011  -9.539  1.00 18.69  ? 426 SER A CA  1 
ATOM   3222  C C   . SER A  1 429 ? 141.362 55.202  -9.738  1.00 19.36  ? 426 SER A C   1 
ATOM   3223  O O   . SER A  1 429 ? 140.670 54.310  -10.252 1.00 17.88  ? 426 SER A O   1 
ATOM   3224  C CB  . SER A  1 429 ? 143.157 54.344  -8.186  1.00 18.38  ? 426 SER A CB  1 
ATOM   3225  O OG  . SER A  1 429 ? 142.588 55.071  -7.111  1.00 18.19  ? 426 SER A OG  1 
ATOM   3226  N N   . ASP A  1 430 ? 140.860 56.368  -9.333  1.00 20.93  ? 427 ASP A N   1 
ATOM   3227  C CA  . ASP A  1 430 ? 139.442 56.683  -9.494  1.00 21.99  ? 427 ASP A CA  1 
ATOM   3228  C C   . ASP A  1 430 ? 139.093 56.918  -10.945 1.00 22.23  ? 427 ASP A C   1 
ATOM   3229  O O   . ASP A  1 430 ? 138.167 56.295  -11.450 1.00 22.50  ? 427 ASP A O   1 
ATOM   3230  C CB  . ASP A  1 430 ? 139.024 57.903  -8.683  1.00 22.72  ? 427 ASP A CB  1 
ATOM   3231  C CG  . ASP A  1 430 ? 137.521 58.032  -8.575  1.00 23.84  ? 427 ASP A CG  1 
ATOM   3232  O OD1 . ASP A  1 430 ? 136.875 57.084  -8.124  1.00 24.72  ? 427 ASP A OD1 1 
ATOM   3233  O OD2 . ASP A  1 430 ? 136.950 59.070  -8.934  1.00 27.44  ? 427 ASP A OD2 1 
ATOM   3234  N N   . ASN A  1 431 ? 139.857 57.783  -11.615 1.00 22.58  ? 428 ASN A N   1 
ATOM   3235  C CA  . ASN A  1 431 ? 139.507 58.275  -12.959 1.00 22.52  ? 428 ASN A CA  1 
ATOM   3236  C C   . ASN A  1 431 ? 140.100 57.545  -14.133 1.00 21.33  ? 428 ASN A C   1 
ATOM   3237  O O   . ASN A  1 431 ? 139.660 57.800  -15.249 1.00 21.20  ? 428 ASN A O   1 
ATOM   3238  C CB  . ASN A  1 431 ? 139.895 59.745  -13.104 1.00 23.71  ? 428 ASN A CB  1 
ATOM   3239  C CG  . ASN A  1 431 ? 139.174 60.625  -12.127 1.00 25.19  ? 428 ASN A CG  1 
ATOM   3240  O OD1 . ASN A  1 431 ? 139.769 61.162  -11.189 1.00 27.04  ? 428 ASN A OD1 1 
ATOM   3241  N ND2 . ASN A  1 431 ? 137.872 60.759  -12.319 1.00 26.47  ? 428 ASN A ND2 1 
ATOM   3242  N N   . ILE A  1 432 ? 141.105 56.694  -13.920 1.00 20.84  ? 429 ILE A N   1 
ATOM   3243  C CA  . ILE A  1 432 ? 141.780 56.019  -15.059 1.00 21.28  ? 429 ILE A CA  1 
ATOM   3244  C C   . ILE A  1 432 ? 140.894 54.953  -15.696 1.00 20.58  ? 429 ILE A C   1 
ATOM   3245  O O   . ILE A  1 432 ? 140.285 54.159  -14.995 1.00 19.52  ? 429 ILE A O   1 
ATOM   3246  C CB  . ILE A  1 432 ? 143.168 55.438  -14.688 1.00 21.84  ? 429 ILE A CB  1 
ATOM   3247  C CG1 . ILE A  1 432 ? 143.964 55.067  -15.948 1.00 22.59  ? 429 ILE A CG1 1 
ATOM   3248  C CG2 . ILE A  1 432 ? 143.065 54.250  -13.744 1.00 21.99  ? 429 ILE A CG2 1 
ATOM   3249  C CD1 . ILE A  1 432 ? 144.621 56.260  -16.636 1.00 23.40  ? 429 ILE A CD1 1 
ATOM   3250  N N   . GLN A  1 433 ? 140.832 54.937  -17.025 1.00 21.37  ? 430 GLN A N   1 
ATOM   3251  C CA  . GLN A  1 433 ? 139.895 54.074  -17.746 1.00 22.01  ? 430 GLN A CA  1 
ATOM   3252  C C   . GLN A  1 433 ? 140.506 52.724  -18.093 1.00 20.40  ? 430 GLN A C   1 
ATOM   3253  O O   . GLN A  1 433 ? 140.521 52.334  -19.260 1.00 19.93  ? 430 GLN A O   1 
ATOM   3254  C CB  . GLN A  1 433 ? 139.404 54.763  -19.021 1.00 24.56  ? 430 GLN A CB  1 
ATOM   3255  C CG  . GLN A  1 433 ? 138.666 56.073  -18.789 1.00 27.50  ? 430 GLN A CG  1 
ATOM   3256  C CD  . GLN A  1 433 ? 137.380 55.895  -17.976 1.00 31.12  ? 430 GLN A CD  1 
ATOM   3257  O OE1 . GLN A  1 433 ? 136.460 55.169  -18.391 1.00 34.66  ? 430 GLN A OE1 1 
ATOM   3258  N NE2 . GLN A  1 433 ? 137.305 56.553  -16.813 1.00 31.84  ? 430 GLN A NE2 1 
ATOM   3259  N N   . VAL A  1 434 ? 141.034 52.029  -17.078 1.00 18.76  ? 431 VAL A N   1 
ATOM   3260  C CA  . VAL A  1 434 ? 141.483 50.633  -17.201 1.00 17.34  ? 431 VAL A CA  1 
ATOM   3261  C C   . VAL A  1 434 ? 140.972 49.798  -16.020 1.00 15.35  ? 431 VAL A C   1 
ATOM   3262  O O   . VAL A  1 434 ? 140.766 50.300  -14.917 1.00 14.82  ? 431 VAL A O   1 
ATOM   3263  C CB  . VAL A  1 434 ? 143.028 50.500  -17.383 1.00 18.05  ? 431 VAL A CB  1 
ATOM   3264  C CG1 . VAL A  1 434 ? 143.641 51.807  -17.835 1.00 18.21  ? 431 VAL A CG1 1 
ATOM   3265  C CG2 . VAL A  1 434 ? 143.731 50.027  -16.120 1.00 18.73  ? 431 VAL A CG2 1 
ATOM   3266  N N   . GLY A  1 435 ? 140.809 48.509  -16.265 1.00 14.12  ? 432 GLY A N   1 
ATOM   3267  C CA  . GLY A  1 435 ? 140.188 47.596  -15.310 1.00 13.58  ? 432 GLY A CA  1 
ATOM   3268  C C   . GLY A  1 435 ? 140.996 47.290  -14.061 1.00 13.04  ? 432 GLY A C   1 
ATOM   3269  O O   . GLY A  1 435 ? 140.461 47.202  -12.966 1.00 12.68  ? 432 GLY A O   1 
ATOM   3270  N N   . MET A  1 436 ? 142.290 47.094  -14.228 1.00 12.65  ? 433 MET A N   1 
ATOM   3271  C CA  . MET A  1 436 ? 143.153 46.760  -13.106 1.00 12.40  ? 433 MET A CA  1 
ATOM   3272  C C   . MET A  1 436 ? 144.255 47.804  -12.912 1.00 11.84  ? 433 MET A C   1 
ATOM   3273  O O   . MET A  1 436 ? 145.120 47.971  -13.751 1.00 11.79  ? 433 MET A O   1 
ATOM   3274  C CB  . MET A  1 436 ? 143.733 45.370  -13.325 1.00 12.61  ? 433 MET A CB  1 
ATOM   3275  C CG  . MET A  1 436 ? 142.678 44.285  -13.313 1.00 12.67  ? 433 MET A CG  1 
ATOM   3276  S SD  . MET A  1 436 ? 143.105 42.849  -14.292 1.00 13.08  ? 433 MET A SD  1 
ATOM   3277  C CE  . MET A  1 436 ? 142.881 43.454  -15.951 1.00 12.84  ? 433 MET A CE  1 
ATOM   3278  N N   . VAL A  1 437 ? 144.204 48.472  -11.772 1.00 11.47  ? 434 VAL A N   1 
ATOM   3279  C CA  . VAL A  1 437 ? 145.012 49.621  -11.457 1.00 11.25  ? 434 VAL A CA  1 
ATOM   3280  C C   . VAL A  1 437 ? 145.969 49.262  -10.344 1.00 11.68  ? 434 VAL A C   1 
ATOM   3281  O O   . VAL A  1 437 ? 145.565 48.650  -9.343  1.00 11.47  ? 434 VAL A O   1 
ATOM   3282  C CB  . VAL A  1 437 ? 144.113 50.723  -10.914 1.00 11.01  ? 434 VAL A CB  1 
ATOM   3283  C CG1 . VAL A  1 437 ? 144.904 51.965  -10.591 1.00 10.92  ? 434 VAL A CG1 1 
ATOM   3284  C CG2 . VAL A  1 437 ? 143.014 51.036  -11.903 1.00 11.10  ? 434 VAL A CG2 1 
ATOM   3285  N N   . GLY A  1 438 ? 147.225 49.668  -10.502 1.00 12.17  ? 435 GLY A N   1 
ATOM   3286  C CA  . GLY A  1 438 ? 148.239 49.475  -9.468  1.00 12.89  ? 435 GLY A CA  1 
ATOM   3287  C C   . GLY A  1 438 ? 148.724 50.804  -8.898  1.00 13.50  ? 435 GLY A C   1 
ATOM   3288  O O   . GLY A  1 438 ? 148.797 51.786  -9.625  1.00 13.30  ? 435 GLY A O   1 
ATOM   3289  N N   . ILE A  1 439 ? 149.023 50.838  -7.597  1.00 14.25  ? 436 ILE A N   1 
ATOM   3290  C CA  . ILE A  1 439 ? 149.699 51.969  -6.961  1.00 14.75  ? 436 ILE A CA  1 
ATOM   3291  C C   . ILE A  1 439 ? 151.047 51.403  -6.544  1.00 15.83  ? 436 ILE A C   1 
ATOM   3292  O O   . ILE A  1 439 ? 151.098 50.529  -5.693  1.00 16.07  ? 436 ILE A O   1 
ATOM   3293  C CB  . ILE A  1 439 ? 148.922 52.493  -5.736  1.00 14.58  ? 436 ILE A CB  1 
ATOM   3294  C CG1 . ILE A  1 439 ? 147.445 52.717  -6.058  1.00 14.56  ? 436 ILE A CG1 1 
ATOM   3295  C CG2 . ILE A  1 439 ? 149.510 53.777  -5.189  1.00 14.55  ? 436 ILE A CG2 1 
ATOM   3296  C CD1 . ILE A  1 439 ? 147.158 53.744  -7.124  1.00 14.41  ? 436 ILE A CD1 1 
ATOM   3297  N N   . ASN A  1 440 ? 152.119 51.856  -7.191  1.00 17.35  ? 437 ASN A N   1 
ATOM   3298  C CA  . ASN A  1 440 ? 153.471 51.322  -7.000  1.00 19.18  ? 437 ASN A CA  1 
ATOM   3299  C C   . ASN A  1 440 ? 153.597 49.800  -7.142  1.00 20.58  ? 437 ASN A C   1 
ATOM   3300  O O   . ASN A  1 440 ? 154.496 49.191  -6.568  1.00 20.39  ? 437 ASN A O   1 
ATOM   3301  C CB  . ASN A  1 440 ? 154.005 51.771  -5.645  1.00 20.66  ? 437 ASN A CB  1 
ATOM   3302  C CG  . ASN A  1 440 ? 154.005 53.291  -5.488  1.00 20.49  ? 437 ASN A CG  1 
ATOM   3303  O OD1 . ASN A  1 440 ? 154.810 53.990  -6.094  1.00 21.16  ? 437 ASN A OD1 1 
ATOM   3304  N ND2 . ASN A  1 440 ? 153.126 53.798  -4.659  1.00 20.46  ? 437 ASN A ND2 1 
ATOM   3305  N N   . ILE A  1 441 ? 152.684 49.215  -7.923  1.00 23.37  ? 438 ILE A N   1 
ATOM   3306  C CA  . ILE A  1 441 ? 152.673 47.798  -8.284  1.00 25.20  ? 438 ILE A CA  1 
ATOM   3307  C C   . ILE A  1 441 ? 152.527 47.777  -9.802  1.00 26.12  ? 438 ILE A C   1 
ATOM   3308  O O   . ILE A  1 441 ? 151.444 47.979  -10.309 1.00 27.84  ? 438 ILE A O   1 
ATOM   3309  C CB  . ILE A  1 441 ? 151.445 47.029  -7.731  1.00 26.72  ? 438 ILE A CB  1 
ATOM   3310  C CG1 . ILE A  1 441 ? 151.364 47.051  -6.209  1.00 27.27  ? 438 ILE A CG1 1 
ATOM   3311  C CG2 . ILE A  1 441 ? 151.464 45.577  -8.224  1.00 27.20  ? 438 ILE A CG2 1 
ATOM   3312  C CD1 . ILE A  1 441 ? 152.351 46.113  -5.544  1.00 29.04  ? 438 ILE A CD1 1 
ATOM   3313  N N   . PRO A  1 442 ? 153.608 47.520  -10.545 1.00 28.03  ? 439 PRO A N   1 
ATOM   3314  C CA  . PRO A  1 442 ? 153.494 47.470  -12.008 1.00 25.95  ? 439 PRO A CA  1 
ATOM   3315  C C   . PRO A  1 442 ? 152.631 46.299  -12.546 1.00 26.19  ? 439 PRO A C   1 
ATOM   3316  O O   . PRO A  1 442 ? 152.133 46.375  -13.663 1.00 28.06  ? 439 PRO A O   1 
ATOM   3317  C CB  . PRO A  1 442 ? 154.941 47.294  -12.435 1.00 26.30  ? 439 PRO A CB  1 
ATOM   3318  C CG  . PRO A  1 442 ? 155.570 46.508  -11.334 1.00 27.42  ? 439 PRO A CG  1 
ATOM   3319  C CD  . PRO A  1 442 ? 154.909 46.985  -10.071 1.00 28.89  ? 439 PRO A CD  1 
ATOM   3320  N N   . LEU A  1 443 ? 152.459 45.224  -11.772 1.00 25.72  ? 440 LEU A N   1 
ATOM   3321  C CA  . LEU A  1 443 ? 151.632 44.082  -12.173 1.00 24.40  ? 440 LEU A CA  1 
ATOM   3322  C C   . LEU A  1 443 ? 150.466 43.905  -11.205 1.00 22.50  ? 440 LEU A C   1 
ATOM   3323  O O   . LEU A  1 443 ? 150.449 42.961  -10.405 1.00 22.16  ? 440 LEU A O   1 
ATOM   3324  C CB  . LEU A  1 443 ? 152.466 42.801  -12.201 1.00 25.72  ? 440 LEU A CB  1 
ATOM   3325  C CG  . LEU A  1 443 ? 153.687 42.765  -13.116 1.00 27.27  ? 440 LEU A CG  1 
ATOM   3326  C CD1 . LEU A  1 443 ? 154.502 41.502  -12.841 1.00 26.92  ? 440 LEU A CD1 1 
ATOM   3327  C CD2 . LEU A  1 443 ? 153.265 42.860  -14.586 1.00 27.57  ? 440 LEU A CD2 1 
ATOM   3328  N N   . PRO A  1 444 ? 149.471 44.805  -11.266 1.00 21.05  ? 441 PRO A N   1 
ATOM   3329  C CA  . PRO A  1 444 ? 148.349 44.739  -10.326 1.00 19.95  ? 441 PRO A CA  1 
ATOM   3330  C C   . PRO A  1 444 ? 147.382 43.654  -10.735 1.00 19.48  ? 441 PRO A C   1 
ATOM   3331  O O   . PRO A  1 444 ? 146.257 43.940  -11.116 1.00 18.41  ? 441 PRO A O   1 
ATOM   3332  C CB  . PRO A  1 444 ? 147.726 46.129  -10.438 1.00 20.21  ? 441 PRO A CB  1 
ATOM   3333  C CG  . PRO A  1 444 ? 148.007 46.549  -11.841 1.00 20.40  ? 441 PRO A CG  1 
ATOM   3334  C CD  . PRO A  1 444 ? 149.317 45.922  -12.219 1.00 20.75  ? 441 PRO A CD  1 
ATOM   3335  N N   . VAL A  1 445 ? 147.856 42.407  -10.659 1.00 19.88  ? 442 VAL A N   1 
ATOM   3336  C CA  . VAL A  1 445 ? 147.074 41.223  -10.980 1.00 19.05  ? 442 VAL A CA  1 
ATOM   3337  C C   . VAL A  1 445 ? 146.178 40.869  -9.782  1.00 18.77  ? 442 VAL A C   1 
ATOM   3338  O O   . VAL A  1 445 ? 146.672 40.621  -8.671  1.00 18.05  ? 442 VAL A O   1 
ATOM   3339  C CB  . VAL A  1 445 ? 147.964 40.040  -11.314 1.00 19.15  ? 442 VAL A CB  1 
ATOM   3340  C CG1 . VAL A  1 445 ? 147.116 38.829  -11.646 1.00 20.67  ? 442 VAL A CG1 1 
ATOM   3341  C CG2 . VAL A  1 445 ? 148.827 40.361  -12.505 1.00 19.15  ? 442 VAL A CG2 1 
ATOM   3342  N N   . PRO A  1 446 ? 144.850 40.886  -9.997  1.00 18.32  ? 443 PRO A N   1 
ATOM   3343  C CA  . PRO A  1 446 ? 143.986 40.513  -8.919  1.00 18.25  ? 443 PRO A CA  1 
ATOM   3344  C C   . PRO A  1 446 ? 144.217 39.082  -8.416  1.00 18.58  ? 443 PRO A C   1 
ATOM   3345  O O   . PRO A  1 446 ? 144.464 38.169  -9.205  1.00 18.74  ? 443 PRO A O   1 
ATOM   3346  C CB  . PRO A  1 446 ? 142.599 40.657  -9.542  1.00 18.26  ? 443 PRO A CB  1 
ATOM   3347  C CG  . PRO A  1 446 ? 142.752 41.714  -10.557 1.00 17.78  ? 443 PRO A CG  1 
ATOM   3348  C CD  . PRO A  1 446 ? 144.087 41.434  -11.139 1.00 17.97  ? 443 PRO A CD  1 
ATOM   3349  N N   . VAL A  1 447 ? 144.111 38.921  -7.104  1.00 18.77  ? 444 VAL A N   1 
ATOM   3350  C CA  . VAL A  1 447 ? 144.272 37.645  -6.453  1.00 19.27  ? 444 VAL A CA  1 
ATOM   3351  C C   . VAL A  1 447 ? 143.044 36.765  -6.752  1.00 19.29  ? 444 VAL A C   1 
ATOM   3352  O O   . VAL A  1 447 ? 141.973 37.272  -7.094  1.00 19.54  ? 444 VAL A O   1 
ATOM   3353  C CB  . VAL A  1 447 ? 144.430 37.840  -4.939  1.00 20.65  ? 444 VAL A CB  1 
ATOM   3354  C CG1 . VAL A  1 447 ? 144.830 36.540  -4.240  1.00 22.66  ? 444 VAL A CG1 1 
ATOM   3355  C CG2 . VAL A  1 447 ? 145.511 38.854  -4.654  1.00 20.35  ? 444 VAL A CG2 1 
ATOM   3356  N N   . ALA A  1 448 ? 143.211 35.449  -6.626  1.00 18.69  ? 445 ALA A N   1 
ATOM   3357  C CA  . ALA A  1 448 ? 142.164 34.447  -6.899  1.00 18.32  ? 445 ALA A CA  1 
ATOM   3358  C C   . ALA A  1 448 ? 140.787 34.731  -6.346  1.00 17.84  ? 445 ALA A C   1 
ATOM   3359  O O   . ALA A  1 448 ? 139.805 34.241  -6.914  1.00 17.99  ? 445 ALA A O   1 
ATOM   3360  C CB  . ALA A  1 448 ? 142.616 33.084  -6.381  1.00 18.82  ? 445 ALA A CB  1 
ATOM   3361  N N   . TYR A  1 449 ? 140.735 35.452  -5.216  1.00 17.40  ? 446 TYR A N   1 
ATOM   3362  C CA  . TYR A  1 449 ? 139.459 35.875  -4.562  1.00 16.95  ? 446 TYR A CA  1 
ATOM   3363  C C   . TYR A  1 449 ? 138.947 37.220  -5.105  1.00 16.30  ? 446 TYR A C   1 
ATOM   3364  O O   . TYR A  1 449 ? 138.004 37.808  -4.582  1.00 16.69  ? 446 TYR A O   1 
ATOM   3365  C CB  . TYR A  1 449 ? 139.504 35.875  -3.001  1.00 16.60  ? 446 TYR A CB  1 
ATOM   3366  C CG  . TYR A  1 449 ? 140.735 36.470  -2.316  1.00 17.06  ? 446 TYR A CG  1 
ATOM   3367  C CD1 . TYR A  1 449 ? 141.959 35.779  -2.287  1.00 17.29  ? 446 TYR A CD1 1 
ATOM   3368  C CD2 . TYR A  1 449 ? 140.677 37.697  -1.634  1.00 17.32  ? 446 TYR A CD2 1 
ATOM   3369  C CE1 . TYR A  1 449 ? 143.079 36.297  -1.631  1.00 16.98  ? 446 TYR A CE1 1 
ATOM   3370  C CE2 . TYR A  1 449 ? 141.811 38.231  -0.992  1.00 16.95  ? 446 TYR A CE2 1 
ATOM   3371  C CZ  . TYR A  1 449 ? 143.013 37.521  -0.998  1.00 16.65  ? 446 TYR A CZ  1 
ATOM   3372  O OH  . TYR A  1 449 ? 144.155 37.985  -0.386  1.00 15.26  ? 446 TYR A OH  1 
ATOM   3373  N N   . HIS A  1 450 ? 139.571 37.690  -6.170  1.00 15.46  ? 447 HIS A N   1 
ATOM   3374  C CA  . HIS A  1 450 ? 139.059 38.805  -6.925  1.00 15.13  ? 447 HIS A CA  1 
ATOM   3375  C C   . HIS A  1 450 ? 138.888 38.369  -8.378  1.00 14.84  ? 447 HIS A C   1 
ATOM   3376  O O   . HIS A  1 450 ? 139.119 37.215  -8.711  1.00 14.71  ? 447 HIS A O   1 
ATOM   3377  C CB  . HIS A  1 450 ? 139.975 40.025  -6.747  1.00 14.66  ? 447 HIS A CB  1 
ATOM   3378  C CG  . HIS A  1 450 ? 139.722 40.774  -5.470  1.00 14.33  ? 447 HIS A CG  1 
ATOM   3379  N ND1 . HIS A  1 450 ? 138.732 41.730  -5.337  1.00 13.89  ? 447 HIS A ND1 1 
ATOM   3380  C CD2 . HIS A  1 450 ? 140.322 40.685  -4.263  1.00 14.19  ? 447 HIS A CD2 1 
ATOM   3381  C CE1 . HIS A  1 450 ? 138.754 42.209  -4.110  1.00 13.84  ? 447 HIS A CE1 1 
ATOM   3382  N NE2 . HIS A  1 450 ? 139.711 41.594  -3.440  1.00 14.05  ? 447 HIS A NE2 1 
ATOM   3383  N N   . SER A  1 451 ? 138.437 39.267  -9.235  1.00 14.37  ? 448 SER A N   1 
ATOM   3384  C CA  . SER A  1 451 ? 138.285 38.897  -10.607 1.00 14.19  ? 448 SER A CA  1 
ATOM   3385  C C   . SER A  1 451 ? 139.170 39.763  -11.431 1.00 14.35  ? 448 SER A C   1 
ATOM   3386  O O   . SER A  1 451 ? 139.479 40.878  -11.028 1.00 13.60  ? 448 SER A O   1 
ATOM   3387  C CB  . SER A  1 451 ? 136.833 38.994  -11.025 1.00 14.04  ? 448 SER A CB  1 
ATOM   3388  O OG  . SER A  1 451 ? 136.071 37.989  -10.392 1.00 13.29  ? 448 SER A OG  1 
ATOM   3389  N N   . PHE A  1 452 ? 139.555 39.206  -12.581 1.00 15.73  ? 449 PHE A N   1 
ATOM   3390  C CA  . PHE A  1 452 ? 140.534 39.757  -13.545 1.00 16.97  ? 449 PHE A CA  1 
ATOM   3391  C C   . PHE A  1 452 ? 139.776 40.170  -14.781 1.00 18.63  ? 449 PHE A C   1 
ATOM   3392  O O   . PHE A  1 452 ? 139.014 39.377  -15.335 1.00 19.94  ? 449 PHE A O   1 
ATOM   3393  C CB  . PHE A  1 452 ? 141.504 38.645  -13.951 1.00 16.66  ? 449 PHE A CB  1 
ATOM   3394  C CG  . PHE A  1 452 ? 142.583 39.054  -14.912 1.00 16.18  ? 449 PHE A CG  1 
ATOM   3395  C CD1 . PHE A  1 452 ? 142.302 39.298  -16.241 1.00 15.72  ? 449 PHE A CD1 1 
ATOM   3396  C CD2 . PHE A  1 452 ? 143.916 39.120  -14.481 1.00 15.94  ? 449 PHE A CD2 1 
ATOM   3397  C CE1 . PHE A  1 452 ? 143.310 39.632  -17.114 1.00 15.67  ? 449 PHE A CE1 1 
ATOM   3398  C CE2 . PHE A  1 452 ? 144.926 39.465  -15.357 1.00 15.68  ? 449 PHE A CE2 1 
ATOM   3399  C CZ  . PHE A  1 452 ? 144.619 39.715  -16.675 1.00 15.60  ? 449 PHE A CZ  1 
ATOM   3400  N N   . GLY A  1 453 ? 139.995 41.392  -15.238 1.00 19.20  ? 450 GLY A N   1 
ATOM   3401  C CA  . GLY A  1 453 ? 139.357 41.821  -16.461 1.00 19.04  ? 450 GLY A CA  1 
ATOM   3402  C C   . GLY A  1 453 ? 139.667 43.257  -16.794 1.00 19.21  ? 450 GLY A C   1 
ATOM   3403  O O   . GLY A  1 453 ? 139.574 44.140  -15.927 1.00 19.05  ? 450 GLY A O   1 
ATOM   3404  N N   . GLY A  1 454 ? 140.054 43.484  -18.045 1.00 18.75  ? 451 GLY A N   1 
ATOM   3405  C CA  . GLY A  1 454 ? 140.307 44.823  -18.543 1.00 18.56  ? 451 GLY A CA  1 
ATOM   3406  C C   . GLY A  1 454 ? 139.060 45.552  -18.981 1.00 18.66  ? 451 GLY A C   1 
ATOM   3407  O O   . GLY A  1 454 ? 137.966 44.984  -19.021 1.00 18.45  ? 451 GLY A O   1 
ATOM   3408  N N   . TRP A  1 455 ? 139.255 46.829  -19.316 1.00 19.18  ? 452 TRP A N   1 
ATOM   3409  C CA  . TRP A  1 455 ? 138.221 47.702  -19.882 1.00 18.60  ? 452 TRP A CA  1 
ATOM   3410  C C   . TRP A  1 455 ? 138.457 47.928  -21.368 1.00 20.73  ? 452 TRP A C   1 
ATOM   3411  O O   . TRP A  1 455 ? 139.446 47.446  -21.942 1.00 22.08  ? 452 TRP A O   1 
ATOM   3412  C CB  . TRP A  1 455 ? 138.229 49.028  -19.158 1.00 16.68  ? 452 TRP A CB  1 
ATOM   3413  C CG  . TRP A  1 455 ? 137.607 48.948  -17.855 1.00 15.54  ? 452 TRP A CG  1 
ATOM   3414  C CD1 . TRP A  1 455 ? 137.270 47.829  -17.168 1.00 14.80  ? 452 TRP A CD1 1 
ATOM   3415  C CD2 . TRP A  1 455 ? 137.284 50.050  -17.012 1.00 14.87  ? 452 TRP A CD2 1 
ATOM   3416  N NE1 . TRP A  1 455 ? 136.732 48.162  -15.967 1.00 14.63  ? 452 TRP A NE1 1 
ATOM   3417  C CE2 . TRP A  1 455 ? 136.737 49.524  -15.841 1.00 14.43  ? 452 TRP A CE2 1 
ATOM   3418  C CE3 . TRP A  1 455 ? 137.414 51.435  -17.134 1.00 14.50  ? 452 TRP A CE3 1 
ATOM   3419  C CZ2 . TRP A  1 455 ? 136.298 50.322  -14.812 1.00 14.22  ? 452 TRP A CZ2 1 
ATOM   3420  C CZ3 . TRP A  1 455 ? 136.977 52.219  -16.110 1.00 14.39  ? 452 TRP A CZ3 1 
ATOM   3421  C CH2 . TRP A  1 455 ? 136.420 51.662  -14.966 1.00 14.24  ? 452 TRP A CH2 1 
ATOM   3422  N N   . LYS A  1 456 ? 137.532 48.655  -21.986 1.00 22.32  ? 453 LYS A N   1 
ATOM   3423  C CA  . LYS A  1 456 ? 137.613 49.004  -23.400 1.00 22.74  ? 453 LYS A CA  1 
ATOM   3424  C C   . LYS A  1 456 ? 137.698 47.738  -24.280 1.00 23.09  ? 453 LYS A C   1 
ATOM   3425  O O   . LYS A  1 456 ? 136.861 46.841  -24.149 1.00 22.30  ? 453 LYS A O   1 
ATOM   3426  C CB  . LYS A  1 456 ? 138.742 50.022  -23.621 1.00 22.43  ? 453 LYS A CB  1 
ATOM   3427  C CG  . LYS A  1 456 ? 138.498 51.293  -22.844 1.00 23.14  ? 453 LYS A CG  1 
ATOM   3428  C CD  . LYS A  1 456 ? 139.457 52.396  -23.244 1.00 25.10  ? 453 LYS A CD  1 
ATOM   3429  C CE  . LYS A  1 456 ? 140.893 52.022  -22.903 1.00 27.23  ? 453 LYS A CE  1 
ATOM   3430  N NZ  . LYS A  1 456 ? 141.782 53.216  -22.796 1.00 28.66  ? 453 LYS A NZ  1 
ATOM   3431  N N   . ARG A  1 457 ? 138.714 47.663  -25.135 1.00 24.27  ? 454 ARG A N   1 
ATOM   3432  C CA  . ARG A  1 457 ? 138.861 46.610  -26.116 1.00 24.82  ? 454 ARG A CA  1 
ATOM   3433  C C   . ARG A  1 457 ? 139.619 45.419  -25.550 1.00 23.87  ? 454 ARG A C   1 
ATOM   3434  O O   . ARG A  1 457 ? 139.730 44.386  -26.219 1.00 24.78  ? 454 ARG A O   1 
ATOM   3435  C CB  . ARG A  1 457 ? 139.629 47.153  -27.318 1.00 27.98  ? 454 ARG A CB  1 
ATOM   3436  C CG  . ARG A  1 457 ? 138.861 48.151  -28.186 1.00 29.76  ? 454 ARG A CG  1 
ATOM   3437  C CD  . ARG A  1 457 ? 138.168 47.474  -29.373 1.00 30.60  ? 454 ARG A CD  1 
ATOM   3438  N NE  . ARG A  1 457 ? 139.106 46.925  -30.356 1.00 31.70  ? 454 ARG A NE  1 
ATOM   3439  C CZ  . ARG A  1 457 ? 138.782 46.065  -31.328 1.00 34.14  ? 454 ARG A CZ  1 
ATOM   3440  N NH1 . ARG A  1 457 ? 137.529 45.642  -31.495 1.00 34.45  ? 454 ARG A NH1 1 
ATOM   3441  N NH2 . ARG A  1 457 ? 139.720 45.624  -32.162 1.00 36.25  ? 454 ARG A NH2 1 
ATOM   3442  N N   . SER A  1 458 ? 140.157 45.554  -24.340 1.00 22.19  ? 455 SER A N   1 
ATOM   3443  C CA  . SER A  1 458 ? 140.809 44.421  -23.654 1.00 22.22  ? 455 SER A CA  1 
ATOM   3444  C C   . SER A  1 458 ? 139.842 43.314  -23.145 1.00 20.67  ? 455 SER A C   1 
ATOM   3445  O O   . SER A  1 458 ? 140.280 42.239  -22.744 1.00 19.26  ? 455 SER A O   1 
ATOM   3446  C CB  . SER A  1 458 ? 141.678 44.935  -22.484 1.00 23.14  ? 455 SER A CB  1 
ATOM   3447  O OG  . SER A  1 458 ? 142.704 45.822  -22.925 1.00 23.39  ? 455 SER A OG  1 
ATOM   3448  N N   . LEU A  1 459 ? 138.541 43.591  -23.141 1.00 19.93  ? 456 LEU A N   1 
ATOM   3449  C CA  . LEU A  1 459 ? 137.539 42.643  -22.663 1.00 19.23  ? 456 LEU A CA  1 
ATOM   3450  C C   . LEU A  1 459 ? 136.161 42.810  -23.316 1.00 18.48  ? 456 LEU A C   1 
ATOM   3451  O O   . LEU A  1 459 ? 135.618 43.918  -23.405 1.00 18.19  ? 456 LEU A O   1 
ATOM   3452  C CB  . LEU A  1 459 ? 137.392 42.791  -21.145 1.00 19.08  ? 456 LEU A CB  1 
ATOM   3453  C CG  . LEU A  1 459 ? 136.576 41.702  -20.451 1.00 18.90  ? 456 LEU A CG  1 
ATOM   3454  C CD1 . LEU A  1 459 ? 137.141 41.444  -19.080 1.00 19.05  ? 456 LEU A CD1 1 
ATOM   3455  C CD2 . LEU A  1 459 ? 135.093 42.056  -20.350 1.00 19.34  ? 456 LEU A CD2 1 
ATOM   3456  N N   . PHE A  1 460 ? 135.590 41.692  -23.739 1.00 18.22  ? 457 PHE A N   1 
ATOM   3457  C CA  . PHE A  1 460 ? 134.235 41.669  -24.257 1.00 18.53  ? 457 PHE A CA  1 
ATOM   3458  C C   . PHE A  1 460 ? 133.361 40.879  -23.291 1.00 17.96  ? 457 PHE A C   1 
ATOM   3459  O O   . PHE A  1 460 ? 133.617 39.717  -23.012 1.00 16.82  ? 457 PHE A O   1 
ATOM   3460  C CB  . PHE A  1 460 ? 134.186 41.074  -25.670 1.00 19.17  ? 457 PHE A CB  1 
ATOM   3461  C CG  . PHE A  1 460 ? 135.037 41.805  -26.674 1.00 19.82  ? 457 PHE A CG  1 
ATOM   3462  C CD1 . PHE A  1 460 ? 136.361 41.461  -26.857 1.00 21.17  ? 457 PHE A CD1 1 
ATOM   3463  C CD2 . PHE A  1 460 ? 134.519 42.816  -27.441 1.00 20.29  ? 457 PHE A CD2 1 
ATOM   3464  C CE1 . PHE A  1 460 ? 137.156 42.126  -27.783 1.00 21.15  ? 457 PHE A CE1 1 
ATOM   3465  C CE2 . PHE A  1 460 ? 135.307 43.487  -28.370 1.00 20.93  ? 457 PHE A CE2 1 
ATOM   3466  C CZ  . PHE A  1 460 ? 136.622 43.145  -28.543 1.00 20.62  ? 457 PHE A CZ  1 
ATOM   3467  N N   . GLY A  1 461 ? 132.342 41.549  -22.765 1.00 18.76  ? 458 GLY A N   1 
ATOM   3468  C CA  . GLY A  1 461 ? 131.392 40.968  -21.817 1.00 19.07  ? 458 GLY A CA  1 
ATOM   3469  C C   . GLY A  1 461 ? 131.150 41.877  -20.619 1.00 19.45  ? 458 GLY A C   1 
ATOM   3470  O O   . GLY A  1 461 ? 131.635 43.024  -20.569 1.00 20.51  ? 458 GLY A O   1 
ATOM   3471  N N   . ASP A  1 462 ? 130.401 41.349  -19.650 1.00 18.96  ? 459 ASP A N   1 
ATOM   3472  C CA  . ASP A  1 462 ? 130.099 42.052  -18.393 1.00 18.14  ? 459 ASP A CA  1 
ATOM   3473  C C   . ASP A  1 462 ? 130.499 41.317  -17.110 1.00 17.53  ? 459 ASP A C   1 
ATOM   3474  O O   . ASP A  1 462 ? 130.327 41.873  -16.024 1.00 19.74  ? 459 ASP A O   1 
ATOM   3475  C CB  . ASP A  1 462 ? 128.608 42.440  -18.333 1.00 18.44  ? 459 ASP A CB  1 
ATOM   3476  C CG  . ASP A  1 462 ? 127.668 41.269  -18.611 1.00 18.15  ? 459 ASP A CG  1 
ATOM   3477  O OD1 . ASP A  1 462 ? 128.074 40.124  -18.370 1.00 18.10  ? 459 ASP A OD1 1 
ATOM   3478  O OD2 . ASP A  1 462 ? 126.536 41.496  -19.092 1.00 17.36  ? 459 ASP A OD2 1 
ATOM   3479  N N   . LEU A  1 463 ? 131.009 40.094  -17.218 1.00 16.23  ? 460 LEU A N   1 
ATOM   3480  C CA  . LEU A  1 463 ? 131.533 39.362  -16.070 1.00 15.74  ? 460 LEU A CA  1 
ATOM   3481  C C   . LEU A  1 463 ? 132.969 38.984  -16.350 1.00 16.15  ? 460 LEU A C   1 
ATOM   3482  O O   . LEU A  1 463 ? 133.274 38.420  -17.403 1.00 16.72  ? 460 LEU A O   1 
ATOM   3483  C CB  . LEU A  1 463 ? 130.732 38.088  -15.812 1.00 15.13  ? 460 LEU A CB  1 
ATOM   3484  C CG  . LEU A  1 463 ? 129.333 38.345  -15.291 1.00 14.84  ? 460 LEU A CG  1 
ATOM   3485  C CD1 . LEU A  1 463 ? 128.531 37.070  -15.355 1.00 14.84  ? 460 LEU A CD1 1 
ATOM   3486  C CD2 . LEU A  1 463 ? 129.367 38.880  -13.872 1.00 14.60  ? 460 LEU A CD2 1 
ATOM   3487  N N   . HIS A  1 464 ? 133.843 39.260  -15.394 1.00 15.83  ? 461 HIS A N   1 
ATOM   3488  C CA  . HIS A  1 464 ? 135.268 39.106  -15.595 1.00 15.74  ? 461 HIS A CA  1 
ATOM   3489  C C   . HIS A  1 464 ? 135.760 37.719  -15.269 1.00 15.41  ? 461 HIS A C   1 
ATOM   3490  O O   . HIS A  1 464 ? 134.985 36.867  -14.894 1.00 15.10  ? 461 HIS A O   1 
ATOM   3491  C CB  . HIS A  1 464 ? 135.958 40.193  -14.809 1.00 16.09  ? 461 HIS A CB  1 
ATOM   3492  C CG  . HIS A  1 464 ? 135.638 41.550  -15.333 1.00 17.09  ? 461 HIS A CG  1 
ATOM   3493  N ND1 . HIS A  1 464 ? 136.305 42.688  -14.932 1.00 18.38  ? 461 HIS A ND1 1 
ATOM   3494  C CD2 . HIS A  1 464 ? 134.737 41.951  -16.262 1.00 16.70  ? 461 HIS A CD2 1 
ATOM   3495  C CE1 . HIS A  1 464 ? 135.826 43.728  -15.589 1.00 17.31  ? 461 HIS A CE1 1 
ATOM   3496  N NE2 . HIS A  1 464 ? 134.871 43.307  -16.396 1.00 16.80  ? 461 HIS A NE2 1 
ATOM   3497  N N   . ALA A  1 465 ? 137.053 37.501  -15.478 1.00 15.69  ? 462 ALA A N   1 
ATOM   3498  C CA  . ALA A  1 465 ? 137.682 36.192  -15.315 1.00 15.44  ? 462 ALA A CA  1 
ATOM   3499  C C   . ALA A  1 465 ? 137.961 35.882  -13.861 1.00 15.39  ? 462 ALA A C   1 
ATOM   3500  O O   . ALA A  1 465 ? 138.303 36.779  -13.074 1.00 14.72  ? 462 ALA A O   1 
ATOM   3501  C CB  . ALA A  1 465 ? 138.970 36.088  -16.122 1.00 15.37  ? 462 ALA A CB  1 
ATOM   3502  N N   . TYR A  1 466 ? 137.759 34.587  -13.558 1.00 15.48  ? 463 TYR A N   1 
ATOM   3503  C CA  . TYR A  1 466 ? 137.982 33.915  -12.268 1.00 14.89  ? 463 TYR A CA  1 
ATOM   3504  C C   . TYR A  1 466 ? 137.318 34.641  -11.129 1.00 14.93  ? 463 TYR A C   1 
ATOM   3505  O O   . TYR A  1 466 ? 136.536 35.525  -11.368 1.00 15.34  ? 463 TYR A O   1 
ATOM   3506  C CB  . TYR A  1 466 ? 139.477 33.532  -12.053 1.00 14.71  ? 463 TYR A CB  1 
ATOM   3507  C CG  . TYR A  1 466 ? 140.561 34.594  -11.874 1.00 14.00  ? 463 TYR A CG  1 
ATOM   3508  C CD1 . TYR A  1 466 ? 140.829 35.112  -10.630 1.00 13.97  ? 463 TYR A CD1 1 
ATOM   3509  C CD2 . TYR A  1 466 ? 141.407 34.951  -12.912 1.00 13.41  ? 463 TYR A CD2 1 
ATOM   3510  C CE1 . TYR A  1 466 ? 141.865 36.015  -10.428 1.00 13.79  ? 463 TYR A CE1 1 
ATOM   3511  C CE2 . TYR A  1 466 ? 142.444 35.843  -12.715 1.00 13.41  ? 463 TYR A CE2 1 
ATOM   3512  C CZ  . TYR A  1 466 ? 142.668 36.382  -11.463 1.00 13.35  ? 463 TYR A CZ  1 
ATOM   3513  O OH  . TYR A  1 466 ? 143.683 37.288  -11.232 1.00 12.71  ? 463 TYR A OH  1 
ATOM   3514  N N   . GLY A  1 467 ? 137.564 34.241  -9.895  1.00 15.55  ? 464 GLY A N   1 
ATOM   3515  C CA  . GLY A  1 467 ? 137.065 34.998  -8.741  1.00 15.52  ? 464 GLY A CA  1 
ATOM   3516  C C   . GLY A  1 467 ? 135.564 34.942  -8.594  1.00 15.40  ? 464 GLY A C   1 
ATOM   3517  O O   . GLY A  1 467 ? 134.958 33.970  -9.042  1.00 14.57  ? 464 GLY A O   1 
ATOM   3518  N N   . PRO A  1 468 ? 134.953 35.998  -7.990  1.00 15.87  ? 465 PRO A N   1 
ATOM   3519  C CA  . PRO A  1 468 ? 133.491 36.023  -7.811  1.00 15.81  ? 465 PRO A CA  1 
ATOM   3520  C C   . PRO A  1 468 ? 132.667 36.067  -9.101  1.00 15.79  ? 465 PRO A C   1 
ATOM   3521  O O   . PRO A  1 468 ? 131.604 35.427  -9.196  1.00 16.41  ? 465 PRO A O   1 
ATOM   3522  C CB  . PRO A  1 468 ? 133.261 37.312  -7.040  1.00 15.84  ? 465 PRO A CB  1 
ATOM   3523  C CG  . PRO A  1 468 ? 134.564 37.566  -6.356  1.00 16.30  ? 465 PRO A CG  1 
ATOM   3524  C CD  . PRO A  1 468 ? 135.556 37.217  -7.410  1.00 16.08  ? 465 PRO A CD  1 
ATOM   3525  N N   . ASP A  1 469 ? 133.145 36.813  -10.083 1.00 14.96  ? 466 ASP A N   1 
ATOM   3526  C CA  . ASP A  1 469 ? 132.446 36.907  -11.341 1.00 14.25  ? 466 ASP A CA  1 
ATOM   3527  C C   . ASP A  1 469 ? 132.345 35.583  -12.040 1.00 14.03  ? 466 ASP A C   1 
ATOM   3528  O O   . ASP A  1 469 ? 131.352 35.339  -12.717 1.00 14.26  ? 466 ASP A O   1 
ATOM   3529  C CB  . ASP A  1 469 ? 133.114 37.927  -12.228 1.00 14.29  ? 466 ASP A CB  1 
ATOM   3530  C CG  . ASP A  1 469 ? 132.832 39.337  -11.772 1.00 14.46  ? 466 ASP A CG  1 
ATOM   3531  O OD1 . ASP A  1 469 ? 132.324 39.535  -10.660 1.00 14.45  ? 466 ASP A OD1 1 
ATOM   3532  O OD2 . ASP A  1 469 ? 133.081 40.287  -12.523 1.00 14.86  ? 466 ASP A OD2 1 
ATOM   3533  N N   . ALA A  1 470 ? 133.343 34.719  -11.868 1.00 13.61  ? 467 ALA A N   1 
ATOM   3534  C CA  . ALA A  1 470 ? 133.295 33.397  -12.493 1.00 13.44  ? 467 ALA A CA  1 
ATOM   3535  C C   . ALA A  1 470 ? 132.204 32.540  -11.876 1.00 12.97  ? 467 ALA A C   1 
ATOM   3536  O O   . ALA A  1 470 ? 131.590 31.714  -12.533 1.00 12.87  ? 467 ALA A O   1 
ATOM   3537  C CB  . ALA A  1 470 ? 134.633 32.713  -12.383 1.00 13.71  ? 467 ALA A CB  1 
ATOM   3538  N N   . VAL A  1 471 ? 131.935 32.766  -10.610 1.00 12.94  ? 468 VAL A N   1 
ATOM   3539  C CA  . VAL A  1 471 ? 130.822 32.090  -9.964  1.00 13.17  ? 468 VAL A CA  1 
ATOM   3540  C C   . VAL A  1 471 ? 129.526 32.459  -10.678 1.00 13.85  ? 468 VAL A C   1 
ATOM   3541  O O   . VAL A  1 471 ? 128.697 31.606  -10.966 1.00 13.42  ? 468 VAL A O   1 
ATOM   3542  C CB  . VAL A  1 471 ? 130.720 32.433  -8.464  1.00 12.63  ? 468 VAL A CB  1 
ATOM   3543  C CG1 . VAL A  1 471 ? 129.487 31.771  -7.878  1.00 12.51  ? 468 VAL A CG1 1 
ATOM   3544  C CG2 . VAL A  1 471 ? 131.965 31.958  -7.715  1.00 12.32  ? 468 VAL A CG2 1 
ATOM   3545  N N   . ARG A  1 472 ? 129.392 33.741  -10.987 1.00 15.44  ? 469 ARG A N   1 
ATOM   3546  C CA  . ARG A  1 472 ? 128.219 34.264  -11.690 1.00 16.76  ? 469 ARG A CA  1 
ATOM   3547  C C   . ARG A  1 472 ? 128.170 33.952  -13.183 1.00 16.66  ? 469 ARG A C   1 
ATOM   3548  O O   . ARG A  1 472 ? 127.070 33.849  -13.773 1.00 16.53  ? 469 ARG A O   1 
ATOM   3549  C CB  . ARG A  1 472 ? 128.096 35.768  -11.465 1.00 17.75  ? 469 ARG A CB  1 
ATOM   3550  C CG  . ARG A  1 472 ? 127.819 36.091  -10.016 1.00 19.50  ? 469 ARG A CG  1 
ATOM   3551  C CD  . ARG A  1 472 ? 126.471 35.563  -9.526  1.00 21.42  ? 469 ARG A CD  1 
ATOM   3552  N NE  . ARG A  1 472 ? 125.404 36.477  -9.938  1.00 24.75  ? 469 ARG A NE  1 
ATOM   3553  C CZ  . ARG A  1 472 ? 124.576 36.300  -10.976 1.00 28.80  ? 469 ARG A CZ  1 
ATOM   3554  N NH1 . ARG A  1 472 ? 124.626 35.204  -11.771 1.00 32.99  ? 469 ARG A NH1 1 
ATOM   3555  N NH2 . ARG A  1 472 ? 123.667 37.232  -11.226 1.00 28.11  ? 469 ARG A NH2 1 
ATOM   3556  N N   . PHE A  1 473 ? 129.345 33.816  -13.790 1.00 16.73  ? 470 PHE A N   1 
ATOM   3557  C CA  . PHE A  1 473 ? 129.409 33.471  -15.197 1.00 16.73  ? 470 PHE A CA  1 
ATOM   3558  C C   . PHE A  1 473 ? 129.148 32.007  -15.409 1.00 16.44  ? 470 PHE A C   1 
ATOM   3559  O O   . PHE A  1 473 ? 128.503 31.648  -16.392 1.00 16.55  ? 470 PHE A O   1 
ATOM   3560  C CB  . PHE A  1 473 ? 130.744 33.821  -15.814 1.00 17.09  ? 470 PHE A CB  1 
ATOM   3561  C CG  . PHE A  1 473 ? 130.793 33.536  -17.285 1.00 17.54  ? 470 PHE A CG  1 
ATOM   3562  C CD1 . PHE A  1 473 ? 130.174 34.390  -18.188 1.00 17.66  ? 470 PHE A CD1 1 
ATOM   3563  C CD2 . PHE A  1 473 ? 131.420 32.400  -17.765 1.00 17.75  ? 470 PHE A CD2 1 
ATOM   3564  C CE1 . PHE A  1 473 ? 130.209 34.132  -19.541 1.00 17.81  ? 470 PHE A CE1 1 
ATOM   3565  C CE2 . PHE A  1 473 ? 131.449 32.125  -19.121 1.00 17.81  ? 470 PHE A CE2 1 
ATOM   3566  C CZ  . PHE A  1 473 ? 130.846 32.991  -20.007 1.00 17.97  ? 470 PHE A CZ  1 
ATOM   3567  N N   . TYR A  1 474 ? 129.654 31.174  -14.494 1.00 15.78  ? 471 TYR A N   1 
ATOM   3568  C CA  . TYR A  1 474 ? 129.476 29.727  -14.589 1.00 15.14  ? 471 TYR A CA  1 
ATOM   3569  C C   . TYR A  1 474 ? 128.186 29.232  -13.949 1.00 14.61  ? 471 TYR A C   1 
ATOM   3570  O O   . TYR A  1 474 ? 127.987 28.030  -13.836 1.00 14.38  ? 471 TYR A O   1 
ATOM   3571  C CB  . TYR A  1 474 ? 130.699 28.980  -14.027 1.00 14.64  ? 471 TYR A CB  1 
ATOM   3572  C CG  . TYR A  1 474 ? 131.961 29.251  -14.797 1.00 14.24  ? 471 TYR A CG  1 
ATOM   3573  C CD1 . TYR A  1 474 ? 131.959 29.254  -16.166 1.00 14.30  ? 471 TYR A CD1 1 
ATOM   3574  C CD2 . TYR A  1 474 ? 133.169 29.478  -14.152 1.00 13.95  ? 471 TYR A CD2 1 
ATOM   3575  C CE1 . TYR A  1 474 ? 133.108 29.506  -16.877 1.00 14.41  ? 471 TYR A CE1 1 
ATOM   3576  C CE2 . TYR A  1 474 ? 134.323 29.722  -14.858 1.00 13.80  ? 471 TYR A CE2 1 
ATOM   3577  C CZ  . TYR A  1 474 ? 134.274 29.736  -16.230 1.00 14.24  ? 471 TYR A CZ  1 
ATOM   3578  O OH  . TYR A  1 474 ? 135.371 29.980  -17.016 1.00 15.04  ? 471 TYR A OH  1 
ATOM   3579  N N   . THR A  1 475 ? 127.304 30.134  -13.544 1.00 14.34  ? 472 THR A N   1 
ATOM   3580  C CA  . THR A  1 475 ? 125.965 29.709  -13.116 1.00 14.88  ? 472 THR A CA  1 
ATOM   3581  C C   . THR A  1 475 ? 124.853 30.544  -13.721 1.00 14.83  ? 472 THR A C   1 
ATOM   3582  O O   . THR A  1 475 ? 125.112 31.606  -14.312 1.00 15.37  ? 472 THR A O   1 
ATOM   3583  C CB  . THR A  1 475 ? 125.798 29.801  -11.593 1.00 14.79  ? 472 THR A CB  1 
ATOM   3584  O OG1 . THR A  1 475 ? 125.870 31.177  -11.194 1.00 14.74  ? 472 THR A OG1 1 
ATOM   3585  C CG2 . THR A  1 475 ? 126.848 28.935  -10.881 1.00 14.67  ? 472 THR A CG2 1 
ATOM   3586  N N   . LYS A  1 476 ? 123.618 30.063  -13.549 1.00 14.51  ? 473 LYS A N   1 
ATOM   3587  C CA  . LYS A  1 476 ? 122.426 30.845  -13.924 1.00 14.52  ? 473 LYS A CA  1 
ATOM   3588  C C   . LYS A  1 476 ? 121.473 31.055  -12.748 1.00 13.92  ? 473 LYS A C   1 
ATOM   3589  O O   . LYS A  1 476 ? 121.212 30.148  -11.951 1.00 13.18  ? 473 LYS A O   1 
ATOM   3590  C CB  . LYS A  1 476 ? 121.698 30.270  -15.139 1.00 14.69  ? 473 LYS A CB  1 
ATOM   3591  C CG  . LYS A  1 476 ? 121.622 28.776  -15.168 1.00 15.15  ? 473 LYS A CG  1 
ATOM   3592  C CD  . LYS A  1 476 ? 120.941 28.316  -16.427 1.00 15.96  ? 473 LYS A CD  1 
ATOM   3593  C CE  . LYS A  1 476 ? 120.796 26.794  -16.413 1.00 16.65  ? 473 LYS A CE  1 
ATOM   3594  N NZ  . LYS A  1 476 ? 119.994 26.279  -17.563 1.00 16.93  ? 473 LYS A NZ  1 
ATOM   3595  N N   . ARG A  1 477 ? 120.984 32.286  -12.653 1.00 13.78  ? 474 ARG A N   1 
ATOM   3596  C CA  . ARG A  1 477 ? 120.124 32.706  -11.567 1.00 13.71  ? 474 ARG A CA  1 
ATOM   3597  C C   . ARG A  1 477 ? 118.722 32.166  -11.740 1.00 14.27  ? 474 ARG A C   1 
ATOM   3598  O O   . ARG A  1 477 ? 118.089 32.327  -12.778 1.00 14.30  ? 474 ARG A O   1 
ATOM   3599  C CB  . ARG A  1 477 ? 120.063 34.212  -11.500 1.00 13.40  ? 474 ARG A CB  1 
ATOM   3600  C CG  . ARG A  1 477 ? 119.134 34.700  -10.423 1.00 13.47  ? 474 ARG A CG  1 
ATOM   3601  C CD  . ARG A  1 477 ? 118.897 36.188  -10.534 1.00 13.75  ? 474 ARG A CD  1 
ATOM   3602  N NE  . ARG A  1 477 ? 120.038 36.938  -10.027 1.00 13.91  ? 474 ARG A NE  1 
ATOM   3603  C CZ  . ARG A  1 477 ? 120.231 37.275  -8.757  1.00 14.04  ? 474 ARG A CZ  1 
ATOM   3604  N NH1 . ARG A  1 477 ? 119.354 36.957  -7.803  1.00 14.86  ? 474 ARG A NH1 1 
ATOM   3605  N NH2 . ARG A  1 477 ? 121.314 37.954  -8.435  1.00 14.08  ? 474 ARG A NH2 1 
ATOM   3606  N N   . LYS A  1 478 ? 118.240 31.527  -10.692 1.00 15.24  ? 475 LYS A N   1 
ATOM   3607  C CA  . LYS A  1 478 ? 116.865 31.061  -10.619 1.00 15.78  ? 475 LYS A CA  1 
ATOM   3608  C C   . LYS A  1 478 ? 116.232 31.726  -9.407  1.00 15.56  ? 475 LYS A C   1 
ATOM   3609  O O   . LYS A  1 478 ? 116.810 31.747  -8.317  1.00 15.60  ? 475 LYS A O   1 
ATOM   3610  C CB  . LYS A  1 478 ? 116.815 29.528  -10.473 1.00 16.67  ? 475 LYS A CB  1 
ATOM   3611  C CG  . LYS A  1 478 ? 115.408 28.963  -10.309 1.00 17.64  ? 475 LYS A CG  1 
ATOM   3612  C CD  . LYS A  1 478 ? 115.369 27.449  -10.192 1.00 18.60  ? 475 LYS A CD  1 
ATOM   3613  C CE  . LYS A  1 478 ? 115.468 26.743  -11.548 1.00 19.42  ? 475 LYS A CE  1 
ATOM   3614  N NZ  . LYS A  1 478 ? 115.246 25.268  -11.410 1.00 19.65  ? 475 LYS A NZ  1 
ATOM   3615  N N   . THR A  1 479 ? 115.040 32.260  -9.580  1.00 15.26  ? 476 THR A N   1 
ATOM   3616  C CA  . THR A  1 479 ? 114.332 32.795  -8.445  1.00 15.44  ? 476 THR A CA  1 
ATOM   3617  C C   . THR A  1 479 ? 113.078 31.972  -8.228  1.00 15.62  ? 476 THR A C   1 
ATOM   3618  O O   . THR A  1 479 ? 112.277 31.742  -9.166  1.00 15.67  ? 476 THR A O   1 
ATOM   3619  C CB  . THR A  1 479 ? 114.004 34.264  -8.647  1.00 15.72  ? 476 THR A CB  1 
ATOM   3620  O OG1 . THR A  1 479 ? 115.204 34.959  -9.030  1.00 16.23  ? 476 THR A OG1 1 
ATOM   3621  C CG2 . THR A  1 479 ? 113.436 34.853  -7.367  1.00 15.64  ? 476 THR A CG2 1 
ATOM   3622  N N   . VAL A  1 480 ? 112.947 31.501  -6.987  1.00 15.27  ? 477 VAL A N   1 
ATOM   3623  C CA  . VAL A  1 480 ? 111.801 30.746  -6.535  1.00 14.94  ? 477 VAL A CA  1 
ATOM   3624  C C   . VAL A  1 480 ? 110.972 31.671  -5.665  1.00 15.61  ? 477 VAL A C   1 
ATOM   3625  O O   . VAL A  1 480 ? 111.533 32.391  -4.845  1.00 15.74  ? 477 VAL A O   1 
ATOM   3626  C CB  . VAL A  1 480 ? 112.237 29.494  -5.753  1.00 14.47  ? 477 VAL A CB  1 
ATOM   3627  C CG1 . VAL A  1 480 ? 111.039 28.667  -5.274  1.00 14.43  ? 477 VAL A CG1 1 
ATOM   3628  C CG2 . VAL A  1 480 ? 113.104 28.634  -6.641  1.00 14.35  ? 477 VAL A CG2 1 
ATOM   3629  N N   . THR A  1 481 ? 109.646 31.662  -5.874  1.00 16.48  ? 478 THR A N   1 
ATOM   3630  C CA  . THR A  1 481 ? 108.649 32.338  -4.996  1.00 16.49  ? 478 THR A CA  1 
ATOM   3631  C C   . THR A  1 481 ? 107.653 31.273  -4.545  1.00 16.31  ? 478 THR A C   1 
ATOM   3632  O O   . THR A  1 481 ? 107.141 30.535  -5.334  1.00 15.88  ? 478 THR A O   1 
ATOM   3633  C CB  . THR A  1 481 ? 107.933 33.503  -5.719  1.00 16.67  ? 478 THR A CB  1 
ATOM   3634  O OG1 . THR A  1 481 ? 108.904 34.452  -6.171  1.00 17.02  ? 478 THR A OG1 1 
ATOM   3635  C CG2 . THR A  1 481 ? 106.974 34.228  -4.821  1.00 16.33  ? 478 THR A CG2 1 
ATOM   3636  N N   . GLN A  1 482 ? 107.407 31.200  -3.250  1.00 17.71  ? 479 GLN A N   1 
ATOM   3637  C CA  . GLN A  1 482 ? 106.725 30.066  -2.641  1.00 18.32  ? 479 GLN A CA  1 
ATOM   3638  C C   . GLN A  1 482 ? 105.593 30.550  -1.793  1.00 19.13  ? 479 GLN A C   1 
ATOM   3639  O O   . GLN A  1 482 ? 105.734 31.524  -1.082  1.00 18.38  ? 479 GLN A O   1 
ATOM   3640  C CB  . GLN A  1 482 ? 107.690 29.312  -1.733  1.00 18.58  ? 479 GLN A CB  1 
ATOM   3641  C CG  . GLN A  1 482 ? 107.218 27.945  -1.307  1.00 18.01  ? 479 GLN A CG  1 
ATOM   3642  C CD  . GLN A  1 482 ? 108.187 27.307  -0.358  1.00 17.65  ? 479 GLN A CD  1 
ATOM   3643  O OE1 . GLN A  1 482 ? 108.301 27.744  0.770   1.00 16.90  ? 479 GLN A OE1 1 
ATOM   3644  N NE2 . GLN A  1 482 ? 108.875 26.263  -0.800  1.00 18.05  ? 479 GLN A NE2 1 
ATOM   3645  N N   . ARG A  1 483 ? 104.487 29.820  -1.837  1.00 21.78  ? 480 ARG A N   1 
ATOM   3646  C CA  . ARG A  1 483 ? 103.291 30.104  -1.043  1.00 23.27  ? 480 ARG A CA  1 
ATOM   3647  C C   . ARG A  1 483 ? 102.557 28.819  -0.736  1.00 21.25  ? 480 ARG A C   1 
ATOM   3648  O O   . ARG A  1 483 ? 102.459 27.959  -1.584  1.00 19.97  ? 480 ARG A O   1 
ATOM   3649  C CB  . ARG A  1 483 ? 102.379 31.001  -1.845  1.00 27.12  ? 480 ARG A CB  1 
ATOM   3650  C CG  . ARG A  1 483 ? 101.082 31.356  -1.166  1.00 32.06  ? 480 ARG A CG  1 
ATOM   3651  C CD  . ARG A  1 483 ? 100.455 32.566  -1.834  1.00 37.80  ? 480 ARG A CD  1 
ATOM   3652  N NE  . ARG A  1 483 ? 99.186  32.874  -1.192  1.00 45.28  ? 480 ARG A NE  1 
ATOM   3653  C CZ  . ARG A  1 483 ? 97.993  32.440  -1.609  1.00 51.33  ? 480 ARG A CZ  1 
ATOM   3654  N NH1 . ARG A  1 483 ? 96.901  32.767  -0.919  1.00 51.31  ? 480 ARG A NH1 1 
ATOM   3655  N NH2 . ARG A  1 483 ? 97.868  31.688  -2.711  1.00 55.16  ? 480 ARG A NH2 1 
ATOM   3656  N N   . TRP A  1 484 ? 102.014 28.701  0.462   1.00 20.70  ? 481 TRP A N   1 
ATOM   3657  C CA  . TRP A  1 484 ? 101.258 27.504  0.839   1.00 20.69  ? 481 TRP A CA  1 
ATOM   3658  C C   . TRP A  1 484 ? 99.854  27.890  1.303   1.00 21.52  ? 481 TRP A C   1 
ATOM   3659  O O   . TRP A  1 484 ? 99.614  28.154  2.493   1.00 21.52  ? 481 TRP A O   1 
ATOM   3660  C CB  . TRP A  1 484 ? 101.974 26.747  1.933   1.00 20.32  ? 481 TRP A CB  1 
ATOM   3661  C CG  . TRP A  1 484 ? 103.356 26.314  1.586   1.00 19.99  ? 481 TRP A CG  1 
ATOM   3662  C CD1 . TRP A  1 484 ? 104.508 26.850  2.048   1.00 19.94  ? 481 TRP A CD1 1 
ATOM   3663  C CD2 . TRP A  1 484 ? 103.737 25.233  0.715   1.00 19.94  ? 481 TRP A CD2 1 
ATOM   3664  N NE1 . TRP A  1 484 ? 105.593 26.191  1.510   1.00 19.85  ? 481 TRP A NE1 1 
ATOM   3665  C CE2 . TRP A  1 484 ? 105.150 25.188  0.696   1.00 19.29  ? 481 TRP A CE2 1 
ATOM   3666  C CE3 . TRP A  1 484 ? 103.022 24.310  -0.063  1.00 19.67  ? 481 TRP A CE3 1 
ATOM   3667  C CZ2 . TRP A  1 484 ? 105.865 24.249  -0.045  1.00 18.71  ? 481 TRP A CZ2 1 
ATOM   3668  C CZ3 . TRP A  1 484 ? 103.739 23.380  -0.814  1.00 19.22  ? 481 TRP A CZ3 1 
ATOM   3669  C CH2 . TRP A  1 484 ? 105.151 23.357  -0.788  1.00 18.82  ? 481 TRP A CH2 1 
ATOM   3670  N N   . PRO A  1 485 ? 98.909  27.917  0.366   1.00 22.17  ? 482 PRO A N   1 
ATOM   3671  C CA  . PRO A  1 485 ? 97.605  28.477  0.646   1.00 23.01  ? 482 PRO A CA  1 
ATOM   3672  C C   . PRO A  1 485 ? 96.650  27.606  1.485   1.00 23.99  ? 482 PRO A C   1 
ATOM   3673  O O   . PRO A  1 485 ? 95.628  28.117  1.943   1.00 24.25  ? 482 PRO A O   1 
ATOM   3674  C CB  . PRO A  1 485 ? 97.042  28.704  -0.756  1.00 22.88  ? 482 PRO A CB  1 
ATOM   3675  C CG  . PRO A  1 485 ? 97.621  27.593  -1.565  1.00 22.81  ? 482 PRO A CG  1 
ATOM   3676  C CD  . PRO A  1 485 ? 98.984  27.348  -0.992  1.00 22.74  ? 482 PRO A CD  1 
ATOM   3677  N N   . SER A  1 486 ? 96.961  26.324  1.672   1.00 26.25  ? 483 SER A N   1 
ATOM   3678  C CA  . SER A  1 486 ? 96.046  25.388  2.350   1.00 29.29  ? 483 SER A CA  1 
ATOM   3679  C C   . SER A  1 486 ? 96.610  24.847  3.682   1.00 29.33  ? 483 SER A C   1 
ATOM   3680  O O   . SER A  1 486 ? 97.564  24.059  3.682   1.00 29.18  ? 483 SER A O   1 
ATOM   3681  C CB  . SER A  1 486 ? 95.732  24.226  1.401   1.00 31.63  ? 483 SER A CB  1 
ATOM   3682  O OG  . SER A  1 486 ? 95.091  24.660  0.208   1.00 36.85  ? 483 SER A OG  1 
ATOM   3683  N N   . ALA A  1 487 ? 96.010  25.250  4.810   1.00 28.71  ? 484 ALA A N   1 
ATOM   3684  C CA  . ALA A  1 487 ? 96.450  24.816  6.160   1.00 27.60  ? 484 ALA A CA  1 
ATOM   3685  C C   . ALA A  1 487 ? 95.657  23.634  6.732   1.00 27.31  ? 484 ALA A C   1 
ATOM   3686  O O   . ALA A  1 487 ? 95.485  23.519  7.960   1.00 28.64  ? 484 ALA A O   1 
ATOM   3687  C CB  . ALA A  1 487 ? 96.392  25.989  7.131   1.00 27.58  ? 484 ALA A CB  1 
ATOM   3688  N N   . GLY A  1 488 ? 95.207  22.747  5.850   1.00 26.46  ? 485 GLY A N   1 
ATOM   3689  C CA  . GLY A  1 488 ? 94.414  21.595  6.227   1.00 26.23  ? 485 GLY A CA  1 
ATOM   3690  C C   . GLY A  1 488 ? 95.054  20.621  7.188   1.00 26.91  ? 485 GLY A C   1 
ATOM   3691  O O   . GLY A  1 488 ? 94.368  20.121  8.065   1.00 27.71  ? 485 GLY A O   1 
ATOM   3692  N N   . VAL A  1 489 ? 96.353  20.348  7.015   1.00 27.74  ? 486 VAL A N   1 
ATOM   3693  C CA  . VAL A  1 489 ? 97.083  19.327  7.785   1.00 26.66  ? 486 VAL A CA  1 
ATOM   3694  C C   . VAL A  1 489 ? 97.459  19.877  9.149   1.00 27.70  ? 486 VAL A C   1 
ATOM   3695  O O   . VAL A  1 489 ? 97.412  19.141  10.145  1.00 28.25  ? 486 VAL A O   1 
ATOM   3696  C CB  . VAL A  1 489 ? 98.361  18.844  7.062   1.00 26.64  ? 486 VAL A CB  1 
ATOM   3697  C CG1 . VAL A  1 489 ? 99.250  17.974  7.960   1.00 26.32  ? 486 VAL A CG1 1 
ATOM   3698  C CG2 . VAL A  1 489 ? 97.996  18.035  5.841   1.00 26.91  ? 486 VAL A CG2 1 
ATOM   3699  N N   . ARG A  1 490 ? 97.849  21.156  9.182   1.00 27.98  ? 487 ARG A N   1 
ATOM   3700  C CA  . ARG A  1 490 ? 98.210  21.857  10.432  1.00 28.48  ? 487 ARG A CA  1 
ATOM   3701  C C   . ARG A  1 490 ? 97.058  21.989  11.430  1.00 30.15  ? 487 ARG A C   1 
ATOM   3702  O O   . ARG A  1 490 ? 97.293  22.031  12.649  1.00 29.46  ? 487 ARG A O   1 
ATOM   3703  C CB  . ARG A  1 490 ? 98.724  23.257  10.137  1.00 28.23  ? 487 ARG A CB  1 
ATOM   3704  C CG  . ARG A  1 490 ? 99.609  23.826  11.238  1.00 27.29  ? 487 ARG A CG  1 
ATOM   3705  C CD  . ARG A  1 490 ? 99.281  25.261  11.538  1.00 26.76  ? 487 ARG A CD  1 
ATOM   3706  N NE  . ARG A  1 490 ? 99.208  26.063  10.327  1.00 25.79  ? 487 ARG A NE  1 
ATOM   3707  C CZ  . ARG A  1 490 ? 98.559  27.221  10.224  1.00 26.48  ? 487 ARG A CZ  1 
ATOM   3708  N NH1 . ARG A  1 490 ? 97.930  27.779  11.260  1.00 26.23  ? 487 ARG A NH1 1 
ATOM   3709  N NH2 . ARG A  1 490 ? 98.539  27.846  9.059   1.00 27.96  ? 487 ARG A NH2 1 
ATOM   3710  N N   . GLU A  1 491 ? 95.837  22.084  10.887  1.00 31.41  ? 488 GLU A N   1 
ATOM   3711  C CA  . GLU A  1 491 ? 94.571  21.974  11.631  1.00 32.12  ? 488 GLU A CA  1 
ATOM   3712  C C   . GLU A  1 491 ? 93.971  20.532  11.356  1.00 36.27  ? 488 GLU A C   1 
ATOM   3713  O O   . GLU A  1 491 ? 93.565  20.272  10.233  1.00 44.93  ? 488 GLU A O   1 
ATOM   3714  C CB  . GLU A  1 491 ? 93.645  23.093  11.106  1.00 29.71  ? 488 GLU A CB  1 
ATOM   3715  C CG  . GLU A  1 491 ? 94.307  24.475  10.896  1.00 28.29  ? 488 GLU A CG  1 
ATOM   3716  C CD  . GLU A  1 491 ? 93.498  25.486  10.044  1.00 26.01  ? 488 GLU A CD  1 
ATOM   3717  O OE1 . GLU A  1 491 ? 92.996  25.114  8.970   1.00 23.82  ? 488 GLU A OE1 1 
ATOM   3718  O OE2 . GLU A  1 491 ? 93.392  26.680  10.424  1.00 23.07  ? 488 GLU A OE2 1 
ATOM   3719  N N   . GLY A  1 492 ? 93.890  19.568  12.279  1.00 37.18  ? 489 GLY A N   1 
ATOM   3720  C CA  . GLY A  1 492 ? 94.173  19.673  13.709  1.00 39.78  ? 489 GLY A CA  1 
ATOM   3721  C C   . GLY A  1 492 ? 93.980  18.305  14.412  1.00 40.31  ? 489 GLY A C   1 
ATOM   3722  O O   . GLY A  1 492 ? 92.884  17.942  14.914  1.00 35.94  ? 489 GLY A O   1 
ATOM   3723  N N   . MET B  1 4   ? 96.398  68.256  -34.802 1.00 57.01  ? 1   MET B N   1 
ATOM   3724  C CA  . MET B  1 4   ? 96.466  67.137  -33.805 1.00 57.50  ? 1   MET B CA  1 
ATOM   3725  C C   . MET B  1 4   ? 97.730  67.246  -32.956 1.00 53.91  ? 1   MET B C   1 
ATOM   3726  O O   . MET B  1 4   ? 98.740  67.830  -33.386 1.00 52.20  ? 1   MET B O   1 
ATOM   3727  C CB  . MET B  1 4   ? 96.432  65.770  -34.498 1.00 61.28  ? 1   MET B CB  1 
ATOM   3728  C CG  . MET B  1 4   ? 96.415  64.589  -33.535 1.00 66.93  ? 1   MET B CG  1 
ATOM   3729  S SD  . MET B  1 4   ? 95.784  63.014  -34.178 1.00 81.51  ? 1   MET B SD  1 
ATOM   3730  C CE  . MET B  1 4   ? 96.330  62.983  -35.881 1.00 75.25  ? 1   MET B CE  1 
ATOM   3731  N N   . THR B  1 5   ? 97.645  66.694  -31.748 1.00 45.33  ? 2   THR B N   1 
ATOM   3732  C CA  . THR B  1 5   ? 98.777  66.637  -30.814 1.00 40.10  ? 2   THR B CA  1 
ATOM   3733  C C   . THR B  1 5   ? 99.934  65.671  -31.208 1.00 35.37  ? 2   THR B C   1 
ATOM   3734  O O   . THR B  1 5   ? 99.712  64.483  -31.426 1.00 35.12  ? 2   THR B O   1 
ATOM   3735  C CB  . THR B  1 5   ? 98.286  66.311  -29.392 1.00 40.12  ? 2   THR B CB  1 
ATOM   3736  O OG1 . THR B  1 5   ? 99.407  66.236  -28.516 1.00 40.43  ? 2   THR B OG1 1 
ATOM   3737  C CG2 . THR B  1 5   ? 97.498  64.975  -29.322 1.00 41.76  ? 2   THR B CG2 1 
ATOM   3738  N N   . THR B  1 6   ? 101.152 66.215  -31.312 1.00 31.53  ? 3   THR B N   1 
ATOM   3739  C CA  . THR B  1 6   ? 102.392 65.475  -31.609 1.00 28.71  ? 3   THR B CA  1 
ATOM   3740  C C   . THR B  1 6   ? 103.252 65.234  -30.366 1.00 26.95  ? 3   THR B C   1 
ATOM   3741  O O   . THR B  1 6   ? 103.668 66.186  -29.721 1.00 29.21  ? 3   THR B O   1 
ATOM   3742  C CB  . THR B  1 6   ? 103.264 66.264  -32.590 1.00 27.91  ? 3   THR B CB  1 
ATOM   3743  O OG1 . THR B  1 6   ? 102.475 66.634  -33.706 1.00 28.33  ? 3   THR B OG1 1 
ATOM   3744  C CG2 . THR B  1 6   ? 104.378 65.432  -33.102 1.00 29.89  ? 3   THR B CG2 1 
ATOM   3745  N N   . ILE B  1 7   ? 103.559 63.976  -30.057 1.00 24.01  ? 4   ILE B N   1 
ATOM   3746  C CA  . ILE B  1 7   ? 104.420 63.635  -28.914 1.00 22.22  ? 4   ILE B CA  1 
ATOM   3747  C C   . ILE B  1 7   ? 105.887 63.742  -29.258 1.00 21.64  ? 4   ILE B C   1 
ATOM   3748  O O   . ILE B  1 7   ? 106.321 63.218  -30.275 1.00 21.31  ? 4   ILE B O   1 
ATOM   3749  C CB  . ILE B  1 7   ? 104.184 62.208  -28.412 1.00 21.59  ? 4   ILE B CB  1 
ATOM   3750  C CG1 . ILE B  1 7   ? 102.761 62.071  -27.890 1.00 21.49  ? 4   ILE B CG1 1 
ATOM   3751  C CG2 . ILE B  1 7   ? 105.146 61.867  -27.281 1.00 21.54  ? 4   ILE B CG2 1 
ATOM   3752  C CD1 . ILE B  1 7   ? 102.286 60.640  -27.859 1.00 22.13  ? 4   ILE B CD1 1 
ATOM   3753  N N   . GLY B  1 8   ? 106.650 64.378  -28.374 1.00 21.84  ? 5   GLY B N   1 
ATOM   3754  C CA  . GLY B  1 8   ? 108.047 64.695  -28.650 1.00 22.82  ? 5   GLY B CA  1 
ATOM   3755  C C   . GLY B  1 8   ? 109.076 63.751  -28.030 1.00 23.35  ? 5   GLY B C   1 
ATOM   3756  O O   . GLY B  1 8   ? 108.801 62.555  -27.770 1.00 22.23  ? 5   GLY B O   1 
ATOM   3757  N N   . HIS B  1 9   ? 110.266 64.314  -27.809 1.00 22.42  ? 6   HIS B N   1 
ATOM   3758  C CA  . HIS B  1 9   ? 111.357 63.645  -27.141 1.00 21.69  ? 6   HIS B CA  1 
ATOM   3759  C C   . HIS B  1 9   ? 111.799 64.467  -25.957 1.00 21.83  ? 6   HIS B C   1 
ATOM   3760  O O   . HIS B  1 9   ? 111.615 65.668  -25.943 1.00 22.30  ? 6   HIS B O   1 
ATOM   3761  C CB  . HIS B  1 9   ? 112.493 63.513  -28.112 1.00 21.88  ? 6   HIS B CB  1 
ATOM   3762  C CG  . HIS B  1 9   ? 112.060 63.032  -29.453 1.00 22.37  ? 6   HIS B CG  1 
ATOM   3763  N ND1 . HIS B  1 9   ? 111.603 61.756  -29.662 1.00 21.91  ? 6   HIS B ND1 1 
ATOM   3764  C CD2 . HIS B  1 9   ? 112.000 63.656  -30.650 1.00 23.42  ? 6   HIS B CD2 1 
ATOM   3765  C CE1 . HIS B  1 9   ? 111.289 61.601  -30.929 1.00 22.95  ? 6   HIS B CE1 1 
ATOM   3766  N NE2 . HIS B  1 9   ? 111.523 62.740  -31.555 1.00 23.75  ? 6   HIS B NE2 1 
ATOM   3767  N N   . LEU B  1 10  ? 112.366 63.808  -24.948 1.00 22.66  ? 7   LEU B N   1 
ATOM   3768  C CA  . LEU B  1 10  ? 113.002 64.487  -23.804 1.00 21.24  ? 7   LEU B CA  1 
ATOM   3769  C C   . LEU B  1 10  ? 114.512 64.380  -23.975 1.00 20.26  ? 7   LEU B C   1 
ATOM   3770  O O   . LEU B  1 10  ? 115.070 63.310  -23.788 1.00 19.90  ? 7   LEU B O   1 
ATOM   3771  C CB  . LEU B  1 10  ? 112.553 63.881  -22.472 1.00 21.31  ? 7   LEU B CB  1 
ATOM   3772  C CG  . LEU B  1 10  ? 113.156 64.510  -21.200 1.00 22.46  ? 7   LEU B CG  1 
ATOM   3773  C CD1 . LEU B  1 10  ? 112.668 65.935  -20.957 1.00 22.78  ? 7   LEU B CD1 1 
ATOM   3774  C CD2 . LEU B  1 10  ? 112.843 63.680  -19.970 1.00 22.86  ? 7   LEU B CD2 1 
ATOM   3775  N N   . ILE B  1 11  ? 115.144 65.488  -24.370 1.00 19.80  ? 8   ILE B N   1 
ATOM   3776  C CA  . ILE B  1 11  ? 116.594 65.571  -24.617 1.00 19.06  ? 8   ILE B CA  1 
ATOM   3777  C C   . ILE B  1 11  ? 117.149 66.755  -23.843 1.00 20.84  ? 8   ILE B C   1 
ATOM   3778  O O   . ILE B  1 11  ? 116.679 67.904  -23.987 1.00 20.63  ? 8   ILE B O   1 
ATOM   3779  C CB  . ILE B  1 11  ? 116.927 65.756  -26.104 1.00 17.66  ? 8   ILE B CB  1 
ATOM   3780  C CG1 . ILE B  1 11  ? 116.347 64.583  -26.911 1.00 17.36  ? 8   ILE B CG1 1 
ATOM   3781  C CG2 . ILE B  1 11  ? 118.431 65.903  -26.280 1.00 17.54  ? 8   ILE B CG2 1 
ATOM   3782  C CD1 . ILE B  1 11  ? 116.643 64.548  -28.402 1.00 17.12  ? 8   ILE B CD1 1 
ATOM   3783  N N   . ASN B  1 12  ? 118.146 66.480  -23.011 1.00 22.25  ? 9   ASN B N   1 
ATOM   3784  C CA  . ASN B  1 12  ? 118.699 67.524  -22.157 1.00 24.39  ? 9   ASN B CA  1 
ATOM   3785  C C   . ASN B  1 12  ? 117.668 68.353  -21.345 1.00 24.78  ? 9   ASN B C   1 
ATOM   3786  O O   . ASN B  1 12  ? 117.857 69.524  -21.152 1.00 23.95  ? 9   ASN B O   1 
ATOM   3787  C CB  . ASN B  1 12  ? 119.570 68.474  -22.982 1.00 24.92  ? 9   ASN B CB  1 
ATOM   3788  C CG  . ASN B  1 12  ? 120.778 68.974  -22.208 1.00 25.92  ? 9   ASN B CG  1 
ATOM   3789  O OD1 . ASN B  1 12  ? 121.577 68.184  -21.717 1.00 28.90  ? 9   ASN B OD1 1 
ATOM   3790  N ND2 . ASN B  1 12  ? 120.926 70.272  -22.111 1.00 26.96  ? 9   ASN B ND2 1 
ATOM   3791  N N   . GLY B  1 13  ? 116.618 67.729  -20.825 1.00 26.54  ? 10  GLY B N   1 
ATOM   3792  C CA  . GLY B  1 13  ? 115.687 68.415  -19.917 1.00 28.28  ? 10  GLY B CA  1 
ATOM   3793  C C   . GLY B  1 13  ? 114.603 69.218  -20.630 1.00 30.69  ? 10  GLY B C   1 
ATOM   3794  O O   . GLY B  1 13  ? 113.866 69.981  -20.010 1.00 26.62  ? 10  GLY B O   1 
ATOM   3795  N N   . GLN B  1 14  ? 114.477 69.023  -21.938 1.00 35.28  ? 11  GLN B N   1 
ATOM   3796  C CA  . GLN B  1 14  ? 113.527 69.796  -22.707 1.00 38.57  ? 11  GLN B CA  1 
ATOM   3797  C C   . GLN B  1 14  ? 112.828 68.931  -23.705 1.00 36.16  ? 11  GLN B C   1 
ATOM   3798  O O   . GLN B  1 14  ? 113.443 68.029  -24.278 1.00 35.62  ? 11  GLN B O   1 
ATOM   3799  C CB  . GLN B  1 14  ? 114.224 70.963  -23.405 1.00 44.27  ? 11  GLN B CB  1 
ATOM   3800  C CG  . GLN B  1 14  ? 114.473 72.130  -22.458 1.00 50.45  ? 11  GLN B CG  1 
ATOM   3801  C CD  . GLN B  1 14  ? 115.019 73.347  -23.154 1.00 60.99  ? 11  GLN B CD  1 
ATOM   3802  O OE1 . GLN B  1 14  ? 115.140 73.373  -24.386 1.00 79.50  ? 11  GLN B OE1 1 
ATOM   3803  N NE2 . GLN B  1 14  ? 115.367 74.371  -22.373 1.00 61.33  ? 11  GLN B NE2 1 
ATOM   3804  N N   . LEU B  1 15  ? 111.536 69.220  -23.894 1.00 34.45  ? 12  LEU B N   1 
ATOM   3805  C CA  . LEU B  1 15  ? 110.760 68.646  -24.987 1.00 33.59  ? 12  LEU B CA  1 
ATOM   3806  C C   . LEU B  1 15  ? 111.167 69.250  -26.306 1.00 30.53  ? 12  LEU B C   1 
ATOM   3807  O O   . LEU B  1 15  ? 111.238 70.471  -26.447 1.00 30.68  ? 12  LEU B O   1 
ATOM   3808  C CB  . LEU B  1 15  ? 109.272 68.854  -24.781 1.00 35.08  ? 12  LEU B CB  1 
ATOM   3809  C CG  . LEU B  1 15  ? 108.624 68.061  -23.641 1.00 38.12  ? 12  LEU B CG  1 
ATOM   3810  C CD1 . LEU B  1 15  ? 107.117 68.319  -23.649 1.00 38.65  ? 12  LEU B CD1 1 
ATOM   3811  C CD2 . LEU B  1 15  ? 108.912 66.556  -23.734 1.00 39.01  ? 12  LEU B CD2 1 
ATOM   3812  N N   . VAL B  1 16  ? 111.480 68.382  -27.248 1.00 28.91  ? 13  VAL B N   1 
ATOM   3813  C CA  . VAL B  1 16  ? 111.785 68.790  -28.595 1.00 30.07  ? 13  VAL B CA  1 
ATOM   3814  C C   . VAL B  1 16  ? 111.069 67.861  -29.554 1.00 30.15  ? 13  VAL B C   1 
ATOM   3815  O O   . VAL B  1 16  ? 110.604 66.787  -29.189 1.00 30.36  ? 13  VAL B O   1 
ATOM   3816  C CB  . VAL B  1 16  ? 113.309 68.780  -28.877 1.00 30.07  ? 13  VAL B CB  1 
ATOM   3817  C CG1 . VAL B  1 16  ? 114.048 69.668  -27.885 1.00 30.81  ? 13  VAL B CG1 1 
ATOM   3818  C CG2 . VAL B  1 16  ? 113.882 67.378  -28.819 1.00 30.35  ? 13  VAL B CG2 1 
ATOM   3819  N N   . THR B  1 17  ? 111.023 68.278  -30.802 1.00 30.80  ? 14  THR B N   1 
ATOM   3820  C CA  . THR B  1 17  ? 110.419 67.478  -31.831 1.00 28.22  ? 14  THR B CA  1 
ATOM   3821  C C   . THR B  1 17  ? 111.233 67.699  -33.095 1.00 26.39  ? 14  THR B C   1 
ATOM   3822  O O   . THR B  1 17  ? 111.759 68.779  -33.297 1.00 23.47  ? 14  THR B O   1 
ATOM   3823  C CB  . THR B  1 17  ? 108.924 67.820  -31.942 1.00 27.98  ? 14  THR B CB  1 
ATOM   3824  O OG1 . THR B  1 17  ? 108.433 67.365  -33.190 1.00 30.04  ? 14  THR B OG1 1 
ATOM   3825  C CG2 . THR B  1 17  ? 108.670 69.307  -31.852 1.00 28.69  ? 14  THR B CG2 1 
ATOM   3826  N N   . GLU B  1 18  ? 111.398 66.635  -33.882 1.00 27.89  ? 15  GLU B N   1 
ATOM   3827  C CA  . GLU B  1 18  ? 112.121 66.662  -35.169 1.00 29.00  ? 15  GLU B CA  1 
ATOM   3828  C C   . GLU B  1 18  ? 111.165 67.044  -36.332 1.00 29.50  ? 15  GLU B C   1 
ATOM   3829  O O   . GLU B  1 18  ? 111.480 67.936  -37.120 1.00 29.55  ? 15  GLU B O   1 
ATOM   3830  C CB  . GLU B  1 18  ? 112.827 65.312  -35.422 1.00 28.86  ? 15  GLU B CB  1 
ATOM   3831  C CG  . GLU B  1 18  ? 113.768 65.319  -36.609 1.00 31.63  ? 15  GLU B CG  1 
ATOM   3832  C CD  . GLU B  1 18  ? 114.238 63.938  -37.049 1.00 35.08  ? 15  GLU B CD  1 
ATOM   3833  O OE1 . GLU B  1 18  ? 114.407 63.049  -36.194 1.00 38.41  ? 15  GLU B OE1 1 
ATOM   3834  O OE2 . GLU B  1 18  ? 114.467 63.751  -38.270 1.00 36.86  ? 15  GLU B OE2 1 
ATOM   3835  N N   . ASN B  1 19  ? 110.014 66.373  -36.414 1.00 29.52  ? 16  ASN B N   1 
ATOM   3836  C CA  . ASN B  1 19  ? 108.999 66.592  -37.463 1.00 31.23  ? 16  ASN B CA  1 
ATOM   3837  C C   . ASN B  1 19  ? 109.438 66.249  -38.875 1.00 31.12  ? 16  ASN B C   1 
ATOM   3838  O O   . ASN B  1 19  ? 109.165 67.002  -39.807 1.00 36.56  ? 16  ASN B O   1 
ATOM   3839  C CB  . ASN B  1 19  ? 108.477 68.039  -37.472 1.00 32.96  ? 16  ASN B CB  1 
ATOM   3840  C CG  . ASN B  1 19  ? 107.937 68.482  -36.128 1.00 33.86  ? 16  ASN B CG  1 
ATOM   3841  O OD1 . ASN B  1 19  ? 106.899 67.977  -35.657 1.00 33.74  ? 16  ASN B OD1 1 
ATOM   3842  N ND2 . ASN B  1 19  ? 108.621 69.452  -35.506 1.00 32.92  ? 16  ASN B ND2 1 
ATOM   3843  N N   . THR B  1 20  ? 110.137 65.143  -39.050 1.00 30.48  ? 17  THR B N   1 
ATOM   3844  C CA  . THR B  1 20  ? 110.364 64.637  -40.400 1.00 30.38  ? 17  THR B CA  1 
ATOM   3845  C C   . THR B  1 20  ? 109.430 63.488  -40.703 1.00 29.81  ? 17  THR B C   1 
ATOM   3846  O O   . THR B  1 20  ? 109.009 63.328  -41.839 1.00 33.58  ? 17  THR B O   1 
ATOM   3847  C CB  . THR B  1 20  ? 111.835 64.260  -40.680 1.00 29.37  ? 17  THR B CB  1 
ATOM   3848  O OG1 . THR B  1 20  ? 112.269 63.296  -39.740 1.00 29.28  ? 17  THR B OG1 1 
ATOM   3849  C CG2 . THR B  1 20  ? 112.731 65.499  -40.590 1.00 29.79  ? 17  THR B CG2 1 
ATOM   3850  N N   . ARG B  1 21  ? 109.048 62.733  -39.682 1.00 28.14  ? 18  ARG B N   1 
ATOM   3851  C CA  . ARG B  1 21  ? 108.389 61.450  -39.865 1.00 27.17  ? 18  ARG B CA  1 
ATOM   3852  C C   . ARG B  1 21  ? 107.613 61.146  -38.607 1.00 26.31  ? 18  ARG B C   1 
ATOM   3853  O O   . ARG B  1 21  ? 108.086 61.484  -37.523 1.00 28.94  ? 18  ARG B O   1 
ATOM   3854  C CB  . ARG B  1 21  ? 109.468 60.395  -40.092 1.00 28.03  ? 18  ARG B CB  1 
ATOM   3855  C CG  . ARG B  1 21  ? 108.917 59.032  -40.403 1.00 29.87  ? 18  ARG B CG  1 
ATOM   3856  C CD  . ARG B  1 21  ? 109.904 58.247  -41.231 1.00 30.39  ? 18  ARG B CD  1 
ATOM   3857  N NE  . ARG B  1 21  ? 111.099 57.879  -40.492 1.00 28.26  ? 18  ARG B NE  1 
ATOM   3858  C CZ  . ARG B  1 21  ? 111.184 56.835  -39.667 1.00 27.56  ? 18  ARG B CZ  1 
ATOM   3859  N NH1 . ARG B  1 21  ? 110.129 56.059  -39.409 1.00 25.94  ? 18  ARG B NH1 1 
ATOM   3860  N NH2 . ARG B  1 21  ? 112.342 56.573  -39.073 1.00 27.79  ? 18  ARG B NH2 1 
ATOM   3861  N N   . SER B  1 22  ? 106.430 60.544  -38.714 1.00 25.08  ? 19  SER B N   1 
ATOM   3862  C CA  . SER B  1 22  ? 105.604 60.265  -37.504 1.00 24.02  ? 19  SER B CA  1 
ATOM   3863  C C   . SER B  1 22  ? 104.851 58.963  -37.610 1.00 24.83  ? 19  SER B C   1 
ATOM   3864  O O   . SER B  1 22  ? 104.844 58.317  -38.660 1.00 24.14  ? 19  SER B O   1 
ATOM   3865  C CB  . SER B  1 22  ? 104.613 61.392  -37.214 1.00 22.79  ? 19  SER B CB  1 
ATOM   3866  O OG  . SER B  1 22  ? 103.587 61.430  -38.187 1.00 21.87  ? 19  SER B OG  1 
ATOM   3867  N N   . GLN B  1 23  ? 104.221 58.584  -36.506 1.00 26.38  ? 20  GLN B N   1 
ATOM   3868  C CA  . GLN B  1 23  ? 103.358 57.414  -36.477 1.00 27.98  ? 20  GLN B CA  1 
ATOM   3869  C C   . GLN B  1 23  ? 102.120 57.608  -35.608 1.00 27.14  ? 20  GLN B C   1 
ATOM   3870  O O   . GLN B  1 23  ? 102.143 58.332  -34.606 1.00 26.62  ? 20  GLN B O   1 
ATOM   3871  C CB  . GLN B  1 23  ? 104.151 56.228  -35.961 1.00 30.43  ? 20  GLN B CB  1 
ATOM   3872  C CG  . GLN B  1 23  ? 103.433 54.896  -36.116 1.00 32.27  ? 20  GLN B CG  1 
ATOM   3873  C CD  . GLN B  1 23  ? 104.282 53.744  -35.625 1.00 33.99  ? 20  GLN B CD  1 
ATOM   3874  O OE1 . GLN B  1 23  ? 105.443 53.571  -36.033 1.00 34.14  ? 20  GLN B OE1 1 
ATOM   3875  N NE2 . GLN B  1 23  ? 103.716 52.948  -34.731 1.00 35.96  ? 20  GLN B NE2 1 
ATOM   3876  N N   . ASN B  1 24  ? 101.047 56.924  -35.979 1.00 26.74  ? 21  ASN B N   1 
ATOM   3877  C CA  . ASN B  1 24  ? 99.815  56.994  -35.211 1.00 26.60  ? 21  ASN B CA  1 
ATOM   3878  C C   . ASN B  1 24  ? 99.967  56.246  -33.918 1.00 25.10  ? 21  ASN B C   1 
ATOM   3879  O O   . ASN B  1 24  ? 100.518 55.157  -33.910 1.00 23.65  ? 21  ASN B O   1 
ATOM   3880  C CB  . ASN B  1 24  ? 98.640  56.405  -35.997 1.00 27.47  ? 21  ASN B CB  1 
ATOM   3881  C CG  . ASN B  1 24  ? 98.344  57.179  -37.281 1.00 26.63  ? 21  ASN B CG  1 
ATOM   3882  O OD1 . ASN B  1 24  ? 98.487  58.402  -37.324 1.00 24.92  ? 21  ASN B OD1 1 
ATOM   3883  N ND2 . ASN B  1 24  ? 97.931  56.465  -38.330 1.00 25.82  ? 21  ASN B ND2 1 
ATOM   3884  N N   . VAL B  1 25  ? 99.528  56.871  -32.826 1.00 25.58  ? 22  VAL B N   1 
ATOM   3885  C CA  . VAL B  1 25  ? 99.211  56.149  -31.586 1.00 26.54  ? 22  VAL B CA  1 
ATOM   3886  C C   . VAL B  1 25  ? 97.680  56.094  -31.493 1.00 26.75  ? 22  VAL B C   1 
ATOM   3887  O O   . VAL B  1 25  ? 97.013  57.125  -31.641 1.00 26.15  ? 22  VAL B O   1 
ATOM   3888  C CB  . VAL B  1 25  ? 99.857  56.751  -30.287 1.00 25.90  ? 22  VAL B CB  1 
ATOM   3889  C CG1 . VAL B  1 25  ? 101.252 57.281  -30.545 1.00 25.24  ? 22  VAL B CG1 1 
ATOM   3890  C CG2 . VAL B  1 25  ? 99.021  57.859  -29.694 1.00 27.21  ? 22  VAL B CG2 1 
ATOM   3891  N N   . PHE B  1 26  ? 97.147  54.892  -31.256 1.00 27.00  ? 23  PHE B N   1 
ATOM   3892  C CA  . PHE B  1 26  ? 95.708  54.658  -31.190 1.00 27.06  ? 23  PHE B CA  1 
ATOM   3893  C C   . PHE B  1 26  ? 95.160  54.686  -29.769 1.00 27.18  ? 23  PHE B C   1 
ATOM   3894  O O   . PHE B  1 26  ? 95.906  54.622  -28.803 1.00 27.76  ? 23  PHE B O   1 
ATOM   3895  C CB  . PHE B  1 26  ? 95.397  53.300  -31.798 1.00 28.02  ? 23  PHE B CB  1 
ATOM   3896  C CG  . PHE B  1 26  ? 95.550  53.270  -33.283 1.00 29.66  ? 23  PHE B CG  1 
ATOM   3897  C CD1 . PHE B  1 26  ? 96.811  53.121  -33.864 1.00 30.89  ? 23  PHE B CD1 1 
ATOM   3898  C CD2 . PHE B  1 26  ? 94.442  53.403  -34.116 1.00 29.05  ? 23  PHE B CD2 1 
ATOM   3899  C CE1 . PHE B  1 26  ? 96.961  53.112  -35.244 1.00 29.81  ? 23  PHE B CE1 1 
ATOM   3900  C CE2 . PHE B  1 26  ? 94.592  53.390  -35.489 1.00 28.82  ? 23  PHE B CE2 1 
ATOM   3901  C CZ  . PHE B  1 26  ? 95.849  53.251  -36.054 1.00 28.83  ? 23  PHE B CZ  1 
ATOM   3902  N N   . ASN B  1 27  ? 93.841  54.817  -29.661 1.00 26.61  ? 24  ASN B N   1 
ATOM   3903  C CA  . ASN B  1 27  ? 93.126  54.429  -28.471 1.00 24.86  ? 24  ASN B CA  1 
ATOM   3904  C C   . ASN B  1 27  ? 92.632  53.082  -28.874 1.00 24.64  ? 24  ASN B C   1 
ATOM   3905  O O   . ASN B  1 27  ? 91.754  53.007  -29.718 1.00 25.19  ? 24  ASN B O   1 
ATOM   3906  C CB  . ASN B  1 27  ? 91.958  55.359  -28.167 1.00 24.74  ? 24  ASN B CB  1 
ATOM   3907  C CG  . ASN B  1 27  ? 91.324  55.088  -26.797 1.00 24.55  ? 24  ASN B CG  1 
ATOM   3908  O OD1 . ASN B  1 27  ? 91.156  53.945  -26.383 1.00 26.69  ? 24  ASN B OD1 1 
ATOM   3909  N ND2 . ASN B  1 27  ? 90.961  56.141  -26.104 1.00 24.04  ? 24  ASN B ND2 1 
ATOM   3910  N N   . PRO B  1 28  ? 93.208  52.013  -28.309 1.00 24.12  ? 25  PRO B N   1 
ATOM   3911  C CA  . PRO B  1 28  ? 92.825  50.661  -28.710 1.00 24.04  ? 25  PRO B CA  1 
ATOM   3912  C C   . PRO B  1 28  ? 91.456  50.232  -28.222 1.00 24.23  ? 25  PRO B C   1 
ATOM   3913  O O   . PRO B  1 28  ? 90.992  49.180  -28.612 1.00 23.62  ? 25  PRO B O   1 
ATOM   3914  C CB  . PRO B  1 28  ? 93.913  49.797  -28.095 1.00 24.14  ? 25  PRO B CB  1 
ATOM   3915  C CG  . PRO B  1 28  ? 94.375  50.572  -26.910 1.00 24.22  ? 25  PRO B CG  1 
ATOM   3916  C CD  . PRO B  1 28  ? 94.230  52.011  -27.256 1.00 23.85  ? 25  PRO B CD  1 
ATOM   3917  N N   . ALA B  1 29  ? 90.826  51.026  -27.363 1.00 25.95  ? 26  ALA B N   1 
ATOM   3918  C CA  . ALA B  1 29  ? 89.431  50.795  -27.001 1.00 28.17  ? 26  ALA B CA  1 
ATOM   3919  C C   . ALA B  1 29  ? 88.523  51.188  -28.149 1.00 28.35  ? 26  ALA B C   1 
ATOM   3920  O O   . ALA B  1 29  ? 87.744  50.359  -28.618 1.00 28.83  ? 26  ALA B O   1 
ATOM   3921  C CB  . ALA B  1 29  ? 89.043  51.562  -25.737 1.00 28.42  ? 26  ALA B CB  1 
ATOM   3922  N N   . THR B  1 30  ? 88.639  52.441  -28.595 1.00 27.97  ? 27  THR B N   1 
ATOM   3923  C CA  . THR B  1 30  ? 87.773  52.990  -29.662 1.00 27.92  ? 27  THR B CA  1 
ATOM   3924  C C   . THR B  1 30  ? 88.241  52.659  -31.078 1.00 27.26  ? 27  THR B C   1 
ATOM   3925  O O   . THR B  1 30  ? 87.485  52.781  -32.037 1.00 27.72  ? 27  THR B O   1 
ATOM   3926  C CB  . THR B  1 30  ? 87.665  54.525  -29.591 1.00 27.95  ? 27  THR B CB  1 
ATOM   3927  O OG1 . THR B  1 30  ? 88.934  55.114  -29.870 1.00 27.81  ? 27  THR B OG1 1 
ATOM   3928  C CG2 . THR B  1 30  ? 87.199  54.978  -28.229 1.00 29.09  ? 27  THR B CG2 1 
ATOM   3929  N N   . GLY B  1 31  ? 89.500  52.272  -31.211 1.00 26.90  ? 28  GLY B N   1 
ATOM   3930  C CA  . GLY B  1 31  ? 90.101  52.038  -32.520 1.00 25.53  ? 28  GLY B CA  1 
ATOM   3931  C C   . GLY B  1 31  ? 90.492  53.312  -33.255 1.00 25.13  ? 28  GLY B C   1 
ATOM   3932  O O   . GLY B  1 31  ? 90.959  53.229  -34.378 1.00 23.51  ? 28  GLY B O   1 
ATOM   3933  N N   . GLU B  1 32  ? 90.350  54.476  -32.617 1.00 26.67  ? 29  GLU B N   1 
ATOM   3934  C CA  . GLU B  1 32  ? 90.577  55.763  -33.263 1.00 29.72  ? 29  GLU B CA  1 
ATOM   3935  C C   . GLU B  1 32  ? 91.975  56.289  -33.023 1.00 30.17  ? 29  GLU B C   1 
ATOM   3936  O O   . GLU B  1 32  ? 92.603  55.968  -32.023 1.00 32.31  ? 29  GLU B O   1 
ATOM   3937  C CB  . GLU B  1 32  ? 89.581  56.793  -32.757 1.00 34.79  ? 29  GLU B CB  1 
ATOM   3938  C CG  . GLU B  1 32  ? 88.156  56.564  -33.249 1.00 41.89  ? 29  GLU B CG  1 
ATOM   3939  C CD  . GLU B  1 32  ? 87.109  57.394  -32.499 1.00 48.42  ? 29  GLU B CD  1 
ATOM   3940  O OE1 . GLU B  1 32  ? 85.914  57.042  -32.577 1.00 56.09  ? 29  GLU B OE1 1 
ATOM   3941  O OE2 . GLU B  1 32  ? 87.458  58.388  -31.823 1.00 50.76  ? 29  GLU B OE2 1 
ATOM   3942  N N   . ILE B  1 33  ? 92.455  57.128  -33.934 1.00 29.92  ? 30  ILE B N   1 
ATOM   3943  C CA  . ILE B  1 33  ? 93.795  57.709  -33.820 1.00 29.27  ? 30  ILE B CA  1 
ATOM   3944  C C   . ILE B  1 33  ? 93.786  58.885  -32.855 1.00 29.04  ? 30  ILE B C   1 
ATOM   3945  O O   . ILE B  1 33  ? 93.233  59.919  -33.163 1.00 28.79  ? 30  ILE B O   1 
ATOM   3946  C CB  . ILE B  1 33  ? 94.332  58.197  -35.177 1.00 28.40  ? 30  ILE B CB  1 
ATOM   3947  C CG1 . ILE B  1 33  ? 94.575  57.005  -36.104 1.00 29.11  ? 30  ILE B CG1 1 
ATOM   3948  C CG2 . ILE B  1 33  ? 95.635  58.961  -34.992 1.00 27.52  ? 30  ILE B CG2 1 
ATOM   3949  C CD1 . ILE B  1 33  ? 94.744  57.390  -37.565 1.00 29.37  ? 30  ILE B CD1 1 
ATOM   3950  N N   . GLY B  1 34  ? 94.459  58.727  -31.724 1.00 29.67  ? 31  GLY B N   1 
ATOM   3951  C CA  . GLY B  1 34  ? 94.456  59.711  -30.657 1.00 30.13  ? 31  GLY B CA  1 
ATOM   3952  C C   . GLY B  1 34  ? 95.497  60.797  -30.782 1.00 31.16  ? 31  GLY B C   1 
ATOM   3953  O O   . GLY B  1 34  ? 95.198  61.951  -30.506 1.00 34.39  ? 31  GLY B O   1 
ATOM   3954  N N   . LYS B  1 35  ? 96.728  60.436  -31.152 1.00 32.15  ? 32  LYS B N   1 
ATOM   3955  C CA  . LYS B  1 35  ? 97.878  61.376  -31.138 1.00 32.01  ? 32  LYS B CA  1 
ATOM   3956  C C   . LYS B  1 35  ? 98.846  60.952  -32.218 1.00 30.22  ? 32  LYS B C   1 
ATOM   3957  O O   . LYS B  1 35  ? 98.646  59.901  -32.812 1.00 29.31  ? 32  LYS B O   1 
ATOM   3958  C CB  . LYS B  1 35  ? 98.583  61.394  -29.765 1.00 34.86  ? 32  LYS B CB  1 
ATOM   3959  C CG  . LYS B  1 35  ? 97.661  61.103  -28.573 1.00 39.60  ? 32  LYS B CG  1 
ATOM   3960  C CD  . LYS B  1 35  ? 98.346  61.121  -27.221 1.00 43.64  ? 32  LYS B CD  1 
ATOM   3961  C CE  . LYS B  1 35  ? 98.668  62.547  -26.785 1.00 47.11  ? 32  LYS B CE  1 
ATOM   3962  N NZ  . LYS B  1 35  ? 99.330  62.580  -25.440 1.00 50.69  ? 32  LYS B NZ  1 
ATOM   3963  N N   . GLN B  1 36  ? 99.874  61.765  -32.473 1.00 30.02  ? 33  GLN B N   1 
ATOM   3964  C CA  . GLN B  1 36  ? 100.929 61.457  -33.475 1.00 31.78  ? 33  GLN B CA  1 
ATOM   3965  C C   . GLN B  1 36  ? 102.251 61.386  -32.787 1.00 27.87  ? 33  GLN B C   1 
ATOM   3966  O O   . GLN B  1 36  ? 102.604 62.280  -32.050 1.00 27.29  ? 33  GLN B O   1 
ATOM   3967  C CB  . GLN B  1 36  ? 101.107 62.558  -34.531 1.00 38.07  ? 33  GLN B CB  1 
ATOM   3968  C CG  . GLN B  1 36  ? 100.042 62.654  -35.610 1.00 43.90  ? 33  GLN B CG  1 
ATOM   3969  C CD  . GLN B  1 36  ? 100.060 61.474  -36.560 1.00 49.03  ? 33  GLN B CD  1 
ATOM   3970  O OE1 . GLN B  1 36  ? 101.083 61.197  -37.191 1.00 52.08  ? 33  GLN B OE1 1 
ATOM   3971  N NE2 . GLN B  1 36  ? 98.927  60.765  -36.670 1.00 52.51  ? 33  GLN B NE2 1 
ATOM   3972  N N   . LEU B  1 37  ? 103.024 60.361  -33.080 1.00 24.65  ? 34  LEU B N   1 
ATOM   3973  C CA  . LEU B  1 37  ? 104.291 60.186  -32.404 1.00 22.59  ? 34  LEU B CA  1 
ATOM   3974  C C   . LEU B  1 37  ? 105.421 60.533  -33.329 1.00 20.39  ? 34  LEU B C   1 
ATOM   3975  O O   . LEU B  1 37  ? 105.615 59.887  -34.351 1.00 18.76  ? 34  LEU B O   1 
ATOM   3976  C CB  . LEU B  1 37  ? 104.460 58.749  -31.923 1.00 22.87  ? 34  LEU B CB  1 
ATOM   3977  C CG  . LEU B  1 37  ? 105.798 58.499  -31.215 1.00 22.96  ? 34  LEU B CG  1 
ATOM   3978  C CD1 . LEU B  1 37  ? 105.848 59.287  -29.913 1.00 23.20  ? 34  LEU B CD1 1 
ATOM   3979  C CD2 . LEU B  1 37  ? 106.020 57.025  -30.965 1.00 22.40  ? 34  LEU B CD2 1 
ATOM   3980  N N   . ASP B  1 38  ? 106.173 61.546  -32.943 1.00 19.47  ? 35  ASP B N   1 
ATOM   3981  C CA  . ASP B  1 38  ? 107.333 61.967  -33.693 1.00 19.54  ? 35  ASP B CA  1 
ATOM   3982  C C   . ASP B  1 38  ? 108.434 60.893  -33.594 1.00 18.91  ? 35  ASP B C   1 
ATOM   3983  O O   . ASP B  1 38  ? 108.744 60.379  -32.527 1.00 17.70  ? 35  ASP B O   1 
ATOM   3984  C CB  . ASP B  1 38  ? 107.795 63.322  -33.186 1.00 19.86  ? 35  ASP B CB  1 
ATOM   3985  C CG  . ASP B  1 38  ? 108.978 63.861  -33.947 1.00 20.75  ? 35  ASP B CG  1 
ATOM   3986  O OD1 . ASP B  1 38  ? 108.988 63.879  -35.201 1.00 21.39  ? 35  ASP B OD1 1 
ATOM   3987  O OD2 . ASP B  1 38  ? 109.912 64.313  -33.263 1.00 21.43  ? 35  ASP B OD2 1 
ATOM   3988  N N   . LEU B  1 39  ? 108.958 60.518  -34.747 1.00 19.06  ? 36  LEU B N   1 
ATOM   3989  C CA  . LEU B  1 39  ? 109.899 59.435  -34.849 1.00 19.40  ? 36  LEU B CA  1 
ATOM   3990  C C   . LEU B  1 39  ? 111.234 60.084  -35.082 1.00 19.69  ? 36  LEU B C   1 
ATOM   3991  O O   . LEU B  1 39  ? 111.387 60.885  -36.008 1.00 20.14  ? 36  LEU B O   1 
ATOM   3992  C CB  . LEU B  1 39  ? 109.527 58.463  -35.986 1.00 19.54  ? 36  LEU B CB  1 
ATOM   3993  C CG  . LEU B  1 39  ? 108.164 57.735  -35.889 1.00 19.22  ? 36  LEU B CG  1 
ATOM   3994  C CD1 . LEU B  1 39  ? 107.912 56.807  -37.056 1.00 18.89  ? 36  LEU B CD1 1 
ATOM   3995  C CD2 . LEU B  1 39  ? 108.042 56.931  -34.610 1.00 19.27  ? 36  LEU B CD2 1 
ATOM   3996  N N   . ALA B  1 40  ? 112.171 59.759  -34.199 1.00 20.02  ? 37  ALA B N   1 
ATOM   3997  C CA  . ALA B  1 40  ? 113.500 60.316  -34.200 1.00 20.92  ? 37  ALA B CA  1 
ATOM   3998  C C   . ALA B  1 40  ? 114.427 59.590  -35.163 1.00 22.09  ? 37  ALA B C   1 
ATOM   3999  O O   . ALA B  1 40  ? 114.353 58.360  -35.352 1.00 22.04  ? 37  ALA B O   1 
ATOM   4000  C CB  . ALA B  1 40  ? 114.084 60.275  -32.798 1.00 21.61  ? 37  ALA B CB  1 
ATOM   4001  N N   . SER B  1 41  ? 115.305 60.398  -35.743 1.00 23.85  ? 38  SER B N   1 
ATOM   4002  C CA  . SER B  1 41  ? 116.283 59.992  -36.740 1.00 26.79  ? 38  SER B CA  1 
ATOM   4003  C C   . SER B  1 41  ? 117.630 59.792  -36.075 1.00 28.71  ? 38  SER B C   1 
ATOM   4004  O O   . SER B  1 41  ? 117.841 60.279  -34.945 1.00 28.68  ? 38  SER B O   1 
ATOM   4005  C CB  . SER B  1 41  ? 116.448 61.106  -37.781 1.00 26.51  ? 38  SER B CB  1 
ATOM   4006  O OG  . SER B  1 41  ? 117.002 62.268  -37.165 1.00 24.55  ? 38  SER B OG  1 
ATOM   4007  N N   . THR B  1 42  ? 118.569 59.159  -36.791 1.00 29.20  ? 39  THR B N   1 
ATOM   4008  C CA  . THR B  1 42  ? 119.882 58.872  -36.177 1.00 30.63  ? 39  THR B CA  1 
ATOM   4009  C C   . THR B  1 42  ? 120.551 60.162  -35.653 1.00 31.55  ? 39  THR B C   1 
ATOM   4010  O O   . THR B  1 42  ? 121.350 60.105  -34.737 1.00 32.04  ? 39  THR B O   1 
ATOM   4011  C CB  . THR B  1 42  ? 120.879 58.091  -37.072 1.00 29.85  ? 39  THR B CB  1 
ATOM   4012  O OG1 . THR B  1 42  ? 121.417 58.960  -38.036 1.00 33.97  ? 39  THR B OG1 1 
ATOM   4013  C CG2 . THR B  1 42  ? 120.248 56.914  -37.798 1.00 30.87  ? 39  THR B CG2 1 
ATOM   4014  N N   . LYS B  1 43  ? 120.192 61.317  -36.219 1.00 33.43  ? 40  LYS B N   1 
ATOM   4015  C CA  . LYS B  1 43  ? 120.716 62.630  -35.782 1.00 33.68  ? 40  LYS B CA  1 
ATOM   4016  C C   . LYS B  1 43  ? 120.046 63.174  -34.522 1.00 30.12  ? 40  LYS B C   1 
ATOM   4017  O O   . LYS B  1 43  ? 120.702 63.814  -33.724 1.00 30.50  ? 40  LYS B O   1 
ATOM   4018  C CB  . LYS B  1 43  ? 120.575 63.669  -36.912 1.00 37.64  ? 40  LYS B CB  1 
ATOM   4019  C CG  . LYS B  1 43  ? 121.123 65.054  -36.588 1.00 39.36  ? 40  LYS B CG  1 
ATOM   4020  C CD  . LYS B  1 43  ? 120.678 66.080  -37.610 1.00 42.19  ? 40  LYS B CD  1 
ATOM   4021  C CE  . LYS B  1 43  ? 121.208 67.461  -37.260 1.00 42.44  ? 40  LYS B CE  1 
ATOM   4022  N NZ  . LYS B  1 43  ? 120.776 68.437  -38.287 1.00 43.36  ? 40  LYS B NZ  1 
ATOM   4023  N N   . THR B  1 44  ? 118.740 62.979  -34.375 1.00 27.56  ? 41  THR B N   1 
ATOM   4024  C CA  . THR B  1 44  ? 118.053 63.332  -33.128 1.00 25.65  ? 41  THR B CA  1 
ATOM   4025  C C   . THR B  1 44  ? 118.537 62.387  -32.015 1.00 25.51  ? 41  THR B C   1 
ATOM   4026  O O   . THR B  1 44  ? 118.867 62.839  -30.924 1.00 23.51  ? 41  THR B O   1 
ATOM   4027  C CB  . THR B  1 44  ? 116.506 63.308  -33.277 1.00 24.26  ? 41  THR B CB  1 
ATOM   4028  O OG1 . THR B  1 44  ? 116.094 64.340  -34.187 1.00 23.68  ? 41  THR B OG1 1 
ATOM   4029  C CG2 . THR B  1 44  ? 115.796 63.544  -31.960 1.00 23.01  ? 41  THR B CG2 1 
ATOM   4030  N N   . VAL B  1 45  ? 118.614 61.087  -32.300 1.00 26.56  ? 42  VAL B N   1 
ATOM   4031  C CA  . VAL B  1 45  ? 119.165 60.132  -31.320 1.00 27.23  ? 42  VAL B CA  1 
ATOM   4032  C C   . VAL B  1 45  ? 120.548 60.632  -30.862 1.00 29.19  ? 42  VAL B C   1 
ATOM   4033  O O   . VAL B  1 45  ? 120.801 60.783  -29.656 1.00 28.52  ? 42  VAL B O   1 
ATOM   4034  C CB  . VAL B  1 45  ? 119.209 58.673  -31.865 1.00 25.65  ? 42  VAL B CB  1 
ATOM   4035  C CG1 . VAL B  1 45  ? 119.935 57.728  -30.915 1.00 24.83  ? 42  VAL B CG1 1 
ATOM   4036  C CG2 . VAL B  1 45  ? 117.798 58.157  -32.096 1.00 24.84  ? 42  VAL B CG2 1 
ATOM   4037  N N   . GLU B  1 46  ? 121.416 60.935  -31.825 1.00 31.38  ? 43  GLU B N   1 
ATOM   4038  C CA  . GLU B  1 46  ? 122.772 61.397  -31.514 1.00 33.18  ? 43  GLU B CA  1 
ATOM   4039  C C   . GLU B  1 46  ? 122.810 62.658  -30.638 1.00 33.37  ? 43  GLU B C   1 
ATOM   4040  O O   . GLU B  1 46  ? 123.730 62.817  -29.841 1.00 32.19  ? 43  GLU B O   1 
ATOM   4041  C CB  . GLU B  1 46  ? 123.572 61.594  -32.800 1.00 35.18  ? 43  GLU B CB  1 
ATOM   4042  C CG  . GLU B  1 46  ? 124.077 60.286  -33.412 1.00 36.90  ? 43  GLU B CG  1 
ATOM   4043  C CD  . GLU B  1 46  ? 124.760 60.484  -34.755 1.00 38.56  ? 43  GLU B CD  1 
ATOM   4044  O OE1 . GLU B  1 46  ? 125.139 59.482  -35.394 1.00 37.85  ? 43  GLU B OE1 1 
ATOM   4045  O OE2 . GLU B  1 46  ? 124.933 61.655  -35.167 1.00 42.55  ? 43  GLU B OE2 1 
ATOM   4046  N N   . GLN B  1 47  ? 121.817 63.539  -30.779 1.00 34.74  ? 44  GLN B N   1 
ATOM   4047  C CA  . GLN B  1 47  ? 121.666 64.690  -29.867 1.00 36.13  ? 44  GLN B CA  1 
ATOM   4048  C C   . GLN B  1 47  ? 121.418 64.265  -28.438 1.00 33.38  ? 44  GLN B C   1 
ATOM   4049  O O   . GLN B  1 47  ? 121.939 64.886  -27.528 1.00 34.61  ? 44  GLN B O   1 
ATOM   4050  C CB  . GLN B  1 47  ? 120.510 65.612  -30.267 1.00 39.87  ? 44  GLN B CB  1 
ATOM   4051  C CG  . GLN B  1 47  ? 120.760 66.485  -31.490 1.00 44.23  ? 44  GLN B CG  1 
ATOM   4052  C CD  . GLN B  1 47  ? 119.559 67.380  -31.825 1.00 48.01  ? 44  GLN B CD  1 
ATOM   4053  O OE1 . GLN B  1 47  ? 118.630 67.563  -30.993 1.00 42.21  ? 44  GLN B OE1 1 
ATOM   4054  N NE2 . GLN B  1 47  ? 119.566 67.945  -33.056 1.00 47.61  ? 44  GLN B NE2 1 
ATOM   4055  N N   . ALA B  1 48  ? 120.592 63.233  -28.257 1.00 31.40  ? 45  ALA B N   1 
ATOM   4056  C CA  . ALA B  1 48  ? 120.315 62.647  -26.934 1.00 28.39  ? 45  ALA B CA  1 
ATOM   4057  C C   . ALA B  1 48  ? 121.553 61.992  -26.319 1.00 26.21  ? 45  ALA B C   1 
ATOM   4058  O O   . ALA B  1 48  ? 121.874 62.235  -25.168 1.00 26.32  ? 45  ALA B O   1 
ATOM   4059  C CB  . ALA B  1 48  ? 119.170 61.652  -27.018 1.00 27.81  ? 45  ALA B CB  1 
ATOM   4060  N N   . ILE B  1 49  ? 122.263 61.187  -27.091 1.00 23.81  ? 46  ILE B N   1 
ATOM   4061  C CA  . ILE B  1 49  ? 123.527 60.604  -26.617 1.00 22.78  ? 46  ILE B CA  1 
ATOM   4062  C C   . ILE B  1 49  ? 124.503 61.740  -26.252 1.00 22.47  ? 46  ILE B C   1 
ATOM   4063  O O   . ILE B  1 49  ? 125.164 61.689  -25.221 1.00 22.71  ? 46  ILE B O   1 
ATOM   4064  C CB  . ILE B  1 49  ? 124.153 59.626  -27.676 1.00 21.76  ? 46  ILE B CB  1 
ATOM   4065  C CG1 . ILE B  1 49  ? 123.249 58.409  -27.895 1.00 20.97  ? 46  ILE B CG1 1 
ATOM   4066  C CG2 . ILE B  1 49  ? 125.543 59.126  -27.269 1.00 21.15  ? 46  ILE B CG2 1 
ATOM   4067  C CD1 . ILE B  1 49  ? 123.517 57.681  -29.190 1.00 21.05  ? 46  ILE B CD1 1 
ATOM   4068  N N   . SER B  1 50  ? 124.582 62.764  -27.097 1.00 22.76  ? 47  SER B N   1 
ATOM   4069  C CA  . SER B  1 50  ? 125.513 63.874  -26.869 1.00 23.09  ? 47  SER B CA  1 
ATOM   4070  C C   . SER B  1 50  ? 125.207 64.553  -25.564 1.00 22.06  ? 47  SER B C   1 
ATOM   4071  O O   . SER B  1 50  ? 126.129 64.922  -24.834 1.00 22.13  ? 47  SER B O   1 
ATOM   4072  C CB  . SER B  1 50  ? 125.475 64.922  -27.999 1.00 24.25  ? 47  SER B CB  1 
ATOM   4073  O OG  . SER B  1 50  ? 126.154 64.489  -29.170 1.00 25.08  ? 47  SER B OG  1 
ATOM   4074  N N   . ALA B  1 51  ? 123.912 64.713  -25.287 1.00 21.16  ? 48  ALA B N   1 
ATOM   4075  C CA  . ALA B  1 51  ? 123.442 65.322  -24.042 1.00 20.67  ? 48  ALA B CA  1 
ATOM   4076  C C   . ALA B  1 51  ? 123.782 64.469  -22.833 1.00 20.92  ? 48  ALA B C   1 
ATOM   4077  O O   . ALA B  1 51  ? 124.130 64.994  -21.795 1.00 20.38  ? 48  ALA B O   1 
ATOM   4078  C CB  . ALA B  1 51  ? 121.955 65.566  -24.105 1.00 20.43  ? 48  ALA B CB  1 
ATOM   4079  N N   . ALA B  1 52  ? 123.669 63.150  -22.988 1.00 21.98  ? 49  ALA B N   1 
ATOM   4080  C CA  . ALA B  1 52  ? 124.047 62.175  -21.956 1.00 22.19  ? 49  ALA B CA  1 
ATOM   4081  C C   . ALA B  1 52  ? 125.548 62.144  -21.719 1.00 22.50  ? 49  ALA B C   1 
ATOM   4082  O O   . ALA B  1 52  ? 126.008 62.161  -20.565 1.00 23.17  ? 49  ALA B O   1 
ATOM   4083  C CB  . ALA B  1 52  ? 123.571 60.780  -22.350 1.00 22.57  ? 49  ALA B CB  1 
ATOM   4084  N N   . GLN B  1 53  ? 126.307 62.052  -22.806 1.00 21.85  ? 50  GLN B N   1 
ATOM   4085  C CA  . GLN B  1 53  ? 127.752 62.061  -22.706 1.00 22.63  ? 50  GLN B CA  1 
ATOM   4086  C C   . GLN B  1 53  ? 128.260 63.336  -22.029 1.00 23.29  ? 50  GLN B C   1 
ATOM   4087  O O   . GLN B  1 53  ? 129.203 63.301  -21.253 1.00 22.30  ? 50  GLN B O   1 
ATOM   4088  C CB  . GLN B  1 53  ? 128.380 61.917  -24.088 1.00 23.14  ? 50  GLN B CB  1 
ATOM   4089  C CG  . GLN B  1 53  ? 129.872 61.616  -24.052 1.00 23.10  ? 50  GLN B CG  1 
ATOM   4090  C CD  . GLN B  1 53  ? 130.173 60.289  -23.386 1.00 23.18  ? 50  GLN B CD  1 
ATOM   4091  O OE1 . GLN B  1 53  ? 129.872 59.222  -23.931 1.00 22.62  ? 50  GLN B OE1 1 
ATOM   4092  N NE2 . GLN B  1 53  ? 130.766 60.345  -22.199 1.00 23.54  ? 50  GLN B NE2 1 
ATOM   4093  N N   . HIS B  1 54  ? 127.619 64.460  -22.331 1.00 25.23  ? 51  HIS B N   1 
ATOM   4094  C CA  . HIS B  1 54  ? 127.992 65.743  -21.757 1.00 26.13  ? 51  HIS B CA  1 
ATOM   4095  C C   . HIS B  1 54  ? 127.703 65.834  -20.227 1.00 25.10  ? 51  HIS B C   1 
ATOM   4096  O O   . HIS B  1 54  ? 128.458 66.447  -19.471 1.00 24.89  ? 51  HIS B O   1 
ATOM   4097  C CB  . HIS B  1 54  ? 127.312 66.872  -22.536 1.00 28.03  ? 51  HIS B CB  1 
ATOM   4098  C CG  . HIS B  1 54  ? 127.779 68.224  -22.122 1.00 32.12  ? 51  HIS B CG  1 
ATOM   4099  N ND1 . HIS B  1 54  ? 129.059 68.673  -22.373 1.00 33.52  ? 51  HIS B ND1 1 
ATOM   4100  C CD2 . HIS B  1 54  ? 127.163 69.203  -21.414 1.00 34.24  ? 51  HIS B CD2 1 
ATOM   4101  C CE1 . HIS B  1 54  ? 129.208 69.878  -21.850 1.00 34.92  ? 51  HIS B CE1 1 
ATOM   4102  N NE2 . HIS B  1 54  ? 128.074 70.219  -21.258 1.00 35.91  ? 51  HIS B NE2 1 
ATOM   4103  N N   . ALA B  1 55  ? 126.631 65.189  -19.783 1.00 23.87  ? 52  ALA B N   1 
ATOM   4104  C CA  . ALA B  1 55  ? 126.214 65.214  -18.380 1.00 23.25  ? 52  ALA B CA  1 
ATOM   4105  C C   . ALA B  1 55  ? 126.926 64.185  -17.504 1.00 23.67  ? 52  ALA B C   1 
ATOM   4106  O O   . ALA B  1 55  ? 126.866 64.264  -16.263 1.00 22.98  ? 52  ALA B O   1 
ATOM   4107  C CB  . ALA B  1 55  ? 124.724 64.960  -18.303 1.00 23.03  ? 52  ALA B CB  1 
ATOM   4108  N N   . PHE B  1 56  ? 127.570 63.209  -18.144 1.00 22.25  ? 53  PHE B N   1 
ATOM   4109  C CA  . PHE B  1 56  ? 128.100 62.064  -17.443 1.00 21.48  ? 53  PHE B CA  1 
ATOM   4110  C C   . PHE B  1 56  ? 129.284 62.358  -16.511 1.00 21.14  ? 53  PHE B C   1 
ATOM   4111  O O   . PHE B  1 56  ? 129.269 61.909  -15.380 1.00 22.49  ? 53  PHE B O   1 
ATOM   4112  C CB  . PHE B  1 56  ? 128.456 60.963  -18.445 1.00 21.86  ? 53  PHE B CB  1 
ATOM   4113  C CG  . PHE B  1 56  ? 129.226 59.820  -17.845 1.00 21.24  ? 53  PHE B CG  1 
ATOM   4114  C CD1 . PHE B  1 56  ? 128.594 58.919  -17.015 1.00 20.94  ? 53  PHE B CD1 1 
ATOM   4115  C CD2 . PHE B  1 56  ? 130.567 59.656  -18.111 1.00 20.76  ? 53  PHE B CD2 1 
ATOM   4116  C CE1 . PHE B  1 56  ? 129.291 57.885  -16.454 1.00 20.82  ? 53  PHE B CE1 1 
ATOM   4117  C CE2 . PHE B  1 56  ? 131.264 58.605  -17.570 1.00 20.59  ? 53  PHE B CE2 1 
ATOM   4118  C CZ  . PHE B  1 56  ? 130.628 57.729  -16.736 1.00 20.81  ? 53  PHE B CZ  1 
ATOM   4119  N N   . PRO B  1 57  ? 130.306 63.101  -16.967 1.00 20.03  ? 54  PRO B N   1 
ATOM   4120  C CA  . PRO B  1 57  ? 131.450 63.312  -16.073 1.00 19.23  ? 54  PRO B CA  1 
ATOM   4121  C C   . PRO B  1 57  ? 131.112 63.848  -14.656 1.00 18.29  ? 54  PRO B C   1 
ATOM   4122  O O   . PRO B  1 57  ? 131.616 63.312  -13.671 1.00 16.99  ? 54  PRO B O   1 
ATOM   4123  C CB  . PRO B  1 57  ? 132.326 64.294  -16.852 1.00 19.39  ? 54  PRO B CB  1 
ATOM   4124  C CG  . PRO B  1 57  ? 131.999 64.010  -18.282 1.00 20.17  ? 54  PRO B CG  1 
ATOM   4125  C CD  . PRO B  1 57  ? 130.527 63.709  -18.290 1.00 20.05  ? 54  PRO B CD  1 
ATOM   4126  N N   . THR B  1 58  ? 130.264 64.862  -14.535 1.00 17.64  ? 55  THR B N   1 
ATOM   4127  C CA  . THR B  1 58  ? 129.936 65.347  -13.186 1.00 18.33  ? 55  THR B CA  1 
ATOM   4128  C C   . THR B  1 58  ? 128.982 64.423  -12.435 1.00 18.83  ? 55  THR B C   1 
ATOM   4129  O O   . THR B  1 58  ? 129.026 64.342  -11.203 1.00 19.06  ? 55  THR B O   1 
ATOM   4130  C CB  . THR B  1 58  ? 129.332 66.764  -13.128 1.00 18.16  ? 55  THR B CB  1 
ATOM   4131  O OG1 . THR B  1 58  ? 128.023 66.742  -13.674 1.00 18.84  ? 55  THR B OG1 1 
ATOM   4132  C CG2 . THR B  1 58  ? 130.200 67.760  -13.859 1.00 18.33  ? 55  THR B CG2 1 
ATOM   4133  N N   . TRP B  1 59  ? 128.113 63.744  -13.180 1.00 19.16  ? 56  TRP B N   1 
ATOM   4134  C CA  . TRP B  1 59  ? 127.173 62.788  -12.598 1.00 18.15  ? 56  TRP B CA  1 
ATOM   4135  C C   . TRP B  1 59  ? 127.896 61.534  -12.085 1.00 19.68  ? 56  TRP B C   1 
ATOM   4136  O O   . TRP B  1 59  ? 127.526 60.997  -11.042 1.00 19.95  ? 56  TRP B O   1 
ATOM   4137  C CB  . TRP B  1 59  ? 126.085 62.427  -13.607 1.00 16.37  ? 56  TRP B CB  1 
ATOM   4138  C CG  . TRP B  1 59  ? 125.032 61.595  -13.025 1.00 15.14  ? 56  TRP B CG  1 
ATOM   4139  C CD1 . TRP B  1 59  ? 124.744 60.317  -13.343 1.00 14.95  ? 56  TRP B CD1 1 
ATOM   4140  C CD2 . TRP B  1 59  ? 124.133 61.961  -11.982 1.00 14.78  ? 56  TRP B CD2 1 
ATOM   4141  N NE1 . TRP B  1 59  ? 123.704 59.854  -12.577 1.00 14.53  ? 56  TRP B NE1 1 
ATOM   4142  C CE2 . TRP B  1 59  ? 123.313 60.840  -11.727 1.00 14.23  ? 56  TRP B CE2 1 
ATOM   4143  C CE3 . TRP B  1 59  ? 123.931 63.136  -11.241 1.00 14.59  ? 56  TRP B CE3 1 
ATOM   4144  C CZ2 . TRP B  1 59  ? 122.319 60.844  -10.773 1.00 14.31  ? 56  TRP B CZ2 1 
ATOM   4145  C CZ3 . TRP B  1 59  ? 122.934 63.143  -10.277 1.00 14.35  ? 56  TRP B CZ3 1 
ATOM   4146  C CH2 . TRP B  1 59  ? 122.139 62.002  -10.052 1.00 14.52  ? 56  TRP B CH2 1 
ATOM   4147  N N   . ARG B  1 60  ? 128.914 61.088  -12.823 1.00 21.04  ? 57  ARG B N   1 
ATOM   4148  C CA  . ARG B  1 60  ? 129.768 59.953  -12.444 1.00 23.18  ? 57  ARG B CA  1 
ATOM   4149  C C   . ARG B  1 60  ? 130.442 60.167  -11.067 1.00 24.82  ? 57  ARG B C   1 
ATOM   4150  O O   . ARG B  1 60  ? 130.574 59.229  -10.274 1.00 25.45  ? 57  ARG B O   1 
ATOM   4151  C CB  . ARG B  1 60  ? 130.840 59.739  -13.536 1.00 23.85  ? 57  ARG B CB  1 
ATOM   4152  C CG  . ARG B  1 60  ? 131.888 58.674  -13.239 1.00 24.25  ? 57  ARG B CG  1 
ATOM   4153  C CD  . ARG B  1 60  ? 133.072 58.724  -14.185 1.00 24.97  ? 57  ARG B CD  1 
ATOM   4154  N NE  . ARG B  1 60  ? 134.284 58.751  -13.372 1.00 27.00  ? 57  ARG B NE  1 
ATOM   4155  C CZ  . ARG B  1 60  ? 135.055 57.707  -13.071 1.00 28.40  ? 57  ARG B CZ  1 
ATOM   4156  N NH1 . ARG B  1 60  ? 134.813 56.492  -13.545 1.00 29.96  ? 57  ARG B NH1 1 
ATOM   4157  N NH2 . ARG B  1 60  ? 136.101 57.884  -12.286 1.00 29.70  ? 57  ARG B NH2 1 
ATOM   4158  N N   . ASN B  1 61  ? 130.864 61.403  -10.797 1.00 25.10  ? 58  ASN B N   1 
ATOM   4159  C CA  . ASN B  1 61  ? 131.588 61.718  -9.574  1.00 25.03  ? 58  ASN B CA  1 
ATOM   4160  C C   . ASN B  1 61  ? 130.683 62.183  -8.437  1.00 23.75  ? 58  ASN B C   1 
ATOM   4161  O O   . ASN B  1 61  ? 131.165 62.465  -7.338  1.00 22.92  ? 58  ASN B O   1 
ATOM   4162  C CB  . ASN B  1 61  ? 132.687 62.749  -9.864  1.00 26.10  ? 58  ASN B CB  1 
ATOM   4163  C CG  . ASN B  1 61  ? 133.891 62.144  -10.583 1.00 27.73  ? 58  ASN B CG  1 
ATOM   4164  O OD1 . ASN B  1 61  ? 133.959 60.944  -10.853 1.00 29.87  ? 58  ASN B OD1 1 
ATOM   4165  N ND2 . ASN B  1 61  ? 134.850 62.982  -10.893 1.00 29.28  ? 58  ASN B ND2 1 
ATOM   4166  N N   . THR B  1 62  ? 129.381 62.251  -8.706  1.00 22.61  ? 59  THR B N   1 
ATOM   4167  C CA  . THR B  1 62  ? 128.375 62.637  -7.726  1.00 21.23  ? 59  THR B CA  1 
ATOM   4168  C C   . THR B  1 62  ? 128.215 61.512  -6.727  1.00 21.93  ? 59  THR B C   1 
ATOM   4169  O O   . THR B  1 62  ? 127.985 60.369  -7.133  1.00 23.08  ? 59  THR B O   1 
ATOM   4170  C CB  . THR B  1 62  ? 126.997 62.817  -8.378  1.00 20.91  ? 59  THR B CB  1 
ATOM   4171  O OG1 . THR B  1 62  ? 127.092 63.711  -9.486  1.00 21.52  ? 59  THR B OG1 1 
ATOM   4172  C CG2 . THR B  1 62  ? 125.991 63.372  -7.396  1.00 20.88  ? 59  THR B CG2 1 
ATOM   4173  N N   . PRO B  1 63  ? 128.312 61.819  -5.412  1.00 21.91  ? 60  PRO B N   1 
ATOM   4174  C CA  . PRO B  1 63  ? 128.152 60.794  -4.373  1.00 21.27  ? 60  PRO B CA  1 
ATOM   4175  C C   . PRO B  1 63  ? 126.861 59.982  -4.518  1.00 20.99  ? 60  PRO B C   1 
ATOM   4176  O O   . PRO B  1 63  ? 125.813 60.545  -4.828  1.00 20.63  ? 60  PRO B O   1 
ATOM   4177  C CB  . PRO B  1 63  ? 128.126 61.613  -3.082  1.00 21.20  ? 60  PRO B CB  1 
ATOM   4178  C CG  . PRO B  1 63  ? 128.979 62.778  -3.387  1.00 21.20  ? 60  PRO B CG  1 
ATOM   4179  C CD  . PRO B  1 63  ? 128.689 63.117  -4.820  1.00 21.65  ? 60  PRO B CD  1 
ATOM   4180  N N   . PRO B  1 64  ? 126.937 58.665  -4.314  1.00 20.88  ? 61  PRO B N   1 
ATOM   4181  C CA  . PRO B  1 64  ? 125.764 57.792  -4.451  1.00 21.19  ? 61  PRO B CA  1 
ATOM   4182  C C   . PRO B  1 64  ? 124.572 58.200  -3.589  1.00 21.09  ? 61  PRO B C   1 
ATOM   4183  O O   . PRO B  1 64  ? 123.435 57.967  -3.959  1.00 20.59  ? 61  PRO B O   1 
ATOM   4184  C CB  . PRO B  1 64  ? 126.285 56.428  -4.000  1.00 21.44  ? 61  PRO B CB  1 
ATOM   4185  C CG  . PRO B  1 64  ? 127.754 56.472  -4.269  1.00 21.98  ? 61  PRO B CG  1 
ATOM   4186  C CD  . PRO B  1 64  ? 128.191 57.904  -4.204  1.00 21.67  ? 61  PRO B CD  1 
ATOM   4187  N N   . LEU B  1 65  ? 124.847 58.768  -2.428  1.00 21.83  ? 62  LEU B N   1 
ATOM   4188  C CA  . LEU B  1 65  ? 123.805 59.312  -1.556  1.00 22.41  ? 62  LEU B CA  1 
ATOM   4189  C C   . LEU B  1 65  ? 123.001 60.417  -2.207  1.00 22.50  ? 62  LEU B C   1 
ATOM   4190  O O   . LEU B  1 65  ? 121.793 60.449  -2.061  1.00 23.07  ? 62  LEU B O   1 
ATOM   4191  C CB  . LEU B  1 65  ? 124.425 59.906  -0.302  1.00 22.85  ? 62  LEU B CB  1 
ATOM   4192  C CG  . LEU B  1 65  ? 124.447 58.969  0.871   1.00 23.88  ? 62  LEU B CG  1 
ATOM   4193  C CD1 . LEU B  1 65  ? 125.583 59.336  1.846   1.00 25.05  ? 62  LEU B CD1 1 
ATOM   4194  C CD2 . LEU B  1 65  ? 123.049 59.033  1.480   1.00 24.08  ? 62  LEU B CD2 1 
ATOM   4195  N N   . LYS B  1 66  ? 123.698 61.334  -2.879  1.00 21.59  ? 63  LYS B N   1 
ATOM   4196  C CA  . LYS B  1 66  ? 123.075 62.440  -3.574  1.00 21.37  ? 63  LYS B CA  1 
ATOM   4197  C C   . LYS B  1 66  ? 122.320 61.926  -4.800  1.00 20.16  ? 63  LYS B C   1 
ATOM   4198  O O   . LYS B  1 66  ? 121.235 62.404  -5.096  1.00 20.10  ? 63  LYS B O   1 
ATOM   4199  C CB  . LYS B  1 66  ? 124.125 63.495  -3.998  1.00 22.56  ? 63  LYS B CB  1 
ATOM   4200  C CG  . LYS B  1 66  ? 123.508 64.804  -4.486  1.00 22.86  ? 63  LYS B CG  1 
ATOM   4201  C CD  . LYS B  1 66  ? 124.534 65.835  -4.918  1.00 23.38  ? 63  LYS B CD  1 
ATOM   4202  C CE  . LYS B  1 66  ? 123.862 67.205  -5.100  1.00 24.38  ? 63  LYS B CE  1 
ATOM   4203  N NZ  . LYS B  1 66  ? 124.764 68.313  -5.546  1.00 24.59  ? 63  LYS B NZ  1 
ATOM   4204  N N   . ARG B  1 67  ? 122.896 60.968  -5.522  1.00 18.76  ? 64  ARG B N   1 
ATOM   4205  C CA  . ARG B  1 67  ? 122.207 60.374  -6.666  1.00 17.71  ? 64  ARG B CA  1 
ATOM   4206  C C   . ARG B  1 67  ? 120.917 59.728  -6.188  1.00 17.61  ? 64  ARG B C   1 
ATOM   4207  O O   . ARG B  1 67  ? 119.870 59.867  -6.798  1.00 17.53  ? 64  ARG B O   1 
ATOM   4208  C CB  . ARG B  1 67  ? 123.088 59.346  -7.390  1.00 17.48  ? 64  ARG B CB  1 
ATOM   4209  C CG  . ARG B  1 67  ? 124.373 59.913  -7.998  1.00 17.74  ? 64  ARG B CG  1 
ATOM   4210  C CD  . ARG B  1 67  ? 124.946 59.068  -9.135  1.00 17.67  ? 64  ARG B CD  1 
ATOM   4211  N NE  . ARG B  1 67  ? 125.487 57.770  -8.698  1.00 17.18  ? 64  ARG B NE  1 
ATOM   4212  C CZ  . ARG B  1 67  ? 126.777 57.395  -8.721  1.00 17.54  ? 64  ARG B CZ  1 
ATOM   4213  N NH1 . ARG B  1 67  ? 127.749 58.189  -9.167  1.00 17.13  ? 64  ARG B NH1 1 
ATOM   4214  N NH2 . ARG B  1 67  ? 127.114 56.173  -8.295  1.00 18.25  ? 64  ARG B NH2 1 
ATOM   4215  N N   . ALA B  1 68  ? 120.986 59.037  -5.066  1.00 17.90  ? 65  ALA B N   1 
ATOM   4216  C CA  . ALA B  1 68  ? 119.847 58.282  -4.572  1.00 18.20  ? 65  ALA B CA  1 
ATOM   4217  C C   . ALA B  1 68  ? 118.718 59.185  -4.107  1.00 18.60  ? 65  ALA B C   1 
ATOM   4218  O O   . ALA B  1 68  ? 117.539 58.848  -4.196  1.00 18.08  ? 65  ALA B O   1 
ATOM   4219  C CB  . ALA B  1 68  ? 120.293 57.381  -3.444  1.00 18.92  ? 65  ALA B CB  1 
ATOM   4220  N N   . ARG B  1 69  ? 119.085 60.346  -3.600  1.00 19.88  ? 66  ARG B N   1 
ATOM   4221  C CA  . ARG B  1 69  ? 118.101 61.285  -3.103  1.00 20.33  ? 66  ARG B CA  1 
ATOM   4222  C C   . ARG B  1 69  ? 117.146 61.763  -4.215  1.00 19.55  ? 66  ARG B C   1 
ATOM   4223  O O   . ARG B  1 69  ? 115.986 62.098  -3.940  1.00 18.38  ? 66  ARG B O   1 
ATOM   4224  C CB  . ARG B  1 69  ? 118.796 62.440  -2.394  1.00 21.93  ? 66  ARG B CB  1 
ATOM   4225  C CG  . ARG B  1 69  ? 119.315 62.093  -1.001  1.00 24.21  ? 66  ARG B CG  1 
ATOM   4226  C CD  . ARG B  1 69  ? 119.681 63.349  -0.224  1.00 27.29  ? 66  ARG B CD  1 
ATOM   4227  N NE  . ARG B  1 69  ? 121.051 63.306  0.305   1.00 29.81  ? 66  ARG B NE  1 
ATOM   4228  C CZ  . ARG B  1 69  ? 121.421 62.749  1.455   1.00 30.27  ? 66  ARG B CZ  1 
ATOM   4229  N NH1 . ARG B  1 69  ? 120.540 62.148  2.233   1.00 29.14  ? 66  ARG B NH1 1 
ATOM   4230  N NH2 . ARG B  1 69  ? 122.699 62.787  1.822   1.00 33.19  ? 66  ARG B NH2 1 
ATOM   4231  N N   . VAL B  1 70  ? 117.623 61.760  -5.462  1.00 18.91  ? 67  VAL B N   1 
ATOM   4232  C CA  . VAL B  1 70  ? 116.760 62.037  -6.617  1.00 18.33  ? 67  VAL B CA  1 
ATOM   4233  C C   . VAL B  1 70  ? 115.669 60.981  -6.664  1.00 18.43  ? 67  VAL B C   1 
ATOM   4234  O O   . VAL B  1 70  ? 114.498 61.313  -6.753  1.00 18.02  ? 67  VAL B O   1 
ATOM   4235  C CB  . VAL B  1 70  ? 117.542 62.034  -7.947  1.00 18.24  ? 67  VAL B CB  1 
ATOM   4236  C CG1 . VAL B  1 70  ? 116.630 62.267  -9.136  1.00 18.04  ? 67  VAL B CG1 1 
ATOM   4237  C CG2 . VAL B  1 70  ? 118.612 63.114  -7.944  1.00 18.62  ? 67  VAL B CG2 1 
ATOM   4238  N N   . MET B  1 71  ? 116.052 59.710  -6.560  1.00 18.45  ? 68  MET B N   1 
ATOM   4239  C CA  . MET B  1 71  ? 115.064 58.626  -6.582  1.00 18.32  ? 68  MET B CA  1 
ATOM   4240  C C   . MET B  1 71  ? 114.131 58.718  -5.383  1.00 18.29  ? 68  MET B C   1 
ATOM   4241  O O   . MET B  1 71  ? 112.953 58.361  -5.481  1.00 17.59  ? 68  MET B O   1 
ATOM   4242  C CB  . MET B  1 71  ? 115.705 57.233  -6.638  1.00 18.13  ? 68  MET B CB  1 
ATOM   4243  C CG  . MET B  1 71  ? 116.737 57.042  -7.738  1.00 18.79  ? 68  MET B CG  1 
ATOM   4244  S SD  . MET B  1 71  ? 116.263 57.665  -9.374  1.00 19.62  ? 68  MET B SD  1 
ATOM   4245  C CE  . MET B  1 71  ? 114.845 56.646  -9.579  1.00 19.53  ? 68  MET B CE  1 
ATOM   4246  N N   . PHE B  1 72  ? 114.627 59.192  -4.248  1.00 18.66  ? 69  PHE B N   1 
ATOM   4247  C CA  . PHE B  1 72  ? 113.713 59.406  -3.098  1.00 19.42  ? 69  PHE B CA  1 
ATOM   4248  C C   . PHE B  1 72  ? 112.546 60.352  -3.474  1.00 20.27  ? 69  PHE B C   1 
ATOM   4249  O O   . PHE B  1 72  ? 111.388 60.094  -3.125  1.00 18.96  ? 69  PHE B O   1 
ATOM   4250  C CB  . PHE B  1 72  ? 114.453 59.918  -1.820  1.00 18.56  ? 69  PHE B CB  1 
ATOM   4251  C CG  . PHE B  1 72  ? 114.993 58.823  -0.940  1.00 17.18  ? 69  PHE B CG  1 
ATOM   4252  C CD1 . PHE B  1 72  ? 114.145 58.085  -0.137  1.00 16.34  ? 69  PHE B CD1 1 
ATOM   4253  C CD2 . PHE B  1 72  ? 116.346 58.542  -0.913  1.00 16.58  ? 69  PHE B CD2 1 
ATOM   4254  C CE1 . PHE B  1 72  ? 114.636 57.076  0.660   1.00 15.83  ? 69  PHE B CE1 1 
ATOM   4255  C CE2 . PHE B  1 72  ? 116.831 57.540  -0.110  1.00 16.34  ? 69  PHE B CE2 1 
ATOM   4256  C CZ  . PHE B  1 72  ? 115.972 56.802  0.674   1.00 15.86  ? 69  PHE B CZ  1 
ATOM   4257  N N   . ARG B  1 73  ? 112.887 61.437  -4.176  1.00 21.99  ? 70  ARG B N   1 
ATOM   4258  C CA  . ARG B  1 73  ? 111.923 62.458  -4.594  1.00 23.45  ? 70  ARG B CA  1 
ATOM   4259  C C   . ARG B  1 73  ? 111.064 61.956  -5.745  1.00 22.84  ? 70  ARG B C   1 
ATOM   4260  O O   . ARG B  1 73  ? 109.889 62.309  -5.866  1.00 23.08  ? 70  ARG B O   1 
ATOM   4261  C CB  . ARG B  1 73  ? 112.642 63.745  -5.011  1.00 25.92  ? 70  ARG B CB  1 
ATOM   4262  C CG  . ARG B  1 73  ? 113.033 64.656  -3.845  1.00 28.98  ? 70  ARG B CG  1 
ATOM   4263  C CD  . ARG B  1 73  ? 113.957 65.816  -4.282  1.00 31.92  ? 70  ARG B CD  1 
ATOM   4264  N NE  . ARG B  1 73  ? 115.249 65.837  -3.555  1.00 33.91  ? 70  ARG B NE  1 
ATOM   4265  C CZ  . ARG B  1 73  ? 116.479 65.684  -4.084  1.00 33.11  ? 70  ARG B CZ  1 
ATOM   4266  N NH1 . ARG B  1 73  ? 116.685 65.525  -5.392  1.00 31.57  ? 70  ARG B NH1 1 
ATOM   4267  N NH2 . ARG B  1 73  ? 117.542 65.710  -3.274  1.00 33.21  ? 70  ARG B NH2 1 
ATOM   4268  N N   . PHE B  1 74  ? 111.672 61.137  -6.596  1.00 21.86  ? 71  PHE B N   1 
ATOM   4269  C CA  . PHE B  1 74  ? 110.993 60.545  -7.726  1.00 20.02  ? 71  PHE B CA  1 
ATOM   4270  C C   . PHE B  1 74  ? 109.898 59.625  -7.277  1.00 20.36  ? 71  PHE B C   1 
ATOM   4271  O O   . PHE B  1 74  ? 108.876 59.536  -7.898  1.00 21.04  ? 71  PHE B O   1 
ATOM   4272  C CB  . PHE B  1 74  ? 111.990 59.753  -8.554  1.00 19.29  ? 71  PHE B CB  1 
ATOM   4273  C CG  . PHE B  1 74  ? 111.475 59.341  -9.906  1.00 18.59  ? 71  PHE B CG  1 
ATOM   4274  C CD1 . PHE B  1 74  ? 110.646 60.184  -10.641 1.00 17.70  ? 71  PHE B CD1 1 
ATOM   4275  C CD2 . PHE B  1 74  ? 111.859 58.130  -10.470 1.00 17.75  ? 71  PHE B CD2 1 
ATOM   4276  C CE1 . PHE B  1 74  ? 110.201 59.826  -11.881 1.00 16.77  ? 71  PHE B CE1 1 
ATOM   4277  C CE2 . PHE B  1 74  ? 111.404 57.765  -11.722 1.00 17.38  ? 71  PHE B CE2 1 
ATOM   4278  C CZ  . PHE B  1 74  ? 110.580 58.623  -12.422 1.00 17.14  ? 71  PHE B CZ  1 
ATOM   4279  N N   . LYS B  1 75  ? 110.145 58.915  -6.195  1.00 22.16  ? 72  LYS B N   1 
ATOM   4280  C CA  . LYS B  1 75  ? 109.188 57.986  -5.616  1.00 23.08  ? 72  LYS B CA  1 
ATOM   4281  C C   . LYS B  1 75  ? 107.940 58.717  -5.155  1.00 25.02  ? 72  LYS B C   1 
ATOM   4282  O O   . LYS B  1 75  ? 106.839 58.260  -5.372  1.00 24.91  ? 72  LYS B O   1 
ATOM   4283  C CB  . LYS B  1 75  ? 109.856 57.299  -4.433  1.00 23.22  ? 72  LYS B CB  1 
ATOM   4284  C CG  . LYS B  1 75  ? 109.112 56.112  -3.872  1.00 23.40  ? 72  LYS B CG  1 
ATOM   4285  C CD  . LYS B  1 75  ? 109.261 56.082  -2.363  1.00 23.30  ? 72  LYS B CD  1 
ATOM   4286  C CE  . LYS B  1 75  ? 108.514 54.920  -1.778  1.00 23.57  ? 72  LYS B CE  1 
ATOM   4287  N NZ  . LYS B  1 75  ? 107.065 55.176  -1.807  1.00 24.68  ? 72  LYS B NZ  1 
ATOM   4288  N N   . GLU B  1 76  ? 108.138 59.861  -4.502  1.00 29.13  ? 73  GLU B N   1 
ATOM   4289  C CA  . GLU B  1 76  ? 107.044 60.734  -4.017  1.00 30.51  ? 73  GLU B CA  1 
ATOM   4290  C C   . GLU B  1 76  ? 106.164 61.227  -5.164  1.00 27.46  ? 73  GLU B C   1 
ATOM   4291  O O   . GLU B  1 76  ? 104.948 61.287  -5.055  1.00 26.02  ? 73  GLU B O   1 
ATOM   4292  C CB  . GLU B  1 76  ? 107.621 61.967  -3.305  1.00 35.53  ? 73  GLU B CB  1 
ATOM   4293  C CG  . GLU B  1 76  ? 107.876 61.875  -1.795  1.00 40.88  ? 73  GLU B CG  1 
ATOM   4294  C CD  . GLU B  1 76  ? 108.871 62.978  -1.278  1.00 47.76  ? 73  GLU B CD  1 
ATOM   4295  O OE1 . GLU B  1 76  ? 109.435 63.775  -2.079  1.00 50.26  ? 73  GLU B OE1 1 
ATOM   4296  O OE2 . GLU B  1 76  ? 109.131 63.070  -0.049  1.00 51.26  ? 73  GLU B OE2 1 
ATOM   4297  N N   . LEU B  1 77  ? 106.818 61.612  -6.251  1.00 25.52  ? 74  LEU B N   1 
ATOM   4298  C CA  . LEU B  1 77  ? 106.160 62.167  -7.433  1.00 23.96  ? 74  LEU B CA  1 
ATOM   4299  C C   . LEU B  1 77  ? 105.342 61.149  -8.202  1.00 23.79  ? 74  LEU B C   1 
ATOM   4300  O O   . LEU B  1 77  ? 104.229 61.435  -8.648  1.00 23.05  ? 74  LEU B O   1 
ATOM   4301  C CB  . LEU B  1 77  ? 107.209 62.760  -8.369  1.00 22.77  ? 74  LEU B CB  1 
ATOM   4302  C CG  . LEU B  1 77  ? 107.857 63.999  -7.767  1.00 22.58  ? 74  LEU B CG  1 
ATOM   4303  C CD1 . LEU B  1 77  ? 109.068 64.423  -8.565  1.00 22.73  ? 74  LEU B CD1 1 
ATOM   4304  C CD2 . LEU B  1 77  ? 106.848 65.130  -7.698  1.00 22.08  ? 74  LEU B CD2 1 
ATOM   4305  N N   . LEU B  1 78  ? 105.900 59.960  -8.365  1.00 22.65  ? 75  LEU B N   1 
ATOM   4306  C CA  . LEU B  1 78  ? 105.216 58.928  -9.085  1.00 22.69  ? 75  LEU B CA  1 
ATOM   4307  C C   . LEU B  1 78  ? 103.921 58.579  -8.366  1.00 24.20  ? 75  LEU B C   1 
ATOM   4308  O O   . LEU B  1 78  ? 102.888 58.349  -8.991  1.00 24.11  ? 75  LEU B O   1 
ATOM   4309  C CB  . LEU B  1 78  ? 106.111 57.711  -9.198  1.00 22.45  ? 75  LEU B CB  1 
ATOM   4310  C CG  . LEU B  1 78  ? 107.367 57.818  -10.054 1.00 21.96  ? 75  LEU B CG  1 
ATOM   4311  C CD1 . LEU B  1 78  ? 108.205 56.570  -9.875  1.00 21.57  ? 75  LEU B CD1 1 
ATOM   4312  C CD2 . LEU B  1 78  ? 106.982 57.960  -11.510 1.00 22.51  ? 75  LEU B CD2 1 
ATOM   4313  N N   . GLU B  1 79  ? 103.996 58.554  -7.043  1.00 26.32  ? 76  GLU B N   1 
ATOM   4314  C CA  . GLU B  1 79  ? 102.831 58.349  -6.192  1.00 27.95  ? 76  GLU B CA  1 
ATOM   4315  C C   . GLU B  1 79  ? 101.807 59.479  -6.278  1.00 27.57  ? 76  GLU B C   1 
ATOM   4316  O O   . GLU B  1 79  ? 100.609 59.225  -6.424  1.00 25.68  ? 76  GLU B O   1 
ATOM   4317  C CB  . GLU B  1 79  ? 103.288 58.188  -4.754  1.00 29.84  ? 76  GLU B CB  1 
ATOM   4318  C CG  . GLU B  1 79  ? 103.800 56.792  -4.493  1.00 31.78  ? 76  GLU B CG  1 
ATOM   4319  C CD  . GLU B  1 79  ? 104.471 56.666  -3.165  1.00 32.12  ? 76  GLU B CD  1 
ATOM   4320  O OE1 . GLU B  1 79  ? 104.335 57.573  -2.321  1.00 35.72  ? 76  GLU B OE1 1 
ATOM   4321  O OE2 . GLU B  1 79  ? 105.144 55.652  -2.985  1.00 31.72  ? 76  GLU B OE2 1 
ATOM   4322  N N   . GLN B  1 80  ? 102.294 60.709  -6.167  1.00 27.49  ? 77  GLN B N   1 
ATOM   4323  C CA  . GLN B  1 80  ? 101.466 61.891  -6.354  1.00 29.65  ? 77  GLN B CA  1 
ATOM   4324  C C   . GLN B  1 80  ? 100.730 61.946  -7.686  1.00 28.97  ? 77  GLN B C   1 
ATOM   4325  O O   . GLN B  1 80  ? 99.630  62.469  -7.746  1.00 28.55  ? 77  GLN B O   1 
ATOM   4326  C CB  . GLN B  1 80  ? 102.312 63.145  -6.301  1.00 33.99  ? 77  GLN B CB  1 
ATOM   4327  C CG  . GLN B  1 80  ? 102.394 63.835  -4.957  1.00 37.50  ? 77  GLN B CG  1 
ATOM   4328  C CD  . GLN B  1 80  ? 103.429 64.971  -4.990  1.00 41.05  ? 77  GLN B CD  1 
ATOM   4329  O OE1 . GLN B  1 80  ? 103.411 65.826  -5.906  1.00 38.17  ? 77  GLN B OE1 1 
ATOM   4330  N NE2 . GLN B  1 80  ? 104.356 64.970  -4.013  1.00 40.40  ? 77  GLN B NE2 1 
ATOM   4331  N N   . HIS B  1 81  ? 101.357 61.458  -8.753  1.00 28.43  ? 78  HIS B N   1 
ATOM   4332  C CA  . HIS B  1 81  ? 100.789 61.542  -10.101 1.00 28.20  ? 78  HIS B CA  1 
ATOM   4333  C C   . HIS B  1 81  ? 100.198 60.247  -10.574 1.00 26.54  ? 78  HIS B C   1 
ATOM   4334  O O   . HIS B  1 81  ? 100.002 60.052  -11.770 1.00 24.00  ? 78  HIS B O   1 
ATOM   4335  C CB  . HIS B  1 81  ? 101.870 61.968  -11.077 1.00 29.67  ? 78  HIS B CB  1 
ATOM   4336  C CG  . HIS B  1 81  ? 102.361 63.348  -10.825 1.00 31.11  ? 78  HIS B CG  1 
ATOM   4337  N ND1 . HIS B  1 81  ? 101.768 64.457  -11.388 1.00 32.21  ? 78  HIS B ND1 1 
ATOM   4338  C CD2 . HIS B  1 81  ? 103.358 63.807  -10.038 1.00 31.60  ? 78  HIS B CD2 1 
ATOM   4339  C CE1 . HIS B  1 81  ? 102.398 65.541  -10.974 1.00 32.85  ? 78  HIS B CE1 1 
ATOM   4340  N NE2 . HIS B  1 81  ? 103.365 65.174  -10.152 1.00 32.91  ? 78  HIS B NE2 1 
ATOM   4341  N N   . ALA B  1 82  ? 99.885  59.377  -9.624  1.00 26.61  ? 79  ALA B N   1 
ATOM   4342  C CA  . ALA B  1 82  ? 99.544  58.010  -9.925  1.00 26.13  ? 79  ALA B CA  1 
ATOM   4343  C C   . ALA B  1 82  ? 98.313  57.922  -10.815 1.00 27.37  ? 79  ALA B C   1 
ATOM   4344  O O   . ALA B  1 82  ? 98.297  57.133  -11.760 1.00 27.85  ? 79  ALA B O   1 
ATOM   4345  C CB  . ALA B  1 82  ? 99.341  57.245  -8.644  1.00 25.69  ? 79  ALA B CB  1 
ATOM   4346  N N   . ASP B  1 83  ? 97.304  58.759  -10.553 1.00 28.78  ? 80  ASP B N   1 
ATOM   4347  C CA  . ASP B  1 83  ? 96.062  58.732  -11.349 1.00 28.67  ? 80  ASP B CA  1 
ATOM   4348  C C   . ASP B  1 83  ? 96.297  59.081  -12.810 1.00 29.51  ? 80  ASP B C   1 
ATOM   4349  O O   . ASP B  1 83  ? 95.797  58.404  -13.708 1.00 29.57  ? 80  ASP B O   1 
ATOM   4350  C CB  . ASP B  1 83  ? 95.022  59.691  -10.790 1.00 28.33  ? 80  ASP B CB  1 
ATOM   4351  C CG  . ASP B  1 83  ? 94.448  59.242  -9.467  1.00 29.63  ? 80  ASP B CG  1 
ATOM   4352  O OD1 . ASP B  1 83  ? 94.374  58.030  -9.193  1.00 30.23  ? 80  ASP B OD1 1 
ATOM   4353  O OD2 . ASP B  1 83  ? 94.048  60.122  -8.685  1.00 31.70  ? 80  ASP B OD2 1 
ATOM   4354  N N   . GLU B  1 84  ? 97.064  60.137  -13.038 1.00 31.14  ? 81  GLU B N   1 
ATOM   4355  C CA  . GLU B  1 84  ? 97.322  60.639  -14.394 1.00 32.88  ? 81  GLU B CA  1 
ATOM   4356  C C   . GLU B  1 84  ? 98.176  59.643  -15.198 1.00 30.36  ? 81  GLU B C   1 
ATOM   4357  O O   . GLU B  1 84  ? 97.956  59.434  -16.391 1.00 28.32  ? 81  GLU B O   1 
ATOM   4358  C CB  . GLU B  1 84  ? 97.982  62.029  -14.327 1.00 38.23  ? 81  GLU B CB  1 
ATOM   4359  C CG  . GLU B  1 84  ? 97.184  63.080  -13.507 1.00 44.88  ? 81  GLU B CG  1 
ATOM   4360  C CD  . GLU B  1 84  ? 97.760  63.463  -12.103 1.00 48.25  ? 81  GLU B CD  1 
ATOM   4361  O OE1 . GLU B  1 84  ? 98.450  64.530  -12.000 1.00 47.29  ? 81  GLU B OE1 1 
ATOM   4362  O OE2 . GLU B  1 84  ? 97.496  62.722  -11.102 1.00 45.70  ? 81  GLU B OE2 1 
ATOM   4363  N N   . ILE B  1 85  ? 99.127  59.004  -14.522 1.00 27.43  ? 82  ILE B N   1 
ATOM   4364  C CA  . ILE B  1 85  ? 99.963  57.981  -15.138 1.00 25.03  ? 82  ILE B CA  1 
ATOM   4365  C C   . ILE B  1 85  ? 99.129  56.769  -15.535 1.00 24.14  ? 82  ILE B C   1 
ATOM   4366  O O   . ILE B  1 85  ? 99.300  56.234  -16.628 1.00 24.14  ? 82  ILE B O   1 
ATOM   4367  C CB  . ILE B  1 85  ? 101.118 57.530  -14.204 1.00 24.27  ? 82  ILE B CB  1 
ATOM   4368  C CG1 . ILE B  1 85  ? 102.069 58.699  -13.925 1.00 23.92  ? 82  ILE B CG1 1 
ATOM   4369  C CG2 . ILE B  1 85  ? 101.929 56.391  -14.825 1.00 23.81  ? 82  ILE B CG2 1 
ATOM   4370  C CD1 . ILE B  1 85  ? 102.883 58.561  -12.657 1.00 23.55  ? 82  ILE B CD1 1 
ATOM   4371  N N   . CYS B  1 86  ? 98.253  56.318  -14.650 1.00 23.04  ? 83  CYS B N   1 
ATOM   4372  C CA  . CYS B  1 86  ? 97.370  55.196  -14.977 1.00 23.82  ? 83  CYS B CA  1 
ATOM   4373  C C   . CYS B  1 86  ? 96.391  55.513  -16.124 1.00 24.89  ? 83  CYS B C   1 
ATOM   4374  O O   . CYS B  1 86  ? 96.019  54.649  -16.920 1.00 26.40  ? 83  CYS B O   1 
ATOM   4375  C CB  . CYS B  1 86  ? 96.596  54.760  -13.742 1.00 23.37  ? 83  CYS B CB  1 
ATOM   4376  S SG  . CYS B  1 86  ? 97.674  53.984  -12.536 1.00 23.82  ? 83  CYS B SG  1 
ATOM   4377  N N   . ARG B  1 87  ? 95.972  56.765  -16.179 1.00 25.49  ? 84  ARG B N   1 
ATOM   4378  C CA  . ARG B  1 87  ? 95.098  57.263  -17.226 1.00 24.92  ? 84  ARG B CA  1 
ATOM   4379  C C   . ARG B  1 87  ? 95.794  57.227  -18.600 1.00 23.32  ? 84  ARG B C   1 
ATOM   4380  O O   . ARG B  1 87  ? 95.219  56.812  -19.581 1.00 23.41  ? 84  ARG B O   1 
ATOM   4381  C CB  . ARG B  1 87  ? 94.722  58.687  -16.862 1.00 25.89  ? 84  ARG B CB  1 
ATOM   4382  C CG  . ARG B  1 87  ? 93.380  59.145  -17.363 1.00 26.90  ? 84  ARG B CG  1 
ATOM   4383  C CD  . ARG B  1 87  ? 93.358  60.677  -17.408 1.00 27.32  ? 84  ARG B CD  1 
ATOM   4384  N NE  . ARG B  1 87  ? 93.839  61.148  -18.707 1.00 27.71  ? 84  ARG B NE  1 
ATOM   4385  C CZ  . ARG B  1 87  ? 94.907  61.921  -18.923 1.00 29.94  ? 84  ARG B CZ  1 
ATOM   4386  N NH1 . ARG B  1 87  ? 95.699  62.394  -17.915 1.00 30.82  ? 84  ARG B NH1 1 
ATOM   4387  N NH2 . ARG B  1 87  ? 95.188  62.228  -20.188 1.00 29.49  ? 84  ARG B NH2 1 
ATOM   4388  N N   . LEU B  1 88  ? 97.043  57.669  -18.638 1.00 22.14  ? 85  LEU B N   1 
ATOM   4389  C CA  . LEU B  1 88  ? 97.879  57.633  -19.840 1.00 20.27  ? 85  LEU B CA  1 
ATOM   4390  C C   . LEU B  1 88  ? 98.216  56.231  -20.348 1.00 19.78  ? 85  LEU B C   1 
ATOM   4391  O O   . LEU B  1 88  ? 98.148  55.966  -21.554 1.00 18.10  ? 85  LEU B O   1 
ATOM   4392  C CB  . LEU B  1 88  ? 99.174  58.397  -19.547 1.00 19.88  ? 85  LEU B CB  1 
ATOM   4393  C CG  . LEU B  1 88  ? 99.026  59.914  -19.629 1.00 19.45  ? 85  LEU B CG  1 
ATOM   4394  C CD1 . LEU B  1 88  ? 100.241 60.562  -19.037 1.00 19.25  ? 85  LEU B CD1 1 
ATOM   4395  C CD2 . LEU B  1 88  ? 98.869  60.372  -21.067 1.00 19.60  ? 85  LEU B CD2 1 
ATOM   4396  N N   . ILE B  1 89  ? 98.609  55.356  -19.420 1.00 19.69  ? 86  ILE B N   1 
ATOM   4397  C CA  . ILE B  1 89  ? 98.829  53.964  -19.729 1.00 19.83  ? 86  ILE B CA  1 
ATOM   4398  C C   . ILE B  1 89  ? 97.540  53.436  -20.312 1.00 20.07  ? 86  ILE B C   1 
ATOM   4399  O O   . ILE B  1 89  ? 97.530  52.886  -21.391 1.00 20.32  ? 86  ILE B O   1 
ATOM   4400  C CB  . ILE B  1 89  ? 99.202  53.121  -18.487 1.00 20.41  ? 86  ILE B CB  1 
ATOM   4401  C CG1 . ILE B  1 89  ? 100.573 53.525  -17.902 1.00 19.94  ? 86  ILE B CG1 1 
ATOM   4402  C CG2 . ILE B  1 89  ? 99.272  51.633  -18.844 1.00 20.57  ? 86  ILE B CG2 1 
ATOM   4403  C CD1 . ILE B  1 89  ? 100.790 53.039  -16.480 1.00 19.27  ? 86  ILE B CD1 1 
ATOM   4404  N N   . GLY B  1 90  ? 96.442  53.642  -19.603 1.00 21.61  ? 87  GLY B N   1 
ATOM   4405  C CA  . GLY B  1 90  ? 95.120  53.149  -20.027 1.00 22.68  ? 87  GLY B CA  1 
ATOM   4406  C C   . GLY B  1 90  ? 94.667  53.620  -21.398 1.00 23.57  ? 87  GLY B C   1 
ATOM   4407  O O   . GLY B  1 90  ? 94.073  52.885  -22.165 1.00 24.84  ? 87  GLY B O   1 
ATOM   4408  N N   . GLU B  1 91  ? 94.981  54.859  -21.708 1.00 24.63  ? 88  GLU B N   1 
ATOM   4409  C CA  . GLU B  1 91  ? 94.570  55.486  -22.952 1.00 25.14  ? 88  GLU B CA  1 
ATOM   4410  C C   . GLU B  1 91  ? 95.240  54.932  -24.203 1.00 23.95  ? 88  GLU B C   1 
ATOM   4411  O O   . GLU B  1 91  ? 94.634  54.926  -25.244 1.00 25.46  ? 88  GLU B O   1 
ATOM   4412  C CB  . GLU B  1 91  ? 94.873  56.975  -22.857 1.00 26.92  ? 88  GLU B CB  1 
ATOM   4413  C CG  . GLU B  1 91  ? 94.138  57.855  -23.835 1.00 29.10  ? 88  GLU B CG  1 
ATOM   4414  C CD  . GLU B  1 91  ? 94.509  59.324  -23.665 1.00 31.80  ? 88  GLU B CD  1 
ATOM   4415  O OE1 . GLU B  1 91  ? 93.597  60.159  -23.480 1.00 34.22  ? 88  GLU B OE1 1 
ATOM   4416  O OE2 . GLU B  1 91  ? 95.719  59.660  -23.701 1.00 34.95  ? 88  GLU B OE2 1 
ATOM   4417  N N   . GLU B  1 92  ? 96.495  54.515  -24.115 1.00 22.39  ? 89  GLU B N   1 
ATOM   4418  C CA  . GLU B  1 92  ? 97.248  54.060  -25.281 1.00 20.35  ? 89  GLU B CA  1 
ATOM   4419  C C   . GLU B  1 92  ? 97.483  52.584  -25.278 1.00 20.14  ? 89  GLU B C   1 
ATOM   4420  O O   . GLU B  1 92  ? 97.519  51.994  -26.334 1.00 20.90  ? 89  GLU B O   1 
ATOM   4421  C CB  . GLU B  1 92  ? 98.602  54.751  -25.347 1.00 20.67  ? 89  GLU B CB  1 
ATOM   4422  C CG  . GLU B  1 92  ? 98.543  56.228  -25.732 1.00 20.46  ? 89  GLU B CG  1 
ATOM   4423  C CD  . GLU B  1 92  ? 99.822  57.006  -25.429 1.00 20.01  ? 89  GLU B CD  1 
ATOM   4424  O OE1 . GLU B  1 92  ? 99.887  58.165  -25.882 1.00 19.69  ? 89  GLU B OE1 1 
ATOM   4425  O OE2 . GLU B  1 92  ? 100.755 56.496  -24.752 1.00 19.34  ? 89  GLU B OE2 1 
ATOM   4426  N N   . HIS B  1 93  ? 97.687  51.979  -24.116 1.00 20.48  ? 90  HIS B N   1 
ATOM   4427  C CA  . HIS B  1 93  ? 97.747  50.515  -24.017 1.00 21.39  ? 90  HIS B CA  1 
ATOM   4428  C C   . HIS B  1 93  ? 96.341  49.926  -23.972 1.00 22.97  ? 90  HIS B C   1 
ATOM   4429  O O   . HIS B  1 93  ? 96.011  48.990  -24.704 1.00 22.26  ? 90  HIS B O   1 
ATOM   4430  C CB  . HIS B  1 93  ? 98.493  50.121  -22.759 1.00 21.53  ? 90  HIS B CB  1 
ATOM   4431  C CG  . HIS B  1 93  ? 98.609  48.644  -22.551 1.00 21.92  ? 90  HIS B CG  1 
ATOM   4432  N ND1 . HIS B  1 93  ? 97.591  47.875  -22.024 1.00 21.97  ? 90  HIS B ND1 1 
ATOM   4433  C CD2 . HIS B  1 93  ? 99.647  47.802  -22.753 1.00 22.25  ? 90  HIS B CD2 1 
ATOM   4434  C CE1 . HIS B  1 93  ? 97.990  46.623  -21.924 1.00 22.07  ? 90  HIS B CE1 1 
ATOM   4435  N NE2 . HIS B  1 93  ? 99.235  46.553  -22.357 1.00 22.88  ? 90  HIS B NE2 1 
ATOM   4436  N N   . GLY B  1 94  ? 95.530  50.472  -23.068 1.00 24.76  ? 91  GLY B N   1 
ATOM   4437  C CA  . GLY B  1 94  ? 94.151  50.040  -22.894 1.00 25.87  ? 91  GLY B CA  1 
ATOM   4438  C C   . GLY B  1 94  ? 93.816  49.461  -21.538 1.00 26.35  ? 91  GLY B C   1 
ATOM   4439  O O   . GLY B  1 94  ? 92.647  49.251  -21.256 1.00 26.95  ? 91  GLY B O   1 
ATOM   4440  N N   . LYS B  1 95  ? 94.814  49.234  -20.684 1.00 27.05  ? 92  LYS B N   1 
ATOM   4441  C CA  . LYS B  1 95  ? 94.600  48.460  -19.440 1.00 27.21  ? 92  LYS B CA  1 
ATOM   4442  C C   . LYS B  1 95  ? 93.905  49.292  -18.393 1.00 28.63  ? 92  LYS B C   1 
ATOM   4443  O O   . LYS B  1 95  ? 94.094  50.511  -18.314 1.00 30.17  ? 92  LYS B O   1 
ATOM   4444  C CB  . LYS B  1 95  ? 95.886  47.839  -18.871 1.00 25.13  ? 92  LYS B CB  1 
ATOM   4445  C CG  . LYS B  1 95  ? 96.935  48.824  -18.445 1.00 24.41  ? 92  LYS B CG  1 
ATOM   4446  C CD  . LYS B  1 95  ? 98.107  48.139  -17.777 1.00 24.18  ? 92  LYS B CD  1 
ATOM   4447  C CE  . LYS B  1 95  ? 98.988  47.376  -18.747 1.00 23.93  ? 92  LYS B CE  1 
ATOM   4448  N NZ  . LYS B  1 95  ? 100.156 46.781  -18.031 1.00 24.35  ? 92  LYS B NZ  1 
ATOM   4449  N N   . ILE B  1 96  ? 93.112  48.621  -17.570 1.00 30.60  ? 93  ILE B N   1 
ATOM   4450  C CA  . ILE B  1 96  ? 92.201  49.336  -16.703 1.00 32.25  ? 93  ILE B CA  1 
ATOM   4451  C C   . ILE B  1 96  ? 92.966  49.755  -15.433 1.00 30.62  ? 93  ILE B C   1 
ATOM   4452  O O   . ILE B  1 96  ? 93.994  49.160  -15.082 1.00 29.18  ? 93  ILE B O   1 
ATOM   4453  C CB  . ILE B  1 96  ? 90.859  48.577  -16.461 1.00 34.33  ? 93  ILE B CB  1 
ATOM   4454  C CG1 . ILE B  1 96  ? 90.822  47.910  -15.090 1.00 38.42  ? 93  ILE B CG1 1 
ATOM   4455  C CG2 . ILE B  1 96  ? 90.497  47.624  -17.612 1.00 33.12  ? 93  ILE B CG2 1 
ATOM   4456  C CD1 . ILE B  1 96  ? 89.983  48.702  -14.094 1.00 42.25  ? 93  ILE B CD1 1 
ATOM   4457  N N   . ALA B  1 97  ? 92.469  50.806  -14.789 1.00 28.89  ? 94  ALA B N   1 
ATOM   4458  C CA  . ALA B  1 97  ? 93.071  51.362  -13.589 1.00 27.33  ? 94  ALA B CA  1 
ATOM   4459  C C   . ALA B  1 97  ? 93.923  50.384  -12.753 1.00 26.95  ? 94  ALA B C   1 
ATOM   4460  O O   . ALA B  1 97  ? 95.112  50.590  -12.579 1.00 26.73  ? 94  ALA B O   1 
ATOM   4461  C CB  . ALA B  1 97  ? 91.977  51.972  -12.740 1.00 28.01  ? 94  ALA B CB  1 
ATOM   4462  N N   . HIS B  1 98  ? 93.328  49.305  -12.269 1.00 27.43  ? 95  HIS B N   1 
ATOM   4463  C CA  . HIS B  1 98  ? 94.019  48.424  -11.333 1.00 28.14  ? 95  HIS B CA  1 
ATOM   4464  C C   . HIS B  1 98  ? 95.260  47.743  -11.910 1.00 28.13  ? 95  HIS B C   1 
ATOM   4465  O O   . HIS B  1 98  ? 96.248  47.613  -11.218 1.00 30.64  ? 95  HIS B O   1 
ATOM   4466  C CB  . HIS B  1 98  ? 93.067  47.370  -10.759 1.00 28.91  ? 95  HIS B CB  1 
ATOM   4467  C CG  . HIS B  1 98  ? 92.667  46.320  -11.742 1.00 30.25  ? 95  HIS B CG  1 
ATOM   4468  N ND1 . HIS B  1 98  ? 91.454  46.341  -12.391 1.00 30.18  ? 95  HIS B ND1 1 
ATOM   4469  C CD2 . HIS B  1 98  ? 93.324  45.230  -12.207 1.00 31.21  ? 95  HIS B CD2 1 
ATOM   4470  C CE1 . HIS B  1 98  ? 91.369  45.299  -13.200 1.00 30.01  ? 95  HIS B CE1 1 
ATOM   4471  N NE2 . HIS B  1 98  ? 92.495  44.618  -13.119 1.00 30.98  ? 95  HIS B NE2 1 
ATOM   4472  N N   . ASP B  1 99  ? 95.219  47.292  -13.155 1.00 28.64  ? 96  ASP B N   1 
ATOM   4473  C CA  . ASP B  1 99  ? 96.418  46.721  -13.774 1.00 29.68  ? 96  ASP B CA  1 
ATOM   4474  C C   . ASP B  1 99  ? 97.475  47.814  -13.944 1.00 30.52  ? 96  ASP B C   1 
ATOM   4475  O O   . ASP B  1 99  ? 98.668  47.550  -13.742 1.00 31.07  ? 96  ASP B O   1 
ATOM   4476  C CB  . ASP B  1 99  ? 96.137  46.085  -15.145 1.00 30.50  ? 96  ASP B CB  1 
ATOM   4477  C CG  . ASP B  1 99  ? 95.565  44.669  -15.057 1.00 32.16  ? 96  ASP B CG  1 
ATOM   4478  O OD1 . ASP B  1 99  ? 96.093  43.853  -14.259 1.00 33.94  ? 96  ASP B OD1 1 
ATOM   4479  O OD2 . ASP B  1 99  ? 94.603  44.361  -15.822 1.00 31.68  ? 96  ASP B OD2 1 
ATOM   4480  N N   . ALA B  1 100 ? 97.037  49.026  -14.316 1.00 29.24  ? 97  ALA B N   1 
ATOM   4481  C CA  . ALA B  1 100 ? 97.946  50.166  -14.483 1.00 28.49  ? 97  ALA B CA  1 
ATOM   4482  C C   . ALA B  1 100 ? 98.630  50.563  -13.186 1.00 28.09  ? 97  ALA B C   1 
ATOM   4483  O O   . ALA B  1 100 ? 99.843  50.781  -13.175 1.00 27.57  ? 97  ALA B O   1 
ATOM   4484  C CB  . ALA B  1 100 ? 97.208  51.362  -15.052 1.00 29.40  ? 97  ALA B CB  1 
ATOM   4485  N N   . MET B  1 101 ? 97.838  50.696  -12.116 1.00 27.84  ? 98  MET B N   1 
ATOM   4486  C CA  . MET B  1 101 ? 98.364  50.933  -10.758 1.00 26.38  ? 98  MET B CA  1 
ATOM   4487  C C   . MET B  1 101 ? 99.345  49.838  -10.377 1.00 24.40  ? 98  MET B C   1 
ATOM   4488  O O   . MET B  1 101 ? 100.387 50.134  -9.803  1.00 24.95  ? 98  MET B O   1 
ATOM   4489  C CB  . MET B  1 101 ? 97.241  50.973  -9.707  1.00 28.05  ? 98  MET B CB  1 
ATOM   4490  C CG  . MET B  1 101 ? 96.573  52.331  -9.492  1.00 29.76  ? 98  MET B CG  1 
ATOM   4491  S SD  . MET B  1 101 ? 97.688  53.670  -9.044  1.00 32.59  ? 98  MET B SD  1 
ATOM   4492  C CE  . MET B  1 101 ? 98.582  52.956  -7.640  1.00 33.98  ? 98  MET B CE  1 
ATOM   4493  N N   . GLY B  1 102 ? 99.002  48.582  -10.685 1.00 22.06  ? 99  GLY B N   1 
ATOM   4494  C CA  . GLY B  1 102 ? 99.825  47.434  -10.339 1.00 20.66  ? 99  GLY B CA  1 
ATOM   4495  C C   . GLY B  1 102 ? 101.189 47.567  -10.979 1.00 20.70  ? 99  GLY B C   1 
ATOM   4496  O O   . GLY B  1 102 ? 102.232 47.430  -10.321 1.00 21.15  ? 99  GLY B O   1 
ATOM   4497  N N   . GLU B  1 103 ? 101.170 47.864  -12.271 1.00 19.79  ? 100 GLU B N   1 
ATOM   4498  C CA  . GLU B  1 103 ? 102.371 48.180  -13.022 1.00 19.04  ? 100 GLU B CA  1 
ATOM   4499  C C   . GLU B  1 103 ? 103.150 49.293  -12.359 1.00 19.06  ? 100 GLU B C   1 
ATOM   4500  O O   . GLU B  1 103 ? 104.346 49.178  -12.143 1.00 18.29  ? 100 GLU B O   1 
ATOM   4501  C CB  . GLU B  1 103 ? 101.995 48.637  -14.434 1.00 18.94  ? 100 GLU B CB  1 
ATOM   4502  C CG  . GLU B  1 103 ? 103.175 49.192  -15.205 1.00 18.76  ? 100 GLU B CG  1 
ATOM   4503  C CD  . GLU B  1 103 ? 102.943 49.413  -16.681 1.00 18.60  ? 100 GLU B CD  1 
ATOM   4504  O OE1 . GLU B  1 103 ? 101.843 49.082  -17.186 1.00 18.38  ? 100 GLU B OE1 1 
ATOM   4505  O OE2 . GLU B  1 103 ? 103.906 49.900  -17.335 1.00 17.92  ? 100 GLU B OE2 1 
ATOM   4506  N N   . LEU B  1 104 ? 102.455 50.388  -12.078 1.00 19.87  ? 101 LEU B N   1 
ATOM   4507  C CA  . LEU B  1 104 ? 103.070 51.555  -11.493 1.00 20.78  ? 101 LEU B CA  1 
ATOM   4508  C C   . LEU B  1 104 ? 103.724 51.221  -10.157 1.00 23.46  ? 101 LEU B C   1 
ATOM   4509  O O   . LEU B  1 104 ? 104.859 51.636  -9.911  1.00 23.36  ? 101 LEU B O   1 
ATOM   4510  C CB  . LEU B  1 104 ? 102.046 52.679  -11.339 1.00 19.68  ? 101 LEU B CB  1 
ATOM   4511  C CG  . LEU B  1 104 ? 102.531 53.970  -10.677 1.00 19.25  ? 101 LEU B CG  1 
ATOM   4512  C CD1 . LEU B  1 104 ? 103.746 54.550  -11.389 1.00 19.11  ? 101 LEU B CD1 1 
ATOM   4513  C CD2 . LEU B  1 104 ? 101.407 54.981  -10.636 1.00 19.01  ? 101 LEU B CD2 1 
ATOM   4514  N N   . GLN B  1 105 ? 103.013 50.450  -9.329  1.00 28.01  ? 102 GLN B N   1 
ATOM   4515  C CA  . GLN B  1 105 ? 103.487 50.025  -7.992  1.00 32.48  ? 102 GLN B CA  1 
ATOM   4516  C C   . GLN B  1 105 ? 104.800 49.248  -8.061  1.00 29.20  ? 102 GLN B C   1 
ATOM   4517  O O   . GLN B  1 105 ? 105.747 49.540  -7.336  1.00 25.91  ? 102 GLN B O   1 
ATOM   4518  C CB  . GLN B  1 105 ? 102.431 49.166  -7.255  1.00 37.16  ? 102 GLN B CB  1 
ATOM   4519  C CG  . GLN B  1 105 ? 102.632 49.116  -5.738  1.00 42.34  ? 102 GLN B CG  1 
ATOM   4520  C CD  . GLN B  1 105 ? 102.333 50.467  -5.070  1.00 49.80  ? 102 GLN B CD  1 
ATOM   4521  O OE1 . GLN B  1 105 ? 101.285 51.104  -5.343  1.00 50.41  ? 102 GLN B OE1 1 
ATOM   4522  N NE2 . GLN B  1 105 ? 103.253 50.918  -4.189  1.00 54.86  ? 102 GLN B NE2 1 
ATOM   4523  N N   . ARG B  1 106 ? 104.843 48.268  -8.948  1.00 27.73  ? 103 ARG B N   1 
ATOM   4524  C CA  . ARG B  1 106 ? 106.053 47.494  -9.128  1.00 28.46  ? 103 ARG B CA  1 
ATOM   4525  C C   . ARG B  1 106 ? 107.190 48.367  -9.643  1.00 25.62  ? 103 ARG B C   1 
ATOM   4526  O O   . ARG B  1 106 ? 108.342 48.175  -9.285  1.00 26.14  ? 103 ARG B O   1 
ATOM   4527  C CB  . ARG B  1 106 ? 105.800 46.290  -10.036 1.00 31.76  ? 103 ARG B CB  1 
ATOM   4528  C CG  . ARG B  1 106 ? 104.780 45.310  -9.456  1.00 36.75  ? 103 ARG B CG  1 
ATOM   4529  C CD  . ARG B  1 106 ? 105.244 43.868  -9.522  1.00 42.06  ? 103 ARG B CD  1 
ATOM   4530  N NE  . ARG B  1 106 ? 105.601 43.424  -10.882 1.00 47.98  ? 103 ARG B NE  1 
ATOM   4531  C CZ  . ARG B  1 106 ? 104.735 43.056  -11.839 1.00 50.24  ? 103 ARG B CZ  1 
ATOM   4532  N NH1 . ARG B  1 106 ? 103.414 43.099  -11.646 1.00 49.31  ? 103 ARG B NH1 1 
ATOM   4533  N NH2 . ARG B  1 106 ? 105.202 42.655  -13.020 1.00 51.88  ? 103 ARG B NH2 1 
ATOM   4534  N N   . GLY B  1 107 ? 106.862 49.343  -10.463 1.00 23.88  ? 104 GLY B N   1 
ATOM   4535  C CA  . GLY B  1 107 ? 107.862 50.266  -10.958 1.00 23.44  ? 104 GLY B CA  1 
ATOM   4536  C C   . GLY B  1 107 ? 108.440 51.133  -9.864  1.00 22.96  ? 104 GLY B C   1 
ATOM   4537  O O   . GLY B  1 107 ? 109.647 51.382  -9.842  1.00 24.06  ? 104 GLY B O   1 
ATOM   4538  N N   . ILE B  1 108 ? 107.572 51.612  -8.973  1.00 21.96  ? 105 ILE B N   1 
ATOM   4539  C CA  . ILE B  1 108 ? 107.983 52.375  -7.791  1.00 20.85  ? 105 ILE B CA  1 
ATOM   4540  C C   . ILE B  1 108 ? 108.851 51.508  -6.864  1.00 19.82  ? 105 ILE B C   1 
ATOM   4541  O O   . ILE B  1 108 ? 109.808 51.989  -6.258  1.00 20.11  ? 105 ILE B O   1 
ATOM   4542  C CB  . ILE B  1 108 ? 106.750 52.950  -7.033  1.00 21.15  ? 105 ILE B CB  1 
ATOM   4543  C CG1 . ILE B  1 108 ? 106.069 54.058  -7.860  1.00 20.85  ? 105 ILE B CG1 1 
ATOM   4544  C CG2 . ILE B  1 108 ? 107.140 53.532  -5.672  1.00 21.38  ? 105 ILE B CG2 1 
ATOM   4545  C CD1 . ILE B  1 108 ? 104.671 54.426  -7.393  1.00 20.39  ? 105 ILE B CD1 1 
ATOM   4546  N N   . GLU B  1 109 ? 108.531 50.227  -6.772  1.00 18.73  ? 106 GLU B N   1 
ATOM   4547  C CA  . GLU B  1 109 ? 109.348 49.306  -5.999  1.00 18.22  ? 106 GLU B CA  1 
ATOM   4548  C C   . GLU B  1 109 ? 110.793 49.242  -6.491  1.00 17.77  ? 106 GLU B C   1 
ATOM   4549  O O   . GLU B  1 109 ? 111.709 49.098  -5.699  1.00 17.39  ? 106 GLU B O   1 
ATOM   4550  C CB  . GLU B  1 109 ? 108.700 47.926  -5.960  1.00 18.33  ? 106 GLU B CB  1 
ATOM   4551  C CG  . GLU B  1 109 ? 107.523 47.907  -4.986  1.00 18.97  ? 106 GLU B CG  1 
ATOM   4552  C CD  . GLU B  1 109 ? 106.805 46.597  -4.907  1.00 18.99  ? 106 GLU B CD  1 
ATOM   4553  O OE1 . GLU B  1 109 ? 105.789 46.561  -4.211  1.00 17.47  ? 106 GLU B OE1 1 
ATOM   4554  O OE2 . GLU B  1 109 ? 107.271 45.619  -5.528  1.00 21.46  ? 106 GLU B OE2 1 
ATOM   4555  N N   . ASN B  1 110 ? 110.979 49.372  -7.796  1.00 17.49  ? 107 ASN B N   1 
ATOM   4556  C CA  . ASN B  1 110 ? 112.306 49.426  -8.392  1.00 17.22  ? 107 ASN B CA  1 
ATOM   4557  C C   . ASN B  1 110 ? 112.995 50.705  -7.961  1.00 16.52  ? 107 ASN B C   1 
ATOM   4558  O O   . ASN B  1 110 ? 114.178 50.715  -7.587  1.00 16.44  ? 107 ASN B O   1 
ATOM   4559  C CB  . ASN B  1 110 ? 112.212 49.336  -9.927  1.00 17.42  ? 107 ASN B CB  1 
ATOM   4560  C CG  . ASN B  1 110 ? 111.727 47.970  -10.407 1.00 17.38  ? 107 ASN B CG  1 
ATOM   4561  O OD1 . ASN B  1 110 ? 110.647 47.832  -10.977 1.00 16.58  ? 107 ASN B OD1 1 
ATOM   4562  N ND2 . ASN B  1 110 ? 112.533 46.949  -10.161 1.00 17.97  ? 107 ASN B ND2 1 
ATOM   4563  N N   . VAL B  1 111 ? 112.229 51.781  -7.991  1.00 15.64  ? 108 VAL B N   1 
ATOM   4564  C CA  . VAL B  1 111 ? 112.720 53.063  -7.532  1.00 15.38  ? 108 VAL B CA  1 
ATOM   4565  C C   . VAL B  1 111 ? 113.119 52.976  -6.050  1.00 15.13  ? 108 VAL B C   1 
ATOM   4566  O O   . VAL B  1 111 ? 114.142 53.529  -5.668  1.00 15.24  ? 108 VAL B O   1 
ATOM   4567  C CB  . VAL B  1 111 ? 111.681 54.180  -7.789  1.00 15.19  ? 108 VAL B CB  1 
ATOM   4568  C CG1 . VAL B  1 111 ? 112.121 55.503  -7.185  1.00 14.97  ? 108 VAL B CG1 1 
ATOM   4569  C CG2 . VAL B  1 111 ? 111.450 54.348  -9.290  1.00 15.30  ? 108 VAL B CG2 1 
ATOM   4570  N N   . GLU B  1 112 ? 112.335 52.273  -5.233  1.00 14.68  ? 109 GLU B N   1 
ATOM   4571  C CA  . GLU B  1 112 ? 112.632 52.150  -3.807  1.00 14.72  ? 109 GLU B CA  1 
ATOM   4572  C C   . GLU B  1 112 ? 113.958 51.463  -3.590  1.00 14.73  ? 109 GLU B C   1 
ATOM   4573  O O   . GLU B  1 112 ? 114.739 51.859  -2.745  1.00 14.63  ? 109 GLU B O   1 
ATOM   4574  C CB  . GLU B  1 112 ? 111.553 51.353  -3.089  1.00 15.10  ? 109 GLU B CB  1 
ATOM   4575  C CG  . GLU B  1 112 ? 110.223 52.064  -2.931  1.00 15.38  ? 109 GLU B CG  1 
ATOM   4576  C CD  . GLU B  1 112 ? 109.090 51.189  -2.373  1.00 15.91  ? 109 GLU B CD  1 
ATOM   4577  O OE1 . GLU B  1 112 ? 108.069 51.783  -1.947  1.00 17.35  ? 109 GLU B OE1 1 
ATOM   4578  O OE2 . GLU B  1 112 ? 109.173 49.931  -2.338  1.00 15.42  ? 109 GLU B OE2 1 
ATOM   4579  N N   . TYR B  1 113 ? 114.203 50.431  -4.379  1.00 15.12  ? 110 TYR B N   1 
ATOM   4580  C CA  . TYR B  1 113 ? 115.409 49.638  -4.283  1.00 15.65  ? 110 TYR B CA  1 
ATOM   4581  C C   . TYR B  1 113 ? 116.565 50.499  -4.711  1.00 16.38  ? 110 TYR B C   1 
ATOM   4582  O O   . TYR B  1 113 ? 117.623 50.468  -4.108  1.00 17.14  ? 110 TYR B O   1 
ATOM   4583  C CB  . TYR B  1 113 ? 115.301 48.365  -5.159  1.00 15.84  ? 110 TYR B CB  1 
ATOM   4584  C CG  . TYR B  1 113 ? 116.454 47.380  -5.015  1.00 15.76  ? 110 TYR B CG  1 
ATOM   4585  C CD1 . TYR B  1 113 ? 116.606 46.602  -3.873  1.00 15.93  ? 110 TYR B CD1 1 
ATOM   4586  C CD2 . TYR B  1 113 ? 117.396 47.252  -5.999  1.00 15.64  ? 110 TYR B CD2 1 
ATOM   4587  C CE1 . TYR B  1 113 ? 117.659 45.720  -3.736  1.00 15.65  ? 110 TYR B CE1 1 
ATOM   4588  C CE2 . TYR B  1 113 ? 118.453 46.374  -5.866  1.00 15.72  ? 110 TYR B CE2 1 
ATOM   4589  C CZ  . TYR B  1 113 ? 118.578 45.612  -4.735  1.00 15.57  ? 110 TYR B CZ  1 
ATOM   4590  O OH  . TYR B  1 113 ? 119.625 44.745  -4.623  1.00 15.51  ? 110 TYR B OH  1 
ATOM   4591  N N   . ALA B  1 114 ? 116.348 51.298  -5.739  1.00 17.51  ? 111 ALA B N   1 
ATOM   4592  C CA  . ALA B  1 114 ? 117.375 52.220  -6.215  1.00 18.33  ? 111 ALA B CA  1 
ATOM   4593  C C   . ALA B  1 114 ? 117.816 53.236  -5.162  1.00 18.58  ? 111 ALA B C   1 
ATOM   4594  O O   . ALA B  1 114 ? 118.977 53.647  -5.136  1.00 19.74  ? 111 ALA B O   1 
ATOM   4595  C CB  . ALA B  1 114 ? 116.887 52.940  -7.461  1.00 18.52  ? 111 ALA B CB  1 
ATOM   4596  N N   . CYS B  1 115 ? 116.896 53.633  -4.289  1.00 18.33  ? 112 CYS B N   1 
ATOM   4597  C CA  . CYS B  1 115 ? 117.209 54.570  -3.210  1.00 17.92  ? 112 CYS B CA  1 
ATOM   4598  C C   . CYS B  1 115 ? 118.300 54.075  -2.259  1.00 17.14  ? 112 CYS B C   1 
ATOM   4599  O O   . CYS B  1 115 ? 118.934 54.889  -1.594  1.00 17.35  ? 112 CYS B O   1 
ATOM   4600  C CB  . CYS B  1 115 ? 115.956 54.848  -2.386  1.00 18.51  ? 112 CYS B CB  1 
ATOM   4601  S SG  . CYS B  1 115 ? 114.677 55.760  -3.261  1.00 18.47  ? 112 CYS B SG  1 
ATOM   4602  N N   . GLY B  1 116 ? 118.486 52.754  -2.177  1.00 15.76  ? 113 GLY B N   1 
ATOM   4603  C CA  . GLY B  1 116 ? 119.558 52.154  -1.388  1.00 14.92  ? 113 GLY B CA  1 
ATOM   4604  C C   . GLY B  1 116 ? 120.855 51.905  -2.151  1.00 14.17  ? 113 GLY B C   1 
ATOM   4605  O O   . GLY B  1 116 ? 121.615 51.003  -1.795  1.00 13.59  ? 113 GLY B O   1 
ATOM   4606  N N   . ALA B  1 117 ? 121.136 52.733  -3.162  1.00 13.63  ? 114 ALA B N   1 
ATOM   4607  C CA  . ALA B  1 117 ? 122.333 52.574  -4.005  1.00 13.08  ? 114 ALA B CA  1 
ATOM   4608  C C   . ALA B  1 117 ? 123.671 52.485  -3.254  1.00 12.67  ? 114 ALA B C   1 
ATOM   4609  O O   . ALA B  1 117 ? 124.556 51.782  -3.710  1.00 12.94  ? 114 ALA B O   1 
ATOM   4610  C CB  . ALA B  1 117 ? 122.402 53.687  -5.030  1.00 12.94  ? 114 ALA B CB  1 
ATOM   4611  N N   . PRO B  1 118 ? 123.830 53.204  -2.129  1.00 12.15  ? 115 PRO B N   1 
ATOM   4612  C CA  . PRO B  1 118 ? 125.158 53.212  -1.513  1.00 12.02  ? 115 PRO B CA  1 
ATOM   4613  C C   . PRO B  1 118 ? 125.623 51.871  -0.966  1.00 11.40  ? 115 PRO B C   1 
ATOM   4614  O O   . PRO B  1 118 ? 126.815 51.534  -1.033  1.00 11.66  ? 115 PRO B O   1 
ATOM   4615  C CB  . PRO B  1 118 ? 124.990 54.213  -0.364  1.00 12.20  ? 115 PRO B CB  1 
ATOM   4616  C CG  . PRO B  1 118 ? 123.934 55.142  -0.831  1.00 12.18  ? 115 PRO B CG  1 
ATOM   4617  C CD  . PRO B  1 118 ? 122.967 54.254  -1.546  1.00 12.16  ? 115 PRO B CD  1 
ATOM   4618  N N   . GLU B  1 119 ? 124.670 51.162  -0.387  1.00 10.79  ? 116 GLU B N   1 
ATOM   4619  C CA  . GLU B  1 119 ? 124.798 49.754  -0.023  1.00 10.30  ? 116 GLU B CA  1 
ATOM   4620  C C   . GLU B  1 119 ? 125.067 48.887  -1.259  1.00 10.07  ? 116 GLU B C   1 
ATOM   4621  O O   . GLU B  1 119 ? 126.022 48.116  -1.276  1.00 10.12  ? 116 GLU B O   1 
ATOM   4622  C CB  . GLU B  1 119 ? 123.510 49.311  0.684   1.00 10.11  ? 116 GLU B CB  1 
ATOM   4623  C CG  . GLU B  1 119 ? 123.366 47.836  1.041   1.00 10.09  ? 116 GLU B CG  1 
ATOM   4624  C CD  . GLU B  1 119 ? 124.237 47.362  2.194   1.00 10.10  ? 116 GLU B CD  1 
ATOM   4625  O OE1 . GLU B  1 119 ? 124.613 48.145  3.082   1.00 10.20  ? 116 GLU B OE1 1 
ATOM   4626  O OE2 . GLU B  1 119 ? 124.541 46.163  2.232   1.00 10.36  ? 116 GLU B OE2 1 
ATOM   4627  N N   . LEU B  1 120 ? 124.260 49.045  -2.300  1.00 9.69   ? 117 LEU B N   1 
ATOM   4628  C CA  . LEU B  1 120 ? 124.358 48.182  -3.459  1.00 9.83   ? 117 LEU B CA  1 
ATOM   4629  C C   . LEU B  1 120 ? 125.653 48.345  -4.228  1.00 10.20  ? 117 LEU B C   1 
ATOM   4630  O O   . LEU B  1 120 ? 126.124 47.410  -4.868  1.00 10.22  ? 117 LEU B O   1 
ATOM   4631  C CB  . LEU B  1 120 ? 123.196 48.412  -4.403  1.00 9.82   ? 117 LEU B CB  1 
ATOM   4632  C CG  . LEU B  1 120 ? 121.783 48.290  -3.821  1.00 9.78   ? 117 LEU B CG  1 
ATOM   4633  C CD1 . LEU B  1 120 ? 120.809 48.582  -4.946  1.00 9.78   ? 117 LEU B CD1 1 
ATOM   4634  C CD2 . LEU B  1 120 ? 121.495 46.930  -3.185  1.00 9.62   ? 117 LEU B CD2 1 
ATOM   4635  N N   . LEU B  1 121 ? 126.236 49.530  -4.133  1.00 10.77  ? 118 LEU B N   1 
ATOM   4636  C CA  . LEU B  1 121 ? 127.501 49.861  -4.800  1.00 10.99  ? 118 LEU B CA  1 
ATOM   4637  C C   . LEU B  1 121 ? 128.749 49.564  -3.975  1.00 10.98  ? 118 LEU B C   1 
ATOM   4638  O O   . LEU B  1 121 ? 129.856 49.927  -4.400  1.00 10.90  ? 118 LEU B O   1 
ATOM   4639  C CB  . LEU B  1 121 ? 127.491 51.344  -5.201  1.00 11.05  ? 118 LEU B CB  1 
ATOM   4640  C CG  . LEU B  1 121 ? 126.536 51.629  -6.345  1.00 11.21  ? 118 LEU B CG  1 
ATOM   4641  C CD1 . LEU B  1 121 ? 126.350 53.141  -6.544  1.00 11.40  ? 118 LEU B CD1 1 
ATOM   4642  C CD2 . LEU B  1 121 ? 127.071 50.962  -7.616  1.00 11.16  ? 118 LEU B CD2 1 
ATOM   4643  N N   . LYS B  1 122 ? 128.584 48.916  -2.814  1.00 11.00  ? 119 LYS B N   1 
ATOM   4644  C CA  . LYS B  1 122 ? 129.741 48.518  -1.979  1.00 10.97  ? 119 LYS B CA  1 
ATOM   4645  C C   . LYS B  1 122 ? 130.663 47.544  -2.708  1.00 10.86  ? 119 LYS B C   1 
ATOM   4646  O O   . LYS B  1 122 ? 130.195 46.545  -3.279  1.00 10.72  ? 119 LYS B O   1 
ATOM   4647  C CB  . LYS B  1 122 ? 129.284 47.899  -0.660  1.00 10.92  ? 119 LYS B CB  1 
ATOM   4648  C CG  . LYS B  1 122 ? 128.720 48.915  0.320   1.00 10.89  ? 119 LYS B CG  1 
ATOM   4649  C CD  . LYS B  1 122 ? 128.202 48.232  1.574   1.00 10.90  ? 119 LYS B CD  1 
ATOM   4650  C CE  . LYS B  1 122 ? 127.901 49.227  2.675   1.00 10.93  ? 119 LYS B CE  1 
ATOM   4651  N NZ  . LYS B  1 122 ? 127.250 48.576  3.847   1.00 10.98  ? 119 LYS B NZ  1 
ATOM   4652  N N   . GLY B  1 123 ? 131.954 47.876  -2.723  1.00 10.84  ? 120 GLY B N   1 
ATOM   4653  C CA  . GLY B  1 123 ? 132.991 46.997  -3.249  1.00 10.94  ? 120 GLY B CA  1 
ATOM   4654  C C   . GLY B  1 123 ? 133.474 46.051  -2.176  1.00 11.32  ? 120 GLY B C   1 
ATOM   4655  O O   . GLY B  1 123 ? 132.924 45.986  -1.090  1.00 11.02  ? 120 GLY B O   1 
ATOM   4656  N N   . GLU B  1 124 ? 134.521 45.313  -2.479  1.00 12.45  ? 121 GLU B N   1 
ATOM   4657  C CA  . GLU B  1 124 ? 135.094 44.354  -1.538  1.00 13.34  ? 121 GLU B CA  1 
ATOM   4658  C C   . GLU B  1 124 ? 136.511 44.797  -1.280  1.00 13.95  ? 121 GLU B C   1 
ATOM   4659  O O   . GLU B  1 124 ? 137.301 44.865  -2.211  1.00 13.37  ? 121 GLU B O   1 
ATOM   4660  C CB  . GLU B  1 124 ? 135.071 42.929  -2.114  1.00 13.66  ? 121 GLU B CB  1 
ATOM   4661  C CG  . GLU B  1 124 ? 133.669 42.338  -2.279  1.00 13.67  ? 121 GLU B CG  1 
ATOM   4662  C CD  . GLU B  1 124 ? 133.669 40.926  -2.850  1.00 14.06  ? 121 GLU B CD  1 
ATOM   4663  O OE1 . GLU B  1 124 ? 134.295 40.666  -3.895  1.00 14.99  ? 121 GLU B OE1 1 
ATOM   4664  O OE2 . GLU B  1 124 ? 133.034 40.052  -2.252  1.00 14.49  ? 121 GLU B OE2 1 
ATOM   4665  N N   . HIS B  1 125 ? 136.806 45.127  -0.024  1.00 15.06  ? 122 HIS B N   1 
ATOM   4666  C CA  . HIS B  1 125 ? 138.141 45.514  0.396   1.00 16.45  ? 122 HIS B CA  1 
ATOM   4667  C C   . HIS B  1 125 ? 138.811 44.292  0.975   1.00 16.88  ? 122 HIS B C   1 
ATOM   4668  O O   . HIS B  1 125 ? 138.173 43.545  1.713   1.00 16.89  ? 122 HIS B O   1 
ATOM   4669  C CB  . HIS B  1 125 ? 138.046 46.620  1.446   1.00 17.90  ? 122 HIS B CB  1 
ATOM   4670  C CG  . HIS B  1 125 ? 139.352 47.299  1.772   1.00 19.30  ? 122 HIS B CG  1 
ATOM   4671  N ND1 . HIS B  1 125 ? 139.800 48.428  1.115   1.00 19.76  ? 122 HIS B ND1 1 
ATOM   4672  C CD2 . HIS B  1 125 ? 140.268 47.042  2.735   1.00 20.24  ? 122 HIS B CD2 1 
ATOM   4673  C CE1 . HIS B  1 125 ? 140.955 48.812  1.631   1.00 20.68  ? 122 HIS B CE1 1 
ATOM   4674  N NE2 . HIS B  1 125 ? 141.257 47.993  2.620   1.00 20.77  ? 122 HIS B NE2 1 
ATOM   4675  N N   . SER B  1 126 ? 140.085 44.099  0.628   1.00 17.52  ? 123 SER B N   1 
ATOM   4676  C CA  . SER B  1 126 ? 140.894 42.979  1.091   1.00 18.00  ? 123 SER B CA  1 
ATOM   4677  C C   . SER B  1 126 ? 142.200 43.497  1.660   1.00 19.20  ? 123 SER B C   1 
ATOM   4678  O O   . SER B  1 126 ? 142.988 44.110  0.941   1.00 18.47  ? 123 SER B O   1 
ATOM   4679  C CB  . SER B  1 126 ? 141.210 42.036  -0.069  1.00 17.80  ? 123 SER B CB  1 
ATOM   4680  O OG  . SER B  1 126 ? 140.104 41.251  -0.452  1.00 16.92  ? 123 SER B OG  1 
ATOM   4681  N N   . ARG B  1 127 ? 142.427 43.225  2.941   1.00 21.82  ? 124 ARG B N   1 
ATOM   4682  C CA  . ARG B  1 127 ? 143.665 43.612  3.645   1.00 24.23  ? 124 ARG B CA  1 
ATOM   4683  C C   . ARG B  1 127 ? 144.770 42.580  3.420   1.00 22.01  ? 124 ARG B C   1 
ATOM   4684  O O   . ARG B  1 127 ? 144.549 41.402  3.615   1.00 22.47  ? 124 ARG B O   1 
ATOM   4685  C CB  . ARG B  1 127 ? 143.377 43.755  5.145   1.00 28.86  ? 124 ARG B CB  1 
ATOM   4686  C CG  . ARG B  1 127 ? 144.583 44.018  6.049   1.00 35.16  ? 124 ARG B CG  1 
ATOM   4687  C CD  . ARG B  1 127 ? 144.181 44.203  7.523   1.00 38.30  ? 124 ARG B CD  1 
ATOM   4688  N NE  . ARG B  1 127 ? 145.341 44.459  8.402   1.00 41.54  ? 124 ARG B NE  1 
ATOM   4689  C CZ  . ARG B  1 127 ? 145.963 43.557  9.175   1.00 43.98  ? 124 ARG B CZ  1 
ATOM   4690  N NH1 . ARG B  1 127 ? 145.553 42.284  9.217   1.00 49.71  ? 124 ARG B NH1 1 
ATOM   4691  N NH2 . ARG B  1 127 ? 147.008 43.928  9.927   1.00 41.32  ? 124 ARG B NH2 1 
ATOM   4692  N N   . ASN B  1 128 ? 145.952 43.038  3.025   1.00 19.95  ? 125 ASN B N   1 
ATOM   4693  C CA  . ASN B  1 128 ? 147.129 42.194  2.890   1.00 18.69  ? 125 ASN B CA  1 
ATOM   4694  C C   . ASN B  1 128 ? 146.905 41.008  1.980   1.00 18.30  ? 125 ASN B C   1 
ATOM   4695  O O   . ASN B  1 128 ? 146.866 39.864  2.424   1.00 17.05  ? 125 ASN B O   1 
ATOM   4696  C CB  . ASN B  1 128 ? 147.630 41.691  4.237   1.00 18.93  ? 125 ASN B CB  1 
ATOM   4697  C CG  . ASN B  1 128 ? 148.220 42.779  5.095   1.00 19.19  ? 125 ASN B CG  1 
ATOM   4698  O OD1 . ASN B  1 128 ? 148.695 43.803  4.598   1.00 19.35  ? 125 ASN B OD1 1 
ATOM   4699  N ND2 . ASN B  1 128 ? 148.227 42.543  6.414   1.00 19.41  ? 125 ASN B ND2 1 
ATOM   4700  N N   . VAL B  1 129 ? 146.798 41.297  0.692   1.00 18.14  ? 126 VAL B N   1 
ATOM   4701  C CA  . VAL B  1 129 ? 146.792 40.257  -0.317  1.00 18.25  ? 126 VAL B CA  1 
ATOM   4702  C C   . VAL B  1 129 ? 148.191 39.686  -0.449  1.00 19.38  ? 126 VAL B C   1 
ATOM   4703  O O   . VAL B  1 129 ? 148.375 38.507  -0.768  1.00 21.22  ? 126 VAL B O   1 
ATOM   4704  C CB  . VAL B  1 129 ? 146.227 40.746  -1.658  1.00 18.00  ? 126 VAL B CB  1 
ATOM   4705  C CG1 . VAL B  1 129 ? 144.822 41.272  -1.460  1.00 18.14  ? 126 VAL B CG1 1 
ATOM   4706  C CG2 . VAL B  1 129 ? 147.062 41.815  -2.312  1.00 18.22  ? 126 VAL B CG2 1 
ATOM   4707  N N   . GLY B  1 130 ? 149.170 40.546  -0.211  1.00 20.11  ? 127 GLY B N   1 
ATOM   4708  C CA  . GLY B  1 130 ? 150.529 40.136  0.115   1.00 21.23  ? 127 GLY B CA  1 
ATOM   4709  C C   . GLY B  1 130 ? 151.000 41.006  1.268   1.00 22.17  ? 127 GLY B C   1 
ATOM   4710  O O   . GLY B  1 130 ? 150.272 41.889  1.708   1.00 21.97  ? 127 GLY B O   1 
ATOM   4711  N N   . PRO B  1 131 ? 152.233 40.798  1.749   1.00 23.86  ? 128 PRO B N   1 
ATOM   4712  C CA  . PRO B  1 131 ? 152.692 41.616  2.866   1.00 24.37  ? 128 PRO B CA  1 
ATOM   4713  C C   . PRO B  1 131 ? 152.719 43.112  2.493   1.00 23.89  ? 128 PRO B C   1 
ATOM   4714  O O   . PRO B  1 131 ? 153.332 43.494  1.498   1.00 24.02  ? 128 PRO B O   1 
ATOM   4715  C CB  . PRO B  1 131 ? 154.093 41.054  3.169   1.00 24.88  ? 128 PRO B CB  1 
ATOM   4716  C CG  . PRO B  1 131 ? 154.134 39.732  2.481   1.00 25.32  ? 128 PRO B CG  1 
ATOM   4717  C CD  . PRO B  1 131 ? 153.304 39.927  1.251   1.00 24.88  ? 128 PRO B CD  1 
ATOM   4718  N N   . GLY B  1 132 ? 151.995 43.917  3.272   1.00 24.12  ? 129 GLY B N   1 
ATOM   4719  C CA  . GLY B  1 132 ? 151.859 45.371  3.061   1.00 24.25  ? 129 GLY B CA  1 
ATOM   4720  C C   . GLY B  1 132 ? 151.171 45.855  1.777   1.00 24.10  ? 129 GLY B C   1 
ATOM   4721  O O   . GLY B  1 132 ? 151.320 47.024  1.379   1.00 24.47  ? 129 GLY B O   1 
ATOM   4722  N N   . ILE B  1 133 ? 150.414 44.966  1.138   1.00 22.56  ? 130 ILE B N   1 
ATOM   4723  C CA  . ILE B  1 133 ? 149.733 45.262  -0.102  1.00 21.00  ? 130 ILE B CA  1 
ATOM   4724  C C   . ILE B  1 133 ? 148.252 45.003  0.096   1.00 19.82  ? 130 ILE B C   1 
ATOM   4725  O O   . ILE B  1 133 ? 147.867 43.885  0.386   1.00 19.65  ? 130 ILE B O   1 
ATOM   4726  C CB  . ILE B  1 133 ? 150.230 44.357  -1.252  1.00 22.27  ? 130 ILE B CB  1 
ATOM   4727  C CG1 . ILE B  1 133 ? 151.749 44.488  -1.425  1.00 22.31  ? 130 ILE B CG1 1 
ATOM   4728  C CG2 . ILE B  1 133 ? 149.481 44.673  -2.567  1.00 21.78  ? 130 ILE B CG2 1 
ATOM   4729  C CD1 . ILE B  1 133 ? 152.327 43.526  -2.439  1.00 22.18  ? 130 ILE B CD1 1 
ATOM   4730  N N   . ASP B  1 134 ? 147.429 46.037  -0.075  1.00 19.08  ? 131 ASP B N   1 
ATOM   4731  C CA  . ASP B  1 134 ? 145.960 45.927  -0.038  1.00 18.31  ? 131 ASP B CA  1 
ATOM   4732  C C   . ASP B  1 134 ? 145.312 46.090  -1.395  1.00 17.09  ? 131 ASP B C   1 
ATOM   4733  O O   . ASP B  1 134 ? 145.822 46.763  -2.263  1.00 17.18  ? 131 ASP B O   1 
ATOM   4734  C CB  . ASP B  1 134 ? 145.377 46.998  0.842   1.00 19.43  ? 131 ASP B CB  1 
ATOM   4735  C CG  . ASP B  1 134 ? 145.838 46.897  2.253   1.00 20.50  ? 131 ASP B CG  1 
ATOM   4736  O OD1 . ASP B  1 134 ? 146.314 45.818  2.647   1.00 20.36  ? 131 ASP B OD1 1 
ATOM   4737  O OD2 . ASP B  1 134 ? 145.739 47.921  2.971   1.00 22.44  ? 131 ASP B OD2 1 
ATOM   4738  N N   . SER B  1 135 ? 144.143 45.502  -1.557  1.00 16.27  ? 132 SER B N   1 
ATOM   4739  C CA  . SER B  1 135 ? 143.433 45.563  -2.831  1.00 15.68  ? 132 SER B CA  1 
ATOM   4740  C C   . SER B  1 135 ? 141.944 45.661  -2.573  1.00 15.08  ? 132 SER B C   1 
ATOM   4741  O O   . SER B  1 135 ? 141.450 45.192  -1.573  1.00 14.98  ? 132 SER B O   1 
ATOM   4742  C CB  . SER B  1 135 ? 143.766 44.316  -3.655  1.00 16.01  ? 132 SER B CB  1 
ATOM   4743  O OG  . SER B  1 135 ? 143.003 44.199  -4.834  1.00 15.81  ? 132 SER B OG  1 
ATOM   4744  N N   . TRP B  1 136 ? 141.232 46.283  -3.484  1.00 15.13  ? 133 TRP B N   1 
ATOM   4745  C CA  . TRP B  1 136 ? 139.785 46.407  -3.368  1.00 15.59  ? 133 TRP B CA  1 
ATOM   4746  C C   . TRP B  1 136 ? 139.130 46.595  -4.723  1.00 15.19  ? 133 TRP B C   1 
ATOM   4747  O O   . TRP B  1 136 ? 139.754 47.090  -5.670  1.00 15.29  ? 133 TRP B O   1 
ATOM   4748  C CB  . TRP B  1 136 ? 139.402 47.585  -2.464  1.00 16.27  ? 133 TRP B CB  1 
ATOM   4749  C CG  . TRP B  1 136 ? 139.816 48.903  -3.014  1.00 17.03  ? 133 TRP B CG  1 
ATOM   4750  C CD1 . TRP B  1 136 ? 139.081 49.721  -3.822  1.00 17.32  ? 133 TRP B CD1 1 
ATOM   4751  C CD2 . TRP B  1 136 ? 141.083 49.545  -2.835  1.00 17.36  ? 133 TRP B CD2 1 
ATOM   4752  N NE1 . TRP B  1 136 ? 139.808 50.840  -4.151  1.00 17.34  ? 133 TRP B NE1 1 
ATOM   4753  C CE2 . TRP B  1 136 ? 141.039 50.759  -3.558  1.00 17.17  ? 133 TRP B CE2 1 
ATOM   4754  C CE3 . TRP B  1 136 ? 142.243 49.218  -2.123  1.00 17.91  ? 133 TRP B CE3 1 
ATOM   4755  C CZ2 . TRP B  1 136 ? 142.109 51.646  -3.600  1.00 17.45  ? 133 TRP B CZ2 1 
ATOM   4756  C CZ3 . TRP B  1 136 ? 143.312 50.107  -2.159  1.00 18.38  ? 133 TRP B CZ3 1 
ATOM   4757  C CH2 . TRP B  1 136 ? 143.230 51.317  -2.897  1.00 18.19  ? 133 TRP B CH2 1 
ATOM   4758  N N   . SER B  1 137 ? 137.859 46.220  -4.805  1.00 14.81  ? 134 SER B N   1 
ATOM   4759  C CA  . SER B  1 137 ? 137.109 46.347  -6.040  1.00 14.39  ? 134 SER B CA  1 
ATOM   4760  C C   . SER B  1 137 ? 136.198 47.557  -5.984  1.00 14.80  ? 134 SER B C   1 
ATOM   4761  O O   . SER B  1 137 ? 135.732 47.977  -4.930  1.00 15.00  ? 134 SER B O   1 
ATOM   4762  C CB  . SER B  1 137 ? 136.309 45.103  -6.313  1.00 14.26  ? 134 SER B CB  1 
ATOM   4763  O OG  . SER B  1 137 ? 135.536 44.737  -5.186  1.00 14.21  ? 134 SER B OG  1 
ATOM   4764  N N   . GLU B  1 138 ? 135.982 48.152  -7.142  1.00 15.50  ? 135 GLU B N   1 
ATOM   4765  C CA  . GLU B  1 138 ? 135.046 49.243  -7.287  1.00 15.84  ? 135 GLU B CA  1 
ATOM   4766  C C   . GLU B  1 138 ? 134.203 48.929  -8.502  1.00 15.47  ? 135 GLU B C   1 
ATOM   4767  O O   . GLU B  1 138 ? 134.713 48.618  -9.564  1.00 15.64  ? 135 GLU B O   1 
ATOM   4768  C CB  . GLU B  1 138 ? 135.764 50.591  -7.447  1.00 16.69  ? 135 GLU B CB  1 
ATOM   4769  C CG  . GLU B  1 138 ? 136.329 51.200  -6.159  1.00 17.44  ? 135 GLU B CG  1 
ATOM   4770  C CD  . GLU B  1 138 ? 136.997 52.546  -6.384  1.00 17.95  ? 135 GLU B CD  1 
ATOM   4771  O OE1 . GLU B  1 138 ? 136.609 53.248  -7.317  1.00 19.38  ? 135 GLU B OE1 1 
ATOM   4772  O OE2 . GLU B  1 138 ? 137.922 52.915  -5.652  1.00 18.96  ? 135 GLU B OE2 1 
ATOM   4773  N N   . PHE B  1 139 ? 132.900 48.980  -8.315  1.00 15.66  ? 136 PHE B N   1 
ATOM   4774  C CA  . PHE B  1 139 ? 131.957 48.954  -9.414  1.00 15.93  ? 136 PHE B CA  1 
ATOM   4775  C C   . PHE B  1 139 ? 131.632 50.369  -9.917  1.00 15.79  ? 136 PHE B C   1 
ATOM   4776  O O   . PHE B  1 139 ? 130.717 51.011  -9.409  1.00 15.60  ? 136 PHE B O   1 
ATOM   4777  C CB  . PHE B  1 139 ? 130.706 48.252  -8.943  1.00 16.38  ? 136 PHE B CB  1 
ATOM   4778  C CG  . PHE B  1 139 ? 130.958 46.868  -8.424  1.00 17.12  ? 136 PHE B CG  1 
ATOM   4779  C CD1 . PHE B  1 139 ? 131.568 45.912  -9.224  1.00 17.69  ? 136 PHE B CD1 1 
ATOM   4780  C CD2 . PHE B  1 139 ? 130.556 46.507  -7.155  1.00 18.06  ? 136 PHE B CD2 1 
ATOM   4781  C CE1 . PHE B  1 139 ? 131.784 44.624  -8.773  1.00 18.00  ? 136 PHE B CE1 1 
ATOM   4782  C CE2 . PHE B  1 139 ? 130.782 45.219  -6.689  1.00 18.99  ? 136 PHE B CE2 1 
ATOM   4783  C CZ  . PHE B  1 139 ? 131.395 44.274  -7.502  1.00 18.59  ? 136 PHE B CZ  1 
ATOM   4784  N N   . GLN B  1 140 ? 132.409 50.852  -10.896 1.00 15.80  ? 137 GLN B N   1 
ATOM   4785  C CA  . GLN B  1 140 ? 132.295 52.229  -11.387 1.00 15.40  ? 137 GLN B CA  1 
ATOM   4786  C C   . GLN B  1 140 ? 131.262 52.318  -12.517 1.00 15.59  ? 137 GLN B C   1 
ATOM   4787  O O   . GLN B  1 140 ? 130.828 51.287  -13.038 1.00 15.43  ? 137 GLN B O   1 
ATOM   4788  C CB  . GLN B  1 140 ? 133.662 52.740  -11.834 1.00 15.07  ? 137 GLN B CB  1 
ATOM   4789  C CG  . GLN B  1 140 ? 134.652 52.820  -10.698 1.00 14.85  ? 137 GLN B CG  1 
ATOM   4790  C CD  . GLN B  1 140 ? 135.930 53.568  -11.051 1.00 14.82  ? 137 GLN B CD  1 
ATOM   4791  O OE1 . GLN B  1 140 ? 136.438 53.506  -12.175 1.00 14.26  ? 137 GLN B OE1 1 
ATOM   4792  N NE2 . GLN B  1 140 ? 136.479 54.253  -10.064 1.00 14.76  ? 137 GLN B NE2 1 
ATOM   4793  N N   . PRO B  1 141 ? 130.850 53.539  -12.887 1.00 15.53  ? 138 PRO B N   1 
ATOM   4794  C CA  . PRO B  1 141 ? 129.844 53.683  -13.934 1.00 16.02  ? 138 PRO B CA  1 
ATOM   4795  C C   . PRO B  1 141 ? 130.334 53.354  -15.323 1.00 16.68  ? 138 PRO B C   1 
ATOM   4796  O O   . PRO B  1 141 ? 131.527 53.461  -15.590 1.00 17.40  ? 138 PRO B O   1 
ATOM   4797  C CB  . PRO B  1 141 ? 129.479 55.164  -13.873 1.00 16.11  ? 138 PRO B CB  1 
ATOM   4798  C CG  . PRO B  1 141 ? 129.904 55.601  -12.512 1.00 16.21  ? 138 PRO B CG  1 
ATOM   4799  C CD  . PRO B  1 141 ? 131.127 54.816  -12.219 1.00 15.78  ? 138 PRO B CD  1 
ATOM   4800  N N   . MET B  1 142 ? 129.395 53.002  -16.195 1.00 17.54  ? 139 MET B N   1 
ATOM   4801  C CA  . MET B  1 142 ? 129.656 52.652  -17.599 1.00 18.35  ? 139 MET B CA  1 
ATOM   4802  C C   . MET B  1 142 ? 129.838 53.888  -18.489 1.00 17.72  ? 139 MET B C   1 
ATOM   4803  O O   . MET B  1 142 ? 130.757 53.986  -19.328 1.00 16.56  ? 139 MET B O   1 
ATOM   4804  C CB  . MET B  1 142 ? 128.471 51.857  -18.150 1.00 19.34  ? 139 MET B CB  1 
ATOM   4805  C CG  . MET B  1 142 ? 128.213 50.518  -17.484 1.00 19.99  ? 139 MET B CG  1 
ATOM   4806  S SD  . MET B  1 142 ? 129.588 49.401  -17.711 1.00 22.65  ? 139 MET B SD  1 
ATOM   4807  C CE  . MET B  1 142 ? 129.748 49.259  -19.498 1.00 23.19  ? 139 MET B CE  1 
ATOM   4808  N N   . GLY B  1 143 ? 128.915 54.816  -18.307 1.00 17.60  ? 140 GLY B N   1 
ATOM   4809  C CA  . GLY B  1 143 ? 128.803 55.989  -19.177 1.00 17.85  ? 140 GLY B CA  1 
ATOM   4810  C C   . GLY B  1 143 ? 127.371 56.127  -19.679 1.00 17.43  ? 140 GLY B C   1 
ATOM   4811  O O   . GLY B  1 143 ? 126.427 56.081  -18.881 1.00 16.78  ? 140 GLY B O   1 
ATOM   4812  N N   . VAL B  1 144 ? 127.207 56.276  -21.002 1.00 16.79  ? 141 VAL B N   1 
ATOM   4813  C CA  . VAL B  1 144 ? 125.868 56.412  -21.594 1.00 16.14  ? 141 VAL B CA  1 
ATOM   4814  C C   . VAL B  1 144 ? 125.280 55.037  -21.817 1.00 14.85  ? 141 VAL B C   1 
ATOM   4815  O O   . VAL B  1 144 ? 125.879 54.207  -22.473 1.00 14.94  ? 141 VAL B O   1 
ATOM   4816  C CB  . VAL B  1 144 ? 125.863 57.194  -22.923 1.00 16.14  ? 141 VAL B CB  1 
ATOM   4817  C CG1 . VAL B  1 144 ? 124.440 57.327  -23.427 1.00 16.37  ? 141 VAL B CG1 1 
ATOM   4818  C CG2 . VAL B  1 144 ? 126.425 58.593  -22.747 1.00 15.90  ? 141 VAL B CG2 1 
ATOM   4819  N N   . VAL B  1 145 ? 124.098 54.823  -21.283 1.00 13.97  ? 142 VAL B N   1 
ATOM   4820  C CA  . VAL B  1 145 ? 123.450 53.536  -21.351 1.00 13.91  ? 142 VAL B CA  1 
ATOM   4821  C C   . VAL B  1 145 ? 122.187 53.661  -22.155 1.00 13.29  ? 142 VAL B C   1 
ATOM   4822  O O   . VAL B  1 145 ? 121.503 54.677  -22.058 1.00 14.27  ? 142 VAL B O   1 
ATOM   4823  C CB  . VAL B  1 145 ? 123.127 53.066  -19.942 1.00 14.34  ? 142 VAL B CB  1 
ATOM   4824  C CG1 . VAL B  1 145 ? 122.233 51.842  -19.946 1.00 14.80  ? 142 VAL B CG1 1 
ATOM   4825  C CG2 . VAL B  1 145 ? 124.427 52.738  -19.244 1.00 14.83  ? 142 VAL B CG2 1 
ATOM   4826  N N   . ALA B  1 146 ? 121.877 52.639  -22.943 1.00 12.20  ? 143 ALA B N   1 
ATOM   4827  C CA  . ALA B  1 146 ? 120.650 52.629  -23.733 1.00 12.12  ? 143 ALA B CA  1 
ATOM   4828  C C   . ALA B  1 146 ? 119.593 51.646  -23.183 1.00 12.12  ? 143 ALA B C   1 
ATOM   4829  O O   . ALA B  1 146 ? 119.914 50.521  -22.798 1.00 12.22  ? 143 ALA B O   1 
ATOM   4830  C CB  . ALA B  1 146 ? 120.963 52.321  -25.192 1.00 12.04  ? 143 ALA B CB  1 
ATOM   4831  N N   . GLY B  1 147 ? 118.337 52.088  -23.136 1.00 12.17  ? 144 GLY B N   1 
ATOM   4832  C CA  . GLY B  1 147 ? 117.193 51.239  -22.737 1.00 12.41  ? 144 GLY B CA  1 
ATOM   4833  C C   . GLY B  1 147 ? 116.121 51.159  -23.821 1.00 12.84  ? 144 GLY B C   1 
ATOM   4834  O O   . GLY B  1 147 ? 115.749 52.188  -24.422 1.00 12.65  ? 144 GLY B O   1 
ATOM   4835  N N   . ILE B  1 148 ? 115.647 49.943  -24.107 1.00 13.01  ? 145 ILE B N   1 
ATOM   4836  C CA  . ILE B  1 148 ? 114.631 49.736  -25.132 1.00 13.62  ? 145 ILE B CA  1 
ATOM   4837  C C   . ILE B  1 148 ? 113.557 48.836  -24.554 1.00 14.44  ? 145 ILE B C   1 
ATOM   4838  O O   . ILE B  1 148 ? 113.833 47.711  -24.180 1.00 14.64  ? 145 ILE B O   1 
ATOM   4839  C CB  . ILE B  1 148 ? 115.204 49.096  -26.415 1.00 13.56  ? 145 ILE B CB  1 
ATOM   4840  C CG1 . ILE B  1 148 ? 116.264 49.995  -27.050 1.00 13.25  ? 145 ILE B CG1 1 
ATOM   4841  C CG2 . ILE B  1 148 ? 114.088 48.794  -27.422 1.00 13.52  ? 145 ILE B CG2 1 
ATOM   4842  C CD1 . ILE B  1 148 ? 117.179 49.234  -27.960 1.00 13.29  ? 145 ILE B CD1 1 
ATOM   4843  N N   . THR B  1 149 ? 112.323 49.332  -24.531 1.00 15.62  ? 146 THR B N   1 
ATOM   4844  C CA  . THR B  1 149 ? 111.259 48.718  -23.763 1.00 16.37  ? 146 THR B CA  1 
ATOM   4845  C C   . THR B  1 149 ? 110.098 48.402  -24.649 1.00 16.60  ? 146 THR B C   1 
ATOM   4846  O O   . THR B  1 149 ? 109.917 49.062  -25.642 1.00 16.66  ? 146 THR B O   1 
ATOM   4847  C CB  . THR B  1 149 ? 110.765 49.659  -22.649 1.00 16.85  ? 146 THR B CB  1 
ATOM   4848  O OG1 . THR B  1 149 ? 110.191 50.841  -23.225 1.00 16.41  ? 146 THR B OG1 1 
ATOM   4849  C CG2 . THR B  1 149 ? 111.924 50.002  -21.702 1.00 17.25  ? 146 THR B CG2 1 
ATOM   4850  N N   . PRO B  1 150 ? 109.278 47.429  -24.260 1.00 17.69  ? 147 PRO B N   1 
ATOM   4851  C CA  . PRO B  1 150 ? 108.190 46.992  -25.044 1.00 18.69  ? 147 PRO B CA  1 
ATOM   4852  C C   . PRO B  1 150 ? 106.925 47.746  -24.647 1.00 19.94  ? 147 PRO B C   1 
ATOM   4853  O O   . PRO B  1 150 ? 106.978 48.625  -23.773 1.00 20.29  ? 147 PRO B O   1 
ATOM   4854  C CB  . PRO B  1 150 ? 108.097 45.540  -24.634 1.00 19.61  ? 147 PRO B CB  1 
ATOM   4855  C CG  . PRO B  1 150 ? 108.329 45.594  -23.157 1.00 19.38  ? 147 PRO B CG  1 
ATOM   4856  C CD  . PRO B  1 150 ? 109.237 46.771  -22.944 1.00 19.01  ? 147 PRO B CD  1 
ATOM   4857  N N   . PHE B  1 151 ? 105.808 47.402  -25.299 1.00 21.36  ? 148 PHE B N   1 
ATOM   4858  C CA  . PHE B  1 151 ? 104.528 48.106  -25.125 1.00 22.55  ? 148 PHE B CA  1 
ATOM   4859  C C   . PHE B  1 151 ? 103.789 47.697  -23.867 1.00 23.13  ? 148 PHE B C   1 
ATOM   4860  O O   . PHE B  1 151 ? 103.122 48.523  -23.253 1.00 23.85  ? 148 PHE B O   1 
ATOM   4861  C CB  . PHE B  1 151 ? 103.593 47.912  -26.350 1.00 23.24  ? 148 PHE B CB  1 
ATOM   4862  C CG  . PHE B  1 151 ? 102.861 46.587  -26.385 1.00 23.59  ? 148 PHE B CG  1 
ATOM   4863  C CD1 . PHE B  1 151 ? 101.675 46.403  -25.694 1.00 24.16  ? 148 PHE B CD1 1 
ATOM   4864  C CD2 . PHE B  1 151 ? 103.359 45.521  -27.129 1.00 25.13  ? 148 PHE B CD2 1 
ATOM   4865  C CE1 . PHE B  1 151 ? 101.016 45.178  -25.723 1.00 24.88  ? 148 PHE B CE1 1 
ATOM   4866  C CE2 . PHE B  1 151 ? 102.703 44.295  -27.173 1.00 24.88  ? 148 PHE B CE2 1 
ATOM   4867  C CZ  . PHE B  1 151 ? 101.528 44.124  -26.470 1.00 24.88  ? 148 PHE B CZ  1 
ATOM   4868  N N   . ASN B  1 152 ? 103.879 46.422  -23.506 1.00 23.52  ? 149 ASN B N   1 
ATOM   4869  C CA  . ASN B  1 152 ? 102.978 45.867  -22.487 1.00 24.59  ? 149 ASN B CA  1 
ATOM   4870  C C   . ASN B  1 152 ? 103.139 46.452  -21.105 1.00 22.13  ? 149 ASN B C   1 
ATOM   4871  O O   . ASN B  1 152 ? 102.200 46.370  -20.292 1.00 20.58  ? 149 ASN B O   1 
ATOM   4872  C CB  . ASN B  1 152 ? 103.043 44.341  -22.402 1.00 27.36  ? 149 ASN B CB  1 
ATOM   4873  C CG  . ASN B  1 152 ? 104.448 43.815  -22.372 1.00 29.77  ? 149 ASN B CG  1 
ATOM   4874  O OD1 . ASN B  1 152 ? 105.294 44.295  -23.113 1.00 33.68  ? 149 ASN B OD1 1 
ATOM   4875  N ND2 . ASN B  1 152 ? 104.703 42.803  -21.543 1.00 31.85  ? 149 ASN B ND2 1 
ATOM   4876  N N   . PHE B  1 153 ? 104.308 47.056  -20.863 1.00 19.53  ? 150 PHE B N   1 
ATOM   4877  C CA  . PHE B  1 153 ? 104.586 47.761  -19.622 1.00 17.49  ? 150 PHE B CA  1 
ATOM   4878  C C   . PHE B  1 153 ? 105.359 49.029  -19.881 1.00 16.73  ? 150 PHE B C   1 
ATOM   4879  O O   . PHE B  1 153 ? 106.565 49.107  -19.588 1.00 16.26  ? 150 PHE B O   1 
ATOM   4880  C CB  . PHE B  1 153 ? 105.403 46.885  -18.723 1.00 17.16  ? 150 PHE B CB  1 
ATOM   4881  C CG  . PHE B  1 153 ? 104.646 45.749  -18.136 1.00 16.97  ? 150 PHE B CG  1 
ATOM   4882  C CD1 . PHE B  1 153 ? 103.736 45.963  -17.106 1.00 16.53  ? 150 PHE B CD1 1 
ATOM   4883  C CD2 . PHE B  1 153 ? 104.871 44.464  -18.577 1.00 16.97  ? 150 PHE B CD2 1 
ATOM   4884  C CE1 . PHE B  1 153 ? 103.063 44.918  -16.542 1.00 16.42  ? 150 PHE B CE1 1 
ATOM   4885  C CE2 . PHE B  1 153 ? 104.185 43.407  -18.020 1.00 16.88  ? 150 PHE B CE2 1 
ATOM   4886  C CZ  . PHE B  1 153 ? 103.284 43.638  -17.002 1.00 16.70  ? 150 PHE B CZ  1 
ATOM   4887  N N   . PRO B  1 154 ? 104.667 50.052  -20.390 1.00 15.98  ? 151 PRO B N   1 
ATOM   4888  C CA  . PRO B  1 154 ? 105.326 51.283  -20.782 1.00 16.00  ? 151 PRO B CA  1 
ATOM   4889  C C   . PRO B  1 154 ? 105.841 52.101  -19.627 1.00 16.05  ? 151 PRO B C   1 
ATOM   4890  O O   . PRO B  1 154 ? 106.532 53.087  -19.883 1.00 15.61  ? 151 PRO B O   1 
ATOM   4891  C CB  . PRO B  1 154 ? 104.219 52.057  -21.453 1.00 15.90  ? 151 PRO B CB  1 
ATOM   4892  C CG  . PRO B  1 154 ? 103.027 51.651  -20.677 1.00 16.01  ? 151 PRO B CG  1 
ATOM   4893  C CD  . PRO B  1 154 ? 103.210 50.193  -20.432 1.00 15.87  ? 151 PRO B CD  1 
ATOM   4894  N N   . VAL B  1 155 ? 105.462 51.733  -18.394 1.00 16.26  ? 152 VAL B N   1 
ATOM   4895  C CA  . VAL B  1 155 ? 105.980 52.379  -17.168 1.00 16.28  ? 152 VAL B CA  1 
ATOM   4896  C C   . VAL B  1 155 ? 106.972 51.510  -16.388 1.00 15.62  ? 152 VAL B C   1 
ATOM   4897  O O   . VAL B  1 155 ? 108.066 51.971  -16.049 1.00 14.52  ? 152 VAL B O   1 
ATOM   4898  C CB  . VAL B  1 155 ? 104.813 52.834  -16.272 1.00 16.47  ? 152 VAL B CB  1 
ATOM   4899  C CG1 . VAL B  1 155 ? 105.289 53.178  -14.869 1.00 16.80  ? 152 VAL B CG1 1 
ATOM   4900  C CG2 . VAL B  1 155 ? 104.139 54.042  -16.910 1.00 16.43  ? 152 VAL B CG2 1 
ATOM   4901  N N   . MET B  1 156 ? 106.590 50.259  -16.143 1.00 15.46  ? 153 MET B N   1 
ATOM   4902  C CA  . MET B  1 156 ? 107.346 49.394  -15.268 1.00 15.99  ? 153 MET B CA  1 
ATOM   4903  C C   . MET B  1 156 ? 108.674 48.944  -15.881 1.00 15.93  ? 153 MET B C   1 
ATOM   4904  O O   . MET B  1 156 ? 109.733 49.042  -15.244 1.00 16.52  ? 153 MET B O   1 
ATOM   4905  C CB  . MET B  1 156 ? 106.502 48.199  -14.866 1.00 16.45  ? 153 MET B CB  1 
ATOM   4906  C CG  . MET B  1 156 ? 107.143 47.295  -13.820 1.00 17.27  ? 153 MET B CG  1 
ATOM   4907  S SD  . MET B  1 156 ? 106.281 45.720  -13.664 1.00 17.83  ? 153 MET B SD  1 
ATOM   4908  C CE  . MET B  1 156 ? 106.778 44.969  -15.212 1.00 17.30  ? 153 MET B CE  1 
ATOM   4909  N N   . VAL B  1 157 ? 108.640 48.464  -17.108 1.00 15.32  ? 154 VAL B N   1 
ATOM   4910  C CA  . VAL B  1 157 ? 109.858 47.951  -17.707 1.00 15.42  ? 154 VAL B CA  1 
ATOM   4911  C C   . VAL B  1 157 ? 110.891 49.074  -17.875 1.00 16.19  ? 154 VAL B C   1 
ATOM   4912  O O   . VAL B  1 157 ? 112.085 48.860  -17.684 1.00 16.26  ? 154 VAL B O   1 
ATOM   4913  C CB  . VAL B  1 157 ? 109.577 47.207  -19.018 1.00 14.97  ? 154 VAL B CB  1 
ATOM   4914  C CG1 . VAL B  1 157 ? 110.860 46.819  -19.702 1.00 14.95  ? 154 VAL B CG1 1 
ATOM   4915  C CG2 . VAL B  1 157 ? 108.821 45.939  -18.733 1.00 15.07  ? 154 VAL B CG2 1 
ATOM   4916  N N   . PRO B  1 158 ? 110.445 50.278  -18.244 1.00 17.23  ? 155 PRO B N   1 
ATOM   4917  C CA  . PRO B  1 158 ? 111.419 51.363  -18.166 1.00 17.39  ? 155 PRO B CA  1 
ATOM   4918  C C   . PRO B  1 158 ? 111.965 51.556  -16.749 1.00 17.28  ? 155 PRO B C   1 
ATOM   4919  O O   . PRO B  1 158 ? 113.150 51.817  -16.579 1.00 17.11  ? 155 PRO B O   1 
ATOM   4920  C CB  . PRO B  1 158 ? 110.617 52.584  -18.641 1.00 17.55  ? 155 PRO B CB  1 
ATOM   4921  C CG  . PRO B  1 158 ? 109.649 52.008  -19.620 1.00 17.71  ? 155 PRO B CG  1 
ATOM   4922  C CD  . PRO B  1 158 ? 109.293 50.632  -19.100 1.00 17.52  ? 155 PRO B CD  1 
ATOM   4923  N N   . LEU B  1 159 ? 111.117 51.406  -15.737 1.00 17.20  ? 156 LEU B N   1 
ATOM   4924  C CA  . LEU B  1 159 ? 111.569 51.573  -14.335 1.00 16.96  ? 156 LEU B CA  1 
ATOM   4925  C C   . LEU B  1 159 ? 112.431 50.430  -13.831 1.00 15.76  ? 156 LEU B C   1 
ATOM   4926  O O   . LEU B  1 159 ? 113.016 50.550  -12.761 1.00 15.60  ? 156 LEU B O   1 
ATOM   4927  C CB  . LEU B  1 159 ? 110.386 51.844  -13.369 1.00 17.14  ? 156 LEU B CB  1 
ATOM   4928  C CG  . LEU B  1 159 ? 109.726 53.233  -13.559 1.00 17.13  ? 156 LEU B CG  1 
ATOM   4929  C CD1 . LEU B  1 159 ? 108.378 53.241  -12.858 1.00 17.36  ? 156 LEU B CD1 1 
ATOM   4930  C CD2 . LEU B  1 159 ? 110.573 54.421  -13.084 1.00 17.02  ? 156 LEU B CD2 1 
ATOM   4931  N N   . TRP B  1 160 ? 112.480 49.329  -14.585 1.00 14.85  ? 157 TRP B N   1 
ATOM   4932  C CA  . TRP B  1 160 ? 113.493 48.284  -14.390 1.00 14.37  ? 157 TRP B CA  1 
ATOM   4933  C C   . TRP B  1 160 ? 114.897 48.796  -14.679 1.00 13.61  ? 157 TRP B C   1 
ATOM   4934  O O   . TRP B  1 160 ? 115.867 48.347  -14.062 1.00 13.24  ? 157 TRP B O   1 
ATOM   4935  C CB  . TRP B  1 160 ? 113.245 47.104  -15.335 1.00 14.71  ? 157 TRP B CB  1 
ATOM   4936  C CG  . TRP B  1 160 ? 112.093 46.253  -15.017 1.00 15.03  ? 157 TRP B CG  1 
ATOM   4937  C CD1 . TRP B  1 160 ? 111.159 46.447  -14.033 1.00 15.86  ? 157 TRP B CD1 1 
ATOM   4938  C CD2 . TRP B  1 160 ? 111.720 45.058  -15.695 1.00 15.01  ? 157 TRP B CD2 1 
ATOM   4939  N NE1 . TRP B  1 160 ? 110.221 45.423  -14.049 1.00 15.96  ? 157 TRP B NE1 1 
ATOM   4940  C CE2 . TRP B  1 160 ? 110.544 44.561  -15.062 1.00 15.31  ? 157 TRP B CE2 1 
ATOM   4941  C CE3 . TRP B  1 160 ? 112.257 44.357  -16.768 1.00 14.90  ? 157 TRP B CE3 1 
ATOM   4942  C CZ2 . TRP B  1 160 ? 109.919 43.393  -15.458 1.00 15.10  ? 157 TRP B CZ2 1 
ATOM   4943  C CZ3 . TRP B  1 160 ? 111.619 43.201  -17.179 1.00 15.45  ? 157 TRP B CZ3 1 
ATOM   4944  C CH2 . TRP B  1 160 ? 110.457 42.724  -16.515 1.00 15.35  ? 157 TRP B CH2 1 
ATOM   4945  N N   . MET B  1 161 ? 114.994 49.716  -15.642 1.00 13.04  ? 158 MET B N   1 
ATOM   4946  C CA  . MET B  1 161 ? 116.276 50.121  -16.217 1.00 12.69  ? 158 MET B CA  1 
ATOM   4947  C C   . MET B  1 161 ? 116.825 51.404  -15.674 1.00 12.72  ? 158 MET B C   1 
ATOM   4948  O O   . MET B  1 161 ? 117.817 51.350  -14.955 1.00 13.89  ? 158 MET B O   1 
ATOM   4949  C CB  . MET B  1 161 ? 116.193 50.233  -17.723 1.00 12.19  ? 158 MET B CB  1 
ATOM   4950  C CG  . MET B  1 161 ? 115.678 48.975  -18.380 1.00 11.83  ? 158 MET B CG  1 
ATOM   4951  S SD  . MET B  1 161 ? 115.592 49.188  -20.151 1.00 11.38  ? 158 MET B SD  1 
ATOM   4952  C CE  . MET B  1 161 ? 114.891 47.598  -20.596 1.00 11.59  ? 158 MET B CE  1 
ATOM   4953  N N   . PHE B  1 162 ? 116.210 52.539  -16.001 1.00 12.48  ? 159 PHE B N   1 
ATOM   4954  C CA  . PHE B  1 162 ? 116.824 53.861  -15.722 1.00 12.53  ? 159 PHE B CA  1 
ATOM   4955  C C   . PHE B  1 162 ? 116.962 54.282  -14.237 1.00 12.73  ? 159 PHE B C   1 
ATOM   4956  O O   . PHE B  1 162 ? 117.948 54.929  -13.875 1.00 12.41  ? 159 PHE B O   1 
ATOM   4957  C CB  . PHE B  1 162 ? 116.245 54.994  -16.615 1.00 12.30  ? 159 PHE B CB  1 
ATOM   4958  C CG  . PHE B  1 162 ? 114.850 55.427  -16.280 1.00 12.13  ? 159 PHE B CG  1 
ATOM   4959  C CD1 . PHE B  1 162 ? 114.620 56.395  -15.311 1.00 12.33  ? 159 PHE B CD1 1 
ATOM   4960  C CD2 . PHE B  1 162 ? 113.760 54.919  -16.969 1.00 12.07  ? 159 PHE B CD2 1 
ATOM   4961  C CE1 . PHE B  1 162 ? 113.327 56.826  -15.009 1.00 12.05  ? 159 PHE B CE1 1 
ATOM   4962  C CE2 . PHE B  1 162 ? 112.466 55.343  -16.676 1.00 11.94  ? 159 PHE B CE2 1 
ATOM   4963  C CZ  . PHE B  1 162 ? 112.249 56.299  -15.698 1.00 11.90  ? 159 PHE B CZ  1 
ATOM   4964  N N   . PRO B  1 163 ? 116.018 53.885  -13.368 1.00 13.34  ? 160 PRO B N   1 
ATOM   4965  C CA  . PRO B  1 163 ? 116.254 54.174  -11.952 1.00 13.58  ? 160 PRO B CA  1 
ATOM   4966  C C   . PRO B  1 163 ? 117.583 53.598  -11.459 1.00 13.84  ? 160 PRO B C   1 
ATOM   4967  O O   . PRO B  1 163 ? 118.452 54.338  -11.027 1.00 13.27  ? 160 PRO B O   1 
ATOM   4968  C CB  . PRO B  1 163 ? 115.044 53.528  -11.264 1.00 13.57  ? 160 PRO B CB  1 
ATOM   4969  C CG  . PRO B  1 163 ? 113.965 53.619  -12.277 1.00 13.50  ? 160 PRO B CG  1 
ATOM   4970  C CD  . PRO B  1 163 ? 114.667 53.330  -13.580 1.00 13.58  ? 160 PRO B CD  1 
ATOM   4971  N N   . MET B  1 164 ? 117.759 52.292  -11.589 1.00 14.79  ? 161 MET B N   1 
ATOM   4972  C CA  . MET B  1 164 ? 119.024 51.658  -11.190 1.00 15.53  ? 161 MET B CA  1 
ATOM   4973  C C   . MET B  1 164 ? 120.237 52.160  -11.981 1.00 15.15  ? 161 MET B C   1 
ATOM   4974  O O   . MET B  1 164 ? 121.292 52.331  -11.408 1.00 15.36  ? 161 MET B O   1 
ATOM   4975  C CB  . MET B  1 164 ? 118.944 50.134  -11.312 1.00 16.02  ? 161 MET B CB  1 
ATOM   4976  C CG  . MET B  1 164 ? 120.177 49.404  -10.811 1.00 16.76  ? 161 MET B CG  1 
ATOM   4977  S SD  . MET B  1 164 ? 120.562 49.804  -9.088  1.00 18.12  ? 161 MET B SD  1 
ATOM   4978  C CE  . MET B  1 164 ? 119.223 48.939  -8.300  1.00 17.65  ? 161 MET B CE  1 
ATOM   4979  N N   . ALA B  1 165 ? 120.082 52.373  -13.284 1.00 14.91  ? 162 ALA B N   1 
ATOM   4980  C CA  . ALA B  1 165 ? 121.197 52.776  -14.146 1.00 14.73  ? 162 ALA B CA  1 
ATOM   4981  C C   . ALA B  1 165 ? 121.702 54.163  -13.774 1.00 14.36  ? 162 ALA B C   1 
ATOM   4982  O O   . ALA B  1 165 ? 122.908 54.382  -13.654 1.00 14.17  ? 162 ALA B O   1 
ATOM   4983  C CB  . ALA B  1 165 ? 120.783 52.736  -15.609 1.00 14.71  ? 162 ALA B CB  1 
ATOM   4984  N N   . ILE B  1 166 ? 120.768 55.083  -13.571 1.00 14.16  ? 163 ILE B N   1 
ATOM   4985  C CA  . ILE B  1 166 ? 121.106 56.468  -13.220 1.00 14.13  ? 163 ILE B CA  1 
ATOM   4986  C C   . ILE B  1 166 ? 121.768 56.536  -11.837 1.00 14.12  ? 163 ILE B C   1 
ATOM   4987  O O   . ILE B  1 166 ? 122.744 57.267  -11.647 1.00 14.23  ? 163 ILE B O   1 
ATOM   4988  C CB  . ILE B  1 166 ? 119.861 57.386  -13.259 1.00 13.80  ? 163 ILE B CB  1 
ATOM   4989  C CG1 . ILE B  1 166 ? 119.463 57.627  -14.690 1.00 13.72  ? 163 ILE B CG1 1 
ATOM   4990  C CG2 . ILE B  1 166 ? 120.108 58.727  -12.578 1.00 13.94  ? 163 ILE B CG2 1 
ATOM   4991  C CD1 . ILE B  1 166 ? 118.047 58.124  -14.828 1.00 13.92  ? 163 ILE B CD1 1 
ATOM   4992  N N   . VAL B  1 167 ? 121.248 55.768  -10.885 1.00 13.81  ? 164 VAL B N   1 
ATOM   4993  C CA  . VAL B  1 167 ? 121.757 55.818  -9.522  1.00 13.75  ? 164 VAL B CA  1 
ATOM   4994  C C   . VAL B  1 167 ? 123.149 55.171  -9.418  1.00 13.61  ? 164 VAL B C   1 
ATOM   4995  O O   . VAL B  1 167 ? 123.918 55.506  -8.529  1.00 13.28  ? 164 VAL B O   1 
ATOM   4996  C CB  . VAL B  1 167 ? 120.735 55.228  -8.523  1.00 13.91  ? 164 VAL B CB  1 
ATOM   4997  C CG1 . VAL B  1 167 ? 120.899 53.722  -8.325  1.00 14.04  ? 164 VAL B CG1 1 
ATOM   4998  C CG2 . VAL B  1 167 ? 120.866 55.924  -7.203  1.00 14.26  ? 164 VAL B CG2 1 
ATOM   4999  N N   . CYS B  1 168 ? 123.460 54.278  -10.362 1.00 13.65  ? 165 CYS B N   1 
ATOM   5000  C CA  . CYS B  1 168 ? 124.784 53.675  -10.505 1.00 14.08  ? 165 CYS B CA  1 
ATOM   5001  C C   . CYS B  1 168 ? 125.813 54.602  -11.155 1.00 14.32  ? 165 CYS B C   1 
ATOM   5002  O O   . CYS B  1 168 ? 126.979 54.212  -11.337 1.00 13.87  ? 165 CYS B O   1 
ATOM   5003  C CB  . CYS B  1 168 ? 124.700 52.367  -11.310 1.00 14.73  ? 165 CYS B CB  1 
ATOM   5004  S SG  . CYS B  1 168 ? 124.046 50.931  -10.379 1.00 15.97  ? 165 CYS B SG  1 
ATOM   5005  N N   . GLY B  1 169 ? 125.372 55.816  -11.506 1.00 15.00  ? 166 GLY B N   1 
ATOM   5006  C CA  . GLY B  1 169 ? 126.226 56.905  -12.026 1.00 15.19  ? 166 GLY B CA  1 
ATOM   5007  C C   . GLY B  1 169 ? 126.243 57.083  -13.545 1.00 15.03  ? 166 GLY B C   1 
ATOM   5008  O O   . GLY B  1 169 ? 127.112 57.775  -14.074 1.00 14.95  ? 166 GLY B O   1 
ATOM   5009  N N   . ASN B  1 170 ? 125.303 56.450  -14.239 1.00 14.82  ? 167 ASN B N   1 
ATOM   5010  C CA  . ASN B  1 170 ? 125.263 56.498  -15.676 1.00 15.15  ? 167 ASN B CA  1 
ATOM   5011  C C   . ASN B  1 170 ? 124.271 57.544  -16.110 1.00 16.31  ? 167 ASN B C   1 
ATOM   5012  O O   . ASN B  1 170 ? 123.455 58.011  -15.313 1.00 16.22  ? 167 ASN B O   1 
ATOM   5013  C CB  . ASN B  1 170 ? 124.832 55.160  -16.252 1.00 14.75  ? 167 ASN B CB  1 
ATOM   5014  C CG  . ASN B  1 170 ? 125.777 54.035  -15.901 1.00 14.62  ? 167 ASN B CG  1 
ATOM   5015  O OD1 . ASN B  1 170 ? 126.880 53.931  -16.434 1.00 14.69  ? 167 ASN B OD1 1 
ATOM   5016  N ND2 . ASN B  1 170 ? 125.335 53.164  -15.029 1.00 14.83  ? 167 ASN B ND2 1 
ATOM   5017  N N   . CYS B  1 171 ? 124.370 57.925  -17.381 1.00 17.51  ? 168 CYS B N   1 
ATOM   5018  C CA  . CYS B  1 171 ? 123.314 58.661  -18.074 1.00 18.03  ? 168 CYS B CA  1 
ATOM   5019  C C   . CYS B  1 171 ? 122.593 57.704  -19.001 1.00 17.68  ? 168 CYS B C   1 
ATOM   5020  O O   . CYS B  1 171 ? 123.145 56.690  -19.420 1.00 19.19  ? 168 CYS B O   1 
ATOM   5021  C CB  . CYS B  1 171 ? 123.891 59.846  -18.835 1.00 18.62  ? 168 CYS B CB  1 
ATOM   5022  S SG  . CYS B  1 171 ? 124.710 60.982  -17.692 1.00 19.81  ? 168 CYS B SG  1 
ATOM   5023  N N   . PHE B  1 172 ? 121.354 58.027  -19.327 1.00 16.74  ? 169 PHE B N   1 
ATOM   5024  C CA  . PHE B  1 172 ? 120.464 57.068  -19.974 1.00 15.43  ? 169 PHE B CA  1 
ATOM   5025  C C   . PHE B  1 172 ? 119.844 57.642  -21.240 1.00 14.73  ? 169 PHE B C   1 
ATOM   5026  O O   . PHE B  1 172 ? 119.486 58.830  -21.292 1.00 13.80  ? 169 PHE B O   1 
ATOM   5027  C CB  . PHE B  1 172 ? 119.358 56.705  -18.986 1.00 15.14  ? 169 PHE B CB  1 
ATOM   5028  C CG  . PHE B  1 172 ? 118.750 55.371  -19.227 1.00 14.57  ? 169 PHE B CG  1 
ATOM   5029  C CD1 . PHE B  1 172 ? 119.287 54.246  -18.631 1.00 14.40  ? 169 PHE B CD1 1 
ATOM   5030  C CD2 . PHE B  1 172 ? 117.647 55.238  -20.030 1.00 14.17  ? 169 PHE B CD2 1 
ATOM   5031  C CE1 . PHE B  1 172 ? 118.740 53.006  -18.832 1.00 14.11  ? 169 PHE B CE1 1 
ATOM   5032  C CE2 . PHE B  1 172 ? 117.090 53.998  -20.235 1.00 14.33  ? 169 PHE B CE2 1 
ATOM   5033  C CZ  . PHE B  1 172 ? 117.634 52.880  -19.629 1.00 14.10  ? 169 PHE B CZ  1 
ATOM   5034  N N   . VAL B  1 173 ? 119.710 56.796  -22.259 1.00 14.30  ? 170 VAL B N   1 
ATOM   5035  C CA  . VAL B  1 173 ? 118.841 57.110  -23.394 1.00 13.83  ? 170 VAL B CA  1 
ATOM   5036  C C   . VAL B  1 173 ? 117.832 55.977  -23.529 1.00 13.55  ? 170 VAL B C   1 
ATOM   5037  O O   . VAL B  1 173 ? 118.203 54.843  -23.740 1.00 12.90  ? 170 VAL B O   1 
ATOM   5038  C CB  . VAL B  1 173 ? 119.631 57.351  -24.689 1.00 13.86  ? 170 VAL B CB  1 
ATOM   5039  C CG1 . VAL B  1 173 ? 118.708 57.842  -25.788 1.00 13.83  ? 170 VAL B CG1 1 
ATOM   5040  C CG2 . VAL B  1 173 ? 120.711 58.401  -24.481 1.00 13.67  ? 170 VAL B CG2 1 
ATOM   5041  N N   . LEU B  1 174 ? 116.551 56.313  -23.347 1.00 14.17  ? 171 LEU B N   1 
ATOM   5042  C CA  . LEU B  1 174 ? 115.408 55.374  -23.419 1.00 14.14  ? 171 LEU B CA  1 
ATOM   5043  C C   . LEU B  1 174 ? 114.702 55.476  -24.759 1.00 14.15  ? 171 LEU B C   1 
ATOM   5044  O O   . LEU B  1 174 ? 114.401 56.566  -25.216 1.00 13.85  ? 171 LEU B O   1 
ATOM   5045  C CB  . LEU B  1 174 ? 114.395 55.687  -22.322 1.00 14.02  ? 171 LEU B CB  1 
ATOM   5046  C CG  . LEU B  1 174 ? 113.174 54.777  -22.198 1.00 14.13  ? 171 LEU B CG  1 
ATOM   5047  C CD1 . LEU B  1 174 ? 113.555 53.339  -21.919 1.00 14.13  ? 171 LEU B CD1 1 
ATOM   5048  C CD2 . LEU B  1 174 ? 112.325 55.274  -21.045 1.00 14.43  ? 171 LEU B CD2 1 
ATOM   5049  N N   . LYS B  1 175 ? 114.443 54.336  -25.376 1.00 14.65  ? 172 LYS B N   1 
ATOM   5050  C CA  . LYS B  1 175 ? 113.664 54.274  -26.604 1.00 15.42  ? 172 LYS B CA  1 
ATOM   5051  C C   . LYS B  1 175 ? 112.460 53.363  -26.340 1.00 15.79  ? 172 LYS B C   1 
ATOM   5052  O O   . LYS B  1 175 ? 112.569 52.155  -26.411 1.00 15.36  ? 172 LYS B O   1 
ATOM   5053  C CB  . LYS B  1 175 ? 114.551 53.783  -27.748 1.00 15.72  ? 172 LYS B CB  1 
ATOM   5054  C CG  . LYS B  1 175 ? 114.084 54.165  -29.138 1.00 15.82  ? 172 LYS B CG  1 
ATOM   5055  C CD  . LYS B  1 175 ? 113.341 53.028  -29.808 1.00 16.85  ? 172 LYS B CD  1 
ATOM   5056  C CE  . LYS B  1 175 ? 111.843 53.167  -29.707 1.00 17.22  ? 172 LYS B CE  1 
ATOM   5057  N NZ  . LYS B  1 175 ? 111.192 51.883  -30.075 1.00 17.98  ? 172 LYS B NZ  1 
ATOM   5058  N N   . PRO B  1 176 ? 111.302 53.955  -25.994 1.00 17.12  ? 173 PRO B N   1 
ATOM   5059  C CA  . PRO B  1 176 ? 110.128 53.151  -25.608 1.00 17.45  ? 173 PRO B CA  1 
ATOM   5060  C C   . PRO B  1 176 ? 109.267 52.720  -26.754 1.00 17.77  ? 173 PRO B C   1 
ATOM   5061  O O   . PRO B  1 176 ? 109.446 53.183  -27.871 1.00 17.79  ? 173 PRO B O   1 
ATOM   5062  C CB  . PRO B  1 176 ? 109.329 54.093  -24.714 1.00 17.50  ? 173 PRO B CB  1 
ATOM   5063  C CG  . PRO B  1 176 ? 109.704 55.456  -25.178 1.00 17.86  ? 173 PRO B CG  1 
ATOM   5064  C CD  . PRO B  1 176 ? 111.071 55.401  -25.795 1.00 17.55  ? 173 PRO B CD  1 
ATOM   5065  N N   . SER B  1 177 ? 108.316 51.845  -26.463 1.00 18.21  ? 174 SER B N   1 
ATOM   5066  C CA  . SER B  1 177 ? 107.416 51.360  -27.501 1.00 18.86  ? 174 SER B CA  1 
ATOM   5067  C C   . SER B  1 177 ? 106.641 52.515  -28.102 1.00 19.32  ? 174 SER B C   1 
ATOM   5068  O O   . SER B  1 177 ? 106.138 53.359  -27.397 1.00 19.09  ? 174 SER B O   1 
ATOM   5069  C CB  . SER B  1 177 ? 106.442 50.311  -26.970 1.00 18.56  ? 174 SER B CB  1 
ATOM   5070  O OG  . SER B  1 177 ? 105.371 50.113  -27.868 1.00 18.21  ? 174 SER B OG  1 
ATOM   5071  N N   . GLU B  1 178 ? 106.541 52.516  -29.417 1.00 20.89  ? 175 GLU B N   1 
ATOM   5072  C CA  . GLU B  1 178 ? 105.859 53.576  -30.131 1.00 22.35  ? 175 GLU B CA  1 
ATOM   5073  C C   . GLU B  1 178 ? 104.342 53.369  -30.099 1.00 23.47  ? 175 GLU B C   1 
ATOM   5074  O O   . GLU B  1 178 ? 103.582 54.217  -30.529 1.00 23.51  ? 175 GLU B O   1 
ATOM   5075  C CB  . GLU B  1 178 ? 106.404 53.705  -31.558 1.00 23.34  ? 175 GLU B CB  1 
ATOM   5076  C CG  . GLU B  1 178 ? 106.507 52.411  -32.353 1.00 25.07  ? 175 GLU B CG  1 
ATOM   5077  C CD  . GLU B  1 178 ? 107.899 51.763  -32.343 1.00 25.69  ? 175 GLU B CD  1 
ATOM   5078  O OE1 . GLU B  1 178 ? 108.368 51.302  -31.264 1.00 23.43  ? 175 GLU B OE1 1 
ATOM   5079  O OE2 . GLU B  1 178 ? 108.497 51.673  -33.444 1.00 26.31  ? 175 GLU B OE2 1 
ATOM   5080  N N   . ARG B  1 179 ? 103.887 52.259  -29.537 1.00 25.27  ? 176 ARG B N   1 
ATOM   5081  C CA  . ARG B  1 179 ? 102.459 52.031  -29.402 1.00 25.87  ? 176 ARG B CA  1 
ATOM   5082  C C   . ARG B  1 179 ? 101.839 52.717  -28.197 1.00 22.23  ? 176 ARG B C   1 
ATOM   5083  O O   . ARG B  1 179 ? 100.643 52.926  -28.189 1.00 22.18  ? 176 ARG B O   1 
ATOM   5084  C CB  . ARG B  1 179 ? 102.171 50.531  -29.410 1.00 30.00  ? 176 ARG B CB  1 
ATOM   5085  C CG  . ARG B  1 179 ? 102.408 49.918  -30.789 1.00 35.28  ? 176 ARG B CG  1 
ATOM   5086  C CD  . ARG B  1 179 ? 102.597 48.411  -30.711 1.00 42.96  ? 176 ARG B CD  1 
ATOM   5087  N NE  . ARG B  1 179 ? 103.475 47.880  -31.765 1.00 50.29  ? 176 ARG B NE  1 
ATOM   5088  C CZ  . ARG B  1 179 ? 104.001 46.643  -31.796 1.00 57.28  ? 176 ARG B CZ  1 
ATOM   5089  N NH1 . ARG B  1 179 ? 104.778 46.294  -32.814 1.00 60.17  ? 176 ARG B NH1 1 
ATOM   5090  N NH2 . ARG B  1 179 ? 103.768 45.740  -30.833 1.00 61.06  ? 176 ARG B NH2 1 
ATOM   5091  N N   . ASP B  1 180 ? 102.639 53.066  -27.191 1.00 20.08  ? 177 ASP B N   1 
ATOM   5092  C CA  . ASP B  1 180 ? 102.132 53.727  -25.958 1.00 18.85  ? 177 ASP B CA  1 
ATOM   5093  C C   . ASP B  1 180 ? 103.162 54.623  -25.203 1.00 18.47  ? 177 ASP B C   1 
ATOM   5094  O O   . ASP B  1 180 ? 103.505 54.365  -24.034 1.00 18.70  ? 177 ASP B O   1 
ATOM   5095  C CB  . ASP B  1 180 ? 101.474 52.689  -25.006 1.00 17.92  ? 177 ASP B CB  1 
ATOM   5096  C CG  . ASP B  1 180 ? 102.424 51.560  -24.556 1.00 16.77  ? 177 ASP B CG  1 
ATOM   5097  O OD1 . ASP B  1 180 ? 103.643 51.615  -24.768 1.00 15.94  ? 177 ASP B OD1 1 
ATOM   5098  O OD2 . ASP B  1 180 ? 101.928 50.595  -23.963 1.00 16.18  ? 177 ASP B OD2 1 
ATOM   5099  N N   . PRO B  1 181 ? 103.632 55.698  -25.864 1.00 17.68  ? 178 PRO B N   1 
ATOM   5100  C CA  . PRO B  1 181 ? 104.759 56.465  -25.356 1.00 17.53  ? 178 PRO B CA  1 
ATOM   5101  C C   . PRO B  1 181 ? 104.437 57.578  -24.354 1.00 16.90  ? 178 PRO B C   1 
ATOM   5102  O O   . PRO B  1 181 ? 105.338 58.041  -23.673 1.00 16.44  ? 178 PRO B O   1 
ATOM   5103  C CB  . PRO B  1 181 ? 105.353 57.061  -26.640 1.00 17.98  ? 178 PRO B CB  1 
ATOM   5104  C CG  . PRO B  1 181 ? 104.185 57.259  -27.539 1.00 17.59  ? 178 PRO B CG  1 
ATOM   5105  C CD  . PRO B  1 181 ? 103.213 56.175  -27.197 1.00 17.81  ? 178 PRO B CD  1 
ATOM   5106  N N   . SER B  1 182 ? 103.185 58.020  -24.284 1.00 16.78  ? 179 SER B N   1 
ATOM   5107  C CA  . SER B  1 182 ? 102.831 59.179  -23.440 1.00 16.46  ? 179 SER B CA  1 
ATOM   5108  C C   . SER B  1 182 ? 103.152 58.965  -21.957 1.00 16.29  ? 179 SER B C   1 
ATOM   5109  O O   . SER B  1 182 ? 103.723 59.837  -21.312 1.00 15.65  ? 179 SER B O   1 
ATOM   5110  C CB  . SER B  1 182 ? 101.350 59.554  -23.575 1.00 16.23  ? 179 SER B CB  1 
ATOM   5111  O OG  . SER B  1 182 ? 101.060 60.182  -24.803 1.00 15.92  ? 179 SER B OG  1 
ATOM   5112  N N   . SER B  1 183 ? 102.768 57.804  -21.435 1.00 16.32  ? 180 SER B N   1 
ATOM   5113  C CA  . SER B  1 183 ? 102.986 57.469  -20.037 1.00 16.29  ? 180 SER B CA  1 
ATOM   5114  C C   . SER B  1 183 ? 104.481 57.402  -19.699 1.00 16.92  ? 180 SER B C   1 
ATOM   5115  O O   . SER B  1 183 ? 104.930 57.873  -18.675 1.00 17.09  ? 180 SER B O   1 
ATOM   5116  C CB  . SER B  1 183 ? 102.320 56.140  -19.745 1.00 16.08  ? 180 SER B CB  1 
ATOM   5117  O OG  . SER B  1 183 ? 102.766 55.161  -20.653 1.00 15.91  ? 180 SER B OG  1 
ATOM   5118  N N   . THR B  1 184 ? 105.257 56.824  -20.588 1.00 17.84  ? 181 THR B N   1 
ATOM   5119  C CA  . THR B  1 184 ? 106.699 56.741  -20.418 1.00 18.41  ? 181 THR B CA  1 
ATOM   5120  C C   . THR B  1 184 ? 107.375 58.124  -20.377 1.00 19.23  ? 181 THR B C   1 
ATOM   5121  O O   . THR B  1 184 ? 108.249 58.392  -19.529 1.00 20.23  ? 181 THR B O   1 
ATOM   5122  C CB  . THR B  1 184 ? 107.313 55.933  -21.580 1.00 18.39  ? 181 THR B CB  1 
ATOM   5123  O OG1 . THR B  1 184 ? 106.400 54.912  -21.993 1.00 18.62  ? 181 THR B OG1 1 
ATOM   5124  C CG2 . THR B  1 184 ? 108.563 55.271  -21.153 1.00 18.86  ? 181 THR B CG2 1 
ATOM   5125  N N   . LEU B  1 185 ? 106.987 58.988  -21.313 1.00 18.50  ? 182 LEU B N   1 
ATOM   5126  C CA  . LEU B  1 185 ? 107.551 60.308  -21.391 1.00 17.80  ? 182 LEU B CA  1 
ATOM   5127  C C   . LEU B  1 185 ? 107.133 61.142  -20.185 1.00 17.21  ? 182 LEU B C   1 
ATOM   5128  O O   . LEU B  1 185 ? 107.916 61.906  -19.670 1.00 16.41  ? 182 LEU B O   1 
ATOM   5129  C CB  . LEU B  1 185 ? 107.140 60.975  -22.698 1.00 18.12  ? 182 LEU B CB  1 
ATOM   5130  C CG  . LEU B  1 185 ? 107.803 62.339  -22.923 1.00 18.82  ? 182 LEU B CG  1 
ATOM   5131  C CD1 . LEU B  1 185 ? 109.328 62.277  -23.004 1.00 19.08  ? 182 LEU B CD1 1 
ATOM   5132  C CD2 . LEU B  1 185 ? 107.247 62.940  -24.186 1.00 18.92  ? 182 LEU B CD2 1 
ATOM   5133  N N   . TYR B  1 186 ? 105.892 60.960  -19.749 1.00 17.88  ? 183 TYR B N   1 
ATOM   5134  C CA  . TYR B  1 186 ? 105.321 61.646  -18.593 1.00 18.02  ? 183 TYR B CA  1 
ATOM   5135  C C   . TYR B  1 186 ? 106.136 61.432  -17.326 1.00 18.96  ? 183 TYR B C   1 
ATOM   5136  O O   . TYR B  1 186 ? 106.362 62.381  -16.584 1.00 19.40  ? 183 TYR B O   1 
ATOM   5137  C CB  . TYR B  1 186 ? 103.888 61.177  -18.330 1.00 17.71  ? 183 TYR B CB  1 
ATOM   5138  C CG  . TYR B  1 186 ? 103.213 61.933  -17.208 1.00 18.33  ? 183 TYR B CG  1 
ATOM   5139  C CD1 . TYR B  1 186 ? 102.538 63.126  -17.456 1.00 18.97  ? 183 TYR B CD1 1 
ATOM   5140  C CD2 . TYR B  1 186 ? 103.265 61.487  -15.902 1.00 18.60  ? 183 TYR B CD2 1 
ATOM   5141  C CE1 . TYR B  1 186 ? 101.917 63.850  -16.444 1.00 18.90  ? 183 TYR B CE1 1 
ATOM   5142  C CE2 . TYR B  1 186 ? 102.652 62.207  -14.882 1.00 19.24  ? 183 TYR B CE2 1 
ATOM   5143  C CZ  . TYR B  1 186 ? 101.971 63.395  -15.161 1.00 19.21  ? 183 TYR B CZ  1 
ATOM   5144  O OH  . TYR B  1 186 ? 101.346 64.141  -14.174 1.00 18.90  ? 183 TYR B OH  1 
ATOM   5145  N N   . ILE B  1 187 ? 106.544 60.190  -17.067 1.00 19.63  ? 184 ILE B N   1 
ATOM   5146  C CA  . ILE B  1 187 ? 107.288 59.882  -15.848 1.00 20.24  ? 184 ILE B CA  1 
ATOM   5147  C C   . ILE B  1 187 ? 108.735 60.317  -15.932 1.00 20.64  ? 184 ILE B C   1 
ATOM   5148  O O   . ILE B  1 187 ? 109.311 60.671  -14.916 1.00 21.05  ? 184 ILE B O   1 
ATOM   5149  C CB  . ILE B  1 187 ? 107.253 58.402  -15.445 1.00 20.47  ? 184 ILE B CB  1 
ATOM   5150  C CG1 . ILE B  1 187 ? 108.025 57.539  -16.447 1.00 21.03  ? 184 ILE B CG1 1 
ATOM   5151  C CG2 . ILE B  1 187 ? 105.814 57.965  -15.250 1.00 20.38  ? 184 ILE B CG2 1 
ATOM   5152  C CD1 . ILE B  1 187 ? 108.034 56.070  -16.115 1.00 21.29  ? 184 ILE B CD1 1 
ATOM   5153  N N   . ALA B  1 188 ? 109.321 60.286  -17.121 1.00 20.55  ? 185 ALA B N   1 
ATOM   5154  C CA  . ALA B  1 188 ? 110.663 60.819  -17.290 1.00 20.93  ? 185 ALA B CA  1 
ATOM   5155  C C   . ALA B  1 188 ? 110.675 62.338  -17.134 1.00 21.33  ? 185 ALA B C   1 
ATOM   5156  O O   . ALA B  1 188 ? 111.716 62.902  -16.808 1.00 22.21  ? 185 ALA B O   1 
ATOM   5157  C CB  . ALA B  1 188 ? 111.265 60.408  -18.630 1.00 20.77  ? 185 ALA B CB  1 
ATOM   5158  N N   . GLN B  1 189 ? 109.548 63.010  -17.361 1.00 21.84  ? 186 GLN B N   1 
ATOM   5159  C CA  . GLN B  1 189 ? 109.501 64.473  -17.140 1.00 23.32  ? 186 GLN B CA  1 
ATOM   5160  C C   . GLN B  1 189 ? 109.516 64.854  -15.658 1.00 22.77  ? 186 GLN B C   1 
ATOM   5161  O O   . GLN B  1 189 ? 110.027 65.911  -15.271 1.00 23.56  ? 186 GLN B O   1 
ATOM   5162  C CB  . GLN B  1 189 ? 108.319 65.109  -17.865 1.00 24.02  ? 186 GLN B CB  1 
ATOM   5163  C CG  . GLN B  1 189 ? 108.577 65.171  -19.354 1.00 25.29  ? 186 GLN B CG  1 
ATOM   5164  C CD  . GLN B  1 189 ? 107.431 65.726  -20.153 1.00 27.43  ? 186 GLN B CD  1 
ATOM   5165  O OE1 . GLN B  1 189 ? 107.639 66.644  -20.919 1.00 31.69  ? 186 GLN B OE1 1 
ATOM   5166  N NE2 . GLN B  1 189 ? 106.225 65.168  -20.002 1.00 27.91  ? 186 GLN B NE2 1 
ATOM   5167  N N   . LEU B  1 190 ? 108.994 63.949  -14.840 1.00 22.00  ? 187 LEU B N   1 
ATOM   5168  C CA  . LEU B  1 190 ? 108.962 64.100  -13.391 1.00 21.32  ? 187 LEU B CA  1 
ATOM   5169  C C   . LEU B  1 190 ? 110.355 64.088  -12.771 1.00 22.57  ? 187 LEU B C   1 
ATOM   5170  O O   . LEU B  1 190 ? 110.569 64.572  -11.656 1.00 21.30  ? 187 LEU B O   1 
ATOM   5171  C CB  . LEU B  1 190 ? 108.124 62.973  -12.792 1.00 19.69  ? 187 LEU B CB  1 
ATOM   5172  C CG  . LEU B  1 190 ? 106.656 63.005  -13.168 1.00 18.65  ? 187 LEU B CG  1 
ATOM   5173  C CD1 . LEU B  1 190 ? 105.964 61.792  -12.598 1.00 18.73  ? 187 LEU B CD1 1 
ATOM   5174  C CD2 . LEU B  1 190 ? 106.008 64.262  -12.641 1.00 18.37  ? 187 LEU B CD2 1 
ATOM   5175  N N   . LEU B  1 191 ? 111.302 63.549  -13.522 1.00 24.43  ? 188 LEU B N   1 
ATOM   5176  C CA  . LEU B  1 191 ? 112.632 63.314  -13.026 1.00 26.26  ? 188 LEU B CA  1 
ATOM   5177  C C   . LEU B  1 191 ? 113.419 64.619  -12.872 1.00 28.62  ? 188 LEU B C   1 
ATOM   5178  O O   . LEU B  1 191 ? 114.266 64.752  -11.983 1.00 26.13  ? 188 LEU B O   1 
ATOM   5179  C CB  . LEU B  1 191 ? 113.309 62.298  -13.941 1.00 26.02  ? 188 LEU B CB  1 
ATOM   5180  C CG  . LEU B  1 191 ? 114.251 61.328  -13.262 1.00 26.95  ? 188 LEU B CG  1 
ATOM   5181  C CD1 . LEU B  1 191 ? 113.683 60.564  -12.088 1.00 25.92  ? 188 LEU B CD1 1 
ATOM   5182  C CD2 . LEU B  1 191 ? 114.700 60.353  -14.325 1.00 29.17  ? 188 LEU B CD2 1 
ATOM   5183  N N   . GLN B  1 192 ? 113.094 65.606  -13.705 1.00 35.23  ? 189 GLN B N   1 
ATOM   5184  C CA  . GLN B  1 192 ? 113.732 66.926  -13.612 1.00 39.02  ? 189 GLN B CA  1 
ATOM   5185  C C   . GLN B  1 192 ? 113.268 67.596  -12.348 1.00 35.73  ? 189 GLN B C   1 
ATOM   5186  O O   . GLN B  1 192 ? 114.060 68.099  -11.567 1.00 33.92  ? 189 GLN B O   1 
ATOM   5187  C CB  . GLN B  1 192 ? 113.454 67.793  -14.845 1.00 45.41  ? 189 GLN B CB  1 
ATOM   5188  C CG  . GLN B  1 192 ? 114.527 67.649  -15.938 1.00 53.50  ? 189 GLN B CG  1 
ATOM   5189  C CD  . GLN B  1 192 ? 114.607 66.252  -16.618 1.00 54.03  ? 189 GLN B CD  1 
ATOM   5190  O OE1 . GLN B  1 192 ? 113.586 65.544  -16.786 1.00 50.82  ? 189 GLN B OE1 1 
ATOM   5191  N NE2 . GLN B  1 192 ? 115.829 65.873  -17.044 1.00 52.74  ? 189 GLN B NE2 1 
ATOM   5192  N N   . GLU B  1 193 ? 111.978 67.532  -12.103 1.00 34.80  ? 190 GLU B N   1 
ATOM   5193  C CA  . GLU B  1 193 ? 111.426 68.118  -10.885 1.00 35.66  ? 190 GLU B CA  1 
ATOM   5194  C C   . GLU B  1 193 ? 111.975 67.462  -9.605  1.00 34.23  ? 190 GLU B C   1 
ATOM   5195  O O   . GLU B  1 193 ? 111.978 68.082  -8.533  1.00 34.49  ? 190 GLU B O   1 
ATOM   5196  C CB  . GLU B  1 193 ? 109.905 68.006  -10.935 1.00 36.83  ? 190 GLU B CB  1 
ATOM   5197  C CG  . GLU B  1 193 ? 109.172 68.690  -9.803  1.00 35.75  ? 190 GLU B CG  1 
ATOM   5198  C CD  . GLU B  1 193 ? 107.677 68.474  -9.883  1.00 36.94  ? 190 GLU B CD  1 
ATOM   5199  O OE1 . GLU B  1 193 ? 107.031 68.761  -8.846  1.00 36.88  ? 190 GLU B OE1 1 
ATOM   5200  O OE2 . GLU B  1 193 ? 107.168 68.016  -10.959 1.00 34.25  ? 190 GLU B OE2 1 
ATOM   5201  N N   . ALA B  1 194 ? 112.423 66.210  -9.729  1.00 31.16  ? 191 ALA B N   1 
ATOM   5202  C CA  . ALA B  1 194 ? 113.027 65.463  -8.626  1.00 28.28  ? 191 ALA B CA  1 
ATOM   5203  C C   . ALA B  1 194 ? 114.452 65.912  -8.339  1.00 25.79  ? 191 ALA B C   1 
ATOM   5204  O O   . ALA B  1 194 ? 115.062 65.463  -7.379  1.00 26.14  ? 191 ALA B O   1 
ATOM   5205  C CB  . ALA B  1 194 ? 113.005 63.961  -8.928  1.00 28.60  ? 191 ALA B CB  1 
ATOM   5206  N N   . GLY B  1 195 ? 114.998 66.765  -9.190  1.00 23.74  ? 192 GLY B N   1 
ATOM   5207  C CA  . GLY B  1 195 ? 116.344 67.280  -9.014  1.00 22.20  ? 192 GLY B CA  1 
ATOM   5208  C C   . GLY B  1 195 ? 117.393 66.642  -9.895  1.00 21.14  ? 192 GLY B C   1 
ATOM   5209  O O   . GLY B  1 195 ? 118.567 66.820  -9.647  1.00 19.87  ? 192 GLY B O   1 
ATOM   5210  N N   . LEU B  1 196 ? 116.999 65.917  -10.937 1.00 20.81  ? 193 LEU B N   1 
ATOM   5211  C CA  . LEU B  1 196 ? 117.993 65.259  -11.781 1.00 20.84  ? 193 LEU B CA  1 
ATOM   5212  C C   . LEU B  1 196 ? 118.570 66.295  -12.704 1.00 20.52  ? 193 LEU B C   1 
ATOM   5213  O O   . LEU B  1 196 ? 117.835 67.084  -13.285 1.00 21.55  ? 193 LEU B O   1 
ATOM   5214  C CB  . LEU B  1 196 ? 117.382 64.108  -12.594 1.00 21.32  ? 193 LEU B CB  1 
ATOM   5215  C CG  . LEU B  1 196 ? 118.346 63.112  -13.277 1.00 21.56  ? 193 LEU B CG  1 
ATOM   5216  C CD1 . LEU B  1 196 ? 119.190 62.277  -12.310 1.00 20.94  ? 193 LEU B CD1 1 
ATOM   5217  C CD2 . LEU B  1 196 ? 117.571 62.186  -14.209 1.00 21.33  ? 193 LEU B CD2 1 
ATOM   5218  N N   . PRO B  1 197 ? 119.884 66.312  -12.849 1.00 20.48  ? 194 PRO B N   1 
ATOM   5219  C CA  . PRO B  1 197 ? 120.458 67.233  -13.816 1.00 20.80  ? 194 PRO B CA  1 
ATOM   5220  C C   . PRO B  1 197 ? 119.948 67.001  -15.229 1.00 21.86  ? 194 PRO B C   1 
ATOM   5221  O O   . PRO B  1 197 ? 119.543 65.890  -15.590 1.00 24.12  ? 194 PRO B O   1 
ATOM   5222  C CB  . PRO B  1 197 ? 121.952 66.923  -13.731 1.00 20.50  ? 194 PRO B CB  1 
ATOM   5223  C CG  . PRO B  1 197 ? 122.134 66.514  -12.316 1.00 20.24  ? 194 PRO B CG  1 
ATOM   5224  C CD  . PRO B  1 197 ? 120.911 65.701  -11.995 1.00 20.30  ? 194 PRO B CD  1 
ATOM   5225  N N   . ASP B  1 198 ? 119.969 68.047  -16.032 1.00 22.53  ? 195 ASP B N   1 
ATOM   5226  C CA  . ASP B  1 198 ? 119.596 67.910  -17.416 1.00 22.66  ? 195 ASP B CA  1 
ATOM   5227  C C   . ASP B  1 198 ? 120.566 66.935  -18.044 1.00 21.82  ? 195 ASP B C   1 
ATOM   5228  O O   . ASP B  1 198 ? 121.731 66.850  -17.629 1.00 21.74  ? 195 ASP B O   1 
ATOM   5229  C CB  . ASP B  1 198 ? 119.625 69.256  -18.113 1.00 24.82  ? 195 ASP B CB  1 
ATOM   5230  C CG  . ASP B  1 198 ? 118.667 70.251  -17.478 1.00 28.06  ? 195 ASP B CG  1 
ATOM   5231  O OD1 . ASP B  1 198 ? 117.601 69.806  -16.958 1.00 30.01  ? 195 ASP B OD1 1 
ATOM   5232  O OD2 . ASP B  1 198 ? 118.997 71.470  -17.477 1.00 30.31  ? 195 ASP B OD2 1 
ATOM   5233  N N   . GLY B  1 199 ? 120.050 66.121  -18.961 1.00 20.57  ? 196 GLY B N   1 
ATOM   5234  C CA  . GLY B  1 199 ? 120.888 65.271  -19.798 1.00 20.08  ? 196 GLY B CA  1 
ATOM   5235  C C   . GLY B  1 199 ? 121.178 63.887  -19.243 1.00 18.97  ? 196 GLY B C   1 
ATOM   5236  O O   . GLY B  1 199 ? 121.542 62.989  -19.998 1.00 18.71  ? 196 GLY B O   1 
ATOM   5237  N N   . VAL B  1 200 ? 120.999 63.703  -17.942 1.00 18.25  ? 197 VAL B N   1 
ATOM   5238  C CA  . VAL B  1 200 ? 121.266 62.412  -17.319 1.00 18.05  ? 197 VAL B CA  1 
ATOM   5239  C C   . VAL B  1 200 ? 120.240 61.380  -17.786 1.00 18.00  ? 197 VAL B C   1 
ATOM   5240  O O   . VAL B  1 200 ? 120.605 60.252  -18.141 1.00 17.04  ? 197 VAL B O   1 
ATOM   5241  C CB  . VAL B  1 200 ? 121.246 62.527  -15.793 1.00 18.16  ? 197 VAL B CB  1 
ATOM   5242  C CG1 . VAL B  1 200 ? 121.342 61.157  -15.150 1.00 18.71  ? 197 VAL B CG1 1 
ATOM   5243  C CG2 . VAL B  1 200 ? 122.395 63.391  -15.321 1.00 17.90  ? 197 VAL B CG2 1 
ATOM   5244  N N   . MET B  1 201 ? 118.963 61.780  -17.779 1.00 18.01  ? 198 MET B N   1 
ATOM   5245  C CA  . MET B  1 201 ? 117.892 60.988  -18.383 1.00 17.35  ? 198 MET B CA  1 
ATOM   5246  C C   . MET B  1 201 ? 117.333 61.639  -19.646 1.00 17.84  ? 198 MET B C   1 
ATOM   5247  O O   . MET B  1 201 ? 117.015 62.804  -19.648 1.00 17.71  ? 198 MET B O   1 
ATOM   5248  C CB  . MET B  1 201 ? 116.763 60.798  -17.391 1.00 16.70  ? 198 MET B CB  1 
ATOM   5249  C CG  . MET B  1 201 ? 115.609 59.981  -17.930 1.00 16.38  ? 198 MET B CG  1 
ATOM   5250  S SD  . MET B  1 201 ? 116.095 58.298  -18.281 1.00 16.22  ? 198 MET B SD  1 
ATOM   5251  C CE  . MET B  1 201 ? 114.536 57.591  -18.796 1.00 16.97  ? 198 MET B CE  1 
ATOM   5252  N N   . ASN B  1 202 ? 117.157 60.840  -20.694 1.00 19.30  ? 199 ASN B N   1 
ATOM   5253  C CA  . ASN B  1 202 ? 116.630 61.278  -21.989 1.00 19.18  ? 199 ASN B CA  1 
ATOM   5254  C C   . ASN B  1 202 ? 115.699 60.230  -22.568 1.00 19.42  ? 199 ASN B C   1 
ATOM   5255  O O   . ASN B  1 202 ? 115.969 59.051  -22.484 1.00 21.32  ? 199 ASN B O   1 
ATOM   5256  C CB  . ASN B  1 202 ? 117.777 61.460  -22.972 1.00 19.65  ? 199 ASN B CB  1 
ATOM   5257  C CG  . ASN B  1 202 ? 118.808 62.472  -22.494 1.00 19.93  ? 199 ASN B CG  1 
ATOM   5258  O OD1 . ASN B  1 202 ? 118.571 63.694  -22.579 1.00 21.09  ? 199 ASN B OD1 1 
ATOM   5259  N ND2 . ASN B  1 202 ? 119.958 61.984  -22.004 1.00 18.55  ? 199 ASN B ND2 1 
ATOM   5260  N N   . VAL B  1 203 ? 114.606 60.650  -23.175 1.00 19.49  ? 200 VAL B N   1 
ATOM   5261  C CA  . VAL B  1 203 ? 113.706 59.733  -23.864 1.00 18.75  ? 200 VAL B CA  1 
ATOM   5262  C C   . VAL B  1 203 ? 113.747 60.108  -25.344 1.00 18.52  ? 200 VAL B C   1 
ATOM   5263  O O   . VAL B  1 203 ? 113.604 61.270  -25.712 1.00 18.70  ? 200 VAL B O   1 
ATOM   5264  C CB  . VAL B  1 203 ? 112.274 59.828  -23.326 1.00 18.91  ? 200 VAL B CB  1 
ATOM   5265  C CG1 . VAL B  1 203 ? 111.355 58.885  -24.080 1.00 19.70  ? 200 VAL B CG1 1 
ATOM   5266  C CG2 . VAL B  1 203 ? 112.220 59.461  -21.859 1.00 19.06  ? 200 VAL B CG2 1 
ATOM   5267  N N   . VAL B  1 204 ? 113.959 59.117  -26.192 1.00 17.77  ? 201 VAL B N   1 
ATOM   5268  C CA  . VAL B  1 204 ? 114.005 59.348  -27.622 1.00 17.29  ? 201 VAL B CA  1 
ATOM   5269  C C   . VAL B  1 204 ? 113.043 58.370  -28.313 1.00 16.90  ? 201 VAL B C   1 
ATOM   5270  O O   . VAL B  1 204 ? 113.309 57.191  -28.403 1.00 16.38  ? 201 VAL B O   1 
ATOM   5271  C CB  . VAL B  1 204 ? 115.492 59.345  -28.099 1.00 17.41  ? 201 VAL B CB  1 
ATOM   5272  C CG1 . VAL B  1 204 ? 115.975 58.045  -28.734 1.00 16.38  ? 201 VAL B CG1 1 
ATOM   5273  C CG2 . VAL B  1 204 ? 115.713 60.503  -29.033 1.00 18.45  ? 201 VAL B CG2 1 
ATOM   5274  N N   . ASN B  1 205 ? 111.860 58.854  -28.686 1.00 17.48  ? 202 ASN B N   1 
ATOM   5275  C CA  . ASN B  1 205 ? 110.855 58.047  -29.415 1.00 17.95  ? 202 ASN B CA  1 
ATOM   5276  C C   . ASN B  1 205 ? 111.190 57.770  -30.856 1.00 18.67  ? 202 ASN B C   1 
ATOM   5277  O O   . ASN B  1 205 ? 111.768 58.617  -31.519 1.00 18.90  ? 202 ASN B O   1 
ATOM   5278  C CB  . ASN B  1 205 ? 109.494 58.696  -29.362 1.00 17.69  ? 202 ASN B CB  1 
ATOM   5279  C CG  . ASN B  1 205 ? 108.856 58.534  -28.020 1.00 18.34  ? 202 ASN B CG  1 
ATOM   5280  O OD1 . ASN B  1 205 ? 108.569 57.416  -27.606 1.00 19.40  ? 202 ASN B OD1 1 
ATOM   5281  N ND2 . ASN B  1 205 ? 108.653 59.640  -27.308 1.00 18.60  ? 202 ASN B ND2 1 
ATOM   5282  N N   . GLY B  1 206 ? 110.824 56.589  -31.339 1.00 19.40  ? 203 GLY B N   1 
ATOM   5283  C CA  . GLY B  1 206 ? 111.162 56.214  -32.694 1.00 21.44  ? 203 GLY B CA  1 
ATOM   5284  C C   . GLY B  1 206 ? 110.913 54.759  -33.008 1.00 24.27  ? 203 GLY B C   1 
ATOM   5285  O O   . GLY B  1 206 ? 110.154 54.063  -32.299 1.00 24.91  ? 203 GLY B O   1 
ATOM   5286  N N   . ASP B  1 207 ? 111.550 54.311  -34.093 1.00 25.70  ? 204 ASP B N   1 
ATOM   5287  C CA  . ASP B  1 207 ? 111.377 52.949  -34.590 1.00 26.22  ? 204 ASP B CA  1 
ATOM   5288  C C   . ASP B  1 207 ? 112.757 52.295  -34.789 1.00 27.38  ? 204 ASP B C   1 
ATOM   5289  O O   . ASP B  1 207 ? 113.710 52.672  -34.076 1.00 25.39  ? 204 ASP B O   1 
ATOM   5290  C CB  . ASP B  1 207 ? 110.505 52.957  -35.844 1.00 25.62  ? 204 ASP B CB  1 
ATOM   5291  C CG  . ASP B  1 207 ? 111.143 53.692  -36.997 1.00 26.12  ? 204 ASP B CG  1 
ATOM   5292  O OD1 . ASP B  1 207 ? 112.300 54.146  -36.844 1.00 27.55  ? 204 ASP B OD1 1 
ATOM   5293  O OD2 . ASP B  1 207 ? 110.480 53.824  -38.054 1.00 24.79  ? 204 ASP B OD2 1 
ATOM   5294  N N   . LYS B  1 208 ? 112.861 51.327  -35.717 1.00 28.36  ? 205 LYS B N   1 
ATOM   5295  C CA  . LYS B  1 208 ? 114.115 50.595  -35.941 1.00 30.53  ? 205 LYS B CA  1 
ATOM   5296  C C   . LYS B  1 208 ? 115.293 51.537  -36.111 1.00 28.64  ? 205 LYS B C   1 
ATOM   5297  O O   . LYS B  1 208 ? 116.409 51.241  -35.708 1.00 27.77  ? 205 LYS B O   1 
ATOM   5298  C CB  . LYS B  1 208 ? 114.047 49.685  -37.175 1.00 33.55  ? 205 LYS B CB  1 
ATOM   5299  C CG  . LYS B  1 208 ? 115.168 48.634  -37.216 1.00 37.42  ? 205 LYS B CG  1 
ATOM   5300  C CD  . LYS B  1 208 ? 115.635 48.270  -38.632 1.00 39.80  ? 205 LYS B CD  1 
ATOM   5301  C CE  . LYS B  1 208 ? 116.763 47.227  -38.626 1.00 41.78  ? 205 LYS B CE  1 
ATOM   5302  N NZ  . LYS B  1 208 ? 116.429 45.924  -37.954 1.00 43.46  ? 205 LYS B NZ  1 
ATOM   5303  N N   . GLU B  1 209 ? 115.029 52.678  -36.720 1.00 27.19  ? 206 GLU B N   1 
ATOM   5304  C CA  . GLU B  1 209 ? 116.060 53.650  -36.954 1.00 26.21  ? 206 GLU B CA  1 
ATOM   5305  C C   . GLU B  1 209 ? 116.668 54.195  -35.689 1.00 25.13  ? 206 GLU B C   1 
ATOM   5306  O O   . GLU B  1 209 ? 117.880 54.354  -35.616 1.00 25.43  ? 206 GLU B O   1 
ATOM   5307  C CB  . GLU B  1 209 ? 115.513 54.812  -37.757 1.00 26.60  ? 206 GLU B CB  1 
ATOM   5308  C CG  . GLU B  1 209 ? 116.628 55.672  -38.309 1.00 27.42  ? 206 GLU B CG  1 
ATOM   5309  C CD  . GLU B  1 209 ? 116.147 56.935  -38.972 1.00 28.47  ? 206 GLU B CD  1 
ATOM   5310  O OE1 . GLU B  1 209 ? 114.985 56.969  -39.455 1.00 29.64  ? 206 GLU B OE1 1 
ATOM   5311  O OE2 . GLU B  1 209 ? 116.957 57.890  -39.011 1.00 28.69  ? 206 GLU B OE2 1 
ATOM   5312  N N   . ALA B  1 210 ? 115.818 54.539  -34.731 1.00 24.96  ? 207 ALA B N   1 
ATOM   5313  C CA  . ALA B  1 210 ? 116.265 55.017  -33.414 1.00 24.43  ? 207 ALA B CA  1 
ATOM   5314  C C   . ALA B  1 210 ? 117.030 53.962  -32.618 1.00 23.41  ? 207 ALA B C   1 
ATOM   5315  O O   . ALA B  1 210 ? 117.998 54.289  -31.926 1.00 23.02  ? 207 ALA B O   1 
ATOM   5316  C CB  . ALA B  1 210 ? 115.078 55.487  -32.597 1.00 25.26  ? 207 ALA B CB  1 
ATOM   5317  N N   . VAL B  1 211 ? 116.578 52.710  -32.713 1.00 22.19  ? 208 VAL B N   1 
ATOM   5318  C CA  . VAL B  1 211 ? 117.255 51.581  -32.094 1.00 21.24  ? 208 VAL B CA  1 
ATOM   5319  C C   . VAL B  1 211 ? 118.633 51.401  -32.691 1.00 21.43  ? 208 VAL B C   1 
ATOM   5320  O O   . VAL B  1 211 ? 119.620 51.472  -31.985 1.00 21.41  ? 208 VAL B O   1 
ATOM   5321  C CB  . VAL B  1 211 ? 116.466 50.292  -32.285 1.00 21.83  ? 208 VAL B CB  1 
ATOM   5322  C CG1 . VAL B  1 211 ? 117.238 49.087  -31.744 1.00 22.03  ? 208 VAL B CG1 1 
ATOM   5323  C CG2 . VAL B  1 211 ? 115.107 50.410  -31.604 1.00 22.41  ? 208 VAL B CG2 1 
ATOM   5324  N N   . ASP B  1 212 ? 118.692 51.178  -34.000 1.00 23.09  ? 209 ASP B N   1 
ATOM   5325  C CA  . ASP B  1 212 ? 119.961 50.978  -34.718 1.00 23.50  ? 209 ASP B CA  1 
ATOM   5326  C C   . ASP B  1 212 ? 120.935 52.102  -34.421 1.00 23.62  ? 209 ASP B C   1 
ATOM   5327  O O   . ASP B  1 212 ? 122.126 51.854  -34.233 1.00 24.74  ? 209 ASP B O   1 
ATOM   5328  C CB  . ASP B  1 212 ? 119.737 50.860  -36.226 1.00 24.01  ? 209 ASP B CB  1 
ATOM   5329  C CG  . ASP B  1 212 ? 119.191 49.502  -36.639 1.00 25.55  ? 209 ASP B CG  1 
ATOM   5330  O OD1 . ASP B  1 212 ? 118.943 48.616  -35.786 1.00 26.10  ? 209 ASP B OD1 1 
ATOM   5331  O OD2 . ASP B  1 212 ? 118.996 49.324  -37.855 1.00 28.49  ? 209 ASP B OD2 1 
ATOM   5332  N N   . ALA B  1 213 ? 120.425 53.326  -34.324 1.00 23.22  ? 210 ALA B N   1 
ATOM   5333  C CA  . ALA B  1 213 ? 121.260 54.482  -33.999 1.00 23.16  ? 210 ALA B CA  1 
ATOM   5334  C C   . ALA B  1 213 ? 121.964 54.312  -32.677 1.00 23.38  ? 210 ALA B C   1 
ATOM   5335  O O   . ALA B  1 213 ? 123.154 54.586  -32.593 1.00 24.82  ? 210 ALA B O   1 
ATOM   5336  C CB  . ALA B  1 213 ? 120.438 55.753  -33.982 1.00 23.33  ? 210 ALA B CB  1 
ATOM   5337  N N   . LEU B  1 214 ? 121.223 53.867  -31.657 1.00 23.67  ? 211 LEU B N   1 
ATOM   5338  C CA  . LEU B  1 214 ? 121.794 53.542  -30.323 1.00 23.33  ? 211 LEU B CA  1 
ATOM   5339  C C   . LEU B  1 214 ? 122.771 52.364  -30.356 1.00 22.50  ? 211 LEU B C   1 
ATOM   5340  O O   . LEU B  1 214 ? 123.811 52.382  -29.691 1.00 21.36  ? 211 LEU B O   1 
ATOM   5341  C CB  . LEU B  1 214 ? 120.692 53.229  -29.301 1.00 22.53  ? 211 LEU B CB  1 
ATOM   5342  C CG  . LEU B  1 214 ? 119.757 54.380  -28.965 1.00 22.05  ? 211 LEU B CG  1 
ATOM   5343  C CD1 . LEU B  1 214 ? 118.466 53.880  -28.347 1.00 21.70  ? 211 LEU B CD1 1 
ATOM   5344  C CD2 . LEU B  1 214 ? 120.455 55.348  -28.033 1.00 22.02  ? 211 LEU B CD2 1 
ATOM   5345  N N   . LEU B  1 215 ? 122.437 51.348  -31.130 1.00 21.75  ? 212 LEU B N   1 
ATOM   5346  C CA  . LEU B  1 215 ? 123.269 50.178  -31.159 1.00 22.71  ? 212 LEU B CA  1 
ATOM   5347  C C   . LEU B  1 215 ? 124.636 50.472  -31.769 1.00 23.30  ? 212 LEU B C   1 
ATOM   5348  O O   . LEU B  1 215 ? 125.617 49.833  -31.409 1.00 23.61  ? 212 LEU B O   1 
ATOM   5349  C CB  . LEU B  1 215 ? 122.575 49.056  -31.910 1.00 22.66  ? 212 LEU B CB  1 
ATOM   5350  C CG  . LEU B  1 215 ? 121.252 48.592  -31.303 1.00 22.89  ? 212 LEU B CG  1 
ATOM   5351  C CD1 . LEU B  1 215 ? 120.577 47.618  -32.256 1.00 22.60  ? 212 LEU B CD1 1 
ATOM   5352  C CD2 . LEU B  1 215 ? 121.447 47.965  -29.927 1.00 23.21  ? 212 LEU B CD2 1 
ATOM   5353  N N   . HIS B  1 216 ? 124.707 51.444  -32.679 1.00 24.02  ? 213 HIS B N   1 
ATOM   5354  C CA  . HIS B  1 216 ? 125.934 51.650  -33.484 1.00 23.52  ? 213 HIS B CA  1 
ATOM   5355  C C   . HIS B  1 216 ? 126.813 52.821  -33.006 1.00 23.01  ? 213 HIS B C   1 
ATOM   5356  O O   . HIS B  1 216 ? 127.986 52.890  -33.345 1.00 23.24  ? 213 HIS B O   1 
ATOM   5357  C CB  . HIS B  1 216 ? 125.593 51.689  -34.992 1.00 22.32  ? 213 HIS B CB  1 
ATOM   5358  C CG  . HIS B  1 216 ? 125.230 50.340  -35.558 1.00 22.29  ? 213 HIS B CG  1 
ATOM   5359  N ND1 . HIS B  1 216 ? 123.934 49.869  -35.599 1.00 22.90  ? 213 HIS B ND1 1 
ATOM   5360  C CD2 . HIS B  1 216 ? 125.995 49.354  -36.085 1.00 22.38  ? 213 HIS B CD2 1 
ATOM   5361  C CE1 . HIS B  1 216 ? 123.912 48.656  -36.126 1.00 21.98  ? 213 HIS B CE1 1 
ATOM   5362  N NE2 . HIS B  1 216 ? 125.150 48.321  -36.432 1.00 22.07  ? 213 HIS B NE2 1 
ATOM   5363  N N   . ASP B  1 217 ? 126.262 53.695  -32.174 1.00 23.08  ? 214 ASP B N   1 
ATOM   5364  C CA  . ASP B  1 217 ? 127.037 54.766  -31.547 1.00 23.57  ? 214 ASP B CA  1 
ATOM   5365  C C   . ASP B  1 217 ? 128.041 54.235  -30.463 1.00 25.84  ? 214 ASP B C   1 
ATOM   5366  O O   . ASP B  1 217 ? 127.663 53.619  -29.452 1.00 25.59  ? 214 ASP B O   1 
ATOM   5367  C CB  . ASP B  1 217 ? 126.074 55.808  -30.971 1.00 22.83  ? 214 ASP B CB  1 
ATOM   5368  C CG  . ASP B  1 217 ? 126.735 57.156  -30.719 1.00 22.72  ? 214 ASP B CG  1 
ATOM   5369  O OD1 . ASP B  1 217 ? 127.681 57.186  -29.920 1.00 22.77  ? 214 ASP B OD1 1 
ATOM   5370  O OD2 . ASP B  1 217 ? 126.303 58.191  -31.295 1.00 21.47  ? 214 ASP B OD2 1 
ATOM   5371  N N   . ASP B  1 218 ? 129.328 54.513  -30.667 1.00 28.77  ? 215 ASP B N   1 
ATOM   5372  C CA  . ASP B  1 218 ? 130.392 54.038  -29.753 1.00 29.72  ? 215 ASP B CA  1 
ATOM   5373  C C   . ASP B  1 218 ? 130.278 54.579  -28.334 1.00 27.89  ? 215 ASP B C   1 
ATOM   5374  O O   . ASP B  1 218 ? 130.814 53.971  -27.422 1.00 27.25  ? 215 ASP B O   1 
ATOM   5375  C CB  . ASP B  1 218 ? 131.782 54.395  -30.266 1.00 31.86  ? 215 ASP B CB  1 
ATOM   5376  C CG  . ASP B  1 218 ? 132.091 53.771  -31.589 1.00 36.41  ? 215 ASP B CG  1 
ATOM   5377  O OD1 . ASP B  1 218 ? 131.154 53.330  -32.303 1.00 41.75  ? 215 ASP B OD1 1 
ATOM   5378  O OD2 . ASP B  1 218 ? 133.293 53.738  -31.918 1.00 40.86  ? 215 ASP B OD2 1 
ATOM   5379  N N   . ARG B  1 219 ? 129.608 55.722  -28.164 1.00 25.64  ? 216 ARG B N   1 
ATOM   5380  C CA  . ARG B  1 219 ? 129.369 56.325  -26.842 1.00 23.52  ? 216 ARG B CA  1 
ATOM   5381  C C   . ARG B  1 219 ? 128.395 55.536  -25.983 1.00 22.28  ? 216 ARG B C   1 
ATOM   5382  O O   . ARG B  1 219 ? 128.372 55.711  -24.768 1.00 21.59  ? 216 ARG B O   1 
ATOM   5383  C CB  . ARG B  1 219 ? 128.825 57.755  -26.969 1.00 23.58  ? 216 ARG B CB  1 
ATOM   5384  C CG  . ARG B  1 219 ? 129.831 58.804  -27.420 1.00 23.40  ? 216 ARG B CG  1 
ATOM   5385  C CD  . ARG B  1 219 ? 129.162 60.148  -27.723 1.00 23.28  ? 216 ARG B CD  1 
ATOM   5386  N NE  . ARG B  1 219 ? 128.290 60.074  -28.909 1.00 23.12  ? 216 ARG B NE  1 
ATOM   5387  C CZ  . ARG B  1 219 ? 127.544 61.069  -29.387 1.00 21.53  ? 216 ARG B CZ  1 
ATOM   5388  N NH1 . ARG B  1 219 ? 127.531 62.242  -28.810 1.00 21.52  ? 216 ARG B NH1 1 
ATOM   5389  N NH2 . ARG B  1 219 ? 126.808 60.889  -30.455 1.00 21.36  ? 216 ARG B NH2 1 
ATOM   5390  N N   . VAL B  1 220 ? 127.554 54.719  -26.614 1.00 21.37  ? 217 VAL B N   1 
ATOM   5391  C CA  . VAL B  1 220 ? 126.616 53.879  -25.879 1.00 20.34  ? 217 VAL B CA  1 
ATOM   5392  C C   . VAL B  1 220 ? 127.346 52.640  -25.455 1.00 19.59  ? 217 VAL B C   1 
ATOM   5393  O O   . VAL B  1 220 ? 127.856 51.903  -26.289 1.00 19.94  ? 217 VAL B O   1 
ATOM   5394  C CB  . VAL B  1 220 ? 125.386 53.510  -26.724 1.00 20.18  ? 217 VAL B CB  1 
ATOM   5395  C CG1 . VAL B  1 220 ? 124.590 52.380  -26.096 1.00 19.95  ? 217 VAL B CG1 1 
ATOM   5396  C CG2 . VAL B  1 220 ? 124.492 54.722  -26.881 1.00 20.19  ? 217 VAL B CG2 1 
ATOM   5397  N N   . LYS B  1 221 ? 127.344 52.399  -24.157 1.00 19.44  ? 218 LYS B N   1 
ATOM   5398  C CA  . LYS B  1 221 ? 128.172 51.360  -23.556 1.00 19.63  ? 218 LYS B CA  1 
ATOM   5399  C C   . LYS B  1 221 ? 127.465 50.119  -23.030 1.00 17.77  ? 218 LYS B C   1 
ATOM   5400  O O   . LYS B  1 221 ? 128.133 49.181  -22.611 1.00 17.75  ? 218 LYS B O   1 
ATOM   5401  C CB  . LYS B  1 221 ? 128.958 51.980  -22.413 1.00 21.11  ? 218 LYS B CB  1 
ATOM   5402  C CG  . LYS B  1 221 ? 130.375 52.298  -22.806 1.00 22.63  ? 218 LYS B CG  1 
ATOM   5403  C CD  . LYS B  1 221 ? 130.561 53.752  -23.172 1.00 23.37  ? 218 LYS B CD  1 
ATOM   5404  C CE  . LYS B  1 221 ? 131.976 53.959  -23.694 1.00 24.43  ? 218 LYS B CE  1 
ATOM   5405  N NZ  . LYS B  1 221 ? 131.990 53.999  -25.180 1.00 25.67  ? 218 LYS B NZ  1 
ATOM   5406  N N   . ALA B  1 222 ? 126.141 50.117  -23.031 1.00 15.78  ? 219 ALA B N   1 
ATOM   5407  C CA  . ALA B  1 222 ? 125.414 48.973  -22.577 1.00 15.29  ? 219 ALA B CA  1 
ATOM   5408  C C   . ALA B  1 222 ? 124.000 49.067  -23.022 1.00 14.45  ? 219 ALA B C   1 
ATOM   5409  O O   . ALA B  1 222 ? 123.432 50.128  -22.944 1.00 14.47  ? 219 ALA B O   1 
ATOM   5410  C CB  . ALA B  1 222 ? 125.448 48.924  -21.064 1.00 16.17  ? 219 ALA B CB  1 
ATOM   5411  N N   . VAL B  1 223 ? 123.411 47.952  -23.430 1.00 14.03  ? 220 VAL B N   1 
ATOM   5412  C CA  . VAL B  1 223 ? 122.040 47.953  -23.907 1.00 13.79  ? 220 VAL B CA  1 
ATOM   5413  C C   . VAL B  1 223 ? 121.192 46.956  -23.149 1.00 13.48  ? 220 VAL B C   1 
ATOM   5414  O O   . VAL B  1 223 ? 121.486 45.776  -23.123 1.00 13.25  ? 220 VAL B O   1 
ATOM   5415  C CB  . VAL B  1 223 ? 121.966 47.613  -25.404 1.00 14.11  ? 220 VAL B CB  1 
ATOM   5416  C CG1 . VAL B  1 223 ? 120.530 47.714  -25.918 1.00 14.05  ? 220 VAL B CG1 1 
ATOM   5417  C CG2 . VAL B  1 223 ? 122.863 48.549  -26.201 1.00 14.12  ? 220 VAL B CG2 1 
ATOM   5418  N N   . SER B  1 224 ? 120.124 47.462  -22.555 1.00 13.40  ? 221 SER B N   1 
ATOM   5419  C CA  . SER B  1 224 ? 119.112 46.650  -21.917 1.00 13.35  ? 221 SER B CA  1 
ATOM   5420  C C   . SER B  1 224 ? 117.909 46.670  -22.832 1.00 13.66  ? 221 SER B C   1 
ATOM   5421  O O   . SER B  1 224 ? 117.393 47.722  -23.166 1.00 12.99  ? 221 SER B O   1 
ATOM   5422  C CB  . SER B  1 224 ? 118.729 47.228  -20.552 1.00 13.48  ? 221 SER B CB  1 
ATOM   5423  O OG  . SER B  1 224 ? 119.765 47.107  -19.576 1.00 13.36  ? 221 SER B OG  1 
ATOM   5424  N N   . PHE B  1 225 ? 117.495 45.495  -23.281 1.00 14.97  ? 222 PHE B N   1 
ATOM   5425  C CA  . PHE B  1 225 ? 116.346 45.361  -24.163 1.00 15.32  ? 222 PHE B CA  1 
ATOM   5426  C C   . PHE B  1 225 ? 115.405 44.442  -23.469 1.00 15.90  ? 222 PHE B C   1 
ATOM   5427  O O   . PHE B  1 225 ? 115.857 43.462  -22.861 1.00 16.01  ? 222 PHE B O   1 
ATOM   5428  C CB  . PHE B  1 225 ? 116.723 44.725  -25.486 1.00 15.50  ? 222 PHE B CB  1 
ATOM   5429  C CG  . PHE B  1 225 ? 115.536 44.394  -26.352 1.00 16.03  ? 222 PHE B CG  1 
ATOM   5430  C CD1 . PHE B  1 225 ? 114.998 45.335  -27.200 1.00 16.48  ? 222 PHE B CD1 1 
ATOM   5431  C CD2 . PHE B  1 225 ? 114.944 43.142  -26.309 1.00 16.27  ? 222 PHE B CD2 1 
ATOM   5432  C CE1 . PHE B  1 225 ? 113.903 45.034  -27.997 1.00 16.43  ? 222 PHE B CE1 1 
ATOM   5433  C CE2 . PHE B  1 225 ? 113.842 42.844  -27.087 1.00 16.15  ? 222 PHE B CE2 1 
ATOM   5434  C CZ  . PHE B  1 225 ? 113.320 43.791  -27.931 1.00 16.21  ? 222 PHE B CZ  1 
ATOM   5435  N N   . VAL B  1 226 ? 114.111 44.757  -23.572 1.00 16.33  ? 223 VAL B N   1 
ATOM   5436  C CA  . VAL B  1 226 ? 113.044 43.838  -23.204 1.00 16.74  ? 223 VAL B CA  1 
ATOM   5437  C C   . VAL B  1 226 ? 111.940 43.861  -24.257 1.00 16.93  ? 223 VAL B C   1 
ATOM   5438  O O   . VAL B  1 226 ? 111.353 44.917  -24.526 1.00 16.34  ? 223 VAL B O   1 
ATOM   5439  C CB  . VAL B  1 226 ? 112.443 44.202  -21.850 1.00 17.07  ? 223 VAL B CB  1 
ATOM   5440  C CG1 . VAL B  1 226 ? 111.331 43.217  -21.486 1.00 17.39  ? 223 VAL B CG1 1 
ATOM   5441  C CG2 . VAL B  1 226 ? 113.525 44.199  -20.773 1.00 17.16  ? 223 VAL B CG2 1 
ATOM   5442  N N   . GLY B  1 227 ? 111.647 42.691  -24.819 1.00 16.91  ? 224 GLY B N   1 
ATOM   5443  C CA  . GLY B  1 227 ? 110.606 42.574  -25.820 1.00 17.89  ? 224 GLY B CA  1 
ATOM   5444  C C   . GLY B  1 227 ? 110.379 41.156  -26.322 1.00 19.41  ? 224 GLY B C   1 
ATOM   5445  O O   . GLY B  1 227 ? 110.290 40.194  -25.530 1.00 19.95  ? 224 GLY B O   1 
ATOM   5446  N N   . SER B  1 228 ? 110.264 41.017  -27.644 1.00 20.53  ? 225 SER B N   1 
ATOM   5447  C CA  . SER B  1 228 ? 110.060 39.701  -28.271 1.00 21.29  ? 225 SER B CA  1 
ATOM   5448  C C   . SER B  1 228 ? 111.383 38.994  -28.551 1.00 22.81  ? 225 SER B C   1 
ATOM   5449  O O   . SER B  1 228 ? 112.391 39.650  -28.848 1.00 23.75  ? 225 SER B O   1 
ATOM   5450  C CB  . SER B  1 228 ? 109.291 39.856  -29.576 1.00 20.95  ? 225 SER B CB  1 
ATOM   5451  O OG  . SER B  1 228 ? 110.120 40.356  -30.618 1.00 20.31  ? 225 SER B OG  1 
ATOM   5452  N N   . THR B  1 229 ? 111.357 37.661  -28.511 1.00 23.96  ? 226 THR B N   1 
ATOM   5453  C CA  . THR B  1 229 ? 112.552 36.850  -28.753 1.00 25.34  ? 226 THR B CA  1 
ATOM   5454  C C   . THR B  1 229 ? 113.244 37.259  -30.057 1.00 25.59  ? 226 THR B C   1 
ATOM   5455  O O   . THR B  1 229 ? 114.435 37.634  -30.031 1.00 25.94  ? 226 THR B O   1 
ATOM   5456  C CB  . THR B  1 229 ? 112.243 35.334  -28.743 1.00 25.89  ? 226 THR B CB  1 
ATOM   5457  O OG1 . THR B  1 229 ? 111.585 35.019  -27.523 1.00 28.19  ? 226 THR B OG1 1 
ATOM   5458  C CG2 . THR B  1 229 ? 113.518 34.492  -28.834 1.00 25.78  ? 226 THR B CG2 1 
ATOM   5459  N N   . PRO B  1 230 ? 112.504 37.237  -31.184 1.00 24.64  ? 227 PRO B N   1 
ATOM   5460  C CA  . PRO B  1 230 ? 113.122 37.570  -32.480 1.00 24.28  ? 227 PRO B CA  1 
ATOM   5461  C C   . PRO B  1 230 ? 113.912 38.876  -32.475 1.00 23.79  ? 227 PRO B C   1 
ATOM   5462  O O   . PRO B  1 230 ? 114.980 38.932  -33.101 1.00 23.05  ? 227 PRO B O   1 
ATOM   5463  C CB  . PRO B  1 230 ? 111.927 37.687  -33.436 1.00 24.18  ? 227 PRO B CB  1 
ATOM   5464  C CG  . PRO B  1 230 ? 110.845 36.905  -32.797 1.00 25.10  ? 227 PRO B CG  1 
ATOM   5465  C CD  . PRO B  1 230 ? 111.055 37.012  -31.314 1.00 25.14  ? 227 PRO B CD  1 
ATOM   5466  N N   . ILE B  1 231 ? 113.394 39.897  -31.768 1.00 23.17  ? 228 ILE B N   1 
ATOM   5467  C CA  . ILE B  1 231 ? 114.058 41.219  -31.678 1.00 22.93  ? 228 ILE B CA  1 
ATOM   5468  C C   . ILE B  1 231 ? 115.151 41.218  -30.624 1.00 22.08  ? 228 ILE B C   1 
ATOM   5469  O O   . ILE B  1 231 ? 116.266 41.700  -30.870 1.00 20.63  ? 228 ILE B O   1 
ATOM   5470  C CB  . ILE B  1 231 ? 113.088 42.384  -31.345 1.00 23.74  ? 228 ILE B CB  1 
ATOM   5471  C CG1 . ILE B  1 231 ? 111.887 42.418  -32.309 1.00 24.26  ? 228 ILE B CG1 1 
ATOM   5472  C CG2 . ILE B  1 231 ? 113.825 43.729  -31.373 1.00 22.75  ? 228 ILE B CG2 1 
ATOM   5473  C CD1 . ILE B  1 231 ? 112.251 42.598  -33.769 1.00 24.60  ? 228 ILE B CD1 1 
ATOM   5474  N N   . ALA B  1 232 ? 114.830 40.681  -29.448 1.00 21.60  ? 229 ALA B N   1 
ATOM   5475  C CA  . ALA B  1 232 ? 115.852 40.436  -28.418 1.00 20.88  ? 229 ALA B CA  1 
ATOM   5476  C C   . ALA B  1 232 ? 117.107 39.844  -29.056 1.00 20.46  ? 229 ALA B C   1 
ATOM   5477  O O   . ALA B  1 232 ? 118.180 40.399  -28.883 1.00 19.09  ? 229 ALA B O   1 
ATOM   5478  C CB  . ALA B  1 232 ? 115.322 39.523  -27.328 1.00 20.45  ? 229 ALA B CB  1 
ATOM   5479  N N   . GLU B  1 233 ? 116.941 38.755  -29.818 1.00 20.83  ? 230 GLU B N   1 
ATOM   5480  C CA  . GLU B  1 233 ? 118.044 38.101  -30.541 1.00 22.53  ? 230 GLU B CA  1 
ATOM   5481  C C   . GLU B  1 233 ? 118.828 39.060  -31.416 1.00 21.33  ? 230 GLU B C   1 
ATOM   5482  O O   . GLU B  1 233 ? 120.058 39.035  -31.420 1.00 21.15  ? 230 GLU B O   1 
ATOM   5483  C CB  . GLU B  1 233 ? 117.530 36.956  -31.426 1.00 25.57  ? 230 GLU B CB  1 
ATOM   5484  C CG  . GLU B  1 233 ? 118.611 36.022  -31.975 1.00 28.55  ? 230 GLU B CG  1 
ATOM   5485  C CD  . GLU B  1 233 ? 118.037 34.705  -32.510 1.00 32.28  ? 230 GLU B CD  1 
ATOM   5486  O OE1 . GLU B  1 233 ? 116.809 34.621  -32.737 1.00 35.17  ? 230 GLU B OE1 1 
ATOM   5487  O OE2 . GLU B  1 233 ? 118.796 33.728  -32.700 1.00 35.10  ? 230 GLU B OE2 1 
ATOM   5488  N N   . TYR B  1 234 ? 118.118 39.893  -32.168 1.00 20.17  ? 231 TYR B N   1 
ATOM   5489  C CA  . TYR B  1 234 ? 118.777 40.834  -33.091 1.00 19.67  ? 231 TYR B CA  1 
ATOM   5490  C C   . TYR B  1 234 ? 119.541 41.913  -32.357 1.00 19.54  ? 231 TYR B C   1 
ATOM   5491  O O   . TYR B  1 234 ? 120.643 42.256  -32.750 1.00 18.98  ? 231 TYR B O   1 
ATOM   5492  C CB  . TYR B  1 234 ? 117.767 41.479  -34.027 1.00 19.48  ? 231 TYR B CB  1 
ATOM   5493  C CG  . TYR B  1 234 ? 118.262 42.734  -34.685 1.00 18.78  ? 231 TYR B CG  1 
ATOM   5494  C CD1 . TYR B  1 234 ? 118.919 42.690  -35.903 1.00 18.85  ? 231 TYR B CD1 1 
ATOM   5495  C CD2 . TYR B  1 234 ? 118.053 43.980  -34.096 1.00 18.85  ? 231 TYR B CD2 1 
ATOM   5496  C CE1 . TYR B  1 234 ? 119.381 43.857  -36.523 1.00 18.79  ? 231 TYR B CE1 1 
ATOM   5497  C CE2 . TYR B  1 234 ? 118.506 45.155  -34.706 1.00 18.89  ? 231 TYR B CE2 1 
ATOM   5498  C CZ  . TYR B  1 234 ? 119.177 45.095  -35.920 1.00 18.63  ? 231 TYR B CZ  1 
ATOM   5499  O OH  . TYR B  1 234 ? 119.638 46.258  -36.509 1.00 17.97  ? 231 TYR B OH  1 
ATOM   5500  N N   . ILE B  1 235 ? 118.927 42.457  -31.308 1.00 20.08  ? 232 ILE B N   1 
ATOM   5501  C CA  . ILE B  1 235 ? 119.565 43.460  -30.441 1.00 20.05  ? 232 ILE B CA  1 
ATOM   5502  C C   . ILE B  1 235 ? 120.858 42.895  -29.809 1.00 20.26  ? 232 ILE B C   1 
ATOM   5503  O O   . ILE B  1 235 ? 121.892 43.574  -29.839 1.00 20.04  ? 232 ILE B O   1 
ATOM   5504  C CB  . ILE B  1 235 ? 118.599 43.966  -29.327 1.00 19.73  ? 232 ILE B CB  1 
ATOM   5505  C CG1 . ILE B  1 235 ? 117.348 44.636  -29.909 1.00 19.87  ? 232 ILE B CG1 1 
ATOM   5506  C CG2 . ILE B  1 235 ? 119.280 44.935  -28.379 1.00 19.43  ? 232 ILE B CG2 1 
ATOM   5507  C CD1 . ILE B  1 235 ? 117.578 45.895  -30.708 1.00 19.62  ? 232 ILE B CD1 1 
ATOM   5508  N N   . TYR B  1 236 ? 120.789 41.674  -29.262 1.00 19.96  ? 233 TYR B N   1 
ATOM   5509  C CA  . TYR B  1 236 ? 121.940 41.024  -28.627 1.00 20.24  ? 233 TYR B CA  1 
ATOM   5510  C C   . TYR B  1 236 ? 123.053 40.782  -29.604 1.00 21.78  ? 233 TYR B C   1 
ATOM   5511  O O   . TYR B  1 236 ? 124.214 41.007  -29.275 1.00 21.02  ? 233 TYR B O   1 
ATOM   5512  C CB  . TYR B  1 236 ? 121.559 39.672  -28.042 1.00 19.86  ? 233 TYR B CB  1 
ATOM   5513  C CG  . TYR B  1 236 ? 122.579 39.077  -27.101 1.00 19.47  ? 233 TYR B CG  1 
ATOM   5514  C CD1 . TYR B  1 236 ? 122.823 39.656  -25.863 1.00 20.02  ? 233 TYR B CD1 1 
ATOM   5515  C CD2 . TYR B  1 236 ? 123.269 37.919  -27.418 1.00 19.37  ? 233 TYR B CD2 1 
ATOM   5516  C CE1 . TYR B  1 236 ? 123.739 39.106  -24.975 1.00 19.73  ? 233 TYR B CE1 1 
ATOM   5517  C CE2 . TYR B  1 236 ? 124.187 37.372  -26.535 1.00 19.37  ? 233 TYR B CE2 1 
ATOM   5518  C CZ  . TYR B  1 236 ? 124.404 37.973  -25.318 1.00 19.01  ? 233 TYR B CZ  1 
ATOM   5519  O OH  . TYR B  1 236 ? 125.271 37.456  -24.429 1.00 18.98  ? 233 TYR B OH  1 
ATOM   5520  N N   . ARG B  1 237 ? 122.690 40.292  -30.795 1.00 24.65  ? 234 ARG B N   1 
ATOM   5521  C CA  . ARG B  1 237 ? 123.660 39.975  -31.849 1.00 25.98  ? 234 ARG B CA  1 
ATOM   5522  C C   . ARG B  1 237 ? 124.306 41.271  -32.324 1.00 22.64  ? 234 ARG B C   1 
ATOM   5523  O O   . ARG B  1 237 ? 125.529 41.351  -32.491 1.00 21.64  ? 234 ARG B O   1 
ATOM   5524  C CB  . ARG B  1 237 ? 122.993 39.219  -33.005 1.00 31.42  ? 234 ARG B CB  1 
ATOM   5525  C CG  . ARG B  1 237 ? 123.961 38.811  -34.119 1.00 40.65  ? 234 ARG B CG  1 
ATOM   5526  C CD  . ARG B  1 237 ? 123.292 38.275  -35.392 1.00 46.71  ? 234 ARG B CD  1 
ATOM   5527  N NE  . ARG B  1 237 ? 122.549 37.050  -35.079 1.00 57.17  ? 234 ARG B NE  1 
ATOM   5528  C CZ  . ARG B  1 237 ? 121.218 36.942  -34.961 1.00 66.59  ? 234 ARG B CZ  1 
ATOM   5529  N NH1 . ARG B  1 237 ? 120.397 37.984  -35.177 1.00 67.22  ? 234 ARG B NH1 1 
ATOM   5530  N NH2 . ARG B  1 237 ? 120.693 35.753  -34.646 1.00 68.31  ? 234 ARG B NH2 1 
ATOM   5531  N N   . THR B  1 238 ? 123.486 42.300  -32.489 1.00 20.19  ? 235 THR B N   1 
ATOM   5532  C CA  . THR B  1 238 ? 123.972 43.566  -33.018 1.00 19.11  ? 235 THR B CA  1 
ATOM   5533  C C   . THR B  1 238 ? 124.852 44.261  -32.016 1.00 18.56  ? 235 THR B C   1 
ATOM   5534  O O   . THR B  1 238 ? 125.905 44.718  -32.378 1.00 18.29  ? 235 THR B O   1 
ATOM   5535  C CB  . THR B  1 238 ? 122.844 44.523  -33.491 1.00 18.11  ? 235 THR B CB  1 
ATOM   5536  O OG1 . THR B  1 238 ? 122.100 43.927  -34.564 1.00 17.30  ? 235 THR B OG1 1 
ATOM   5537  C CG2 . THR B  1 238 ? 123.427 45.809  -34.012 1.00 17.53  ? 235 THR B CG2 1 
ATOM   5538  N N   . ALA B  1 239 ? 124.425 44.352  -30.767 1.00 19.30  ? 236 ALA B N   1 
ATOM   5539  C CA  . ALA B  1 239 ? 125.257 44.990  -29.715 1.00 19.92  ? 236 ALA B CA  1 
ATOM   5540  C C   . ALA B  1 239 ? 126.543 44.233  -29.430 1.00 20.63  ? 236 ALA B C   1 
ATOM   5541  O O   . ALA B  1 239 ? 127.585 44.839  -29.228 1.00 20.99  ? 236 ALA B O   1 
ATOM   5542  C CB  . ALA B  1 239 ? 124.484 45.135  -28.422 1.00 19.63  ? 236 ALA B CB  1 
ATOM   5543  N N   . SER B  1 240 ? 126.469 42.913  -29.387 1.00 21.54  ? 237 SER B N   1 
ATOM   5544  C CA  . SER B  1 240 ? 127.669 42.096  -29.215 1.00 23.15  ? 237 SER B CA  1 
ATOM   5545  C C   . SER B  1 240 ? 128.697 42.332  -30.321 1.00 24.39  ? 237 SER B C   1 
ATOM   5546  O O   . SER B  1 240 ? 129.880 42.504  -30.061 1.00 21.45  ? 237 SER B O   1 
ATOM   5547  C CB  . SER B  1 240 ? 127.270 40.632  -29.163 1.00 23.15  ? 237 SER B CB  1 
ATOM   5548  O OG  . SER B  1 240 ? 126.315 40.445  -28.127 1.00 23.28  ? 237 SER B OG  1 
ATOM   5549  N N   . ALA B  1 241 ? 128.206 42.370  -31.551 1.00 28.40  ? 238 ALA B N   1 
ATOM   5550  C CA  . ALA B  1 241 ? 129.029 42.672  -32.720 1.00 32.34  ? 238 ALA B CA  1 
ATOM   5551  C C   . ALA B  1 241 ? 129.745 44.025  -32.676 1.00 31.94  ? 238 ALA B C   1 
ATOM   5552  O O   . ALA B  1 241 ? 130.824 44.170  -33.253 1.00 37.06  ? 238 ALA B O   1 
ATOM   5553  C CB  . ALA B  1 241 ? 128.184 42.583  -33.989 1.00 33.64  ? 238 ALA B CB  1 
ATOM   5554  N N   . ASN B  1 242 ? 129.138 45.004  -32.025 1.00 31.83  ? 239 ASN B N   1 
ATOM   5555  C CA  . ASN B  1 242 ? 129.719 46.350  -31.884 1.00 33.69  ? 239 ASN B CA  1 
ATOM   5556  C C   . ASN B  1 242 ? 130.624 46.485  -30.652 1.00 34.97  ? 239 ASN B C   1 
ATOM   5557  O O   . ASN B  1 242 ? 131.232 47.531  -30.436 1.00 34.57  ? 239 ASN B O   1 
ATOM   5558  C CB  . ASN B  1 242 ? 128.622 47.406  -31.802 1.00 33.71  ? 239 ASN B CB  1 
ATOM   5559  C CG  . ASN B  1 242 ? 127.992 47.705  -33.143 1.00 35.14  ? 239 ASN B CG  1 
ATOM   5560  O OD1 . ASN B  1 242 ? 127.983 48.845  -33.584 1.00 37.68  ? 239 ASN B OD1 1 
ATOM   5561  N ND2 . ASN B  1 242 ? 127.444 46.693  -33.790 1.00 37.12  ? 239 ASN B ND2 1 
ATOM   5562  N N   . GLY B  1 243 ? 130.675 45.436  -29.830 1.00 36.87  ? 240 GLY B N   1 
ATOM   5563  C CA  . GLY B  1 243 ? 131.617 45.340  -28.714 1.00 35.96  ? 240 GLY B CA  1 
ATOM   5564  C C   . GLY B  1 243 ? 131.063 45.714  -27.347 1.00 35.65  ? 240 GLY B C   1 
ATOM   5565  O O   . GLY B  1 243 ? 131.730 45.474  -26.325 1.00 35.85  ? 240 GLY B O   1 
ATOM   5566  N N   . LYS B  1 244 ? 129.864 46.313  -27.324 1.00 33.91  ? 241 LYS B N   1 
ATOM   5567  C CA  . LYS B  1 244 ? 129.180 46.692  -26.064 1.00 31.93  ? 241 LYS B CA  1 
ATOM   5568  C C   . LYS B  1 244 ? 128.377 45.546  -25.408 1.00 28.63  ? 241 LYS B C   1 
ATOM   5569  O O   . LYS B  1 244 ? 127.930 44.619  -26.078 1.00 26.86  ? 241 LYS B O   1 
ATOM   5570  C CB  . LYS B  1 244 ? 128.302 47.934  -26.256 1.00 32.15  ? 241 LYS B CB  1 
ATOM   5571  C CG  . LYS B  1 244 ? 127.049 47.749  -27.116 1.00 33.36  ? 241 LYS B CG  1 
ATOM   5572  C CD  . LYS B  1 244 ? 126.559 49.075  -27.715 1.00 33.81  ? 241 LYS B CD  1 
ATOM   5573  C CE  . LYS B  1 244 ? 127.546 49.651  -28.732 1.00 34.76  ? 241 LYS B CE  1 
ATOM   5574  N NZ  . LYS B  1 244 ? 127.394 51.104  -28.960 1.00 35.30  ? 241 LYS B NZ  1 
ATOM   5575  N N   . ARG B  1 245 ? 128.250 45.614  -24.083 1.00 25.59  ? 242 ARG B N   1 
ATOM   5576  C CA  . ARG B  1 245 ? 127.594 44.554  -23.292 1.00 24.22  ? 242 ARG B CA  1 
ATOM   5577  C C   . ARG B  1 245 ? 126.091 44.606  -23.424 1.00 21.85  ? 242 ARG B C   1 
ATOM   5578  O O   . ARG B  1 245 ? 125.543 45.655  -23.733 1.00 23.89  ? 242 ARG B O   1 
ATOM   5579  C CB  . ARG B  1 245 ? 127.943 44.681  -21.799 1.00 24.78  ? 242 ARG B CB  1 
ATOM   5580  C CG  . ARG B  1 245 ? 127.468 45.968  -21.113 1.00 23.45  ? 242 ARG B CG  1 
ATOM   5581  C CD  . ARG B  1 245 ? 127.599 45.862  -19.610 1.00 22.43  ? 242 ARG B CD  1 
ATOM   5582  N NE  . ARG B  1 245 ? 128.992 45.885  -19.179 1.00 22.27  ? 242 ARG B NE  1 
ATOM   5583  C CZ  . ARG B  1 245 ? 129.379 45.948  -17.907 1.00 21.73  ? 242 ARG B CZ  1 
ATOM   5584  N NH1 . ARG B  1 245 ? 128.480 45.973  -16.940 1.00 21.53  ? 242 ARG B NH1 1 
ATOM   5585  N NH2 . ARG B  1 245 ? 130.667 45.974  -17.592 1.00 21.66  ? 242 ARG B NH2 1 
ATOM   5586  N N   . CYS B  1 246 ? 125.401 43.515  -23.145 1.00 18.52  ? 243 CYS B N   1 
ATOM   5587  C CA  . CYS B  1 246 ? 123.974 43.520  -23.430 1.00 17.46  ? 243 CYS B CA  1 
ATOM   5588  C C   . CYS B  1 246 ? 123.158 42.506  -22.644 1.00 16.61  ? 243 CYS B C   1 
ATOM   5589  O O   . CYS B  1 246 ? 123.599 41.383  -22.402 1.00 15.84  ? 243 CYS B O   1 
ATOM   5590  C CB  . CYS B  1 246 ? 123.747 43.315  -24.939 1.00 17.33  ? 243 CYS B CB  1 
ATOM   5591  S SG  . CYS B  1 246 ? 122.032 43.416  -25.535 1.00 16.88  ? 243 CYS B SG  1 
ATOM   5592  N N   . GLN B  1 247 ? 121.958 42.934  -22.252 1.00 15.72  ? 244 GLN B N   1 
ATOM   5593  C CA  . GLN B  1 247 ? 120.939 42.041  -21.741 1.00 15.66  ? 244 GLN B CA  1 
ATOM   5594  C C   . GLN B  1 247 ? 119.669 42.198  -22.573 1.00 15.53  ? 244 GLN B C   1 
ATOM   5595  O O   . GLN B  1 247 ? 119.139 43.312  -22.709 1.00 15.58  ? 244 GLN B O   1 
ATOM   5596  C CB  . GLN B  1 247 ? 120.668 42.293  -20.248 1.00 15.67  ? 244 GLN B CB  1 
ATOM   5597  C CG  . GLN B  1 247 ? 120.235 43.709  -19.867 1.00 15.71  ? 244 GLN B CG  1 
ATOM   5598  C CD  . GLN B  1 247 ? 120.013 43.952  -18.358 1.00 15.94  ? 244 GLN B CD  1 
ATOM   5599  O OE1 . GLN B  1 247 ? 119.530 45.030  -17.963 1.00 16.04  ? 244 GLN B OE1 1 
ATOM   5600  N NE2 . GLN B  1 247 ? 120.348 42.971  -17.513 1.00 16.02  ? 244 GLN B NE2 1 
ATOM   5601  N N   . ALA B  1 248 ? 119.173 41.082  -23.114 1.00 14.93  ? 245 ALA B N   1 
ATOM   5602  C CA  . ALA B  1 248 ? 117.994 41.117  -23.972 1.00 14.68  ? 245 ALA B CA  1 
ATOM   5603  C C   . ALA B  1 248 ? 116.963 40.070  -23.586 1.00 14.39  ? 245 ALA B C   1 
ATOM   5604  O O   . ALA B  1 248 ? 117.154 38.905  -23.841 1.00 14.01  ? 245 ALA B O   1 
ATOM   5605  C CB  . ALA B  1 248 ? 118.413 40.940  -25.412 1.00 14.77  ? 245 ALA B CB  1 
ATOM   5606  N N   . LEU B  1 249 ? 115.859 40.493  -22.980 1.00 14.87  ? 246 LEU B N   1 
ATOM   5607  C CA  . LEU B  1 249 ? 114.835 39.545  -22.520 1.00 15.35  ? 246 LEU B CA  1 
ATOM   5608  C C   . LEU B  1 249 ? 113.873 39.339  -23.656 1.00 15.69  ? 246 LEU B C   1 
ATOM   5609  O O   . LEU B  1 249 ? 113.553 40.290  -24.343 1.00 15.80  ? 246 LEU B O   1 
ATOM   5610  C CB  . LEU B  1 249 ? 114.099 40.040  -21.275 1.00 15.20  ? 246 LEU B CB  1 
ATOM   5611  C CG  . LEU B  1 249 ? 114.910 39.881  -19.990 1.00 15.71  ? 246 LEU B CG  1 
ATOM   5612  C CD1 . LEU B  1 249 ? 116.082 40.861  -19.905 1.00 16.19  ? 246 LEU B CD1 1 
ATOM   5613  C CD2 . LEU B  1 249 ? 114.034 40.062  -18.773 1.00 15.76  ? 246 LEU B CD2 1 
ATOM   5614  N N   . GLY B  1 250 ? 113.418 38.105  -23.836 1.00 16.18  ? 247 GLY B N   1 
ATOM   5615  C CA  . GLY B  1 250 ? 112.527 37.741  -24.925 1.00 17.89  ? 247 GLY B CA  1 
ATOM   5616  C C   . GLY B  1 250 ? 111.198 37.158  -24.463 1.00 19.48  ? 247 GLY B C   1 
ATOM   5617  O O   . GLY B  1 250 ? 110.713 37.462  -23.379 1.00 20.84  ? 247 GLY B O   1 
ATOM   5618  N N   . GLY B  1 251 ? 110.625 36.286  -25.283 1.00 20.45  ? 248 GLY B N   1 
ATOM   5619  C CA  . GLY B  1 251 ? 109.272 35.828  -25.086 1.00 21.92  ? 248 GLY B CA  1 
ATOM   5620  C C   . GLY B  1 251 ? 109.168 34.683  -24.109 1.00 24.11  ? 248 GLY B C   1 
ATOM   5621  O O   . GLY B  1 251 ? 110.130 34.355  -23.395 1.00 25.43  ? 248 GLY B O   1 
ATOM   5622  N N   . ALA B  1 252 ? 107.993 34.050  -24.133 1.00 25.06  ? 249 ALA B N   1 
ATOM   5623  C CA  . ALA B  1 252 ? 107.537 33.168  -23.081 1.00 23.93  ? 249 ALA B CA  1 
ATOM   5624  C C   . ALA B  1 252 ? 106.331 32.291  -23.474 1.00 23.88  ? 249 ALA B C   1 
ATOM   5625  O O   . ALA B  1 252 ? 105.581 32.585  -24.404 1.00 22.30  ? 249 ALA B O   1 
ATOM   5626  C CB  . ALA B  1 252 ? 107.163 34.013  -21.877 1.00 23.89  ? 249 ALA B CB  1 
ATOM   5627  N N   . LYS B  1 253 ? 106.181 31.202  -22.725 1.00 24.52  ? 250 LYS B N   1 
ATOM   5628  C CA  . LYS B  1 253 ? 104.972 30.383  -22.680 1.00 24.39  ? 250 LYS B CA  1 
ATOM   5629  C C   . LYS B  1 253 ? 104.931 29.695  -21.333 1.00 23.23  ? 250 LYS B C   1 
ATOM   5630  O O   . LYS B  1 253 ? 105.446 28.589  -21.149 1.00 21.56  ? 250 LYS B O   1 
ATOM   5631  C CB  . LYS B  1 253 ? 104.985 29.338  -23.786 1.00 26.62  ? 250 LYS B CB  1 
ATOM   5632  C CG  . LYS B  1 253 ? 103.847 29.452  -24.786 1.00 27.76  ? 250 LYS B CG  1 
ATOM   5633  C CD  . LYS B  1 253 ? 102.622 28.662  -24.364 1.00 28.66  ? 250 LYS B CD  1 
ATOM   5634  C CE  . LYS B  1 253 ? 101.565 28.659  -25.452 1.00 30.18  ? 250 LYS B CE  1 
ATOM   5635  N NZ  . LYS B  1 253 ? 100.878 29.974  -25.501 1.00 33.08  ? 250 LYS B NZ  1 
ATOM   5636  N N   . ASN B  1 254 ? 104.344 30.372  -20.368 1.00 23.08  ? 251 ASN B N   1 
ATOM   5637  C CA  . ASN B  1 254 ? 104.440 29.891  -19.016 1.00 22.70  ? 251 ASN B CA  1 
ATOM   5638  C C   . ASN B  1 254 ? 103.399 28.860  -18.740 1.00 21.75  ? 251 ASN B C   1 
ATOM   5639  O O   . ASN B  1 254 ? 102.226 29.069  -19.027 1.00 20.54  ? 251 ASN B O   1 
ATOM   5640  C CB  . ASN B  1 254 ? 104.287 31.018  -18.047 1.00 24.13  ? 251 ASN B CB  1 
ATOM   5641  C CG  . ASN B  1 254 ? 105.479 31.949  -18.027 1.00 25.42  ? 251 ASN B CG  1 
ATOM   5642  O OD1 . ASN B  1 254 ? 105.606 32.693  -17.078 1.00 32.00  ? 251 ASN B OD1 1 
ATOM   5643  N ND2 . ASN B  1 254 ? 106.356 31.915  -19.024 1.00 24.32  ? 251 ASN B ND2 1 
ATOM   5644  N N   . HIS B  1 255 ? 103.862 27.755  -18.160 1.00 21.81  ? 252 HIS B N   1 
ATOM   5645  C CA  . HIS B  1 255 ? 103.044 26.623  -17.802 1.00 22.07  ? 252 HIS B CA  1 
ATOM   5646  C C   . HIS B  1 255 ? 102.826 26.603  -16.300 1.00 23.10  ? 252 HIS B C   1 
ATOM   5647  O O   . HIS B  1 255 ? 103.656 27.115  -15.552 1.00 24.69  ? 252 HIS B O   1 
ATOM   5648  C CB  . HIS B  1 255 ? 103.751 25.337  -18.192 1.00 22.33  ? 252 HIS B CB  1 
ATOM   5649  C CG  . HIS B  1 255 ? 103.898 25.153  -19.665 1.00 22.09  ? 252 HIS B CG  1 
ATOM   5650  N ND1 . HIS B  1 255 ? 104.415 26.125  -20.495 1.00 22.37  ? 252 HIS B ND1 1 
ATOM   5651  C CD2 . HIS B  1 255 ? 103.621 24.097  -20.455 1.00 22.21  ? 252 HIS B CD2 1 
ATOM   5652  C CE1 . HIS B  1 255 ? 104.427 25.683  -21.736 1.00 21.90  ? 252 HIS B CE1 1 
ATOM   5653  N NE2 . HIS B  1 255 ? 103.954 24.454  -21.739 1.00 22.23  ? 252 HIS B NE2 1 
ATOM   5654  N N   . ALA B  1 256 ? 101.730 25.978  -15.869 1.00 23.03  ? 253 ALA B N   1 
ATOM   5655  C CA  . ALA B  1 256 ? 101.473 25.712  -14.456 1.00 22.01  ? 253 ALA B CA  1 
ATOM   5656  C C   . ALA B  1 256 ? 101.079 24.255  -14.301 1.00 22.13  ? 253 ALA B C   1 
ATOM   5657  O O   . ALA B  1 256 ? 100.135 23.790  -14.950 1.00 23.45  ? 253 ALA B O   1 
ATOM   5658  C CB  . ALA B  1 256 ? 100.370 26.604  -13.923 1.00 21.55  ? 253 ALA B CB  1 
ATOM   5659  N N   . ILE B  1 257 ? 101.776 23.544  -13.422 1.00 21.20  ? 254 ILE B N   1 
ATOM   5660  C CA  . ILE B  1 257 ? 101.443 22.166  -13.140 1.00 20.02  ? 254 ILE B CA  1 
ATOM   5661  C C   . ILE B  1 257 ? 100.364 22.191  -12.101 1.00 19.69  ? 254 ILE B C   1 
ATOM   5662  O O   . ILE B  1 257 ? 100.524 22.822  -11.087 1.00 20.12  ? 254 ILE B O   1 
ATOM   5663  C CB  . ILE B  1 257 ? 102.673 21.373  -12.695 1.00 19.41  ? 254 ILE B CB  1 
ATOM   5664  C CG1 . ILE B  1 257 ? 103.642 21.295  -13.865 1.00 19.17  ? 254 ILE B CG1 1 
ATOM   5665  C CG2 . ILE B  1 257 ? 102.293 19.962  -12.311 1.00 19.59  ? 254 ILE B CG2 1 
ATOM   5666  C CD1 . ILE B  1 257 ? 104.920 20.562  -13.569 1.00 19.26  ? 254 ILE B CD1 1 
ATOM   5667  N N   . VAL B  1 258 ? 99.247  21.531  -12.392 1.00 20.89  ? 255 VAL B N   1 
ATOM   5668  C CA  . VAL B  1 258 ? 98.138  21.384  -11.445 1.00 21.39  ? 255 VAL B CA  1 
ATOM   5669  C C   . VAL B  1 258 ? 98.089  19.943  -10.985 1.00 21.58  ? 255 VAL B C   1 
ATOM   5670  O O   . VAL B  1 258 ? 97.453  19.114  -11.612 1.00 23.78  ? 255 VAL B O   1 
ATOM   5671  C CB  . VAL B  1 258 ? 96.789  21.790  -12.059 1.00 20.95  ? 255 VAL B CB  1 
ATOM   5672  C CG1 . VAL B  1 258 ? 95.677  21.665  -11.032 1.00 21.03  ? 255 VAL B CG1 1 
ATOM   5673  C CG2 . VAL B  1 258 ? 96.870  23.224  -12.558 1.00 21.31  ? 255 VAL B CG2 1 
ATOM   5674  N N   . MET B  1 259 ? 98.760  19.674  -9.873  1.00 21.33  ? 256 MET B N   1 
ATOM   5675  C CA  . MET B  1 259 ? 98.804  18.357  -9.269  1.00 20.52  ? 256 MET B CA  1 
ATOM   5676  C C   . MET B  1 259 ? 97.442  18.016  -8.654  1.00 21.75  ? 256 MET B C   1 
ATOM   5677  O O   . MET B  1 259 ? 96.670  18.926  -8.319  1.00 23.24  ? 256 MET B O   1 
ATOM   5678  C CB  . MET B  1 259 ? 99.861  18.330  -8.187  1.00 19.73  ? 256 MET B CB  1 
ATOM   5679  C CG  . MET B  1 259 ? 101.263 18.606  -8.691  1.00 19.09  ? 256 MET B CG  1 
ATOM   5680  S SD  . MET B  1 259 ? 101.940 17.279  -9.701  1.00 18.32  ? 256 MET B SD  1 
ATOM   5681  C CE  . MET B  1 259 ? 102.129 15.978  -8.489  1.00 18.39  ? 256 MET B CE  1 
ATOM   5682  N N   . PRO B  1 260 ? 97.139  16.710  -8.506  1.00 21.37  ? 257 PRO B N   1 
ATOM   5683  C CA  . PRO B  1 260 ? 95.913  16.217  -7.878  1.00 21.04  ? 257 PRO B CA  1 
ATOM   5684  C C   . PRO B  1 260 ? 95.684  16.711  -6.450  1.00 23.03  ? 257 PRO B C   1 
ATOM   5685  O O   . PRO B  1 260 ? 94.525  16.824  -6.031  1.00 23.29  ? 257 PRO B O   1 
ATOM   5686  C CB  . PRO B  1 260 ? 96.123  14.710  -7.838  1.00 20.67  ? 257 PRO B CB  1 
ATOM   5687  C CG  . PRO B  1 260 ? 97.072  14.435  -8.930  1.00 20.90  ? 257 PRO B CG  1 
ATOM   5688  C CD  . PRO B  1 260 ? 97.987  15.607  -8.986  1.00 20.92  ? 257 PRO B CD  1 
ATOM   5689  N N   . ASP B  1 261 ? 96.763  16.992  -5.708  1.00 24.39  ? 258 ASP B N   1 
ATOM   5690  C CA  . ASP B  1 261 ? 96.644  17.433  -4.311  1.00 25.30  ? 258 ASP B CA  1 
ATOM   5691  C C   . ASP B  1 261 ? 96.561  18.944  -4.200  1.00 26.76  ? 258 ASP B C   1 
ATOM   5692  O O   . ASP B  1 261 ? 96.634  19.495  -3.102  1.00 27.94  ? 258 ASP B O   1 
ATOM   5693  C CB  . ASP B  1 261 ? 97.792  16.900  -3.447  1.00 25.07  ? 258 ASP B CB  1 
ATOM   5694  C CG  . ASP B  1 261 ? 99.138  17.443  -3.858  1.00 24.75  ? 258 ASP B CG  1 
ATOM   5695  O OD1 . ASP B  1 261 ? 99.340  17.709  -5.057  1.00 24.56  ? 258 ASP B OD1 1 
ATOM   5696  O OD2 . ASP B  1 261 ? 99.995  17.584  -2.978  1.00 24.16  ? 258 ASP B OD2 1 
ATOM   5697  N N   . ALA B  1 262 ? 96.379  19.616  -5.328  1.00 27.32  ? 259 ALA B N   1 
ATOM   5698  C CA  . ALA B  1 262 ? 96.266  21.061  -5.331  1.00 29.19  ? 259 ALA B CA  1 
ATOM   5699  C C   . ALA B  1 262 ? 94.934  21.515  -4.803  1.00 29.85  ? 259 ALA B C   1 
ATOM   5700  O O   . ALA B  1 262 ? 93.951  20.834  -5.017  1.00 31.31  ? 259 ALA B O   1 
ATOM   5701  C CB  . ALA B  1 262 ? 96.443  21.577  -6.739  1.00 29.79  ? 259 ALA B CB  1 
ATOM   5702  N N   . ASP B  1 263 ? 94.916  22.659  -4.120  1.00 31.53  ? 260 ASP B N   1 
ATOM   5703  C CA  . ASP B  1 263 ? 93.686  23.383  -3.826  1.00 36.42  ? 260 ASP B CA  1 
ATOM   5704  C C   . ASP B  1 263 ? 93.250  24.018  -5.127  1.00 37.54  ? 260 ASP B C   1 
ATOM   5705  O O   . ASP B  1 263 ? 93.868  24.980  -5.590  1.00 35.99  ? 260 ASP B O   1 
ATOM   5706  C CB  . ASP B  1 263 ? 93.909  24.466  -2.766  1.00 40.09  ? 260 ASP B CB  1 
ATOM   5707  C CG  . ASP B  1 263 ? 92.618  25.174  -2.325  1.00 45.65  ? 260 ASP B CG  1 
ATOM   5708  O OD1 . ASP B  1 263 ? 91.471  24.823  -2.739  1.00 53.58  ? 260 ASP B OD1 1 
ATOM   5709  O OD2 . ASP B  1 263 ? 92.780  26.107  -1.516  1.00 46.41  ? 260 ASP B OD2 1 
ATOM   5710  N N   . MET B  1 264 ? 92.182  23.456  -5.699  1.00 38.85  ? 261 MET B N   1 
ATOM   5711  C CA  . MET B  1 264 ? 91.731  23.815  -7.017  1.00 36.96  ? 261 MET B CA  1 
ATOM   5712  C C   . MET B  1 264 ? 91.084  25.183  -6.958  1.00 35.82  ? 261 MET B C   1 
ATOM   5713  O O   . MET B  1 264 ? 91.388  26.032  -7.789  1.00 35.55  ? 261 MET B O   1 
ATOM   5714  C CB  . MET B  1 264 ? 90.780  22.744  -7.580  1.00 38.43  ? 261 MET B CB  1 
ATOM   5715  C CG  . MET B  1 264 ? 90.842  22.618  -9.092  1.00 40.14  ? 261 MET B CG  1 
ATOM   5716  S SD  . MET B  1 264 ? 92.516  22.197  -9.615  1.00 37.87  ? 261 MET B SD  1 
ATOM   5717  C CE  . MET B  1 264 ? 92.508  20.437  -9.294  1.00 36.99  ? 261 MET B CE  1 
ATOM   5718  N N   . ASP B  1 265 ? 90.230  25.415  -5.962  1.00 36.25  ? 262 ASP B N   1 
ATOM   5719  C CA  . ASP B  1 265 ? 89.550  26.719  -5.831  1.00 38.43  ? 262 ASP B CA  1 
ATOM   5720  C C   . ASP B  1 265 ? 90.554  27.860  -5.792  1.00 36.22  ? 262 ASP B C   1 
ATOM   5721  O O   . ASP B  1 265 ? 90.321  28.917  -6.354  1.00 38.27  ? 262 ASP B O   1 
ATOM   5722  C CB  . ASP B  1 265 ? 88.660  26.795  -4.577  1.00 39.78  ? 262 ASP B CB  1 
ATOM   5723  C CG  . ASP B  1 265 ? 87.338  26.054  -4.731  1.00 40.92  ? 262 ASP B CG  1 
ATOM   5724  O OD1 . ASP B  1 265 ? 86.806  25.970  -5.860  1.00 42.47  ? 262 ASP B OD1 1 
ATOM   5725  O OD2 . ASP B  1 265 ? 86.819  25.560  -3.707  1.00 41.78  ? 262 ASP B OD2 1 
ATOM   5726  N N   . ASN B  1 266 ? 91.678  27.628  -5.136  1.00 34.56  ? 263 ASN B N   1 
ATOM   5727  C CA  . ASN B  1 266 ? 92.738  28.619  -5.062  1.00 32.91  ? 263 ASN B CA  1 
ATOM   5728  C C   . ASN B  1 266 ? 93.539  28.772  -6.357  1.00 32.15  ? 263 ASN B C   1 
ATOM   5729  O O   . ASN B  1 266 ? 93.891  29.880  -6.737  1.00 31.08  ? 263 ASN B O   1 
ATOM   5730  C CB  . ASN B  1 266 ? 93.692  28.262  -3.933  1.00 32.89  ? 263 ASN B CB  1 
ATOM   5731  C CG  . ASN B  1 266 ? 94.716  29.343  -3.694  1.00 32.74  ? 263 ASN B CG  1 
ATOM   5732  O OD1 . ASN B  1 266 ? 94.456  30.272  -2.940  1.00 32.13  ? 263 ASN B OD1 1 
ATOM   5733  N ND2 . ASN B  1 266 ? 95.864  29.261  -4.380  1.00 32.27  ? 263 ASN B ND2 1 
ATOM   5734  N N   . ALA B  1 267 ? 93.869  27.651  -6.997  1.00 32.25  ? 264 ALA B N   1 
ATOM   5735  C CA  . ALA B  1 267 ? 94.591  27.662  -8.269  1.00 29.94  ? 264 ALA B CA  1 
ATOM   5736  C C   . ALA B  1 267 ? 93.751  28.357  -9.344  1.00 28.72  ? 264 ALA B C   1 
ATOM   5737  O O   . ALA B  1 267 ? 94.248  29.212  -10.045 1.00 27.02  ? 264 ALA B O   1 
ATOM   5738  C CB  . ALA B  1 267 ? 94.960  26.241  -8.686  1.00 28.94  ? 264 ALA B CB  1 
ATOM   5739  N N   . VAL B  1 268 ? 92.474  28.007  -9.431  1.00 28.47  ? 265 VAL B N   1 
ATOM   5740  C CA  . VAL B  1 268 ? 91.573  28.602  -10.409 1.00 30.05  ? 265 VAL B CA  1 
ATOM   5741  C C   . VAL B  1 268 ? 91.469  30.131  -10.232 1.00 30.80  ? 265 VAL B C   1 
ATOM   5742  O O   . VAL B  1 268 ? 91.411  30.905  -11.202 1.00 32.07  ? 265 VAL B O   1 
ATOM   5743  C CB  . VAL B  1 268 ? 90.175  27.951  -10.314 1.00 29.26  ? 265 VAL B CB  1 
ATOM   5744  C CG1 . VAL B  1 268 ? 89.139  28.736  -11.105 1.00 29.18  ? 265 VAL B CG1 1 
ATOM   5745  C CG2 . VAL B  1 268 ? 90.248  26.517  -10.811 1.00 29.63  ? 265 VAL B CG2 1 
ATOM   5746  N N   . ASN B  1 269 ? 91.438  30.549  -8.983  1.00 30.28  ? 266 ASN B N   1 
ATOM   5747  C CA  . ASN B  1 269 ? 91.203  31.932  -8.651  1.00 31.26  ? 266 ASN B CA  1 
ATOM   5748  C C   . ASN B  1 269 ? 92.403  32.821  -8.962  1.00 29.99  ? 266 ASN B C   1 
ATOM   5749  O O   . ASN B  1 269 ? 92.261  33.966  -9.335  1.00 27.77  ? 266 ASN B O   1 
ATOM   5750  C CB  . ASN B  1 269 ? 90.831  32.011  -7.178  1.00 32.82  ? 266 ASN B CB  1 
ATOM   5751  C CG  . ASN B  1 269 ? 90.287  33.356  -6.796  1.00 35.96  ? 266 ASN B CG  1 
ATOM   5752  O OD1 . ASN B  1 269 ? 89.341  33.865  -7.415  1.00 38.77  ? 266 ASN B OD1 1 
ATOM   5753  N ND2 . ASN B  1 269 ? 90.871  33.946  -5.769  1.00 37.87  ? 266 ASN B ND2 1 
ATOM   5754  N N   . GLN B  1 270 ? 93.591  32.261  -8.812  1.00 31.70  ? 267 GLN B N   1 
ATOM   5755  C CA  . GLN B  1 270 ? 94.838  32.952  -9.119  1.00 30.96  ? 267 GLN B CA  1 
ATOM   5756  C C   . GLN B  1 270 ? 95.224  32.891  -10.601 1.00 29.40  ? 267 GLN B C   1 
ATOM   5757  O O   . GLN B  1 270 ? 95.904  33.796  -11.090 1.00 28.63  ? 267 GLN B O   1 
ATOM   5758  C CB  . GLN B  1 270 ? 95.966  32.347  -8.305  1.00 32.89  ? 267 GLN B CB  1 
ATOM   5759  C CG  . GLN B  1 270 ? 95.967  32.714  -6.840  1.00 34.36  ? 267 GLN B CG  1 
ATOM   5760  C CD  . GLN B  1 270 ? 97.332  32.474  -6.226  1.00 37.08  ? 267 GLN B CD  1 
ATOM   5761  O OE1 . GLN B  1 270 ? 97.946  33.378  -5.682  1.00 43.00  ? 267 GLN B OE1 1 
ATOM   5762  N NE2 . GLN B  1 270 ? 97.831  31.257  -6.347  1.00 37.64  ? 267 GLN B NE2 1 
ATOM   5763  N N   . LEU B  1 271 ? 94.834  31.808  -11.285 1.00 28.16  ? 268 LEU B N   1 
ATOM   5764  C CA  . LEU B  1 271 ? 94.986  31.678  -12.745 1.00 26.44  ? 268 LEU B CA  1 
ATOM   5765  C C   . LEU B  1 271 ? 94.180  32.722  -13.520 1.00 26.23  ? 268 LEU B C   1 
ATOM   5766  O O   . LEU B  1 271 ? 94.627  33.156  -14.581 1.00 26.48  ? 268 LEU B O   1 
ATOM   5767  C CB  . LEU B  1 271 ? 94.628  30.268  -13.228 1.00 25.44  ? 268 LEU B CB  1 
ATOM   5768  C CG  . LEU B  1 271 ? 95.632  29.184  -12.840 1.00 24.87  ? 268 LEU B CG  1 
ATOM   5769  C CD1 . LEU B  1 271 ? 95.052  27.805  -13.052 1.00 24.51  ? 268 LEU B CD1 1 
ATOM   5770  C CD2 . LEU B  1 271 ? 96.899  29.342  -13.650 1.00 26.18  ? 268 LEU B CD2 1 
ATOM   5771  N N   . LEU B  1 272 ? 93.020  33.133  -12.995 1.00 25.84  ? 269 LEU B N   1 
ATOM   5772  C CA  . LEU B  1 272 ? 92.184  34.189  -13.617 1.00 25.15  ? 269 LEU B CA  1 
ATOM   5773  C C   . LEU B  1 272 ? 92.967  35.465  -13.910 1.00 25.09  ? 269 LEU B C   1 
ATOM   5774  O O   . LEU B  1 272 ? 92.873  36.046  -15.011 1.00 27.27  ? 269 LEU B O   1 
ATOM   5775  C CB  . LEU B  1 272 ? 91.026  34.593  -12.701 1.00 25.26  ? 269 LEU B CB  1 
ATOM   5776  C CG  . LEU B  1 272 ? 89.701  33.853  -12.726 1.00 26.30  ? 269 LEU B CG  1 
ATOM   5777  C CD1 . LEU B  1 272 ? 88.841  34.314  -11.556 1.00 27.00  ? 269 LEU B CD1 1 
ATOM   5778  C CD2 . LEU B  1 272 ? 88.974  34.064  -14.040 1.00 26.23  ? 269 LEU B CD2 1 
ATOM   5779  N N   . GLY B  1 273 ? 93.700  35.922  -12.900 1.00 22.79  ? 270 GLY B N   1 
ATOM   5780  C CA  . GLY B  1 273 ? 94.487  37.129  -13.016 1.00 22.22  ? 270 GLY B CA  1 
ATOM   5781  C C   . GLY B  1 273 ? 95.795  36.873  -13.741 1.00 22.64  ? 270 GLY B C   1 
ATOM   5782  O O   . GLY B  1 273 ? 96.305  37.729  -14.462 1.00 23.43  ? 270 GLY B O   1 
ATOM   5783  N N   . ALA B  1 274 ? 96.346  35.683  -13.570 1.00 22.20  ? 271 ALA B N   1 
ATOM   5784  C CA  . ALA B  1 274 ? 97.590  35.328  -14.232 1.00 22.21  ? 271 ALA B CA  1 
ATOM   5785  C C   . ALA B  1 274 ? 97.435  35.114  -15.746 1.00 21.44  ? 271 ALA B C   1 
ATOM   5786  O O   . ALA B  1 274 ? 98.300  35.512  -16.519 1.00 20.35  ? 271 ALA B O   1 
ATOM   5787  C CB  . ALA B  1 274 ? 98.160  34.079  -13.579 1.00 23.65  ? 271 ALA B CB  1 
ATOM   5788  N N   . ALA B  1 275 ? 96.341  34.463  -16.147 1.00 21.11  ? 272 ALA B N   1 
ATOM   5789  C CA  . ALA B  1 275 ? 96.044  34.180  -17.567 1.00 20.59  ? 272 ALA B CA  1 
ATOM   5790  C C   . ALA B  1 275 ? 95.519  35.404  -18.286 1.00 19.77  ? 272 ALA B C   1 
ATOM   5791  O O   . ALA B  1 275 ? 96.010  35.749  -19.357 1.00 18.65  ? 272 ALA B O   1 
ATOM   5792  C CB  . ALA B  1 275 ? 95.036  33.025  -17.695 1.00 20.31  ? 272 ALA B CB  1 
ATOM   5793  N N   . PHE B  1 276 ? 94.527  36.052  -17.670 1.00 20.12  ? 273 PHE B N   1 
ATOM   5794  C CA  . PHE B  1 276 ? 93.708  37.088  -18.326 1.00 20.57  ? 273 PHE B CA  1 
ATOM   5795  C C   . PHE B  1 276 ? 93.992  38.505  -17.852 1.00 21.45  ? 273 PHE B C   1 
ATOM   5796  O O   . PHE B  1 276 ? 93.517  39.468  -18.446 1.00 20.21  ? 273 PHE B O   1 
ATOM   5797  C CB  . PHE B  1 276 ? 92.226  36.761  -18.134 1.00 20.34  ? 273 PHE B CB  1 
ATOM   5798  C CG  . PHE B  1 276 ? 91.881  35.336  -18.476 1.00 19.98  ? 273 PHE B CG  1 
ATOM   5799  C CD1 . PHE B  1 276 ? 92.093  34.853  -19.771 1.00 20.02  ? 273 PHE B CD1 1 
ATOM   5800  C CD2 . PHE B  1 276 ? 91.385  34.479  -17.523 1.00 19.04  ? 273 PHE B CD2 1 
ATOM   5801  C CE1 . PHE B  1 276 ? 91.802  33.546  -20.105 1.00 19.76  ? 273 PHE B CE1 1 
ATOM   5802  C CE2 . PHE B  1 276 ? 91.079  33.184  -17.858 1.00 19.56  ? 273 PHE B CE2 1 
ATOM   5803  C CZ  . PHE B  1 276 ? 91.293  32.710  -19.145 1.00 19.68  ? 273 PHE B CZ  1 
ATOM   5804  N N   . GLY B  1 277 ? 94.774  38.635  -16.787 1.00 23.49  ? 274 GLY B N   1 
ATOM   5805  C CA  . GLY B  1 277 ? 95.194  39.948  -16.310 1.00 24.88  ? 274 GLY B CA  1 
ATOM   5806  C C   . GLY B  1 277 ? 96.037  40.646  -17.357 1.00 26.19  ? 274 GLY B C   1 
ATOM   5807  O O   . GLY B  1 277 ? 96.832  40.021  -18.056 1.00 27.41  ? 274 GLY B O   1 
ATOM   5808  N N   . SER B  1 278 ? 95.842  41.950  -17.473 1.00 27.41  ? 275 SER B N   1 
ATOM   5809  C CA  . SER B  1 278 ? 96.441  42.751  -18.551 1.00 28.41  ? 275 SER B CA  1 
ATOM   5810  C C   . SER B  1 278 ? 96.156  42.189  -19.963 1.00 27.73  ? 275 SER B C   1 
ATOM   5811  O O   . SER B  1 278 ? 96.965  42.366  -20.883 1.00 29.70  ? 275 SER B O   1 
ATOM   5812  C CB  . SER B  1 278 ? 97.952  42.935  -18.323 1.00 29.21  ? 275 SER B CB  1 
ATOM   5813  O OG  . SER B  1 278 ? 98.213  43.670  -17.140 1.00 31.48  ? 275 SER B OG  1 
ATOM   5814  N N   . SER B  1 279 ? 95.010  41.511  -20.112 1.00 26.00  ? 276 SER B N   1 
ATOM   5815  C CA  . SER B  1 279 ? 94.571  40.886  -21.373 1.00 24.19  ? 276 SER B CA  1 
ATOM   5816  C C   . SER B  1 279 ? 95.604  39.885  -21.880 1.00 23.17  ? 276 SER B C   1 
ATOM   5817  O O   . SER B  1 279 ? 95.811  39.724  -23.083 1.00 21.93  ? 276 SER B O   1 
ATOM   5818  C CB  . SER B  1 279 ? 94.280  41.962  -22.422 1.00 24.30  ? 276 SER B CB  1 
ATOM   5819  O OG  . SER B  1 279 ? 93.561  43.043  -21.858 1.00 24.11  ? 276 SER B OG  1 
ATOM   5820  N N   . GLY B  1 280 ? 96.272  39.235  -20.931 1.00 23.37  ? 277 GLY B N   1 
ATOM   5821  C CA  . GLY B  1 280 ? 97.311  38.249  -21.214 1.00 23.57  ? 277 GLY B CA  1 
ATOM   5822  C C   . GLY B  1 280 ? 98.542  38.751  -21.957 1.00 23.61  ? 277 GLY B C   1 
ATOM   5823  O O   . GLY B  1 280 ? 99.420  37.942  -22.308 1.00 22.37  ? 277 GLY B O   1 
ATOM   5824  N N   . GLU B  1 281 ? 98.618  40.069  -22.190 1.00 23.55  ? 278 GLU B N   1 
ATOM   5825  C CA  . GLU B  1 281 ? 99.747  40.690  -22.901 1.00 24.51  ? 278 GLU B CA  1 
ATOM   5826  C C   . GLU B  1 281 ? 100.919 40.902  -21.929 1.00 26.39  ? 278 GLU B C   1 
ATOM   5827  O O   . GLU B  1 281 ? 101.321 42.021  -21.666 1.00 26.60  ? 278 GLU B O   1 
ATOM   5828  C CB  . GLU B  1 281 ? 99.326  42.040  -23.526 1.00 23.38  ? 278 GLU B CB  1 
ATOM   5829  C CG  . GLU B  1 281 ? 98.317  41.956  -24.671 1.00 22.38  ? 278 GLU B CG  1 
ATOM   5830  C CD  . GLU B  1 281 ? 97.881  43.323  -25.173 1.00 21.71  ? 278 GLU B CD  1 
ATOM   5831  O OE1 . GLU B  1 281 ? 97.730  44.231  -24.347 1.00 21.46  ? 278 GLU B OE1 1 
ATOM   5832  O OE2 . GLU B  1 281 ? 97.691  43.512  -26.389 1.00 20.77  ? 278 GLU B OE2 1 
ATOM   5833  N N   . ARG B  1 282 ? 101.467 39.813  -21.415 1.00 28.55  ? 279 ARG B N   1 
ATOM   5834  C CA  . ARG B  1 282 ? 102.385 39.855  -20.297 1.00 31.39  ? 279 ARG B CA  1 
ATOM   5835  C C   . ARG B  1 282 ? 103.463 38.788  -20.560 1.00 33.00  ? 279 ARG B C   1 
ATOM   5836  O O   . ARG B  1 282 ? 103.136 37.654  -20.913 1.00 30.24  ? 279 ARG B O   1 
ATOM   5837  C CB  . ARG B  1 282 ? 101.598 39.622  -18.978 1.00 34.32  ? 279 ARG B CB  1 
ATOM   5838  C CG  . ARG B  1 282 ? 102.289 40.069  -17.681 1.00 38.05  ? 279 ARG B CG  1 
ATOM   5839  C CD  . ARG B  1 282 ? 101.342 40.677  -16.642 1.00 40.64  ? 279 ARG B CD  1 
ATOM   5840  N NE  . ARG B  1 282 ? 100.384 39.734  -16.071 1.00 44.55  ? 279 ARG B NE  1 
ATOM   5841  C CZ  . ARG B  1 282 ? 99.300  40.067  -15.354 1.00 48.66  ? 279 ARG B CZ  1 
ATOM   5842  N NH1 . ARG B  1 282 ? 98.985  41.339  -15.099 1.00 50.37  ? 279 ARG B NH1 1 
ATOM   5843  N NH2 . ARG B  1 282 ? 98.493  39.111  -14.899 1.00 50.25  ? 279 ARG B NH2 1 
ATOM   5844  N N   . CYS B  1 283 ? 104.743 39.154  -20.408 1.00 36.94  ? 280 CYS B N   1 
ATOM   5845  C CA  . CYS B  1 283 ? 105.862 38.176  -20.456 1.00 37.44  ? 280 CYS B CA  1 
ATOM   5846  C C   . CYS B  1 283 ? 105.712 37.053  -19.385 1.00 34.30  ? 280 CYS B C   1 
ATOM   5847  O O   . CYS B  1 283 ? 106.177 35.939  -19.614 1.00 33.82  ? 280 CYS B O   1 
ATOM   5848  C CB  . CYS B  1 283 ? 107.243 38.878  -20.375 1.00 40.05  ? 280 CYS B CB  1 
ATOM   5849  S SG  . CYS B  1 283 ? 107.329 40.298  -19.240 1.00 51.75  ? 280 CYS B SG  1 
ATOM   5850  N N   . MET B  1 284 ? 105.046 37.339  -18.250 1.00 31.09  ? 281 MET B N   1 
ATOM   5851  C CA  . MET B  1 284 ? 104.758 36.331  -17.187 1.00 29.26  ? 281 MET B CA  1 
ATOM   5852  C C   . MET B  1 284 ? 103.325 35.752  -17.207 1.00 28.36  ? 281 MET B C   1 
ATOM   5853  O O   . MET B  1 284 ? 102.924 34.983  -16.321 1.00 27.20  ? 281 MET B O   1 
ATOM   5854  C CB  . MET B  1 284 ? 105.058 36.914  -15.798 1.00 28.37  ? 281 MET B CB  1 
ATOM   5855  C CG  . MET B  1 284 ? 106.532 37.142  -15.530 1.00 28.32  ? 281 MET B CG  1 
ATOM   5856  S SD  . MET B  1 284 ? 107.407 35.638  -15.049 1.00 27.97  ? 281 MET B SD  1 
ATOM   5857  C CE  . MET B  1 284 ? 108.136 35.165  -16.602 1.00 27.17  ? 281 MET B CE  1 
ATOM   5858  N N   . ALA B  1 285 ? 102.564 36.113  -18.225 1.00 27.82  ? 282 ALA B N   1 
ATOM   5859  C CA  . ALA B  1 285 ? 101.245 35.551  -18.428 1.00 28.75  ? 282 ALA B CA  1 
ATOM   5860  C C   . ALA B  1 285 ? 101.279 34.011  -18.453 1.00 28.31  ? 282 ALA B C   1 
ATOM   5861  O O   . ALA B  1 285 ? 102.078 33.391  -19.176 1.00 25.80  ? 282 ALA B O   1 
ATOM   5862  C CB  . ALA B  1 285 ? 100.631 36.077  -19.720 1.00 29.49  ? 282 ALA B CB  1 
ATOM   5863  N N   . LEU B  1 286 ? 100.387 33.425  -17.657 1.00 28.26  ? 283 LEU B N   1 
ATOM   5864  C CA  . LEU B  1 286 ? 100.274 31.993  -17.527 1.00 27.77  ? 283 LEU B CA  1 
ATOM   5865  C C   . LEU B  1 286 ? 99.250  31.513  -18.536 1.00 28.06  ? 283 LEU B C   1 
ATOM   5866  O O   . LEU B  1 286 ? 98.054  31.684  -18.346 1.00 29.77  ? 283 LEU B O   1 
ATOM   5867  C CB  . LEU B  1 286 ? 99.860  31.641  -16.106 1.00 28.21  ? 283 LEU B CB  1 
ATOM   5868  C CG  . LEU B  1 286 ? 100.544 30.355  -15.670 1.00 29.66  ? 283 LEU B CG  1 
ATOM   5869  C CD1 . LEU B  1 286 ? 100.573 30.299  -14.160 1.00 31.19  ? 283 LEU B CD1 1 
ATOM   5870  C CD2 . LEU B  1 286 ? 99.840  29.147  -16.264 1.00 29.97  ? 283 LEU B CD2 1 
ATOM   5871  N N   . SER B  1 287 ? 99.723  30.921  -19.624 1.00 27.59  ? 284 SER B N   1 
ATOM   5872  C CA  . SER B  1 287 ? 98.871  30.632  -20.792 1.00 26.28  ? 284 SER B CA  1 
ATOM   5873  C C   . SER B  1 287 ? 98.593  29.139  -21.000 1.00 25.97  ? 284 SER B C   1 
ATOM   5874  O O   . SER B  1 287 ? 97.787  28.766  -21.877 1.00 25.95  ? 284 SER B O   1 
ATOM   5875  C CB  . SER B  1 287 ? 99.516  31.218  -22.056 1.00 26.18  ? 284 SER B CB  1 
ATOM   5876  O OG  . SER B  1 287 ? 100.885 30.849  -22.151 1.00 25.39  ? 284 SER B OG  1 
ATOM   5877  N N   . VAL B  1 288 ? 99.273  28.299  -20.211 1.00 24.00  ? 285 VAL B N   1 
ATOM   5878  C CA  . VAL B  1 288 ? 99.167  26.850  -20.302 1.00 22.12  ? 285 VAL B CA  1 
ATOM   5879  C C   . VAL B  1 288 ? 99.047  26.246  -18.912 1.00 21.21  ? 285 VAL B C   1 
ATOM   5880  O O   . VAL B  1 288 ? 99.948  26.366  -18.083 1.00 19.43  ? 285 VAL B O   1 
ATOM   5881  C CB  . VAL B  1 288 ? 100.409 26.221  -20.961 1.00 22.05  ? 285 VAL B CB  1 
ATOM   5882  C CG1 . VAL B  1 288 ? 100.272 24.698  -21.044 1.00 21.92  ? 285 VAL B CG1 1 
ATOM   5883  C CG2 . VAL B  1 288 ? 100.671 26.832  -22.336 1.00 22.06  ? 285 VAL B CG2 1 
ATOM   5884  N N   . ALA B  1 289 ? 97.940  25.564  -18.677 1.00 20.74  ? 286 ALA B N   1 
ATOM   5885  C CA  . ALA B  1 289 ? 97.765  24.831  -17.442 1.00 20.57  ? 286 ALA B CA  1 
ATOM   5886  C C   . ALA B  1 289 ? 97.905  23.373  -17.812 1.00 20.28  ? 286 ALA B C   1 
ATOM   5887  O O   . ALA B  1 289 ? 97.153  22.860  -18.618 1.00 19.03  ? 286 ALA B O   1 
ATOM   5888  C CB  . ALA B  1 289 ? 96.411  25.126  -16.820 1.00 20.46  ? 286 ALA B CB  1 
ATOM   5889  N N   . VAL B  1 290 ? 98.915  22.728  -17.251 1.00 21.27  ? 287 VAL B N   1 
ATOM   5890  C CA  . VAL B  1 290 ? 99.181  21.328  -17.509 1.00 21.28  ? 287 VAL B CA  1 
ATOM   5891  C C   . VAL B  1 290 ? 98.621  20.523  -16.364 1.00 21.89  ? 287 VAL B C   1 
ATOM   5892  O O   . VAL B  1 290 ? 99.173  20.521  -15.282 1.00 22.39  ? 287 VAL B O   1 
ATOM   5893  C CB  . VAL B  1 290 ? 100.672 21.078  -17.634 1.00 21.21  ? 287 VAL B CB  1 
ATOM   5894  C CG1 . VAL B  1 290 ? 100.956 19.602  -17.862 1.00 21.30  ? 287 VAL B CG1 1 
ATOM   5895  C CG2 . VAL B  1 290 ? 101.219 21.913  -18.778 1.00 21.29  ? 287 VAL B CG2 1 
ATOM   5896  N N   . ALA B  1 291 ? 97.518  19.840  -16.611 1.00 22.96  ? 288 ALA B N   1 
ATOM   5897  C CA  . ALA B  1 291 ? 96.866  19.052  -15.589 1.00 24.63  ? 288 ALA B CA  1 
ATOM   5898  C C   . ALA B  1 291 ? 97.431  17.648  -15.592 1.00 26.70  ? 288 ALA B C   1 
ATOM   5899  O O   . ALA B  1 291 ? 97.406  16.953  -16.623 1.00 26.02  ? 288 ALA B O   1 
ATOM   5900  C CB  . ALA B  1 291 ? 95.376  18.994  -15.844 1.00 25.38  ? 288 ALA B CB  1 
ATOM   5901  N N   . VAL B  1 292 ? 97.921  17.217  -14.435 1.00 28.60  ? 289 VAL B N   1 
ATOM   5902  C CA  . VAL B  1 292 ? 98.392  15.839  -14.291 1.00 30.14  ? 289 VAL B CA  1 
ATOM   5903  C C   . VAL B  1 292 ? 97.230  14.995  -13.783 1.00 30.20  ? 289 VAL B C   1 
ATOM   5904  O O   . VAL B  1 292 ? 96.734  15.202  -12.673 1.00 28.55  ? 289 VAL B O   1 
ATOM   5905  C CB  . VAL B  1 292 ? 99.682  15.713  -13.448 1.00 31.31  ? 289 VAL B CB  1 
ATOM   5906  C CG1 . VAL B  1 292 ? 99.662  16.657  -12.289 1.00 32.92  ? 289 VAL B CG1 1 
ATOM   5907  C CG2 . VAL B  1 292 ? 99.904  14.281  -12.966 1.00 31.53  ? 289 VAL B CG2 1 
ATOM   5908  N N   . GLY B  1 293 ? 96.800  14.063  -14.637 1.00 31.78  ? 290 GLY B N   1 
ATOM   5909  C CA  . GLY B  1 293 ? 95.582  13.303  -14.425 1.00 35.06  ? 290 GLY B CA  1 
ATOM   5910  C C   . GLY B  1 293 ? 94.349  14.066  -14.871 1.00 37.83  ? 290 GLY B C   1 
ATOM   5911  O O   . GLY B  1 293 ? 94.431  15.213  -15.281 1.00 35.22  ? 290 GLY B O   1 
ATOM   5912  N N   . ASP B  1 294 ? 93.199  13.412  -14.816 1.00 44.00  ? 291 ASP B N   1 
ATOM   5913  C CA  . ASP B  1 294 ? 91.941  14.086  -15.101 1.00 48.06  ? 291 ASP B CA  1 
ATOM   5914  C C   . ASP B  1 294 ? 90.731  13.261  -14.720 1.00 54.66  ? 291 ASP B C   1 
ATOM   5915  O O   . ASP B  1 294 ? 90.240  12.514  -15.570 1.00 71.57  ? 291 ASP B O   1 
ATOM   5916  C CB  . ASP B  1 294 ? 91.854  14.443  -16.598 1.00 49.56  ? 291 ASP B CB  1 
ATOM   5917  C CG  . ASP B  1 294 ? 92.401  13.338  -17.550 1.00 48.97  ? 291 ASP B CG  1 
ATOM   5918  O OD1 . ASP B  1 294 ? 92.932  12.317  -17.060 1.00 52.83  ? 291 ASP B OD1 1 
ATOM   5919  O OD2 . ASP B  1 294 ? 92.296  13.502  -18.796 1.00 44.21  ? 291 ASP B OD2 1 
ATOM   5920  N N   . ALA B  1 295 ? 90.217  13.305  -13.488 1.00 55.64  ? 292 ALA B N   1 
ATOM   5921  C CA  . ALA B  1 295 ? 90.788  13.887  -12.278 1.00 52.93  ? 292 ALA B CA  1 
ATOM   5922  C C   . ALA B  1 295 ? 90.887  15.421  -12.266 1.00 50.39  ? 292 ALA B C   1 
ATOM   5923  O O   . ALA B  1 295 ? 89.863  16.100  -12.330 1.00 47.92  ? 292 ALA B O   1 
ATOM   5924  C CB  . ALA B  1 295 ? 92.100  13.179  -11.909 1.00 58.62  ? 292 ALA B CB  1 
ATOM   5925  N N   . ALA B  1 296 ? 92.099  15.964  -12.175 1.00 47.46  ? 293 ALA B N   1 
ATOM   5926  C CA  . ALA B  1 296 ? 92.309  17.397  -12.015 1.00 45.58  ? 293 ALA B CA  1 
ATOM   5927  C C   . ALA B  1 296 ? 92.031  18.217  -13.287 1.00 45.23  ? 293 ALA B C   1 
ATOM   5928  O O   . ALA B  1 296 ? 91.589  19.361  -13.212 1.00 43.01  ? 293 ALA B O   1 
ATOM   5929  C CB  . ALA B  1 296 ? 93.727  17.644  -11.542 1.00 47.20  ? 293 ALA B CB  1 
ATOM   5930  N N   . GLY B  1 297 ? 92.327  17.651  -14.449 1.00 45.65  ? 294 GLY B N   1 
ATOM   5931  C CA  . GLY B  1 297 ? 91.954  18.272  -15.717 1.00 43.55  ? 294 GLY B CA  1 
ATOM   5932  C C   . GLY B  1 297 ? 90.492  18.664  -15.736 1.00 41.76  ? 294 GLY B C   1 
ATOM   5933  O O   . GLY B  1 297 ? 90.175  19.836  -15.869 1.00 40.01  ? 294 GLY B O   1 
ATOM   5934  N N   . ASP B  1 298 ? 89.611  17.678  -15.570 1.00 41.30  ? 295 ASP B N   1 
ATOM   5935  C CA  . ASP B  1 298 ? 88.166  17.910  -15.600 1.00 38.63  ? 295 ASP B CA  1 
ATOM   5936  C C   . ASP B  1 298 ? 87.775  18.993  -14.589 1.00 36.55  ? 295 ASP B C   1 
ATOM   5937  O O   . ASP B  1 298 ? 86.950  19.883  -14.895 1.00 36.35  ? 295 ASP B O   1 
ATOM   5938  C CB  . ASP B  1 298 ? 87.394  16.612  -15.297 1.00 38.07  ? 295 ASP B CB  1 
ATOM   5939  C CG  . ASP B  1 298 ? 87.476  15.599  -16.402 1.00 38.47  ? 295 ASP B CG  1 
ATOM   5940  O OD1 . ASP B  1 298 ? 87.847  15.958  -17.548 1.00 40.42  ? 295 ASP B OD1 1 
ATOM   5941  O OD2 . ASP B  1 298 ? 87.141  14.435  -16.108 1.00 37.85  ? 295 ASP B OD2 1 
ATOM   5942  N N   . ALA B  1 299 ? 88.385  18.905  -13.398 1.00 33.54  ? 296 ALA B N   1 
ATOM   5943  C CA  . ALA B  1 299 ? 88.079  19.788  -12.239 1.00 31.97  ? 296 ALA B CA  1 
ATOM   5944  C C   . ALA B  1 299 ? 88.549  21.226  -12.392 1.00 30.95  ? 296 ALA B C   1 
ATOM   5945  O O   . ALA B  1 299 ? 87.892  22.147  -11.946 1.00 30.22  ? 296 ALA B O   1 
ATOM   5946  C CB  . ALA B  1 299 ? 88.678  19.215  -10.972 1.00 30.77  ? 296 ALA B CB  1 
ATOM   5947  N N   . LEU B  1 300 ? 89.716  21.399  -12.993 1.00 30.78  ? 297 LEU B N   1 
ATOM   5948  C CA  . LEU B  1 300 ? 90.230  22.711  -13.364 1.00 28.82  ? 297 LEU B CA  1 
ATOM   5949  C C   . LEU B  1 300 ? 89.369  23.389  -14.413 1.00 29.23  ? 297 LEU B C   1 
ATOM   5950  O O   . LEU B  1 300 ? 88.978  24.520  -14.225 1.00 30.00  ? 297 LEU B O   1 
ATOM   5951  C CB  . LEU B  1 300 ? 91.634  22.562  -13.926 1.00 28.58  ? 297 LEU B CB  1 
ATOM   5952  C CG  . LEU B  1 300 ? 92.346  23.810  -14.434 1.00 26.94  ? 297 LEU B CG  1 
ATOM   5953  C CD1 . LEU B  1 300 ? 92.652  24.732  -13.287 1.00 25.75  ? 297 LEU B CD1 1 
ATOM   5954  C CD2 . LEU B  1 300 ? 93.615  23.399  -15.154 1.00 27.72  ? 297 LEU B CD2 1 
ATOM   5955  N N   . VAL B  1 301 ? 89.100  22.709  -15.522 1.00 29.93  ? 298 VAL B N   1 
ATOM   5956  C CA  . VAL B  1 301 ? 88.273  23.272  -16.582 1.00 31.10  ? 298 VAL B CA  1 
ATOM   5957  C C   . VAL B  1 301 ? 86.883  23.601  -16.025 1.00 31.02  ? 298 VAL B C   1 
ATOM   5958  O O   . VAL B  1 301 ? 86.319  24.619  -16.383 1.00 31.41  ? 298 VAL B O   1 
ATOM   5959  C CB  . VAL B  1 301 ? 88.195  22.335  -17.809 1.00 32.94  ? 298 VAL B CB  1 
ATOM   5960  C CG1 . VAL B  1 301 ? 87.265  22.879  -18.887 1.00 34.58  ? 298 VAL B CG1 1 
ATOM   5961  C CG2 . VAL B  1 301 ? 89.573  22.164  -18.417 1.00 34.83  ? 298 VAL B CG2 1 
ATOM   5962  N N   . SER B  1 302 ? 86.345  22.762  -15.138 1.00 30.66  ? 299 SER B N   1 
ATOM   5963  C CA  . SER B  1 302 ? 84.989  22.980  -14.617 1.00 30.49  ? 299 SER B CA  1 
ATOM   5964  C C   . SER B  1 302 ? 84.919  24.253  -13.817 1.00 30.63  ? 299 SER B C   1 
ATOM   5965  O O   . SER B  1 302 ? 84.006  25.061  -13.959 1.00 30.96  ? 299 SER B O   1 
ATOM   5966  C CB  . SER B  1 302 ? 84.516  21.811  -13.740 1.00 30.27  ? 299 SER B CB  1 
ATOM   5967  O OG  . SER B  1 302 ? 83.277  22.075  -13.070 1.00 25.91  ? 299 SER B OG  1 
ATOM   5968  N N   . LYS B  1 303 ? 85.895  24.428  -12.953 1.00 31.75  ? 300 LYS B N   1 
ATOM   5969  C CA  . LYS B  1 303 ? 85.910  25.594  -12.074 1.00 32.84  ? 300 LYS B CA  1 
ATOM   5970  C C   . LYS B  1 303 ? 86.425  26.857  -12.730 1.00 31.37  ? 300 LYS B C   1 
ATOM   5971  O O   . LYS B  1 303 ? 86.100  27.965  -12.312 1.00 29.07  ? 300 LYS B O   1 
ATOM   5972  C CB  . LYS B  1 303 ? 86.763  25.303  -10.863 1.00 34.70  ? 300 LYS B CB  1 
ATOM   5973  C CG  . LYS B  1 303 ? 86.181  24.220  -9.998  1.00 36.23  ? 300 LYS B CG  1 
ATOM   5974  C CD  . LYS B  1 303 ? 86.835  24.183  -8.640  1.00 36.62  ? 300 LYS B CD  1 
ATOM   5975  C CE  . LYS B  1 303 ? 86.260  23.030  -7.847  1.00 38.08  ? 300 LYS B CE  1 
ATOM   5976  N NZ  . LYS B  1 303 ? 86.351  23.266  -6.383  1.00 39.22  ? 300 LYS B NZ  1 
ATOM   5977  N N   . MET B  1 304 ? 87.272  26.679  -13.725 1.00 31.89  ? 301 MET B N   1 
ATOM   5978  C CA  . MET B  1 304 ? 87.753  27.783  -14.508 1.00 31.96  ? 301 MET B CA  1 
ATOM   5979  C C   . MET B  1 304 ? 86.569  28.335  -15.303 1.00 31.47  ? 301 MET B C   1 
ATOM   5980  O O   . MET B  1 304 ? 86.315  29.518  -15.218 1.00 29.43  ? 301 MET B O   1 
ATOM   5981  C CB  . MET B  1 304 ? 88.921  27.319  -15.393 1.00 33.75  ? 301 MET B CB  1 
ATOM   5982  C CG  . MET B  1 304 ? 89.842  28.417  -15.875 1.00 35.37  ? 301 MET B CG  1 
ATOM   5983  S SD  . MET B  1 304 ? 90.523  29.492  -14.586 1.00 35.10  ? 301 MET B SD  1 
ATOM   5984  C CE  . MET B  1 304 ? 89.541  30.934  -14.864 1.00 33.49  ? 301 MET B CE  1 
ATOM   5985  N N   . THR B  1 305 ? 85.827  27.468  -16.014 1.00 33.48  ? 302 THR B N   1 
ATOM   5986  C CA  . THR B  1 305 ? 84.624  27.856  -16.793 1.00 34.95  ? 302 THR B CA  1 
ATOM   5987  C C   . THR B  1 305 ? 83.668  28.749  -15.949 1.00 34.95  ? 302 THR B C   1 
ATOM   5988  O O   . THR B  1 305 ? 83.175  29.795  -16.399 1.00 32.88  ? 302 THR B O   1 
ATOM   5989  C CB  . THR B  1 305 ? 83.828  26.625  -17.367 1.00 34.74  ? 302 THR B CB  1 
ATOM   5990  O OG1 . THR B  1 305 ? 84.680  25.730  -18.089 1.00 35.59  ? 302 THR B OG1 1 
ATOM   5991  C CG2 . THR B  1 305 ? 82.765  27.076  -18.343 1.00 36.01  ? 302 THR B CG2 1 
ATOM   5992  N N   . GLN B  1 306 ? 83.436  28.334  -14.714 1.00 36.25  ? 303 GLN B N   1 
ATOM   5993  C CA  . GLN B  1 306 ? 82.490  29.024  -13.825 1.00 39.05  ? 303 GLN B CA  1 
ATOM   5994  C C   . GLN B  1 306 ? 82.938  30.403  -13.359 1.00 38.43  ? 303 GLN B C   1 
ATOM   5995  O O   . GLN B  1 306 ? 82.182  31.380  -13.418 1.00 43.20  ? 303 GLN B O   1 
ATOM   5996  C CB  . GLN B  1 306 ? 82.194  28.159  -12.600 1.00 41.01  ? 303 GLN B CB  1 
ATOM   5997  C CG  . GLN B  1 306 ? 81.264  26.997  -12.915 1.00 44.55  ? 303 GLN B CG  1 
ATOM   5998  C CD  . GLN B  1 306 ? 79.814  27.421  -13.085 1.00 46.64  ? 303 GLN B CD  1 
ATOM   5999  O OE1 . GLN B  1 306 ? 79.459  28.598  -12.927 1.00 45.36  ? 303 GLN B OE1 1 
ATOM   6000  N NE2 . GLN B  1 306 ? 78.958  26.449  -13.383 1.00 51.39  ? 303 GLN B NE2 1 
ATOM   6001  N N   . ALA B  1 307 ? 84.162  30.474  -12.869 1.00 36.46  ? 304 ALA B N   1 
ATOM   6002  C CA  . ALA B  1 307 ? 84.771  31.751  -12.520 1.00 34.43  ? 304 ALA B CA  1 
ATOM   6003  C C   . ALA B  1 307 ? 84.897  32.697  -13.695 1.00 34.45  ? 304 ALA B C   1 
ATOM   6004  O O   . ALA B  1 307 ? 84.743  33.883  -13.519 1.00 34.43  ? 304 ALA B O   1 
ATOM   6005  C CB  . ALA B  1 307 ? 86.134  31.537  -11.906 1.00 33.37  ? 304 ALA B CB  1 
ATOM   6006  N N   . MET B  1 308 ? 85.159  32.167  -14.883 1.00 36.32  ? 305 MET B N   1 
ATOM   6007  C CA  . MET B  1 308 ? 85.376  32.980  -16.079 1.00 37.08  ? 305 MET B CA  1 
ATOM   6008  C C   . MET B  1 308 ? 84.092  33.679  -16.591 1.00 41.11  ? 305 MET B C   1 
ATOM   6009  O O   . MET B  1 308 ? 84.171  34.697  -17.282 1.00 41.15  ? 305 MET B O   1 
ATOM   6010  C CB  . MET B  1 308 ? 85.999  32.101  -17.164 1.00 35.54  ? 305 MET B CB  1 
ATOM   6011  C CG  . MET B  1 308 ? 87.084  32.774  -17.944 1.00 35.99  ? 305 MET B CG  1 
ATOM   6012  S SD  . MET B  1 308 ? 87.596  31.739  -19.283 1.00 38.17  ? 305 MET B SD  1 
ATOM   6013  C CE  . MET B  1 308 ? 88.308  30.441  -18.327 1.00 34.86  ? 305 MET B CE  1 
ATOM   6014  N N   . GLN B  1 309 ? 82.914  33.153  -16.243 1.00 46.97  ? 306 GLN B N   1 
ATOM   6015  C CA  . GLN B  1 309 ? 81.653  33.771  -16.673 1.00 51.80  ? 306 GLN B CA  1 
ATOM   6016  C C   . GLN B  1 309 ? 81.473  35.175  -16.086 1.00 47.24  ? 306 GLN B C   1 
ATOM   6017  O O   . GLN B  1 309 ? 80.833  36.024  -16.667 1.00 47.21  ? 306 GLN B O   1 
ATOM   6018  C CB  . GLN B  1 309 ? 80.431  32.856  -16.393 1.00 59.01  ? 306 GLN B CB  1 
ATOM   6019  C CG  . GLN B  1 309 ? 79.724  32.338  -17.673 1.00 67.34  ? 306 GLN B CG  1 
ATOM   6020  C CD  . GLN B  1 309 ? 80.454  31.178  -18.373 1.00 70.40  ? 306 GLN B CD  1 
ATOM   6021  O OE1 . GLN B  1 309 ? 80.490  30.053  -17.861 1.00 76.55  ? 306 GLN B OE1 1 
ATOM   6022  N NE2 . GLN B  1 309 ? 81.014  31.443  -19.556 1.00 68.33  ? 306 GLN B NE2 1 
ATOM   6023  N N   . LYS B  1 310 ? 82.088  35.424  -14.950 1.00 48.41  ? 307 LYS B N   1 
ATOM   6024  C CA  . LYS B  1 310 ? 81.973  36.709  -14.246 1.00 48.71  ? 307 LYS B CA  1 
ATOM   6025  C C   . LYS B  1 310 ? 83.001  37.765  -14.702 1.00 45.28  ? 307 LYS B C   1 
ATOM   6026  O O   . LYS B  1 310 ? 82.942  38.913  -14.242 1.00 41.22  ? 307 LYS B O   1 
ATOM   6027  C CB  . LYS B  1 310 ? 82.122  36.481  -12.731 1.00 54.41  ? 307 LYS B CB  1 
ATOM   6028  C CG  . LYS B  1 310 ? 81.257  35.346  -12.167 1.00 61.67  ? 307 LYS B CG  1 
ATOM   6029  C CD  . LYS B  1 310 ? 81.724  34.865  -10.789 1.00 65.47  ? 307 LYS B CD  1 
ATOM   6030  C CE  . LYS B  1 310 ? 81.185  35.729  -9.663  1.00 65.52  ? 307 LYS B CE  1 
ATOM   6031  N NZ  . LYS B  1 310 ? 79.722  35.509  -9.454  1.00 66.34  ? 307 LYS B NZ  1 
ATOM   6032  N N   . LEU B  1 311 ? 83.944  37.380  -15.577 1.00 42.93  ? 308 LEU B N   1 
ATOM   6033  C CA  . LEU B  1 311 ? 84.889  38.329  -16.205 1.00 39.65  ? 308 LEU B CA  1 
ATOM   6034  C C   . LEU B  1 311 ? 84.199  39.447  -16.997 1.00 39.77  ? 308 LEU B C   1 
ATOM   6035  O O   . LEU B  1 311 ? 83.136  39.260  -17.602 1.00 39.33  ? 308 LEU B O   1 
ATOM   6036  C CB  . LEU B  1 311 ? 85.862  37.612  -17.143 1.00 38.42  ? 308 LEU B CB  1 
ATOM   6037  C CG  . LEU B  1 311 ? 86.941  36.705  -16.540 1.00 37.68  ? 308 LEU B CG  1 
ATOM   6038  C CD1 . LEU B  1 311 ? 87.738  36.033  -17.643 1.00 37.49  ? 308 LEU B CD1 1 
ATOM   6039  C CD2 . LEU B  1 311 ? 87.887  37.479  -15.650 1.00 36.90  ? 308 LEU B CD2 1 
ATOM   6040  N N   . LYS B  1 312 ? 84.824  40.614  -16.983 1.00 40.23  ? 309 LYS B N   1 
ATOM   6041  C CA  . LYS B  1 312 ? 84.290  41.800  -17.641 1.00 41.72  ? 309 LYS B CA  1 
ATOM   6042  C C   . LYS B  1 312 ? 85.390  42.394  -18.517 1.00 39.26  ? 309 LYS B C   1 
ATOM   6043  O O   . LYS B  1 312 ? 86.453  42.765  -18.017 1.00 39.36  ? 309 LYS B O   1 
ATOM   6044  C CB  . LYS B  1 312 ? 83.820  42.827  -16.610 1.00 45.29  ? 309 LYS B CB  1 
ATOM   6045  C CG  . LYS B  1 312 ? 82.797  42.308  -15.608 1.00 50.35  ? 309 LYS B CG  1 
ATOM   6046  C CD  . LYS B  1 312 ? 82.422  43.382  -14.586 1.00 54.71  ? 309 LYS B CD  1 
ATOM   6047  C CE  . LYS B  1 312 ? 81.954  42.769  -13.266 1.00 58.87  ? 309 LYS B CE  1 
ATOM   6048  N NZ  . LYS B  1 312 ? 81.742  43.782  -12.191 1.00 58.18  ? 309 LYS B NZ  1 
ATOM   6049  N N   . VAL B  1 313 ? 85.134  42.445  -19.825 1.00 36.30  ? 310 VAL B N   1 
ATOM   6050  C CA  . VAL B  1 313 ? 86.050  43.031  -20.805 1.00 32.81  ? 310 VAL B CA  1 
ATOM   6051  C C   . VAL B  1 313 ? 85.494  44.363  -21.262 1.00 30.06  ? 310 VAL B C   1 
ATOM   6052  O O   . VAL B  1 313 ? 84.301  44.481  -21.548 1.00 30.27  ? 310 VAL B O   1 
ATOM   6053  C CB  . VAL B  1 313 ? 86.179  42.149  -22.050 1.00 33.47  ? 310 VAL B CB  1 
ATOM   6054  C CG1 . VAL B  1 313 ? 87.306  42.640  -22.928 1.00 33.03  ? 310 VAL B CG1 1 
ATOM   6055  C CG2 . VAL B  1 313 ? 86.435  40.714  -21.641 1.00 35.63  ? 310 VAL B CG2 1 
ATOM   6056  N N   . GLY B  1 314 ? 86.359  45.364  -21.341 1.00 26.66  ? 311 GLY B N   1 
ATOM   6057  C CA  . GLY B  1 314 ? 85.939  46.671  -21.812 1.00 24.88  ? 311 GLY B CA  1 
ATOM   6058  C C   . GLY B  1 314 ? 86.988  47.764  -21.744 1.00 23.44  ? 311 GLY B C   1 
ATOM   6059  O O   . GLY B  1 314 ? 88.158  47.506  -21.457 1.00 21.94  ? 311 GLY B O   1 
ATOM   6060  N N   . PRO B  1 315 ? 86.573  49.006  -22.014 1.00 23.43  ? 312 PRO B N   1 
ATOM   6061  C CA  . PRO B  1 315 ? 87.495  50.160  -21.966 1.00 25.16  ? 312 PRO B CA  1 
ATOM   6062  C C   . PRO B  1 315 ? 87.942  50.619  -20.575 1.00 25.54  ? 312 PRO B C   1 
ATOM   6063  O O   . PRO B  1 315 ? 87.181  50.490  -19.614 1.00 26.80  ? 312 PRO B O   1 
ATOM   6064  C CB  . PRO B  1 315 ? 86.676  51.276  -22.627 1.00 24.77  ? 312 PRO B CB  1 
ATOM   6065  C CG  . PRO B  1 315 ? 85.257  50.873  -22.453 1.00 23.56  ? 312 PRO B CG  1 
ATOM   6066  C CD  . PRO B  1 315 ? 85.249  49.385  -22.536 1.00 22.98  ? 312 PRO B CD  1 
ATOM   6067  N N   . SER B  1 316 ? 89.134  51.214  -20.486 1.00 26.03  ? 313 SER B N   1 
ATOM   6068  C CA  . SER B  1 316 ? 89.669  51.699  -19.185 1.00 26.71  ? 313 SER B CA  1 
ATOM   6069  C C   . SER B  1 316 ? 88.910  52.896  -18.584 1.00 27.25  ? 313 SER B C   1 
ATOM   6070  O O   . SER B  1 316 ? 89.232  53.342  -17.500 1.00 28.25  ? 313 SER B O   1 
ATOM   6071  C CB  . SER B  1 316 ? 91.154  52.055  -19.292 1.00 26.33  ? 313 SER B CB  1 
ATOM   6072  O OG  . SER B  1 316 ? 91.339  53.274  -19.984 1.00 26.80  ? 313 SER B OG  1 
ATOM   6073  N N   . THR B  1 317 ? 87.933  53.424  -19.307 1.00 27.96  ? 314 THR B N   1 
ATOM   6074  C CA  . THR B  1 317 ? 86.982  54.393  -18.771 1.00 28.47  ? 314 THR B CA  1 
ATOM   6075  C C   . THR B  1 317 ? 86.002  53.809  -17.739 1.00 29.57  ? 314 THR B C   1 
ATOM   6076  O O   . THR B  1 317 ? 85.526  54.516  -16.848 1.00 29.94  ? 314 THR B O   1 
ATOM   6077  C CB  . THR B  1 317 ? 86.148  54.977  -19.906 1.00 26.96  ? 314 THR B CB  1 
ATOM   6078  O OG1 . THR B  1 317 ? 85.577  53.909  -20.659 1.00 26.05  ? 314 THR B OG1 1 
ATOM   6079  C CG2 . THR B  1 317 ? 87.009  55.824  -20.803 1.00 26.19  ? 314 THR B CG2 1 
ATOM   6080  N N   . ASP B  1 318 ? 85.672  52.536  -17.897 1.00 30.22  ? 315 ASP B N   1 
ATOM   6081  C CA  . ASP B  1 318 ? 84.944  51.807  -16.883 1.00 31.89  ? 315 ASP B CA  1 
ATOM   6082  C C   . ASP B  1 318 ? 85.955  50.988  -16.058 1.00 33.18  ? 315 ASP B C   1 
ATOM   6083  O O   . ASP B  1 318 ? 86.534  50.027  -16.559 1.00 34.05  ? 315 ASP B O   1 
ATOM   6084  C CB  . ASP B  1 318 ? 83.890  50.911  -17.552 1.00 31.84  ? 315 ASP B CB  1 
ATOM   6085  C CG  . ASP B  1 318 ? 83.037  50.160  -16.556 1.00 30.86  ? 315 ASP B CG  1 
ATOM   6086  O OD1 . ASP B  1 318 ? 82.724  50.720  -15.504 1.00 31.59  ? 315 ASP B OD1 1 
ATOM   6087  O OD2 . ASP B  1 318 ? 82.667  49.010  -16.825 1.00 30.88  ? 315 ASP B OD2 1 
ATOM   6088  N N   . SER B  1 319 ? 86.197  51.395  -14.811 1.00 33.98  ? 316 SER B N   1 
ATOM   6089  C CA  . SER B  1 319 ? 86.895  50.535  -13.853 1.00 34.50  ? 316 SER B CA  1 
ATOM   6090  C C   . SER B  1 319 ? 85.971  49.351  -13.525 1.00 36.17  ? 316 SER B C   1 
ATOM   6091  O O   . SER B  1 319 ? 84.797  49.327  -13.928 1.00 38.13  ? 316 SER B O   1 
ATOM   6092  C CB  . SER B  1 319 ? 87.253  51.296  -12.590 1.00 34.73  ? 316 SER B CB  1 
ATOM   6093  O OG  . SER B  1 319 ? 88.215  52.280  -12.861 1.00 35.73  ? 316 SER B OG  1 
ATOM   6094  N N   . GLY B  1 320 ? 86.483  48.339  -12.844 1.00 33.77  ? 317 GLY B N   1 
ATOM   6095  C CA  . GLY B  1 320 ? 85.658  47.153  -12.602 1.00 33.78  ? 317 GLY B CA  1 
ATOM   6096  C C   . GLY B  1 320 ? 85.549  46.207  -13.795 1.00 32.19  ? 317 GLY B C   1 
ATOM   6097  O O   . GLY B  1 320 ? 85.073  45.071  -13.655 1.00 34.72  ? 317 GLY B O   1 
ATOM   6098  N N   . ASN B  1 321 ? 85.959  46.671  -14.974 1.00 29.43  ? 318 ASN B N   1 
ATOM   6099  C CA  . ASN B  1 321 ? 86.400  45.773  -16.042 1.00 27.73  ? 318 ASN B CA  1 
ATOM   6100  C C   . ASN B  1 321 ? 87.649  44.998  -15.568 1.00 27.62  ? 318 ASN B C   1 
ATOM   6101  O O   . ASN B  1 321 ? 88.505  45.542  -14.884 1.00 25.82  ? 318 ASN B O   1 
ATOM   6102  C CB  . ASN B  1 321 ? 86.668  46.537  -17.358 1.00 25.41  ? 318 ASN B CB  1 
ATOM   6103  C CG  . ASN B  1 321 ? 85.395  46.833  -18.140 1.00 24.55  ? 318 ASN B CG  1 
ATOM   6104  O OD1 . ASN B  1 321 ? 84.421  46.097  -18.066 1.00 26.51  ? 318 ASN B OD1 1 
ATOM   6105  N ND2 . ASN B  1 321 ? 85.397  47.907  -18.889 1.00 23.43  ? 318 ASN B ND2 1 
ATOM   6106  N N   . ASP B  1 322 ? 87.712  43.714  -15.891 1.00 27.63  ? 319 ASP B N   1 
ATOM   6107  C CA  . ASP B  1 322 ? 88.823  42.886  -15.465 1.00 28.73  ? 319 ASP B CA  1 
ATOM   6108  C C   . ASP B  1 322 ? 90.070  43.140  -16.307 1.00 27.05  ? 319 ASP B C   1 
ATOM   6109  O O   . ASP B  1 322 ? 91.206  43.158  -15.791 1.00 24.57  ? 319 ASP B O   1 
ATOM   6110  C CB  . ASP B  1 322 ? 88.405  41.418  -15.486 1.00 30.63  ? 319 ASP B CB  1 
ATOM   6111  C CG  . ASP B  1 322 ? 87.437  41.107  -14.393 1.00 31.65  ? 319 ASP B CG  1 
ATOM   6112  O OD1 . ASP B  1 322 ? 87.901  40.984  -13.250 1.00 32.17  ? 319 ASP B OD1 1 
ATOM   6113  O OD2 . ASP B  1 322 ? 86.218  41.030  -14.661 1.00 36.32  ? 319 ASP B OD2 1 
ATOM   6114  N N   . PHE B  1 323 ? 89.846  43.331  -17.608 1.00 26.31  ? 320 PHE B N   1 
ATOM   6115  C CA  . PHE B  1 323 ? 90.928  43.704  -18.523 1.00 24.59  ? 320 PHE B CA  1 
ATOM   6116  C C   . PHE B  1 323 ? 90.436  44.509  -19.704 1.00 23.43  ? 320 PHE B C   1 
ATOM   6117  O O   . PHE B  1 323 ? 89.232  44.610  -19.943 1.00 23.68  ? 320 PHE B O   1 
ATOM   6118  C CB  . PHE B  1 323 ? 91.744  42.482  -18.968 1.00 23.68  ? 320 PHE B CB  1 
ATOM   6119  C CG  . PHE B  1 323 ? 90.934  41.352  -19.547 1.00 22.81  ? 320 PHE B CG  1 
ATOM   6120  C CD1 . PHE B  1 323 ? 90.458  40.339  -18.734 1.00 22.03  ? 320 PHE B CD1 1 
ATOM   6121  C CD2 . PHE B  1 323 ? 90.712  41.266  -20.918 1.00 22.41  ? 320 PHE B CD2 1 
ATOM   6122  C CE1 . PHE B  1 323 ? 89.746  39.287  -19.271 1.00 21.81  ? 320 PHE B CE1 1 
ATOM   6123  C CE2 . PHE B  1 323 ? 90.003  40.216  -21.458 1.00 21.47  ? 320 PHE B CE2 1 
ATOM   6124  C CZ  . PHE B  1 323 ? 89.525  39.226  -20.634 1.00 21.75  ? 320 PHE B CZ  1 
ATOM   6125  N N   . GLY B  1 324 ? 91.387  45.100  -20.413 1.00 22.82  ? 321 GLY B N   1 
ATOM   6126  C CA  . GLY B  1 324 ? 91.102  45.967  -21.551 1.00 22.47  ? 321 GLY B CA  1 
ATOM   6127  C C   . GLY B  1 324 ? 91.379  45.354  -22.913 1.00 22.06  ? 321 GLY B C   1 
ATOM   6128  O O   . GLY B  1 324 ? 91.493  44.125  -23.061 1.00 21.54  ? 321 GLY B O   1 
ATOM   6129  N N   . PRO B  1 325 ? 91.494  46.210  -23.935 1.00 22.25  ? 322 PRO B N   1 
ATOM   6130  C CA  . PRO B  1 325 ? 91.728  45.669  -25.250 1.00 23.50  ? 322 PRO B CA  1 
ATOM   6131  C C   . PRO B  1 325 ? 93.144  45.179  -25.446 1.00 24.77  ? 322 PRO B C   1 
ATOM   6132  O O   . PRO B  1 325 ? 94.037  45.486  -24.664 1.00 26.33  ? 322 PRO B O   1 
ATOM   6133  C CB  . PRO B  1 325 ? 91.464  46.873  -26.175 1.00 22.96  ? 322 PRO B CB  1 
ATOM   6134  C CG  . PRO B  1 325 ? 91.754  48.065  -25.361 1.00 21.65  ? 322 PRO B CG  1 
ATOM   6135  C CD  . PRO B  1 325 ? 91.372  47.680  -23.961 1.00 22.20  ? 322 PRO B CD  1 
ATOM   6136  N N   . VAL B  1 326 ? 93.316  44.446  -26.529 1.00 26.28  ? 323 VAL B N   1 
ATOM   6137  C CA  . VAL B  1 326 ? 94.620  44.121  -27.071 1.00 27.36  ? 323 VAL B CA  1 
ATOM   6138  C C   . VAL B  1 326 ? 95.207  45.379  -27.741 1.00 27.82  ? 323 VAL B C   1 
ATOM   6139  O O   . VAL B  1 326 ? 94.479  46.307  -28.099 1.00 26.92  ? 323 VAL B O   1 
ATOM   6140  C CB  . VAL B  1 326 ? 94.485  42.922  -28.043 1.00 28.72  ? 323 VAL B CB  1 
ATOM   6141  C CG1 . VAL B  1 326 ? 95.178  43.167  -29.372 1.00 30.62  ? 323 VAL B CG1 1 
ATOM   6142  C CG2 . VAL B  1 326 ? 94.946  41.640  -27.377 1.00 28.27  ? 323 VAL B CG2 1 
ATOM   6143  N N   . ILE B  1 327 ? 96.526  45.400  -27.903 1.00 27.96  ? 324 ILE B N   1 
ATOM   6144  C CA  . ILE B  1 327 ? 97.239  46.624  -28.298 1.00 28.16  ? 324 ILE B CA  1 
ATOM   6145  C C   . ILE B  1 327 ? 96.906  47.175  -29.690 1.00 29.27  ? 324 ILE B C   1 
ATOM   6146  O O   . ILE B  1 327 ? 96.882  48.411  -29.874 1.00 30.42  ? 324 ILE B O   1 
ATOM   6147  C CB  . ILE B  1 327 ? 98.776  46.472  -28.134 1.00 27.04  ? 324 ILE B CB  1 
ATOM   6148  C CG1 . ILE B  1 327 ? 99.498  47.809  -28.321 1.00 26.01  ? 324 ILE B CG1 1 
ATOM   6149  C CG2 . ILE B  1 327 ? 99.357  45.447  -29.109 1.00 27.49  ? 324 ILE B CG2 1 
ATOM   6150  C CD1 . ILE B  1 327 ? 99.225  48.794  -27.222 1.00 26.16  ? 324 ILE B CD1 1 
ATOM   6151  N N   . THR B  1 328 ? 96.707  46.283  -30.668 1.00 30.08  ? 325 THR B N   1 
ATOM   6152  C CA  . THR B  1 328 ? 96.434  46.701  -32.073 1.00 30.95  ? 325 THR B CA  1 
ATOM   6153  C C   . THR B  1 328 ? 95.493  45.779  -32.832 1.00 32.18  ? 325 THR B C   1 
ATOM   6154  O O   . THR B  1 328 ? 95.288  44.631  -32.459 1.00 30.46  ? 325 THR B O   1 
ATOM   6155  C CB  . THR B  1 328 ? 97.708  46.834  -32.948 1.00 29.55  ? 325 THR B CB  1 
ATOM   6156  O OG1 . THR B  1 328 ? 98.355  45.564  -33.047 1.00 27.86  ? 325 THR B OG1 1 
ATOM   6157  C CG2 . THR B  1 328 ? 98.679  47.918  -32.408 1.00 30.59  ? 325 THR B CG2 1 
ATOM   6158  N N   . ARG B  1 329 ? 94.950  46.303  -33.927 1.00 36.19  ? 326 ARG B N   1 
ATOM   6159  C CA  . ARG B  1 329 ? 94.132  45.516  -34.852 1.00 40.66  ? 326 ARG B CA  1 
ATOM   6160  C C   . ARG B  1 329 ? 94.884  44.299  -35.376 1.00 39.66  ? 326 ARG B C   1 
ATOM   6161  O O   . ARG B  1 329 ? 94.359  43.204  -35.346 1.00 34.10  ? 326 ARG B O   1 
ATOM   6162  C CB  . ARG B  1 329 ? 93.681  46.387  -36.028 1.00 47.62  ? 326 ARG B CB  1 
ATOM   6163  C CG  . ARG B  1 329 ? 92.779  45.685  -37.052 1.00 53.31  ? 326 ARG B CG  1 
ATOM   6164  C CD  . ARG B  1 329 ? 91.433  46.387  -37.214 1.00 57.51  ? 326 ARG B CD  1 
ATOM   6165  N NE  . ARG B  1 329 ? 90.495  45.993  -36.146 1.00 63.21  ? 326 ARG B NE  1 
ATOM   6166  C CZ  . ARG B  1 329 ? 89.524  46.758  -35.622 1.00 66.91  ? 326 ARG B CZ  1 
ATOM   6167  N NH1 . ARG B  1 329 ? 89.321  48.020  -36.030 1.00 63.80  ? 326 ARG B NH1 1 
ATOM   6168  N NH2 . ARG B  1 329 ? 88.747  46.252  -34.655 1.00 66.73  ? 326 ARG B NH2 1 
ATOM   6169  N N   . GLN B  1 330 ? 96.106  44.520  -35.861 1.00 42.85  ? 327 GLN B N   1 
ATOM   6170  C CA  . GLN B  1 330 ? 97.005  43.445  -36.280 1.00 44.25  ? 327 GLN B CA  1 
ATOM   6171  C C   . GLN B  1 330 ? 97.092  42.385  -35.175 1.00 41.71  ? 327 GLN B C   1 
ATOM   6172  O O   . GLN B  1 330 ? 96.811  41.216  -35.417 1.00 36.66  ? 327 GLN B O   1 
ATOM   6173  C CB  . GLN B  1 330 ? 98.386  44.025  -36.613 1.00 51.78  ? 327 GLN B CB  1 
ATOM   6174  C CG  . GLN B  1 330 ? 99.346  43.082  -37.330 1.00 59.84  ? 327 GLN B CG  1 
ATOM   6175  C CD  . GLN B  1 330 ? 100.714 43.716  -37.589 1.00 69.30  ? 327 GLN B CD  1 
ATOM   6176  O OE1 . GLN B  1 330 ? 101.107 44.683  -36.923 1.00 80.35  ? 327 GLN B OE1 1 
ATOM   6177  N NE2 . GLN B  1 330 ? 101.450 43.167  -38.551 1.00 70.63  ? 327 GLN B NE2 1 
ATOM   6178  N N   . HIS B  1 331 ? 97.427  42.811  -33.956 1.00 41.03  ? 328 HIS B N   1 
ATOM   6179  C CA  . HIS B  1 331 ? 97.546  41.893  -32.805 1.00 40.45  ? 328 HIS B CA  1 
ATOM   6180  C C   . HIS B  1 331 ? 96.249  41.200  -32.438 1.00 35.96  ? 328 HIS B C   1 
ATOM   6181  O O   . HIS B  1 331 ? 96.261  40.075  -32.005 1.00 32.87  ? 328 HIS B O   1 
ATOM   6182  C CB  . HIS B  1 331 ? 98.079  42.621  -31.556 1.00 45.70  ? 328 HIS B CB  1 
ATOM   6183  C CG  . HIS B  1 331 ? 98.567  41.698  -30.474 1.00 48.68  ? 328 HIS B CG  1 
ATOM   6184  N ND1 . HIS B  1 331 ? 99.584  40.792  -30.678 1.00 54.13  ? 328 HIS B ND1 1 
ATOM   6185  C CD2 . HIS B  1 331 ? 98.182  41.539  -29.185 1.00 48.17  ? 328 HIS B CD2 1 
ATOM   6186  C CE1 . HIS B  1 331 ? 99.798  40.113  -29.565 1.00 53.66  ? 328 HIS B CE1 1 
ATOM   6187  N NE2 . HIS B  1 331 ? 98.959  40.548  -28.645 1.00 49.55  ? 328 HIS B NE2 1 
ATOM   6188  N N   . GLN B  1 332 ? 95.127  41.884  -32.584 1.00 35.47  ? 329 GLN B N   1 
ATOM   6189  C CA  . GLN B  1 332 ? 93.819  41.259  -32.361 1.00 35.29  ? 329 GLN B CA  1 
ATOM   6190  C C   . GLN B  1 332 ? 93.504  40.148  -33.371 1.00 36.39  ? 329 GLN B C   1 
ATOM   6191  O O   . GLN B  1 332 ? 92.990  39.100  -32.998 1.00 32.01  ? 329 GLN B O   1 
ATOM   6192  C CB  . GLN B  1 332 ? 92.725  42.309  -32.458 1.00 35.23  ? 329 GLN B CB  1 
ATOM   6193  C CG  . GLN B  1 332 ? 91.317  41.750  -32.272 1.00 34.07  ? 329 GLN B CG  1 
ATOM   6194  C CD  . GLN B  1 332 ? 90.215  42.704  -32.698 1.00 33.20  ? 329 GLN B CD  1 
ATOM   6195  O OE1 . GLN B  1 332 ? 90.409  43.628  -33.486 1.00 33.82  ? 329 GLN B OE1 1 
ATOM   6196  N NE2 . GLN B  1 332 ? 89.040  42.468  -32.185 1.00 34.47  ? 329 GLN B NE2 1 
ATOM   6197  N N   . GLU B  1 333 ? 93.751  40.431  -34.655 1.00 40.61  ? 330 GLU B N   1 
ATOM   6198  C CA  . GLU B  1 333 ? 93.679  39.423  -35.730 1.00 41.73  ? 330 GLU B CA  1 
ATOM   6199  C C   . GLU B  1 333 ? 94.605  38.233  -35.380 1.00 41.76  ? 330 GLU B C   1 
ATOM   6200  O O   . GLU B  1 333 ? 94.168  37.092  -35.445 1.00 37.18  ? 330 GLU B O   1 
ATOM   6201  C CB  . GLU B  1 333 ? 94.017  40.026  -37.127 1.00 42.66  ? 330 GLU B CB  1 
ATOM   6202  C CG  . GLU B  1 333 ? 92.908  40.859  -37.805 1.00 44.25  ? 330 GLU B CG  1 
ATOM   6203  C CD  . GLU B  1 333 ? 93.422  41.790  -38.929 1.00 46.98  ? 330 GLU B CD  1 
ATOM   6204  O OE1 . GLU B  1 333 ? 94.486  41.500  -39.517 1.00 50.53  ? 330 GLU B OE1 1 
ATOM   6205  O OE2 . GLU B  1 333 ? 92.777  42.827  -39.238 1.00 44.75  ? 330 GLU B OE2 1 
ATOM   6206  N N   . LYS B  1 334 ? 95.852  38.511  -34.970 1.00 43.80  ? 331 LYS B N   1 
ATOM   6207  C CA  . LYS B  1 334 ? 96.828  37.455  -34.612 1.00 43.35  ? 331 LYS B CA  1 
ATOM   6208  C C   . LYS B  1 334 ? 96.227  36.528  -33.558 1.00 40.45  ? 331 LYS B C   1 
ATOM   6209  O O   . LYS B  1 334 ? 96.196  35.311  -33.744 1.00 37.10  ? 331 LYS B O   1 
ATOM   6210  C CB  . LYS B  1 334 ? 98.171  38.044  -34.118 1.00 49.13  ? 331 LYS B CB  1 
ATOM   6211  C CG  . LYS B  1 334 ? 99.405  37.183  -34.440 1.00 55.74  ? 331 LYS B CG  1 
ATOM   6212  C CD  . LYS B  1 334 ? 100.652 37.533  -33.613 1.00 59.85  ? 331 LYS B CD  1 
ATOM   6213  C CE  . LYS B  1 334 ? 101.260 38.890  -33.968 1.00 61.68  ? 331 LYS B CE  1 
ATOM   6214  N NZ  . LYS B  1 334 ? 102.428 39.220  -33.093 1.00 61.43  ? 331 LYS B NZ  1 
ATOM   6215  N N   . VAL B  1 335 ? 95.712  37.119  -32.477 1.00 40.62  ? 332 VAL B N   1 
ATOM   6216  C CA  . VAL B  1 335 ? 95.150  36.357  -31.339 1.00 39.69  ? 332 VAL B CA  1 
ATOM   6217  C C   . VAL B  1 335 ? 93.945  35.525  -31.763 1.00 41.25  ? 332 VAL B C   1 
ATOM   6218  O O   . VAL B  1 335 ? 93.851  34.357  -31.422 1.00 41.76  ? 332 VAL B O   1 
ATOM   6219  C CB  . VAL B  1 335 ? 94.752  37.257  -30.138 1.00 38.15  ? 332 VAL B CB  1 
ATOM   6220  C CG1 . VAL B  1 335 ? 93.973  36.473  -29.096 1.00 36.97  ? 332 VAL B CG1 1 
ATOM   6221  C CG2 . VAL B  1 335 ? 95.980  37.869  -29.465 1.00 39.36  ? 332 VAL B CG2 1 
ATOM   6222  N N   . ILE B  1 336 ? 93.026  36.121  -32.510 1.00 45.40  ? 333 ILE B N   1 
ATOM   6223  C CA  . ILE B  1 336 ? 91.883  35.370  -33.083 1.00 46.41  ? 333 ILE B CA  1 
ATOM   6224  C C   . ILE B  1 336 ? 92.373  34.160  -33.897 1.00 46.31  ? 333 ILE B C   1 
ATOM   6225  O O   . ILE B  1 336 ? 91.776  33.084  -33.841 1.00 39.01  ? 333 ILE B O   1 
ATOM   6226  C CB  . ILE B  1 336 ? 91.031  36.255  -34.028 1.00 48.04  ? 333 ILE B CB  1 
ATOM   6227  C CG1 . ILE B  1 336 ? 90.428  37.451  -33.290 1.00 46.66  ? 333 ILE B CG1 1 
ATOM   6228  C CG2 . ILE B  1 336 ? 89.919  35.444  -34.700 1.00 48.04  ? 333 ILE B CG2 1 
ATOM   6229  C CD1 . ILE B  1 336 ? 89.298  37.098  -32.365 1.00 46.76  ? 333 ILE B CD1 1 
ATOM   6230  N N   . GLY B  1 337 ? 93.447  34.381  -34.664 1.00 50.90  ? 334 GLY B N   1 
ATOM   6231  C CA  . GLY B  1 337 ? 94.160  33.337  -35.412 1.00 53.40  ? 334 GLY B CA  1 
ATOM   6232  C C   . GLY B  1 337 ? 94.648  32.183  -34.557 1.00 53.73  ? 334 GLY B C   1 
ATOM   6233  O O   . GLY B  1 337 ? 94.417  31.019  -34.901 1.00 49.64  ? 334 GLY B O   1 
ATOM   6234  N N   . TYR B  1 338 ? 95.307  32.507  -33.437 1.00 54.35  ? 335 TYR B N   1 
ATOM   6235  C CA  . TYR B  1 338 ? 95.828  31.482  -32.510 1.00 55.22  ? 335 TYR B CA  1 
ATOM   6236  C C   . TYR B  1 338 ? 94.697  30.617  -31.924 1.00 50.58  ? 335 TYR B C   1 
ATOM   6237  O O   . TYR B  1 338 ? 94.917  29.460  -31.584 1.00 51.19  ? 335 TYR B O   1 
ATOM   6238  C CB  . TYR B  1 338 ? 96.693  32.095  -31.379 1.00 58.85  ? 335 TYR B CB  1 
ATOM   6239  C CG  . TYR B  1 338 ? 98.109  32.566  -31.791 1.00 64.81  ? 335 TYR B CG  1 
ATOM   6240  C CD1 . TYR B  1 338 ? 99.085  31.651  -32.225 1.00 62.51  ? 335 TYR B CD1 1 
ATOM   6241  C CD2 . TYR B  1 338 ? 98.482  33.927  -31.719 1.00 67.24  ? 335 TYR B CD2 1 
ATOM   6242  C CE1 . TYR B  1 338 ? 100.372 32.071  -32.586 1.00 59.95  ? 335 TYR B CE1 1 
ATOM   6243  C CE2 . TYR B  1 338 ? 99.768  34.348  -32.086 1.00 68.33  ? 335 TYR B CE2 1 
ATOM   6244  C CZ  . TYR B  1 338 ? 100.709 33.415  -32.521 1.00 65.20  ? 335 TYR B CZ  1 
ATOM   6245  O OH  . TYR B  1 338 ? 101.986 33.812  -32.886 1.00 64.19  ? 335 TYR B OH  1 
ATOM   6246  N N   . ILE B  1 339 ? 93.491  31.174  -31.836 1.00 47.04  ? 336 ILE B N   1 
ATOM   6247  C CA  . ILE B  1 339 ? 92.304  30.454  -31.332 1.00 42.82  ? 336 ILE B CA  1 
ATOM   6248  C C   . ILE B  1 339 ? 91.569  29.678  -32.406 1.00 42.03  ? 336 ILE B C   1 
ATOM   6249  O O   . ILE B  1 339 ? 91.043  28.608  -32.139 1.00 38.69  ? 336 ILE B O   1 
ATOM   6250  C CB  . ILE B  1 339 ? 91.282  31.415  -30.707 1.00 41.80  ? 336 ILE B CB  1 
ATOM   6251  C CG1 . ILE B  1 339 ? 91.943  32.227  -29.601 1.00 42.53  ? 336 ILE B CG1 1 
ATOM   6252  C CG2 . ILE B  1 339 ? 90.107  30.646  -30.101 1.00 40.70  ? 336 ILE B CG2 1 
ATOM   6253  C CD1 . ILE B  1 339 ? 91.153  33.434  -29.163 1.00 43.16  ? 336 ILE B CD1 1 
ATOM   6254  N N   . ASN B  1 340 ? 91.480  30.245  -33.603 1.00 44.08  ? 337 ASN B N   1 
ATOM   6255  C CA  . ASN B  1 340 ? 91.027  29.482  -34.763 1.00 43.40  ? 337 ASN B CA  1 
ATOM   6256  C C   . ASN B  1 340 ? 91.865  28.228  -34.953 1.00 43.39  ? 337 ASN B C   1 
ATOM   6257  O O   . ASN B  1 340 ? 91.291  27.146  -35.055 1.00 36.29  ? 337 ASN B O   1 
ATOM   6258  C CB  . ASN B  1 340 ? 91.061  30.341  -36.028 1.00 43.32  ? 337 ASN B CB  1 
ATOM   6259  C CG  . ASN B  1 340 ? 90.001  31.429  -36.014 1.00 41.82  ? 337 ASN B CG  1 
ATOM   6260  O OD1 . ASN B  1 340 ? 89.034  31.366  -35.255 1.00 36.12  ? 337 ASN B OD1 1 
ATOM   6261  N ND2 . ASN B  1 340 ? 90.180  32.437  -36.860 1.00 44.89  ? 337 ASN B ND2 1 
ATOM   6262  N N   . SER B  1 341 ? 93.201  28.389  -34.959 1.00 47.80  ? 338 SER B N   1 
ATOM   6263  C CA  . SER B  1 341 ? 94.148  27.271  -35.111 1.00 49.38  ? 338 SER B CA  1 
ATOM   6264  C C   . SER B  1 341 ? 93.758  26.138  -34.173 1.00 47.70  ? 338 SER B C   1 
ATOM   6265  O O   . SER B  1 341 ? 93.459  25.020  -34.615 1.00 40.36  ? 338 SER B O   1 
ATOM   6266  C CB  . SER B  1 341 ? 95.594  27.703  -34.814 1.00 53.77  ? 338 SER B CB  1 
ATOM   6267  O OG  . SER B  1 341 ? 96.500  26.597  -34.900 1.00 60.48  ? 338 SER B OG  1 
ATOM   6268  N N   . ALA B  1 342 ? 93.723  26.456  -32.878 1.00 46.67  ? 339 ALA B N   1 
ATOM   6269  C CA  . ALA B  1 342 ? 93.457  25.466  -31.827 1.00 45.72  ? 339 ALA B CA  1 
ATOM   6270  C C   . ALA B  1 342 ? 92.207  24.637  -32.078 1.00 46.59  ? 339 ALA B C   1 
ATOM   6271  O O   . ALA B  1 342 ? 92.189  23.448  -31.832 1.00 45.05  ? 339 ALA B O   1 
ATOM   6272  C CB  . ALA B  1 342 ? 93.352  26.138  -30.482 1.00 45.19  ? 339 ALA B CB  1 
ATOM   6273  N N   . GLU B  1 343 ? 91.163  25.260  -32.594 1.00 51.52  ? 340 GLU B N   1 
ATOM   6274  C CA  . GLU B  1 343 ? 89.955  24.520  -33.014 1.00 53.72  ? 340 GLU B CA  1 
ATOM   6275  C C   . GLU B  1 343 ? 90.103  23.649  -34.302 1.00 57.63  ? 340 GLU B C   1 
ATOM   6276  O O   . GLU B  1 343 ? 89.641  22.502  -34.333 1.00 48.55  ? 340 GLU B O   1 
ATOM   6277  C CB  . GLU B  1 343 ? 88.826  25.510  -33.216 1.00 49.99  ? 340 GLU B CB  1 
ATOM   6278  C CG  . GLU B  1 343 ? 87.468  24.857  -33.264 1.00 45.77  ? 340 GLU B CG  1 
ATOM   6279  C CD  . GLU B  1 343 ? 86.353  25.854  -33.054 1.00 43.23  ? 340 GLU B CD  1 
ATOM   6280  O OE1 . GLU B  1 343 ? 85.511  25.606  -32.177 1.00 40.29  ? 340 GLU B OE1 1 
ATOM   6281  O OE2 . GLU B  1 343 ? 86.317  26.890  -33.753 1.00 41.78  ? 340 GLU B OE2 1 
ATOM   6282  N N   . GLN B  1 344 ? 90.708  24.230  -35.348 1.00 63.40  ? 341 GLN B N   1 
ATOM   6283  C CA  . GLN B  1 344 ? 91.133  23.507  -36.558 1.00 67.14  ? 341 GLN B CA  1 
ATOM   6284  C C   . GLN B  1 344 ? 91.953  22.259  -36.152 1.00 68.33  ? 341 GLN B C   1 
ATOM   6285  O O   . GLN B  1 344 ? 91.475  21.135  -36.330 1.00 63.39  ? 341 GLN B O   1 
ATOM   6286  C CB  . GLN B  1 344 ? 91.949  24.444  -37.482 1.00 74.49  ? 341 GLN B CB  1 
ATOM   6287  C CG  . GLN B  1 344 ? 92.200  23.952  -38.907 1.00 81.17  ? 341 GLN B CG  1 
ATOM   6288  C CD  . GLN B  1 344 ? 93.200  24.829  -39.676 1.00 88.57  ? 341 GLN B CD  1 
ATOM   6289  O OE1 . GLN B  1 344 ? 93.824  25.736  -39.107 1.00 88.87  ? 341 GLN B OE1 1 
ATOM   6290  N NE2 . GLN B  1 344 ? 93.351  24.560  -40.981 1.00 93.38  ? 341 GLN B NE2 1 
ATOM   6291  N N   . GLN B  1 345 ? 93.132  22.464  -35.531 1.00 66.46  ? 342 GLN B N   1 
ATOM   6292  C CA  . GLN B  1 345 ? 94.078  21.369  -35.201 1.00 58.58  ? 342 GLN B CA  1 
ATOM   6293  C C   . GLN B  1 345 ? 93.496  20.368  -34.189 1.00 53.76  ? 342 GLN B C   1 
ATOM   6294  O O   . GLN B  1 345 ? 94.125  19.359  -33.901 1.00 58.08  ? 342 GLN B O   1 
ATOM   6295  C CB  . GLN B  1 345 ? 95.459  21.905  -34.736 1.00 60.18  ? 342 GLN B CB  1 
ATOM   6296  C CG  . GLN B  1 345 ? 96.361  22.432  -35.865 1.00 65.55  ? 342 GLN B CG  1 
ATOM   6297  C CD  . GLN B  1 345 ? 97.687  23.067  -35.397 1.00 70.86  ? 342 GLN B CD  1 
ATOM   6298  O OE1 . GLN B  1 345 ? 97.819  23.500  -34.245 1.00 78.37  ? 342 GLN B OE1 1 
ATOM   6299  N NE2 . GLN B  1 345 ? 98.660  23.164  -36.315 1.00 67.26  ? 342 GLN B NE2 1 
ATOM   6300  N N   . GLY B  1 346 ? 92.306  20.639  -33.651 1.00 48.40  ? 343 GLY B N   1 
ATOM   6301  C CA  . GLY B  1 346 ? 91.525  19.624  -32.934 1.00 46.66  ? 343 GLY B CA  1 
ATOM   6302  C C   . GLY B  1 346 ? 91.045  19.940  -31.523 1.00 47.79  ? 343 GLY B C   1 
ATOM   6303  O O   . GLY B  1 346 ? 90.247  19.190  -30.957 1.00 43.85  ? 343 GLY B O   1 
ATOM   6304  N N   . ALA B  1 347 ? 91.516  21.041  -30.937 1.00 50.11  ? 344 ALA B N   1 
ATOM   6305  C CA  . ALA B  1 347 ? 91.222  21.355  -29.517 1.00 45.13  ? 344 ALA B CA  1 
ATOM   6306  C C   . ALA B  1 347 ? 89.754  21.746  -29.266 1.00 41.95  ? 344 ALA B C   1 
ATOM   6307  O O   . ALA B  1 347 ? 88.996  22.017  -30.195 1.00 43.46  ? 344 ALA B O   1 
ATOM   6308  C CB  . ALA B  1 347 ? 92.171  22.431  -28.986 1.00 44.80  ? 344 ALA B CB  1 
ATOM   6309  N N   . THR B  1 348 ? 89.373  21.759  -27.991 1.00 39.22  ? 345 THR B N   1 
ATOM   6310  C CA  . THR B  1 348 ? 87.990  22.063  -27.532 1.00 37.65  ? 345 THR B CA  1 
ATOM   6311  C C   . THR B  1 348 ? 87.813  23.483  -26.974 1.00 38.28  ? 345 THR B C   1 
ATOM   6312  O O   . THR B  1 348 ? 88.164  23.752  -25.825 1.00 36.29  ? 345 THR B O   1 
ATOM   6313  C CB  . THR B  1 348 ? 87.526  21.134  -26.377 1.00 36.19  ? 345 THR B CB  1 
ATOM   6314  O OG1 . THR B  1 348 ? 87.505  19.766  -26.797 1.00 36.97  ? 345 THR B OG1 1 
ATOM   6315  C CG2 . THR B  1 348 ? 86.113  21.520  -25.881 1.00 33.13  ? 345 THR B CG2 1 
ATOM   6316  N N   . ILE B  1 349 ? 87.223  24.378  -27.762 1.00 40.19  ? 346 ILE B N   1 
ATOM   6317  C CA  . ILE B  1 349 ? 87.105  25.792  -27.376 1.00 38.17  ? 346 ILE B CA  1 
ATOM   6318  C C   . ILE B  1 349 ? 86.022  25.914  -26.307 1.00 37.29  ? 346 ILE B C   1 
ATOM   6319  O O   . ILE B  1 349 ? 84.875  26.238  -26.596 1.00 38.79  ? 346 ILE B O   1 
ATOM   6320  C CB  . ILE B  1 349 ? 86.805  26.711  -28.582 1.00 37.43  ? 346 ILE B CB  1 
ATOM   6321  C CG1 . ILE B  1 349 ? 87.897  26.602  -29.651 1.00 39.79  ? 346 ILE B CG1 1 
ATOM   6322  C CG2 . ILE B  1 349 ? 86.678  28.157  -28.141 1.00 36.36  ? 346 ILE B CG2 1 
ATOM   6323  C CD1 . ILE B  1 349 ? 89.278  27.095  -29.235 1.00 41.52  ? 346 ILE B CD1 1 
ATOM   6324  N N   . VAL B  1 350 ? 86.414  25.657  -25.061 1.00 35.84  ? 347 VAL B N   1 
ATOM   6325  C CA  . VAL B  1 350 ? 85.486  25.615  -23.896 1.00 33.72  ? 347 VAL B CA  1 
ATOM   6326  C C   . VAL B  1 350 ? 84.830  26.947  -23.530 1.00 32.37  ? 347 VAL B C   1 
ATOM   6327  O O   . VAL B  1 350 ? 83.698  26.959  -23.049 1.00 31.81  ? 347 VAL B O   1 
ATOM   6328  C CB  . VAL B  1 350 ? 86.184  25.091  -22.601 1.00 33.55  ? 347 VAL B CB  1 
ATOM   6329  C CG1 . VAL B  1 350 ? 85.247  25.110  -21.388 1.00 31.16  ? 347 VAL B CG1 1 
ATOM   6330  C CG2 . VAL B  1 350 ? 86.737  23.682  -22.797 1.00 33.96  ? 347 VAL B CG2 1 
ATOM   6331  N N   . VAL B  1 351 ? 85.552  28.056  -23.679 1.00 31.87  ? 348 VAL B N   1 
ATOM   6332  C CA  . VAL B  1 351 ? 84.950  29.394  -23.522 1.00 30.86  ? 348 VAL B CA  1 
ATOM   6333  C C   . VAL B  1 351 ? 85.412  30.285  -24.652 1.00 30.56  ? 348 VAL B C   1 
ATOM   6334  O O   . VAL B  1 351 ? 86.601  30.508  -24.783 1.00 32.41  ? 348 VAL B O   1 
ATOM   6335  C CB  . VAL B  1 351 ? 85.321  30.059  -22.191 1.00 30.33  ? 348 VAL B CB  1 
ATOM   6336  C CG1 . VAL B  1 351 ? 84.737  31.462  -22.125 1.00 29.98  ? 348 VAL B CG1 1 
ATOM   6337  C CG2 . VAL B  1 351 ? 84.827  29.228  -21.016 1.00 29.47  ? 348 VAL B CG2 1 
ATOM   6338  N N   . ASP B  1 352 ? 84.469  30.776  -25.454 1.00 30.49  ? 349 ASP B N   1 
ATOM   6339  C CA  . ASP B  1 352 ? 84.767  31.484  -26.690 1.00 31.27  ? 349 ASP B CA  1 
ATOM   6340  C C   . ASP B  1 352 ? 84.733  32.968  -26.399 1.00 32.86  ? 349 ASP B C   1 
ATOM   6341  O O   . ASP B  1 352 ? 83.740  33.484  -25.890 1.00 32.57  ? 349 ASP B O   1 
ATOM   6342  C CB  . ASP B  1 352 ? 83.750  31.127  -27.781 1.00 30.55  ? 349 ASP B CB  1 
ATOM   6343  C CG  . ASP B  1 352 ? 84.272  31.373  -29.157 1.00 31.49  ? 349 ASP B CG  1 
ATOM   6344  O OD1 . ASP B  1 352 ? 85.257  32.129  -29.294 1.00 36.86  ? 349 ASP B OD1 1 
ATOM   6345  O OD2 . ASP B  1 352 ? 83.716  30.798  -30.111 1.00 30.90  ? 349 ASP B OD2 1 
ATOM   6346  N N   . GLY B  1 353 ? 85.823  33.649  -26.727 1.00 34.97  ? 350 GLY B N   1 
ATOM   6347  C CA  . GLY B  1 353 ? 85.903  35.099  -26.617 1.00 35.42  ? 350 GLY B CA  1 
ATOM   6348  C C   . GLY B  1 353 ? 86.397  35.753  -27.881 1.00 38.15  ? 350 GLY B C   1 
ATOM   6349  O O   . GLY B  1 353 ? 86.861  36.887  -27.818 1.00 36.59  ? 350 GLY B O   1 
ATOM   6350  N N   . ARG B  1 354 ? 86.308  35.045  -29.013 1.00 41.81  ? 351 ARG B N   1 
ATOM   6351  C CA  . ARG B  1 354 ? 86.813  35.542  -30.285 1.00 45.60  ? 351 ARG B CA  1 
ATOM   6352  C C   . ARG B  1 354 ? 85.922  36.658  -30.769 1.00 49.31  ? 351 ARG B C   1 
ATOM   6353  O O   . ARG B  1 354 ? 86.378  37.685  -31.306 1.00 49.24  ? 351 ARG B O   1 
ATOM   6354  C CB  . ARG B  1 354 ? 86.825  34.431  -31.324 1.00 46.02  ? 351 ARG B CB  1 
ATOM   6355  C CG  . ARG B  1 354 ? 87.997  33.514  -31.177 1.00 47.01  ? 351 ARG B CG  1 
ATOM   6356  C CD  . ARG B  1 354 ? 87.881  32.384  -32.160 1.00 48.71  ? 351 ARG B CD  1 
ATOM   6357  N NE  . ARG B  1 354 ? 86.883  31.409  -31.741 1.00 45.28  ? 351 ARG B NE  1 
ATOM   6358  C CZ  . ARG B  1 354 ? 86.715  30.224  -32.318 1.00 45.40  ? 351 ARG B CZ  1 
ATOM   6359  N NH1 . ARG B  1 354 ? 87.486  29.847  -33.357 1.00 49.12  ? 351 ARG B NH1 1 
ATOM   6360  N NH2 . ARG B  1 354 ? 85.781  29.408  -31.853 1.00 40.73  ? 351 ARG B NH2 1 
ATOM   6361  N N   . GLN B  1 355 ? 84.634  36.430  -30.583 1.00 54.80  ? 352 GLN B N   1 
ATOM   6362  C CA  . GLN B  1 355 ? 83.623  37.377  -30.959 1.00 61.03  ? 352 GLN B CA  1 
ATOM   6363  C C   . GLN B  1 355 ? 83.148  37.934  -29.624 1.00 59.10  ? 352 GLN B C   1 
ATOM   6364  O O   . GLN B  1 355 ? 82.092  37.534  -29.121 1.00 54.05  ? 352 GLN B O   1 
ATOM   6365  C CB  . GLN B  1 355 ? 82.525  36.663  -31.782 1.00 65.38  ? 352 GLN B CB  1 
ATOM   6366  C CG  . GLN B  1 355 ? 81.942  37.506  -32.910 1.00 74.26  ? 352 GLN B CG  1 
ATOM   6367  C CD  . GLN B  1 355 ? 82.874  37.671  -34.120 1.00 80.41  ? 352 GLN B CD  1 
ATOM   6368  O OE1 . GLN B  1 355 ? 84.074  37.380  -34.061 1.00 76.91  ? 352 GLN B OE1 1 
ATOM   6369  N NE2 . GLN B  1 355 ? 82.311  38.145  -35.231 1.00 88.06  ? 352 GLN B NE2 1 
ATOM   6370  N N   . PRO B  1 356 ? 83.960  38.833  -29.006 1.00 63.03  ? 353 PRO B N   1 
ATOM   6371  C CA  . PRO B  1 356 ? 83.529  39.324  -27.693 1.00 63.56  ? 353 PRO B CA  1 
ATOM   6372  C C   . PRO B  1 356 ? 82.277  40.139  -27.837 1.00 71.32  ? 353 PRO B C   1 
ATOM   6373  O O   . PRO B  1 356 ? 81.341  39.909  -27.087 1.00 77.36  ? 353 PRO B O   1 
ATOM   6374  C CB  . PRO B  1 356 ? 84.689  40.189  -27.200 1.00 55.82  ? 353 PRO B CB  1 
ATOM   6375  C CG  . PRO B  1 356 ? 85.454  40.547  -28.402 1.00 58.73  ? 353 PRO B CG  1 
ATOM   6376  C CD  . PRO B  1 356 ? 85.181  39.523  -29.468 1.00 61.25  ? 353 PRO B CD  1 
ATOM   6377  N N   . LYS B  1 357 ? 82.247  41.067  -28.802 1.00 83.68  ? 354 LYS B N   1 
ATOM   6378  C CA  . LYS B  1 357 ? 81.057  41.899  -29.071 1.00 92.48  ? 354 LYS B CA  1 
ATOM   6379  C C   . LYS B  1 357 ? 80.490  42.424  -27.740 1.00 92.52  ? 354 LYS B C   1 
ATOM   6380  O O   . LYS B  1 357 ? 79.284  42.678  -27.599 1.00 83.27  ? 354 LYS B O   1 
ATOM   6381  C CB  . LYS B  1 357 ? 80.004  41.084  -29.852 1.00 98.62  ? 354 LYS B CB  1 
ATOM   6382  C CG  . LYS B  1 357 ? 79.080  41.900  -30.753 1.00 99.15  ? 354 LYS B CG  1 
ATOM   6383  C CD  . LYS B  1 357 ? 77.948  41.066  -31.363 1.00 103.87 ? 354 LYS B CD  1 
ATOM   6384  C CE  . LYS B  1 357 ? 78.425  39.893  -32.220 1.00 105.11 ? 354 LYS B CE  1 
ATOM   6385  N NZ  . LYS B  1 357 ? 79.310  40.300  -33.346 1.00 106.56 ? 354 LYS B NZ  1 
ATOM   6386  N N   . VAL B  1 358 ? 81.391  42.559  -26.766 1.00 95.68  ? 355 VAL B N   1 
ATOM   6387  C CA  . VAL B  1 358 ? 81.030  42.861  -25.389 1.00 100.31 ? 355 VAL B CA  1 
ATOM   6388  C C   . VAL B  1 358 ? 80.786  44.373  -25.355 1.00 91.91  ? 355 VAL B C   1 
ATOM   6389  O O   . VAL B  1 358 ? 79.730  44.796  -24.888 1.00 109.26 ? 355 VAL B O   1 
ATOM   6390  C CB  . VAL B  1 358 ? 82.084  42.327  -24.348 1.00 104.57 ? 355 VAL B CB  1 
ATOM   6391  C CG1 . VAL B  1 358 ? 82.186  43.221  -23.126 1.00 100.91 ? 355 VAL B CG1 1 
ATOM   6392  C CG2 . VAL B  1 358 ? 81.763  40.897  -23.900 1.00 103.59 ? 355 VAL B CG2 1 
ATOM   6393  N N   . PRO B  1 359 ? 81.741  45.186  -25.866 1.00 73.86  ? 356 PRO B N   1 
ATOM   6394  C CA  . PRO B  1 359 ? 81.393  46.587  -26.085 1.00 69.06  ? 356 PRO B CA  1 
ATOM   6395  C C   . PRO B  1 359 ? 80.475  46.697  -27.294 1.00 67.20  ? 356 PRO B C   1 
ATOM   6396  O O   . PRO B  1 359 ? 80.645  45.880  -28.203 1.00 70.51  ? 356 PRO B O   1 
ATOM   6397  C CB  . PRO B  1 359 ? 82.740  47.244  -26.377 1.00 69.72  ? 356 PRO B CB  1 
ATOM   6398  C CG  . PRO B  1 359 ? 83.777  46.297  -25.884 1.00 67.04  ? 356 PRO B CG  1 
ATOM   6399  C CD  . PRO B  1 359 ? 83.177  44.950  -26.098 1.00 69.21  ? 356 PRO B CD  1 
ATOM   6400  N N   . ASN B  1 360 ? 79.529  47.639  -27.398 1.00 63.60  ? 357 ASN B N   1 
ATOM   6401  C CA  . ASN B  1 360 ? 79.282  48.847  -26.584 1.00 57.34  ? 357 ASN B CA  1 
ATOM   6402  C C   . ASN B  1 360 ? 80.138  50.013  -26.973 1.00 53.80  ? 357 ASN B C   1 
ATOM   6403  O O   . ASN B  1 360 ? 81.017  50.413  -26.237 1.00 53.14  ? 357 ASN B O   1 
ATOM   6404  C CB  . ASN B  1 360 ? 79.309  48.615  -25.092 1.00 57.92  ? 357 ASN B CB  1 
ATOM   6405  C CG  . ASN B  1 360 ? 78.325  47.578  -24.684 1.00 61.63  ? 357 ASN B CG  1 
ATOM   6406  O OD1 . ASN B  1 360 ? 77.742  46.922  -25.532 1.00 65.83  ? 357 ASN B OD1 1 
ATOM   6407  N ND2 . ASN B  1 360 ? 78.095  47.441  -23.387 1.00 72.62  ? 357 ASN B ND2 1 
ATOM   6408  N N   . HIS B  1 361 ? 79.835  50.566  -28.141 1.00 54.25  ? 358 HIS B N   1 
ATOM   6409  C CA  . HIS B  1 361 ? 80.567  51.704  -28.717 1.00 56.97  ? 358 HIS B CA  1 
ATOM   6410  C C   . HIS B  1 361 ? 82.061  51.509  -28.811 1.00 50.35  ? 358 HIS B C   1 
ATOM   6411  O O   . HIS B  1 361 ? 82.818  52.450  -28.605 1.00 46.61  ? 358 HIS B O   1 
ATOM   6412  C CB  . HIS B  1 361 ? 80.275  52.958  -27.921 1.00 63.22  ? 358 HIS B CB  1 
ATOM   6413  C CG  . HIS B  1 361 ? 78.853  53.059  -27.560 1.00 71.46  ? 358 HIS B CG  1 
ATOM   6414  N ND1 . HIS B  1 361 ? 78.417  53.025  -26.257 1.00 75.29  ? 358 HIS B ND1 1 
ATOM   6415  C CD2 . HIS B  1 361 ? 77.753  53.066  -28.341 1.00 80.65  ? 358 HIS B CD2 1 
ATOM   6416  C CE1 . HIS B  1 361 ? 77.101  53.052  -26.253 1.00 84.57  ? 358 HIS B CE1 1 
ATOM   6417  N NE2 . HIS B  1 361 ? 76.676  53.085  -27.505 1.00 91.21  ? 358 HIS B NE2 1 
ATOM   6418  N N   . GLU B  1 362 ? 82.470  50.290  -29.139 1.00 45.68  ? 359 GLU B N   1 
ATOM   6419  C CA  . GLU B  1 362 ? 83.864  49.989  -29.348 1.00 43.59  ? 359 GLU B CA  1 
ATOM   6420  C C   . GLU B  1 362 ? 84.064  48.856  -30.399 1.00 44.60  ? 359 GLU B C   1 
ATOM   6421  O O   . GLU B  1 362 ? 83.999  47.685  -30.072 1.00 47.33  ? 359 GLU B O   1 
ATOM   6422  C CB  . GLU B  1 362 ? 84.572  49.717  -27.985 1.00 41.59  ? 359 GLU B CB  1 
ATOM   6423  C CG  . GLU B  1 362 ? 85.158  50.951  -27.235 1.00 39.47  ? 359 GLU B CG  1 
ATOM   6424  C CD  . GLU B  1 362 ? 84.359  51.437  -26.031 1.00 36.59  ? 359 GLU B CD  1 
ATOM   6425  O OE1 . GLU B  1 362 ? 84.543  52.584  -25.592 1.00 29.01  ? 359 GLU B OE1 1 
ATOM   6426  O OE2 . GLU B  1 362 ? 83.570  50.656  -25.488 1.00 41.99  ? 359 GLU B OE2 1 
ATOM   6427  N N   . ASN B  1 363 ? 84.285  49.237  -31.664 1.00 44.40  ? 360 ASN B N   1 
ATOM   6428  C CA  . ASN B  1 363 ? 85.035  48.413  -32.646 1.00 42.90  ? 360 ASN B CA  1 
ATOM   6429  C C   . ASN B  1 363 ? 86.600  48.667  -32.556 1.00 42.44  ? 360 ASN B C   1 
ATOM   6430  O O   . ASN B  1 363 ? 87.311  48.948  -33.547 1.00 37.90  ? 360 ASN B O   1 
ATOM   6431  C CB  . ASN B  1 363 ? 84.541  48.702  -34.060 1.00 43.62  ? 360 ASN B CB  1 
ATOM   6432  C CG  . ASN B  1 363 ? 85.142  49.994  -34.644 1.00 44.06  ? 360 ASN B CG  1 
ATOM   6433  O OD1 . ASN B  1 363 ? 85.410  50.959  -33.914 1.00 42.97  ? 360 ASN B OD1 1 
ATOM   6434  N ND2 . ASN B  1 363 ? 85.385  50.000  -35.953 1.00 41.20  ? 360 ASN B ND2 1 
ATOM   6435  N N   . GLY B  1 364 ? 87.128  48.588  -31.344 1.00 38.33  ? 361 GLY B N   1 
ATOM   6436  C CA  . GLY B  1 364 ? 88.546  48.555  -31.150 1.00 34.20  ? 361 GLY B CA  1 
ATOM   6437  C C   . GLY B  1 364 ? 88.972  47.106  -31.059 1.00 32.32  ? 361 GLY B C   1 
ATOM   6438  O O   . GLY B  1 364 ? 88.299  46.201  -31.550 1.00 30.62  ? 361 GLY B O   1 
ATOM   6439  N N   . PHE B  1 365 ? 90.084  46.892  -30.377 1.00 30.61  ? 362 PHE B N   1 
ATOM   6440  C CA  . PHE B  1 365 ? 90.867  45.695  -30.556 1.00 29.95  ? 362 PHE B CA  1 
ATOM   6441  C C   . PHE B  1 365 ? 90.636  44.757  -29.394 1.00 29.25  ? 362 PHE B C   1 
ATOM   6442  O O   . PHE B  1 365 ? 91.588  44.397  -28.686 1.00 29.39  ? 362 PHE B O   1 
ATOM   6443  C CB  . PHE B  1 365 ? 92.356  46.049  -30.665 1.00 29.86  ? 362 PHE B CB  1 
ATOM   6444  C CG  . PHE B  1 365 ? 92.639  47.273  -31.484 1.00 29.21  ? 362 PHE B CG  1 
ATOM   6445  C CD1 . PHE B  1 365 ? 91.983  47.497  -32.688 1.00 30.11  ? 362 PHE B CD1 1 
ATOM   6446  C CD2 . PHE B  1 365 ? 93.575  48.196  -31.054 1.00 28.96  ? 362 PHE B CD2 1 
ATOM   6447  C CE1 . PHE B  1 365 ? 92.239  48.636  -33.441 1.00 30.53  ? 362 PHE B CE1 1 
ATOM   6448  C CE2 . PHE B  1 365 ? 93.858  49.320  -31.808 1.00 30.05  ? 362 PHE B CE2 1 
ATOM   6449  C CZ  . PHE B  1 365 ? 93.186  49.545  -33.002 1.00 30.91  ? 362 PHE B CZ  1 
ATOM   6450  N N   . PHE B  1 366 ? 89.379  44.354  -29.220 1.00 26.95  ? 363 PHE B N   1 
ATOM   6451  C CA  . PHE B  1 366 ? 88.968  43.568  -28.047 1.00 26.88  ? 363 PHE B CA  1 
ATOM   6452  C C   . PHE B  1 366 ? 88.880  42.063  -28.286 1.00 27.38  ? 363 PHE B C   1 
ATOM   6453  O O   . PHE B  1 366 ? 88.279  41.610  -29.248 1.00 27.67  ? 363 PHE B O   1 
ATOM   6454  C CB  . PHE B  1 366 ? 87.616  44.042  -27.514 1.00 25.91  ? 363 PHE B CB  1 
ATOM   6455  C CG  . PHE B  1 366 ? 87.685  45.317  -26.733 1.00 25.06  ? 363 PHE B CG  1 
ATOM   6456  C CD1 . PHE B  1 366 ? 88.044  45.296  -25.400 1.00 24.14  ? 363 PHE B CD1 1 
ATOM   6457  C CD2 . PHE B  1 366 ? 87.380  46.534  -27.323 1.00 24.55  ? 363 PHE B CD2 1 
ATOM   6458  C CE1 . PHE B  1 366 ? 88.107  46.457  -24.664 1.00 23.51  ? 363 PHE B CE1 1 
ATOM   6459  C CE2 . PHE B  1 366 ? 87.443  47.704  -26.589 1.00 24.14  ? 363 PHE B CE2 1 
ATOM   6460  C CZ  . PHE B  1 366 ? 87.808  47.663  -25.256 1.00 23.70  ? 363 PHE B CZ  1 
ATOM   6461  N N   . VAL B  1 367 ? 89.451  41.302  -27.359 1.00 28.60  ? 364 VAL B N   1 
ATOM   6462  C CA  . VAL B  1 367 ? 89.352  39.852  -27.338 1.00 28.74  ? 364 VAL B CA  1 
ATOM   6463  C C   . VAL B  1 367 ? 88.878  39.440  -25.954 1.00 29.27  ? 364 VAL B C   1 
ATOM   6464  O O   . VAL B  1 367 ? 89.385  39.924  -24.938 1.00 28.14  ? 364 VAL B O   1 
ATOM   6465  C CB  . VAL B  1 367 ? 90.716  39.197  -27.599 1.00 29.82  ? 364 VAL B CB  1 
ATOM   6466  C CG1 . VAL B  1 367 ? 90.599  37.681  -27.617 1.00 29.48  ? 364 VAL B CG1 1 
ATOM   6467  C CG2 . VAL B  1 367 ? 91.298  39.689  -28.917 1.00 31.31  ? 364 VAL B CG2 1 
ATOM   6468  N N   . GLY B  1 368 ? 87.903  38.541  -25.924 1.00 30.41  ? 365 GLY B N   1 
ATOM   6469  C CA  . GLY B  1 368 ? 87.345  38.060  -24.667 1.00 31.10  ? 365 GLY B CA  1 
ATOM   6470  C C   . GLY B  1 368 ? 88.200  36.962  -24.071 1.00 31.56  ? 365 GLY B C   1 
ATOM   6471  O O   . GLY B  1 368 ? 89.049  36.394  -24.742 1.00 35.87  ? 365 GLY B O   1 
ATOM   6472  N N   . GLY B  1 369 ? 87.973  36.649  -22.807 1.00 30.35  ? 366 GLY B N   1 
ATOM   6473  C CA  . GLY B  1 369 ? 88.717  35.579  -22.160 1.00 30.61  ? 366 GLY B CA  1 
ATOM   6474  C C   . GLY B  1 369 ? 88.320  34.276  -22.798 1.00 30.51  ? 366 GLY B C   1 
ATOM   6475  O O   . GLY B  1 369 ? 87.139  34.020  -22.975 1.00 30.35  ? 366 GLY B O   1 
ATOM   6476  N N   . THR B  1 370 ? 89.300  33.474  -23.191 1.00 32.37  ? 367 THR B N   1 
ATOM   6477  C CA  . THR B  1 370 ? 88.997  32.159  -23.765 1.00 33.23  ? 367 THR B CA  1 
ATOM   6478  C C   . THR B  1 370 ? 89.715  31.065  -22.994 1.00 32.59  ? 367 THR B C   1 
ATOM   6479  O O   . THR B  1 370 ? 90.714  31.305  -22.313 1.00 32.42  ? 367 THR B O   1 
ATOM   6480  C CB  . THR B  1 370 ? 89.248  32.070  -25.300 1.00 32.45  ? 367 THR B CB  1 
ATOM   6481  O OG1 . THR B  1 370 ? 90.489  31.443  -25.566 1.00 35.82  ? 367 THR B OG1 1 
ATOM   6482  C CG2 . THR B  1 370 ? 89.226  33.447  -25.944 1.00 32.51  ? 367 THR B CG2 1 
ATOM   6483  N N   . LEU B  1 371 ? 89.162  29.867  -23.091 1.00 33.23  ? 368 LEU B N   1 
ATOM   6484  C CA  . LEU B  1 371 ? 89.688  28.706  -22.413 1.00 33.13  ? 368 LEU B CA  1 
ATOM   6485  C C   . LEU B  1 371 ? 89.693  27.612  -23.446 1.00 35.34  ? 368 LEU B C   1 
ATOM   6486  O O   . LEU B  1 371 ? 88.622  27.243  -23.927 1.00 41.42  ? 368 LEU B O   1 
ATOM   6487  C CB  . LEU B  1 371 ? 88.763  28.309  -21.277 1.00 32.72  ? 368 LEU B CB  1 
ATOM   6488  C CG  . LEU B  1 371 ? 89.373  27.543  -20.103 1.00 33.96  ? 368 LEU B CG  1 
ATOM   6489  C CD1 . LEU B  1 371 ? 88.287  26.957  -19.199 1.00 32.60  ? 368 LEU B CD1 1 
ATOM   6490  C CD2 . LEU B  1 371 ? 90.282  26.433  -20.589 1.00 36.92  ? 368 LEU B CD2 1 
ATOM   6491  N N   . ILE B  1 372 ? 90.871  27.103  -23.796 1.00 34.23  ? 369 ILE B N   1 
ATOM   6492  C CA  . ILE B  1 372 ? 90.992  26.016  -24.774 1.00 33.34  ? 369 ILE B CA  1 
ATOM   6493  C C   . ILE B  1 372 ? 91.343  24.744  -24.001 1.00 31.32  ? 369 ILE B C   1 
ATOM   6494  O O   . ILE B  1 372 ? 92.168  24.788  -23.101 1.00 28.91  ? 369 ILE B O   1 
ATOM   6495  C CB  . ILE B  1 372 ? 92.031  26.364  -25.856 1.00 34.27  ? 369 ILE B CB  1 
ATOM   6496  C CG1 . ILE B  1 372 ? 91.728  27.765  -26.431 1.00 34.69  ? 369 ILE B CG1 1 
ATOM   6497  C CG2 . ILE B  1 372 ? 92.042  25.293  -26.949 1.00 34.87  ? 369 ILE B CG2 1 
ATOM   6498  C CD1 . ILE B  1 372 ? 92.760  28.294  -27.417 1.00 36.22  ? 369 ILE B CD1 1 
ATOM   6499  N N   . ASP B  1 373 ? 90.696  23.626  -24.328 1.00 30.85  ? 370 ASP B N   1 
ATOM   6500  C CA  . ASP B  1 373 ? 90.956  22.343  -23.632 1.00 30.80  ? 370 ASP B CA  1 
ATOM   6501  C C   . ASP B  1 373 ? 91.328  21.224  -24.618 1.00 31.78  ? 370 ASP B C   1 
ATOM   6502  O O   . ASP B  1 373 ? 90.925  21.263  -25.773 1.00 35.18  ? 370 ASP B O   1 
ATOM   6503  C CB  . ASP B  1 373 ? 89.746  21.944  -22.769 1.00 29.28  ? 370 ASP B CB  1 
ATOM   6504  C CG  . ASP B  1 373 ? 90.079  20.867  -21.693 1.00 28.07  ? 370 ASP B CG  1 
ATOM   6505  O OD1 . ASP B  1 373 ? 91.244  20.395  -21.620 1.00 26.73  ? 370 ASP B OD1 1 
ATOM   6506  O OD2 . ASP B  1 373 ? 89.150  20.476  -20.929 1.00 23.78  ? 370 ASP B OD2 1 
ATOM   6507  N N   . HIS B  1 374 ? 92.112  20.259  -24.138 1.00 31.87  ? 371 HIS B N   1 
ATOM   6508  C CA  . HIS B  1 374 ? 92.688  19.158  -24.932 1.00 33.66  ? 371 HIS B CA  1 
ATOM   6509  C C   . HIS B  1 374 ? 93.704  19.539  -25.963 1.00 34.53  ? 371 HIS B C   1 
ATOM   6510  O O   . HIS B  1 374 ? 93.678  19.026  -27.088 1.00 38.14  ? 371 HIS B O   1 
ATOM   6511  C CB  . HIS B  1 374 ? 91.600  18.337  -25.569 1.00 33.97  ? 371 HIS B CB  1 
ATOM   6512  C CG  . HIS B  1 374 ? 90.612  17.868  -24.574 1.00 35.72  ? 371 HIS B CG  1 
ATOM   6513  N ND1 . HIS B  1 374 ? 89.349  18.405  -24.481 1.00 38.08  ? 371 HIS B ND1 1 
ATOM   6514  C CD2 . HIS B  1 374 ? 90.724  16.976  -23.560 1.00 36.10  ? 371 HIS B CD2 1 
ATOM   6515  C CE1 . HIS B  1 374 ? 88.704  17.829  -23.478 1.00 35.82  ? 371 HIS B CE1 1 
ATOM   6516  N NE2 . HIS B  1 374 ? 89.515  16.960  -22.903 1.00 34.77  ? 371 HIS B NE2 1 
ATOM   6517  N N   . VAL B  1 375 ? 94.633  20.391  -25.563 1.00 34.75  ? 372 VAL B N   1 
ATOM   6518  C CA  . VAL B  1 375 ? 95.610  20.873  -26.498 1.00 37.68  ? 372 VAL B CA  1 
ATOM   6519  C C   . VAL B  1 375 ? 96.745  19.855  -26.383 1.00 37.98  ? 372 VAL B C   1 
ATOM   6520  O O   . VAL B  1 375 ? 96.839  19.154  -25.373 1.00 37.34  ? 372 VAL B O   1 
ATOM   6521  C CB  . VAL B  1 375 ? 95.944  22.386  -26.279 1.00 39.05  ? 372 VAL B CB  1 
ATOM   6522  C CG1 . VAL B  1 375 ? 94.706  23.162  -25.830 1.00 37.17  ? 372 VAL B CG1 1 
ATOM   6523  C CG2 . VAL B  1 375 ? 97.033  22.613  -25.278 1.00 39.55  ? 372 VAL B CG2 1 
ATOM   6524  N N   . THR B  1 376 ? 97.552  19.743  -27.434 1.00 38.72  ? 373 THR B N   1 
ATOM   6525  C CA  . THR B  1 376 ? 98.636  18.778  -27.492 1.00 38.17  ? 373 THR B CA  1 
ATOM   6526  C C   . THR B  1 376 ? 99.908  19.492  -27.878 1.00 38.16  ? 373 THR B C   1 
ATOM   6527  O O   . THR B  1 376 ? 99.836  20.621  -28.352 1.00 40.54  ? 373 THR B O   1 
ATOM   6528  C CB  . THR B  1 376 ? 98.327  17.698  -28.531 1.00 39.48  ? 373 THR B CB  1 
ATOM   6529  O OG1 . THR B  1 376 ? 98.298  18.276  -29.855 1.00 41.83  ? 373 THR B OG1 1 
ATOM   6530  C CG2 . THR B  1 376 ? 96.992  17.005  -28.209 1.00 35.63  ? 373 THR B CG2 1 
ATOM   6531  N N   . PRO B  1 377 ? 101.072 18.848  -27.682 1.00 40.19  ? 374 PRO B N   1 
ATOM   6532  C CA  . PRO B  1 377 ? 102.347 19.491  -28.041 1.00 43.55  ? 374 PRO B CA  1 
ATOM   6533  C C   . PRO B  1 377 ? 102.555 19.813  -29.520 1.00 46.13  ? 374 PRO B C   1 
ATOM   6534  O O   . PRO B  1 377 ? 103.324 20.727  -29.836 1.00 50.06  ? 374 PRO B O   1 
ATOM   6535  C CB  . PRO B  1 377 ? 103.385 18.483  -27.556 1.00 42.34  ? 374 PRO B CB  1 
ATOM   6536  C CG  . PRO B  1 377 ? 102.714 17.821  -26.400 1.00 39.84  ? 374 PRO B CG  1 
ATOM   6537  C CD  . PRO B  1 377 ? 101.283 17.687  -26.801 1.00 38.47  ? 374 PRO B CD  1 
ATOM   6538  N N   . GLU B  1 378 ? 101.856 19.100  -30.399 1.00 49.88  ? 375 GLU B N   1 
ATOM   6539  C CA  . GLU B  1 378 ? 102.010 19.304  -31.856 1.00 58.04  ? 375 GLU B CA  1 
ATOM   6540  C C   . GLU B  1 378 ? 101.327 20.571  -32.395 1.00 62.82  ? 375 GLU B C   1 
ATOM   6541  O O   . GLU B  1 378 ? 101.730 21.070  -33.448 1.00 73.77  ? 375 GLU B O   1 
ATOM   6542  C CB  . GLU B  1 378 ? 101.600 18.078  -32.702 1.00 56.53  ? 375 GLU B CB  1 
ATOM   6543  C CG  . GLU B  1 378 ? 100.536 17.172  -32.120 1.00 55.15  ? 375 GLU B CG  1 
ATOM   6544  C CD  . GLU B  1 378 ? 101.059 16.290  -30.989 1.00 55.96  ? 375 GLU B CD  1 
ATOM   6545  O OE1 . GLU B  1 378 ? 100.284 15.997  -30.079 1.00 50.70  ? 375 GLU B OE1 1 
ATOM   6546  O OE2 . GLU B  1 378 ? 102.248 15.911  -30.980 1.00 58.02  ? 375 GLU B OE2 1 
ATOM   6547  N N   . MET B  1 379 ? 100.336 21.098  -31.676 1.00 61.75  ? 376 MET B N   1 
ATOM   6548  C CA  . MET B  1 379 ? 99.579  22.270  -32.130 1.00 60.24  ? 376 MET B CA  1 
ATOM   6549  C C   . MET B  1 379 ? 100.444 23.535  -32.119 1.00 68.05  ? 376 MET B C   1 
ATOM   6550  O O   . MET B  1 379 ? 101.199 23.756  -31.168 1.00 75.61  ? 376 MET B O   1 
ATOM   6551  C CB  . MET B  1 379 ? 98.357  22.479  -31.245 1.00 55.58  ? 376 MET B CB  1 
ATOM   6552  C CG  . MET B  1 379 ? 97.414  21.277  -31.161 1.00 52.46  ? 376 MET B CG  1 
ATOM   6553  S SD  . MET B  1 379 ? 95.929  21.532  -30.126 1.00 48.97  ? 376 MET B SD  1 
ATOM   6554  C CE  . MET B  1 379 ? 95.140  19.923  -30.097 1.00 42.80  ? 376 MET B CE  1 
ATOM   6555  N N   . THR B  1 380 ? 100.345 24.351  -33.170 1.00 72.62  ? 377 THR B N   1 
ATOM   6556  C CA  . THR B  1 380 ? 101.214 25.530  -33.338 1.00 79.41  ? 377 THR B CA  1 
ATOM   6557  C C   . THR B  1 380 ? 100.921 26.549  -32.232 1.00 82.45  ? 377 THR B C   1 
ATOM   6558  O O   . THR B  1 380 ? 101.830 27.225  -31.717 1.00 82.92  ? 377 THR B O   1 
ATOM   6559  C CB  . THR B  1 380 ? 101.016 26.191  -34.728 1.00 85.15  ? 377 THR B CB  1 
ATOM   6560  O OG1 . THR B  1 380 ? 100.862 25.179  -35.737 1.00 88.62  ? 377 THR B OG1 1 
ATOM   6561  C CG2 . THR B  1 380 ? 102.200 27.131  -35.077 1.00 82.67  ? 377 THR B CG2 1 
ATOM   6562  N N   . SER B  1 381 ? 99.635  26.624  -31.877 1.00 84.47  ? 378 SER B N   1 
ATOM   6563  C CA  . SER B  1 381 ? 99.112  27.470  -30.781 1.00 82.17  ? 378 SER B CA  1 
ATOM   6564  C C   . SER B  1 381 ? 99.636  27.098  -29.371 1.00 70.92  ? 378 SER B C   1 
ATOM   6565  O O   . SER B  1 381 ? 99.580  27.907  -28.429 1.00 74.74  ? 378 SER B O   1 
ATOM   6566  C CB  . SER B  1 381 ? 97.572  27.422  -30.799 1.00 83.62  ? 378 SER B CB  1 
ATOM   6567  O OG  . SER B  1 381 ? 97.089  26.079  -30.920 1.00 78.15  ? 378 SER B OG  1 
ATOM   6568  N N   . TYR B  1 382 ? 100.097 25.858  -29.225 1.00 55.50  ? 379 TYR B N   1 
ATOM   6569  C CA  . TYR B  1 382 ? 100.858 25.450  -28.062 1.00 46.37  ? 379 TYR B CA  1 
ATOM   6570  C C   . TYR B  1 382 ? 102.325 25.916  -28.157 1.00 51.28  ? 379 TYR B C   1 
ATOM   6571  O O   . TYR B  1 382 ? 102.882 26.414  -27.176 1.00 50.83  ? 379 TYR B O   1 
ATOM   6572  C CB  . TYR B  1 382 ? 100.772 23.934  -27.854 1.00 40.46  ? 379 TYR B CB  1 
ATOM   6573  C CG  . TYR B  1 382 ? 101.685 23.511  -26.746 1.00 37.08  ? 379 TYR B CG  1 
ATOM   6574  C CD1 . TYR B  1 382 ? 101.310 23.652  -25.411 1.00 34.39  ? 379 TYR B CD1 1 
ATOM   6575  C CD2 . TYR B  1 382 ? 102.973 23.064  -27.022 1.00 35.50  ? 379 TYR B CD2 1 
ATOM   6576  C CE1 . TYR B  1 382 ? 102.185 23.321  -24.388 1.00 32.88  ? 379 TYR B CE1 1 
ATOM   6577  C CE2 . TYR B  1 382 ? 103.856 22.743  -26.008 1.00 33.43  ? 379 TYR B CE2 1 
ATOM   6578  C CZ  . TYR B  1 382 ? 103.465 22.869  -24.696 1.00 32.32  ? 379 TYR B CZ  1 
ATOM   6579  O OH  . TYR B  1 382 ? 104.353 22.537  -23.702 1.00 29.80  ? 379 TYR B OH  1 
ATOM   6580  N N   . GLN B  1 383 ? 102.943 25.755  -29.329 1.00 56.98  ? 380 GLN B N   1 
ATOM   6581  C CA  . GLN B  1 383 ? 104.357 26.123  -29.529 1.00 61.29  ? 380 GLN B CA  1 
ATOM   6582  C C   . GLN B  1 383 ? 104.653 27.640  -29.438 1.00 59.29  ? 380 GLN B C   1 
ATOM   6583  O O   . GLN B  1 383 ? 105.577 28.032  -28.716 1.00 57.18  ? 380 GLN B O   1 
ATOM   6584  C CB  . GLN B  1 383 ? 104.876 25.550  -30.859 1.00 67.43  ? 380 GLN B CB  1 
ATOM   6585  C CG  . GLN B  1 383 ? 104.923 24.021  -30.921 1.00 72.34  ? 380 GLN B CG  1 
ATOM   6586  C CD  . GLN B  1 383 ? 105.005 23.472  -32.352 1.00 79.25  ? 380 GLN B CD  1 
ATOM   6587  O OE1 . GLN B  1 383 ? 105.523 24.136  -33.256 1.00 86.84  ? 380 GLN B OE1 1 
ATOM   6588  N NE2 . GLN B  1 383 ? 104.494 22.253  -32.562 1.00 73.66  ? 380 GLN B NE2 1 
ATOM   6589  N N   . GLU B  1 384 ? 103.878 28.474  -30.148 1.00 58.89  ? 381 GLU B N   1 
ATOM   6590  C CA  . GLU B  1 384 ? 104.140 29.943  -30.238 1.00 58.44  ? 381 GLU B CA  1 
ATOM   6591  C C   . GLU B  1 384 ? 103.426 30.778  -29.159 1.00 52.87  ? 381 GLU B C   1 
ATOM   6592  O O   . GLU B  1 384 ? 102.350 30.417  -28.694 1.00 46.28  ? 381 GLU B O   1 
ATOM   6593  C CB  . GLU B  1 384 ? 103.746 30.493  -31.615 1.00 61.54  ? 381 GLU B CB  1 
ATOM   6594  C CG  . GLU B  1 384 ? 104.585 30.020  -32.799 1.00 66.21  ? 381 GLU B CG  1 
ATOM   6595  C CD  . GLU B  1 384 ? 103.955 30.404  -34.143 1.00 72.17  ? 381 GLU B CD  1 
ATOM   6596  O OE1 . GLU B  1 384 ? 103.435 31.536  -34.262 1.00 73.64  ? 381 GLU B OE1 1 
ATOM   6597  O OE2 . GLU B  1 384 ? 103.969 29.584  -35.089 1.00 73.77  ? 381 GLU B OE2 1 
ATOM   6598  N N   . GLU B  1 385 ? 104.028 31.905  -28.787 1.00 51.72  ? 382 GLU B N   1 
ATOM   6599  C CA  . GLU B  1 385 ? 103.442 32.807  -27.783 1.00 54.00  ? 382 GLU B CA  1 
ATOM   6600  C C   . GLU B  1 385 ? 102.225 33.514  -28.357 1.00 51.10  ? 382 GLU B C   1 
ATOM   6601  O O   . GLU B  1 385 ? 102.331 34.249  -29.339 1.00 51.95  ? 382 GLU B O   1 
ATOM   6602  C CB  . GLU B  1 385 ? 104.462 33.862  -27.300 1.00 57.90  ? 382 GLU B CB  1 
ATOM   6603  C CG  . GLU B  1 385 ? 103.953 34.803  -26.200 1.00 57.23  ? 382 GLU B CG  1 
ATOM   6604  C CD  . GLU B  1 385 ? 105.056 35.650  -25.577 1.00 56.20  ? 382 GLU B CD  1 
ATOM   6605  O OE1 . GLU B  1 385 ? 105.164 35.663  -24.332 1.00 56.38  ? 382 GLU B OE1 1 
ATOM   6606  O OE2 . GLU B  1 385 ? 105.816 36.299  -26.322 1.00 53.65  ? 382 GLU B OE2 1 
ATOM   6607  N N   . ILE B  1 386 ? 101.073 33.292  -27.735 1.00 47.87  ? 383 ILE B N   1 
ATOM   6608  C CA  . ILE B  1 386 ? 99.838  33.926  -28.162 1.00 45.33  ? 383 ILE B CA  1 
ATOM   6609  C C   . ILE B  1 386 ? 99.905  35.392  -27.755 1.00 38.26  ? 383 ILE B C   1 
ATOM   6610  O O   . ILE B  1 386 ? 99.773  36.280  -28.582 1.00 40.49  ? 383 ILE B O   1 
ATOM   6611  C CB  . ILE B  1 386 ? 98.575  33.220  -27.577 1.00 49.04  ? 383 ILE B CB  1 
ATOM   6612  C CG1 . ILE B  1 386 ? 98.506  31.744  -28.047 1.00 48.75  ? 383 ILE B CG1 1 
ATOM   6613  C CG2 . ILE B  1 386 ? 97.305  33.943  -28.034 1.00 52.48  ? 383 ILE B CG2 1 
ATOM   6614  C CD1 . ILE B  1 386 ? 97.408  30.864  -27.451 1.00 46.11  ? 383 ILE B CD1 1 
ATOM   6615  N N   . PHE B  1 387 ? 100.128 35.625  -26.479 1.00 32.53  ? 384 PHE B N   1 
ATOM   6616  C CA  . PHE B  1 387 ? 100.182 36.975  -25.919 1.00 32.07  ? 384 PHE B CA  1 
ATOM   6617  C C   . PHE B  1 387 ? 98.790  37.618  -25.965 1.00 28.84  ? 384 PHE B C   1 
ATOM   6618  O O   . PHE B  1 387 ? 98.632  38.792  -26.260 1.00 28.85  ? 384 PHE B O   1 
ATOM   6619  C CB  . PHE B  1 387 ? 101.259 37.830  -26.617 1.00 33.56  ? 384 PHE B CB  1 
ATOM   6620  C CG  . PHE B  1 387 ? 102.068 38.705  -25.681 1.00 35.59  ? 384 PHE B CG  1 
ATOM   6621  C CD1 . PHE B  1 387 ? 103.043 38.161  -24.837 1.00 33.34  ? 384 PHE B CD1 1 
ATOM   6622  C CD2 . PHE B  1 387 ? 101.907 40.093  -25.693 1.00 38.89  ? 384 PHE B CD2 1 
ATOM   6623  C CE1 . PHE B  1 387 ? 103.810 38.975  -24.004 1.00 33.81  ? 384 PHE B CE1 1 
ATOM   6624  C CE2 . PHE B  1 387 ? 102.677 40.915  -24.858 1.00 38.51  ? 384 PHE B CE2 1 
ATOM   6625  C CZ  . PHE B  1 387 ? 103.623 40.352  -24.010 1.00 36.03  ? 384 PHE B CZ  1 
ATOM   6626  N N   . GLY B  1 388 ? 97.785  36.818  -25.635 1.00 25.78  ? 385 GLY B N   1 
ATOM   6627  C CA  . GLY B  1 388 ? 96.425  37.287  -25.448 1.00 24.04  ? 385 GLY B CA  1 
ATOM   6628  C C   . GLY B  1 388 ? 95.721  36.580  -24.284 1.00 22.73  ? 385 GLY B C   1 
ATOM   6629  O O   . GLY B  1 388 ? 96.337  35.805  -23.547 1.00 21.57  ? 385 GLY B O   1 
ATOM   6630  N N   . PRO B  1 389 ? 94.412  36.843  -24.107 1.00 21.11  ? 386 PRO B N   1 
ATOM   6631  C CA  . PRO B  1 389 ? 93.722  36.331  -22.948 1.00 20.19  ? 386 PRO B CA  1 
ATOM   6632  C C   . PRO B  1 389 ? 93.182  34.964  -23.206 1.00 20.53  ? 386 PRO B C   1 
ATOM   6633  O O   . PRO B  1 389 ? 91.960  34.772  -23.271 1.00 19.50  ? 386 PRO B O   1 
ATOM   6634  C CB  . PRO B  1 389 ? 92.591  37.337  -22.732 1.00 20.39  ? 386 PRO B CB  1 
ATOM   6635  C CG  . PRO B  1 389 ? 92.427  38.081  -24.013 1.00 20.20  ? 386 PRO B CG  1 
ATOM   6636  C CD  . PRO B  1 389 ? 93.544  37.714  -24.927 1.00 20.68  ? 386 PRO B CD  1 
ATOM   6637  N N   . VAL B  1 390 ? 94.099  34.009  -23.318 1.00 20.83  ? 387 VAL B N   1 
ATOM   6638  C CA  . VAL B  1 390 ? 93.750  32.640  -23.642 1.00 21.07  ? 387 VAL B CA  1 
ATOM   6639  C C   . VAL B  1 390 ? 94.475  31.716  -22.706 1.00 21.62  ? 387 VAL B C   1 
ATOM   6640  O O   . VAL B  1 390 ? 95.671  31.844  -22.535 1.00 21.24  ? 387 VAL B O   1 
ATOM   6641  C CB  . VAL B  1 390 ? 94.171  32.296  -25.068 1.00 20.88  ? 387 VAL B CB  1 
ATOM   6642  C CG1 . VAL B  1 390 ? 93.615  30.954  -25.480 1.00 21.08  ? 387 VAL B CG1 1 
ATOM   6643  C CG2 . VAL B  1 390 ? 93.689  33.360  -26.024 1.00 20.99  ? 387 VAL B CG2 1 
ATOM   6644  N N   . LEU B  1 391 ? 93.741  30.779  -22.119 1.00 23.41  ? 388 LEU B N   1 
ATOM   6645  C CA  . LEU B  1 391 ? 94.317  29.780  -21.233 1.00 24.69  ? 388 LEU B CA  1 
ATOM   6646  C C   . LEU B  1 391 ? 94.086  28.426  -21.857 1.00 25.64  ? 388 LEU B C   1 
ATOM   6647  O O   . LEU B  1 391 ? 92.963  28.079  -22.161 1.00 26.83  ? 388 LEU B O   1 
ATOM   6648  C CB  . LEU B  1 391 ? 93.665  29.834  -19.857 1.00 25.04  ? 388 LEU B CB  1 
ATOM   6649  C CG  . LEU B  1 391 ? 94.195  28.850  -18.800 1.00 26.51  ? 388 LEU B CG  1 
ATOM   6650  C CD1 . LEU B  1 391 ? 95.708  28.919  -18.583 1.00 27.01  ? 388 LEU B CD1 1 
ATOM   6651  C CD2 . LEU B  1 391 ? 93.491  29.089  -17.470 1.00 26.73  ? 388 LEU B CD2 1 
ATOM   6652  N N   . GLN B  1 392 ? 95.161  27.674  -22.048 1.00 26.20  ? 389 GLN B N   1 
ATOM   6653  C CA  . GLN B  1 392 ? 95.114  26.373  -22.674 1.00 25.63  ? 389 GLN B CA  1 
ATOM   6654  C C   . GLN B  1 392 ? 95.328  25.328  -21.609 1.00 24.61  ? 389 GLN B C   1 
ATOM   6655  O O   . GLN B  1 392 ? 96.102  25.544  -20.684 1.00 24.72  ? 389 GLN B O   1 
ATOM   6656  C CB  . GLN B  1 392 ? 96.226  26.259  -23.704 1.00 27.44  ? 389 GLN B CB  1 
ATOM   6657  C CG  . GLN B  1 392 ? 95.947  26.961  -25.021 1.00 28.24  ? 389 GLN B CG  1 
ATOM   6658  C CD  . GLN B  1 392 ? 97.150  26.917  -25.949 1.00 28.79  ? 389 GLN B CD  1 
ATOM   6659  O OE1 . GLN B  1 392 ? 98.264  27.248  -25.551 1.00 28.36  ? 389 GLN B OE1 1 
ATOM   6660  N NE2 . GLN B  1 392 ? 96.925  26.514  -27.197 1.00 30.49  ? 389 GLN B NE2 1 
ATOM   6661  N N   . VAL B  1 393 ? 94.650  24.195  -21.745 1.00 23.79  ? 390 VAL B N   1 
ATOM   6662  C CA  . VAL B  1 393 ? 94.810  23.095  -20.817 1.00 23.17  ? 390 VAL B CA  1 
ATOM   6663  C C   . VAL B  1 393 ? 95.338  21.862  -21.506 1.00 23.58  ? 390 VAL B C   1 
ATOM   6664  O O   . VAL B  1 393 ? 94.697  21.304  -22.361 1.00 23.05  ? 390 VAL B O   1 
ATOM   6665  C CB  . VAL B  1 393 ? 93.503  22.707  -20.146 1.00 23.50  ? 390 VAL B CB  1 
ATOM   6666  C CG1 . VAL B  1 393 ? 93.762  21.655  -19.083 1.00 23.93  ? 390 VAL B CG1 1 
ATOM   6667  C CG2 . VAL B  1 393 ? 92.857  23.912  -19.490 1.00 24.36  ? 390 VAL B CG2 1 
ATOM   6668  N N   . VAL B  1 394 ? 96.505  21.416  -21.078 1.00 25.43  ? 391 VAL B N   1 
ATOM   6669  C CA  . VAL B  1 394 ? 97.112  20.184  -21.569 1.00 26.73  ? 391 VAL B CA  1 
ATOM   6670  C C   . VAL B  1 394 ? 96.993  19.135  -20.466 1.00 27.32  ? 391 VAL B C   1 
ATOM   6671  O O   . VAL B  1 394 ? 97.285  19.420  -19.315 1.00 27.29  ? 391 VAL B O   1 
ATOM   6672  C CB  . VAL B  1 394 ? 98.606  20.408  -21.928 1.00 27.03  ? 391 VAL B CB  1 
ATOM   6673  C CG1 . VAL B  1 394 ? 99.249  19.179  -22.557 1.00 26.98  ? 391 VAL B CG1 1 
ATOM   6674  C CG2 . VAL B  1 394 ? 98.739  21.527  -22.910 1.00 26.64  ? 391 VAL B CG2 1 
ATOM   6675  N N   . ARG B  1 395 ? 96.560  17.927  -20.818 1.00 29.09  ? 392 ARG B N   1 
ATOM   6676  C CA  . ARG B  1 395 ? 96.503  16.818  -19.854 1.00 29.40  ? 392 ARG B CA  1 
ATOM   6677  C C   . ARG B  1 395 ? 97.624  15.818  -20.069 1.00 28.05  ? 392 ARG B C   1 
ATOM   6678  O O   . ARG B  1 395 ? 97.888  15.409  -21.188 1.00 27.58  ? 392 ARG B O   1 
ATOM   6679  C CB  . ARG B  1 395 ? 95.166  16.111  -19.921 1.00 30.15  ? 392 ARG B CB  1 
ATOM   6680  C CG  . ARG B  1 395 ? 94.040  16.989  -19.426 1.00 31.87  ? 392 ARG B CG  1 
ATOM   6681  C CD  . ARG B  1 395 ? 92.803  16.755  -20.262 1.00 33.63  ? 392 ARG B CD  1 
ATOM   6682  N NE  . ARG B  1 395 ? 91.727  17.702  -19.953 1.00 34.42  ? 392 ARG B NE  1 
ATOM   6683  C CZ  . ARG B  1 395 ? 90.698  17.461  -19.142 1.00 34.07  ? 392 ARG B CZ  1 
ATOM   6684  N NH1 . ARG B  1 395 ? 89.768  18.386  -18.950 1.00 32.52  ? 392 ARG B NH1 1 
ATOM   6685  N NH2 . ARG B  1 395 ? 90.585  16.295  -18.532 1.00 34.96  ? 392 ARG B NH2 1 
ATOM   6686  N N   . VAL B  1 396 ? 98.264  15.433  -18.972 1.00 27.03  ? 393 VAL B N   1 
ATOM   6687  C CA  . VAL B  1 396 ? 99.342  14.453  -18.982 1.00 26.03  ? 393 VAL B CA  1 
ATOM   6688  C C   . VAL B  1 396 ? 99.098  13.418  -17.886 1.00 25.87  ? 393 VAL B C   1 
ATOM   6689  O O   . VAL B  1 396 ? 98.268  13.619  -16.980 1.00 24.23  ? 393 VAL B O   1 
ATOM   6690  C CB  . VAL B  1 396 ? 100.723 15.121  -18.780 1.00 25.78  ? 393 VAL B CB  1 
ATOM   6691  C CG1 . VAL B  1 396 ? 101.040 16.058  -19.935 1.00 24.89  ? 393 VAL B CG1 1 
ATOM   6692  C CG2 . VAL B  1 396 ? 100.791 15.870  -17.447 1.00 25.91  ? 393 VAL B CG2 1 
ATOM   6693  N N   . ALA B  1 397 ? 99.849  12.320  -17.974 1.00 26.60  ? 394 ALA B N   1 
ATOM   6694  C CA  . ALA B  1 397 ? 99.700  11.179  -17.053 1.00 26.53  ? 394 ALA B CA  1 
ATOM   6695  C C   . ALA B  1 397 ? 100.329 11.424  -15.679 1.00 26.85  ? 394 ALA B C   1 
ATOM   6696  O O   . ALA B  1 397 ? 99.756  11.089  -14.645 1.00 24.31  ? 394 ALA B O   1 
ATOM   6697  C CB  . ALA B  1 397 ? 100.316 9.951   -17.678 1.00 25.98  ? 394 ALA B CB  1 
ATOM   6698  N N   . THR B  1 398 ? 101.520 12.004  -15.689 1.00 28.71  ? 395 THR B N   1 
ATOM   6699  C CA  . THR B  1 398 ? 102.309 12.133  -14.482 1.00 29.44  ? 395 THR B CA  1 
ATOM   6700  C C   . THR B  1 398 ? 103.039 13.490  -14.414 1.00 26.15  ? 395 THR B C   1 
ATOM   6701  O O   . THR B  1 398 ? 103.223 14.147  -15.414 1.00 25.26  ? 395 THR B O   1 
ATOM   6702  C CB  . THR B  1 398 ? 103.256 10.916  -14.378 1.00 30.95  ? 395 THR B CB  1 
ATOM   6703  O OG1 . THR B  1 398 ? 103.937 10.943  -13.123 1.00 39.61  ? 395 THR B OG1 1 
ATOM   6704  C CG2 . THR B  1 398 ? 104.267 10.883  -15.503 1.00 30.40  ? 395 THR B CG2 1 
ATOM   6705  N N   . MET B  1 399 ? 103.421 13.900  -13.216 1.00 24.64  ? 396 MET B N   1 
ATOM   6706  C CA  . MET B  1 399 ? 104.184 15.144  -12.992 1.00 24.60  ? 396 MET B CA  1 
ATOM   6707  C C   . MET B  1 399 ? 105.438 15.256  -13.857 1.00 24.15  ? 396 MET B C   1 
ATOM   6708  O O   . MET B  1 399 ? 105.714 16.286  -14.465 1.00 23.17  ? 396 MET B O   1 
ATOM   6709  C CB  . MET B  1 399 ? 104.609 15.238  -11.518 1.00 24.16  ? 396 MET B CB  1 
ATOM   6710  C CG  . MET B  1 399 ? 105.233 16.553  -11.113 1.00 23.60  ? 396 MET B CG  1 
ATOM   6711  S SD  . MET B  1 399 ? 105.650 16.635  -9.359  1.00 24.91  ? 396 MET B SD  1 
ATOM   6712  C CE  . MET B  1 399 ? 106.735 18.042  -9.435  1.00 25.40  ? 396 MET B CE  1 
ATOM   6713  N N   . GLN B  1 400 ? 106.214 14.191  -13.895 1.00 25.13  ? 397 GLN B N   1 
ATOM   6714  C CA  . GLN B  1 400 ? 107.408 14.189  -14.718 1.00 26.23  ? 397 GLN B CA  1 
ATOM   6715  C C   . GLN B  1 400 ? 107.101 14.481  -16.202 1.00 25.48  ? 397 GLN B C   1 
ATOM   6716  O O   . GLN B  1 400 ? 107.863 15.149  -16.873 1.00 24.02  ? 397 GLN B O   1 
ATOM   6717  C CB  . GLN B  1 400 ? 108.167 12.865  -14.553 1.00 27.02  ? 397 GLN B CB  1 
ATOM   6718  C CG  . GLN B  1 400 ? 109.548 12.846  -15.201 1.00 26.57  ? 397 GLN B CG  1 
ATOM   6719  C CD  . GLN B  1 400 ? 110.500 13.824  -14.545 1.00 26.34  ? 397 GLN B CD  1 
ATOM   6720  O OE1 . GLN B  1 400 ? 110.739 13.773  -13.327 1.00 25.45  ? 397 GLN B OE1 1 
ATOM   6721  N NE2 . GLN B  1 400 ? 111.039 14.734  -15.343 1.00 26.00  ? 397 GLN B NE2 1 
ATOM   6722  N N   . ASP B  1 401 ? 105.970 14.000  -16.693 1.00 26.91  ? 398 ASP B N   1 
ATOM   6723  C CA  . ASP B  1 401 ? 105.573 14.248  -18.076 1.00 28.37  ? 398 ASP B CA  1 
ATOM   6724  C C   . ASP B  1 401 ? 105.328 15.729  -18.271 1.00 27.24  ? 398 ASP B C   1 
ATOM   6725  O O   . ASP B  1 401 ? 105.773 16.308  -19.273 1.00 26.93  ? 398 ASP B O   1 
ATOM   6726  C CB  . ASP B  1 401 ? 104.327 13.429  -18.456 1.00 30.17  ? 398 ASP B CB  1 
ATOM   6727  C CG  . ASP B  1 401 ? 104.611 11.924  -18.544 1.00 30.76  ? 398 ASP B CG  1 
ATOM   6728  O OD1 . ASP B  1 401 ? 105.787 11.522  -18.487 1.00 32.38  ? 398 ASP B OD1 1 
ATOM   6729  O OD2 . ASP B  1 401 ? 103.655 11.132  -18.655 1.00 30.76  ? 398 ASP B OD2 1 
ATOM   6730  N N   . ALA B  1 402 ? 104.651 16.326  -17.290 1.00 25.66  ? 399 ALA B N   1 
ATOM   6731  C CA  . ALA B  1 402 ? 104.477 17.768  -17.223 1.00 25.27  ? 399 ALA B CA  1 
ATOM   6732  C C   . ALA B  1 402 ? 105.798 18.495  -17.284 1.00 25.13  ? 399 ALA B C   1 
ATOM   6733  O O   . ALA B  1 402 ? 105.996 19.363  -18.136 1.00 25.36  ? 399 ALA B O   1 
ATOM   6734  C CB  . ALA B  1 402 ? 103.750 18.158  -15.957 1.00 25.76  ? 399 ALA B CB  1 
ATOM   6735  N N   . MET B  1 403 ? 106.706 18.138  -16.385 1.00 25.07  ? 400 MET B N   1 
ATOM   6736  C CA  . MET B  1 403 ? 108.011 18.798  -16.348 1.00 25.26  ? 400 MET B CA  1 
ATOM   6737  C C   . MET B  1 403 ? 108.784 18.607  -17.621 1.00 24.94  ? 400 MET B C   1 
ATOM   6738  O O   . MET B  1 403 ? 109.442 19.541  -18.070 1.00 26.89  ? 400 MET B O   1 
ATOM   6739  C CB  . MET B  1 403 ? 108.853 18.322  -15.182 1.00 25.28  ? 400 MET B CB  1 
ATOM   6740  C CG  . MET B  1 403 ? 108.451 18.984  -13.887 1.00 25.93  ? 400 MET B CG  1 
ATOM   6741  S SD  . MET B  1 403 ? 109.548 18.500  -12.578 1.00 26.82  ? 400 MET B SD  1 
ATOM   6742  C CE  . MET B  1 403 ? 108.944 16.822  -12.509 1.00 27.82  ? 400 MET B CE  1 
ATOM   6743  N N   . ASP B  1 404 ? 108.699 17.417  -18.204 1.00 24.82  ? 401 ASP B N   1 
ATOM   6744  C CA  . ASP B  1 404 ? 109.443 17.114  -19.440 1.00 25.96  ? 401 ASP B CA  1 
ATOM   6745  C C   . ASP B  1 404 ? 108.914 17.998  -20.558 1.00 26.27  ? 401 ASP B C   1 
ATOM   6746  O O   . ASP B  1 404 ? 109.693 18.518  -21.366 1.00 25.46  ? 401 ASP B O   1 
ATOM   6747  C CB  . ASP B  1 404 ? 109.302 15.635  -19.872 1.00 26.41  ? 401 ASP B CB  1 
ATOM   6748  C CG  . ASP B  1 404 ? 110.123 14.648  -19.024 1.00 26.88  ? 401 ASP B CG  1 
ATOM   6749  O OD1 . ASP B  1 404 ? 110.884 15.024  -18.105 1.00 26.63  ? 401 ASP B OD1 1 
ATOM   6750  O OD2 . ASP B  1 404 ? 109.973 13.438  -19.289 1.00 29.15  ? 401 ASP B OD2 1 
ATOM   6751  N N   . LEU B  1 405 ? 107.582 18.157  -20.583 1.00 26.76  ? 402 LEU B N   1 
ATOM   6752  C CA  . LEU B  1 405 ? 106.910 18.987  -21.565 1.00 25.65  ? 402 LEU B CA  1 
ATOM   6753  C C   . LEU B  1 405 ? 107.371 20.424  -21.431 1.00 26.21  ? 402 LEU B C   1 
ATOM   6754  O O   . LEU B  1 405 ? 107.731 21.042  -22.424 1.00 26.54  ? 402 LEU B O   1 
ATOM   6755  C CB  . LEU B  1 405 ? 105.404 18.887  -21.397 1.00 25.81  ? 402 LEU B CB  1 
ATOM   6756  C CG  . LEU B  1 405 ? 104.531 19.758  -22.307 1.00 25.89  ? 402 LEU B CG  1 
ATOM   6757  C CD1 . LEU B  1 405 ? 104.662 19.326  -23.759 1.00 25.30  ? 402 LEU B CD1 1 
ATOM   6758  C CD2 . LEU B  1 405 ? 103.080 19.723  -21.843 1.00 25.68  ? 402 LEU B CD2 1 
ATOM   6759  N N   . ILE B  1 406 ? 107.393 20.939  -20.206 1.00 27.10  ? 403 ILE B N   1 
ATOM   6760  C CA  . ILE B  1 406 ? 107.881 22.294  -19.967 1.00 28.60  ? 403 ILE B CA  1 
ATOM   6761  C C   . ILE B  1 406 ? 109.329 22.454  -20.454 1.00 29.47  ? 403 ILE B C   1 
ATOM   6762  O O   . ILE B  1 406 ? 109.600 23.378  -21.227 1.00 28.90  ? 403 ILE B O   1 
ATOM   6763  C CB  . ILE B  1 406 ? 107.759 22.707  -18.481 1.00 30.10  ? 403 ILE B CB  1 
ATOM   6764  C CG1 . ILE B  1 406 ? 106.276 22.787  -18.074 1.00 30.39  ? 403 ILE B CG1 1 
ATOM   6765  C CG2 . ILE B  1 406 ? 108.427 24.076  -18.219 1.00 30.02  ? 403 ILE B CG2 1 
ATOM   6766  C CD1 . ILE B  1 406 ? 106.036 22.884  -16.575 1.00 30.43  ? 403 ILE B CD1 1 
ATOM   6767  N N   . ASP B  1 407 ? 110.235 21.563  -20.012 1.00 29.65  ? 404 ASP B N   1 
ATOM   6768  C CA  . ASP B  1 407 ? 111.681 21.639  -20.354 1.00 29.17  ? 404 ASP B CA  1 
ATOM   6769  C C   . ASP B  1 407 ? 111.979 21.591  -21.845 1.00 28.26  ? 404 ASP B C   1 
ATOM   6770  O O   . ASP B  1 407 ? 112.911 22.229  -22.321 1.00 28.31  ? 404 ASP B O   1 
ATOM   6771  C CB  . ASP B  1 407 ? 112.457 20.547  -19.632 1.00 29.35  ? 404 ASP B CB  1 
ATOM   6772  C CG  . ASP B  1 407 ? 112.537 20.802  -18.144 1.00 31.04  ? 404 ASP B CG  1 
ATOM   6773  O OD1 . ASP B  1 407 ? 112.490 21.989  -17.752 1.00 31.08  ? 404 ASP B OD1 1 
ATOM   6774  O OD2 . ASP B  1 407 ? 112.632 19.834  -17.355 1.00 32.09  ? 404 ASP B OD2 1 
ATOM   6775  N N   . ALA B  1 408 ? 111.158 20.852  -22.567 1.00 27.68  ? 405 ALA B N   1 
ATOM   6776  C CA  . ALA B  1 408 ? 111.247 20.762  -24.015 1.00 28.54  ? 405 ALA B CA  1 
ATOM   6777  C C   . ALA B  1 408 ? 110.919 22.083  -24.792 1.00 29.07  ? 405 ALA B C   1 
ATOM   6778  O O   . ALA B  1 408 ? 111.403 22.300  -25.903 1.00 28.63  ? 405 ALA B O   1 
ATOM   6779  C CB  . ALA B  1 408 ? 110.342 19.619  -24.487 1.00 28.00  ? 405 ALA B CB  1 
ATOM   6780  N N   . HIS B  1 409 ? 110.093 22.950  -24.217 1.00 30.42  ? 406 HIS B N   1 
ATOM   6781  C CA  . HIS B  1 409 ? 109.661 24.178  -24.885 1.00 30.54  ? 406 HIS B CA  1 
ATOM   6782  C C   . HIS B  1 409 ? 110.851 25.110  -25.149 1.00 32.73  ? 406 HIS B C   1 
ATOM   6783  O O   . HIS B  1 409 ? 111.919 25.043  -24.503 1.00 31.54  ? 406 HIS B O   1 
ATOM   6784  C CB  . HIS B  1 409 ? 108.600 24.902  -24.051 1.00 31.32  ? 406 HIS B CB  1 
ATOM   6785  C CG  . HIS B  1 409 ? 107.641 25.722  -24.849 1.00 33.47  ? 406 HIS B CG  1 
ATOM   6786  N ND1 . HIS B  1 409 ? 107.900 27.023  -25.217 1.00 33.52  ? 406 HIS B ND1 1 
ATOM   6787  C CD2 . HIS B  1 409 ? 106.403 25.439  -25.322 1.00 36.28  ? 406 HIS B CD2 1 
ATOM   6788  C CE1 . HIS B  1 409 ? 106.881 27.502  -25.906 1.00 34.26  ? 406 HIS B CE1 1 
ATOM   6789  N NE2 . HIS B  1 409 ? 105.955 26.562  -25.980 1.00 36.49  ? 406 HIS B NE2 1 
ATOM   6790  N N   . GLU B  1 410 ? 110.649 25.965  -26.141 1.00 35.74  ? 407 GLU B N   1 
ATOM   6791  C CA  . GLU B  1 410 ? 111.677 26.879  -26.629 1.00 35.45  ? 407 GLU B CA  1 
ATOM   6792  C C   . GLU B  1 410 ? 112.103 27.860  -25.531 1.00 32.76  ? 407 GLU B C   1 
ATOM   6793  O O   . GLU B  1 410 ? 113.286 28.050  -25.287 1.00 29.38  ? 407 GLU B O   1 
ATOM   6794  C CB  . GLU B  1 410 ? 111.125 27.621  -27.867 1.00 36.79  ? 407 GLU B CB  1 
ATOM   6795  C CG  . GLU B  1 410 ? 112.119 28.550  -28.559 1.00 38.24  ? 407 GLU B CG  1 
ATOM   6796  C CD  . GLU B  1 410 ? 111.524 29.347  -29.700 1.00 38.99  ? 407 GLU B CD  1 
ATOM   6797  O OE1 . GLU B  1 410 ? 110.395 29.022  -30.128 1.00 39.29  ? 407 GLU B OE1 1 
ATOM   6798  O OE2 . GLU B  1 410 ? 112.187 30.311  -30.163 1.00 39.57  ? 407 GLU B OE2 1 
ATOM   6799  N N   . TYR B  1 411 ? 111.101 28.466  -24.911 1.00 32.20  ? 408 TYR B N   1 
ATOM   6800  C CA  . TYR B  1 411 ? 111.233 29.453  -23.859 1.00 34.34  ? 408 TYR B CA  1 
ATOM   6801  C C   . TYR B  1 411 ? 111.361 28.838  -22.476 1.00 32.79  ? 408 TYR B C   1 
ATOM   6802  O O   . TYR B  1 411 ? 111.050 27.661  -22.262 1.00 34.27  ? 408 TYR B O   1 
ATOM   6803  C CB  . TYR B  1 411 ? 109.973 30.326  -23.849 1.00 38.68  ? 408 TYR B CB  1 
ATOM   6804  C CG  . TYR B  1 411 ? 109.681 30.997  -25.174 1.00 42.85  ? 408 TYR B CG  1 
ATOM   6805  C CD1 . TYR B  1 411 ? 110.644 31.781  -25.794 1.00 44.26  ? 408 TYR B CD1 1 
ATOM   6806  C CD2 . TYR B  1 411 ? 108.442 30.840  -25.818 1.00 44.51  ? 408 TYR B CD2 1 
ATOM   6807  C CE1 . TYR B  1 411 ? 110.390 32.383  -27.013 1.00 44.78  ? 408 TYR B CE1 1 
ATOM   6808  C CE2 . TYR B  1 411 ? 108.186 31.449  -27.042 1.00 43.86  ? 408 TYR B CE2 1 
ATOM   6809  C CZ  . TYR B  1 411 ? 109.167 32.225  -27.625 1.00 43.32  ? 408 TYR B CZ  1 
ATOM   6810  O OH  . TYR B  1 411 ? 108.957 32.849  -28.821 1.00 41.93  ? 408 TYR B OH  1 
ATOM   6811  N N   . GLY B  1 412 ? 111.780 29.662  -21.526 1.00 29.78  ? 409 GLY B N   1 
ATOM   6812  C CA  . GLY B  1 412 ? 111.787 29.258  -20.130 1.00 28.94  ? 409 GLY B CA  1 
ATOM   6813  C C   . GLY B  1 412 ? 111.759 30.431  -19.178 1.00 27.02  ? 409 GLY B C   1 
ATOM   6814  O O   . GLY B  1 412 ? 112.585 30.552  -18.275 1.00 26.35  ? 409 GLY B O   1 
ATOM   6815  N N   . ASN B  1 413 ? 110.774 31.285  -19.352 1.00 26.34  ? 410 ASN B N   1 
ATOM   6816  C CA  . ASN B  1 413 ? 110.702 32.491  -18.547 1.00 26.28  ? 410 ASN B CA  1 
ATOM   6817  C C   . ASN B  1 413 ? 110.163 32.168  -17.162 1.00 24.70  ? 410 ASN B C   1 
ATOM   6818  O O   . ASN B  1 413 ? 110.867 32.271  -16.159 1.00 25.47  ? 410 ASN B O   1 
ATOM   6819  C CB  . ASN B  1 413 ? 109.825 33.525  -19.247 1.00 27.56  ? 410 ASN B CB  1 
ATOM   6820  C CG  . ASN B  1 413 ? 110.364 34.926  -19.155 1.00 29.35  ? 410 ASN B CG  1 
ATOM   6821  O OD1 . ASN B  1 413 ? 111.509 35.152  -18.775 1.00 34.36  ? 410 ASN B OD1 1 
ATOM   6822  N ND2 . ASN B  1 413 ? 109.534 35.886  -19.518 1.00 30.25  ? 410 ASN B ND2 1 
ATOM   6823  N N   . GLY B  1 414 ? 108.928 31.710  -17.123 1.00 23.26  ? 411 GLY B N   1 
ATOM   6824  C CA  . GLY B  1 414 ? 108.191 31.595  -15.866 1.00 22.63  ? 411 GLY B CA  1 
ATOM   6825  C C   . GLY B  1 414 ? 107.401 30.306  -15.768 1.00 21.80  ? 411 GLY B C   1 
ATOM   6826  O O   . GLY B  1 414 ? 106.970 29.745  -16.777 1.00 22.06  ? 411 GLY B O   1 
ATOM   6827  N N   . THR B  1 415 ? 107.224 29.818  -14.547 1.00 20.33  ? 412 THR B N   1 
ATOM   6828  C CA  . THR B  1 415 ? 106.521 28.568  -14.351 1.00 19.09  ? 412 THR B CA  1 
ATOM   6829  C C   . THR B  1 415 ? 105.969 28.485  -12.958 1.00 18.90  ? 412 THR B C   1 
ATOM   6830  O O   . THR B  1 415 ? 106.342 29.279  -12.087 1.00 19.30  ? 412 THR B O   1 
ATOM   6831  C CB  . THR B  1 415 ? 107.417 27.360  -14.665 1.00 18.62  ? 412 THR B CB  1 
ATOM   6832  O OG1 . THR B  1 415 ? 106.587 26.239  -14.917 1.00 19.26  ? 412 THR B OG1 1 
ATOM   6833  C CG2 . THR B  1 415 ? 108.352 27.031  -13.540 1.00 18.18  ? 412 THR B CG2 1 
ATOM   6834  N N   . CYS B  1 416 ? 105.078 27.517  -12.759 1.00 18.58  ? 413 CYS B N   1 
ATOM   6835  C CA  . CYS B  1 416 ? 104.381 27.333  -11.485 1.00 18.40  ? 413 CYS B CA  1 
ATOM   6836  C C   . CYS B  1 416 ? 103.943 25.876  -11.252 1.00 18.60  ? 413 CYS B C   1 
ATOM   6837  O O   . CYS B  1 416 ? 103.692 25.126  -12.189 1.00 18.86  ? 413 CYS B O   1 
ATOM   6838  C CB  . CYS B  1 416 ? 103.163 28.255  -11.433 1.00 18.17  ? 413 CYS B CB  1 
ATOM   6839  S SG  . CYS B  1 416 ? 102.148 28.114  -9.946  1.00 18.49  ? 413 CYS B SG  1 
ATOM   6840  N N   . ILE B  1 417 ? 103.868 25.483  -9.986  1.00 18.22  ? 414 ILE B N   1 
ATOM   6841  C CA  . ILE B  1 417 ? 103.283 24.208  -9.600  1.00 17.75  ? 414 ILE B CA  1 
ATOM   6842  C C   . ILE B  1 417 ? 102.313 24.439  -8.459  1.00 17.80  ? 414 ILE B C   1 
ATOM   6843  O O   . ILE B  1 417 ? 102.648 25.089  -7.453  1.00 18.08  ? 414 ILE B O   1 
ATOM   6844  C CB  . ILE B  1 417 ? 104.345 23.151  -9.187  1.00 17.73  ? 414 ILE B CB  1 
ATOM   6845  C CG1 . ILE B  1 417 ? 103.686 21.790  -8.900  1.00 17.27  ? 414 ILE B CG1 1 
ATOM   6846  C CG2 . ILE B  1 417 ? 105.156 23.588  -7.973  1.00 17.59  ? 414 ILE B CG2 1 
ATOM   6847  C CD1 . ILE B  1 417 ? 104.657 20.637  -8.938  1.00 16.71  ? 414 ILE B CD1 1 
ATOM   6848  N N   . PHE B  1 418 ? 101.108 23.911  -8.618  1.00 17.47  ? 415 PHE B N   1 
ATOM   6849  C CA  . PHE B  1 418 ? 100.119 23.999  -7.586  1.00 17.18  ? 415 PHE B CA  1 
ATOM   6850  C C   . PHE B  1 418 ? 100.166 22.646  -6.929  1.00 17.64  ? 415 PHE B C   1 
ATOM   6851  O O   . PHE B  1 418 ? 99.955  21.654  -7.603  1.00 16.78  ? 415 PHE B O   1 
ATOM   6852  C CB  . PHE B  1 418 ? 98.744  24.275  -8.160  1.00 16.66  ? 415 PHE B CB  1 
ATOM   6853  C CG  . PHE B  1 418 ? 98.595  25.637  -8.750  1.00 16.02  ? 415 PHE B CG  1 
ATOM   6854  C CD1 . PHE B  1 418 ? 98.446  26.744  -7.930  1.00 15.97  ? 415 PHE B CD1 1 
ATOM   6855  C CD2 . PHE B  1 418 ? 98.554  25.810  -10.125 1.00 15.77  ? 415 PHE B CD2 1 
ATOM   6856  C CE1 . PHE B  1 418 ? 98.276  28.002  -8.473  1.00 15.74  ? 415 PHE B CE1 1 
ATOM   6857  C CE2 . PHE B  1 418 ? 98.389  27.059  -10.680 1.00 15.75  ? 415 PHE B CE2 1 
ATOM   6858  C CZ  . PHE B  1 418 ? 98.247  28.154  -9.854  1.00 15.95  ? 415 PHE B CZ  1 
ATOM   6859  N N   . THR B  1 419 ? 100.480 22.630  -5.632  1.00 18.83  ? 416 THR B N   1 
ATOM   6860  C CA  . THR B  1 419 ? 100.540 21.416  -4.811  1.00 20.07  ? 416 THR B CA  1 
ATOM   6861  C C   . THR B  1 419 ? 100.606 21.755  -3.306  1.00 22.42  ? 416 THR B C   1 
ATOM   6862  O O   . THR B  1 419 ? 100.986 22.869  -2.930  1.00 23.75  ? 416 THR B O   1 
ATOM   6863  C CB  . THR B  1 419 ? 101.737 20.525  -5.208  1.00 19.80  ? 416 THR B CB  1 
ATOM   6864  O OG1 . THR B  1 419 ? 101.719 19.318  -4.437  1.00 19.95  ? 416 THR B OG1 1 
ATOM   6865  C CG2 . THR B  1 419 ? 103.071 21.246  -5.025  1.00 19.38  ? 416 THR B CG2 1 
ATOM   6866  N N   . ARG B  1 420 ? 100.191 20.816  -2.462  1.00 24.80  ? 417 ARG B N   1 
ATOM   6867  C CA  . ARG B  1 420 ? 100.325 20.954  -1.006  1.00 28.47  ? 417 ARG B CA  1 
ATOM   6868  C C   . ARG B  1 420 ? 101.615 20.281  -0.492  1.00 27.43  ? 417 ARG B C   1 
ATOM   6869  O O   . ARG B  1 420 ? 102.055 20.569  0.635   1.00 24.70  ? 417 ARG B O   1 
ATOM   6870  C CB  . ARG B  1 420 ? 99.082  20.398  -0.279  1.00 33.82  ? 417 ARG B CB  1 
ATOM   6871  C CG  . ARG B  1 420 ? 97.767  21.097  -0.653  1.00 41.49  ? 417 ARG B CG  1 
ATOM   6872  C CD  . ARG B  1 420 ? 96.542  20.777  0.227   1.00 49.52  ? 417 ARG B CD  1 
ATOM   6873  N NE  . ARG B  1 420 ? 96.789  21.236  1.605   1.00 66.67  ? 417 ARG B NE  1 
ATOM   6874  C CZ  . ARG B  1 420 ? 97.052  20.469  2.680   1.00 76.10  ? 417 ARG B CZ  1 
ATOM   6875  N NH1 . ARG B  1 420 ? 97.066  19.136  2.602   1.00 79.96  ? 417 ARG B NH1 1 
ATOM   6876  N NH2 . ARG B  1 420 ? 97.302  21.051  3.863   1.00 72.79  ? 417 ARG B NH2 1 
ATOM   6877  N N   . ASP B  1 421 ? 102.209 19.427  -1.349  1.00 27.45  ? 418 ASP B N   1 
ATOM   6878  C CA  . ASP B  1 421 ? 103.289 18.481  -1.008  1.00 26.78  ? 418 ASP B CA  1 
ATOM   6879  C C   . ASP B  1 421 ? 104.619 19.132  -1.250  1.00 26.59  ? 418 ASP B C   1 
ATOM   6880  O O   . ASP B  1 421 ? 104.873 19.603  -2.349  1.00 28.37  ? 418 ASP B O   1 
ATOM   6881  C CB  . ASP B  1 421 ? 103.194 17.205  -1.871  1.00 25.92  ? 418 ASP B CB  1 
ATOM   6882  C CG  . ASP B  1 421 ? 104.305 16.208  -1.590  1.00 26.50  ? 418 ASP B CG  1 
ATOM   6883  O OD1 . ASP B  1 421 ? 104.576 15.829  -0.421  1.00 26.94  ? 418 ASP B OD1 1 
ATOM   6884  O OD2 . ASP B  1 421 ? 104.940 15.811  -2.576  1.00 27.31  ? 418 ASP B OD2 1 
ATOM   6885  N N   . GLY B  1 422 ? 105.477 19.125  -0.237  1.00 26.26  ? 419 GLY B N   1 
ATOM   6886  C CA  . GLY B  1 422 ? 106.767 19.804  -0.311  1.00 26.38  ? 419 GLY B CA  1 
ATOM   6887  C C   . GLY B  1 422 ? 107.772 19.098  -1.199  1.00 25.45  ? 419 GLY B C   1 
ATOM   6888  O O   . GLY B  1 422 ? 108.551 19.737  -1.918  1.00 22.76  ? 419 GLY B O   1 
ATOM   6889  N N   . GLU B  1 423 ? 107.742 17.774  -1.139  1.00 25.42  ? 420 GLU B N   1 
ATOM   6890  C CA  . GLU B  1 423 ? 108.648 16.969  -1.929  1.00 26.93  ? 420 GLU B CA  1 
ATOM   6891  C C   . GLU B  1 423 ? 108.528 17.362  -3.412  1.00 25.73  ? 420 GLU B C   1 
ATOM   6892  O O   . GLU B  1 423 ? 109.520 17.666  -4.087  1.00 23.72  ? 420 GLU B O   1 
ATOM   6893  C CB  . GLU B  1 423 ? 108.344 15.478  -1.705  1.00 29.10  ? 420 GLU B CB  1 
ATOM   6894  C CG  . GLU B  1 423 ? 109.505 14.537  -2.003  1.00 31.71  ? 420 GLU B CG  1 
ATOM   6895  C CD  . GLU B  1 423 ? 109.744 14.324  -3.478  1.00 34.18  ? 420 GLU B CD  1 
ATOM   6896  O OE1 . GLU B  1 423 ? 108.783 14.380  -4.268  1.00 35.69  ? 420 GLU B OE1 1 
ATOM   6897  O OE2 . GLU B  1 423 ? 110.910 14.116  -3.857  1.00 38.90  ? 420 GLU B OE2 1 
ATOM   6898  N N   . ALA B  1 424 ? 107.288 17.356  -3.891  1.00 25.22  ? 421 ALA B N   1 
ATOM   6899  C CA  . ALA B  1 424 ? 106.947 17.751  -5.256  1.00 23.56  ? 421 ALA B CA  1 
ATOM   6900  C C   . ALA B  1 424 ? 107.336 19.188  -5.561  1.00 23.02  ? 421 ALA B C   1 
ATOM   6901  O O   . ALA B  1 424 ? 107.787 19.467  -6.663  1.00 23.14  ? 421 ALA B O   1 
ATOM   6902  C CB  . ALA B  1 424 ? 105.460 17.569  -5.487  1.00 23.35  ? 421 ALA B CB  1 
ATOM   6903  N N   . ALA B  1 425 ? 107.161 20.093  -4.597  1.00 21.81  ? 422 ALA B N   1 
ATOM   6904  C CA  . ALA B  1 425 ? 107.547 21.483  -4.788  1.00 21.08  ? 422 ALA B CA  1 
ATOM   6905  C C   . ALA B  1 425 ? 109.048 21.664  -4.992  1.00 20.34  ? 422 ALA B C   1 
ATOM   6906  O O   . ALA B  1 425 ? 109.443 22.368  -5.915  1.00 19.11  ? 422 ALA B O   1 
ATOM   6907  C CB  . ALA B  1 425 ? 107.070 22.326  -3.625  1.00 22.09  ? 422 ALA B CB  1 
ATOM   6908  N N   . ARG B  1 426 ? 109.867 21.038  -4.141  1.00 20.86  ? 423 ARG B N   1 
ATOM   6909  C CA  . ARG B  1 426 ? 111.339 21.126  -4.260  1.00 21.68  ? 423 ARG B CA  1 
ATOM   6910  C C   . ARG B  1 426 ? 111.840 20.481  -5.536  1.00 20.93  ? 423 ARG B C   1 
ATOM   6911  O O   . ARG B  1 426 ? 112.646 21.067  -6.267  1.00 21.00  ? 423 ARG B O   1 
ATOM   6912  C CB  . ARG B  1 426 ? 112.076 20.481  -3.085  1.00 22.97  ? 423 ARG B CB  1 
ATOM   6913  C CG  . ARG B  1 426 ? 113.465 21.051  -2.910  1.00 25.36  ? 423 ARG B CG  1 
ATOM   6914  C CD  . ARG B  1 426 ? 114.432 20.059  -2.330  1.00 29.61  ? 423 ARG B CD  1 
ATOM   6915  N NE  . ARG B  1 426 ? 115.211 19.370  -3.371  1.00 32.61  ? 423 ARG B NE  1 
ATOM   6916  C CZ  . ARG B  1 426 ? 116.476 19.640  -3.718  1.00 35.10  ? 423 ARG B CZ  1 
ATOM   6917  N NH1 . ARG B  1 426 ? 117.070 18.919  -4.658  1.00 36.78  ? 423 ARG B NH1 1 
ATOM   6918  N NH2 . ARG B  1 426 ? 117.169 20.617  -3.142  1.00 37.72  ? 423 ARG B NH2 1 
ATOM   6919  N N   . TYR B  1 427 ? 111.366 19.269  -5.797  1.00 20.72  ? 424 TYR B N   1 
ATOM   6920  C CA  . TYR B  1 427 ? 111.751 18.545  -6.999  1.00 20.33  ? 424 TYR B CA  1 
ATOM   6921  C C   . TYR B  1 427 ? 111.381 19.341  -8.243  1.00 19.56  ? 424 TYR B C   1 
ATOM   6922  O O   . TYR B  1 427 ? 112.111 19.335  -9.212  1.00 19.46  ? 424 TYR B O   1 
ATOM   6923  C CB  . TYR B  1 427 ? 111.106 17.171  -7.039  1.00 20.64  ? 424 TYR B CB  1 
ATOM   6924  C CG  . TYR B  1 427 ? 111.570 16.372  -8.219  1.00 21.87  ? 424 TYR B CG  1 
ATOM   6925  C CD1 . TYR B  1 427 ? 112.712 15.591  -8.148  1.00 22.86  ? 424 TYR B CD1 1 
ATOM   6926  C CD2 . TYR B  1 427 ? 110.898 16.425  -9.430  1.00 22.60  ? 424 TYR B CD2 1 
ATOM   6927  C CE1 . TYR B  1 427 ? 113.154 14.865  -9.243  1.00 23.17  ? 424 TYR B CE1 1 
ATOM   6928  C CE2 . TYR B  1 427 ? 111.333 15.694  -10.519 1.00 23.01  ? 424 TYR B CE2 1 
ATOM   6929  C CZ  . TYR B  1 427 ? 112.445 14.924  -10.428 1.00 23.56  ? 424 TYR B CZ  1 
ATOM   6930  O OH  . TYR B  1 427 ? 112.806 14.243  -11.563 1.00 24.64  ? 424 TYR B OH  1 
ATOM   6931  N N   . PHE B  1 428 ? 110.252 20.031  -8.203  1.00 18.95  ? 425 PHE B N   1 
ATOM   6932  C CA  . PHE B  1 428 ? 109.889 20.930  -9.264  1.00 19.00  ? 425 PHE B CA  1 
ATOM   6933  C C   . PHE B  1 428 ? 110.823 22.145  -9.313  1.00 20.01  ? 425 PHE B C   1 
ATOM   6934  O O   . PHE B  1 428 ? 111.463 22.395  -10.347 1.00 21.39  ? 425 PHE B O   1 
ATOM   6935  C CB  . PHE B  1 428 ? 108.431 21.383  -9.118  1.00 19.25  ? 425 PHE B CB  1 
ATOM   6936  C CG  . PHE B  1 428 ? 107.971 22.310  -10.220 1.00 18.82  ? 425 PHE B CG  1 
ATOM   6937  C CD1 . PHE B  1 428 ? 107.849 21.858  -11.530 1.00 18.00  ? 425 PHE B CD1 1 
ATOM   6938  C CD2 . PHE B  1 428 ? 107.701 23.652  -9.947  1.00 18.99  ? 425 PHE B CD2 1 
ATOM   6939  C CE1 . PHE B  1 428 ? 107.463 22.720  -12.536 1.00 18.28  ? 425 PHE B CE1 1 
ATOM   6940  C CE2 . PHE B  1 428 ? 107.306 24.522  -10.953 1.00 18.94  ? 425 PHE B CE2 1 
ATOM   6941  C CZ  . PHE B  1 428 ? 107.185 24.051  -12.251 1.00 18.68  ? 425 PHE B CZ  1 
ATOM   6942  N N   . SER B  1 429 ? 110.896 22.902  -8.215  1.00 19.90  ? 426 SER B N   1 
ATOM   6943  C CA  . SER B  1 429 ? 111.672 24.151  -8.192  1.00 19.68  ? 426 SER B CA  1 
ATOM   6944  C C   . SER B  1 429 ? 113.143 23.917  -8.473  1.00 21.31  ? 426 SER B C   1 
ATOM   6945  O O   . SER B  1 429 ? 113.778 24.710  -9.178  1.00 21.41  ? 426 SER B O   1 
ATOM   6946  C CB  . SER B  1 429 ? 111.510 24.884  -6.865  1.00 18.96  ? 426 SER B CB  1 
ATOM   6947  O OG  . SER B  1 429 ? 112.134 24.177  -5.823  1.00 17.96  ? 426 SER B OG  1 
ATOM   6948  N N   . ASP B  1 430 ? 113.678 22.818  -7.942  1.00 22.63  ? 427 ASP B N   1 
ATOM   6949  C CA  . ASP B  1 430 ? 115.092 22.494  -8.149  1.00 24.14  ? 427 ASP B CA  1 
ATOM   6950  C C   . ASP B  1 430 ? 115.456 22.110  -9.587  1.00 22.23  ? 427 ASP B C   1 
ATOM   6951  O O   . ASP B  1 430 ? 116.455 22.584  -10.085 1.00 21.49  ? 427 ASP B O   1 
ATOM   6952  C CB  . ASP B  1 430 ? 115.575 21.393  -7.194  1.00 25.85  ? 427 ASP B CB  1 
ATOM   6953  C CG  . ASP B  1 430 ? 117.087 21.256  -7.208  1.00 28.13  ? 427 ASP B CG  1 
ATOM   6954  O OD1 . ASP B  1 430 ? 117.760 22.129  -6.575  1.00 28.02  ? 427 ASP B OD1 1 
ATOM   6955  O OD2 . ASP B  1 430 ? 117.581 20.304  -7.881  1.00 29.52  ? 427 ASP B OD2 1 
ATOM   6956  N N   . ASN B  1 431 ? 114.666 21.246  -10.224 1.00 21.21  ? 428 ASN B N   1 
ATOM   6957  C CA  . ASN B  1 431 ? 115.033 20.636  -11.531 1.00 20.98  ? 428 ASN B CA  1 
ATOM   6958  C C   . ASN B  1 431 ? 114.481 21.309  -12.789 1.00 19.37  ? 428 ASN B C   1 
ATOM   6959  O O   . ASN B  1 431 ? 115.055 21.164  -13.851 1.00 17.56  ? 428 ASN B O   1 
ATOM   6960  C CB  . ASN B  1 431 ? 114.632 19.155  -11.555 1.00 22.32  ? 428 ASN B CB  1 
ATOM   6961  C CG  . ASN B  1 431 ? 115.408 18.312  -10.554 1.00 23.17  ? 428 ASN B CG  1 
ATOM   6962  O OD1 . ASN B  1 431 ? 114.849 17.844  -9.560  1.00 24.00  ? 428 ASN B OD1 1 
ATOM   6963  N ND2 . ASN B  1 431 ? 116.702 18.114  -10.812 1.00 23.89  ? 428 ASN B ND2 1 
ATOM   6964  N N   . ILE B  1 432 ? 113.374 22.034  -12.661 1.00 18.74  ? 429 ILE B N   1 
ATOM   6965  C CA  . ILE B  1 432 ? 112.733 22.653  -13.805 1.00 18.67  ? 429 ILE B CA  1 
ATOM   6966  C C   . ILE B  1 432 ? 113.636 23.671  -14.485 1.00 17.86  ? 429 ILE B C   1 
ATOM   6967  O O   . ILE B  1 432 ? 114.253 24.488  -13.841 1.00 17.12  ? 429 ILE B O   1 
ATOM   6968  C CB  . ILE B  1 432 ? 111.370 23.277  -13.406 1.00 19.81  ? 429 ILE B CB  1 
ATOM   6969  C CG1 . ILE B  1 432 ? 110.501 23.578  -14.643 1.00 20.56  ? 429 ILE B CG1 1 
ATOM   6970  C CG2 . ILE B  1 432 ? 111.537 24.535  -12.577 1.00 20.76  ? 429 ILE B CG2 1 
ATOM   6971  C CD1 . ILE B  1 432 ? 109.768 22.363  -15.198 1.00 20.85  ? 429 ILE B CD1 1 
ATOM   6972  N N   . GLN B  1 433 ? 113.688 23.637  -15.805 1.00 18.44  ? 430 GLN B N   1 
ATOM   6973  C CA  . GLN B  1 433 ? 114.569 24.523  -16.564 1.00 19.14  ? 430 GLN B CA  1 
ATOM   6974  C C   . GLN B  1 433 ? 113.912 25.825  -16.964 1.00 19.22  ? 430 GLN B C   1 
ATOM   6975  O O   . GLN B  1 433 ? 113.777 26.119  -18.167 1.00 19.31  ? 430 GLN B O   1 
ATOM   6976  C CB  . GLN B  1 433 ? 115.098 23.813  -17.809 1.00 20.17  ? 430 GLN B CB  1 
ATOM   6977  C CG  . GLN B  1 433 ? 115.912 22.562  -17.511 1.00 20.75  ? 430 GLN B CG  1 
ATOM   6978  C CD  . GLN B  1 433 ? 117.072 22.842  -16.562 1.00 21.22  ? 430 GLN B CD  1 
ATOM   6979  O OE1 . GLN B  1 433 ? 118.066 23.480  -16.935 1.00 22.05  ? 430 GLN B OE1 1 
ATOM   6980  N NE2 . GLN B  1 433 ? 116.940 22.388  -15.319 1.00 21.37  ? 430 GLN B NE2 1 
ATOM   6981  N N   . VAL B  1 434 ? 113.490 26.600  -15.955 1.00 18.98  ? 431 VAL B N   1 
ATOM   6982  C CA  . VAL B  1 434 ? 113.015 27.979  -16.168 1.00 18.41  ? 431 VAL B CA  1 
ATOM   6983  C C   . VAL B  1 434 ? 113.541 28.924  -15.057 1.00 17.16  ? 431 VAL B C   1 
ATOM   6984  O O   . VAL B  1 434 ? 113.819 28.518  -13.919 1.00 16.99  ? 431 VAL B O   1 
ATOM   6985  C CB  . VAL B  1 434 ? 111.457 28.066  -16.395 1.00 19.07  ? 431 VAL B CB  1 
ATOM   6986  C CG1 . VAL B  1 434 ? 110.827 26.694  -16.553 1.00 18.88  ? 431 VAL B CG1 1 
ATOM   6987  C CG2 . VAL B  1 434 ? 110.729 28.811  -15.282 1.00 20.05  ? 431 VAL B CG2 1 
ATOM   6988  N N   . GLY B  1 435 ? 113.642 30.198  -15.399 1.00 16.04  ? 432 GLY B N   1 
ATOM   6989  C CA  . GLY B  1 435 ? 114.253 31.172  -14.510 1.00 15.79  ? 432 GLY B CA  1 
ATOM   6990  C C   . GLY B  1 435 ? 113.449 31.452  -13.260 1.00 15.09  ? 432 GLY B C   1 
ATOM   6991  O O   . GLY B  1 435 ? 113.960 31.459  -12.158 1.00 15.42  ? 432 GLY B O   1 
ATOM   6992  N N   . MET B  1 436 ? 112.174 31.707  -13.428 1.00 14.36  ? 433 MET B N   1 
ATOM   6993  C CA  . MET B  1 436 ? 111.383 32.185  -12.314 1.00 13.81  ? 433 MET B CA  1 
ATOM   6994  C C   . MET B  1 436 ? 110.314 31.157  -12.003 1.00 13.12  ? 433 MET B C   1 
ATOM   6995  O O   . MET B  1 436 ? 109.422 30.919  -12.801 1.00 12.83  ? 433 MET B O   1 
ATOM   6996  C CB  . MET B  1 436 ? 110.814 33.569  -12.657 1.00 13.66  ? 433 MET B CB  1 
ATOM   6997  C CG  . MET B  1 436 ? 111.887 34.652  -12.683 1.00 13.26  ? 433 MET B CG  1 
ATOM   6998  S SD  . MET B  1 436 ? 111.421 36.123  -13.608 1.00 13.12  ? 433 MET B SD  1 
ATOM   6999  C CE  . MET B  1 436 ? 111.591 35.645  -15.323 1.00 13.11  ? 433 MET B CE  1 
ATOM   7000  N N   . VAL B  1 437 ? 110.425 30.505  -10.857 1.00 12.77  ? 434 VAL B N   1 
ATOM   7001  C CA  . VAL B  1 437 ? 109.490 29.406  -10.554 1.00 12.51  ? 434 VAL B CA  1 
ATOM   7002  C C   . VAL B  1 437 ? 108.689 29.779  -9.341  1.00 12.27  ? 434 VAL B C   1 
ATOM   7003  O O   . VAL B  1 437 ? 109.239 30.345  -8.406  1.00 11.70  ? 434 VAL B O   1 
ATOM   7004  C CB  . VAL B  1 437 ? 110.128 27.987  -10.458 1.00 12.19  ? 434 VAL B CB  1 
ATOM   7005  C CG1 . VAL B  1 437 ? 111.625 27.997  -10.689 1.00 12.51  ? 434 VAL B CG1 1 
ATOM   7006  C CG2 . VAL B  1 437 ? 109.785 27.304  -9.162  1.00 12.04  ? 434 VAL B CG2 1 
ATOM   7007  N N   . GLY B  1 438 ? 107.385 29.496  -9.417  1.00 12.32  ? 435 GLY B N   1 
ATOM   7008  C CA  . GLY B  1 438 ? 106.440 29.756  -8.341  1.00 12.69  ? 435 GLY B CA  1 
ATOM   7009  C C   . GLY B  1 438 ? 105.906 28.474  -7.734  1.00 13.04  ? 435 GLY B C   1 
ATOM   7010  O O   . GLY B  1 438 ? 105.763 27.469  -8.434  1.00 12.90  ? 435 GLY B O   1 
ATOM   7011  N N   . ILE B  1 439 ? 105.644 28.510  -6.433  1.00 13.65  ? 436 ILE B N   1 
ATOM   7012  C CA  . ILE B  1 439 ? 104.973 27.427  -5.743  1.00 14.94  ? 436 ILE B CA  1 
ATOM   7013  C C   . ILE B  1 439 ? 103.642 27.970  -5.277  1.00 14.90  ? 436 ILE B C   1 
ATOM   7014  O O   . ILE B  1 439 ? 103.597 28.790  -4.362  1.00 14.32  ? 436 ILE B O   1 
ATOM   7015  C CB  . ILE B  1 439 ? 105.758 26.881  -4.527  1.00 16.25  ? 436 ILE B CB  1 
ATOM   7016  C CG1 . ILE B  1 439 ? 107.265 26.718  -4.850  1.00 17.13  ? 436 ILE B CG1 1 
ATOM   7017  C CG2 . ILE B  1 439 ? 105.153 25.548  -4.043  1.00 16.17  ? 436 ILE B CG2 1 
ATOM   7018  C CD1 . ILE B  1 439 ? 107.580 25.700  -5.934  1.00 17.05  ? 436 ILE B CD1 1 
ATOM   7019  N N   . ASN B  1 440 ? 102.571 27.503  -5.927  1.00 15.12  ? 437 ASN B N   1 
ATOM   7020  C CA  . ASN B  1 440 ? 101.230 28.049  -5.767  1.00 15.45  ? 437 ASN B CA  1 
ATOM   7021  C C   . ASN B  1 440 ? 101.181 29.542  -6.032  1.00 15.99  ? 437 ASN B C   1 
ATOM   7022  O O   . ASN B  1 440 ? 100.414 30.281  -5.408  1.00 16.41  ? 437 ASN B O   1 
ATOM   7023  C CB  . ASN B  1 440 ? 100.707 27.696  -4.390  1.00 15.54  ? 437 ASN B CB  1 
ATOM   7024  C CG  . ASN B  1 440 ? 100.747 26.211  -4.149  1.00 15.95  ? 437 ASN B CG  1 
ATOM   7025  O OD1 . ASN B  1 440 ? 100.263 25.453  -4.972  1.00 16.20  ? 437 ASN B OD1 1 
ATOM   7026  N ND2 . ASN B  1 440 ? 101.339 25.781  -3.042  1.00 16.60  ? 437 ASN B ND2 1 
ATOM   7027  N N   . ILE B  1 441 ? 102.029 29.971  -6.956  1.00 17.10  ? 438 ILE B N   1 
ATOM   7028  C CA  . ILE B  1 441 ? 102.136 31.364  -7.367  1.00 18.66  ? 438 ILE B CA  1 
ATOM   7029  C C   . ILE B  1 441 ? 102.285 31.358  -8.892  1.00 18.97  ? 438 ILE B C   1 
ATOM   7030  O O   . ILE B  1 441 ? 103.387 31.250  -9.440  1.00 17.56  ? 438 ILE B O   1 
ATOM   7031  C CB  . ILE B  1 441 ? 103.331 32.110  -6.757  1.00 19.65  ? 438 ILE B CB  1 
ATOM   7032  C CG1 . ILE B  1 441 ? 103.260 32.153  -5.246  1.00 21.37  ? 438 ILE B CG1 1 
ATOM   7033  C CG2 . ILE B  1 441 ? 103.371 33.549  -7.256  1.00 20.07  ? 438 ILE B CG2 1 
ATOM   7034  C CD1 . ILE B  1 441 ? 102.182 33.072  -4.695  1.00 23.19  ? 438 ILE B CD1 1 
ATOM   7035  N N   . PRO B  1 442 ? 101.161 31.478  -9.591  1.00 20.13  ? 439 PRO B N   1 
ATOM   7036  C CA  . PRO B  1 442 ? 101.204 31.489  -11.047 1.00 21.19  ? 439 PRO B CA  1 
ATOM   7037  C C   . PRO B  1 442 ? 101.900 32.743  -11.668 1.00 22.25  ? 439 PRO B C   1 
ATOM   7038  O O   . PRO B  1 442 ? 102.193 32.704  -12.848 1.00 21.49  ? 439 PRO B O   1 
ATOM   7039  C CB  . PRO B  1 442 ? 99.728  31.450  -11.410 1.00 21.47  ? 439 PRO B CB  1 
ATOM   7040  C CG  . PRO B  1 442 ? 99.071  32.197  -10.318 1.00 21.45  ? 439 PRO B CG  1 
ATOM   7041  C CD  . PRO B  1 442 ? 99.837  31.866  -9.076  1.00 20.44  ? 439 PRO B CD  1 
ATOM   7042  N N   . LEU B  1 443 ? 102.136 33.826  -10.897 1.00 22.95  ? 440 LEU B N   1 
ATOM   7043  C CA  . LEU B  1 443 ? 102.972 34.969  -11.337 1.00 22.88  ? 440 LEU B CA  1 
ATOM   7044  C C   . LEU B  1 443 ? 104.171 35.183  -10.415 1.00 21.07  ? 440 LEU B C   1 
ATOM   7045  O O   . LEU B  1 443 ? 104.201 36.147  -9.651  1.00 20.21  ? 440 LEU B O   1 
ATOM   7046  C CB  . LEU B  1 443 ? 102.152 36.277  -11.409 1.00 24.66  ? 440 LEU B CB  1 
ATOM   7047  C CG  . LEU B  1 443 ? 101.081 36.475  -12.501 1.00 24.97  ? 440 LEU B CG  1 
ATOM   7048  C CD1 . LEU B  1 443 ? 100.355 37.789  -12.270 1.00 25.19  ? 440 LEU B CD1 1 
ATOM   7049  C CD2 . LEU B  1 443 ? 101.668 36.459  -13.903 1.00 24.33  ? 440 LEU B CD2 1 
ATOM   7050  N N   . PRO B  1 444 ? 105.181 34.305  -10.495 1.00 20.73  ? 441 PRO B N   1 
ATOM   7051  C CA  . PRO B  1 444 ? 106.343 34.397  -9.599  1.00 20.66  ? 441 PRO B CA  1 
ATOM   7052  C C   . PRO B  1 444 ? 107.314 35.489  -10.019 1.00 21.02  ? 441 PRO B C   1 
ATOM   7053  O O   . PRO B  1 444 ? 108.462 35.215  -10.307 1.00 21.28  ? 441 PRO B O   1 
ATOM   7054  C CB  . PRO B  1 444 ? 106.988 33.023  -9.748  1.00 20.28  ? 441 PRO B CB  1 
ATOM   7055  C CG  . PRO B  1 444 ? 106.713 32.665  -11.168 1.00 20.42  ? 441 PRO B CG  1 
ATOM   7056  C CD  . PRO B  1 444 ? 105.326 33.182  -11.444 1.00 20.77  ? 441 PRO B CD  1 
ATOM   7057  N N   . VAL B  1 445 ? 106.847 36.730  -10.020 1.00 21.47  ? 442 VAL B N   1 
ATOM   7058  C CA  . VAL B  1 445 ? 107.650 37.840  -10.464 1.00 21.16  ? 442 VAL B CA  1 
ATOM   7059  C C   . VAL B  1 445 ? 108.520 38.230  -9.297  1.00 20.06  ? 442 VAL B C   1 
ATOM   7060  O O   . VAL B  1 445 ? 108.013 38.499  -8.217  1.00 19.44  ? 442 VAL B O   1 
ATOM   7061  C CB  . VAL B  1 445 ? 106.810 39.049  -10.916 1.00 22.59  ? 442 VAL B CB  1 
ATOM   7062  C CG1 . VAL B  1 445 ? 107.709 40.108  -11.559 1.00 23.75  ? 442 VAL B CG1 1 
ATOM   7063  C CG2 . VAL B  1 445 ? 105.765 38.639  -11.940 1.00 22.97  ? 442 VAL B CG2 1 
ATOM   7064  N N   . PRO B  1 446 ? 109.840 38.247  -9.502  1.00 19.89  ? 443 PRO B N   1 
ATOM   7065  C CA  . PRO B  1 446 ? 110.652 38.687  -8.400  1.00 19.70  ? 443 PRO B CA  1 
ATOM   7066  C C   . PRO B  1 446 ? 110.401 40.161  -8.079  1.00 19.59  ? 443 PRO B C   1 
ATOM   7067  O O   . PRO B  1 446 ? 110.028 40.972  -8.932  1.00 18.81  ? 443 PRO B O   1 
ATOM   7068  C CB  . PRO B  1 446 ? 112.085 38.439  -8.885  1.00 19.83  ? 443 PRO B CB  1 
ATOM   7069  C CG  . PRO B  1 446 ? 111.956 37.383  -9.912  1.00 20.12  ? 443 PRO B CG  1 
ATOM   7070  C CD  . PRO B  1 446 ? 110.665 37.715  -10.597 1.00 20.08  ? 443 PRO B CD  1 
ATOM   7071  N N   . VAL B  1 447 ? 110.614 40.469  -6.813  1.00 19.54  ? 444 VAL B N   1 
ATOM   7072  C CA  . VAL B  1 447 ? 110.373 41.762  -6.278  1.00 18.18  ? 444 VAL B CA  1 
ATOM   7073  C C   . VAL B  1 447 ? 111.579 42.593  -6.678  1.00 17.24  ? 444 VAL B C   1 
ATOM   7074  O O   . VAL B  1 447 ? 112.569 42.060  -7.172  1.00 16.48  ? 444 VAL B O   1 
ATOM   7075  C CB  . VAL B  1 447 ? 110.233 41.641  -4.771  1.00 19.02  ? 444 VAL B CB  1 
ATOM   7076  C CG1 . VAL B  1 447 ? 109.703 42.937  -4.185  1.00 21.65  ? 444 VAL B CG1 1 
ATOM   7077  C CG2 . VAL B  1 447 ? 109.253 40.556  -4.420  1.00 18.08  ? 444 VAL B CG2 1 
ATOM   7078  N N   . ALA B  1 448 ? 111.490 43.899  -6.498  1.00 16.92  ? 445 ALA B N   1 
ATOM   7079  C CA  . ALA B  1 448 ? 112.575 44.805  -6.860  1.00 17.38  ? 445 ALA B CA  1 
ATOM   7080  C C   . ALA B  1 448 ? 113.943 44.500  -6.269  1.00 17.67  ? 445 ALA B C   1 
ATOM   7081  O O   . ALA B  1 448 ? 114.964 44.880  -6.851  1.00 17.91  ? 445 ALA B O   1 
ATOM   7082  C CB  . ALA B  1 448 ? 112.194 46.220  -6.498  1.00 17.77  ? 445 ALA B CB  1 
ATOM   7083  N N   . TYR B  1 449 ? 113.970 43.847  -5.109  1.00 17.73  ? 446 TYR B N   1 
ATOM   7084  C CA  . TYR B  1 449 ? 115.256 43.463  -4.485  1.00 17.55  ? 446 TYR B CA  1 
ATOM   7085  C C   . TYR B  1 449 ? 115.791 42.084  -4.901  1.00 17.61  ? 446 TYR B C   1 
ATOM   7086  O O   . TYR B  1 449 ? 116.787 41.603  -4.348  1.00 17.77  ? 446 TYR B O   1 
ATOM   7087  C CB  . TYR B  1 449 ? 115.215 43.595  -2.974  1.00 16.97  ? 446 TYR B CB  1 
ATOM   7088  C CG  . TYR B  1 449 ? 114.011 43.033  -2.258  1.00 16.92  ? 446 TYR B CG  1 
ATOM   7089  C CD1 . TYR B  1 449 ? 112.824 43.774  -2.144  1.00 16.22  ? 446 TYR B CD1 1 
ATOM   7090  C CD2 . TYR B  1 449 ? 114.086 41.812  -1.592  1.00 16.84  ? 446 TYR B CD2 1 
ATOM   7091  C CE1 . TYR B  1 449 ? 111.743 43.296  -1.424  1.00 15.98  ? 446 TYR B CE1 1 
ATOM   7092  C CE2 . TYR B  1 449 ? 113.006 41.330  -0.866  1.00 16.66  ? 446 TYR B CE2 1 
ATOM   7093  C CZ  . TYR B  1 449 ? 111.833 42.072  -0.790  1.00 16.36  ? 446 TYR B CZ  1 
ATOM   7094  O OH  . TYR B  1 449 ? 110.755 41.589  -0.073  1.00 16.31  ? 446 TYR B OH  1 
ATOM   7095  N N   . HIS B  1 450 ? 115.122 41.472  -5.878  1.00 16.99  ? 447 HIS B N   1 
ATOM   7096  C CA  . HIS B  1 450 ? 115.637 40.334  -6.619  1.00 16.65  ? 447 HIS B CA  1 
ATOM   7097  C C   . HIS B  1 450 ? 115.748 40.755  -8.082  1.00 16.49  ? 447 HIS B C   1 
ATOM   7098  O O   . HIS B  1 450 ? 115.487 41.915  -8.395  1.00 16.35  ? 447 HIS B O   1 
ATOM   7099  C CB  . HIS B  1 450 ? 114.741 39.119  -6.405  1.00 16.25  ? 447 HIS B CB  1 
ATOM   7100  C CG  . HIS B  1 450 ? 114.985 38.474  -5.094  1.00 16.38  ? 447 HIS B CG  1 
ATOM   7101  N ND1 . HIS B  1 450 ? 116.004 37.571  -4.893  1.00 17.11  ? 447 HIS B ND1 1 
ATOM   7102  C CD2 . HIS B  1 450 ? 114.425 38.685  -3.886  1.00 16.77  ? 447 HIS B CD2 1 
ATOM   7103  C CE1 . HIS B  1 450 ? 116.030 37.215  -3.623  1.00 16.94  ? 447 HIS B CE1 1 
ATOM   7104  N NE2 . HIS B  1 450 ? 115.080 37.878  -2.989  1.00 17.02  ? 447 HIS B NE2 1 
ATOM   7105  N N   . SER B  1 451 ? 116.182 39.846  -8.956  1.00 15.93  ? 448 SER B N   1 
ATOM   7106  C CA  . SER B  1 451 ? 116.254 40.139  -10.377 1.00 15.52  ? 448 SER B CA  1 
ATOM   7107  C C   . SER B  1 451 ? 115.366 39.209  -11.159 1.00 15.67  ? 448 SER B C   1 
ATOM   7108  O O   . SER B  1 451 ? 115.028 38.127  -10.698 1.00 15.18  ? 448 SER B O   1 
ATOM   7109  C CB  . SER B  1 451 ? 117.678 40.060  -10.865 1.00 15.69  ? 448 SER B CB  1 
ATOM   7110  O OG  . SER B  1 451 ? 118.464 40.958  -10.106 1.00 16.21  ? 448 SER B OG  1 
ATOM   7111  N N   . PHE B  1 452 ? 114.983 39.681  -12.342 1.00 16.57  ? 449 PHE B N   1 
ATOM   7112  C CA  . PHE B  1 452 ? 113.996 39.058  -13.238 1.00 16.28  ? 449 PHE B CA  1 
ATOM   7113  C C   . PHE B  1 452 ? 114.748 38.660  -14.464 1.00 16.19  ? 449 PHE B C   1 
ATOM   7114  O O   . PHE B  1 452 ? 115.406 39.485  -15.073 1.00 15.40  ? 449 PHE B O   1 
ATOM   7115  C CB  . PHE B  1 452 ? 112.993 40.121  -13.614 1.00 16.33  ? 449 PHE B CB  1 
ATOM   7116  C CG  . PHE B  1 452 ? 111.918 39.688  -14.551 1.00 16.52  ? 449 PHE B CG  1 
ATOM   7117  C CD1 . PHE B  1 452 ? 112.152 39.547  -15.885 1.00 16.57  ? 449 PHE B CD1 1 
ATOM   7118  C CD2 . PHE B  1 452 ? 110.620 39.542  -14.096 1.00 17.96  ? 449 PHE B CD2 1 
ATOM   7119  C CE1 . PHE B  1 452 ? 111.144 39.190  -16.752 1.00 16.87  ? 449 PHE B CE1 1 
ATOM   7120  C CE2 . PHE B  1 452 ? 109.593 39.180  -14.954 1.00 18.00  ? 449 PHE B CE2 1 
ATOM   7121  C CZ  . PHE B  1 452 ? 109.863 39.009  -16.291 1.00 17.67  ? 449 PHE B CZ  1 
ATOM   7122  N N   . GLY B  1 453 ? 114.654 37.394  -14.827 1.00 16.85  ? 450 GLY B N   1 
ATOM   7123  C CA  . GLY B  1 453 ? 115.268 36.927  -16.062 1.00 17.24  ? 450 GLY B CA  1 
ATOM   7124  C C   . GLY B  1 453 ? 114.996 35.468  -16.322 1.00 17.78  ? 450 GLY B C   1 
ATOM   7125  O O   . GLY B  1 453 ? 115.019 34.649  -15.404 1.00 17.89  ? 450 GLY B O   1 
ATOM   7126  N N   . GLY B  1 454 ? 114.706 35.151  -17.578 1.00 18.72  ? 451 GLY B N   1 
ATOM   7127  C CA  . GLY B  1 454 ? 114.326 33.781  -17.973 1.00 18.73  ? 451 GLY B CA  1 
ATOM   7128  C C   . GLY B  1 454 ? 115.531 32.993  -18.451 1.00 18.24  ? 451 GLY B C   1 
ATOM   7129  O O   . GLY B  1 454 ? 116.622 33.528  -18.586 1.00 18.30  ? 451 GLY B O   1 
ATOM   7130  N N   . TRP B  1 455 ? 115.315 31.720  -18.707 1.00 17.50  ? 452 TRP B N   1 
ATOM   7131  C CA  . TRP B  1 455 ? 116.350 30.824  -19.164 1.00 17.72  ? 452 TRP B CA  1 
ATOM   7132  C C   . TRP B  1 455 ? 116.061 30.420  -20.603 1.00 19.87  ? 452 TRP B C   1 
ATOM   7133  O O   . TRP B  1 455 ? 114.986 30.715  -21.144 1.00 20.92  ? 452 TRP B O   1 
ATOM   7134  C CB  . TRP B  1 455 ? 116.343 29.571  -18.290 1.00 16.79  ? 452 TRP B CB  1 
ATOM   7135  C CG  . TRP B  1 455 ? 116.981 29.703  -16.966 1.00 15.67  ? 452 TRP B CG  1 
ATOM   7136  C CD1 . TRP B  1 455 ? 117.355 30.847  -16.341 1.00 15.39  ? 452 TRP B CD1 1 
ATOM   7137  C CD2 . TRP B  1 455 ? 117.287 28.641  -16.074 1.00 15.26  ? 452 TRP B CD2 1 
ATOM   7138  N NE1 . TRP B  1 455 ? 117.909 30.567  -15.120 1.00 15.03  ? 452 TRP B NE1 1 
ATOM   7139  C CE2 . TRP B  1 455 ? 117.873 29.217  -14.925 1.00 15.09  ? 452 TRP B CE2 1 
ATOM   7140  C CE3 . TRP B  1 455 ? 117.130 27.251  -16.131 1.00 15.28  ? 452 TRP B CE3 1 
ATOM   7141  C CZ2 . TRP B  1 455 ? 118.305 28.458  -13.846 1.00 15.00  ? 452 TRP B CZ2 1 
ATOM   7142  C CZ3 . TRP B  1 455 ? 117.578 26.493  -15.057 1.00 15.27  ? 452 TRP B CZ3 1 
ATOM   7143  C CH2 . TRP B  1 455 ? 118.155 27.102  -13.929 1.00 15.08  ? 452 TRP B CH2 1 
ATOM   7144  N N   . LYS B  1 456 ? 117.011 29.700  -21.200 1.00 21.71  ? 453 LYS B N   1 
ATOM   7145  C CA  . LYS B  1 456 ? 116.927 29.264  -22.598 1.00 23.01  ? 453 LYS B CA  1 
ATOM   7146  C C   . LYS B  1 456 ? 116.704 30.491  -23.530 1.00 22.86  ? 453 LYS B C   1 
ATOM   7147  O O   . LYS B  1 456 ? 117.398 31.489  -23.407 1.00 22.32  ? 453 LYS B O   1 
ATOM   7148  C CB  . LYS B  1 456 ? 115.890 28.138  -22.754 1.00 23.93  ? 453 LYS B CB  1 
ATOM   7149  C CG  . LYS B  1 456 ? 116.175 26.907  -21.890 1.00 25.78  ? 453 LYS B CG  1 
ATOM   7150  C CD  . LYS B  1 456 ? 115.189 25.740  -22.094 1.00 27.35  ? 453 LYS B CD  1 
ATOM   7151  C CE  . LYS B  1 456 ? 113.764 26.071  -21.638 1.00 29.27  ? 453 LYS B CE  1 
ATOM   7152  N NZ  . LYS B  1 456 ? 112.809 24.918  -21.669 1.00 29.94  ? 453 LYS B NZ  1 
ATOM   7153  N N   . ARG B  1 457 ? 115.727 30.437  -24.417 1.00 23.63  ? 454 ARG B N   1 
ATOM   7154  C CA  . ARG B  1 457 ? 115.533 31.472  -25.426 1.00 24.55  ? 454 ARG B CA  1 
ATOM   7155  C C   . ARG B  1 457 ? 114.849 32.724  -24.927 1.00 23.05  ? 454 ARG B C   1 
ATOM   7156  O O   . ARG B  1 457 ? 114.751 33.683  -25.677 1.00 22.78  ? 454 ARG B O   1 
ATOM   7157  C CB  . ARG B  1 457 ? 114.678 30.906  -26.566 1.00 27.91  ? 454 ARG B CB  1 
ATOM   7158  C CG  . ARG B  1 457 ? 115.376 29.831  -27.403 1.00 29.19  ? 454 ARG B CG  1 
ATOM   7159  C CD  . ARG B  1 457 ? 116.108 30.464  -28.568 1.00 29.72  ? 454 ARG B CD  1 
ATOM   7160  N NE  . ARG B  1 457 ? 115.165 30.900  -29.587 1.00 30.73  ? 454 ARG B NE  1 
ATOM   7161  C CZ  . ARG B  1 457 ? 115.468 31.695  -30.612 1.00 32.97  ? 454 ARG B CZ  1 
ATOM   7162  N NH1 . ARG B  1 457 ? 116.698 32.185  -30.778 1.00 32.41  ? 454 ARG B NH1 1 
ATOM   7163  N NH2 . ARG B  1 457 ? 114.515 32.030  -31.473 1.00 34.90  ? 454 ARG B NH2 1 
ATOM   7164  N N   . SER B  1 458 ? 114.344 32.702  -23.691 1.00 22.15  ? 455 SER B N   1 
ATOM   7165  C CA  . SER B  1 458 ? 113.653 33.849  -23.100 1.00 20.33  ? 455 SER B CA  1 
ATOM   7166  C C   . SER B  1 458 ? 114.620 34.950  -22.739 1.00 19.47  ? 455 SER B C   1 
ATOM   7167  O O   . SER B  1 458 ? 114.184 36.073  -22.518 1.00 20.49  ? 455 SER B O   1 
ATOM   7168  C CB  . SER B  1 458 ? 112.864 33.465  -21.845 1.00 19.79  ? 455 SER B CB  1 
ATOM   7169  O OG  . SER B  1 458 ? 111.839 32.560  -22.141 1.00 19.43  ? 455 SER B OG  1 
ATOM   7170  N N   . LEU B  1 459 ? 115.913 34.665  -22.673 1.00 18.00  ? 456 LEU B N   1 
ATOM   7171  C CA  . LEU B  1 459 ? 116.869 35.699  -22.305 1.00 17.58  ? 456 LEU B CA  1 
ATOM   7172  C C   . LEU B  1 459 ? 118.177 35.477  -23.002 1.00 17.41  ? 456 LEU B C   1 
ATOM   7173  O O   . LEU B  1 459 ? 118.609 34.337  -23.148 1.00 18.40  ? 456 LEU B O   1 
ATOM   7174  C CB  . LEU B  1 459 ? 117.079 35.666  -20.798 1.00 17.68  ? 456 LEU B CB  1 
ATOM   7175  C CG  . LEU B  1 459 ? 117.913 36.761  -20.139 1.00 17.92  ? 456 LEU B CG  1 
ATOM   7176  C CD1 . LEU B  1 459 ? 117.382 37.048  -18.751 1.00 18.07  ? 456 LEU B CD1 1 
ATOM   7177  C CD2 . LEU B  1 459 ? 119.384 36.389  -20.021 1.00 18.48  ? 456 LEU B CD2 1 
ATOM   7178  N N   . PHE B  1 460 ? 118.808 36.575  -23.420 1.00 17.04  ? 457 PHE B N   1 
ATOM   7179  C CA  . PHE B  1 460 ? 120.181 36.580  -23.944 1.00 16.35  ? 457 PHE B CA  1 
ATOM   7180  C C   . PHE B  1 460 ? 121.068 37.425  -23.055 1.00 16.10  ? 457 PHE B C   1 
ATOM   7181  O O   . PHE B  1 460 ? 120.808 38.625  -22.848 1.00 15.17  ? 457 PHE B O   1 
ATOM   7182  C CB  . PHE B  1 460 ? 120.214 37.115  -25.358 1.00 16.60  ? 457 PHE B CB  1 
ATOM   7183  C CG  . PHE B  1 460 ? 119.308 36.381  -26.263 1.00 17.58  ? 457 PHE B CG  1 
ATOM   7184  C CD1 . PHE B  1 460 ? 117.981 36.691  -26.317 1.00 18.32  ? 457 PHE B CD1 1 
ATOM   7185  C CD2 . PHE B  1 460 ? 119.766 35.334  -27.003 1.00 18.67  ? 457 PHE B CD2 1 
ATOM   7186  C CE1 . PHE B  1 460 ? 117.117 35.987  -27.123 1.00 18.98  ? 457 PHE B CE1 1 
ATOM   7187  C CE2 . PHE B  1 460 ? 118.919 34.626  -27.816 1.00 19.26  ? 457 PHE B CE2 1 
ATOM   7188  C CZ  . PHE B  1 460 ? 117.588 34.949  -27.876 1.00 19.13  ? 457 PHE B CZ  1 
ATOM   7189  N N   . GLY B  1 461 ? 122.111 36.784  -22.525 1.00 16.07  ? 458 GLY B N   1 
ATOM   7190  C CA  . GLY B  1 461 ? 123.092 37.448  -21.674 1.00 16.03  ? 458 GLY B CA  1 
ATOM   7191  C C   . GLY B  1 461 ? 123.300 36.674  -20.398 1.00 15.91  ? 458 GLY B C   1 
ATOM   7192  O O   . GLY B  1 461 ? 122.769 35.578  -20.252 1.00 16.19  ? 458 GLY B O   1 
ATOM   7193  N N   . ASP B  1 462 ? 124.059 37.250  -19.470 1.00 16.08  ? 459 ASP B N   1 
ATOM   7194  C CA  . ASP B  1 462 ? 124.364 36.586  -18.192 1.00 16.58  ? 459 ASP B CA  1 
ATOM   7195  C C   . ASP B  1 462 ? 124.023 37.417  -16.946 1.00 17.11  ? 459 ASP B C   1 
ATOM   7196  O O   . ASP B  1 462 ? 124.391 37.035  -15.826 1.00 20.80  ? 459 ASP B O   1 
ATOM   7197  C CB  . ASP B  1 462 ? 125.833 36.152  -18.162 1.00 16.28  ? 459 ASP B CB  1 
ATOM   7198  C CG  . ASP B  1 462 ? 126.763 37.282  -18.452 1.00 16.58  ? 459 ASP B CG  1 
ATOM   7199  O OD1 . ASP B  1 462 ? 126.401 38.420  -18.129 1.00 16.77  ? 459 ASP B OD1 1 
ATOM   7200  O OD2 . ASP B  1 462 ? 127.835 37.053  -19.034 1.00 17.18  ? 459 ASP B OD2 1 
ATOM   7201  N N   . LEU B  1 463 ? 123.336 38.536  -17.116 1.00 16.25  ? 460 LEU B N   1 
ATOM   7202  C CA  . LEU B  1 463 ? 122.889 39.331  -15.971 1.00 16.24  ? 460 LEU B CA  1 
ATOM   7203  C C   . LEU B  1 463 ? 121.472 39.764  -16.219 1.00 16.07  ? 460 LEU B C   1 
ATOM   7204  O O   . LEU B  1 463 ? 121.187 40.393  -17.234 1.00 17.08  ? 460 LEU B O   1 
ATOM   7205  C CB  . LEU B  1 463 ? 123.747 40.578  -15.779 1.00 16.36  ? 460 LEU B CB  1 
ATOM   7206  C CG  . LEU B  1 463 ? 125.167 40.361  -15.252 1.00 16.35  ? 460 LEU B CG  1 
ATOM   7207  C CD1 . LEU B  1 463 ? 125.853 41.721  -15.225 1.00 16.59  ? 460 LEU B CD1 1 
ATOM   7208  C CD2 . LEU B  1 463 ? 125.184 39.734  -13.881 1.00 15.99  ? 460 LEU B CD2 1 
ATOM   7209  N N   . HIS B  1 464 ? 120.590 39.441  -15.285 1.00 15.25  ? 461 HIS B N   1 
ATOM   7210  C CA  . HIS B  1 464 ? 119.158 39.604  -15.470 1.00 14.76  ? 461 HIS B CA  1 
ATOM   7211  C C   . HIS B  1 464 ? 118.747 41.002  -15.130 1.00 14.79  ? 461 HIS B C   1 
ATOM   7212  O O   . HIS B  1 464 ? 119.577 41.818  -14.800 1.00 15.33  ? 461 HIS B O   1 
ATOM   7213  C CB  . HIS B  1 464 ? 118.422 38.582  -14.623 1.00 14.61  ? 461 HIS B CB  1 
ATOM   7214  C CG  . HIS B  1 464 ? 118.746 37.174  -14.990 1.00 14.79  ? 461 HIS B CG  1 
ATOM   7215  N ND1 . HIS B  1 464 ? 118.076 36.096  -14.458 1.00 15.17  ? 461 HIS B ND1 1 
ATOM   7216  C CD2 . HIS B  1 464 ? 119.663 36.662  -15.847 1.00 14.88  ? 461 HIS B CD2 1 
ATOM   7217  C CE1 . HIS B  1 464 ? 118.578 34.981  -14.957 1.00 14.98  ? 461 HIS B CE1 1 
ATOM   7218  N NE2 . HIS B  1 464 ? 119.537 35.299  -15.808 1.00 14.94  ? 461 HIS B NE2 1 
ATOM   7219  N N   . ALA B  1 465 ? 117.457 41.270  -15.226 1.00 15.05  ? 462 ALA B N   1 
ATOM   7220  C CA  . ALA B  1 465 ? 116.921 42.616  -15.114 1.00 15.55  ? 462 ALA B CA  1 
ATOM   7221  C C   . ALA B  1 465 ? 116.572 43.062  -13.705 1.00 15.22  ? 462 ALA B C   1 
ATOM   7222  O O   . ALA B  1 465 ? 116.049 42.309  -12.881 1.00 15.09  ? 462 ALA B O   1 
ATOM   7223  C CB  . ALA B  1 465 ? 115.680 42.742  -15.986 1.00 16.49  ? 462 ALA B CB  1 
ATOM   7224  N N   . TYR B  1 466 ? 116.812 44.346  -13.488 1.00 15.11  ? 463 TYR B N   1 
ATOM   7225  C CA  . TYR B  1 466 ? 116.613 45.023  -12.212 1.00 14.98  ? 463 TYR B CA  1 
ATOM   7226  C C   . TYR B  1 466 ? 117.251 44.270  -11.066 1.00 14.57  ? 463 TYR B C   1 
ATOM   7227  O O   . TYR B  1 466 ? 118.043 43.355  -11.319 1.00 14.27  ? 463 TYR B O   1 
ATOM   7228  C CB  . TYR B  1 466 ? 115.140 45.429  -11.996 1.00 15.38  ? 463 TYR B CB  1 
ATOM   7229  C CG  . TYR B  1 466 ? 114.093 44.367  -11.786 1.00 15.76  ? 463 TYR B CG  1 
ATOM   7230  C CD1 . TYR B  1 466 ? 113.276 43.961  -12.833 1.00 16.07  ? 463 TYR B CD1 1 
ATOM   7231  C CD2 . TYR B  1 466 ? 113.837 43.845  -10.532 1.00 15.89  ? 463 TYR B CD2 1 
ATOM   7232  C CE1 . TYR B  1 466 ? 112.266 43.032  -12.643 1.00 15.93  ? 463 TYR B CE1 1 
ATOM   7233  C CE2 . TYR B  1 466 ? 112.832 42.897  -10.345 1.00 15.80  ? 463 TYR B CE2 1 
ATOM   7234  C CZ  . TYR B  1 466 ? 112.057 42.500  -11.409 1.00 15.66  ? 463 TYR B CZ  1 
ATOM   7235  O OH  . TYR B  1 466 ? 111.053 41.581  -11.283 1.00 15.45  ? 463 TYR B OH  1 
ATOM   7236  N N   . GLY B  1 467 ? 116.990 44.701  -9.828  1.00 14.32  ? 464 GLY B N   1 
ATOM   7237  C CA  . GLY B  1 467 ? 117.481 44.007  -8.635  1.00 13.81  ? 464 GLY B CA  1 
ATOM   7238  C C   . GLY B  1 467 ? 118.979 44.013  -8.501  1.00 13.53  ? 464 GLY B C   1 
ATOM   7239  O O   . GLY B  1 467 ? 119.615 44.950  -8.929  1.00 13.07  ? 464 GLY B O   1 
ATOM   7240  N N   . PRO B  1 468 ? 119.563 42.949  -7.904  1.00 13.86  ? 465 PRO B N   1 
ATOM   7241  C CA  . PRO B  1 468 ? 121.014 42.976  -7.824  1.00 13.47  ? 465 PRO B CA  1 
ATOM   7242  C C   . PRO B  1 468 ? 121.770 42.857  -9.138  1.00 12.76  ? 465 PRO B C   1 
ATOM   7243  O O   . PRO B  1 468 ? 122.751 43.567  -9.282  1.00 13.16  ? 465 PRO B O   1 
ATOM   7244  C CB  . PRO B  1 468 ? 121.323 41.777  -6.928  1.00 13.56  ? 465 PRO B CB  1 
ATOM   7245  C CG  . PRO B  1 468 ? 120.156 41.729  -6.025  1.00 13.55  ? 465 PRO B CG  1 
ATOM   7246  C CD  . PRO B  1 468 ? 119.041 41.885  -7.020  1.00 13.74  ? 465 PRO B CD  1 
ATOM   7247  N N   . ASP B  1 469 ? 121.351 41.990  -10.061 1.00 11.81  ? 466 ASP B N   1 
ATOM   7248  C CA  . ASP B  1 469 ? 122.090 41.811  -11.322 1.00 11.28  ? 466 ASP B CA  1 
ATOM   7249  C C   . ASP B  1 469 ? 122.253 43.109  -12.063 1.00 11.21  ? 466 ASP B C   1 
ATOM   7250  O O   . ASP B  1 469 ? 123.282 43.337  -12.666 1.00 11.47  ? 466 ASP B O   1 
ATOM   7251  C CB  . ASP B  1 469 ? 121.435 40.802  -12.239 1.00 11.11  ? 466 ASP B CB  1 
ATOM   7252  C CG  . ASP B  1 469 ? 121.731 39.394  -11.835 1.00 11.20  ? 466 ASP B CG  1 
ATOM   7253  O OD1 . ASP B  1 469 ? 122.319 39.185  -10.748 1.00 10.96  ? 466 ASP B OD1 1 
ATOM   7254  O OD2 . ASP B  1 469 ? 121.385 38.470  -12.597 1.00 11.06  ? 466 ASP B OD2 1 
ATOM   7255  N N   . ALA B  1 470 ? 121.269 43.988  -11.959 1.00 11.02  ? 467 ALA B N   1 
ATOM   7256  C CA  . ALA B  1 470 ? 121.335 45.285  -12.608 1.00 11.08  ? 467 ALA B CA  1 
ATOM   7257  C C   . ALA B  1 470 ? 122.434 46.218  -12.101 1.00 11.31  ? 467 ALA B C   1 
ATOM   7258  O O   . ALA B  1 470 ? 122.900 47.075  -12.818 1.00 11.34  ? 467 ALA B O   1 
ATOM   7259  C CB  . ALA B  1 470 ? 119.998 45.969  -12.484 1.00 11.06  ? 467 ALA B CB  1 
ATOM   7260  N N   . VAL B  1 471 ? 122.837 46.077  -10.858 1.00 11.79  ? 468 VAL B N   1 
ATOM   7261  C CA  . VAL B  1 471 ? 123.902 46.914  -10.331 1.00 12.09  ? 468 VAL B CA  1 
ATOM   7262  C C   . VAL B  1 471 ? 125.157 46.523  -11.086 1.00 13.08  ? 468 VAL B C   1 
ATOM   7263  O O   . VAL B  1 471 ? 125.983 47.399  -11.404 1.00 13.19  ? 468 VAL B O   1 
ATOM   7264  C CB  . VAL B  1 471 ? 124.137 46.695  -8.821  1.00 11.60  ? 468 VAL B CB  1 
ATOM   7265  C CG1 . VAL B  1 471 ? 125.118 47.702  -8.270  1.00 11.40  ? 468 VAL B CG1 1 
ATOM   7266  C CG2 . VAL B  1 471 ? 122.850 46.854  -8.053  1.00 11.74  ? 468 VAL B CG2 1 
ATOM   7267  N N   . ARG B  1 472 ? 125.287 45.214  -11.362 1.00 13.75  ? 469 ARG B N   1 
ATOM   7268  C CA  . ARG B  1 472 ? 126.471 44.677  -11.991 1.00 14.85  ? 469 ARG B CA  1 
ATOM   7269  C C   . ARG B  1 472 ? 126.467 44.920  -13.493 1.00 14.93  ? 469 ARG B C   1 
ATOM   7270  O O   . ARG B  1 472 ? 127.532 45.062  -14.126 1.00 15.69  ? 469 ARG B O   1 
ATOM   7271  C CB  . ARG B  1 472 ? 126.597 43.200  -11.710 1.00 16.12  ? 469 ARG B CB  1 
ATOM   7272  C CG  . ARG B  1 472 ? 126.841 42.894  -10.256 1.00 17.60  ? 469 ARG B CG  1 
ATOM   7273  C CD  . ARG B  1 472 ? 128.212 43.356  -9.781  1.00 19.28  ? 469 ARG B CD  1 
ATOM   7274  N NE  . ARG B  1 472 ? 129.277 42.449  -10.202 1.00 20.72  ? 469 ARG B NE  1 
ATOM   7275  C CZ  . ARG B  1 472 ? 130.089 42.644  -11.228 1.00 23.44  ? 469 ARG B CZ  1 
ATOM   7276  N NH1 . ARG B  1 472 ? 129.989 43.744  -12.010 1.00 26.81  ? 469 ARG B NH1 1 
ATOM   7277  N NH2 . ARG B  1 472 ? 131.015 41.728  -11.476 1.00 23.23  ? 469 ARG B NH2 1 
ATOM   7278  N N   . PHE B  1 473 ? 125.273 44.942  -14.067 1.00 14.38  ? 470 PHE B N   1 
ATOM   7279  C CA  . PHE B  1 473 ? 125.143 45.209  -15.473 1.00 13.65  ? 470 PHE B CA  1 
ATOM   7280  C C   . PHE B  1 473 ? 125.414 46.670  -15.780 1.00 13.95  ? 470 PHE B C   1 
ATOM   7281  O O   . PHE B  1 473 ? 126.023 46.975  -16.806 1.00 14.25  ? 470 PHE B O   1 
ATOM   7282  C CB  . PHE B  1 473 ? 123.774 44.807  -16.005 1.00 12.97  ? 470 PHE B CB  1 
ATOM   7283  C CG  . PHE B  1 473 ? 123.658 44.988  -17.491 1.00 12.64  ? 470 PHE B CG  1 
ATOM   7284  C CD1 . PHE B  1 473 ? 124.281 44.090  -18.361 1.00 12.46  ? 470 PHE B CD1 1 
ATOM   7285  C CD2 . PHE B  1 473 ? 123.005 46.083  -18.024 1.00 12.31  ? 470 PHE B CD2 1 
ATOM   7286  C CE1 . PHE B  1 473 ? 124.216 44.266  -19.721 1.00 12.26  ? 470 PHE B CE1 1 
ATOM   7287  C CE2 . PHE B  1 473 ? 122.940 46.263  -19.393 1.00 12.26  ? 470 PHE B CE2 1 
ATOM   7288  C CZ  . PHE B  1 473 ? 123.546 45.359  -20.242 1.00 12.26  ? 470 PHE B CZ  1 
ATOM   7289  N N   . TYR B  1 474 ? 124.956 47.563  -14.906 1.00 14.14  ? 471 TYR B N   1 
ATOM   7290  C CA  . TYR B  1 474 ? 125.150 48.990  -15.092 1.00 14.46  ? 471 TYR B CA  1 
ATOM   7291  C C   . TYR B  1 474 ? 126.457 49.535  -14.463 1.00 15.19  ? 471 TYR B C   1 
ATOM   7292  O O   . TYR B  1 474 ? 126.621 50.735  -14.327 1.00 15.34  ? 471 TYR B O   1 
ATOM   7293  C CB  . TYR B  1 474 ? 123.943 49.741  -14.550 1.00 14.48  ? 471 TYR B CB  1 
ATOM   7294  C CG  . TYR B  1 474 ? 122.634 49.490  -15.273 1.00 14.68  ? 471 TYR B CG  1 
ATOM   7295  C CD1 . TYR B  1 474 ? 122.552 49.527  -16.653 1.00 14.90  ? 471 TYR B CD1 1 
ATOM   7296  C CD2 . TYR B  1 474 ? 121.453 49.291  -14.559 1.00 14.90  ? 471 TYR B CD2 1 
ATOM   7297  C CE1 . TYR B  1 474 ? 121.340 49.334  -17.303 1.00 15.21  ? 471 TYR B CE1 1 
ATOM   7298  C CE2 . TYR B  1 474 ? 120.239 49.104  -15.196 1.00 15.13  ? 471 TYR B CE2 1 
ATOM   7299  C CZ  . TYR B  1 474 ? 120.181 49.125  -16.572 1.00 15.24  ? 471 TYR B CZ  1 
ATOM   7300  O OH  . TYR B  1 474 ? 118.976 48.920  -17.222 1.00 14.91  ? 471 TYR B OH  1 
ATOM   7301  N N   . THR B  1 475 ? 127.392 48.675  -14.078 1.00 15.79  ? 472 THR B N   1 
ATOM   7302  C CA  . THR B  1 475 ? 128.698 49.141  -13.645 1.00 16.53  ? 472 THR B CA  1 
ATOM   7303  C C   . THR B  1 475 ? 129.743 48.182  -14.120 1.00 17.09  ? 472 THR B C   1 
ATOM   7304  O O   . THR B  1 475 ? 129.440 47.055  -14.445 1.00 18.07  ? 472 THR B O   1 
ATOM   7305  C CB  . THR B  1 475 ? 128.809 49.202  -12.121 1.00 17.33  ? 472 THR B CB  1 
ATOM   7306  O OG1 . THR B  1 475 ? 128.592 47.894  -11.564 1.00 17.94  ? 472 THR B OG1 1 
ATOM   7307  C CG2 . THR B  1 475 ? 127.803 50.203  -11.534 1.00 17.60  ? 472 THR B CG2 1 
ATOM   7308  N N   . LYS B  1 476 ? 130.990 48.628  -14.129 1.00 17.70  ? 473 LYS B N   1 
ATOM   7309  C CA  . LYS B  1 476 ? 132.100 47.796  -14.596 1.00 17.79  ? 473 LYS B CA  1 
ATOM   7310  C C   . LYS B  1 476 ? 133.123 47.645  -13.479 1.00 16.82  ? 473 LYS B C   1 
ATOM   7311  O O   . LYS B  1 476 ? 133.428 48.603  -12.770 1.00 16.34  ? 473 LYS B O   1 
ATOM   7312  C CB  . LYS B  1 476 ? 132.722 48.336  -15.885 1.00 18.98  ? 473 LYS B CB  1 
ATOM   7313  C CG  . LYS B  1 476 ? 132.924 49.830  -15.940 1.00 20.62  ? 473 LYS B CG  1 
ATOM   7314  C CD  . LYS B  1 476 ? 133.491 50.246  -17.285 1.00 23.12  ? 473 LYS B CD  1 
ATOM   7315  C CE  . LYS B  1 476 ? 133.673 51.777  -17.365 1.00 24.54  ? 473 LYS B CE  1 
ATOM   7316  N NZ  . LYS B  1 476 ? 134.370 52.248  -18.621 1.00 25.23  ? 473 LYS B NZ  1 
ATOM   7317  N N   . ARG B  1 477 ? 133.626 46.429  -13.311 1.00 16.07  ? 474 ARG B N   1 
ATOM   7318  C CA  . ARG B  1 477 ? 134.531 46.112  -12.200 1.00 15.52  ? 474 ARG B CA  1 
ATOM   7319  C C   . ARG B  1 477 ? 135.892 46.735  -12.430 1.00 14.93  ? 474 ARG B C   1 
ATOM   7320  O O   . ARG B  1 477 ? 136.470 46.589  -13.518 1.00 13.87  ? 474 ARG B O   1 
ATOM   7321  C CB  . ARG B  1 477 ? 134.704 44.598  -12.056 1.00 15.68  ? 474 ARG B CB  1 
ATOM   7322  C CG  . ARG B  1 477 ? 135.703 44.152  -10.980 1.00 15.66  ? 474 ARG B CG  1 
ATOM   7323  C CD  . ARG B  1 477 ? 135.889 42.624  -10.930 1.00 15.41  ? 474 ARG B CD  1 
ATOM   7324  N NE  . ARG B  1 477 ? 134.724 41.910  -10.396 1.00 14.87  ? 474 ARG B NE  1 
ATOM   7325  C CZ  . ARG B  1 477 ? 134.391 41.855  -9.115  1.00 15.14  ? 474 ARG B CZ  1 
ATOM   7326  N NH1 . ARG B  1 477 ? 135.124 42.460  -8.185  1.00 16.05  ? 474 ARG B NH1 1 
ATOM   7327  N NH2 . ARG B  1 477 ? 133.321 41.172  -8.741  1.00 15.10  ? 474 ARG B NH2 1 
ATOM   7328  N N   . LYS B  1 478 ? 136.377 47.427  -11.397 1.00 14.50  ? 475 LYS B N   1 
ATOM   7329  C CA  . LYS B  1 478 ? 137.754 47.905  -11.330 1.00 14.31  ? 475 LYS B CA  1 
ATOM   7330  C C   . LYS B  1 478 ? 138.375 47.246  -10.135 1.00 13.77  ? 475 LYS B C   1 
ATOM   7331  O O   . LYS B  1 478 ? 137.740 47.157  -9.111  1.00 13.85  ? 475 LYS B O   1 
ATOM   7332  C CB  . LYS B  1 478 ? 137.840 49.440  -11.191 1.00 14.48  ? 475 LYS B CB  1 
ATOM   7333  C CG  . LYS B  1 478 ? 139.277 49.972  -11.172 1.00 14.74  ? 475 LYS B CG  1 
ATOM   7334  C CD  . LYS B  1 478 ? 139.342 51.485  -11.102 1.00 15.05  ? 475 LYS B CD  1 
ATOM   7335  C CE  . LYS B  1 478 ? 139.190 52.142  -12.477 1.00 15.11  ? 475 LYS B CE  1 
ATOM   7336  N NZ  . LYS B  1 478 ? 139.242 53.636  -12.413 1.00 14.82  ? 475 LYS B NZ  1 
ATOM   7337  N N   . THR B  1 479 ? 139.604 46.770  -10.263 1.00 13.44  ? 476 THR B N   1 
ATOM   7338  C CA  . THR B  1 479 ? 140.327 46.301  -9.097  1.00 13.17  ? 476 THR B CA  1 
ATOM   7339  C C   . THR B  1 479 ? 141.586 47.110  -8.949  1.00 13.25  ? 476 THR B C   1 
ATOM   7340  O O   . THR B  1 479 ? 142.387 47.170  -9.870  1.00 13.04  ? 476 THR B O   1 
ATOM   7341  C CB  . THR B  1 479 ? 140.640 44.817  -9.220  1.00 12.91  ? 476 THR B CB  1 
ATOM   7342  O OG1 . THR B  1 479 ? 139.462 44.145  -9.672  1.00 13.02  ? 476 THR B OG1 1 
ATOM   7343  C CG2 . THR B  1 479 ? 141.049 44.247  -7.896  1.00 12.72  ? 476 THR B CG2 1 
ATOM   7344  N N   . VAL B  1 480 ? 141.745 47.739  -7.785  1.00 13.75  ? 477 VAL B N   1 
ATOM   7345  C CA  . VAL B  1 480 ? 142.975 48.458  -7.452  1.00 14.35  ? 477 VAL B CA  1 
ATOM   7346  C C   . VAL B  1 480 ? 143.858 47.595  -6.570  1.00 15.44  ? 477 VAL B C   1 
ATOM   7347  O O   . VAL B  1 480 ? 143.361 46.904  -5.696  1.00 16.04  ? 477 VAL B O   1 
ATOM   7348  C CB  . VAL B  1 480 ? 142.695 49.775  -6.716  1.00 13.96  ? 477 VAL B CB  1 
ATOM   7349  C CG1 . VAL B  1 480 ? 143.984 50.546  -6.509  1.00 13.97  ? 477 VAL B CG1 1 
ATOM   7350  C CG2 . VAL B  1 480 ? 141.723 50.646  -7.491  1.00 13.69  ? 477 VAL B CG2 1 
ATOM   7351  N N   . THR B  1 481 ? 145.165 47.631  -6.801  1.00 16.74  ? 478 THR B N   1 
ATOM   7352  C CA  . THR B  1 481 ? 146.124 47.002  -5.882  1.00 17.60  ? 478 THR B CA  1 
ATOM   7353  C C   . THR B  1 481 ? 147.164 48.059  -5.436  1.00 19.03  ? 478 THR B C   1 
ATOM   7354  O O   . THR B  1 481 ? 147.851 48.680  -6.256  1.00 20.22  ? 478 THR B O   1 
ATOM   7355  C CB  . THR B  1 481 ? 146.733 45.761  -6.540  1.00 17.29  ? 478 THR B CB  1 
ATOM   7356  O OG1 . THR B  1 481 ? 145.681 44.818  -6.766  1.00 16.49  ? 478 THR B OG1 1 
ATOM   7357  C CG2 . THR B  1 481 ? 147.782 45.127  -5.673  1.00 17.56  ? 478 THR B CG2 1 
ATOM   7358  N N   . GLN B  1 482 ? 147.252 48.270  -4.126  1.00 19.65  ? 479 GLN B N   1 
ATOM   7359  C CA  . GLN B  1 482 ? 147.969 49.411  -3.551  1.00 19.59  ? 479 GLN B CA  1 
ATOM   7360  C C   . GLN B  1 482 ? 149.159 48.982  -2.703  1.00 20.13  ? 479 GLN B C   1 
ATOM   7361  O O   . GLN B  1 482 ? 149.061 48.076  -1.926  1.00 20.65  ? 479 GLN B O   1 
ATOM   7362  C CB  . GLN B  1 482 ? 147.005 50.239  -2.695  1.00 19.23  ? 479 GLN B CB  1 
ATOM   7363  C CG  . GLN B  1 482 ? 147.534 51.602  -2.312  1.00 18.96  ? 479 GLN B CG  1 
ATOM   7364  C CD  . GLN B  1 482 ? 146.618 52.322  -1.358  1.00 18.82  ? 479 GLN B CD  1 
ATOM   7365  O OE1 . GLN B  1 482 ? 146.510 51.951  -0.192  1.00 17.41  ? 479 GLN B OE1 1 
ATOM   7366  N NE2 . GLN B  1 482 ? 145.965 53.378  -1.843  1.00 19.74  ? 479 GLN B NE2 1 
ATOM   7367  N N   . ARG B  1 483 ? 150.275 49.675  -2.842  1.00 21.91  ? 480 ARG B N   1 
ATOM   7368  C CA  . ARG B  1 483 ? 151.485 49.393  -2.092  1.00 23.07  ? 480 ARG B CA  1 
ATOM   7369  C C   . ARG B  1 483 ? 152.178 50.713  -1.916  1.00 22.08  ? 480 ARG B C   1 
ATOM   7370  O O   . ARG B  1 483 ? 152.110 51.566  -2.793  1.00 20.20  ? 480 ARG B O   1 
ATOM   7371  C CB  . ARG B  1 483 ? 152.356 48.440  -2.898  1.00 26.54  ? 480 ARG B CB  1 
ATOM   7372  C CG  . ARG B  1 483 ? 153.724 48.157  -2.331  1.00 31.39  ? 480 ARG B CG  1 
ATOM   7373  C CD  . ARG B  1 483 ? 154.385 46.975  -3.031  1.00 36.34  ? 480 ARG B CD  1 
ATOM   7374  N NE  . ARG B  1 483 ? 155.661 46.701  -2.379  1.00 44.13  ? 480 ARG B NE  1 
ATOM   7375  C CZ  . ARG B  1 483 ? 156.843 47.180  -2.766  1.00 49.29  ? 480 ARG B CZ  1 
ATOM   7376  N NH1 . ARG B  1 483 ? 157.938 46.898  -2.053  1.00 50.05  ? 480 ARG B NH1 1 
ATOM   7377  N NH2 . ARG B  1 483 ? 156.945 47.931  -3.864  1.00 52.18  ? 480 ARG B NH2 1 
ATOM   7378  N N   . TRP B  1 484 ? 152.855 50.882  -0.791  1.00 22.47  ? 481 TRP B N   1 
ATOM   7379  C CA  . TRP B  1 484 ? 153.624 52.102  -0.526  1.00 23.04  ? 481 TRP B CA  1 
ATOM   7380  C C   . TRP B  1 484 ? 155.039 51.740  -0.086  1.00 24.67  ? 481 TRP B C   1 
ATOM   7381  O O   . TRP B  1 484 ? 155.286 51.529  1.105   1.00 26.05  ? 481 TRP B O   1 
ATOM   7382  C CB  . TRP B  1 484 ? 152.956 52.932  0.549   1.00 22.63  ? 481 TRP B CB  1 
ATOM   7383  C CG  . TRP B  1 484 ? 151.572 53.387  0.225   1.00 22.59  ? 481 TRP B CG  1 
ATOM   7384  C CD1 . TRP B  1 484 ? 150.414 52.879  0.721   1.00 22.70  ? 481 TRP B CD1 1 
ATOM   7385  C CD2 . TRP B  1 484 ? 151.194 54.462  -0.656  1.00 22.75  ? 481 TRP B CD2 1 
ATOM   7386  N NE1 . TRP B  1 484 ? 149.330 53.567  0.211   1.00 23.27  ? 481 TRP B NE1 1 
ATOM   7387  C CE2 . TRP B  1 484 ? 149.778 54.547  -0.629  1.00 22.44  ? 481 TRP B CE2 1 
ATOM   7388  C CE3 . TRP B  1 484 ? 151.912 55.351  -1.472  1.00 22.13  ? 481 TRP B CE3 1 
ATOM   7389  C CZ2 . TRP B  1 484 ? 149.068 55.489  -1.368  1.00 21.78  ? 481 TRP B CZ2 1 
ATOM   7390  C CZ3 . TRP B  1 484 ? 151.205 56.287  -2.213  1.00 21.94  ? 481 TRP B CZ3 1 
ATOM   7391  C CH2 . TRP B  1 484 ? 149.792 56.349  -2.152  1.00 22.09  ? 481 TRP B CH2 1 
ATOM   7392  N N   . PRO B  1 485 ? 155.985 51.676  -1.039  1.00 26.25  ? 482 PRO B N   1 
ATOM   7393  C CA  . PRO B  1 485 ? 157.333 51.184  -0.758  1.00 26.81  ? 482 PRO B CA  1 
ATOM   7394  C C   . PRO B  1 485 ? 158.173 52.042  0.183   1.00 26.02  ? 482 PRO B C   1 
ATOM   7395  O O   . PRO B  1 485 ? 159.070 51.511  0.834   1.00 28.22  ? 482 PRO B O   1 
ATOM   7396  C CB  . PRO B  1 485 ? 157.983 51.195  -2.137  1.00 27.57  ? 482 PRO B CB  1 
ATOM   7397  C CG  . PRO B  1 485 ? 157.331 52.351  -2.822  1.00 27.41  ? 482 PRO B CG  1 
ATOM   7398  C CD  . PRO B  1 485 ? 155.904 52.286  -2.382  1.00 27.12  ? 482 PRO B CD  1 
ATOM   7399  N N   . SER B  1 486 ? 157.892 53.339  0.239   1.00 25.44  ? 483 SER B N   1 
ATOM   7400  C CA  . SER B  1 486 ? 158.729 54.300  0.953   1.00 26.55  ? 483 SER B CA  1 
ATOM   7401  C C   . SER B  1 486 ? 158.076 54.943  2.176   1.00 25.73  ? 483 SER B C   1 
ATOM   7402  O O   . SER B  1 486 ? 157.062 55.619  2.057   1.00 26.36  ? 483 SER B O   1 
ATOM   7403  C CB  . SER B  1 486 ? 159.185 55.393  -0.011  1.00 28.07  ? 483 SER B CB  1 
ATOM   7404  O OG  . SER B  1 486 ? 158.147 55.717  -0.933  1.00 31.41  ? 483 SER B OG  1 
ATOM   7405  N N   . ALA B  1 487 ? 158.715 54.779  3.335   1.00 24.50  ? 484 ALA B N   1 
ATOM   7406  C CA  . ALA B  1 487 ? 158.218 55.281  4.600   1.00 23.23  ? 484 ALA B CA  1 
ATOM   7407  C C   . ALA B  1 487 ? 159.034 56.464  5.129   1.00 22.51  ? 484 ALA B C   1 
ATOM   7408  O O   . ALA B  1 487 ? 159.150 56.653  6.334   1.00 21.83  ? 484 ALA B O   1 
ATOM   7409  C CB  . ALA B  1 487 ? 158.233 54.144  5.608   1.00 24.40  ? 484 ALA B CB  1 
ATOM   7410  N N   . GLY B  1 488 ? 159.581 57.270  4.229   1.00 21.98  ? 485 GLY B N   1 
ATOM   7411  C CA  . GLY B  1 488 ? 160.333 58.455  4.606   1.00 22.19  ? 485 GLY B CA  1 
ATOM   7412  C C   . GLY B  1 488 ? 159.631 59.426  5.533   1.00 22.41  ? 485 GLY B C   1 
ATOM   7413  O O   . GLY B  1 488 ? 160.113 59.708  6.625   1.00 24.62  ? 485 GLY B O   1 
ATOM   7414  N N   . VAL B  1 489 ? 158.489 59.941  5.117   1.00 23.54  ? 486 VAL B N   1 
ATOM   7415  C CA  . VAL B  1 489 ? 157.835 61.015  5.898   1.00 24.31  ? 486 VAL B CA  1 
ATOM   7416  C C   . VAL B  1 489 ? 157.464 60.503  7.280   1.00 24.58  ? 486 VAL B C   1 
ATOM   7417  O O   . VAL B  1 489 ? 157.701 61.189  8.257   1.00 25.16  ? 486 VAL B O   1 
ATOM   7418  C CB  . VAL B  1 489 ? 156.680 61.815  5.172   1.00 23.61  ? 486 VAL B CB  1 
ATOM   7419  C CG1 . VAL B  1 489 ? 156.449 61.355  3.750   1.00 23.62  ? 486 VAL B CG1 1 
ATOM   7420  C CG2 . VAL B  1 489 ? 155.382 61.872  5.975   1.00 22.87  ? 486 VAL B CG2 1 
ATOM   7421  N N   . ARG B  1 490 ? 156.958 59.277  7.346   1.00 25.72  ? 487 ARG B N   1 
ATOM   7422  C CA  . ARG B  1 490 ? 156.553 58.659  8.624   1.00 27.62  ? 487 ARG B CA  1 
ATOM   7423  C C   . ARG B  1 490 ? 157.691 58.585  9.651   1.00 27.34  ? 487 ARG B C   1 
ATOM   7424  O O   . ARG B  1 490 ? 157.462 58.739  10.857  1.00 27.29  ? 487 ARG B O   1 
ATOM   7425  C CB  . ARG B  1 490 ? 156.014 57.249  8.369   1.00 30.40  ? 487 ARG B CB  1 
ATOM   7426  C CG  . ARG B  1 490 ? 155.022 56.723  9.405   1.00 31.55  ? 487 ARG B CG  1 
ATOM   7427  C CD  . ARG B  1 490 ? 154.750 55.244  9.150   1.00 32.46  ? 487 ARG B CD  1 
ATOM   7428  N NE  . ARG B  1 490 ? 155.806 54.403  9.715   1.00 32.58  ? 487 ARG B NE  1 
ATOM   7429  C CZ  . ARG B  1 490 ? 156.145 53.192  9.293   1.00 32.47  ? 487 ARG B CZ  1 
ATOM   7430  N NH1 . ARG B  1 490 ? 155.552 52.631  8.259   1.00 32.66  ? 487 ARG B NH1 1 
ATOM   7431  N NH2 . ARG B  1 490 ? 157.111 52.539  9.918   1.00 35.19  ? 487 ARG B NH2 1 
ATOM   7432  N N   . GLU B  1 491 ? 158.907 58.342  9.152   1.00 26.69  ? 488 GLU B N   1 
ATOM   7433  C CA  . GLU B  1 491 ? 160.135 58.269  9.950   1.00 25.25  ? 488 GLU B CA  1 
ATOM   7434  C C   . GLU B  1 491 ? 160.922 59.601  9.997   1.00 25.91  ? 488 GLU B C   1 
ATOM   7435  O O   . GLU B  1 491 ? 160.364 60.710  10.046  1.00 23.77  ? 488 GLU B O   1 
ATOM   7436  C CB  . GLU B  1 491 ? 161.045 57.193  9.361   1.00 24.60  ? 488 GLU B CB  1 
ATOM   7437  C CG  . GLU B  1 491 ? 160.453 55.780  9.348   1.00 24.95  ? 488 GLU B CG  1 
ATOM   7438  C CD  . GLU B  1 491 ? 161.265 54.773  8.517   1.00 24.43  ? 488 GLU B CD  1 
ATOM   7439  O OE1 . GLU B  1 491 ? 161.797 55.142  7.437   1.00 23.53  ? 488 GLU B OE1 1 
ATOM   7440  O OE2 . GLU B  1 491 ? 161.354 53.600  8.944   1.00 23.60  ? 488 GLU B OE2 1 
ATOM   7441  N N   . MET C  1 4   ? 152.691 4.324   32.650  1.00 84.33  ? 1   MET C N   1 
ATOM   7442  C CA  . MET C  1 4   ? 151.315 4.906   32.843  1.00 86.69  ? 1   MET C CA  1 
ATOM   7443  C C   . MET C  1 4   ? 151.157 6.304   32.181  1.00 84.05  ? 1   MET C C   1 
ATOM   7444  O O   . MET C  1 4   ? 150.196 6.530   31.446  1.00 85.76  ? 1   MET C O   1 
ATOM   7445  C CB  . MET C  1 4   ? 150.955 4.937   34.341  1.00 88.38  ? 1   MET C CB  1 
ATOM   7446  C CG  . MET C  1 4   ? 149.470 4.763   34.650  1.00 88.49  ? 1   MET C CG  1 
ATOM   7447  S SD  . MET C  1 4   ? 148.572 6.330   34.666  1.00 92.79  ? 1   MET C SD  1 
ATOM   7448  C CE  . MET C  1 4   ? 146.957 5.859   35.274  1.00 85.01  ? 1   MET C CE  1 
ATOM   7449  N N   . THR C  1 5   ? 152.098 7.216   32.449  1.00 75.57  ? 2   THR C N   1 
ATOM   7450  C CA  . THR C  1 5   ? 152.258 8.521   31.729  1.00 67.77  ? 2   THR C CA  1 
ATOM   7451  C C   . THR C  1 5   ? 151.162 9.588   31.919  1.00 58.75  ? 2   THR C C   1 
ATOM   7452  O O   . THR C  1 5   ? 149.958 9.281   32.048  1.00 50.55  ? 2   THR C O   1 
ATOM   7453  C CB  . THR C  1 5   ? 152.471 8.379   30.191  1.00 68.04  ? 2   THR C CB  1 
ATOM   7454  O OG1 . THR C  1 5   ? 151.259 7.948   29.552  1.00 63.32  ? 2   THR C OG1 1 
ATOM   7455  C CG2 . THR C  1 5   ? 153.611 7.417   29.862  1.00 68.75  ? 2   THR C CG2 1 
ATOM   7456  N N   . THR C  1 6   ? 151.618 10.847  31.854  1.00 48.35  ? 3   THR C N   1 
ATOM   7457  C CA  . THR C  1 6   ? 150.814 12.019  32.199  1.00 41.30  ? 3   THR C CA  1 
ATOM   7458  C C   . THR C  1 6   ? 150.581 12.969  31.024  1.00 35.10  ? 3   THR C C   1 
ATOM   7459  O O   . THR C  1 6   ? 151.504 13.290  30.294  1.00 33.10  ? 3   THR C O   1 
ATOM   7460  C CB  . THR C  1 6   ? 151.469 12.800  33.340  1.00 38.93  ? 3   THR C CB  1 
ATOM   7461  O OG1 . THR C  1 6   ? 151.603 11.927  34.460  1.00 38.43  ? 3   THR C OG1 1 
ATOM   7462  C CG2 . THR C  1 6   ? 150.614 14.011  33.737  1.00 38.40  ? 3   THR C CG2 1 
ATOM   7463  N N   . ILE C  1 7   ? 149.338 13.434  30.895  1.00 30.66  ? 4   ILE C N   1 
ATOM   7464  C CA  . ILE C  1 7   ? 148.914 14.318  29.807  1.00 27.10  ? 4   ILE C CA  1 
ATOM   7465  C C   . ILE C  1 7   ? 149.123 15.789  30.165  1.00 25.05  ? 4   ILE C C   1 
ATOM   7466  O O   . ILE C  1 7   ? 148.560 16.303  31.126  1.00 23.33  ? 4   ILE C O   1 
ATOM   7467  C CB  . ILE C  1 7   ? 147.433 14.132  29.452  1.00 25.17  ? 4   ILE C CB  1 
ATOM   7468  C CG1 . ILE C  1 7   ? 147.189 12.715  28.957  1.00 24.43  ? 4   ILE C CG1 1 
ATOM   7469  C CG2 . ILE C  1 7   ? 147.029 15.126  28.371  1.00 25.13  ? 4   ILE C CG2 1 
ATOM   7470  C CD1 . ILE C  1 7   ? 145.728 12.323  28.992  1.00 24.89  ? 4   ILE C CD1 1 
ATOM   7471  N N   . GLY C  1 8   ? 149.887 16.473  29.335  1.00 23.95  ? 5   GLY C N   1 
ATOM   7472  C CA  . GLY C  1 8   ? 150.326 17.813  29.653  1.00 24.00  ? 5   GLY C CA  1 
ATOM   7473  C C   . GLY C  1 8   ? 149.597 18.882  28.877  1.00 23.55  ? 5   GLY C C   1 
ATOM   7474  O O   . GLY C  1 8   ? 148.433 18.714  28.515  1.00 24.00  ? 5   GLY C O   1 
ATOM   7475  N N   . HIS C  1 9   ? 150.316 19.978  28.624  1.00 22.92  ? 6   HIS C N   1 
ATOM   7476  C CA  . HIS C  1 9   ? 149.801 21.165  27.950  1.00 21.91  ? 6   HIS C CA  1 
ATOM   7477  C C   . HIS C  1 9   ? 150.592 21.467  26.700  1.00 20.91  ? 6   HIS C C   1 
ATOM   7478  O O   . HIS C  1 9   ? 151.793 21.237  26.655  1.00 20.54  ? 6   HIS C O   1 
ATOM   7479  C CB  . HIS C  1 9   ? 149.886 22.352  28.890  1.00 21.58  ? 6   HIS C CB  1 
ATOM   7480  C CG  . HIS C  1 9   ? 149.410 22.031  30.268  1.00 21.40  ? 6   HIS C CG  1 
ATOM   7481  N ND1 . HIS C  1 9   ? 148.122 21.630  30.520  1.00 20.95  ? 6   HIS C ND1 1 
ATOM   7482  C CD2 . HIS C  1 9   ? 150.046 22.015  31.460  1.00 20.87  ? 6   HIS C CD2 1 
ATOM   7483  C CE1 . HIS C  1 9   ? 147.975 21.386  31.806  1.00 20.42  ? 6   HIS C CE1 1 
ATOM   7484  N NE2 . HIS C  1 9   ? 149.130 21.610  32.399  1.00 21.03  ? 6   HIS C NE2 1 
ATOM   7485  N N   . LEU C  1 10  ? 149.892 21.970  25.686  1.00 20.00  ? 7   LEU C N   1 
ATOM   7486  C CA  . LEU C  1 10  ? 150.527 22.447  24.481  1.00 19.43  ? 7   LEU C CA  1 
ATOM   7487  C C   . LEU C  1 10  ? 150.636 23.939  24.590  1.00 18.27  ? 7   LEU C C   1 
ATOM   7488  O O   . LEU C  1 10  ? 149.658 24.651  24.495  1.00 16.41  ? 7   LEU C O   1 
ATOM   7489  C CB  . LEU C  1 10  ? 149.755 22.081  23.209  1.00 19.84  ? 7   LEU C CB  1 
ATOM   7490  C CG  . LEU C  1 10  ? 150.405 22.552  21.889  1.00 19.73  ? 7   LEU C CG  1 
ATOM   7491  C CD1 . LEU C  1 10  ? 151.805 21.991  21.658  1.00 19.67  ? 7   LEU C CD1 1 
ATOM   7492  C CD2 . LEU C  1 10  ? 149.504 22.135  20.749  1.00 20.28  ? 7   LEU C CD2 1 
ATOM   7493  N N   . ILE C  1 11  ? 151.860 24.400  24.780  1.00 19.01  ? 8   ILE C N   1 
ATOM   7494  C CA  . ILE C  1 11  ? 152.147 25.805  24.848  1.00 19.37  ? 8   ILE C CA  1 
ATOM   7495  C C   . ILE C  1 11  ? 153.403 26.151  24.052  1.00 19.28  ? 8   ILE C C   1 
ATOM   7496  O O   . ILE C  1 11  ? 154.436 25.489  24.173  1.00 19.06  ? 8   ILE C O   1 
ATOM   7497  C CB  . ILE C  1 11  ? 152.346 26.246  26.290  1.00 20.11  ? 8   ILE C CB  1 
ATOM   7498  C CG1 . ILE C  1 11  ? 151.311 25.637  27.229  1.00 20.35  ? 8   ILE C CG1 1 
ATOM   7499  C CG2 . ILE C  1 11  ? 152.250 27.762  26.344  1.00 21.42  ? 8   ILE C CG2 1 
ATOM   7500  C CD1 . ILE C  1 11  ? 151.309 26.212  28.628  1.00 19.92  ? 8   ILE C CD1 1 
ATOM   7501  N N   . ASN C  1 12  ? 153.304 27.206  23.250  1.00 19.65  ? 9   ASN C N   1 
ATOM   7502  C CA  . ASN C  1 12  ? 154.369 27.614  22.326  1.00 20.07  ? 9   ASN C CA  1 
ATOM   7503  C C   . ASN C  1 12  ? 155.096 26.451  21.620  1.00 21.58  ? 9   ASN C C   1 
ATOM   7504  O O   . ASN C  1 12  ? 156.332 26.444  21.483  1.00 21.55  ? 9   ASN C O   1 
ATOM   7505  C CB  . ASN C  1 12  ? 155.355 28.519  23.023  1.00 19.53  ? 9   ASN C CB  1 
ATOM   7506  C CG  . ASN C  1 12  ? 155.986 29.524  22.079  1.00 19.45  ? 9   ASN C CG  1 
ATOM   7507  O OD1 . ASN C  1 12  ? 155.305 30.342  21.445  1.00 18.53  ? 9   ASN C OD1 1 
ATOM   7508  N ND2 . ASN C  1 12  ? 157.299 29.493  22.004  1.00 20.06  ? 9   ASN C ND2 1 
ATOM   7509  N N   . GLY C  1 13  ? 154.279 25.498  21.153  1.00 23.00  ? 10  GLY C N   1 
ATOM   7510  C CA  . GLY C  1 13  ? 154.709 24.352  20.363  1.00 23.46  ? 10  GLY C CA  1 
ATOM   7511  C C   . GLY C  1 13  ? 155.381 23.265  21.167  1.00 24.13  ? 10  GLY C C   1 
ATOM   7512  O O   . GLY C  1 13  ? 156.060 22.431  20.604  1.00 24.14  ? 10  GLY C O   1 
ATOM   7513  N N   . GLN C  1 14  ? 155.186 23.267  22.479  1.00 25.68  ? 11  GLN C N   1 
ATOM   7514  C CA  . GLN C  1 14  ? 155.871 22.338  23.346  1.00 27.82  ? 11  GLN C CA  1 
ATOM   7515  C C   . GLN C  1 14  ? 154.921 21.739  24.334  1.00 25.63  ? 11  GLN C C   1 
ATOM   7516  O O   . GLN C  1 14  ? 154.040 22.404  24.819  1.00 23.32  ? 11  GLN C O   1 
ATOM   7517  C CB  . GLN C  1 14  ? 157.002 23.037  24.087  1.00 32.18  ? 11  GLN C CB  1 
ATOM   7518  C CG  . GLN C  1 14  ? 158.195 23.335  23.202  1.00 37.55  ? 11  GLN C CG  1 
ATOM   7519  C CD  . GLN C  1 14  ? 159.326 24.027  23.941  1.00 41.99  ? 11  GLN C CD  1 
ATOM   7520  O OE1 . GLN C  1 14  ? 159.204 24.361  25.129  1.00 41.24  ? 11  GLN C OE1 1 
ATOM   7521  N NE2 . GLN C  1 14  ? 160.447 24.241  23.235  1.00 46.50  ? 11  GLN C NE2 1 
ATOM   7522  N N   . LEU C  1 15  ? 155.122 20.462  24.618  1.00 26.04  ? 12  LEU C N   1 
ATOM   7523  C CA  . LEU C  1 15  ? 154.416 19.784  25.684  1.00 26.56  ? 12  LEU C CA  1 
ATOM   7524  C C   . LEU C  1 15  ? 155.080 20.107  27.006  1.00 27.28  ? 12  LEU C C   1 
ATOM   7525  O O   . LEU C  1 15  ? 156.265 19.804  27.213  1.00 27.23  ? 12  LEU C O   1 
ATOM   7526  C CB  . LEU C  1 15  ? 154.432 18.280  25.467  1.00 26.93  ? 12  LEU C CB  1 
ATOM   7527  C CG  . LEU C  1 15  ? 153.563 17.706  24.354  1.00 27.61  ? 12  LEU C CG  1 
ATOM   7528  C CD1 . LEU C  1 15  ? 153.638 16.196  24.442  1.00 28.95  ? 12  LEU C CD1 1 
ATOM   7529  C CD2 . LEU C  1 15  ? 152.115 18.141  24.471  1.00 28.16  ? 12  LEU C CD2 1 
ATOM   7530  N N   . VAL C  1 16  ? 154.332 20.741  27.896  1.00 27.65  ? 13  VAL C N   1 
ATOM   7531  C CA  . VAL C  1 16  ? 154.843 21.023  29.224  1.00 28.77  ? 13  VAL C CA  1 
ATOM   7532  C C   . VAL C  1 16  ? 153.847 20.526  30.223  1.00 29.46  ? 13  VAL C C   1 
ATOM   7533  O O   . VAL C  1 16  ? 152.669 20.385  29.912  1.00 29.51  ? 13  VAL C O   1 
ATOM   7534  C CB  . VAL C  1 16  ? 155.150 22.522  29.472  1.00 28.44  ? 13  VAL C CB  1 
ATOM   7535  C CG1 . VAL C  1 16  ? 156.112 23.036  28.418  1.00 28.53  ? 13  VAL C CG1 1 
ATOM   7536  C CG2 . VAL C  1 16  ? 153.893 23.375  29.528  1.00 28.40  ? 13  VAL C CG2 1 
ATOM   7537  N N   . THR C  1 17  ? 154.339 20.282  31.426  1.00 30.73  ? 14  THR C N   1 
ATOM   7538  C CA  . THR C  1 17  ? 153.518 19.781  32.496  1.00 31.26  ? 14  THR C CA  1 
ATOM   7539  C C   . THR C  1 17  ? 153.954 20.515  33.766  1.00 30.07  ? 14  THR C C   1 
ATOM   7540  O O   . THR C  1 17  ? 155.143 20.743  33.956  1.00 31.83  ? 14  THR C O   1 
ATOM   7541  C CB  . THR C  1 17  ? 153.633 18.241  32.557  1.00 32.35  ? 14  THR C CB  1 
ATOM   7542  O OG1 . THR C  1 17  ? 152.928 17.756  33.698  1.00 36.04  ? 14  THR C OG1 1 
ATOM   7543  C CG2 . THR C  1 17  ? 155.100 17.779  32.606  1.00 32.29  ? 14  THR C CG2 1 
ATOM   7544  N N   . GLU C  1 18  ? 152.981 20.929  34.577  1.00 29.41  ? 15  GLU C N   1 
ATOM   7545  C CA  . GLU C  1 18  ? 153.197 21.718  35.795  1.00 30.12  ? 15  GLU C CA  1 
ATOM   7546  C C   . GLU C  1 18  ? 153.522 20.852  37.006  1.00 32.08  ? 15  GLU C C   1 
ATOM   7547  O O   . GLU C  1 18  ? 154.380 21.202  37.800  1.00 32.00  ? 15  GLU C O   1 
ATOM   7548  C CB  . GLU C  1 18  ? 151.949 22.546  36.108  1.00 29.83  ? 15  GLU C CB  1 
ATOM   7549  C CG  . GLU C  1 18  ? 152.105 23.472  37.305  1.00 29.84  ? 15  GLU C CG  1 
ATOM   7550  C CD  . GLU C  1 18  ? 150.898 24.349  37.587  1.00 29.48  ? 15  GLU C CD  1 
ATOM   7551  O OE1 . GLU C  1 18  ? 150.183 24.735  36.644  1.00 29.06  ? 15  GLU C OE1 1 
ATOM   7552  O OE2 . GLU C  1 18  ? 150.674 24.672  38.774  1.00 29.27  ? 15  GLU C OE2 1 
ATOM   7553  N N   . ASN C  1 19  ? 152.778 19.761  37.159  1.00 34.66  ? 16  ASN C N   1 
ATOM   7554  C CA  . ASN C  1 19  ? 152.976 18.766  38.226  1.00 34.66  ? 16  ASN C CA  1 
ATOM   7555  C C   . ASN C  1 19  ? 152.666 19.228  39.638  1.00 32.86  ? 16  ASN C C   1 
ATOM   7556  O O   . ASN C  1 19  ? 153.340 18.831  40.586  1.00 33.28  ? 16  ASN C O   1 
ATOM   7557  C CB  . ASN C  1 19  ? 154.375 18.146  38.152  1.00 35.47  ? 16  ASN C CB  1 
ATOM   7558  C CG  . ASN C  1 19  ? 154.619 17.461  36.833  1.00 37.58  ? 16  ASN C CG  1 
ATOM   7559  O OD1 . ASN C  1 19  ? 153.813 16.627  36.407  1.00 40.88  ? 16  ASN C OD1 1 
ATOM   7560  N ND2 . ASN C  1 19  ? 155.712 17.801  36.172  1.00 37.11  ? 16  ASN C ND2 1 
ATOM   7561  N N   . THR C  1 20  ? 151.634 20.048  39.785  1.00 32.25  ? 17  THR C N   1 
ATOM   7562  C CA  . THR C  1 20  ? 151.150 20.402  41.119  1.00 32.77  ? 17  THR C CA  1 
ATOM   7563  C C   . THR C  1 20  ? 149.830 19.742  41.461  1.00 32.38  ? 17  THR C C   1 
ATOM   7564  O O   . THR C  1 20  ? 149.467 19.678  42.618  1.00 34.06  ? 17  THR C O   1 
ATOM   7565  C CB  . THR C  1 20  ? 151.027 21.922  41.331  1.00 32.33  ? 17  THR C CB  1 
ATOM   7566  O OG1 . THR C  1 20  ? 150.137 22.455  40.368  1.00 35.31  ? 17  THR C OG1 1 
ATOM   7567  C CG2 . THR C  1 20  ? 152.383 22.608  41.185  1.00 33.19  ? 17  THR C CG2 1 
ATOM   7568  N N   . ARG C  1 21  ? 149.118 19.224  40.477  1.00 32.78  ? 18  ARG C N   1 
ATOM   7569  C CA  . ARG C  1 21  ? 147.786 18.683  40.725  1.00 32.13  ? 18  ARG C CA  1 
ATOM   7570  C C   . ARG C  1 21  ? 147.393 17.908  39.511  1.00 31.99  ? 18  ARG C C   1 
ATOM   7571  O O   . ARG C  1 21  ? 147.630 18.372  38.393  1.00 31.98  ? 18  ARG C O   1 
ATOM   7572  C CB  . ARG C  1 21  ? 146.797 19.822  40.945  1.00 32.93  ? 18  ARG C CB  1 
ATOM   7573  C CG  . ARG C  1 21  ? 145.402 19.401  41.361  1.00 33.27  ? 18  ARG C CG  1 
ATOM   7574  C CD  . ARG C  1 21  ? 144.748 20.523  42.143  1.00 33.51  ? 18  ARG C CD  1 
ATOM   7575  N NE  . ARG C  1 21  ? 144.639 21.753  41.356  1.00 34.66  ? 18  ARG C NE  1 
ATOM   7576  C CZ  . ARG C  1 21  ? 143.589 22.091  40.600  1.00 35.26  ? 18  ARG C CZ  1 
ATOM   7577  N NH1 . ARG C  1 21  ? 142.524 21.294  40.498  1.00 33.66  ? 18  ARG C NH1 1 
ATOM   7578  N NH2 . ARG C  1 21  ? 143.601 23.247  39.934  1.00 37.27  ? 18  ARG C NH2 1 
ATOM   7579  N N   . SER C  1 22  ? 146.824 16.727  39.720  1.00 32.10  ? 19  SER C N   1 
ATOM   7580  C CA  . SER C  1 22  ? 146.413 15.865  38.613  1.00 32.04  ? 19  SER C CA  1 
ATOM   7581  C C   . SER C  1 22  ? 145.078 15.199  38.909  1.00 31.67  ? 19  SER C C   1 
ATOM   7582  O O   . SER C  1 22  ? 144.566 15.301  40.020  1.00 32.77  ? 19  SER C O   1 
ATOM   7583  C CB  . SER C  1 22  ? 147.482 14.828  38.321  1.00 31.94  ? 19  SER C CB  1 
ATOM   7584  O OG  . SER C  1 22  ? 147.357 13.740  39.208  1.00 34.95  ? 19  SER C OG  1 
ATOM   7585  N N   . GLN C  1 23  ? 144.533 14.523  37.904  1.00 31.81  ? 20  GLN C N   1 
ATOM   7586  C CA  . GLN C  1 23  ? 143.189 13.938  37.959  1.00 32.33  ? 20  GLN C CA  1 
ATOM   7587  C C   . GLN C  1 23  ? 143.221 12.700  37.071  1.00 33.21  ? 20  GLN C C   1 
ATOM   7588  O O   . GLN C  1 23  ? 144.068 12.608  36.179  1.00 33.28  ? 20  GLN C O   1 
ATOM   7589  C CB  . GLN C  1 23  ? 142.170 14.979  37.480  1.00 33.03  ? 20  GLN C CB  1 
ATOM   7590  C CG  . GLN C  1 23  ? 140.728 14.531  37.359  1.00 34.14  ? 20  GLN C CG  1 
ATOM   7591  C CD  . GLN C  1 23  ? 139.796 15.678  37.005  1.00 34.98  ? 20  GLN C CD  1 
ATOM   7592  O OE1 . GLN C  1 23  ? 140.053 16.812  37.374  1.00 33.90  ? 20  GLN C OE1 1 
ATOM   7593  N NE2 . GLN C  1 23  ? 138.692 15.380  36.312  1.00 36.65  ? 20  GLN C NE2 1 
ATOM   7594  N N   . ASN C  1 24  ? 142.339 11.736  37.329  1.00 34.31  ? 21  ASN C N   1 
ATOM   7595  C CA  . ASN C  1 24  ? 142.234 10.528  36.484  1.00 34.98  ? 21  ASN C CA  1 
ATOM   7596  C C   . ASN C  1 24  ? 141.500 10.848  35.189  1.00 32.11  ? 21  ASN C C   1 
ATOM   7597  O O   . ASN C  1 24  ? 140.534 11.608  35.210  1.00 33.56  ? 21  ASN C O   1 
ATOM   7598  C CB  . ASN C  1 24  ? 141.422 9.426   37.194  1.00 39.00  ? 21  ASN C CB  1 
ATOM   7599  C CG  . ASN C  1 24  ? 142.134 8.831   38.402  1.00 40.98  ? 21  ASN C CG  1 
ATOM   7600  O OD1 . ASN C  1 24  ? 143.298 8.418   38.299  1.00 42.78  ? 21  ASN C OD1 1 
ATOM   7601  N ND2 . ASN C  1 24  ? 141.430 8.753   39.546  1.00 40.05  ? 21  ASN C ND2 1 
ATOM   7602  N N   . VAL C  1 25  ? 141.929 10.284  34.065  1.00 28.81  ? 22  VAL C N   1 
ATOM   7603  C CA  . VAL C  1 25  ? 141.002 10.130  32.928  1.00 26.93  ? 22  VAL C CA  1 
ATOM   7604  C C   . VAL C  1 25  ? 140.697 8.640   32.842  1.00 25.22  ? 22  VAL C C   1 
ATOM   7605  O O   . VAL C  1 25  ? 141.556 7.820   33.133  1.00 22.74  ? 22  VAL C O   1 
ATOM   7606  C CB  . VAL C  1 25  ? 141.475 10.746  31.579  1.00 26.09  ? 22  VAL C CB  1 
ATOM   7607  C CG1 . VAL C  1 25  ? 142.257 12.027  31.797  1.00 25.90  ? 22  VAL C CG1 1 
ATOM   7608  C CG2 . VAL C  1 25  ? 142.304 9.780   30.777  1.00 27.71  ? 22  VAL C CG2 1 
ATOM   7609  N N   . PHE C  1 26  ? 139.467 8.305   32.471  1.00 25.26  ? 23  PHE C N   1 
ATOM   7610  C CA  . PHE C  1 26  ? 139.011 6.932   32.540  1.00 26.69  ? 23  PHE C CA  1 
ATOM   7611  C C   . PHE C  1 26  ? 138.824 6.375   31.146  1.00 25.89  ? 23  PHE C C   1 
ATOM   7612  O O   . PHE C  1 26  ? 138.941 7.078   30.161  1.00 27.07  ? 23  PHE C O   1 
ATOM   7613  C CB  . PHE C  1 26  ? 137.684 6.833   33.311  1.00 29.00  ? 23  PHE C CB  1 
ATOM   7614  C CG  . PHE C  1 26  ? 137.809 7.034   34.792  1.00 29.99  ? 23  PHE C CG  1 
ATOM   7615  C CD1 . PHE C  1 26  ? 137.840 8.315   35.330  1.00 32.34  ? 23  PHE C CD1 1 
ATOM   7616  C CD2 . PHE C  1 26  ? 137.861 5.956   35.646  1.00 30.99  ? 23  PHE C CD2 1 
ATOM   7617  C CE1 . PHE C  1 26  ? 137.945 8.513   36.697  1.00 33.34  ? 23  PHE C CE1 1 
ATOM   7618  C CE2 . PHE C  1 26  ? 137.958 6.143   37.015  1.00 33.03  ? 23  PHE C CE2 1 
ATOM   7619  C CZ  . PHE C  1 26  ? 138.002 7.422   37.545  1.00 33.28  ? 23  PHE C CZ  1 
ATOM   7620  N N   . ASN C  1 27  ? 138.571 5.076   31.088  1.00 25.45  ? 24  ASN C N   1 
ATOM   7621  C CA  . ASN C  1 27  ? 138.056 4.414   29.912  1.00 24.05  ? 24  ASN C CA  1 
ATOM   7622  C C   . ASN C  1 27  ? 136.665 3.973   30.283  1.00 24.71  ? 24  ASN C C   1 
ATOM   7623  O O   . ASN C  1 27  ? 136.505 2.902   30.876  1.00 28.11  ? 24  ASN C O   1 
ATOM   7624  C CB  . ASN C  1 27  ? 138.887 3.187   29.588  1.00 23.60  ? 24  ASN C CB  1 
ATOM   7625  C CG  . ASN C  1 27  ? 138.347 2.405   28.400  1.00 23.39  ? 24  ASN C CG  1 
ATOM   7626  O OD1 . ASN C  1 27  ? 137.170 2.505   28.029  1.00 23.26  ? 24  ASN C OD1 1 
ATOM   7627  N ND2 . ASN C  1 27  ? 139.224 1.629   27.778  1.00 23.34  ? 24  ASN C ND2 1 
ATOM   7628  N N   . PRO C  1 28  ? 135.642 4.772   29.930  1.00 23.41  ? 25  PRO C N   1 
ATOM   7629  C CA  . PRO C  1 28  ? 134.287 4.585   30.435  1.00 22.27  ? 25  PRO C CA  1 
ATOM   7630  C C   . PRO C  1 28  ? 133.629 3.260   30.078  1.00 21.38  ? 25  PRO C C   1 
ATOM   7631  O O   . PRO C  1 28  ? 132.689 2.871   30.751  1.00 20.59  ? 25  PRO C O   1 
ATOM   7632  C CB  . PRO C  1 28  ? 133.529 5.751   29.827  1.00 22.11  ? 25  PRO C CB  1 
ATOM   7633  C CG  . PRO C  1 28  ? 134.220 5.998   28.578  1.00 22.78  ? 25  PRO C CG  1 
ATOM   7634  C CD  . PRO C  1 28  ? 135.669 5.774   28.864  1.00 23.39  ? 25  PRO C CD  1 
ATOM   7635  N N   . ALA C  1 29  ? 134.128 2.575   29.054  1.00 21.44  ? 26  ALA C N   1 
ATOM   7636  C CA  . ALA C  1 29  ? 133.742 1.179   28.783  1.00 21.93  ? 26  ALA C CA  1 
ATOM   7637  C C   . ALA C  1 29  ? 134.133 0.197   29.910  1.00 22.67  ? 26  ALA C C   1 
ATOM   7638  O O   . ALA C  1 29  ? 133.288 -0.560  30.390  1.00 22.21  ? 26  ALA C O   1 
ATOM   7639  C CB  . ALA C  1 29  ? 134.336 0.719   27.464  1.00 21.76  ? 26  ALA C CB  1 
ATOM   7640  N N   . THR C  1 30  ? 135.406 0.222   30.322  1.00 22.73  ? 27  THR C N   1 
ATOM   7641  C CA  . THR C  1 30  ? 135.927 -0.684  31.360  1.00 22.54  ? 27  THR C CA  1 
ATOM   7642  C C   . THR C  1 30  ? 135.724 -0.131  32.753  1.00 21.90  ? 27  THR C C   1 
ATOM   7643  O O   . THR C  1 30  ? 135.797 -0.866  33.740  1.00 20.87  ? 27  THR C O   1 
ATOM   7644  C CB  . THR C  1 30  ? 137.436 -0.984  31.182  1.00 22.85  ? 27  THR C CB  1 
ATOM   7645  O OG1 . THR C  1 30  ? 138.213 0.217   31.327  1.00 23.98  ? 27  THR C OG1 1 
ATOM   7646  C CG2 . THR C  1 30  ? 137.698 -1.581  29.826  1.00 22.53  ? 27  THR C CG2 1 
ATOM   7647  N N   . GLY C  1 31  ? 135.506 1.176   32.830  1.00 22.01  ? 28  GLY C N   1 
ATOM   7648  C CA  . GLY C  1 31  ? 135.497 1.878   34.113  1.00 22.52  ? 28  GLY C CA  1 
ATOM   7649  C C   . GLY C  1 31  ? 136.863 2.048   34.744  1.00 22.73  ? 28  GLY C C   1 
ATOM   7650  O O   . GLY C  1 31  ? 136.953 2.532   35.856  1.00 22.37  ? 28  GLY C O   1 
ATOM   7651  N N   . GLU C  1 32  ? 137.921 1.684   34.019  1.00 24.70  ? 29  GLU C N   1 
ATOM   7652  C CA  . GLU C  1 32  ? 139.276 1.691   34.538  1.00 26.61  ? 29  GLU C CA  1 
ATOM   7653  C C   . GLU C  1 32  ? 139.980 3.021   34.305  1.00 28.97  ? 29  GLU C C   1 
ATOM   7654  O O   . GLU C  1 32  ? 139.692 3.740   33.342  1.00 28.49  ? 29  GLU C O   1 
ATOM   7655  C CB  . GLU C  1 32  ? 140.088 0.598   33.876  1.00 27.04  ? 29  GLU C CB  1 
ATOM   7656  C CG  . GLU C  1 32  ? 139.642 -0.794  34.273  1.00 28.35  ? 29  GLU C CG  1 
ATOM   7657  C CD  . GLU C  1 32  ? 140.185 -1.899  33.386  1.00 29.26  ? 29  GLU C CD  1 
ATOM   7658  O OE1 . GLU C  1 32  ? 139.732 -3.043  33.548  1.00 31.14  ? 29  GLU C OE1 1 
ATOM   7659  O OE2 . GLU C  1 32  ? 141.040 -1.647  32.517  1.00 31.21  ? 29  GLU C OE2 1 
ATOM   7660  N N   . ILE C  1 33  ? 140.925 3.324   35.189  1.00 30.19  ? 30  ILE C N   1 
ATOM   7661  C CA  . ILE C  1 33  ? 141.706 4.527   35.072  1.00 30.84  ? 30  ILE C CA  1 
ATOM   7662  C C   . ILE C  1 33  ? 142.635 4.342   33.911  1.00 30.93  ? 30  ILE C C   1 
ATOM   7663  O O   . ILE C  1 33  ? 143.360 3.391   33.876  1.00 32.51  ? 30  ILE C O   1 
ATOM   7664  C CB  . ILE C  1 33  ? 142.564 4.778   36.301  1.00 32.64  ? 30  ILE C CB  1 
ATOM   7665  C CG1 . ILE C  1 33  ? 141.676 4.976   37.528  1.00 35.64  ? 30  ILE C CG1 1 
ATOM   7666  C CG2 . ILE C  1 33  ? 143.411 6.023   36.066  1.00 34.89  ? 30  ILE C CG2 1 
ATOM   7667  C CD1 . ILE C  1 33  ? 142.416 4.964   38.850  1.00 35.58  ? 30  ILE C CD1 1 
ATOM   7668  N N   . GLY C  1 34  ? 142.595 5.244   32.951  1.00 32.68  ? 31  GLY C N   1 
ATOM   7669  C CA  . GLY C  1 34  ? 143.522 5.217   31.843  1.00 33.76  ? 31  GLY C CA  1 
ATOM   7670  C C   . GLY C  1 34  ? 144.766 6.009   32.196  1.00 34.99  ? 31  GLY C C   1 
ATOM   7671  O O   . GLY C  1 34  ? 145.827 5.452   32.440  1.00 40.44  ? 31  GLY C O   1 
ATOM   7672  N N   . LYS C  1 35  ? 144.631 7.324   32.252  1.00 34.32  ? 32  LYS C N   1 
ATOM   7673  C CA  . LYS C  1 35  ? 145.799 8.228   32.237  1.00 33.66  ? 32  LYS C CA  1 
ATOM   7674  C C   . LYS C  1 35  ? 145.625 9.345   33.227  1.00 31.70  ? 32  LYS C C   1 
ATOM   7675  O O   . LYS C  1 35  ? 144.504 9.646   33.615  1.00 32.93  ? 32  LYS C O   1 
ATOM   7676  C CB  . LYS C  1 35  ? 145.996 8.820   30.846  1.00 34.53  ? 32  LYS C CB  1 
ATOM   7677  C CG  . LYS C  1 35  ? 145.550 7.892   29.723  1.00 37.41  ? 32  LYS C CG  1 
ATOM   7678  C CD  . LYS C  1 35  ? 145.716 8.511   28.350  1.00 39.47  ? 32  LYS C CD  1 
ATOM   7679  C CE  . LYS C  1 35  ? 147.182 8.680   27.963  1.00 37.85  ? 32  LYS C CE  1 
ATOM   7680  N NZ  . LYS C  1 35  ? 147.271 9.206   26.571  1.00 38.13  ? 32  LYS C NZ  1 
ATOM   7681  N N   . GLN C  1 36  ? 146.732 9.958   33.634  1.00 31.14  ? 33  GLN C N   1 
ATOM   7682  C CA  . GLN C  1 36  ? 146.690 11.102  34.564  1.00 32.03  ? 33  GLN C CA  1 
ATOM   7683  C C   . GLN C  1 36  ? 146.727 12.402  33.772  1.00 27.02  ? 33  GLN C C   1 
ATOM   7684  O O   . GLN C  1 36  ? 147.520 12.540  32.841  1.00 23.47  ? 33  GLN C O   1 
ATOM   7685  C CB  . GLN C  1 36  ? 147.848 11.073  35.575  1.00 37.49  ? 33  GLN C CB  1 
ATOM   7686  C CG  . GLN C  1 36  ? 147.780 9.933   36.596  1.00 43.20  ? 33  GLN C CG  1 
ATOM   7687  C CD  . GLN C  1 36  ? 146.658 10.103  37.616  1.00 47.90  ? 33  GLN C CD  1 
ATOM   7688  O OE1 . GLN C  1 36  ? 146.685 11.049  38.420  1.00 50.14  ? 33  GLN C OE1 1 
ATOM   7689  N NE2 . GLN C  1 36  ? 145.663 9.181   37.596  1.00 48.12  ? 33  GLN C NE2 1 
ATOM   7690  N N   . LEU C  1 37  ? 145.851 13.338  34.132  1.00 23.65  ? 34  LEU C N   1 
ATOM   7691  C CA  . LEU C  1 37  ? 145.772 14.628  33.446  1.00 21.65  ? 34  LEU C CA  1 
ATOM   7692  C C   . LEU C  1 37  ? 146.311 15.680  34.350  1.00 20.12  ? 34  LEU C C   1 
ATOM   7693  O O   . LEU C  1 37  ? 145.816 15.822  35.446  1.00 20.41  ? 34  LEU C O   1 
ATOM   7694  C CB  . LEU C  1 37  ? 144.332 14.990  33.095  1.00 21.21  ? 34  LEU C CB  1 
ATOM   7695  C CG  . LEU C  1 37  ? 144.130 16.312  32.338  1.00 21.20  ? 34  LEU C CG  1 
ATOM   7696  C CD1 . LEU C  1 37  ? 144.883 16.290  31.007  1.00 21.47  ? 34  LEU C CD1 1 
ATOM   7697  C CD2 . LEU C  1 37  ? 142.648 16.623  32.117  1.00 20.77  ? 34  LEU C CD2 1 
ATOM   7698  N N   . ASP C  1 38  ? 147.320 16.412  33.899  1.00 19.29  ? 35  ASP C N   1 
ATOM   7699  C CA  . ASP C  1 38  ? 147.891 17.491  34.689  1.00 19.71  ? 35  ASP C CA  1 
ATOM   7700  C C   . ASP C  1 38  ? 146.955 18.674  34.604  1.00 20.16  ? 35  ASP C C   1 
ATOM   7701  O O   . ASP C  1 38  ? 146.560 19.063  33.515  1.00 21.98  ? 35  ASP C O   1 
ATOM   7702  C CB  . ASP C  1 38  ? 149.275 17.862  34.165  1.00 19.78  ? 35  ASP C CB  1 
ATOM   7703  C CG  . ASP C  1 38  ? 149.878 19.049  34.878  1.00 20.34  ? 35  ASP C CG  1 
ATOM   7704  O OD1 . ASP C  1 38  ? 149.970 19.077  36.124  1.00 22.89  ? 35  ASP C OD1 1 
ATOM   7705  O OD2 . ASP C  1 38  ? 150.286 19.979  34.189  1.00 19.96  ? 35  ASP C OD2 1 
ATOM   7706  N N   . LEU C  1 39  ? 146.602 19.245  35.742  1.00 20.36  ? 36  LEU C N   1 
ATOM   7707  C CA  . LEU C  1 39  ? 145.626 20.321  35.796  1.00 21.40  ? 36  LEU C CA  1 
ATOM   7708  C C   . LEU C  1 39  ? 146.319 21.634  36.015  1.00 22.59  ? 36  LEU C C   1 
ATOM   7709  O O   . LEU C  1 39  ? 146.990 21.808  37.030  1.00 25.69  ? 36  LEU C O   1 
ATOM   7710  C CB  . LEU C  1 39  ? 144.656 20.087  36.946  1.00 21.55  ? 36  LEU C CB  1 
ATOM   7711  C CG  . LEU C  1 39  ? 143.979 18.717  36.966  1.00 21.03  ? 36  LEU C CG  1 
ATOM   7712  C CD1 . LEU C  1 39  ? 142.976 18.685  38.097  1.00 20.91  ? 36  LEU C CD1 1 
ATOM   7713  C CD2 . LEU C  1 39  ? 143.312 18.395  35.639  1.00 20.87  ? 36  LEU C CD2 1 
ATOM   7714  N N   . ALA C  1 40  ? 146.123 22.567  35.092  1.00 23.26  ? 37  ALA C N   1 
ATOM   7715  C CA  . ALA C  1 40  ? 146.929 23.786  35.041  1.00 24.66  ? 37  ALA C CA  1 
ATOM   7716  C C   . ALA C  1 40  ? 146.429 24.804  36.018  1.00 24.79  ? 37  ALA C C   1 
ATOM   7717  O O   . ALA C  1 40  ? 145.231 25.023  36.116  1.00 24.87  ? 37  ALA C O   1 
ATOM   7718  C CB  . ALA C  1 40  ? 146.900 24.381  33.647  1.00 25.92  ? 37  ALA C CB  1 
ATOM   7719  N N   . SER C  1 41  ? 147.348 25.428  36.736  1.00 25.31  ? 38  SER C N   1 
ATOM   7720  C CA  . SER C  1 41  ? 146.980 26.469  37.664  1.00 26.70  ? 38  SER C CA  1 
ATOM   7721  C C   . SER C  1 41  ? 147.016 27.810  36.899  1.00 26.88  ? 38  SER C C   1 
ATOM   7722  O O   . SER C  1 41  ? 147.320 27.843  35.711  1.00 27.34  ? 38  SER C O   1 
ATOM   7723  C CB  . SER C  1 41  ? 147.917 26.428  38.864  1.00 27.54  ? 38  SER C CB  1 
ATOM   7724  O OG  . SER C  1 41  ? 149.243 26.652  38.439  1.00 30.95  ? 38  SER C OG  1 
ATOM   7725  N N   . THR C  1 42  ? 146.706 28.913  37.569  1.00 26.77  ? 39  THR C N   1 
ATOM   7726  C CA  . THR C  1 42  ? 146.621 30.191  36.880  1.00 26.42  ? 39  THR C CA  1 
ATOM   7727  C C   . THR C  1 42  ? 147.978 30.570  36.306  1.00 24.89  ? 39  THR C C   1 
ATOM   7728  O O   . THR C  1 42  ? 148.043 31.226  35.291  1.00 25.95  ? 39  THR C O   1 
ATOM   7729  C CB  . THR C  1 42  ? 146.072 31.348  37.752  1.00 27.49  ? 39  THR C CB  1 
ATOM   7730  O OG1 . THR C  1 42  ? 147.104 31.825  38.596  1.00 31.82  ? 39  THR C OG1 1 
ATOM   7731  C CG2 . THR C  1 42  ? 144.850 30.935  38.610  1.00 28.20  ? 39  THR C CG2 1 
ATOM   7732  N N   . LYS C  1 43  ? 149.057 30.147  36.935  1.00 24.62  ? 40  LYS C N   1 
ATOM   7733  C CA  . LYS C  1 43  ? 150.386 30.452  36.425  1.00 25.40  ? 40  LYS C CA  1 
ATOM   7734  C C   . LYS C  1 43  ? 150.613 29.839  35.047  1.00 22.64  ? 40  LYS C C   1 
ATOM   7735  O O   . LYS C  1 43  ? 151.207 30.445  34.183  1.00 21.26  ? 40  LYS C O   1 
ATOM   7736  C CB  . LYS C  1 43  ? 151.454 29.963  37.406  1.00 29.09  ? 40  LYS C CB  1 
ATOM   7737  C CG  . LYS C  1 43  ? 152.870 30.349  37.008  1.00 34.73  ? 40  LYS C CG  1 
ATOM   7738  C CD  . LYS C  1 43  ? 153.909 29.813  37.987  1.00 40.34  ? 40  LYS C CD  1 
ATOM   7739  C CE  . LYS C  1 43  ? 155.334 30.188  37.588  1.00 41.33  ? 40  LYS C CE  1 
ATOM   7740  N NZ  . LYS C  1 43  ? 156.303 29.764  38.632  1.00 41.76  ? 40  LYS C NZ  1 
ATOM   7741  N N   . THR C  1 44  ? 150.146 28.622  34.855  1.00 22.05  ? 41  THR C N   1 
ATOM   7742  C CA  . THR C  1 44  ? 150.389 27.878  33.617  1.00 22.23  ? 41  THR C CA  1 
ATOM   7743  C C   . THR C  1 44  ? 149.515 28.381  32.466  1.00 21.28  ? 41  THR C C   1 
ATOM   7744  O O   . THR C  1 44  ? 149.939 28.423  31.311  1.00 20.04  ? 41  THR C O   1 
ATOM   7745  C CB  . THR C  1 44  ? 150.137 26.379  33.830  1.00 23.15  ? 41  THR C CB  1 
ATOM   7746  O OG1 . THR C  1 44  ? 151.059 25.865  34.810  1.00 24.49  ? 41  THR C OG1 1 
ATOM   7747  C CG2 . THR C  1 44  ? 150.313 25.608  32.531  1.00 23.67  ? 41  THR C CG2 1 
ATOM   7748  N N   . VAL C  1 45  ? 148.298 28.767  32.800  1.00 20.84  ? 42  VAL C N   1 
ATOM   7749  C CA  . VAL C  1 45  ? 147.413 29.421  31.856  1.00 21.23  ? 42  VAL C CA  1 
ATOM   7750  C C   . VAL C  1 45  ? 148.004 30.745  31.382  1.00 22.71  ? 42  VAL C C   1 
ATOM   7751  O O   . VAL C  1 45  ? 147.912 31.063  30.220  1.00 23.32  ? 42  VAL C O   1 
ATOM   7752  C CB  . VAL C  1 45  ? 146.031 29.682  32.485  1.00 21.07  ? 42  VAL C CB  1 
ATOM   7753  C CG1 . VAL C  1 45  ? 145.091 30.437  31.550  1.00 20.54  ? 42  VAL C CG1 1 
ATOM   7754  C CG2 . VAL C  1 45  ? 145.386 28.367  32.850  1.00 21.34  ? 42  VAL C CG2 1 
ATOM   7755  N N   . GLU C  1 46  ? 148.583 31.526  32.286  1.00 25.01  ? 43  GLU C N   1 
ATOM   7756  C CA  . GLU C  1 46  ? 149.237 32.788  31.922  1.00 25.81  ? 43  GLU C CA  1 
ATOM   7757  C C   . GLU C  1 46  ? 150.463 32.614  31.043  1.00 26.22  ? 43  GLU C C   1 
ATOM   7758  O O   . GLU C  1 46  ? 150.820 33.522  30.316  1.00 28.28  ? 43  GLU C O   1 
ATOM   7759  C CB  . GLU C  1 46  ? 149.641 33.541  33.167  1.00 26.86  ? 43  GLU C CB  1 
ATOM   7760  C CG  . GLU C  1 46  ? 148.451 34.098  33.921  1.00 28.14  ? 43  GLU C CG  1 
ATOM   7761  C CD  . GLU C  1 46  ? 148.855 34.755  35.219  1.00 29.36  ? 43  GLU C CD  1 
ATOM   7762  O OE1 . GLU C  1 46  ? 147.942 35.146  35.975  1.00 26.56  ? 43  GLU C OE1 1 
ATOM   7763  O OE2 . GLU C  1 46  ? 150.092 34.870  35.459  1.00 32.38  ? 43  GLU C OE2 1 
ATOM   7764  N N   . GLN C  1 47  ? 151.125 31.470  31.135  1.00 26.42  ? 44  GLN C N   1 
ATOM   7765  C CA  . GLN C  1 47  ? 152.191 31.133  30.191  1.00 27.21  ? 44  GLN C CA  1 
ATOM   7766  C C   . GLN C  1 47  ? 151.636 30.867  28.780  1.00 24.17  ? 44  GLN C C   1 
ATOM   7767  O O   . GLN C  1 47  ? 152.270 31.181  27.774  1.00 22.30  ? 44  GLN C O   1 
ATOM   7768  C CB  . GLN C  1 47  ? 152.966 29.917  30.681  1.00 29.93  ? 44  GLN C CB  1 
ATOM   7769  C CG  . GLN C  1 47  ? 153.711 30.135  31.984  1.00 31.99  ? 44  GLN C CG  1 
ATOM   7770  C CD  . GLN C  1 47  ? 154.288 28.847  32.489  1.00 35.16  ? 44  GLN C CD  1 
ATOM   7771  O OE1 . GLN C  1 47  ? 154.323 27.852  31.755  1.00 38.84  ? 44  GLN C OE1 1 
ATOM   7772  N NE2 . GLN C  1 47  ? 154.773 28.851  33.729  1.00 37.36  ? 44  GLN C NE2 1 
ATOM   7773  N N   . ALA C  1 48  ? 150.447 30.273  28.736  1.00 22.28  ? 45  ALA C N   1 
ATOM   7774  C CA  . ALA C  1 48  ? 149.713 30.078  27.488  1.00 20.04  ? 45  ALA C CA  1 
ATOM   7775  C C   . ALA C  1 48  ? 149.302 31.388  26.857  1.00 19.01  ? 45  ALA C C   1 
ATOM   7776  O O   . ALA C  1 48  ? 149.483 31.569  25.669  1.00 20.21  ? 45  ALA C O   1 
ATOM   7777  C CB  . ALA C  1 48  ? 148.508 29.203  27.708  1.00 19.32  ? 45  ALA C CB  1 
ATOM   7778  N N   . ILE C  1 49  ? 148.785 32.306  27.652  1.00 17.22  ? 46  ILE C N   1 
ATOM   7779  C CA  . ILE C  1 49  ? 148.375 33.600  27.157  1.00 16.59  ? 46  ILE C CA  1 
ATOM   7780  C C   . ILE C  1 49  ? 149.589 34.419  26.724  1.00 16.66  ? 46  ILE C C   1 
ATOM   7781  O O   . ILE C  1 49  ? 149.548 35.031  25.660  1.00 16.86  ? 46  ILE C O   1 
ATOM   7782  C CB  . ILE C  1 49  ? 147.497 34.346  28.200  1.00 17.00  ? 46  ILE C CB  1 
ATOM   7783  C CG1 . ILE C  1 49  ? 146.207 33.532  28.474  1.00 16.47  ? 46  ILE C CG1 1 
ATOM   7784  C CG2 . ILE C  1 49  ? 147.141 35.785  27.761  1.00 16.67  ? 46  ILE C CG2 1 
ATOM   7785  C CD1 . ILE C  1 49  ? 145.570 33.821  29.803  1.00 16.00  ? 46  ILE C CD1 1 
ATOM   7786  N N   . SER C  1 50  ? 150.666 34.429  27.512  1.00 16.64  ? 47  SER C N   1 
ATOM   7787  C CA  . SER C  1 50  ? 151.909 35.091  27.096  1.00 16.54  ? 47  SER C CA  1 
ATOM   7788  C C   . SER C  1 50  ? 152.392 34.559  25.750  1.00 17.10  ? 47  SER C C   1 
ATOM   7789  O O   . SER C  1 50  ? 152.753 35.333  24.865  1.00 17.64  ? 47  SER C O   1 
ATOM   7790  C CB  . SER C  1 50  ? 153.009 34.879  28.110  1.00 16.20  ? 47  SER C CB  1 
ATOM   7791  O OG  . SER C  1 50  ? 152.641 35.467  29.317  1.00 16.64  ? 47  SER C OG  1 
ATOM   7792  N N   . ALA C  1 51  ? 152.393 33.237  25.600  1.00 16.99  ? 48  ALA C N   1 
ATOM   7793  C CA  . ALA C  1 51  ? 152.796 32.608  24.347  1.00 17.21  ? 48  ALA C CA  1 
ATOM   7794  C C   . ALA C  1 51  ? 151.988 33.135  23.150  1.00 17.70  ? 48  ALA C C   1 
ATOM   7795  O O   . ALA C  1 51  ? 152.552 33.579  22.155  1.00 18.24  ? 48  ALA C O   1 
ATOM   7796  C CB  . ALA C  1 51  ? 152.666 31.098  24.454  1.00 17.00  ? 48  ALA C CB  1 
ATOM   7797  N N   . ALA C  1 52  ? 150.671 33.069  23.285  1.00 18.27  ? 49  ALA C N   1 
ATOM   7798  C CA  . ALA C  1 52  ? 149.711 33.550  22.302  1.00 18.60  ? 49  ALA C CA  1 
ATOM   7799  C C   . ALA C  1 52  ? 149.870 35.014  22.043  1.00 19.54  ? 49  ALA C C   1 
ATOM   7800  O O   . ALA C  1 52  ? 149.848 35.414  20.884  1.00 20.43  ? 49  ALA C O   1 
ATOM   7801  C CB  . ALA C  1 52  ? 148.290 33.310  22.786  1.00 18.51  ? 49  ALA C CB  1 
ATOM   7802  N N   . GLN C  1 53  ? 149.984 35.813  23.110  1.00 19.66  ? 50  GLN C N   1 
ATOM   7803  C CA  . GLN C  1 53  ? 150.148 37.258  22.978  1.00 19.90  ? 50  GLN C CA  1 
ATOM   7804  C C   . GLN C  1 53  ? 151.472 37.606  22.297  1.00 21.21  ? 50  GLN C C   1 
ATOM   7805  O O   . GLN C  1 53  ? 151.508 38.539  21.505  1.00 21.54  ? 50  GLN C O   1 
ATOM   7806  C CB  . GLN C  1 53  ? 150.037 37.937  24.334  1.00 20.00  ? 50  GLN C CB  1 
ATOM   7807  C CG  . GLN C  1 53  ? 150.078 39.457  24.306  1.00 20.46  ? 50  GLN C CG  1 
ATOM   7808  C CD  . GLN C  1 53  ? 148.817 40.111  23.738  1.00 21.50  ? 50  GLN C CD  1 
ATOM   7809  O OE1 . GLN C  1 53  ? 147.668 39.669  23.969  1.00 20.84  ? 50  GLN C OE1 1 
ATOM   7810  N NE2 . GLN C  1 53  ? 149.022 41.209  23.007  1.00 22.30  ? 50  GLN C NE2 1 
ATOM   7811  N N   . HIS C  1 54  ? 152.535 36.850  22.582  1.00 22.18  ? 51  HIS C N   1 
ATOM   7812  C CA  . HIS C  1 54  ? 153.831 37.087  21.973  1.00 24.33  ? 51  HIS C CA  1 
ATOM   7813  C C   . HIS C  1 54  ? 153.787 36.733  20.473  1.00 21.93  ? 51  HIS C C   1 
ATOM   7814  O O   . HIS C  1 54  ? 154.456 37.377  19.671  1.00 21.75  ? 51  HIS C O   1 
ATOM   7815  C CB  . HIS C  1 54  ? 154.966 36.357  22.754  1.00 29.45  ? 51  HIS C CB  1 
ATOM   7816  C CG  . HIS C  1 54  ? 156.313 36.474  22.114  1.00 35.65  ? 51  HIS C CG  1 
ATOM   7817  N ND1 . HIS C  1 54  ? 156.923 37.689  21.888  1.00 41.65  ? 51  HIS C ND1 1 
ATOM   7818  C CD2 . HIS C  1 54  ? 157.142 35.535  21.601  1.00 39.59  ? 51  HIS C CD2 1 
ATOM   7819  C CE1 . HIS C  1 54  ? 158.061 37.495  21.244  1.00 46.78  ? 51  HIS C CE1 1 
ATOM   7820  N NE2 . HIS C  1 54  ? 158.225 36.193  21.074  1.00 45.82  ? 51  HIS C NE2 1 
ATOM   7821  N N   . ALA C  1 55  ? 152.974 35.747  20.096  1.00 20.00  ? 52  ALA C N   1 
ATOM   7822  C CA  . ALA C  1 55  ? 152.846 35.318  18.691  1.00 18.90  ? 52  ALA C CA  1 
ATOM   7823  C C   . ALA C  1 55  ? 151.985 36.216  17.835  1.00 18.51  ? 52  ALA C C   1 
ATOM   7824  O O   . ALA C  1 55  ? 152.039 36.161  16.605  1.00 18.17  ? 52  ALA C O   1 
ATOM   7825  C CB  . ALA C  1 55  ? 152.276 33.923  18.622  1.00 18.95  ? 52  ALA C CB  1 
ATOM   7826  N N   . PHE C  1 56  ? 151.174 37.038  18.478  1.00 17.94  ? 53  PHE C N   1 
ATOM   7827  C CA  . PHE C  1 56  ? 150.072 37.691  17.790  1.00 17.27  ? 53  PHE C CA  1 
ATOM   7828  C C   . PHE C  1 56  ? 150.466 38.754  16.767  1.00 17.23  ? 53  PHE C C   1 
ATOM   7829  O O   . PHE C  1 56  ? 149.941 38.759  15.661  1.00 17.51  ? 53  PHE C O   1 
ATOM   7830  C CB  . PHE C  1 56  ? 149.109 38.261  18.813  1.00 16.80  ? 53  PHE C CB  1 
ATOM   7831  C CG  . PHE C  1 56  ? 148.070 39.151  18.222  1.00 16.26  ? 53  PHE C CG  1 
ATOM   7832  C CD1 . PHE C  1 56  ? 147.183 38.648  17.290  1.00 16.03  ? 53  PHE C CD1 1 
ATOM   7833  C CD2 . PHE C  1 56  ? 147.987 40.484  18.582  1.00 15.67  ? 53  PHE C CD2 1 
ATOM   7834  C CE1 . PHE C  1 56  ? 146.216 39.462  16.741  1.00 15.68  ? 53  PHE C CE1 1 
ATOM   7835  C CE2 . PHE C  1 56  ? 147.030 41.308  18.030  1.00 15.40  ? 53  PHE C CE2 1 
ATOM   7836  C CZ  . PHE C  1 56  ? 146.142 40.796  17.113  1.00 15.65  ? 53  PHE C CZ  1 
ATOM   7837  N N   . PRO C  1 57  ? 151.364 39.666  17.141  1.00 16.73  ? 54  PRO C N   1 
ATOM   7838  C CA  . PRO C  1 57  ? 151.774 40.701  16.221  1.00 16.68  ? 54  PRO C CA  1 
ATOM   7839  C C   . PRO C  1 57  ? 152.187 40.239  14.831  1.00 16.81  ? 54  PRO C C   1 
ATOM   7840  O O   . PRO C  1 57  ? 151.724 40.822  13.853  1.00 17.95  ? 54  PRO C O   1 
ATOM   7841  C CB  . PRO C  1 57  ? 152.953 41.327  16.939  1.00 16.50  ? 54  PRO C CB  1 
ATOM   7842  C CG  . PRO C  1 57  ? 152.561 41.231  18.362  1.00 16.52  ? 54  PRO C CG  1 
ATOM   7843  C CD  . PRO C  1 57  ? 151.939 39.886  18.478  1.00 16.50  ? 54  PRO C CD  1 
ATOM   7844  N N   . THR C  1 58  ? 153.045 39.229  14.720  1.00 16.71  ? 55  THR C N   1 
ATOM   7845  C CA  . THR C  1 58  ? 153.500 38.815  13.385  1.00 16.77  ? 55  THR C CA  1 
ATOM   7846  C C   . THR C  1 58  ? 152.392 38.094  12.661  1.00 17.22  ? 55  THR C C   1 
ATOM   7847  O O   . THR C  1 58  ? 152.210 38.296  11.462  1.00 18.03  ? 55  THR C O   1 
ATOM   7848  C CB  . THR C  1 58  ? 154.836 38.024  13.343  1.00 16.29  ? 55  THR C CB  1 
ATOM   7849  O OG1 . THR C  1 58  ? 154.842 36.946  14.289  1.00 16.91  ? 55  THR C OG1 1 
ATOM   7850  C CG2 . THR C  1 58  ? 155.980 38.954  13.639  1.00 16.27  ? 55  THR C CG2 1 
ATOM   7851  N N   . TRP C  1 59  ? 151.638 37.280  13.398  1.00 17.82  ? 56  TRP C N   1 
ATOM   7852  C CA  . TRP C  1 59  ? 150.522 36.518  12.837  1.00 17.67  ? 56  TRP C CA  1 
ATOM   7853  C C   . TRP C  1 59  ? 149.355 37.448  12.412  1.00 18.50  ? 56  TRP C C   1 
ATOM   7854  O O   . TRP C  1 59  ? 148.707 37.229  11.378  1.00 18.02  ? 56  TRP C O   1 
ATOM   7855  C CB  . TRP C  1 59  ? 150.070 35.478  13.839  1.00 17.15  ? 56  TRP C CB  1 
ATOM   7856  C CG  . TRP C  1 59  ? 149.033 34.563  13.320  1.00 16.78  ? 56  TRP C CG  1 
ATOM   7857  C CD1 . TRP C  1 59  ? 147.696 34.515  13.679  1.00 16.51  ? 56  TRP C CD1 1 
ATOM   7858  C CD2 . TRP C  1 59  ? 149.221 33.564  12.347  1.00 16.11  ? 56  TRP C CD2 1 
ATOM   7859  N NE1 . TRP C  1 59  ? 147.063 33.538  12.975  1.00 16.26  ? 56  TRP C NE1 1 
ATOM   7860  C CE2 . TRP C  1 59  ? 147.979 32.929  12.154  1.00 16.27  ? 56  TRP C CE2 1 
ATOM   7861  C CE3 . TRP C  1 59  ? 150.321 33.124  11.626  1.00 16.37  ? 56  TRP C CE3 1 
ATOM   7862  C CZ2 . TRP C  1 59  ? 147.817 31.874  11.263  1.00 16.55  ? 56  TRP C CZ2 1 
ATOM   7863  C CZ3 . TRP C  1 59  ? 150.159 32.077  10.732  1.00 16.38  ? 56  TRP C CZ3 1 
ATOM   7864  C CH2 . TRP C  1 59  ? 148.919 31.469  10.551  1.00 16.33  ? 56  TRP C CH2 1 
ATOM   7865  N N   . ARG C  1 60  ? 149.128 38.504  13.187  1.00 19.50  ? 57  ARG C N   1 
ATOM   7866  C CA  . ARG C  1 60  ? 148.189 39.574  12.815  1.00 20.81  ? 57  ARG C CA  1 
ATOM   7867  C C   . ARG C  1 60  ? 148.430 40.104  11.402  1.00 20.44  ? 57  ARG C C   1 
ATOM   7868  O O   . ARG C  1 60  ? 147.496 40.286  10.631  1.00 19.79  ? 57  ARG C O   1 
ATOM   7869  C CB  . ARG C  1 60  ? 148.274 40.710  13.839  1.00 21.95  ? 57  ARG C CB  1 
ATOM   7870  C CG  . ARG C  1 60  ? 147.418 41.934  13.550  1.00 23.65  ? 57  ARG C CG  1 
ATOM   7871  C CD  . ARG C  1 60  ? 147.751 43.086  14.502  1.00 25.49  ? 57  ARG C CD  1 
ATOM   7872  N NE  . ARG C  1 60  ? 147.900 44.316  13.728  1.00 27.74  ? 57  ARG C NE  1 
ATOM   7873  C CZ  . ARG C  1 60  ? 146.928 45.186  13.475  1.00 32.04  ? 57  ARG C CZ  1 
ATOM   7874  N NH1 . ARG C  1 60  ? 145.682 45.034  13.960  1.00 34.57  ? 57  ARG C NH1 1 
ATOM   7875  N NH2 . ARG C  1 60  ? 147.200 46.243  12.726  1.00 34.40  ? 57  ARG C NH2 1 
ATOM   7876  N N   . ASN C  1 61  ? 149.692 40.333  11.081  1.00 21.20  ? 58  ASN C N   1 
ATOM   7877  C CA  . ASN C  1 61  ? 150.068 40.871  9.785   1.00 22.44  ? 58  ASN C CA  1 
ATOM   7878  C C   . ASN C  1 61  ? 150.326 39.804  8.731   1.00 21.15  ? 58  ASN C C   1 
ATOM   7879  O O   . ASN C  1 61  ? 150.617 40.135  7.576   1.00 20.62  ? 58  ASN C O   1 
ATOM   7880  C CB  . ASN C  1 61  ? 151.310 41.759  9.926   1.00 24.10  ? 58  ASN C CB  1 
ATOM   7881  C CG  . ASN C  1 61  ? 151.032 43.029  10.684  1.00 25.28  ? 58  ASN C CG  1 
ATOM   7882  O OD1 . ASN C  1 61  ? 149.882 43.434  10.844  1.00 27.87  ? 58  ASN C OD1 1 
ATOM   7883  N ND2 . ASN C  1 61  ? 152.088 43.671  11.154  1.00 26.38  ? 58  ASN C ND2 1 
ATOM   7884  N N   . THR C  1 62  ? 150.244 38.535  9.119   1.00 19.83  ? 59  THR C N   1 
ATOM   7885  C CA  . THR C  1 62  ? 150.462 37.451  8.177   1.00 19.04  ? 59  THR C CA  1 
ATOM   7886  C C   . THR C  1 62  ? 149.268 37.467  7.226   1.00 19.28  ? 59  THR C C   1 
ATOM   7887  O O   . THR C  1 62  ? 148.127 37.470  7.681   1.00 20.86  ? 59  THR C O   1 
ATOM   7888  C CB  . THR C  1 62  ? 150.546 36.080  8.869   1.00 18.54  ? 59  THR C CB  1 
ATOM   7889  O OG1 . THR C  1 62  ? 151.592 36.067  9.857   1.00 17.88  ? 59  THR C OG1 1 
ATOM   7890  C CG2 . THR C  1 62  ? 150.820 34.989  7.849   1.00 18.43  ? 59  THR C CG2 1 
ATOM   7891  N N   . PRO C  1 63  ? 149.515 37.528  5.909   1.00 18.17  ? 60  PRO C N   1 
ATOM   7892  C CA  . PRO C  1 63  ? 148.404 37.571  4.995   1.00 17.57  ? 60  PRO C CA  1 
ATOM   7893  C C   . PRO C  1 63  ? 147.431 36.405  5.189   1.00 17.86  ? 60  PRO C C   1 
ATOM   7894  O O   . PRO C  1 63  ? 147.852 35.297  5.519   1.00 17.41  ? 60  PRO C O   1 
ATOM   7895  C CB  . PRO C  1 63  ? 149.079 37.481  3.646   1.00 17.59  ? 60  PRO C CB  1 
ATOM   7896  C CG  . PRO C  1 63  ? 150.367 38.171  3.849   1.00 17.64  ? 60  PRO C CG  1 
ATOM   7897  C CD  . PRO C  1 63  ? 150.792 37.761  5.218   1.00 17.94  ? 60  PRO C CD  1 
ATOM   7898  N N   . PRO C  1 64  ? 146.128 36.662  5.019   1.00 18.00  ? 61  PRO C N   1 
ATOM   7899  C CA  . PRO C  1 64  ? 145.111 35.648  5.123   1.00 18.10  ? 61  PRO C CA  1 
ATOM   7900  C C   . PRO C  1 64  ? 145.414 34.413  4.317   1.00 18.21  ? 61  PRO C C   1 
ATOM   7901  O O   . PRO C  1 64  ? 145.211 33.308  4.800   1.00 18.38  ? 61  PRO C O   1 
ATOM   7902  C CB  . PRO C  1 64  ? 143.886 36.340  4.552   1.00 18.52  ? 61  PRO C CB  1 
ATOM   7903  C CG  . PRO C  1 64  ? 144.070 37.755  4.939   1.00 18.88  ? 61  PRO C CG  1 
ATOM   7904  C CD  . PRO C  1 64  ? 145.542 38.006  4.924   1.00 18.38  ? 61  PRO C CD  1 
ATOM   7905  N N   . LEU C  1 65  ? 145.868 34.603  3.089   1.00 18.76  ? 62  LEU C N   1 
ATOM   7906  C CA  . LEU C  1 65  ? 146.175 33.469  2.207   1.00 19.69  ? 62  LEU C CA  1 
ATOM   7907  C C   . LEU C  1 65  ? 147.191 32.529  2.826   1.00 20.42  ? 62  LEU C C   1 
ATOM   7908  O O   . LEU C  1 65  ? 147.055 31.323  2.733   1.00 21.65  ? 62  LEU C O   1 
ATOM   7909  C CB  . LEU C  1 65  ? 146.750 33.945  0.880   1.00 20.04  ? 62  LEU C CB  1 
ATOM   7910  C CG  . LEU C  1 65  ? 145.800 34.038  -0.290  1.00 20.53  ? 62  LEU C CG  1 
ATOM   7911  C CD1 . LEU C  1 65  ? 146.382 34.904  -1.405  1.00 21.33  ? 62  LEU C CD1 1 
ATOM   7912  C CD2 . LEU C  1 65  ? 145.522 32.635  -0.774  1.00 20.88  ? 62  LEU C CD2 1 
ATOM   7913  N N   . LYS C  1 66  ? 148.223 33.106  3.429   1.00 20.56  ? 63  LYS C N   1 
ATOM   7914  C CA  . LYS C  1 66  ? 149.260 32.355  4.088   1.00 20.23  ? 63  LYS C CA  1 
ATOM   7915  C C   . LYS C  1 66  ? 148.723 31.667  5.332   1.00 18.56  ? 63  LYS C C   1 
ATOM   7916  O O   . LYS C  1 66  ? 149.088 30.531  5.596   1.00 18.62  ? 63  LYS C O   1 
ATOM   7917  C CB  . LYS C  1 66  ? 150.450 33.256  4.437   1.00 21.91  ? 63  LYS C CB  1 
ATOM   7918  C CG  . LYS C  1 66  ? 151.637 32.434  4.909   1.00 24.27  ? 63  LYS C CG  1 
ATOM   7919  C CD  . LYS C  1 66  ? 152.889 33.251  5.174   1.00 25.95  ? 63  LYS C CD  1 
ATOM   7920  C CE  . LYS C  1 66  ? 154.073 32.352  5.523   1.00 26.07  ? 63  LYS C CE  1 
ATOM   7921  N NZ  . LYS C  1 66  ? 155.275 33.172  5.817   1.00 26.86  ? 63  LYS C NZ  1 
ATOM   7922  N N   . ARG C  1 67  ? 147.857 32.338  6.094   1.00 17.24  ? 64  ARG C N   1 
ATOM   7923  C CA  . ARG C  1 67  ? 147.235 31.710  7.301   1.00 16.27  ? 64  ARG C CA  1 
ATOM   7924  C C   . ARG C  1 67  ? 146.318 30.555  6.911   1.00 15.72  ? 64  ARG C C   1 
ATOM   7925  O O   . ARG C  1 67  ? 146.175 29.580  7.639   1.00 14.87  ? 64  ARG C O   1 
ATOM   7926  C CB  . ARG C  1 67  ? 146.395 32.708  8.116   1.00 15.82  ? 64  ARG C CB  1 
ATOM   7927  C CG  . ARG C  1 67  ? 147.107 33.971  8.577   1.00 15.54  ? 64  ARG C CG  1 
ATOM   7928  C CD  . ARG C  1 67  ? 146.385 34.645  9.732   1.00 15.27  ? 64  ARG C CD  1 
ATOM   7929  N NE  . ARG C  1 67  ? 145.188 35.377  9.316   1.00 14.77  ? 64  ARG C NE  1 
ATOM   7930  C CZ  . ARG C  1 67  ? 145.025 36.703  9.346   1.00 14.18  ? 64  ARG C CZ  1 
ATOM   7931  N NH1 . ARG C  1 67  ? 145.961 37.531  9.791   1.00 14.49  ? 64  ARG C NH1 1 
ATOM   7932  N NH2 . ARG C  1 67  ? 143.885 37.213  8.947   1.00 13.83  ? 64  ARG C NH2 1 
ATOM   7933  N N   . ALA C  1 68  ? 145.669 30.705  5.762   1.00 15.70  ? 65  ALA C N   1 
ATOM   7934  C CA  . ALA C  1 68  ? 144.688 29.740  5.309   1.00 16.09  ? 65  ALA C CA  1 
ATOM   7935  C C   . ALA C  1 68  ? 145.345 28.492  4.761   1.00 16.83  ? 65  ALA C C   1 
ATOM   7936  O O   . ALA C  1 68  ? 144.731 27.422  4.782   1.00 16.52  ? 65  ALA C O   1 
ATOM   7937  C CB  . ALA C  1 68  ? 143.760 30.361  4.289   1.00 15.86  ? 65  ALA C CB  1 
ATOM   7938  N N   . ARG C  1 69  ? 146.592 28.631  4.301   1.00 18.16  ? 66  ARG C N   1 
ATOM   7939  C CA  . ARG C  1 69  ? 147.370 27.494  3.778   1.00 19.21  ? 66  ARG C CA  1 
ATOM   7940  C C   . ARG C  1 69  ? 147.758 26.510  4.878   1.00 18.44  ? 66  ARG C C   1 
ATOM   7941  O O   . ARG C  1 69  ? 147.977 25.342  4.596   1.00 18.07  ? 66  ARG C O   1 
ATOM   7942  C CB  . ARG C  1 69  ? 148.614 27.964  3.006   1.00 20.53  ? 66  ARG C CB  1 
ATOM   7943  C CG  . ARG C  1 69  ? 148.312 28.532  1.606   1.00 21.72  ? 66  ARG C CG  1 
ATOM   7944  C CD  . ARG C  1 69  ? 149.562 28.610  0.729   1.00 22.27  ? 66  ARG C CD  1 
ATOM   7945  N NE  . ARG C  1 69  ? 149.696 29.956  0.187   1.00 23.44  ? 66  ARG C NE  1 
ATOM   7946  C CZ  . ARG C  1 69  ? 149.102 30.410  -0.908  1.00 23.67  ? 66  ARG C CZ  1 
ATOM   7947  N NH1 . ARG C  1 69  ? 148.332 29.622  -1.628  1.00 23.55  ? 66  ARG C NH1 1 
ATOM   7948  N NH2 . ARG C  1 69  ? 149.306 31.665  -1.301  1.00 24.89  ? 66  ARG C NH2 1 
ATOM   7949  N N   . VAL C  1 70  ? 147.826 26.993  6.115   1.00 18.17  ? 67  VAL C N   1 
ATOM   7950  C CA  . VAL C  1 70  ? 148.015 26.140  7.287   1.00 18.45  ? 67  VAL C CA  1 
ATOM   7951  C C   . VAL C  1 70  ? 146.805 25.225  7.466   1.00 18.27  ? 67  VAL C C   1 
ATOM   7952  O O   . VAL C  1 70  ? 146.933 24.026  7.724   1.00 17.00  ? 67  VAL C O   1 
ATOM   7953  C CB  . VAL C  1 70  ? 148.186 26.987  8.565   1.00 19.75  ? 67  VAL C CB  1 
ATOM   7954  C CG1 . VAL C  1 70  ? 148.344 26.117  9.803   1.00 19.99  ? 67  VAL C CG1 1 
ATOM   7955  C CG2 . VAL C  1 70  ? 149.391 27.931  8.452   1.00 20.50  ? 67  VAL C CG2 1 
ATOM   7956  N N   . MET C  1 71  ? 145.618 25.798  7.324   1.00 18.67  ? 68  MET C N   1 
ATOM   7957  C CA  . MET C  1 71  ? 144.396 24.998  7.421   1.00 18.64  ? 68  MET C CA  1 
ATOM   7958  C C   . MET C  1 71  ? 144.212 24.025  6.255   1.00 18.31  ? 68  MET C C   1 
ATOM   7959  O O   . MET C  1 71  ? 143.641 22.947  6.430   1.00 18.24  ? 68  MET C O   1 
ATOM   7960  C CB  . MET C  1 71  ? 143.162 25.884  7.558   1.00 18.74  ? 68  MET C CB  1 
ATOM   7961  C CG  . MET C  1 71  ? 143.196 26.881  8.729   1.00 19.35  ? 68  MET C CG  1 
ATOM   7962  S SD  . MET C  1 71  ? 143.704 26.410  10.417  1.00 18.50  ? 68  MET C SD  1 
ATOM   7963  C CE  . MET C  1 71  ? 142.443 25.223  10.657  1.00 19.39  ? 68  MET C CE  1 
ATOM   7964  N N   . PHE C  1 72  ? 144.681 24.393  5.069   1.00 17.91  ? 69  PHE C N   1 
ATOM   7965  C CA  . PHE C  1 72  ? 144.742 23.427  3.949   1.00 17.90  ? 69  PHE C CA  1 
ATOM   7966  C C   . PHE C  1 72  ? 145.563 22.184  4.294   1.00 17.79  ? 69  PHE C C   1 
ATOM   7967  O O   . PHE C  1 72  ? 145.120 21.066  4.101   1.00 16.80  ? 69  PHE C O   1 
ATOM   7968  C CB  . PHE C  1 72  ? 145.310 24.070  2.680   1.00 17.55  ? 69  PHE C CB  1 
ATOM   7969  C CG  . PHE C  1 72  ? 144.285 24.772  1.842   1.00 17.13  ? 69  PHE C CG  1 
ATOM   7970  C CD1 . PHE C  1 72  ? 143.485 24.060  0.985   1.00 17.29  ? 69  PHE C CD1 1 
ATOM   7971  C CD2 . PHE C  1 72  ? 144.124 26.149  1.900   1.00 16.92  ? 69  PHE C CD2 1 
ATOM   7972  C CE1 . PHE C  1 72  ? 142.552 24.712  0.179   1.00 17.05  ? 69  PHE C CE1 1 
ATOM   7973  C CE2 . PHE C  1 72  ? 143.193 26.800  1.103   1.00 16.54  ? 69  PHE C CE2 1 
ATOM   7974  C CZ  . PHE C  1 72  ? 142.410 26.081  0.238   1.00 16.36  ? 69  PHE C CZ  1 
ATOM   7975  N N   . ARG C  1 73  ? 146.758 22.403  4.809   1.00 19.11  ? 70  ARG C N   1 
ATOM   7976  C CA  . ARG C  1 73  ? 147.610 21.309  5.246   1.00 20.73  ? 70  ARG C CA  1 
ATOM   7977  C C   . ARG C  1 73  ? 147.043 20.625  6.484   1.00 20.03  ? 70  ARG C C   1 
ATOM   7978  O O   . ARG C  1 73  ? 147.195 19.438  6.621   1.00 20.60  ? 70  ARG C O   1 
ATOM   7979  C CB  . ARG C  1 73  ? 149.026 21.805  5.532   1.00 22.50  ? 70  ARG C CB  1 
ATOM   7980  C CG  . ARG C  1 73  ? 149.691 22.476  4.343   1.00 24.63  ? 70  ARG C CG  1 
ATOM   7981  C CD  . ARG C  1 73  ? 151.116 22.882  4.668   1.00 27.60  ? 70  ARG C CD  1 
ATOM   7982  N NE  . ARG C  1 73  ? 151.501 24.085  3.930   1.00 30.12  ? 70  ARG C NE  1 
ATOM   7983  C CZ  . ARG C  1 73  ? 151.553 25.328  4.428   1.00 31.06  ? 70  ARG C CZ  1 
ATOM   7984  N NH1 . ARG C  1 73  ? 151.249 25.584  5.708   1.00 29.68  ? 70  ARG C NH1 1 
ATOM   7985  N NH2 . ARG C  1 73  ? 151.928 26.335  3.624   1.00 32.08  ? 70  ARG C NH2 1 
ATOM   7986  N N   . PHE C  1 74  ? 146.407 21.375  7.380   1.00 19.67  ? 71  PHE C N   1 
ATOM   7987  C CA  . PHE C  1 74  ? 145.842 20.805  8.595   1.00 19.59  ? 71  PHE C CA  1 
ATOM   7988  C C   . PHE C  1 74  ? 144.750 19.814  8.257   1.00 20.39  ? 71  PHE C C   1 
ATOM   7989  O O   . PHE C  1 74  ? 144.581 18.832  8.957   1.00 20.66  ? 71  PHE C O   1 
ATOM   7990  C CB  . PHE C  1 74  ? 145.267 21.911  9.481   1.00 19.40  ? 71  PHE C CB  1 
ATOM   7991  C CG  . PHE C  1 74  ? 144.746 21.449  10.827  1.00 18.80  ? 71  PHE C CG  1 
ATOM   7992  C CD1 . PHE C  1 74  ? 145.471 20.582  11.629  1.00 19.28  ? 71  PHE C CD1 1 
ATOM   7993  C CD2 . PHE C  1 74  ? 143.539 21.943  11.325  1.00 18.65  ? 71  PHE C CD2 1 
ATOM   7994  C CE1 . PHE C  1 74  ? 144.979 20.195  12.890  1.00 19.49  ? 71  PHE C CE1 1 
ATOM   7995  C CE2 . PHE C  1 74  ? 143.041 21.568  12.579  1.00 18.54  ? 71  PHE C CE2 1 
ATOM   7996  C CZ  . PHE C  1 74  ? 143.765 20.698  13.367  1.00 18.90  ? 71  PHE C CZ  1 
ATOM   7997  N N   . LYS C  1 75  ? 144.008 20.086  7.186   1.00 21.64  ? 72  LYS C N   1 
ATOM   7998  C CA  . LYS C  1 75  ? 142.927 19.224  6.732   1.00 21.87  ? 72  LYS C CA  1 
ATOM   7999  C C   . LYS C  1 75  ? 143.453 17.860  6.334   1.00 23.16  ? 72  LYS C C   1 
ATOM   8000  O O   . LYS C  1 75  ? 142.902 16.854  6.739   1.00 23.45  ? 72  LYS C O   1 
ATOM   8001  C CB  . LYS C  1 75  ? 142.226 19.858  5.538   1.00 22.61  ? 72  LYS C CB  1 
ATOM   8002  C CG  . LYS C  1 75  ? 141.139 18.988  4.925   1.00 23.19  ? 72  LYS C CG  1 
ATOM   8003  C CD  . LYS C  1 75  ? 140.464 19.615  3.729   1.00 23.13  ? 72  LYS C CD  1 
ATOM   8004  C CE  . LYS C  1 75  ? 139.322 18.739  3.267   1.00 24.17  ? 72  LYS C CE  1 
ATOM   8005  N NZ  . LYS C  1 75  ? 139.757 17.455  2.649   1.00 25.15  ? 72  LYS C NZ  1 
ATOM   8006  N N   . GLU C  1 76  ? 144.509 17.827  5.532   1.00 25.12  ? 73  GLU C N   1 
ATOM   8007  C CA  . GLU C  1 76  ? 145.128 16.562  5.138   1.00 27.02  ? 73  GLU C CA  1 
ATOM   8008  C C   . GLU C  1 76  ? 145.556 15.743  6.338   1.00 23.65  ? 73  GLU C C   1 
ATOM   8009  O O   . GLU C  1 76  ? 145.285 14.549  6.415   1.00 21.76  ? 73  GLU C O   1 
ATOM   8010  C CB  . GLU C  1 76  ? 146.370 16.810  4.333   1.00 32.84  ? 73  GLU C CB  1 
ATOM   8011  C CG  . GLU C  1 76  ? 146.169 17.451  2.984   1.00 38.90  ? 73  GLU C CG  1 
ATOM   8012  C CD  . GLU C  1 76  ? 147.370 18.337  2.654   1.00 47.89  ? 73  GLU C CD  1 
ATOM   8013  O OE1 . GLU C  1 76  ? 148.512 18.058  3.123   1.00 51.35  ? 73  GLU C OE1 1 
ATOM   8014  O OE2 . GLU C  1 76  ? 147.168 19.349  1.954   1.00 55.17  ? 73  GLU C OE2 1 
ATOM   8015  N N   . LEU C  1 77  ? 146.225 16.405  7.271   1.00 21.36  ? 74  LEU C N   1 
ATOM   8016  C CA  . LEU C  1 77  ? 146.729 15.750  8.467   1.00 20.38  ? 74  LEU C CA  1 
ATOM   8017  C C   . LEU C  1 77  ? 145.610 15.152  9.306   1.00 20.12  ? 74  LEU C C   1 
ATOM   8018  O O   . LEU C  1 77  ? 145.748 14.051  9.807   1.00 19.68  ? 74  LEU C O   1 
ATOM   8019  C CB  . LEU C  1 77  ? 147.561 16.719  9.307   1.00 19.37  ? 74  LEU C CB  1 
ATOM   8020  C CG  . LEU C  1 77  ? 148.859 17.189  8.675   1.00 18.70  ? 74  LEU C CG  1 
ATOM   8021  C CD1 . LEU C  1 77  ? 149.493 18.270  9.519   1.00 18.77  ? 74  LEU C CD1 1 
ATOM   8022  C CD2 . LEU C  1 77  ? 149.814 16.032  8.544   1.00 18.75  ? 74  LEU C CD2 1 
ATOM   8023  N N   . LEU C  1 78  ? 144.495 15.862  9.435   1.00 20.23  ? 75  LEU C N   1 
ATOM   8024  C CA  . LEU C  1 78  ? 143.329 15.313  10.127  1.00 20.81  ? 75  LEU C CA  1 
ATOM   8025  C C   . LEU C  1 78  ? 142.864 14.029  9.468   1.00 22.20  ? 75  LEU C C   1 
ATOM   8026  O O   . LEU C  1 78  ? 142.476 13.086  10.138  1.00 23.57  ? 75  LEU C O   1 
ATOM   8027  C CB  . LEU C  1 78  ? 142.176 16.310  10.147  1.00 20.09  ? 75  LEU C CB  1 
ATOM   8028  C CG  . LEU C  1 78  ? 142.453 17.557  10.990  1.00 20.17  ? 75  LEU C CG  1 
ATOM   8029  C CD1 . LEU C  1 78  ? 141.314 18.544  10.796  1.00 20.35  ? 75  LEU C CD1 1 
ATOM   8030  C CD2 . LEU C  1 78  ? 142.660 17.249  12.468  1.00 20.01  ? 75  LEU C CD2 1 
ATOM   8031  N N   . GLU C  1 79  ? 142.935 13.988  8.151   1.00 23.03  ? 76  GLU C N   1 
ATOM   8032  C CA  . GLU C  1 79  ? 142.487 12.832  7.410   1.00 23.56  ? 76  GLU C CA  1 
ATOM   8033  C C   . GLU C  1 79  ? 143.440 11.665  7.469   1.00 24.75  ? 76  GLU C C   1 
ATOM   8034  O O   . GLU C  1 79  ? 143.004 10.531  7.528   1.00 24.66  ? 76  GLU C O   1 
ATOM   8035  C CB  . GLU C  1 79  ? 142.252 13.229  5.981   1.00 23.85  ? 76  GLU C CB  1 
ATOM   8036  C CG  . GLU C  1 79  ? 141.259 14.358  5.900   1.00 24.58  ? 76  GLU C CG  1 
ATOM   8037  C CD  . GLU C  1 79  ? 140.724 14.584  4.520   1.00 25.18  ? 76  GLU C CD  1 
ATOM   8038  O OE1 . GLU C  1 79  ? 141.422 14.221  3.537   1.00 25.73  ? 76  GLU C OE1 1 
ATOM   8039  O OE2 . GLU C  1 79  ? 139.616 15.161  4.437   1.00 24.59  ? 76  GLU C OE2 1 
ATOM   8040  N N   . GLN C  1 80  ? 144.736 11.938  7.430   1.00 26.77  ? 77  GLN C N   1 
ATOM   8041  C CA  . GLN C  1 80  ? 145.739 10.867  7.532   1.00 27.43  ? 77  GLN C CA  1 
ATOM   8042  C C   . GLN C  1 80  ? 145.695 10.201  8.874   1.00 24.54  ? 77  GLN C C   1 
ATOM   8043  O O   . GLN C  1 80  ? 145.829 9.000   8.956   1.00 23.59  ? 77  GLN C O   1 
ATOM   8044  C CB  . GLN C  1 80  ? 147.148 11.390  7.373   1.00 30.73  ? 77  GLN C CB  1 
ATOM   8045  C CG  . GLN C  1 80  ? 147.272 12.388  6.264   1.00 34.87  ? 77  GLN C CG  1 
ATOM   8046  C CD  . GLN C  1 80  ? 148.691 12.618  5.824   1.00 37.95  ? 77  GLN C CD  1 
ATOM   8047  O OE1 . GLN C  1 80  ? 149.658 12.349  6.569   1.00 36.14  ? 77  GLN C OE1 1 
ATOM   8048  N NE2 . GLN C  1 80  ? 148.830 13.169  4.612   1.00 38.16  ? 77  GLN C NE2 1 
ATOM   8049  N N   . HIS C  1 81  ? 145.514 10.994  9.919   1.00 22.41  ? 78  HIS C N   1 
ATOM   8050  C CA  . HIS C  1 81  ? 145.497 10.484  11.265  1.00 22.55  ? 78  HIS C CA  1 
ATOM   8051  C C   . HIS C  1 81  ? 144.074 10.180  11.770  1.00 21.33  ? 78  HIS C C   1 
ATOM   8052  O O   . HIS C  1 81  ? 143.824 10.104  12.979  1.00 20.57  ? 78  HIS C O   1 
ATOM   8053  C CB  . HIS C  1 81  ? 146.205 11.476  12.191  1.00 23.72  ? 78  HIS C CB  1 
ATOM   8054  C CG  . HIS C  1 81  ? 147.647 11.708  11.848  1.00 25.23  ? 78  HIS C CG  1 
ATOM   8055  N ND1 . HIS C  1 81  ? 148.653 10.874  12.278  1.00 26.27  ? 78  HIS C ND1 1 
ATOM   8056  C CD2 . HIS C  1 81  ? 148.253 12.685  11.132  1.00 25.58  ? 78  HIS C CD2 1 
ATOM   8057  C CE1 . HIS C  1 81  ? 149.812 11.318  11.827  1.00 26.45  ? 78  HIS C CE1 1 
ATOM   8058  N NE2 . HIS C  1 81  ? 149.596 12.419  11.133  1.00 25.86  ? 78  HIS C NE2 1 
ATOM   8059  N N   . ALA C  1 82  ? 143.138 9.961   10.858  1.00 20.49  ? 79  ALA C N   1 
ATOM   8060  C CA  . ALA C  1 82  ? 141.746 9.779   11.254  1.00 20.21  ? 79  ALA C CA  1 
ATOM   8061  C C   . ALA C  1 82  ? 141.564 8.648   12.239  1.00 20.92  ? 79  ALA C C   1 
ATOM   8062  O O   . ALA C  1 82  ? 140.913 8.823   13.259  1.00 20.15  ? 79  ALA C O   1 
ATOM   8063  C CB  . ALA C  1 82  ? 140.867 9.550   10.045  1.00 20.00  ? 79  ALA C CB  1 
ATOM   8064  N N   . ASP C  1 83  ? 142.153 7.493   11.936  1.00 23.15  ? 80  ASP C N   1 
ATOM   8065  C CA  . ASP C  1 83  ? 141.953 6.283   12.748  1.00 23.77  ? 80  ASP C CA  1 
ATOM   8066  C C   . ASP C  1 83  ? 142.493 6.457   14.149  1.00 25.81  ? 80  ASP C C   1 
ATOM   8067  O O   . ASP C  1 83  ? 141.830 6.065   15.085  1.00 26.71  ? 80  ASP C O   1 
ATOM   8068  C CB  . ASP C  1 83  ? 142.585 5.055   12.090  1.00 23.27  ? 80  ASP C CB  1 
ATOM   8069  C CG  . ASP C  1 83  ? 141.941 4.708   10.757  1.00 23.08  ? 80  ASP C CG  1 
ATOM   8070  O OD1 . ASP C  1 83  ? 140.744 5.018   10.577  1.00 22.64  ? 80  ASP C OD1 1 
ATOM   8071  O OD2 . ASP C  1 83  ? 142.624 4.129   9.882   1.00 22.75  ? 80  ASP C OD2 1 
ATOM   8072  N N   . GLU C  1 84  ? 143.661 7.078   14.297  1.00 29.61  ? 81  GLU C N   1 
ATOM   8073  C CA  . GLU C  1 84  ? 144.234 7.331   15.629  1.00 34.16  ? 81  GLU C CA  1 
ATOM   8074  C C   . GLU C  1 84  ? 143.374 8.352   16.342  1.00 30.42  ? 81  GLU C C   1 
ATOM   8075  O O   . GLU C  1 84  ? 143.092 8.187   17.514  1.00 31.41  ? 81  GLU C O   1 
ATOM   8076  C CB  . GLU C  1 84  ? 145.698 7.806   15.596  1.00 41.63  ? 81  GLU C CB  1 
ATOM   8077  C CG  . GLU C  1 84  ? 146.643 6.897   14.788  1.00 51.61  ? 81  GLU C CG  1 
ATOM   8078  C CD  . GLU C  1 84  ? 146.774 7.269   13.273  1.00 59.75  ? 81  GLU C CD  1 
ATOM   8079  O OE1 . GLU C  1 84  ? 147.917 7.625   12.850  1.00 63.36  ? 81  GLU C OE1 1 
ATOM   8080  O OE2 . GLU C  1 84  ? 145.755 7.217   12.494  1.00 55.94  ? 81  GLU C OE2 1 
ATOM   8081  N N   . ILE C  1 85  ? 142.923 9.385   15.639  1.00 26.30  ? 82  ILE C N   1 
ATOM   8082  C CA  . ILE C  1 85  ? 142.034 10.370  16.254  1.00 24.29  ? 82  ILE C CA  1 
ATOM   8083  C C   . ILE C  1 85  ? 140.775 9.711   16.826  1.00 23.95  ? 82  ILE C C   1 
ATOM   8084  O O   . ILE C  1 85  ? 140.433 9.897   18.006  1.00 23.69  ? 82  ILE C O   1 
ATOM   8085  C CB  . ILE C  1 85  ? 141.644 11.475  15.260  1.00 23.47  ? 82  ILE C CB  1 
ATOM   8086  C CG1 . ILE C  1 85  ? 142.846 12.398  15.024  1.00 22.90  ? 82  ILE C CG1 1 
ATOM   8087  C CG2 . ILE C  1 85  ? 140.443 12.274  15.772  1.00 23.42  ? 82  ILE C CG2 1 
ATOM   8088  C CD1 . ILE C  1 85  ? 142.735 13.285  13.799  1.00 22.22  ? 82  ILE C CD1 1 
ATOM   8089  N N   . CYS C  1 86  ? 140.084 8.960   15.971  1.00 23.43  ? 83  CYS C N   1 
ATOM   8090  C CA  . CYS C  1 86  ? 138.891 8.197   16.368  1.00 22.86  ? 83  CYS C CA  1 
ATOM   8091  C C   . CYS C  1 86  ? 139.149 7.228   17.530  1.00 23.99  ? 83  CYS C C   1 
ATOM   8092  O O   . CYS C  1 86  ? 138.317 7.080   18.422  1.00 25.09  ? 83  CYS C O   1 
ATOM   8093  C CB  . CYS C  1 86  ? 138.331 7.462   15.161  1.00 21.70  ? 83  CYS C CB  1 
ATOM   8094  S SG  . CYS C  1 86  ? 137.595 8.639   13.998  1.00 19.90  ? 83  CYS C SG  1 
ATOM   8095  N N   . ARG C  1 87  ? 140.324 6.616   17.532  1.00 24.86  ? 84  ARG C N   1 
ATOM   8096  C CA  . ARG C  1 87  ? 140.736 5.715   18.599  1.00 25.19  ? 84  ARG C CA  1 
ATOM   8097  C C   . ARG C  1 87  ? 140.868 6.397   19.965  1.00 24.75  ? 84  ARG C C   1 
ATOM   8098  O O   . ARG C  1 87  ? 140.507 5.807   20.994  1.00 25.26  ? 84  ARG C O   1 
ATOM   8099  C CB  . ARG C  1 87  ? 142.069 5.085   18.242  1.00 26.47  ? 84  ARG C CB  1 
ATOM   8100  C CG  . ARG C  1 87  ? 142.138 3.608   18.536  1.00 27.96  ? 84  ARG C CG  1 
ATOM   8101  C CD  . ARG C  1 87  ? 143.567 3.172   18.790  1.00 28.69  ? 84  ARG C CD  1 
ATOM   8102  N NE  . ARG C  1 87  ? 144.031 3.641   20.101  1.00 28.84  ? 84  ARG C NE  1 
ATOM   8103  C CZ  . ARG C  1 87  ? 144.931 4.605   20.302  1.00 30.04  ? 84  ARG C CZ  1 
ATOM   8104  N NH1 . ARG C  1 87  ? 145.529 5.257   19.270  1.00 30.80  ? 84  ARG C NH1 1 
ATOM   8105  N NH2 . ARG C  1 87  ? 145.241 4.922   21.556  1.00 29.71  ? 84  ARG C NH2 1 
ATOM   8106  N N   . LEU C  1 88  ? 141.405 7.620   19.958  1.00 23.16  ? 85  LEU C N   1 
ATOM   8107  C CA  . LEU C  1 88  ? 141.573 8.431   21.170  1.00 21.34  ? 85  LEU C CA  1 
ATOM   8108  C C   . LEU C  1 88  ? 140.306 9.077   21.606  1.00 19.89  ? 85  LEU C C   1 
ATOM   8109  O O   . LEU C  1 88  ? 140.171 9.445   22.773  1.00 19.39  ? 85  LEU C O   1 
ATOM   8110  C CB  . LEU C  1 88  ? 142.580 9.550   20.951  1.00 21.51  ? 85  LEU C CB  1 
ATOM   8111  C CG  . LEU C  1 88  ? 143.997 9.108   20.601  1.00 21.57  ? 85  LEU C CG  1 
ATOM   8112  C CD1 . LEU C  1 88  ? 144.776 10.333  20.156  1.00 21.98  ? 85  LEU C CD1 1 
ATOM   8113  C CD2 . LEU C  1 88  ? 144.652 8.411   21.784  1.00 21.10  ? 85  LEU C CD2 1 
ATOM   8114  N N   . ILE C  1 89  ? 139.399 9.288   20.665  1.00 19.37  ? 86  ILE C N   1 
ATOM   8115  C CA  . ILE C  1 89  ? 138.082 9.762   21.033  1.00 19.32  ? 86  ILE C CA  1 
ATOM   8116  C C   . ILE C  1 89  ? 137.423 8.610   21.750  1.00 19.05  ? 86  ILE C C   1 
ATOM   8117  O O   . ILE C  1 89  ? 136.932 8.774   22.866  1.00 18.66  ? 86  ILE C O   1 
ATOM   8118  C CB  . ILE C  1 89  ? 137.252 10.212  19.822  1.00 19.69  ? 86  ILE C CB  1 
ATOM   8119  C CG1 . ILE C  1 89  ? 137.736 11.573  19.306  1.00 19.43  ? 86  ILE C CG1 1 
ATOM   8120  C CG2 . ILE C  1 89  ? 135.791 10.350  20.209  1.00 20.40  ? 86  ILE C CG2 1 
ATOM   8121  C CD1 . ILE C  1 89  ? 137.108 12.019  17.991  1.00 19.02  ? 86  ILE C CD1 1 
ATOM   8122  N N   . GLY C  1 90  ? 137.460 7.446   21.103  1.00 19.02  ? 87  GLY C N   1 
ATOM   8123  C CA  . GLY C  1 90  ? 136.815 6.236   21.605  1.00 19.40  ? 87  GLY C CA  1 
ATOM   8124  C C   . GLY C  1 90  ? 137.308 5.785   22.951  1.00 19.41  ? 87  GLY C C   1 
ATOM   8125  O O   . GLY C  1 90  ? 136.534 5.375   23.793  1.00 19.47  ? 87  GLY C O   1 
ATOM   8126  N N   . GLU C  1 91  ? 138.604 5.890   23.161  1.00 20.42  ? 88  GLU C N   1 
ATOM   8127  C CA  . GLU C  1 91  ? 139.215 5.416   24.395  1.00 21.04  ? 88  GLU C CA  1 
ATOM   8128  C C   . GLU C  1 91  ? 138.727 6.175   25.649  1.00 21.12  ? 88  GLU C C   1 
ATOM   8129  O O   . GLU C  1 91  ? 138.649 5.579   26.722  1.00 22.21  ? 88  GLU C O   1 
ATOM   8130  C CB  . GLU C  1 91  ? 140.742 5.488   24.253  1.00 21.99  ? 88  GLU C CB  1 
ATOM   8131  C CG  . GLU C  1 91  ? 141.562 4.790   25.331  1.00 22.62  ? 88  GLU C CG  1 
ATOM   8132  C CD  . GLU C  1 91  ? 143.053 4.839   25.034  1.00 22.14  ? 88  GLU C CD  1 
ATOM   8133  O OE1 . GLU C  1 91  ? 143.544 3.834   24.495  1.00 21.24  ? 88  GLU C OE1 1 
ATOM   8134  O OE2 . GLU C  1 91  ? 143.716 5.874   25.316  1.00 22.49  ? 88  GLU C OE2 1 
ATOM   8135  N N   . GLU C  1 92  ? 138.392 7.466   25.519  1.00 20.59  ? 89  GLU C N   1 
ATOM   8136  C CA  . GLU C  1 92  ? 138.092 8.333   26.697  1.00 19.79  ? 89  GLU C CA  1 
ATOM   8137  C C   . GLU C  1 92  ? 136.630 8.804   26.732  1.00 19.57  ? 89  GLU C C   1 
ATOM   8138  O O   . GLU C  1 92  ? 136.001 8.897   27.785  1.00 18.73  ? 89  GLU C O   1 
ATOM   8139  C CB  . GLU C  1 92  ? 139.043 9.541   26.737  1.00 19.47  ? 89  GLU C CB  1 
ATOM   8140  C CG  . GLU C  1 92  ? 140.524 9.167   26.773  1.00 19.50  ? 89  GLU C CG  1 
ATOM   8141  C CD  . GLU C  1 92  ? 141.504 10.337  26.714  1.00 18.98  ? 89  GLU C CD  1 
ATOM   8142  O OE1 . GLU C  1 92  ? 142.681 10.107  27.098  1.00 18.05  ? 89  GLU C OE1 1 
ATOM   8143  O OE2 . GLU C  1 92  ? 141.122 11.445  26.256  1.00 18.93  ? 89  GLU C OE2 1 
ATOM   8144  N N   . HIS C  1 93  ? 136.086 9.124   25.579  1.00 20.13  ? 90  HIS C N   1 
ATOM   8145  C CA  . HIS C  1 93  ? 134.651 9.344   25.486  1.00 21.49  ? 90  HIS C CA  1 
ATOM   8146  C C   . HIS C  1 93  ? 133.862 8.015   25.481  1.00 22.90  ? 90  HIS C C   1 
ATOM   8147  O O   . HIS C  1 93  ? 132.833 7.879   26.142  1.00 23.46  ? 90  HIS C O   1 
ATOM   8148  C CB  . HIS C  1 93  ? 134.322 10.127  24.225  1.00 20.71  ? 90  HIS C CB  1 
ATOM   8149  C CG  . HIS C  1 93  ? 132.879 10.465  24.098  1.00 20.17  ? 90  HIS C CG  1 
ATOM   8150  N ND1 . HIS C  1 93  ? 131.924 9.537   23.762  1.00 20.01  ? 90  HIS C ND1 1 
ATOM   8151  C CD2 . HIS C  1 93  ? 132.224 11.635  24.268  1.00 20.88  ? 90  HIS C CD2 1 
ATOM   8152  C CE1 . HIS C  1 93  ? 130.742 10.122  23.722  1.00 20.77  ? 90  HIS C CE1 1 
ATOM   8153  N NE2 . HIS C  1 93  ? 130.897 11.398  24.019  1.00 20.88  ? 90  HIS C NE2 1 
ATOM   8154  N N   . GLY C  1 94  ? 134.317 7.060   24.688  1.00 23.47  ? 91  GLY C N   1 
ATOM   8155  C CA  . GLY C  1 94  ? 133.641 5.793   24.606  1.00 24.74  ? 91  GLY C CA  1 
ATOM   8156  C C   . GLY C  1 94  ? 132.913 5.566   23.309  1.00 25.65  ? 91  GLY C C   1 
ATOM   8157  O O   . GLY C  1 94  ? 132.501 4.437   23.035  1.00 28.31  ? 91  GLY C O   1 
ATOM   8158  N N   . LYS C  1 95  ? 132.783 6.603   22.491  1.00 25.88  ? 92  LYS C N   1 
ATOM   8159  C CA  . LYS C  1 95  ? 131.949 6.520   21.273  1.00 26.15  ? 92  LYS C CA  1 
ATOM   8160  C C   . LYS C  1 95  ? 132.598 5.674   20.194  1.00 24.66  ? 92  LYS C C   1 
ATOM   8161  O O   . LYS C  1 95  ? 133.817 5.685   20.025  1.00 24.15  ? 92  LYS C O   1 
ATOM   8162  C CB  . LYS C  1 95  ? 131.573 7.911   20.715  1.00 27.19  ? 92  LYS C CB  1 
ATOM   8163  C CG  . LYS C  1 95  ? 132.735 8.792   20.273  1.00 27.74  ? 92  LYS C CG  1 
ATOM   8164  C CD  . LYS C  1 95  ? 132.259 10.055  19.565  1.00 27.81  ? 92  LYS C CD  1 
ATOM   8165  C CE  . LYS C  1 95  ? 131.639 11.052  20.523  1.00 27.72  ? 92  LYS C CE  1 
ATOM   8166  N NZ  . LYS C  1 95  ? 131.271 12.309  19.806  1.00 28.28  ? 92  LYS C NZ  1 
ATOM   8167  N N   . ILE C  1 96  ? 131.768 4.961   19.447  1.00 24.60  ? 93  ILE C N   1 
ATOM   8168  C CA  . ILE C  1 96  ? 132.291 3.911   18.563  1.00 25.64  ? 93  ILE C CA  1 
ATOM   8169  C C   . ILE C  1 96  ? 132.702 4.532   17.195  1.00 24.04  ? 93  ILE C C   1 
ATOM   8170  O O   . ILE C  1 96  ? 132.165 5.555   16.784  1.00 22.31  ? 93  ILE C O   1 
ATOM   8171  C CB  . ILE C  1 96  ? 131.372 2.631   18.510  1.00 26.11  ? 93  ILE C CB  1 
ATOM   8172  C CG1 . ILE C  1 96  ? 130.516 2.604   17.266  1.00 29.36  ? 93  ILE C CG1 1 
ATOM   8173  C CG2 . ILE C  1 96  ? 130.534 2.420   19.783  1.00 24.77  ? 93  ILE C CG2 1 
ATOM   8174  C CD1 . ILE C  1 96  ? 131.149 1.767   16.163  1.00 32.95  ? 93  ILE C CD1 1 
ATOM   8175  N N   . ALA C  1 97  ? 133.668 3.912   16.524  1.00 23.80  ? 94  ALA C N   1 
ATOM   8176  C CA  . ALA C  1 97  ? 134.288 4.445   15.282  1.00 24.42  ? 94  ALA C CA  1 
ATOM   8177  C C   . ALA C  1 97  ? 133.412 5.347   14.352  1.00 24.09  ? 94  ALA C C   1 
ATOM   8178  O O   . ALA C  1 97  ? 133.836 6.399   13.896  1.00 22.30  ? 94  ALA C O   1 
ATOM   8179  C CB  . ALA C  1 97  ? 134.896 3.294   14.474  1.00 24.42  ? 94  ALA C CB  1 
ATOM   8180  N N   . HIS C  1 98  ? 132.188 4.938   14.082  1.00 25.79  ? 95  HIS C N   1 
ATOM   8181  C CA  . HIS C  1 98  ? 131.326 5.717   13.169  1.00 26.74  ? 95  HIS C CA  1 
ATOM   8182  C C   . HIS C  1 98  ? 130.767 7.041   13.763  1.00 25.90  ? 95  HIS C C   1 
ATOM   8183  O O   . HIS C  1 98  ? 130.549 7.986   13.017  1.00 25.30  ? 95  HIS C O   1 
ATOM   8184  C CB  . HIS C  1 98  ? 130.168 4.860   12.659  1.00 26.74  ? 95  HIS C CB  1 
ATOM   8185  C CG  . HIS C  1 98  ? 129.130 4.605   13.698  1.00 27.28  ? 95  HIS C CG  1 
ATOM   8186  N ND1 . HIS C  1 98  ? 129.042 3.414   14.379  1.00 26.04  ? 95  HIS C ND1 1 
ATOM   8187  C CD2 . HIS C  1 98  ? 128.173 5.410   14.217  1.00 28.11  ? 95  HIS C CD2 1 
ATOM   8188  C CE1 . HIS C  1 98  ? 128.055 3.483   15.252  1.00 25.64  ? 95  HIS C CE1 1 
ATOM   8189  N NE2 . HIS C  1 98  ? 127.515 4.684   15.178  1.00 26.60  ? 95  HIS C NE2 1 
ATOM   8190  N N   . ASP C  1 99  ? 130.500 7.104   15.071  1.00 24.39  ? 96  ASP C N   1 
ATOM   8191  C CA  . ASP C  1 99  ? 130.213 8.396   15.700  1.00 23.35  ? 96  ASP C CA  1 
ATOM   8192  C C   . ASP C  1 99  ? 131.460 9.258   15.733  1.00 22.69  ? 96  ASP C C   1 
ATOM   8193  O O   . ASP C  1 99  ? 131.377 10.470  15.527  1.00 22.06  ? 96  ASP C O   1 
ATOM   8194  C CB  . ASP C  1 99  ? 129.705 8.246   17.123  1.00 23.93  ? 96  ASP C CB  1 
ATOM   8195  C CG  . ASP C  1 99  ? 128.259 7.897   17.186  1.00 25.15  ? 96  ASP C CG  1 
ATOM   8196  O OD1 . ASP C  1 99  ? 127.507 8.330   16.289  1.00 25.10  ? 96  ASP C OD1 1 
ATOM   8197  O OD2 . ASP C  1 99  ? 127.865 7.190   18.154  1.00 27.48  ? 96  ASP C OD2 1 
ATOM   8198  N N   . ALA C  1 100 ? 132.604 8.636   16.002  1.00 21.40  ? 97  ALA C N   1 
ATOM   8199  C CA  . ALA C  1 100 ? 133.840 9.358   16.074  1.00 21.40  ? 97  ALA C CA  1 
ATOM   8200  C C   . ALA C  1 100 ? 134.213 9.866   14.710  1.00 21.40  ? 97  ALA C C   1 
ATOM   8201  O O   . ALA C  1 100 ? 134.653 11.008  14.573  1.00 20.45  ? 97  ALA C O   1 
ATOM   8202  C CB  . ALA C  1 100 ? 134.940 8.480   16.623  1.00 22.31  ? 97  ALA C CB  1 
ATOM   8203  N N   . MET C  1 101 ? 134.045 9.028   13.695  1.00 22.68  ? 98  MET C N   1 
ATOM   8204  C CA  . MET C  1 101 ? 134.356 9.459   12.318  1.00 24.11  ? 98  MET C CA  1 
ATOM   8205  C C   . MET C  1 101 ? 133.417 10.531  11.845  1.00 22.93  ? 98  MET C C   1 
ATOM   8206  O O   . MET C  1 101 ? 133.853 11.423  11.177  1.00 26.07  ? 98  MET C O   1 
ATOM   8207  C CB  . MET C  1 101 ? 134.354 8.317   11.304  1.00 25.65  ? 98  MET C CB  1 
ATOM   8208  C CG  . MET C  1 101 ? 135.710 7.632   11.120  1.00 27.11  ? 98  MET C CG  1 
ATOM   8209  S SD  . MET C  1 101 ? 137.043 8.701   10.566  1.00 28.14  ? 98  MET C SD  1 
ATOM   8210  C CE  . MET C  1 101 ? 136.271 9.490   9.165   1.00 28.28  ? 98  MET C CE  1 
ATOM   8211  N N   . GLY C  1 102 ? 132.137 10.441  12.169  1.00 21.89  ? 99  GLY C N   1 
ATOM   8212  C CA  . GLY C  1 102 ? 131.208 11.545  11.919  1.00 21.39  ? 99  GLY C CA  1 
ATOM   8213  C C   . GLY C  1 102 ? 131.611 12.877  12.577  1.00 21.57  ? 99  GLY C C   1 
ATOM   8214  O O   . GLY C  1 102 ? 131.595 13.935  11.945  1.00 20.77  ? 99  GLY C O   1 
ATOM   8215  N N   . GLU C  1 103 ? 131.960 12.824  13.858  1.00 22.00  ? 100 GLU C N   1 
ATOM   8216  C CA  . GLU C  1 103 ? 132.464 13.990  14.574  1.00 22.15  ? 100 GLU C CA  1 
ATOM   8217  C C   . GLU C  1 103 ? 133.676 14.574  13.887  1.00 22.08  ? 100 GLU C C   1 
ATOM   8218  O O   . GLU C  1 103 ? 133.758 15.777  13.723  1.00 23.59  ? 100 GLU C O   1 
ATOM   8219  C CB  . GLU C  1 103 ? 132.851 13.627  16.010  1.00 23.07  ? 100 GLU C CB  1 
ATOM   8220  C CG  . GLU C  1 103 ? 133.578 14.738  16.754  1.00 23.64  ? 100 GLU C CG  1 
ATOM   8221  C CD  . GLU C  1 103 ? 133.857 14.444  18.210  1.00 23.84  ? 100 GLU C CD  1 
ATOM   8222  O OE1 . GLU C  1 103 ? 133.474 13.363  18.713  1.00 24.36  ? 100 GLU C OE1 1 
ATOM   8223  O OE2 . GLU C  1 103 ? 134.455 15.330  18.850  1.00 23.75  ? 100 GLU C OE2 1 
ATOM   8224  N N   . LEU C  1 104 ? 134.633 13.727  13.518  1.00 22.28  ? 101 LEU C N   1 
ATOM   8225  C CA  . LEU C  1 104 ? 135.856 14.198  12.860  1.00 21.97  ? 101 LEU C CA  1 
ATOM   8226  C C   . LEU C  1 104 ? 135.550 14.882  11.533  1.00 23.59  ? 101 LEU C C   1 
ATOM   8227  O O   . LEU C  1 104 ? 136.115 15.937  11.225  1.00 23.52  ? 101 LEU C O   1 
ATOM   8228  C CB  . LEU C  1 104 ? 136.857 13.063  12.643  1.00 20.44  ? 101 LEU C CB  1 
ATOM   8229  C CG  . LEU C  1 104 ? 138.209 13.457  12.036  1.00 19.80  ? 101 LEU C CG  1 
ATOM   8230  C CD1 . LEU C  1 104 ? 138.877 14.588  12.790  1.00 19.54  ? 101 LEU C CD1 1 
ATOM   8231  C CD2 . LEU C  1 104 ? 139.135 12.258  12.003  1.00 19.78  ? 101 LEU C CD2 1 
ATOM   8232  N N   . GLN C  1 105 ? 134.630 14.297  10.776  1.00 25.76  ? 102 GLN C N   1 
ATOM   8233  C CA  . GLN C  1 105 ? 134.315 14.772  9.440   1.00 29.28  ? 102 GLN C CA  1 
ATOM   8234  C C   . GLN C  1 105 ? 133.738 16.168  9.497   1.00 26.68  ? 102 GLN C C   1 
ATOM   8235  O O   . GLN C  1 105 ? 134.149 17.014  8.735   1.00 24.90  ? 102 GLN C O   1 
ATOM   8236  C CB  . GLN C  1 105 ? 133.330 13.832  8.739   1.00 35.53  ? 102 GLN C CB  1 
ATOM   8237  C CG  . GLN C  1 105 ? 133.224 14.038  7.223   1.00 42.75  ? 102 GLN C CG  1 
ATOM   8238  C CD  . GLN C  1 105 ? 134.454 13.522  6.470   1.00 49.85  ? 102 GLN C CD  1 
ATOM   8239  O OE1 . GLN C  1 105 ? 134.994 12.444  6.794   1.00 53.92  ? 102 GLN C OE1 1 
ATOM   8240  N NE2 . GLN C  1 105 ? 134.906 14.286  5.461   1.00 51.41  ? 102 GLN C NE2 1 
ATOM   8241  N N   . ARG C  1 106 ? 132.798 16.392  10.410  1.00 26.13  ? 103 ARG C N   1 
ATOM   8242  C CA  . ARG C  1 106 ? 132.209 17.711  10.623  1.00 26.66  ? 103 ARG C CA  1 
ATOM   8243  C C   . ARG C  1 106 ? 133.230 18.709  11.155  1.00 24.96  ? 103 ARG C C   1 
ATOM   8244  O O   . ARG C  1 106 ? 133.122 19.923  10.933  1.00 24.94  ? 103 ARG C O   1 
ATOM   8245  C CB  . ARG C  1 106 ? 131.054 17.630  11.603  1.00 29.89  ? 103 ARG C CB  1 
ATOM   8246  C CG  . ARG C  1 106 ? 129.889 16.789  11.130  1.00 34.08  ? 103 ARG C CG  1 
ATOM   8247  C CD  . ARG C  1 106 ? 128.561 17.513  11.323  1.00 39.47  ? 103 ARG C CD  1 
ATOM   8248  N NE  . ARG C  1 106 ? 128.243 17.935  12.705  1.00 45.20  ? 103 ARG C NE  1 
ATOM   8249  C CZ  . ARG C  1 106 ? 127.756 17.145  13.679  1.00 52.99  ? 103 ARG C CZ  1 
ATOM   8250  N NH1 . ARG C  1 106 ? 127.556 15.831  13.496  1.00 58.28  ? 103 ARG C NH1 1 
ATOM   8251  N NH2 . ARG C  1 106 ? 127.479 17.668  14.873  1.00 55.35  ? 103 ARG C NH2 1 
ATOM   8252  N N   . GLY C  1 107 ? 134.206 18.196  11.888  1.00 22.33  ? 104 GLY C N   1 
ATOM   8253  C CA  . GLY C  1 107 ? 135.314 19.006  12.326  1.00 21.19  ? 104 GLY C CA  1 
ATOM   8254  C C   . GLY C  1 107 ? 136.161 19.444  11.158  1.00 19.18  ? 104 GLY C C   1 
ATOM   8255  O O   . GLY C  1 107 ? 136.511 20.602  11.038  1.00 18.36  ? 104 GLY C O   1 
ATOM   8256  N N   . ILE C  1 108 ? 136.497 18.492  10.304  1.00 18.32  ? 105 ILE C N   1 
ATOM   8257  C CA  . ILE C  1 108 ? 137.278 18.771  9.106   1.00 17.67  ? 105 ILE C CA  1 
ATOM   8258  C C   . ILE C  1 108 ? 136.525 19.797  8.258   1.00 17.54  ? 105 ILE C C   1 
ATOM   8259  O O   . ILE C  1 108 ? 137.143 20.694  7.692   1.00 18.01  ? 105 ILE C O   1 
ATOM   8260  C CB  . ILE C  1 108 ? 137.606 17.471  8.332   1.00 17.00  ? 105 ILE C CB  1 
ATOM   8261  C CG1 . ILE C  1 108 ? 138.609 16.649  9.127   1.00 16.89  ? 105 ILE C CG1 1 
ATOM   8262  C CG2 . ILE C  1 108 ? 138.203 17.747  6.962   1.00 16.67  ? 105 ILE C CG2 1 
ATOM   8263  C CD1 . ILE C  1 108 ? 138.662 15.202  8.713   1.00 16.98  ? 105 ILE C CD1 1 
ATOM   8264  N N   . GLU C  1 109 ? 135.201 19.701  8.229   1.00 17.23  ? 106 GLU C N   1 
ATOM   8265  C CA  . GLU C  1 109 ? 134.374 20.648  7.489   1.00 17.45  ? 106 GLU C CA  1 
ATOM   8266  C C   . GLU C  1 109 ? 134.494 22.090  7.957   1.00 16.79  ? 106 GLU C C   1 
ATOM   8267  O O   . GLU C  1 109 ? 134.468 23.003  7.139   1.00 17.03  ? 106 GLU C O   1 
ATOM   8268  C CB  . GLU C  1 109 ? 132.922 20.223  7.525   1.00 18.28  ? 106 GLU C CB  1 
ATOM   8269  C CG  . GLU C  1 109 ? 132.611 19.071  6.572   1.00 19.24  ? 106 GLU C CG  1 
ATOM   8270  C CD  . GLU C  1 109 ? 131.154 18.698  6.617   1.00 20.27  ? 106 GLU C CD  1 
ATOM   8271  O OE1 . GLU C  1 109 ? 130.767 17.825  5.825   1.00 20.66  ? 106 GLU C OE1 1 
ATOM   8272  O OE2 . GLU C  1 109 ? 130.398 19.308  7.429   1.00 20.83  ? 106 GLU C OE2 1 
ATOM   8273  N N   . ASN C  1 110 ? 134.625 22.289  9.261   1.00 16.11  ? 107 ASN C N   1 
ATOM   8274  C CA  . ASN C  1 110 ? 134.979 23.599  9.816   1.00 15.52  ? 107 ASN C CA  1 
ATOM   8275  C C   . ASN C  1 110 ? 136.337 24.132  9.294   1.00 15.91  ? 107 ASN C C   1 
ATOM   8276  O O   . ASN C  1 110 ? 136.504 25.367  9.064   1.00 17.10  ? 107 ASN C O   1 
ATOM   8277  C CB  . ASN C  1 110 ? 135.011 23.538  11.339  1.00 14.98  ? 107 ASN C CB  1 
ATOM   8278  C CG  . ASN C  1 110 ? 133.652 23.257  11.942  1.00 15.19  ? 107 ASN C CG  1 
ATOM   8279  O OD1 . ASN C  1 110 ? 133.452 22.250  12.622  1.00 14.65  ? 107 ASN C OD1 1 
ATOM   8280  N ND2 . ASN C  1 110 ? 132.697 24.144  11.683  1.00 15.78  ? 107 ASN C ND2 1 
ATOM   8281  N N   . VAL C  1 111 ? 137.293 23.215  9.124   1.00 15.19  ? 108 VAL C N   1 
ATOM   8282  C CA  . VAL C  1 111 ? 138.634 23.556  8.672   1.00 15.13  ? 108 VAL C CA  1 
ATOM   8283  C C   . VAL C  1 111 ? 138.533 23.888  7.200   1.00 15.76  ? 108 VAL C C   1 
ATOM   8284  O O   . VAL C  1 111 ? 139.111 24.876  6.764   1.00 17.89  ? 108 VAL C O   1 
ATOM   8285  C CB  . VAL C  1 111 ? 139.662 22.414  8.905   1.00 14.61  ? 108 VAL C CB  1 
ATOM   8286  C CG1 . VAL C  1 111 ? 140.999 22.750  8.274   1.00 14.28  ? 108 VAL C CG1 1 
ATOM   8287  C CG2 . VAL C  1 111 ? 139.848 22.124  10.391  1.00 14.33  ? 108 VAL C CG2 1 
ATOM   8288  N N   . GLU C  1 112 ? 137.801 23.086  6.433   1.00 15.47  ? 109 GLU C N   1 
ATOM   8289  C CA  . GLU C  1 112 ? 137.518 23.414  5.017   1.00 15.41  ? 109 GLU C CA  1 
ATOM   8290  C C   . GLU C  1 112 ? 137.008 24.853  4.864   1.00 15.23  ? 109 GLU C C   1 
ATOM   8291  O O   . GLU C  1 112 ? 137.501 25.620  4.027   1.00 15.72  ? 109 GLU C O   1 
ATOM   8292  C CB  . GLU C  1 112 ? 136.469 22.469  4.412   1.00 15.28  ? 109 GLU C CB  1 
ATOM   8293  C CG  . GLU C  1 112 ? 136.941 21.036  4.248   1.00 15.42  ? 109 GLU C CG  1 
ATOM   8294  C CD  . GLU C  1 112 ? 135.848 20.079  3.799   1.00 15.72  ? 109 GLU C CD  1 
ATOM   8295  O OE1 . GLU C  1 112 ? 136.185 18.892  3.626   1.00 15.94  ? 109 GLU C OE1 1 
ATOM   8296  O OE2 . GLU C  1 112 ? 134.672 20.481  3.601   1.00 15.70  ? 109 GLU C OE2 1 
ATOM   8297  N N   . TYR C  1 113 ? 136.027 25.214  5.687   1.00 14.41  ? 110 TYR C N   1 
ATOM   8298  C CA  . TYR C  1 113 ? 135.402 26.524  5.584   1.00 13.66  ? 110 TYR C CA  1 
ATOM   8299  C C   . TYR C  1 113 ? 136.411 27.611  5.848   1.00 12.99  ? 110 TYR C C   1 
ATOM   8300  O O   . TYR C  1 113 ? 136.373 28.645  5.167   1.00 12.59  ? 110 TYR C O   1 
ATOM   8301  C CB  . TYR C  1 113 ? 134.188 26.659  6.527   1.00 13.51  ? 110 TYR C CB  1 
ATOM   8302  C CG  . TYR C  1 113 ? 133.436 27.982  6.376   1.00 13.52  ? 110 TYR C CG  1 
ATOM   8303  C CD1 . TYR C  1 113 ? 132.796 28.312  5.192   1.00 13.63  ? 110 TYR C CD1 1 
ATOM   8304  C CD2 . TYR C  1 113 ? 133.395 28.902  7.403   1.00 13.37  ? 110 TYR C CD2 1 
ATOM   8305  C CE1 . TYR C  1 113 ? 132.116 29.505  5.045   1.00 13.57  ? 110 TYR C CE1 1 
ATOM   8306  C CE2 . TYR C  1 113 ? 132.716 30.092  7.273   1.00 13.47  ? 110 TYR C CE2 1 
ATOM   8307  C CZ  . TYR C  1 113 ? 132.072 30.395  6.086   1.00 13.75  ? 110 TYR C CZ  1 
ATOM   8308  O OH  . TYR C  1 113 ? 131.377 31.592  5.936   1.00 14.03  ? 110 TYR C OH  1 
ATOM   8309  N N   . ALA C  1 114 ? 137.304 27.364  6.815   1.00 12.48  ? 111 ALA C N   1 
ATOM   8310  C CA  . ALA C  1 114 ? 138.286 28.358  7.229   1.00 12.40  ? 111 ALA C CA  1 
ATOM   8311  C C   . ALA C  1 114 ? 139.380 28.559  6.188   1.00 12.58  ? 111 ALA C C   1 
ATOM   8312  O O   . ALA C  1 114 ? 139.960 29.628  6.108   1.00 12.26  ? 111 ALA C O   1 
ATOM   8313  C CB  . ALA C  1 114 ? 138.878 27.979  8.556   1.00 12.64  ? 111 ALA C CB  1 
ATOM   8314  N N   . CYS C  1 115 ? 139.625 27.542  5.354   1.00 13.11  ? 112 CYS C N   1 
ATOM   8315  C CA  . CYS C  1 115 ? 140.569 27.636  4.208   1.00 13.05  ? 112 CYS C CA  1 
ATOM   8316  C C   . CYS C  1 115 ? 140.266 28.777  3.259   1.00 13.10  ? 112 CYS C C   1 
ATOM   8317  O O   . CYS C  1 115 ? 141.150 29.174  2.448   1.00 13.42  ? 112 CYS C O   1 
ATOM   8318  C CB  . CYS C  1 115 ? 140.567 26.341  3.405   1.00 12.87  ? 112 CYS C CB  1 
ATOM   8319  S SG  . CYS C  1 115 ? 141.351 24.985  4.282   1.00 13.39  ? 112 CYS C SG  1 
ATOM   8320  N N   . GLY C  1 116 ? 139.019 29.264  3.341   1.00 12.69  ? 113 GLY C N   1 
ATOM   8321  C CA  . GLY C  1 116 ? 138.544 30.351  2.517   1.00 12.93  ? 113 GLY C CA  1 
ATOM   8322  C C   . GLY C  1 116 ? 138.543 31.680  3.234   1.00 12.93  ? 113 GLY C C   1 
ATOM   8323  O O   . GLY C  1 116 ? 137.710 32.537  2.949   1.00 13.28  ? 113 GLY C O   1 
ATOM   8324  N N   . ALA C  1 117 ? 139.479 31.879  4.152   1.00 12.67  ? 114 ALA C N   1 
ATOM   8325  C CA  . ALA C  1 117 ? 139.479 33.088  4.975   1.00 12.47  ? 114 ALA C CA  1 
ATOM   8326  C C   . ALA C  1 117 ? 139.575 34.366  4.165   1.00 12.46  ? 114 ALA C C   1 
ATOM   8327  O O   . ALA C  1 117 ? 138.999 35.370  4.565   1.00 12.96  ? 114 ALA C O   1 
ATOM   8328  C CB  . ALA C  1 117 ? 140.601 33.049  5.991   1.00 12.35  ? 114 ALA C CB  1 
ATOM   8329  N N   . PRO C  1 118 ? 140.324 34.360  3.048   1.00 12.27  ? 115 PRO C N   1 
ATOM   8330  C CA  . PRO C  1 118 ? 140.394 35.623  2.311   1.00 12.30  ? 115 PRO C CA  1 
ATOM   8331  C C   . PRO C  1 118 ? 139.063 36.151  1.794   1.00 12.08  ? 115 PRO C C   1 
ATOM   8332  O O   . PRO C  1 118 ? 138.854 37.365  1.862   1.00 12.95  ? 115 PRO C O   1 
ATOM   8333  C CB  . PRO C  1 118 ? 141.362 35.316  1.167   1.00 12.28  ? 115 PRO C CB  1 
ATOM   8334  C CG  . PRO C  1 118 ? 142.257 34.254  1.723   1.00 12.13  ? 115 PRO C CG  1 
ATOM   8335  C CD  . PRO C  1 118 ? 141.372 33.421  2.606   1.00 12.22  ? 115 PRO C CD  1 
ATOM   8336  N N   . GLU C  1 119 ? 138.200 35.271  1.287   1.00 11.42  ? 116 GLU C N   1 
ATOM   8337  C CA  . GLU C  1 119 ? 136.811 35.613  0.929   1.00 11.34  ? 116 GLU C CA  1 
ATOM   8338  C C   . GLU C  1 119 ? 135.970 36.110  2.128   1.00 11.24  ? 116 GLU C C   1 
ATOM   8339  O O   . GLU C  1 119 ? 135.197 37.053  2.025   1.00 11.18  ? 116 GLU C O   1 
ATOM   8340  C CB  . GLU C  1 119 ? 136.148 34.371  0.329   1.00 11.67  ? 116 GLU C CB  1 
ATOM   8341  C CG  . GLU C  1 119 ? 134.660 34.451  0.007   1.00 11.87  ? 116 GLU C CG  1 
ATOM   8342  C CD  . GLU C  1 119 ? 134.315 35.473  -1.068  1.00 12.39  ? 116 GLU C CD  1 
ATOM   8343  O OE1 . GLU C  1 119 ? 135.106 35.719  -2.015  1.00 12.73  ? 116 GLU C OE1 1 
ATOM   8344  O OE2 . GLU C  1 119 ? 133.207 36.022  -0.985  1.00 12.89  ? 116 GLU C OE2 1 
ATOM   8345  N N   . LEU C  1 120 ? 136.120 35.442  3.261   1.00 11.12  ? 117 LEU C N   1 
ATOM   8346  C CA  . LEU C  1 120 ? 135.342 35.720  4.456   1.00 10.88  ? 117 LEU C CA  1 
ATOM   8347  C C   . LEU C  1 120 ? 135.783 36.987  5.147   1.00 10.98  ? 117 LEU C C   1 
ATOM   8348  O O   . LEU C  1 120 ? 135.005 37.602  5.835   1.00 10.99  ? 117 LEU C O   1 
ATOM   8349  C CB  . LEU C  1 120 ? 135.452 34.549  5.419   1.00 10.88  ? 117 LEU C CB  1 
ATOM   8350  C CG  . LEU C  1 120 ? 135.072 33.181  4.833   1.00 11.06  ? 117 LEU C CG  1 
ATOM   8351  C CD1 . LEU C  1 120 ? 135.311 32.100  5.877   1.00 11.19  ? 117 LEU C CD1 1 
ATOM   8352  C CD2 . LEU C  1 120 ? 133.639 33.120  4.306   1.00 10.81  ? 117 LEU C CD2 1 
ATOM   8353  N N   . LEU C  1 121 ? 137.035 37.379  4.958   1.00 11.40  ? 118 LEU C N   1 
ATOM   8354  C CA  . LEU C  1 121 ? 137.589 38.591  5.575   1.00 11.74  ? 118 LEU C CA  1 
ATOM   8355  C C   . LEU C  1 121 ? 137.482 39.867  4.697   1.00 12.05  ? 118 LEU C C   1 
ATOM   8356  O O   . LEU C  1 121 ? 138.061 40.909  5.029   1.00 12.24  ? 118 LEU C O   1 
ATOM   8357  C CB  . LEU C  1 121 ? 139.048 38.335  5.931   1.00 11.79  ? 118 LEU C CB  1 
ATOM   8358  C CG  . LEU C  1 121 ? 139.247 37.396  7.118   1.00 12.02  ? 118 LEU C CG  1 
ATOM   8359  C CD1 . LEU C  1 121 ? 140.695 36.906  7.170   1.00 12.14  ? 118 LEU C CD1 1 
ATOM   8360  C CD2 . LEU C  1 121 ? 138.872 38.103  8.418   1.00 11.92  ? 118 LEU C CD2 1 
ATOM   8361  N N   . LYS C  1 122 ? 136.753 39.791  3.582   1.00 11.89  ? 119 LYS C N   1 
ATOM   8362  C CA  . LYS C  1 122 ? 136.540 40.957  2.754   1.00 11.57  ? 119 LYS C CA  1 
ATOM   8363  C C   . LYS C  1 122 ? 135.737 41.978  3.533   1.00 11.96  ? 119 LYS C C   1 
ATOM   8364  O O   . LYS C  1 122 ? 134.632 41.677  4.046   1.00 11.66  ? 119 LYS C O   1 
ATOM   8365  C CB  . LYS C  1 122 ? 135.802 40.599  1.469   1.00 11.19  ? 119 LYS C CB  1 
ATOM   8366  C CG  . LYS C  1 122 ? 136.639 39.766  0.526   1.00 11.14  ? 119 LYS C CG  1 
ATOM   8367  C CD  . LYS C  1 122 ? 135.827 39.356  -0.701  1.00 11.04  ? 119 LYS C CD  1 
ATOM   8368  C CE  . LYS C  1 122 ? 136.685 38.758  -1.806  1.00 10.77  ? 119 LYS C CE  1 
ATOM   8369  N NZ  . LYS C  1 122 ? 135.829 38.366  -2.957  1.00 10.72  ? 119 LYS C NZ  1 
ATOM   8370  N N   . GLY C  1 123 ? 136.314 43.172  3.631   1.00 12.43  ? 120 GLY C N   1 
ATOM   8371  C CA  . GLY C  1 123 ? 135.583 44.363  4.067   1.00 13.21  ? 120 GLY C CA  1 
ATOM   8372  C C   . GLY C  1 123 ? 134.723 45.001  2.969   1.00 13.58  ? 120 GLY C C   1 
ATOM   8373  O O   . GLY C  1 123 ? 134.812 44.609  1.807   1.00 14.31  ? 120 GLY C O   1 
ATOM   8374  N N   . GLU C  1 124 ? 133.903 45.979  3.346   1.00 13.66  ? 121 GLU C N   1 
ATOM   8375  C CA  . GLU C  1 124 ? 133.048 46.685  2.418   1.00 14.29  ? 121 GLU C CA  1 
ATOM   8376  C C   . GLU C  1 124 ? 133.668 48.017  2.054   1.00 14.59  ? 121 GLU C C   1 
ATOM   8377  O O   . GLU C  1 124 ? 133.891 48.842  2.930   1.00 15.68  ? 121 GLU C O   1 
ATOM   8378  C CB  . GLU C  1 124 ? 131.692 46.943  3.071   1.00 14.94  ? 121 GLU C CB  1 
ATOM   8379  C CG  . GLU C  1 124 ? 130.891 45.674  3.293   1.00 15.40  ? 121 GLU C CG  1 
ATOM   8380  C CD  . GLU C  1 124 ? 129.526 45.923  3.902   1.00 15.68  ? 121 GLU C CD  1 
ATOM   8381  O OE1 . GLU C  1 124 ? 129.444 46.806  4.795   1.00 16.58  ? 121 GLU C OE1 1 
ATOM   8382  O OE2 . GLU C  1 124 ? 128.555 45.221  3.514   1.00 14.97  ? 121 GLU C OE2 1 
ATOM   8383  N N   . HIS C  1 125 ? 133.922 48.250  0.771   1.00 14.53  ? 122 HIS C N   1 
ATOM   8384  C CA  . HIS C  1 125 ? 134.492 49.532  0.281   1.00 14.35  ? 122 HIS C CA  1 
ATOM   8385  C C   . HIS C  1 125 ? 133.431 50.442  -0.311  1.00 14.22  ? 122 HIS C C   1 
ATOM   8386  O O   . HIS C  1 125 ? 132.593 49.990  -1.081  1.00 14.49  ? 122 HIS C O   1 
ATOM   8387  C CB  . HIS C  1 125 ? 135.531 49.241  -0.779  1.00 14.43  ? 122 HIS C CB  1 
ATOM   8388  C CG  . HIS C  1 125 ? 136.306 50.436  -1.208  1.00 15.04  ? 122 HIS C CG  1 
ATOM   8389  N ND1 . HIS C  1 125 ? 137.490 50.806  -0.612  1.00 15.76  ? 122 HIS C ND1 1 
ATOM   8390  C CD2 . HIS C  1 125 ? 136.089 51.331  -2.199  1.00 15.44  ? 122 HIS C CD2 1 
ATOM   8391  C CE1 . HIS C  1 125 ? 137.963 51.891  -1.202  1.00 15.94  ? 122 HIS C CE1 1 
ATOM   8392  N NE2 . HIS C  1 125 ? 137.134 52.224  -2.176  1.00 15.55  ? 122 HIS C NE2 1 
ATOM   8393  N N   . SER C  1 126 ? 133.479 51.724  0.023   1.00 14.47  ? 123 SER C N   1 
ATOM   8394  C CA  . SER C  1 126 ? 132.476 52.691  -0.432  1.00 14.94  ? 123 SER C CA  1 
ATOM   8395  C C   . SER C  1 126 ? 133.094 53.907  -1.107  1.00 15.82  ? 123 SER C C   1 
ATOM   8396  O O   . SER C  1 126 ? 133.825 54.660  -0.511  1.00 14.92  ? 123 SER C O   1 
ATOM   8397  C CB  . SER C  1 126 ? 131.592 53.142  0.726   1.00 14.84  ? 123 SER C CB  1 
ATOM   8398  O OG  . SER C  1 126 ? 130.590 52.187  1.007   1.00 14.63  ? 123 SER C OG  1 
ATOM   8399  N N   . ARG C  1 127 ? 132.760 54.089  -2.372  1.00 18.57  ? 124 ARG C N   1 
ATOM   8400  C CA  . ARG C  1 127 ? 133.252 55.206  -3.167  1.00 20.66  ? 124 ARG C CA  1 
ATOM   8401  C C   . ARG C  1 127 ? 132.359 56.457  -2.981  1.00 21.31  ? 124 ARG C C   1 
ATOM   8402  O O   . ARG C  1 127 ? 131.108 56.389  -2.993  1.00 19.88  ? 124 ARG C O   1 
ATOM   8403  C CB  . ARG C  1 127 ? 133.309 54.782  -4.630  1.00 21.92  ? 124 ARG C CB  1 
ATOM   8404  C CG  . ARG C  1 127 ? 133.839 55.837  -5.562  1.00 24.37  ? 124 ARG C CG  1 
ATOM   8405  C CD  . ARG C  1 127 ? 133.821 55.351  -7.002  1.00 26.38  ? 124 ARG C CD  1 
ATOM   8406  N NE  . ARG C  1 127 ? 134.183 56.440  -7.915  1.00 28.66  ? 124 ARG C NE  1 
ATOM   8407  C CZ  . ARG C  1 127 ? 133.344 57.134  -8.688  1.00 31.15  ? 124 ARG C CZ  1 
ATOM   8408  N NH1 . ARG C  1 127 ? 132.046 56.847  -8.726  1.00 32.16  ? 124 ARG C NH1 1 
ATOM   8409  N NH2 . ARG C  1 127 ? 133.823 58.119  -9.457  1.00 33.16  ? 124 ARG C NH2 1 
ATOM   8410  N N   . ASN C  1 128 ? 133.031 57.592  -2.806  1.00 22.33  ? 125 ASN C N   1 
ATOM   8411  C CA  . ASN C  1 128 ? 132.390 58.902  -2.587  1.00 22.77  ? 125 ASN C CA  1 
ATOM   8412  C C   . ASN C  1 128 ? 131.239 58.934  -1.571  1.00 22.30  ? 125 ASN C C   1 
ATOM   8413  O O   . ASN C  1 128 ? 130.103 59.182  -1.911  1.00 21.83  ? 125 ASN C O   1 
ATOM   8414  C CB  . ASN C  1 128 ? 131.978 59.519  -3.919  1.00 23.53  ? 125 ASN C CB  1 
ATOM   8415  C CG  . ASN C  1 128 ? 133.167 59.728  -4.866  1.00 24.02  ? 125 ASN C CG  1 
ATOM   8416  O OD1 . ASN C  1 128 ? 134.320 59.720  -4.450  1.00 23.60  ? 125 ASN C OD1 1 
ATOM   8417  N ND2 . ASN C  1 128 ? 132.877 59.896  -6.158  1.00 24.88  ? 125 ASN C ND2 1 
ATOM   8418  N N   . VAL C  1 129 ? 131.557 58.676  -0.313  1.00 21.92  ? 126 VAL C N   1 
ATOM   8419  C CA  . VAL C  1 129 ? 130.584 58.848  0.751   1.00 22.10  ? 126 VAL C CA  1 
ATOM   8420  C C   . VAL C  1 129 ? 130.265 60.336  0.893   1.00 21.93  ? 126 VAL C C   1 
ATOM   8421  O O   . VAL C  1 129 ? 129.156 60.755  1.257   1.00 22.51  ? 126 VAL C O   1 
ATOM   8422  C CB  . VAL C  1 129 ? 131.095 58.250  2.079   1.00 23.17  ? 126 VAL C CB  1 
ATOM   8423  C CG1 . VAL C  1 129 ? 131.255 56.742  1.945   1.00 23.76  ? 126 VAL C CG1 1 
ATOM   8424  C CG2 . VAL C  1 129 ? 132.397 58.883  2.575   1.00 23.22  ? 126 VAL C CG2 1 
ATOM   8425  N N   . GLY C  1 130 ? 131.292 61.117  0.609   1.00 21.83  ? 127 GLY C N   1 
ATOM   8426  C CA  . GLY C  1 130 ? 131.188 62.531  0.345   1.00 21.88  ? 127 GLY C CA  1 
ATOM   8427  C C   . GLY C  1 130 ? 131.922 62.819  -0.955  1.00 21.39  ? 127 GLY C C   1 
ATOM   8428  O O   . GLY C  1 130 ? 132.478 61.906  -1.580  1.00 20.00  ? 127 GLY C O   1 
ATOM   8429  N N   . PRO C  1 131 ? 131.910 64.087  -1.392  1.00 22.17  ? 128 PRO C N   1 
ATOM   8430  C CA  . PRO C  1 131 ? 132.543 64.415  -2.676  1.00 22.35  ? 128 PRO C CA  1 
ATOM   8431  C C   . PRO C  1 131 ? 134.047 64.271  -2.537  1.00 22.13  ? 128 PRO C C   1 
ATOM   8432  O O   . PRO C  1 131 ? 134.649 64.976  -1.732  1.00 22.04  ? 128 PRO C O   1 
ATOM   8433  C CB  . PRO C  1 131 ? 132.135 65.867  -2.926  1.00 22.49  ? 128 PRO C CB  1 
ATOM   8434  C CG  . PRO C  1 131 ? 131.025 66.149  -1.972  1.00 22.95  ? 128 PRO C CG  1 
ATOM   8435  C CD  . PRO C  1 131 ? 131.221 65.243  -0.796  1.00 22.70  ? 128 PRO C CD  1 
ATOM   8436  N N   . GLY C  1 132 ? 134.612 63.315  -3.275  1.00 22.44  ? 129 GLY C N   1 
ATOM   8437  C CA  . GLY C  1 132 ? 136.036 62.957  -3.198  1.00 22.74  ? 129 GLY C CA  1 
ATOM   8438  C C   . GLY C  1 132 ? 136.505 62.215  -1.951  1.00 23.55  ? 129 GLY C C   1 
ATOM   8439  O O   . GLY C  1 132 ? 137.711 62.129  -1.699  1.00 26.34  ? 129 GLY C O   1 
ATOM   8440  N N   . ILE C  1 133 ? 135.568 61.658  -1.184  1.00 22.95  ? 130 ILE C N   1 
ATOM   8441  C CA  . ILE C  1 133 ? 135.871 61.003  0.074   1.00 21.86  ? 130 ILE C CA  1 
ATOM   8442  C C   . ILE C  1 133 ? 135.457 59.538  -0.016  1.00 20.09  ? 130 ILE C C   1 
ATOM   8443  O O   . ILE C  1 133 ? 134.319 59.223  -0.326  1.00 18.62  ? 130 ILE C O   1 
ATOM   8444  C CB  . ILE C  1 133 ? 135.161 61.694  1.255   1.00 23.22  ? 130 ILE C CB  1 
ATOM   8445  C CG1 . ILE C  1 133 ? 135.518 63.194  1.285   1.00 24.03  ? 130 ILE C CG1 1 
ATOM   8446  C CG2 . ILE C  1 133 ? 135.555 61.032  2.581   1.00 24.21  ? 130 ILE C CG2 1 
ATOM   8447  C CD1 . ILE C  1 133 ? 134.813 64.025  2.353   1.00 24.56  ? 130 ILE C CD1 1 
ATOM   8448  N N   . ASP C  1 134 ? 136.392 58.645  0.283   1.00 19.17  ? 131 ASP C N   1 
ATOM   8449  C CA  . ASP C  1 134 ? 136.100 57.210  0.365   1.00 18.36  ? 131 ASP C CA  1 
ATOM   8450  C C   . ASP C  1 134 ? 136.064 56.705  1.796   1.00 17.32  ? 131 ASP C C   1 
ATOM   8451  O O   . ASP C  1 134 ? 136.511 57.372  2.702   1.00 18.04  ? 131 ASP C O   1 
ATOM   8452  C CB  . ASP C  1 134 ? 137.112 56.435  -0.437  1.00 18.13  ? 131 ASP C CB  1 
ATOM   8453  C CG  . ASP C  1 134 ? 137.052 56.756  -1.897  1.00 18.42  ? 131 ASP C CG  1 
ATOM   8454  O OD1 . ASP C  1 134 ? 136.056 57.325  -2.425  1.00 17.67  ? 131 ASP C OD1 1 
ATOM   8455  O OD2 . ASP C  1 134 ? 138.051 56.418  -2.534  1.00 19.86  ? 131 ASP C OD2 1 
ATOM   8456  N N   . SER C  1 135 ? 135.473 55.541  1.994   1.00 16.56  ? 132 SER C N   1 
ATOM   8457  C CA  . SER C  1 135 ? 135.387 54.927  3.319   1.00 16.53  ? 132 SER C CA  1 
ATOM   8458  C C   . SER C  1 135 ? 135.287 53.421  3.122   1.00 16.08  ? 132 SER C C   1 
ATOM   8459  O O   . SER C  1 135 ? 134.760 52.981  2.131   1.00 16.42  ? 132 SER C O   1 
ATOM   8460  C CB  . SER C  1 135 ? 134.182 55.491  4.112   1.00 16.54  ? 132 SER C CB  1 
ATOM   8461  O OG  . SER C  1 135 ? 133.926 54.845  5.365   1.00 15.70  ? 132 SER C OG  1 
ATOM   8462  N N   . TRP C  1 136 ? 135.843 52.632  4.026   1.00 16.02  ? 133 TRP C N   1 
ATOM   8463  C CA  . TRP C  1 136 ? 135.724 51.173  3.935   1.00 15.71  ? 133 TRP C CA  1 
ATOM   8464  C C   . TRP C  1 136 ? 135.865 50.532  5.292   1.00 15.15  ? 133 TRP C C   1 
ATOM   8465  O O   . TRP C  1 136 ? 136.458 51.122  6.194   1.00 15.00  ? 133 TRP C O   1 
ATOM   8466  C CB  . TRP C  1 136 ? 136.771 50.591  2.991   1.00 15.76  ? 133 TRP C CB  1 
ATOM   8467  C CG  . TRP C  1 136 ? 138.200 50.752  3.463   1.00 16.42  ? 133 TRP C CG  1 
ATOM   8468  C CD1 . TRP C  1 136 ? 138.928 49.859  4.200   1.00 16.52  ? 133 TRP C CD1 1 
ATOM   8469  C CD2 . TRP C  1 136 ? 139.071 51.868  3.215   1.00 16.46  ? 133 TRP C CD2 1 
ATOM   8470  N NE1 . TRP C  1 136 ? 140.193 50.352  4.424   1.00 16.63  ? 133 TRP C NE1 1 
ATOM   8471  C CE2 . TRP C  1 136 ? 140.308 51.583  3.835   1.00 16.51  ? 133 TRP C CE2 1 
ATOM   8472  C CE3 . TRP C  1 136 ? 138.928 53.075  2.530   1.00 16.59  ? 133 TRP C CE3 1 
ATOM   8473  C CZ2 . TRP C  1 136 ? 141.404 52.476  3.797   1.00 16.30  ? 133 TRP C CZ2 1 
ATOM   8474  C CZ3 . TRP C  1 136 ? 140.037 53.957  2.483   1.00 16.81  ? 133 TRP C CZ3 1 
ATOM   8475  C CH2 . TRP C  1 136 ? 141.251 53.646  3.122   1.00 15.86  ? 133 TRP C CH2 1 
ATOM   8476  N N   . SER C  1 137 ? 135.332 49.318  5.418   1.00 14.61  ? 134 SER C N   1 
ATOM   8477  C CA  . SER C  1 137 ? 135.454 48.529  6.642   1.00 13.98  ? 134 SER C CA  1 
ATOM   8478  C C   . SER C  1 137 ? 136.613 47.523  6.548   1.00 14.12  ? 134 SER C C   1 
ATOM   8479  O O   . SER C  1 137 ? 137.017 47.070  5.459   1.00 13.05  ? 134 SER C O   1 
ATOM   8480  C CB  . SER C  1 137 ? 134.146 47.834  6.990   1.00 13.47  ? 134 SER C CB  1 
ATOM   8481  O OG  . SER C  1 137 ? 133.702 47.006  5.932   1.00 13.17  ? 134 SER C OG  1 
ATOM   8482  N N   . GLU C  1 138 ? 137.190 47.256  7.716   1.00 14.86  ? 135 GLU C N   1 
ATOM   8483  C CA  . GLU C  1 138 ? 138.140 46.176  7.899   1.00 15.91  ? 135 GLU C CA  1 
ATOM   8484  C C   . GLU C  1 138 ? 137.700 45.409  9.129   1.00 16.61  ? 135 GLU C C   1 
ATOM   8485  O O   . GLU C  1 138 ? 137.199 45.988  10.103  1.00 17.10  ? 135 GLU C O   1 
ATOM   8486  C CB  . GLU C  1 138 ? 139.570 46.685  8.071   1.00 16.25  ? 135 GLU C CB  1 
ATOM   8487  C CG  . GLU C  1 138 ? 140.152 47.352  6.837   1.00 16.81  ? 135 GLU C CG  1 
ATOM   8488  C CD  . GLU C  1 138 ? 141.664 47.557  6.864   1.00 17.10  ? 135 GLU C CD  1 
ATOM   8489  O OE1 . GLU C  1 138 ? 142.378 47.122  7.783   1.00 17.62  ? 135 GLU C OE1 1 
ATOM   8490  O OE2 . GLU C  1 138 ? 142.165 48.174  5.922   1.00 18.50  ? 135 GLU C OE2 1 
ATOM   8491  N N   . PHE C  1 139 ? 137.854 44.101  9.068   1.00 17.00  ? 136 PHE C N   1 
ATOM   8492  C CA  . PHE C  1 139 ? 137.598 43.276  10.213  1.00 17.56  ? 136 PHE C CA  1 
ATOM   8493  C C   . PHE C  1 139 ? 138.977 42.786  10.641  1.00 17.45  ? 136 PHE C C   1 
ATOM   8494  O O   . PHE C  1 139 ? 139.571 41.893  10.041  1.00 16.80  ? 136 PHE C O   1 
ATOM   8495  C CB  . PHE C  1 139 ? 136.572 42.185  9.864   1.00 18.33  ? 136 PHE C CB  1 
ATOM   8496  C CG  . PHE C  1 139 ? 135.281 42.742  9.302   1.00 19.60  ? 136 PHE C CG  1 
ATOM   8497  C CD1 . PHE C  1 139 ? 134.374 43.413  10.121  1.00 19.78  ? 136 PHE C CD1 1 
ATOM   8498  C CD2 . PHE C  1 139 ? 134.977 42.625  7.942   1.00 20.88  ? 136 PHE C CD2 1 
ATOM   8499  C CE1 . PHE C  1 139 ? 133.196 43.941  9.608   1.00 19.92  ? 136 PHE C CE1 1 
ATOM   8500  C CE2 . PHE C  1 139 ? 133.797 43.158  7.421   1.00 20.73  ? 136 PHE C CE2 1 
ATOM   8501  C CZ  . PHE C  1 139 ? 132.908 43.811  8.261   1.00 20.57  ? 136 PHE C CZ  1 
ATOM   8502  N N   . GLN C  1 140 ? 139.507 43.446  11.662  1.00 18.32  ? 137 GLN C N   1 
ATOM   8503  C CA  . GLN C  1 140 ? 140.853 43.180  12.161  1.00 18.50  ? 137 GLN C CA  1 
ATOM   8504  C C   . GLN C  1 140 ? 140.847 42.200  13.336  1.00 17.95  ? 137 GLN C C   1 
ATOM   8505  O O   . GLN C  1 140 ? 139.835 42.029  13.991  1.00 17.48  ? 137 GLN C O   1 
ATOM   8506  C CB  . GLN C  1 140 ? 141.533 44.500  12.529  1.00 19.21  ? 137 GLN C CB  1 
ATOM   8507  C CG  . GLN C  1 140 ? 141.737 45.429  11.327  1.00 20.00  ? 137 GLN C CG  1 
ATOM   8508  C CD  . GLN C  1 140 ? 142.713 46.590  11.582  1.00 20.91  ? 137 GLN C CD  1 
ATOM   8509  O OE1 . GLN C  1 140 ? 142.980 46.979  12.732  1.00 21.30  ? 137 GLN C OE1 1 
ATOM   8510  N NE2 . GLN C  1 140 ? 143.257 47.143  10.497  1.00 20.77  ? 137 GLN C NE2 1 
ATOM   8511  N N   . PRO C  1 141 ? 141.977 41.531  13.587  1.00 18.51  ? 138 PRO C N   1 
ATOM   8512  C CA  . PRO C  1 141 ? 142.038 40.552  14.649  1.00 19.26  ? 138 PRO C CA  1 
ATOM   8513  C C   . PRO C  1 141 ? 141.871 41.144  16.052  1.00 19.51  ? 138 PRO C C   1 
ATOM   8514  O O   . PRO C  1 141 ? 142.246 42.310  16.278  1.00 19.03  ? 138 PRO C O   1 
ATOM   8515  C CB  . PRO C  1 141 ? 143.452 39.979  14.520  1.00 19.41  ? 138 PRO C CB  1 
ATOM   8516  C CG  . PRO C  1 141 ? 143.876 40.278  13.148  1.00 19.54  ? 138 PRO C CG  1 
ATOM   8517  C CD  . PRO C  1 141 ? 143.258 41.605  12.874  1.00 19.60  ? 138 PRO C CD  1 
ATOM   8518  N N   . MET C  1 142 ? 141.332 40.317  16.956  1.00 18.17  ? 139 MET C N   1 
ATOM   8519  C CA  . MET C  1 142 ? 141.063 40.704  18.323  1.00 17.49  ? 139 MET C CA  1 
ATOM   8520  C C   . MET C  1 142 ? 142.329 40.686  19.126  1.00 17.54  ? 139 MET C C   1 
ATOM   8521  O O   . MET C  1 142 ? 142.528 41.555  19.986  1.00 19.25  ? 139 MET C O   1 
ATOM   8522  C CB  . MET C  1 142 ? 140.123 39.718  19.013  1.00 17.36  ? 139 MET C CB  1 
ATOM   8523  C CG  . MET C  1 142 ? 138.720 39.639  18.460  1.00 17.55  ? 139 MET C CG  1 
ATOM   8524  S SD  . MET C  1 142 ? 137.773 41.163  18.611  1.00 17.49  ? 139 MET C SD  1 
ATOM   8525  C CE  . MET C  1 142 ? 137.506 41.264  20.380  1.00 17.65  ? 139 MET C CE  1 
ATOM   8526  N N   . GLY C  1 143 ? 143.150 39.667  18.887  1.00 16.71  ? 140 GLY C N   1 
ATOM   8527  C CA  . GLY C  1 143 ? 144.272 39.349  19.761  1.00 16.56  ? 140 GLY C CA  1 
ATOM   8528  C C   . GLY C  1 143 ? 144.238 37.921  20.265  1.00 16.62  ? 140 GLY C C   1 
ATOM   8529  O O   . GLY C  1 143 ? 144.188 36.980  19.460  1.00 16.92  ? 140 GLY C O   1 
ATOM   8530  N N   . VAL C  1 144 ? 144.290 37.752  21.592  1.00 16.69  ? 141 VAL C N   1 
ATOM   8531  C CA  . VAL C  1 144 ? 144.323 36.423  22.207  1.00 15.94  ? 141 VAL C CA  1 
ATOM   8532  C C   . VAL C  1 144 ? 142.905 36.066  22.491  1.00 15.70  ? 141 VAL C C   1 
ATOM   8533  O O   . VAL C  1 144 ? 142.220 36.779  23.230  1.00 15.93  ? 141 VAL C O   1 
ATOM   8534  C CB  . VAL C  1 144 ? 145.150 36.382  23.503  1.00 16.03  ? 141 VAL C CB  1 
ATOM   8535  C CG1 . VAL C  1 144 ? 145.111 35.000  24.156  1.00 15.99  ? 141 VAL C CG1 1 
ATOM   8536  C CG2 . VAL C  1 144 ? 146.586 36.735  23.192  1.00 16.22  ? 141 VAL C CG2 1 
ATOM   8537  N N   . VAL C  1 145 ? 142.469 34.959  21.904  1.00 15.74  ? 142 VAL C N   1 
ATOM   8538  C CA  . VAL C  1 145 ? 141.094 34.462  22.055  1.00 15.67  ? 142 VAL C CA  1 
ATOM   8539  C C   . VAL C  1 145 ? 141.118 33.202  22.896  1.00 15.69  ? 142 VAL C C   1 
ATOM   8540  O O   . VAL C  1 145 ? 142.047 32.398  22.781  1.00 16.35  ? 142 VAL C O   1 
ATOM   8541  C CB  . VAL C  1 145 ? 140.504 34.135  20.684  1.00 15.91  ? 142 VAL C CB  1 
ATOM   8542  C CG1 . VAL C  1 145 ? 139.161 33.460  20.786  1.00 16.37  ? 142 VAL C CG1 1 
ATOM   8543  C CG2 . VAL C  1 145 ? 140.365 35.398  19.864  1.00 16.16  ? 142 VAL C CG2 1 
ATOM   8544  N N   . ALA C  1 146 ? 140.096 33.030  23.735  1.00 15.52  ? 143 ALA C N   1 
ATOM   8545  C CA  . ALA C  1 146 ? 140.001 31.873  24.622  1.00 15.28  ? 143 ALA C CA  1 
ATOM   8546  C C   . ALA C  1 146 ? 138.826 31.001  24.211  1.00 15.24  ? 143 ALA C C   1 
ATOM   8547  O O   . ALA C  1 146 ? 137.762 31.519  23.863  1.00 14.61  ? 143 ALA C O   1 
ATOM   8548  C CB  . ALA C  1 146 ? 139.844 32.322  26.063  1.00 15.20  ? 143 ALA C CB  1 
ATOM   8549  N N   . GLY C  1 147 ? 139.031 29.682  24.279  1.00 15.43  ? 144 GLY C N   1 
ATOM   8550  C CA  . GLY C  1 147 ? 138.007 28.687  23.941  1.00 15.33  ? 144 GLY C CA  1 
ATOM   8551  C C   . GLY C  1 147 ? 137.875 27.626  25.010  1.00 15.49  ? 144 GLY C C   1 
ATOM   8552  O O   . GLY C  1 147 ? 138.878 27.111  25.503  1.00 16.00  ? 144 GLY C O   1 
ATOM   8553  N N   . ILE C  1 148 ? 136.634 27.303  25.369  1.00 15.48  ? 145 ILE C N   1 
ATOM   8554  C CA  . ILE C  1 148 ? 136.335 26.330  26.416  1.00 15.92  ? 145 ILE C CA  1 
ATOM   8555  C C   . ILE C  1 148 ? 135.302 25.337  25.910  1.00 16.70  ? 145 ILE C C   1 
ATOM   8556  O O   . ILE C  1 148 ? 134.221 25.741  25.467  1.00 17.68  ? 145 ILE C O   1 
ATOM   8557  C CB  . ILE C  1 148 ? 135.798 27.023  27.670  1.00 15.99  ? 145 ILE C CB  1 
ATOM   8558  C CG1 . ILE C  1 148 ? 136.885 27.933  28.265  1.00 16.94  ? 145 ILE C CG1 1 
ATOM   8559  C CG2 . ILE C  1 148 ? 135.377 26.013  28.728  1.00 15.62  ? 145 ILE C CG2 1 
ATOM   8560  C CD1 . ILE C  1 148 ? 136.350 29.057  29.135  1.00 17.25  ? 145 ILE C CD1 1 
ATOM   8561  N N   . THR C  1 149 ? 135.615 24.043  25.995  1.00 16.58  ? 146 THR C N   1 
ATOM   8562  C CA  . THR C  1 149 ? 134.865 23.056  25.244  1.00 16.83  ? 146 THR C CA  1 
ATOM   8563  C C   . THR C  1 149 ? 134.466 21.871  26.097  1.00 17.08  ? 146 THR C C   1 
ATOM   8564  O O   . THR C  1 149 ? 135.170 21.527  27.042  1.00 16.59  ? 146 THR C O   1 
ATOM   8565  C CB  . THR C  1 149 ? 135.639 22.591  23.975  1.00 17.15  ? 146 THR C CB  1 
ATOM   8566  O OG1 . THR C  1 149 ? 136.853 21.894  24.314  1.00 16.79  ? 146 THR C OG1 1 
ATOM   8567  C CG2 . THR C  1 149 ? 135.972 23.791  23.086  1.00 17.14  ? 146 THR C CG2 1 
ATOM   8568  N N   . PRO C  1 150 ? 133.335 21.230  25.748  1.00 17.87  ? 147 PRO C N   1 
ATOM   8569  C CA  . PRO C  1 150 ? 132.746 20.171  26.535  1.00 18.00  ? 147 PRO C CA  1 
ATOM   8570  C C   . PRO C  1 150 ? 133.311 18.825  26.151  1.00 18.84  ? 147 PRO C C   1 
ATOM   8571  O O   . PRO C  1 150 ? 134.216 18.752  25.313  1.00 19.54  ? 147 PRO C O   1 
ATOM   8572  C CB  . PRO C  1 150 ? 131.284 20.250  26.152  1.00 17.97  ? 147 PRO C CB  1 
ATOM   8573  C CG  . PRO C  1 150 ? 131.303 20.664  24.723  1.00 18.41  ? 147 PRO C CG  1 
ATOM   8574  C CD  . PRO C  1 150 ? 132.604 21.385  24.474  1.00 18.34  ? 147 PRO C CD  1 
ATOM   8575  N N   . PHE C  1 151 ? 132.803 17.775  26.795  1.00 19.29  ? 148 PHE C N   1 
ATOM   8576  C CA  . PHE C  1 151 ? 133.368 16.432  26.672  1.00 19.63  ? 148 PHE C CA  1 
ATOM   8577  C C   . PHE C  1 151 ? 132.805 15.714  25.479  1.00 20.20  ? 148 PHE C C   1 
ATOM   8578  O O   . PHE C  1 151 ? 133.449 14.847  24.930  1.00 20.49  ? 148 PHE C O   1 
ATOM   8579  C CB  . PHE C  1 151 ? 133.116 15.578  27.939  1.00 19.57  ? 148 PHE C CB  1 
ATOM   8580  C CG  . PHE C  1 151 ? 131.697 15.049  28.067  1.00 19.10  ? 148 PHE C CG  1 
ATOM   8581  C CD1 . PHE C  1 151 ? 131.284 13.917  27.382  1.00 18.83  ? 148 PHE C CD1 1 
ATOM   8582  C CD2 . PHE C  1 151 ? 130.782 15.682  28.894  1.00 18.99  ? 148 PHE C CD2 1 
ATOM   8583  C CE1 . PHE C  1 151 ? 129.987 13.462  27.499  1.00 18.64  ? 148 PHE C CE1 1 
ATOM   8584  C CE2 . PHE C  1 151 ? 129.489 15.231  29.015  1.00 18.38  ? 148 PHE C CE2 1 
ATOM   8585  C CZ  . PHE C  1 151 ? 129.091 14.120  28.319  1.00 18.48  ? 148 PHE C CZ  1 
ATOM   8586  N N   . ASN C  1 152 ? 131.586 16.038  25.095  1.00 21.08  ? 149 ASN C N   1 
ATOM   8587  C CA  . ASN C  1 152 ? 130.879 15.156  24.174  1.00 22.50  ? 149 ASN C CA  1 
ATOM   8588  C C   . ASN C  1 152 ? 131.359 15.173  22.729  1.00 21.34  ? 149 ASN C C   1 
ATOM   8589  O O   . ASN C  1 152 ? 131.098 14.232  21.950  1.00 20.71  ? 149 ASN C O   1 
ATOM   8590  C CB  . ASN C  1 152 ? 129.383 15.387  24.239  1.00 24.43  ? 149 ASN C CB  1 
ATOM   8591  C CG  . ASN C  1 152 ? 129.000 16.817  24.055  1.00 24.94  ? 149 ASN C CG  1 
ATOM   8592  O OD1 . ASN C  1 152 ? 129.398 17.675  24.834  1.00 24.86  ? 149 ASN C OD1 1 
ATOM   8593  N ND2 . ASN C  1 152 ? 128.170 17.072  23.052  1.00 26.44  ? 149 ASN C ND2 1 
ATOM   8594  N N   . PHE C  1 153 ? 132.062 16.249  22.395  1.00 19.78  ? 150 PHE C N   1 
ATOM   8595  C CA  . PHE C  1 153 ? 132.727 16.394  21.124  1.00 17.86  ? 150 PHE C CA  1 
ATOM   8596  C C   . PHE C  1 153 ? 134.112 16.972  21.344  1.00 17.15  ? 150 PHE C C   1 
ATOM   8597  O O   . PHE C  1 153 ? 134.335 18.147  21.051  1.00 18.00  ? 150 PHE C O   1 
ATOM   8598  C CB  . PHE C  1 153 ? 131.923 17.359  20.281  1.00 17.49  ? 150 PHE C CB  1 
ATOM   8599  C CG  . PHE C  1 153 ? 130.620 16.817  19.830  1.00 17.21  ? 150 PHE C CG  1 
ATOM   8600  C CD1 . PHE C  1 153 ? 130.579 15.789  18.900  1.00 17.54  ? 150 PHE C CD1 1 
ATOM   8601  C CD2 . PHE C  1 153 ? 129.437 17.335  20.297  1.00 17.03  ? 150 PHE C CD2 1 
ATOM   8602  C CE1 . PHE C  1 153 ? 129.381 15.281  18.460  1.00 17.27  ? 150 PHE C CE1 1 
ATOM   8603  C CE2 . PHE C  1 153 ? 128.221 16.825  19.862  1.00 17.25  ? 150 PHE C CE2 1 
ATOM   8604  C CZ  . PHE C  1 153 ? 128.199 15.800  18.943  1.00 17.17  ? 150 PHE C CZ  1 
ATOM   8605  N N   . PRO C  1 154 ? 135.064 16.161  21.842  1.00 16.11  ? 151 PRO C N   1 
ATOM   8606  C CA  . PRO C  1 154 ? 136.394 16.707  22.144  1.00 15.48  ? 151 PRO C CA  1 
ATOM   8607  C C   . PRO C  1 154 ? 137.182 17.119  20.903  1.00 15.05  ? 151 PRO C C   1 
ATOM   8608  O O   . PRO C  1 154 ? 138.202 17.774  21.047  1.00 14.82  ? 151 PRO C O   1 
ATOM   8609  C CB  . PRO C  1 154 ? 137.092 15.548  22.848  1.00 15.48  ? 151 PRO C CB  1 
ATOM   8610  C CG  . PRO C  1 154 ? 136.469 14.345  22.252  1.00 15.39  ? 151 PRO C CG  1 
ATOM   8611  C CD  . PRO C  1 154 ? 135.040 14.695  21.966  1.00 15.65  ? 151 PRO C CD  1 
ATOM   8612  N N   . VAL C  1 155 ? 136.719 16.740  19.708  1.00 14.94  ? 152 VAL C N   1 
ATOM   8613  C CA  . VAL C  1 155 ? 137.361 17.148  18.453  1.00 15.01  ? 152 VAL C CA  1 
ATOM   8614  C C   . VAL C  1 155 ? 136.608 18.225  17.681  1.00 14.65  ? 152 VAL C C   1 
ATOM   8615  O O   . VAL C  1 155 ? 137.194 19.233  17.253  1.00 14.11  ? 152 VAL C O   1 
ATOM   8616  C CB  . VAL C  1 155 ? 137.652 15.938  17.550  1.00 15.03  ? 152 VAL C CB  1 
ATOM   8617  C CG1 . VAL C  1 155 ? 138.009 16.362  16.138  1.00 15.03  ? 152 VAL C CG1 1 
ATOM   8618  C CG2 . VAL C  1 155 ? 138.839 15.172  18.113  1.00 15.26  ? 152 VAL C CG2 1 
ATOM   8619  N N   . MET C  1 156 ? 135.325 18.007  17.492  1.00 14.59  ? 153 MET C N   1 
ATOM   8620  C CA  . MET C  1 156 ? 134.556 18.887  16.631  1.00 14.78  ? 153 MET C CA  1 
ATOM   8621  C C   . MET C  1 156 ? 134.371 20.271  17.236  1.00 14.62  ? 153 MET C C   1 
ATOM   8622  O O   . MET C  1 156 ? 134.529 21.280  16.573  1.00 14.51  ? 153 MET C O   1 
ATOM   8623  C CB  . MET C  1 156 ? 133.200 18.274  16.365  1.00 14.80  ? 153 MET C CB  1 
ATOM   8624  C CG  . MET C  1 156 ? 132.381 19.060  15.379  1.00 15.15  ? 153 MET C CG  1 
ATOM   8625  S SD  . MET C  1 156 ? 130.710 18.419  15.260  1.00 16.13  ? 153 MET C SD  1 
ATOM   8626  C CE  . MET C  1 156 ? 129.999 18.865  16.842  1.00 15.50  ? 153 MET C CE  1 
ATOM   8627  N N   . VAL C  1 157 ? 134.011 20.321  18.505  1.00 14.86  ? 154 VAL C N   1 
ATOM   8628  C CA  . VAL C  1 157 ? 133.691 21.600  19.121  1.00 14.44  ? 154 VAL C CA  1 
ATOM   8629  C C   . VAL C  1 157 ? 134.914 22.488  19.204  1.00 13.62  ? 154 VAL C C   1 
ATOM   8630  O O   . VAL C  1 157 ? 134.763 23.662  18.983  1.00 14.30  ? 154 VAL C O   1 
ATOM   8631  C CB  . VAL C  1 157 ? 132.984 21.450  20.472  1.00 14.66  ? 154 VAL C CB  1 
ATOM   8632  C CG1 . VAL C  1 157 ? 132.832 22.793  21.154  1.00 15.20  ? 154 VAL C CG1 1 
ATOM   8633  C CG2 . VAL C  1 157 ? 131.596 20.908  20.241  1.00 14.79  ? 154 VAL C CG2 1 
ATOM   8634  N N   . PRO C  1 158 ? 136.118 21.945  19.498  1.00 12.56  ? 155 PRO C N   1 
ATOM   8635  C CA  . PRO C  1 158 ? 137.314 22.774  19.343  1.00 11.98  ? 155 PRO C CA  1 
ATOM   8636  C C   . PRO C  1 158 ? 137.464 23.291  17.936  1.00 11.57  ? 155 PRO C C   1 
ATOM   8637  O O   . PRO C  1 158 ? 137.702 24.469  17.761  1.00 11.17  ? 155 PRO C O   1 
ATOM   8638  C CB  . PRO C  1 158 ? 138.442 21.827  19.698  1.00 11.93  ? 155 PRO C CB  1 
ATOM   8639  C CG  . PRO C  1 158 ? 137.842 20.938  20.702  1.00 12.02  ? 155 PRO C CG  1 
ATOM   8640  C CD  . PRO C  1 158 ? 136.412 20.743  20.285  1.00 12.23  ? 155 PRO C CD  1 
ATOM   8641  N N   . LEU C  1 159 ? 137.283 22.419  16.947  1.00 11.69  ? 156 LEU C N   1 
ATOM   8642  C CA  . LEU C  1 159 ? 137.355 22.794  15.514  1.00 11.70  ? 156 LEU C CA  1 
ATOM   8643  C C   . LEU C  1 159 ? 136.288 23.806  15.069  1.00 11.46  ? 156 LEU C C   1 
ATOM   8644  O O   . LEU C  1 159 ? 136.411 24.409  14.005  1.00 11.22  ? 156 LEU C O   1 
ATOM   8645  C CB  . LEU C  1 159 ? 137.301 21.546  14.612  1.00 11.84  ? 156 LEU C CB  1 
ATOM   8646  C CG  . LEU C  1 159 ? 138.551 20.661  14.729  1.00 12.45  ? 156 LEU C CG  1 
ATOM   8647  C CD1 . LEU C  1 159 ? 138.378 19.321  14.026  1.00 12.40  ? 156 LEU C CD1 1 
ATOM   8648  C CD2 . LEU C  1 159 ? 139.800 21.356  14.196  1.00 12.73  ? 156 LEU C CD2 1 
ATOM   8649  N N   . TRP C  1 160 ? 135.241 23.984  15.868  1.00 11.31  ? 157 TRP C N   1 
ATOM   8650  C CA  . TRP C  1 160 ? 134.325 25.093  15.677  1.00 11.48  ? 157 TRP C CA  1 
ATOM   8651  C C   . TRP C  1 160 ? 135.047 26.417  15.869  1.00 11.49  ? 157 TRP C C   1 
ATOM   8652  O O   . TRP C  1 160 ? 134.779 27.370  15.171  1.00 11.43  ? 157 TRP C O   1 
ATOM   8653  C CB  . TRP C  1 160 ? 133.172 25.045  16.692  1.00 11.77  ? 157 TRP C CB  1 
ATOM   8654  C CG  . TRP C  1 160 ? 132.086 23.994  16.472  1.00 11.99  ? 157 TRP C CG  1 
ATOM   8655  C CD1 . TRP C  1 160 ? 132.079 22.989  15.547  1.00 12.23  ? 157 TRP C CD1 1 
ATOM   8656  C CD2 . TRP C  1 160 ? 130.871 23.850  17.221  1.00 11.79  ? 157 TRP C CD2 1 
ATOM   8657  N NE1 . TRP C  1 160 ? 130.934 22.235  15.671  1.00 12.12  ? 157 TRP C NE1 1 
ATOM   8658  C CE2 . TRP C  1 160 ? 130.185 22.738  16.698  1.00 11.92  ? 157 TRP C CE2 1 
ATOM   8659  C CE3 . TRP C  1 160 ? 130.288 24.566  18.271  1.00 11.77  ? 157 TRP C CE3 1 
ATOM   8660  C CZ2 . TRP C  1 160 ? 128.941 22.330  17.183  1.00 11.90  ? 157 TRP C CZ2 1 
ATOM   8661  C CZ3 . TRP C  1 160 ? 129.046 24.140  18.772  1.00 11.78  ? 157 TRP C CZ3 1 
ATOM   8662  C CH2 . TRP C  1 160 ? 128.395 23.030  18.228  1.00 11.68  ? 157 TRP C CH2 1 
ATOM   8663  N N   . MET C  1 161 ? 135.963 26.451  16.828  1.00 11.85  ? 158 MET C N   1 
ATOM   8664  C CA  . MET C  1 161 ? 136.569 27.679  17.323  1.00 12.10  ? 158 MET C CA  1 
ATOM   8665  C C   . MET C  1 161 ? 137.924 28.010  16.720  1.00 12.73  ? 158 MET C C   1 
ATOM   8666  O O   . MET C  1 161 ? 138.020 29.007  16.030  1.00 13.32  ? 158 MET C O   1 
ATOM   8667  C CB  . MET C  1 161 ? 136.714 27.609  18.837  1.00 11.94  ? 158 MET C CB  1 
ATOM   8668  C CG  . MET C  1 161 ? 135.439 27.209  19.555  1.00 11.77  ? 158 MET C CG  1 
ATOM   8669  S SD  . MET C  1 161 ? 135.731 27.172  21.308  1.00 11.52  ? 158 MET C SD  1 
ATOM   8670  C CE  . MET C  1 161 ? 134.074 26.925  21.928  1.00 11.79  ? 158 MET C CE  1 
ATOM   8671  N N   . PHE C  1 162 ? 138.963 27.207  16.976  1.00 13.27  ? 159 PHE C N   1 
ATOM   8672  C CA  . PHE C  1 162 ? 140.346 27.669  16.702  1.00 13.78  ? 159 PHE C CA  1 
ATOM   8673  C C   . PHE C  1 162 ? 140.716 27.838  15.225  1.00 13.65  ? 159 PHE C C   1 
ATOM   8674  O O   . PHE C  1 162 ? 141.373 28.809  14.865  1.00 12.85  ? 159 PHE C O   1 
ATOM   8675  C CB  . PHE C  1 162 ? 141.451 26.934  17.531  1.00 14.21  ? 159 PHE C CB  1 
ATOM   8676  C CG  . PHE C  1 162 ? 141.690 25.475  17.194  1.00 14.19  ? 159 PHE C CG  1 
ATOM   8677  C CD1 . PHE C  1 162 ? 142.521 25.103  16.158  1.00 14.59  ? 159 PHE C CD1 1 
ATOM   8678  C CD2 . PHE C  1 162 ? 141.182 24.465  17.999  1.00 14.50  ? 159 PHE C CD2 1 
ATOM   8679  C CE1 . PHE C  1 162 ? 142.780 23.745  15.895  1.00 14.46  ? 159 PHE C CE1 1 
ATOM   8680  C CE2 . PHE C  1 162 ? 141.449 23.114  17.745  1.00 14.22  ? 159 PHE C CE2 1 
ATOM   8681  C CZ  . PHE C  1 162 ? 142.247 22.755  16.697  1.00 13.94  ? 159 PHE C CZ  1 
ATOM   8682  N N   . PRO C  1 163 ? 140.255 26.926  14.367  1.00 14.32  ? 160 PRO C N   1 
ATOM   8683  C CA  . PRO C  1 163 ? 140.429 27.098  12.924  1.00 14.05  ? 160 PRO C CA  1 
ATOM   8684  C C   . PRO C  1 163 ? 139.982 28.471  12.460  1.00 13.71  ? 160 PRO C C   1 
ATOM   8685  O O   . PRO C  1 163 ? 140.802 29.221  11.953  1.00 14.29  ? 160 PRO C O   1 
ATOM   8686  C CB  . PRO C  1 163 ? 139.550 26.014  12.338  1.00 14.26  ? 160 PRO C CB  1 
ATOM   8687  C CG  . PRO C  1 163 ? 139.634 24.939  13.361  1.00 15.16  ? 160 PRO C CG  1 
ATOM   8688  C CD  . PRO C  1 163 ? 139.521 25.683  14.671  1.00 15.04  ? 160 PRO C CD  1 
ATOM   8689  N N   . MET C  1 164 ? 138.739 28.852  12.707  1.00 13.08  ? 161 MET C N   1 
ATOM   8690  C CA  . MET C  1 164 ? 138.310 30.197  12.308  1.00 12.76  ? 161 MET C CA  1 
ATOM   8691  C C   . MET C  1 164 ? 139.053 31.316  13.010  1.00 12.74  ? 161 MET C C   1 
ATOM   8692  O O   . MET C  1 164 ? 139.360 32.317  12.399  1.00 12.94  ? 161 MET C O   1 
ATOM   8693  C CB  . MET C  1 164 ? 136.825 30.440  12.554  1.00 12.49  ? 161 MET C CB  1 
ATOM   8694  C CG  . MET C  1 164 ? 136.283 31.729  11.908  1.00 12.30  ? 161 MET C CG  1 
ATOM   8695  S SD  . MET C  1 164 ? 136.526 31.924  10.099  1.00 12.48  ? 161 MET C SD  1 
ATOM   8696  C CE  . MET C  1 164 ? 135.382 30.722  9.437   1.00 12.07  ? 161 MET C CE  1 
ATOM   8697  N N   . ALA C  1 165 ? 139.287 31.167  14.300  1.00 12.77  ? 162 ALA C N   1 
ATOM   8698  C CA  . ALA C  1 165 ? 139.887 32.228  15.097  1.00 12.81  ? 162 ALA C CA  1 
ATOM   8699  C C   . ALA C  1 165 ? 141.301 32.505  14.631  1.00 13.34  ? 162 ALA C C   1 
ATOM   8700  O O   . ALA C  1 165 ? 141.691 33.674  14.456  1.00 13.14  ? 162 ALA C O   1 
ATOM   8701  C CB  . ALA C  1 165 ? 139.886 31.845  16.566  1.00 12.90  ? 162 ALA C CB  1 
ATOM   8702  N N   . ILE C  1 166 ? 142.048 31.414  14.416  1.00 13.85  ? 163 ILE C N   1 
ATOM   8703  C CA  . ILE C  1 166 ? 143.431 31.470  13.973  1.00 13.57  ? 163 ILE C CA  1 
ATOM   8704  C C   . ILE C  1 166 ? 143.514 32.090  12.592  1.00 13.44  ? 163 ILE C C   1 
ATOM   8705  O O   . ILE C  1 166 ? 144.341 32.979  12.342  1.00 13.63  ? 163 ILE C O   1 
ATOM   8706  C CB  . ILE C  1 166 ? 144.058 30.071  13.990  1.00 13.82  ? 163 ILE C CB  1 
ATOM   8707  C CG1 . ILE C  1 166 ? 144.380 29.718  15.450  1.00 14.03  ? 163 ILE C CG1 1 
ATOM   8708  C CG2 . ILE C  1 166 ? 145.308 30.019  13.113  1.00 14.39  ? 163 ILE C CG2 1 
ATOM   8709  C CD1 . ILE C  1 166 ? 144.728 28.272  15.732  1.00 14.35  ? 163 ILE C CD1 1 
ATOM   8710  N N   . VAL C  1 167 ? 142.643 31.639  11.698  1.00 12.81  ? 164 VAL C N   1 
ATOM   8711  C CA  . VAL C  1 167 ? 142.720 32.083  10.310  1.00 12.47  ? 164 VAL C CA  1 
ATOM   8712  C C   . VAL C  1 167 ? 142.265 33.540  10.178  1.00 12.55  ? 164 VAL C C   1 
ATOM   8713  O O   . VAL C  1 167 ? 142.597 34.205  9.215   1.00 12.67  ? 164 VAL C O   1 
ATOM   8714  C CB  . VAL C  1 167 ? 141.930 31.136  9.381   1.00 12.08  ? 164 VAL C CB  1 
ATOM   8715  C CG1 . VAL C  1 167 ? 140.509 31.636  9.172   1.00 12.34  ? 164 VAL C CG1 1 
ATOM   8716  C CG2 . VAL C  1 167 ? 142.630 30.919  8.067   1.00 11.63  ? 164 VAL C CG2 1 
ATOM   8717  N N   . CYS C  1 168 ? 141.494 34.024  11.146  1.00 12.66  ? 165 CYS C N   1 
ATOM   8718  C CA  . CYS C  1 168 ? 141.150 35.448  11.247  1.00 12.70  ? 165 CYS C CA  1 
ATOM   8719  C C   . CYS C  1 168 ? 142.281 36.279  11.895  1.00 13.24  ? 165 CYS C C   1 
ATOM   8720  O O   . CYS C  1 168 ? 142.088 37.466  12.203  1.00 13.42  ? 165 CYS C O   1 
ATOM   8721  C CB  . CYS C  1 168 ? 139.849 35.644  12.052  1.00 12.44  ? 165 CYS C CB  1 
ATOM   8722  S SG  . CYS C  1 168 ? 138.329 35.147  11.193  1.00 12.28  ? 165 CYS C SG  1 
ATOM   8723  N N   . GLY C  1 169 ? 143.449 35.669  12.122  1.00 13.32  ? 166 GLY C N   1 
ATOM   8724  C CA  . GLY C  1 169 ? 144.608 36.384  12.642  1.00 13.08  ? 166 GLY C CA  1 
ATOM   8725  C C   . GLY C  1 169 ? 144.777 36.429  14.149  1.00 12.68  ? 166 GLY C C   1 
ATOM   8726  O O   . GLY C  1 169 ? 145.745 36.985  14.625  1.00 12.99  ? 166 GLY C O   1 
ATOM   8727  N N   . ASN C  1 170 ? 143.866 35.843  14.906  1.00 12.32  ? 167 ASN C N   1 
ATOM   8728  C CA  . ASN C  1 170 ? 144.045 35.745  16.359  1.00 12.21  ? 167 ASN C CA  1 
ATOM   8729  C C   . ASN C  1 170 ? 145.032 34.622  16.787  1.00 12.31  ? 167 ASN C C   1 
ATOM   8730  O O   . ASN C  1 170 ? 145.467 33.766  15.976  1.00 11.70  ? 167 ASN C O   1 
ATOM   8731  C CB  . ASN C  1 170 ? 142.700 35.504  17.057  1.00 12.22  ? 167 ASN C CB  1 
ATOM   8732  C CG  . ASN C  1 170 ? 141.603 36.448  16.594  1.00 11.98  ? 167 ASN C CG  1 
ATOM   8733  O OD1 . ASN C  1 170 ? 141.587 37.631  16.923  1.00 12.02  ? 167 ASN C OD1 1 
ATOM   8734  N ND2 . ASN C  1 170 ? 140.679 35.926  15.829  1.00 11.83  ? 167 ASN C ND2 1 
ATOM   8735  N N   . CYS C  1 171 ? 145.386 34.669  18.070  1.00 12.35  ? 168 CYS C N   1 
ATOM   8736  C CA  . CYS C  1 171 ? 146.058 33.563  18.731  1.00 12.89  ? 168 CYS C CA  1 
ATOM   8737  C C   . CYS C  1 171 ? 145.095 32.940  19.739  1.00 13.13  ? 168 CYS C C   1 
ATOM   8738  O O   . CYS C  1 171 ? 144.203 33.622  20.257  1.00 12.94  ? 168 CYS C O   1 
ATOM   8739  C CB  . CYS C  1 171 ? 147.355 34.035  19.376  1.00 12.98  ? 168 CYS C CB  1 
ATOM   8740  S SG  . CYS C  1 171 ? 148.547 34.517  18.114  1.00 13.15  ? 168 CYS C SG  1 
ATOM   8741  N N   . PHE C  1 172 ? 145.268 31.647  20.003  1.00 13.30  ? 169 PHE C N   1 
ATOM   8742  C CA  . PHE C  1 172 ? 144.240 30.871  20.686  1.00 13.66  ? 169 PHE C CA  1 
ATOM   8743  C C   . PHE C  1 172 ? 144.759 30.135  21.916  1.00 14.09  ? 169 PHE C C   1 
ATOM   8744  O O   . PHE C  1 172 ? 145.869 29.597  21.909  1.00 14.39  ? 169 PHE C O   1 
ATOM   8745  C CB  . PHE C  1 172 ? 143.620 29.863  19.710  1.00 13.69  ? 169 PHE C CB  1 
ATOM   8746  C CG  . PHE C  1 172 ? 142.202 29.482  20.043  1.00 13.57  ? 169 PHE C CG  1 
ATOM   8747  C CD1 . PHE C  1 172 ? 141.928 28.406  20.863  1.00 13.56  ? 169 PHE C CD1 1 
ATOM   8748  C CD2 . PHE C  1 172 ? 141.139 30.207  19.542  1.00 13.70  ? 169 PHE C CD2 1 
ATOM   8749  C CE1 . PHE C  1 172 ? 140.613 28.052  21.170  1.00 13.47  ? 169 PHE C CE1 1 
ATOM   8750  C CE2 . PHE C  1 172 ? 139.823 29.847  19.836  1.00 13.78  ? 169 PHE C CE2 1 
ATOM   8751  C CZ  . PHE C  1 172 ? 139.562 28.760  20.651  1.00 13.30  ? 169 PHE C CZ  1 
ATOM   8752  N N   . VAL C  1 173 ? 143.939 30.120  22.964  1.00 14.33  ? 170 VAL C N   1 
ATOM   8753  C CA  . VAL C  1 173 ? 144.192 29.324  24.138  1.00 15.04  ? 170 VAL C CA  1 
ATOM   8754  C C   . VAL C  1 173 ? 142.944 28.509  24.414  1.00 15.73  ? 170 VAL C C   1 
ATOM   8755  O O   . VAL C  1 173 ? 141.904 29.064  24.787  1.00 15.65  ? 170 VAL C O   1 
ATOM   8756  C CB  . VAL C  1 173 ? 144.509 30.175  25.381  1.00 15.43  ? 170 VAL C CB  1 
ATOM   8757  C CG1 . VAL C  1 173 ? 144.827 29.273  26.576  1.00 15.60  ? 170 VAL C CG1 1 
ATOM   8758  C CG2 . VAL C  1 173 ? 145.682 31.099  25.119  1.00 15.40  ? 170 VAL C CG2 1 
ATOM   8759  N N   . LEU C  1 174 ? 143.078 27.189  24.256  1.00 16.53  ? 171 LEU C N   1 
ATOM   8760  C CA  . LEU C  1 174 ? 141.987 26.241  24.402  1.00 16.56  ? 171 LEU C CA  1 
ATOM   8761  C C   . LEU C  1 174 ? 142.055 25.570  25.754  1.00 16.98  ? 171 LEU C C   1 
ATOM   8762  O O   . LEU C  1 174 ? 143.113 25.126  26.192  1.00 16.56  ? 171 LEU C O   1 
ATOM   8763  C CB  . LEU C  1 174 ? 142.082 25.175  23.312  1.00 16.94  ? 171 LEU C CB  1 
ATOM   8764  C CG  . LEU C  1 174 ? 141.042 24.051  23.330  1.00 17.23  ? 171 LEU C CG  1 
ATOM   8765  C CD1 . LEU C  1 174 ? 139.651 24.612  23.139  1.00 17.05  ? 171 LEU C CD1 1 
ATOM   8766  C CD2 . LEU C  1 174 ? 141.347 23.028  22.250  1.00 17.72  ? 171 LEU C CD2 1 
ATOM   8767  N N   . LYS C  1 175 ? 140.906 25.468  26.402  1.00 18.07  ? 172 LYS C N   1 
ATOM   8768  C CA  . LYS C  1 175 ? 140.786 24.714  27.631  1.00 18.77  ? 172 LYS C CA  1 
ATOM   8769  C C   . LYS C  1 175 ? 139.687 23.684  27.452  1.00 19.80  ? 172 LYS C C   1 
ATOM   8770  O O   . LYS C  1 175 ? 138.516 23.984  27.678  1.00 20.21  ? 172 LYS C O   1 
ATOM   8771  C CB  . LYS C  1 175 ? 140.476 25.652  28.755  1.00 18.83  ? 172 LYS C CB  1 
ATOM   8772  C CG  . LYS C  1 175 ? 140.791 25.063  30.112  1.00 19.56  ? 172 LYS C CG  1 
ATOM   8773  C CD  . LYS C  1 175 ? 139.584 24.427  30.752  1.00 19.68  ? 172 LYS C CD  1 
ATOM   8774  C CE  . LYS C  1 175 ? 139.675 22.931  30.725  1.00 19.42  ? 172 LYS C CE  1 
ATOM   8775  N NZ  . LYS C  1 175 ? 138.346 22.384  31.115  1.00 19.41  ? 172 LYS C NZ  1 
ATOM   8776  N N   . PRO C  1 176 ? 140.058 22.465  27.017  1.00 20.19  ? 173 PRO C N   1 
ATOM   8777  C CA  . PRO C  1 176 ? 139.078 21.442  26.657  1.00 20.25  ? 173 PRO C CA  1 
ATOM   8778  C C   . PRO C  1 176 ? 138.600 20.616  27.846  1.00 21.00  ? 173 PRO C C   1 
ATOM   8779  O O   . PRO C  1 176 ? 139.180 20.706  28.919  1.00 22.54  ? 173 PRO C O   1 
ATOM   8780  C CB  . PRO C  1 176 ? 139.860 20.569  25.693  1.00 20.14  ? 173 PRO C CB  1 
ATOM   8781  C CG  . PRO C  1 176 ? 141.262 20.605  26.217  1.00 20.07  ? 173 PRO C CG  1 
ATOM   8782  C CD  . PRO C  1 176 ? 141.439 21.979  26.823  1.00 20.25  ? 173 PRO C CD  1 
ATOM   8783  N N   . SER C  1 177 ? 137.574 19.795  27.648  1.00 21.03  ? 174 SER C N   1 
ATOM   8784  C CA  . SER C  1 177 ? 137.033 18.961  28.736  1.00 21.34  ? 174 SER C CA  1 
ATOM   8785  C C   . SER C  1 177 ? 138.066 18.042  29.338  1.00 21.69  ? 174 SER C C   1 
ATOM   8786  O O   . SER C  1 177 ? 138.735 17.328  28.623  1.00 20.50  ? 174 SER C O   1 
ATOM   8787  C CB  . SER C  1 177 ? 135.894 18.091  28.221  1.00 21.06  ? 174 SER C CB  1 
ATOM   8788  O OG  . SER C  1 177 ? 135.374 17.259  29.232  1.00 19.83  ? 174 SER C OG  1 
ATOM   8789  N N   . GLU C  1 178 ? 138.142 18.026  30.659  1.00 24.00  ? 175 GLU C N   1 
ATOM   8790  C CA  . GLU C  1 178 ? 139.106 17.172  31.380  1.00 26.45  ? 175 GLU C CA  1 
ATOM   8791  C C   . GLU C  1 178 ? 138.799 15.649  31.282  1.00 26.53  ? 175 GLU C C   1 
ATOM   8792  O O   . GLU C  1 178 ? 139.657 14.800  31.534  1.00 26.56  ? 175 GLU C O   1 
ATOM   8793  C CB  . GLU C  1 178 ? 139.255 17.640  32.841  1.00 27.84  ? 175 GLU C CB  1 
ATOM   8794  C CG  . GLU C  1 178 ? 137.971 17.733  33.657  1.00 30.01  ? 175 GLU C CG  1 
ATOM   8795  C CD  . GLU C  1 178 ? 137.237 19.066  33.494  1.00 31.86  ? 175 GLU C CD  1 
ATOM   8796  O OE1 . GLU C  1 178 ? 136.945 19.451  32.344  1.00 31.48  ? 175 GLU C OE1 1 
ATOM   8797  O OE2 . GLU C  1 178 ? 136.930 19.728  34.507  1.00 33.91  ? 175 GLU C OE2 1 
ATOM   8798  N N   . ARG C  1 179 ? 137.585 15.317  30.864  1.00 26.83  ? 176 ARG C N   1 
ATOM   8799  C CA  . ARG C  1 179 ? 137.119 13.941  30.824  1.00 27.38  ? 176 ARG C CA  1 
ATOM   8800  C C   . ARG C  1 179 ? 137.597 13.172  29.604  1.00 25.18  ? 176 ARG C C   1 
ATOM   8801  O O   . ARG C  1 179 ? 137.489 11.933  29.586  1.00 24.27  ? 176 ARG C O   1 
ATOM   8802  C CB  . ARG C  1 179 ? 135.582 13.902  30.926  1.00 30.56  ? 176 ARG C CB  1 
ATOM   8803  C CG  . ARG C  1 179 ? 135.080 14.202  32.342  1.00 34.80  ? 176 ARG C CG  1 
ATOM   8804  C CD  . ARG C  1 179 ? 133.578 14.447  32.412  1.00 39.14  ? 176 ARG C CD  1 
ATOM   8805  N NE  . ARG C  1 179 ? 133.191 15.364  33.499  1.00 43.66  ? 176 ARG C NE  1 
ATOM   8806  C CZ  . ARG C  1 179 ? 132.045 16.071  33.549  1.00 47.54  ? 176 ARG C CZ  1 
ATOM   8807  N NH1 . ARG C  1 179 ? 131.827 16.881  34.580  1.00 49.13  ? 176 ARG C NH1 1 
ATOM   8808  N NH2 . ARG C  1 179 ? 131.108 15.999  32.588  1.00 45.45  ? 176 ARG C NH2 1 
ATOM   8809  N N   . ASP C  1 180 ? 138.103 13.891  28.593  1.00 23.29  ? 177 ASP C N   1 
ATOM   8810  C CA  . ASP C  1 180 ? 138.675 13.270  27.385  1.00 22.19  ? 177 ASP C CA  1 
ATOM   8811  C C   . ASP C  1 180 ? 139.599 14.206  26.622  1.00 22.54  ? 177 ASP C C   1 
ATOM   8812  O O   . ASP C  1 180 ? 139.256 14.661  25.519  1.00 25.55  ? 177 ASP C O   1 
ATOM   8813  C CB  . ASP C  1 180 ? 137.585 12.724  26.446  1.00 21.30  ? 177 ASP C CB  1 
ATOM   8814  C CG  . ASP C  1 180 ? 136.499 13.753  26.100  1.00 21.21  ? 177 ASP C CG  1 
ATOM   8815  O OD1 . ASP C  1 180 ? 136.671 14.979  26.297  1.00 20.25  ? 177 ASP C OD1 1 
ATOM   8816  O OD2 . ASP C  1 180 ? 135.438 13.306  25.623  1.00 20.94  ? 177 ASP C OD2 1 
ATOM   8817  N N   . PRO C  1 181 ? 140.791 14.481  27.177  1.00 21.36  ? 178 PRO C N   1 
ATOM   8818  C CA  . PRO C  1 181 ? 141.694 15.482  26.613  1.00 20.85  ? 178 PRO C CA  1 
ATOM   8819  C C   . PRO C  1 181 ? 142.690 14.987  25.557  1.00 20.23  ? 178 PRO C C   1 
ATOM   8820  O O   . PRO C  1 181 ? 143.298 15.828  24.905  1.00 21.87  ? 178 PRO C O   1 
ATOM   8821  C CB  . PRO C  1 181 ? 142.475 15.955  27.844  1.00 21.45  ? 178 PRO C CB  1 
ATOM   8822  C CG  . PRO C  1 181 ? 142.583 14.734  28.681  1.00 21.66  ? 178 PRO C CG  1 
ATOM   8823  C CD  . PRO C  1 181 ? 141.355 13.893  28.400  1.00 21.67  ? 178 PRO C CD  1 
ATOM   8824  N N   . SER C  1 182 ? 142.892 13.675  25.405  1.00 18.42  ? 179 SER C N   1 
ATOM   8825  C CA  . SER C  1 182 ? 143.957 13.155  24.533  1.00 17.05  ? 179 SER C CA  1 
ATOM   8826  C C   . SER C  1 182 ? 143.682 13.432  23.066  1.00 15.81  ? 179 SER C C   1 
ATOM   8827  O O   . SER C  1 182 ? 144.588 13.807  22.326  1.00 15.12  ? 179 SER C O   1 
ATOM   8828  C CB  . SER C  1 182 ? 144.176 11.650  24.737  1.00 17.16  ? 179 SER C CB  1 
ATOM   8829  O OG  . SER C  1 182 ? 144.706 11.370  26.023  1.00 17.77  ? 179 SER C OG  1 
ATOM   8830  N N   . SER C  1 183 ? 142.435 13.231  22.654  1.00 15.13  ? 180 SER C N   1 
ATOM   8831  C CA  . SER C  1 183 ? 142.031 13.415  21.256  1.00 14.47  ? 180 SER C CA  1 
ATOM   8832  C C   . SER C  1 183 ? 142.133 14.866  20.880  1.00 14.27  ? 180 SER C C   1 
ATOM   8833  O O   . SER C  1 183 ? 142.598 15.191  19.800  1.00 14.80  ? 180 SER C O   1 
ATOM   8834  C CB  . SER C  1 183 ? 140.598 12.958  21.031  1.00 14.48  ? 180 SER C CB  1 
ATOM   8835  O OG  . SER C  1 183 ? 139.708 13.582  21.935  1.00 14.62  ? 180 SER C OG  1 
ATOM   8836  N N   . THR C  1 184 ? 141.706 15.736  21.783  1.00 13.76  ? 181 THR C N   1 
ATOM   8837  C CA  . THR C  1 184 ? 141.876 17.155  21.604  1.00 13.70  ? 181 THR C CA  1 
ATOM   8838  C C   . THR C  1 184 ? 143.342 17.552  21.454  1.00 14.22  ? 181 THR C C   1 
ATOM   8839  O O   . THR C  1 184 ? 143.699 18.194  20.485  1.00 14.53  ? 181 THR C O   1 
ATOM   8840  C CB  . THR C  1 184 ? 141.200 17.934  22.738  1.00 13.71  ? 181 THR C CB  1 
ATOM   8841  O OG1 . THR C  1 184 ? 139.780 17.764  22.658  1.00 13.96  ? 181 THR C OG1 1 
ATOM   8842  C CG2 . THR C  1 184 ? 141.499 19.396  22.643  1.00 13.74  ? 181 THR C CG2 1 
ATOM   8843  N N   . LEU C  1 185 ? 144.198 17.163  22.392  1.00 15.21  ? 182 LEU C N   1 
ATOM   8844  C CA  . LEU C  1 185 ? 145.630 17.515  22.328  1.00 15.35  ? 182 LEU C CA  1 
ATOM   8845  C C   . LEU C  1 185 ? 146.287 16.953  21.079  1.00 15.88  ? 182 LEU C C   1 
ATOM   8846  O O   . LEU C  1 185 ? 147.131 17.597  20.502  1.00 15.72  ? 182 LEU C O   1 
ATOM   8847  C CB  . LEU C  1 185 ? 146.369 17.024  23.571  1.00 15.10  ? 182 LEU C CB  1 
ATOM   8848  C CG  . LEU C  1 185 ? 147.848 17.368  23.754  1.00 14.86  ? 182 LEU C CG  1 
ATOM   8849  C CD1 . LEU C  1 185 ? 148.051 18.855  23.876  1.00 14.80  ? 182 LEU C CD1 1 
ATOM   8850  C CD2 . LEU C  1 185 ? 148.368 16.674  24.998  1.00 14.82  ? 182 LEU C CD2 1 
ATOM   8851  N N   . TYR C  1 186 ? 145.875 15.761  20.658  1.00 17.19  ? 183 TYR C N   1 
ATOM   8852  C CA  . TYR C  1 186 ? 146.451 15.107  19.479  1.00 18.08  ? 183 TYR C CA  1 
ATOM   8853  C C   . TYR C  1 186 ? 146.275 15.986  18.240  1.00 19.34  ? 183 TYR C C   1 
ATOM   8854  O O   . TYR C  1 186 ? 147.224 16.163  17.464  1.00 21.03  ? 183 TYR C O   1 
ATOM   8855  C CB  . TYR C  1 186 ? 145.824 13.716  19.248  1.00 17.68  ? 183 TYR C CB  1 
ATOM   8856  C CG  . TYR C  1 186 ? 146.507 12.923  18.159  1.00 17.40  ? 183 TYR C CG  1 
ATOM   8857  C CD1 . TYR C  1 186 ? 146.051 12.972  16.848  1.00 17.30  ? 183 TYR C CD1 1 
ATOM   8858  C CD2 . TYR C  1 186 ? 147.627 12.143  18.437  1.00 17.24  ? 183 TYR C CD2 1 
ATOM   8859  C CE1 . TYR C  1 186 ? 146.686 12.269  15.849  1.00 17.38  ? 183 TYR C CE1 1 
ATOM   8860  C CE2 . TYR C  1 186 ? 148.270 11.438  17.444  1.00 17.14  ? 183 TYR C CE2 1 
ATOM   8861  C CZ  . TYR C  1 186 ? 147.798 11.508  16.154  1.00 17.57  ? 183 TYR C CZ  1 
ATOM   8862  O OH  . TYR C  1 186 ? 148.429 10.820  15.159  1.00 17.85  ? 183 TYR C OH  1 
ATOM   8863  N N   . ILE C  1 187 ? 145.077 16.537  18.059  1.00 19.26  ? 184 ILE C N   1 
ATOM   8864  C CA  . ILE C  1 187 ? 144.827 17.366  16.886  1.00 19.58  ? 184 ILE C CA  1 
ATOM   8865  C C   . ILE C  1 187 ? 145.545 18.709  16.954  1.00 20.12  ? 184 ILE C C   1 
ATOM   8866  O O   . ILE C  1 187 ? 145.953 19.245  15.923  1.00 21.04  ? 184 ILE C O   1 
ATOM   8867  C CB  . ILE C  1 187 ? 143.329 17.578  16.566  1.00 19.41  ? 184 ILE C CB  1 
ATOM   8868  C CG1 . ILE C  1 187 ? 142.593 18.304  17.680  1.00 19.40  ? 184 ILE C CG1 1 
ATOM   8869  C CG2 . ILE C  1 187 ? 142.668 16.249  16.254  1.00 19.38  ? 184 ILE C CG2 1 
ATOM   8870  C CD1 . ILE C  1 187 ? 141.282 18.900  17.229  1.00 19.44  ? 184 ILE C CD1 1 
ATOM   8871  N N   . ALA C  1 188 ? 145.691 19.260  18.151  1.00 19.81  ? 185 ALA C N   1 
ATOM   8872  C CA  . ALA C  1 188 ? 146.399 20.519  18.312  1.00 19.72  ? 185 ALA C CA  1 
ATOM   8873  C C   . ALA C  1 188 ? 147.874 20.394  17.916  1.00 20.28  ? 185 ALA C C   1 
ATOM   8874  O O   . ALA C  1 188 ? 148.445 21.324  17.381  1.00 20.15  ? 185 ALA C O   1 
ATOM   8875  C CB  . ALA C  1 188 ? 146.277 20.992  19.740  1.00 19.60  ? 185 ALA C CB  1 
ATOM   8876  N N   . GLN C  1 189 ? 148.475 19.238  18.179  1.00 21.30  ? 186 GLN C N   1 
ATOM   8877  C CA  . GLN C  1 189 ? 149.892 18.989  17.864  1.00 22.25  ? 186 GLN C CA  1 
ATOM   8878  C C   . GLN C  1 189 ? 150.145 18.847  16.387  1.00 22.60  ? 186 GLN C C   1 
ATOM   8879  O O   . GLN C  1 189 ? 151.250 19.118  15.904  1.00 21.56  ? 186 GLN C O   1 
ATOM   8880  C CB  . GLN C  1 189 ? 150.376 17.733  18.560  1.00 22.36  ? 186 GLN C CB  1 
ATOM   8881  C CG  . GLN C  1 189 ? 150.291 17.867  20.054  1.00 23.77  ? 186 GLN C CG  1 
ATOM   8882  C CD  . GLN C  1 189 ? 150.998 16.762  20.784  1.00 25.11  ? 186 GLN C CD  1 
ATOM   8883  O OE1 . GLN C  1 189 ? 152.179 16.878  21.060  1.00 27.38  ? 186 GLN C OE1 1 
ATOM   8884  N NE2 . GLN C  1 189 ? 150.278 15.701  21.138  1.00 25.86  ? 186 GLN C NE2 1 
ATOM   8885  N N   . LEU C  1 190 ? 149.108 18.392  15.681  1.00 24.38  ? 187 LEU C N   1 
ATOM   8886  C CA  . LEU C  1 190 ? 149.155 18.214  14.223  1.00 24.67  ? 187 LEU C CA  1 
ATOM   8887  C C   . LEU C  1 190 ? 149.398 19.530  13.580  1.00 25.25  ? 187 LEU C C   1 
ATOM   8888  O O   . LEU C  1 190 ? 150.119 19.637  12.604  1.00 26.00  ? 187 LEU C O   1 
ATOM   8889  C CB  . LEU C  1 190 ? 147.847 17.671  13.677  1.00 23.43  ? 187 LEU C CB  1 
ATOM   8890  C CG  . LEU C  1 190 ? 147.628 16.176  13.870  1.00 23.51  ? 187 LEU C CG  1 
ATOM   8891  C CD1 . LEU C  1 190 ? 146.209 15.821  13.405  1.00 24.25  ? 187 LEU C CD1 1 
ATOM   8892  C CD2 . LEU C  1 190 ? 148.654 15.357  13.104  1.00 22.70  ? 187 LEU C CD2 1 
ATOM   8893  N N   . LEU C  1 191 ? 148.783 20.534  14.173  1.00 25.64  ? 188 LEU C N   1 
ATOM   8894  C CA  . LEU C  1 191 ? 148.878 21.891  13.711  1.00 25.73  ? 188 LEU C CA  1 
ATOM   8895  C C   . LEU C  1 191 ? 150.306 22.366  13.548  1.00 28.11  ? 188 LEU C C   1 
ATOM   8896  O O   . LEU C  1 191 ? 150.583 23.053  12.581  1.00 28.72  ? 188 LEU C O   1 
ATOM   8897  C CB  . LEU C  1 191 ? 148.152 22.780  14.686  1.00 24.32  ? 188 LEU C CB  1 
ATOM   8898  C CG  . LEU C  1 191 ? 147.247 23.897  14.241  1.00 23.68  ? 188 LEU C CG  1 
ATOM   8899  C CD1 . LEU C  1 191 ? 146.448 23.627  12.989  1.00 23.13  ? 188 LEU C CD1 1 
ATOM   8900  C CD2 . LEU C  1 191 ? 146.314 24.154  15.415  1.00 24.02  ? 188 LEU C CD2 1 
ATOM   8901  N N   . GLN C  1 192 ? 151.213 21.996  14.449  1.00 31.76  ? 189 GLN C N   1 
ATOM   8902  C CA  . GLN C  1 192 ? 152.610 22.454  14.317  1.00 37.70  ? 189 GLN C CA  1 
ATOM   8903  C C   . GLN C  1 192 ? 153.280 21.875  13.077  1.00 34.07  ? 189 GLN C C   1 
ATOM   8904  O O   . GLN C  1 192 ? 154.098 22.538  12.433  1.00 31.99  ? 189 GLN C O   1 
ATOM   8905  C CB  . GLN C  1 192 ? 153.448 22.163  15.572  1.00 46.79  ? 189 GLN C CB  1 
ATOM   8906  C CG  . GLN C  1 192 ? 153.610 23.365  16.515  1.00 56.17  ? 189 GLN C CG  1 
ATOM   8907  C CD  . GLN C  1 192 ? 152.312 23.786  17.240  1.00 62.85  ? 189 GLN C CD  1 
ATOM   8908  O OE1 . GLN C  1 192 ? 151.473 22.925  17.599  1.00 65.27  ? 189 GLN C OE1 1 
ATOM   8909  N NE2 . GLN C  1 192 ? 152.150 25.116  17.477  1.00 58.22  ? 189 GLN C NE2 1 
ATOM   8910  N N   . GLU C  1 193 ? 152.909 20.643  12.756  1.00 32.67  ? 190 GLU C N   1 
ATOM   8911  C CA  . GLU C  1 193 ? 153.308 20.003  11.502  1.00 33.22  ? 190 GLU C CA  1 
ATOM   8912  C C   . GLU C  1 193 ? 152.697 20.723  10.275  1.00 30.63  ? 190 GLU C C   1 
ATOM   8913  O O   . GLU C  1 193 ? 153.375 20.899  9.278   1.00 29.96  ? 190 GLU C O   1 
ATOM   8914  C CB  . GLU C  1 193 ? 152.916 18.511  11.535  1.00 34.94  ? 190 GLU C CB  1 
ATOM   8915  C CG  . GLU C  1 193 ? 153.550 17.627  10.460  1.00 35.21  ? 190 GLU C CG  1 
ATOM   8916  C CD  . GLU C  1 193 ? 153.203 16.134  10.601  1.00 36.78  ? 190 GLU C CD  1 
ATOM   8917  O OE1 . GLU C  1 193 ? 153.462 15.384  9.636   1.00 37.60  ? 190 GLU C OE1 1 
ATOM   8918  O OE2 . GLU C  1 193 ? 152.686 15.685  11.661  1.00 36.50  ? 190 GLU C OE2 1 
ATOM   8919  N N   . ALA C  1 194 ? 151.437 21.168  10.377  1.00 28.33  ? 191 ALA C N   1 
ATOM   8920  C CA  . ALA C  1 194 ? 150.743 21.942  9.312   1.00 26.04  ? 191 ALA C CA  1 
ATOM   8921  C C   . ALA C  1 194 ? 151.356 23.302  9.001   1.00 24.59  ? 191 ALA C C   1 
ATOM   8922  O O   . ALA C  1 194 ? 150.958 23.958  8.029   1.00 23.67  ? 191 ALA C O   1 
ATOM   8923  C CB  . ALA C  1 194 ? 149.272 22.137  9.654   1.00 25.78  ? 191 ALA C CB  1 
ATOM   8924  N N   . GLY C  1 195 ? 152.300 23.727  9.837   1.00 23.52  ? 192 GLY C N   1 
ATOM   8925  C CA  . GLY C  1 195 ? 153.123 24.903  9.577   1.00 22.54  ? 192 GLY C CA  1 
ATOM   8926  C C   . GLY C  1 195 ? 152.725 26.130  10.358  1.00 21.74  ? 192 GLY C C   1 
ATOM   8927  O O   . GLY C  1 195 ? 153.058 27.241  9.968   1.00 21.24  ? 192 GLY C O   1 
ATOM   8928  N N   . LEU C  1 196 ? 152.027 25.931  11.473  1.00 21.38  ? 193 LEU C N   1 
ATOM   8929  C CA  . LEU C  1 196 ? 151.536 27.037  12.292  1.00 19.52  ? 193 LEU C CA  1 
ATOM   8930  C C   . LEU C  1 196 ? 152.680 27.462  13.168  1.00 18.91  ? 193 LEU C C   1 
ATOM   8931  O O   . LEU C  1 196 ? 153.302 26.612  13.826  1.00 20.28  ? 193 LEU C O   1 
ATOM   8932  C CB  . LEU C  1 196 ? 150.348 26.609  13.147  1.00 18.75  ? 193 LEU C CB  1 
ATOM   8933  C CG  . LEU C  1 196 ? 149.562 27.734  13.823  1.00 18.99  ? 193 LEU C CG  1 
ATOM   8934  C CD1 . LEU C  1 196 ? 148.768 28.590  12.836  1.00 19.25  ? 193 LEU C CD1 1 
ATOM   8935  C CD2 . LEU C  1 196 ? 148.595 27.191  14.857  1.00 18.64  ? 193 LEU C CD2 1 
ATOM   8936  N N   . PRO C  1 197 ? 152.984 28.761  13.177  1.00 17.73  ? 194 PRO C N   1 
ATOM   8937  C CA  . PRO C  1 197 ? 154.001 29.179  14.116  1.00 17.86  ? 194 PRO C CA  1 
ATOM   8938  C C   . PRO C  1 197 ? 153.668 28.803  15.565  1.00 18.10  ? 194 PRO C C   1 
ATOM   8939  O O   . PRO C  1 197 ? 152.481 28.699  15.956  1.00 17.94  ? 194 PRO C O   1 
ATOM   8940  C CB  . PRO C  1 197 ? 154.046 30.715  13.937  1.00 17.87  ? 194 PRO C CB  1 
ATOM   8941  C CG  . PRO C  1 197 ? 153.435 30.994  12.593  1.00 17.28  ? 194 PRO C CG  1 
ATOM   8942  C CD  . PRO C  1 197 ? 152.432 29.896  12.408  1.00 17.56  ? 194 PRO C CD  1 
ATOM   8943  N N   . ASP C  1 198 ? 154.732 28.571  16.332  1.00 19.00  ? 195 ASP C N   1 
ATOM   8944  C CA  . ASP C  1 198 ? 154.653 28.373  17.798  1.00 18.65  ? 195 ASP C CA  1 
ATOM   8945  C C   . ASP C  1 198 ? 153.897 29.515  18.494  1.00 18.44  ? 195 ASP C C   1 
ATOM   8946  O O   . ASP C  1 198 ? 154.071 30.701  18.179  1.00 17.65  ? 195 ASP C O   1 
ATOM   8947  C CB  . ASP C  1 198 ? 156.056 28.243  18.405  1.00 18.64  ? 195 ASP C CB  1 
ATOM   8948  C CG  . ASP C  1 198 ? 156.790 27.038  17.915  1.00 18.94  ? 195 ASP C CG  1 
ATOM   8949  O OD1 . ASP C  1 198 ? 156.184 26.196  17.208  1.00 19.27  ? 195 ASP C OD1 1 
ATOM   8950  O OD2 . ASP C  1 198 ? 157.983 26.941  18.242  1.00 19.42  ? 195 ASP C OD2 1 
ATOM   8951  N N   . GLY C  1 199 ? 153.015 29.143  19.409  1.00 18.68  ? 196 GLY C N   1 
ATOM   8952  C CA  . GLY C  1 199 ? 152.305 30.123  20.241  1.00 19.55  ? 196 GLY C CA  1 
ATOM   8953  C C   . GLY C  1 199 ? 150.920 30.521  19.770  1.00 19.50  ? 196 GLY C C   1 
ATOM   8954  O O   . GLY C  1 199 ? 150.080 30.922  20.567  1.00 18.19  ? 196 GLY C O   1 
ATOM   8955  N N   . VAL C  1 200 ? 150.697 30.401  18.466  1.00 20.89  ? 197 VAL C N   1 
ATOM   8956  C CA  . VAL C  1 200 ? 149.439 30.791  17.834  1.00 21.41  ? 197 VAL C CA  1 
ATOM   8957  C C   . VAL C  1 200 ? 148.271 29.890  18.280  1.00 21.63  ? 197 VAL C C   1 
ATOM   8958  O O   . VAL C  1 200 ? 147.125 30.368  18.378  1.00 22.43  ? 197 VAL C O   1 
ATOM   8959  C CB  . VAL C  1 200 ? 149.576 30.787  16.280  1.00 21.90  ? 197 VAL C CB  1 
ATOM   8960  C CG1 . VAL C  1 200 ? 148.236 31.092  15.601  1.00 22.32  ? 197 VAL C CG1 1 
ATOM   8961  C CG2 . VAL C  1 200 ? 150.622 31.800  15.817  1.00 21.63  ? 197 VAL C CG2 1 
ATOM   8962  N N   . MET C  1 201 ? 148.548 28.603  18.519  1.00 20.65  ? 198 MET C N   1 
ATOM   8963  C CA  . MET C  1 201 ? 147.564 27.703  19.108  1.00 19.73  ? 198 MET C CA  1 
ATOM   8964  C C   . MET C  1 201 ? 148.128 27.116  20.359  1.00 19.22  ? 198 MET C C   1 
ATOM   8965  O O   . MET C  1 201 ? 149.167 26.515  20.320  1.00 19.98  ? 198 MET C O   1 
ATOM   8966  C CB  . MET C  1 201 ? 147.240 26.558  18.167  1.00 20.17  ? 198 MET C CB  1 
ATOM   8967  C CG  . MET C  1 201 ? 146.278 25.532  18.756  1.00 20.32  ? 198 MET C CG  1 
ATOM   8968  S SD  . MET C  1 201 ? 144.653 26.208  19.159  1.00 20.66  ? 198 MET C SD  1 
ATOM   8969  C CE  . MET C  1 201 ? 143.835 24.826  19.940  1.00 19.60  ? 198 MET C CE  1 
ATOM   8970  N N   . ASN C  1 202 ? 147.411 27.253  21.462  1.00 19.30  ? 199 ASN C N   1 
ATOM   8971  C CA  . ASN C  1 202 ? 147.789 26.619  22.741  1.00 18.58  ? 199 ASN C CA  1 
ATOM   8972  C C   . ASN C  1 202 ? 146.643 25.818  23.349  1.00 16.77  ? 199 ASN C C   1 
ATOM   8973  O O   . ASN C  1 202 ? 145.476 26.135  23.176  1.00 15.76  ? 199 ASN C O   1 
ATOM   8974  C CB  . ASN C  1 202 ? 148.259 27.662  23.734  1.00 19.72  ? 199 ASN C CB  1 
ATOM   8975  C CG  . ASN C  1 202 ? 149.254 28.632  23.127  1.00 21.09  ? 199 ASN C CG  1 
ATOM   8976  O OD1 . ASN C  1 202 ? 150.465 28.364  23.067  1.00 22.28  ? 199 ASN C OD1 1 
ATOM   8977  N ND2 . ASN C  1 202 ? 148.748 29.771  22.671  1.00 21.39  ? 199 ASN C ND2 1 
ATOM   8978  N N   . VAL C  1 203 ? 147.003 24.743  24.027  1.00 16.12  ? 200 VAL C N   1 
ATOM   8979  C CA  . VAL C  1 203 ? 146.050 23.881  24.707  1.00 15.27  ? 200 VAL C CA  1 
ATOM   8980  C C   . VAL C  1 203 ? 146.451 23.755  26.155  1.00 14.71  ? 200 VAL C C   1 
ATOM   8981  O O   . VAL C  1 203 ? 147.543 23.282  26.457  1.00 14.59  ? 200 VAL C O   1 
ATOM   8982  C CB  . VAL C  1 203 ? 146.004 22.492  24.111  1.00 14.86  ? 200 VAL C CB  1 
ATOM   8983  C CG1 . VAL C  1 203 ? 145.040 21.634  24.906  1.00 14.95  ? 200 VAL C CG1 1 
ATOM   8984  C CG2 . VAL C  1 203 ? 145.557 22.573  22.667  1.00 14.87  ? 200 VAL C CG2 1 
ATOM   8985  N N   . VAL C  1 204 ? 145.541 24.163  27.031  1.00 14.50  ? 201 VAL C N   1 
ATOM   8986  C CA  . VAL C  1 204 ? 145.777 24.181  28.466  1.00 15.09  ? 201 VAL C CA  1 
ATOM   8987  C C   . VAL C  1 204 ? 144.678 23.361  29.148  1.00 14.80  ? 201 VAL C C   1 
ATOM   8988  O O   . VAL C  1 204 ? 143.522 23.697  29.095  1.00 15.89  ? 201 VAL C O   1 
ATOM   8989  C CB  . VAL C  1 204 ? 145.919 25.648  28.982  1.00 15.28  ? 201 VAL C CB  1 
ATOM   8990  C CG1 . VAL C  1 204 ? 144.649 26.201  29.591  1.00 15.06  ? 201 VAL C CG1 1 
ATOM   8991  C CG2 . VAL C  1 204 ? 147.045 25.760  29.978  1.00 15.66  ? 201 VAL C CG2 1 
ATOM   8992  N N   . ASN C  1 205 ? 145.053 22.219  29.695  1.00 14.59  ? 202 ASN C N   1 
ATOM   8993  C CA  . ASN C  1 205 ? 144.151 21.327  30.438  1.00 14.61  ? 202 ASN C CA  1 
ATOM   8994  C C   . ASN C  1 205 ? 143.996 21.634  31.930  1.00 15.21  ? 202 ASN C C   1 
ATOM   8995  O O   . ASN C  1 205 ? 144.933 22.027  32.600  1.00 15.91  ? 202 ASN C O   1 
ATOM   8996  C CB  . ASN C  1 205 ? 144.637 19.883  30.294  1.00 14.19  ? 202 ASN C CB  1 
ATOM   8997  C CG  . ASN C  1 205 ? 144.367 19.325  28.927  1.00 13.65  ? 202 ASN C CG  1 
ATOM   8998  O OD1 . ASN C  1 205 ? 143.213 19.118  28.582  1.00 13.51  ? 202 ASN C OD1 1 
ATOM   8999  N ND2 . ASN C  1 205 ? 145.412 19.080  28.145  1.00 13.01  ? 202 ASN C ND2 1 
ATOM   9000  N N   . GLY C  1 206 ? 142.814 21.381  32.455  1.00 16.38  ? 203 GLY C N   1 
ATOM   9001  C CA  . GLY C  1 206 ? 142.472 21.758  33.816  1.00 17.75  ? 203 GLY C CA  1 
ATOM   9002  C C   . GLY C  1 206 ? 140.965 21.732  34.063  1.00 19.44  ? 203 GLY C C   1 
ATOM   9003  O O   . GLY C  1 206 ? 140.183 21.127  33.297  1.00 17.86  ? 203 GLY C O   1 
ATOM   9004  N N   . ASP C  1 207 ? 140.573 22.409  35.142  1.00 22.17  ? 204 ASP C N   1 
ATOM   9005  C CA  . ASP C  1 207 ? 139.171 22.488  35.583  1.00 23.64  ? 204 ASP C CA  1 
ATOM   9006  C C   . ASP C  1 207 ? 138.791 23.958  35.773  1.00 25.10  ? 204 ASP C C   1 
ATOM   9007  O O   . ASP C  1 207 ? 139.274 24.781  35.033  1.00 25.43  ? 204 ASP C O   1 
ATOM   9008  C CB  . ASP C  1 207 ? 138.972 21.621  36.834  1.00 23.00  ? 204 ASP C CB  1 
ATOM   9009  C CG  . ASP C  1 207 ? 139.817 22.067  38.004  1.00 23.64  ? 204 ASP C CG  1 
ATOM   9010  O OD1 . ASP C  1 207 ? 140.491 23.130  37.936  1.00 24.97  ? 204 ASP C OD1 1 
ATOM   9011  O OD2 . ASP C  1 207 ? 139.805 21.334  39.008  1.00 23.32  ? 204 ASP C OD2 1 
ATOM   9012  N N   . LYS C  1 208 ? 137.957 24.293  36.753  1.00 29.66  ? 205 LYS C N   1 
ATOM   9013  C CA  . LYS C  1 208 ? 137.479 25.662  36.935  1.00 34.04  ? 205 LYS C CA  1 
ATOM   9014  C C   . LYS C  1 208 ? 138.628 26.661  37.063  1.00 33.13  ? 205 LYS C C   1 
ATOM   9015  O O   . LYS C  1 208 ? 138.514 27.805  36.592  1.00 36.88  ? 205 LYS C O   1 
ATOM   9016  C CB  . LYS C  1 208 ? 136.574 25.763  38.175  1.00 40.82  ? 205 LYS C CB  1 
ATOM   9017  C CG  . LYS C  1 208 ? 135.838 27.107  38.306  1.00 48.48  ? 205 LYS C CG  1 
ATOM   9018  C CD  . LYS C  1 208 ? 135.501 27.503  39.744  1.00 52.38  ? 205 LYS C CD  1 
ATOM   9019  C CE  . LYS C  1 208 ? 134.872 28.889  39.806  1.00 53.23  ? 205 LYS C CE  1 
ATOM   9020  N NZ  . LYS C  1 208 ? 133.577 28.953  39.067  1.00 57.72  ? 205 LYS C NZ  1 
ATOM   9021  N N   . GLU C  1 209 ? 139.727 26.239  37.686  1.00 30.10  ? 206 GLU C N   1 
ATOM   9022  C CA  . GLU C  1 209 ? 140.825 27.155  37.960  1.00 29.35  ? 206 GLU C CA  1 
ATOM   9023  C C   . GLU C  1 209 ? 141.432 27.683  36.670  1.00 27.24  ? 206 GLU C C   1 
ATOM   9024  O O   . GLU C  1 209 ? 141.805 28.852  36.588  1.00 27.66  ? 206 GLU C O   1 
ATOM   9025  C CB  . GLU C  1 209 ? 141.893 26.516  38.851  1.00 29.15  ? 206 GLU C CB  1 
ATOM   9026  C CG  . GLU C  1 209 ? 142.852 27.564  39.407  1.00 30.64  ? 206 GLU C CG  1 
ATOM   9027  C CD  . GLU C  1 209 ? 144.138 26.989  39.984  1.00 30.22  ? 206 GLU C CD  1 
ATOM   9028  O OE1 . GLU C  1 209 ? 144.142 25.784  40.364  1.00 27.31  ? 206 GLU C OE1 1 
ATOM   9029  O OE2 . GLU C  1 209 ? 145.126 27.782  40.057  1.00 28.04  ? 206 GLU C OE2 1 
ATOM   9030  N N   . ALA C  1 210 ? 141.501 26.811  35.676  1.00 25.83  ? 207 ALA C N   1 
ATOM   9031  C CA  . ALA C  1 210 ? 142.053 27.153  34.385  1.00 26.27  ? 207 ALA C CA  1 
ATOM   9032  C C   . ALA C  1 210 ? 141.117 28.102  33.670  1.00 26.72  ? 207 ALA C C   1 
ATOM   9033  O O   . ALA C  1 210 ? 141.553 29.065  33.054  1.00 27.35  ? 207 ALA C O   1 
ATOM   9034  C CB  . ALA C  1 210 ? 142.283 25.897  33.552  1.00 26.10  ? 207 ALA C CB  1 
ATOM   9035  N N   . VAL C  1 211 ? 139.825 27.838  33.773  1.00 27.44  ? 208 VAL C N   1 
ATOM   9036  C CA  . VAL C  1 211 ? 138.817 28.661  33.117  1.00 29.29  ? 208 VAL C CA  1 
ATOM   9037  C C   . VAL C  1 211 ? 138.751 30.071  33.694  1.00 29.51  ? 208 VAL C C   1 
ATOM   9038  O O   . VAL C  1 211 ? 138.739 31.050  32.949  1.00 30.98  ? 208 VAL C O   1 
ATOM   9039  C CB  . VAL C  1 211 ? 137.432 28.029  33.252  1.00 30.28  ? 208 VAL C CB  1 
ATOM   9040  C CG1 . VAL C  1 211 ? 136.372 28.978  32.738  1.00 31.98  ? 208 VAL C CG1 1 
ATOM   9041  C CG2 . VAL C  1 211 ? 137.366 26.730  32.467  1.00 30.45  ? 208 VAL C CG2 1 
ATOM   9042  N N   . ASP C  1 212 ? 138.668 30.155  35.014  1.00 28.57  ? 209 ASP C N   1 
ATOM   9043  C CA  . ASP C  1 212 ? 138.765 31.424  35.709  1.00 29.53  ? 209 ASP C CA  1 
ATOM   9044  C C   . ASP C  1 212 ? 139.975 32.271  35.335  1.00 26.17  ? 209 ASP C C   1 
ATOM   9045  O O   . ASP C  1 212 ? 139.861 33.473  35.241  1.00 26.55  ? 209 ASP C O   1 
ATOM   9046  C CB  . ASP C  1 212 ? 138.803 31.187  37.211  1.00 34.80  ? 209 ASP C CB  1 
ATOM   9047  C CG  . ASP C  1 212 ? 137.439 30.859  37.782  1.00 39.71  ? 209 ASP C CG  1 
ATOM   9048  O OD1 . ASP C  1 212 ? 136.575 30.320  37.030  1.00 42.37  ? 209 ASP C OD1 1 
ATOM   9049  O OD2 . ASP C  1 212 ? 137.244 31.166  38.987  1.00 42.90  ? 209 ASP C OD2 1 
ATOM   9050  N N   . ALA C  1 213 ? 141.127 31.654  35.145  1.00 22.90  ? 210 ALA C N   1 
ATOM   9051  C CA  . ALA C  1 213 ? 142.321 32.396  34.802  1.00 21.38  ? 210 ALA C CA  1 
ATOM   9052  C C   . ALA C  1 213 ? 142.203 33.007  33.407  1.00 20.46  ? 210 ALA C C   1 
ATOM   9053  O O   . ALA C  1 213 ? 142.716 34.083  33.159  1.00 19.63  ? 210 ALA C O   1 
ATOM   9054  C CB  . ALA C  1 213 ? 143.537 31.485  34.886  1.00 21.72  ? 210 ALA C CB  1 
ATOM   9055  N N   . LEU C  1 214 ? 141.534 32.306  32.499  1.00 20.23  ? 211 LEU C N   1 
ATOM   9056  C CA  . LEU C  1 214 ? 141.267 32.830  31.169  1.00 20.18  ? 211 LEU C CA  1 
ATOM   9057  C C   . LEU C  1 214 ? 140.312 33.985  31.241  1.00 21.00  ? 211 LEU C C   1 
ATOM   9058  O O   . LEU C  1 214 ? 140.513 34.994  30.570  1.00 22.74  ? 211 LEU C O   1 
ATOM   9059  C CB  . LEU C  1 214 ? 140.635 31.776  30.273  1.00 19.71  ? 211 LEU C CB  1 
ATOM   9060  C CG  . LEU C  1 214 ? 141.593 30.687  29.831  1.00 19.27  ? 211 LEU C CG  1 
ATOM   9061  C CD1 . LEU C  1 214 ? 140.795 29.521  29.293  1.00 18.76  ? 211 LEU C CD1 1 
ATOM   9062  C CD2 . LEU C  1 214 ? 142.569 31.214  28.788  1.00 19.19  ? 211 LEU C CD2 1 
ATOM   9063  N N   . LEU C  1 215 ? 139.276 33.846  32.059  1.00 20.86  ? 212 LEU C N   1 
ATOM   9064  C CA  . LEU C  1 215 ? 138.272 34.894  32.193  1.00 21.48  ? 212 LEU C CA  1 
ATOM   9065  C C   . LEU C  1 215 ? 138.732 36.192  32.865  1.00 22.30  ? 212 LEU C C   1 
ATOM   9066  O O   . LEU C  1 215 ? 138.079 37.236  32.679  1.00 23.63  ? 212 LEU C O   1 
ATOM   9067  C CB  . LEU C  1 215 ? 137.041 34.347  32.919  1.00 21.49  ? 212 LEU C CB  1 
ATOM   9068  C CG  . LEU C  1 215 ? 136.283 33.234  32.178  1.00 21.27  ? 212 LEU C CG  1 
ATOM   9069  C CD1 . LEU C  1 215 ? 135.117 32.754  33.004  1.00 20.97  ? 212 LEU C CD1 1 
ATOM   9070  C CD2 . LEU C  1 215 ? 135.776 33.699  30.830  1.00 21.28  ? 212 LEU C CD2 1 
ATOM   9071  N N   . HIS C  1 216 ? 139.827 36.139  33.625  1.00 22.49  ? 213 HIS C N   1 
ATOM   9072  C CA  . HIS C  1 216 ? 140.322 37.300  34.358  1.00 23.23  ? 213 HIS C CA  1 
ATOM   9073  C C   . HIS C  1 216 ? 141.671 37.824  33.910  1.00 25.12  ? 213 HIS C C   1 
ATOM   9074  O O   . HIS C  1 216 ? 142.278 38.689  34.570  1.00 29.07  ? 213 HIS C O   1 
ATOM   9075  C CB  . HIS C  1 216 ? 140.355 36.974  35.830  1.00 22.74  ? 213 HIS C CB  1 
ATOM   9076  C CG  . HIS C  1 216 ? 138.997 36.832  36.428  1.00 21.91  ? 213 HIS C CG  1 
ATOM   9077  N ND1 . HIS C  1 216 ? 138.366 35.614  36.552  1.00 21.04  ? 213 HIS C ND1 1 
ATOM   9078  C CD2 . HIS C  1 216 ? 138.146 37.756  36.933  1.00 21.60  ? 213 HIS C CD2 1 
ATOM   9079  C CE1 . HIS C  1 216 ? 137.188 35.791  37.119  1.00 21.11  ? 213 HIS C CE1 1 
ATOM   9080  N NE2 . HIS C  1 216 ? 137.029 37.081  37.355  1.00 21.61  ? 213 HIS C NE2 1 
ATOM   9081  N N   . ASP C  1 217 ? 142.139 37.340  32.775  1.00 25.79  ? 214 ASP C N   1 
ATOM   9082  C CA  . ASP C  1 217 ? 143.334 37.906  32.178  1.00 25.61  ? 214 ASP C CA  1 
ATOM   9083  C C   . ASP C  1 217 ? 142.927 38.971  31.152  1.00 26.93  ? 214 ASP C C   1 
ATOM   9084  O O   . ASP C  1 217 ? 142.122 38.703  30.259  1.00 28.30  ? 214 ASP C O   1 
ATOM   9085  C CB  . ASP C  1 217 ? 144.170 36.808  31.555  1.00 23.72  ? 214 ASP C CB  1 
ATOM   9086  C CG  . ASP C  1 217 ? 145.529 37.261  31.248  1.00 23.02  ? 214 ASP C CG  1 
ATOM   9087  O OD1 . ASP C  1 217 ? 145.679 38.100  30.336  1.00 22.36  ? 214 ASP C OD1 1 
ATOM   9088  O OD2 . ASP C  1 217 ? 146.445 36.781  31.929  1.00 23.84  ? 214 ASP C OD2 1 
ATOM   9089  N N   . ASP C  1 218 ? 143.500 40.167  31.282  1.00 27.59  ? 215 ASP C N   1 
ATOM   9090  C CA  . ASP C  1 218 ? 143.142 41.301  30.444  1.00 27.82  ? 215 ASP C CA  1 
ATOM   9091  C C   . ASP C  1 218 ? 143.544 41.118  29.003  1.00 26.40  ? 215 ASP C C   1 
ATOM   9092  O O   . ASP C  1 218 ? 142.957 41.752  28.119  1.00 26.90  ? 215 ASP C O   1 
ATOM   9093  C CB  . ASP C  1 218 ? 143.788 42.577  30.950  1.00 31.33  ? 215 ASP C CB  1 
ATOM   9094  C CG  . ASP C  1 218 ? 143.239 43.030  32.286  1.00 36.31  ? 215 ASP C CG  1 
ATOM   9095  O OD1 . ASP C  1 218 ? 142.267 42.431  32.821  1.00 43.40  ? 215 ASP C OD1 1 
ATOM   9096  O OD2 . ASP C  1 218 ? 143.807 44.007  32.814  1.00 40.87  ? 215 ASP C OD2 1 
ATOM   9097  N N   . ARG C  1 219 ? 144.536 40.269  28.754  1.00 24.34  ? 216 ARG C N   1 
ATOM   9098  C CA  . ARG C  1 219 ? 144.976 40.010  27.379  1.00 22.24  ? 216 ARG C CA  1 
ATOM   9099  C C   . ARG C  1 219 ? 143.971 39.145  26.581  1.00 20.75  ? 216 ARG C C   1 
ATOM   9100  O O   . ARG C  1 219 ? 144.012 39.089  25.350  1.00 20.35  ? 216 ARG C O   1 
ATOM   9101  C CB  . ARG C  1 219 ? 146.359 39.379  27.389  1.00 21.64  ? 216 ARG C CB  1 
ATOM   9102  C CG  . ARG C  1 219 ? 147.418 40.262  28.008  1.00 21.42  ? 216 ARG C CG  1 
ATOM   9103  C CD  . ARG C  1 219 ? 148.707 39.496  28.274  1.00 21.34  ? 216 ARG C CD  1 
ATOM   9104  N NE  . ARG C  1 219 ? 148.553 38.544  29.357  1.00 20.97  ? 216 ARG C NE  1 
ATOM   9105  C CZ  . ARG C  1 219 ? 149.468 37.655  29.704  1.00 21.42  ? 216 ARG C CZ  1 
ATOM   9106  N NH1 . ARG C  1 219 ? 150.625 37.584  29.062  1.00 21.63  ? 216 ARG C NH1 1 
ATOM   9107  N NH2 . ARG C  1 219 ? 149.214 36.812  30.693  1.00 22.21  ? 216 ARG C NH2 1 
ATOM   9108  N N   . VAL C  1 220 ? 143.073 38.465  27.277  1.00 19.94  ? 217 VAL C N   1 
ATOM   9109  C CA  . VAL C  1 220 ? 142.068 37.630  26.606  1.00 20.05  ? 217 VAL C CA  1 
ATOM   9110  C C   . VAL C  1 220 ? 140.863 38.478  26.145  1.00 19.19  ? 217 VAL C C   1 
ATOM   9111  O O   . VAL C  1 220 ? 140.024 38.914  26.953  1.00 17.58  ? 217 VAL C O   1 
ATOM   9112  C CB  . VAL C  1 220 ? 141.637 36.443  27.512  1.00 19.81  ? 217 VAL C CB  1 
ATOM   9113  C CG1 . VAL C  1 220 ? 140.436 35.685  26.946  1.00 19.40  ? 217 VAL C CG1 1 
ATOM   9114  C CG2 . VAL C  1 220 ? 142.814 35.502  27.705  1.00 19.71  ? 217 VAL C CG2 1 
ATOM   9115  N N   . LYS C  1 221 ? 140.772 38.670  24.836  1.00 18.80  ? 218 LYS C N   1 
ATOM   9116  C CA  . LYS C  1 221 ? 139.827 39.619  24.280  1.00 19.19  ? 218 LYS C CA  1 
ATOM   9117  C C   . LYS C  1 221 ? 138.474 39.009  23.942  1.00 17.59  ? 218 LYS C C   1 
ATOM   9118  O O   . LYS C  1 221 ? 137.504 39.725  23.755  1.00 17.23  ? 218 LYS C O   1 
ATOM   9119  C CB  . LYS C  1 221 ? 140.427 40.296  23.047  1.00 20.96  ? 218 LYS C CB  1 
ATOM   9120  C CG  . LYS C  1 221 ? 141.109 41.602  23.362  1.00 22.99  ? 218 LYS C CG  1 
ATOM   9121  C CD  . LYS C  1 221 ? 142.382 41.414  24.157  1.00 25.17  ? 218 LYS C CD  1 
ATOM   9122  C CE  . LYS C  1 221 ? 142.645 42.612  25.069  1.00 27.77  ? 218 LYS C CE  1 
ATOM   9123  N NZ  . LYS C  1 221 ? 142.640 43.911  24.323  1.00 29.05  ? 218 LYS C NZ  1 
ATOM   9124  N N   . ALA C  1 222 ? 138.398 37.696  23.842  1.00 15.87  ? 219 ALA C N   1 
ATOM   9125  C CA  . ALA C  1 222 ? 137.140 37.075  23.518  1.00 14.64  ? 219 ALA C CA  1 
ATOM   9126  C C   . ALA C  1 222 ? 137.097 35.673  24.053  1.00 14.18  ? 219 ALA C C   1 
ATOM   9127  O O   . ALA C  1 222 ? 138.109 34.967  24.058  1.00 14.36  ? 219 ALA C O   1 
ATOM   9128  C CB  . ALA C  1 222 ? 136.950 37.076  22.020  1.00 14.65  ? 219 ALA C CB  1 
ATOM   9129  N N   . VAL C  1 223 ? 135.919 35.264  24.504  1.00 13.83  ? 220 VAL C N   1 
ATOM   9130  C CA  . VAL C  1 223 ? 135.752 33.951  25.118  1.00 13.65  ? 220 VAL C CA  1 
ATOM   9131  C C   . VAL C  1 223 ? 134.662 33.208  24.417  1.00 13.38  ? 220 VAL C C   1 
ATOM   9132  O O   . VAL C  1 223 ? 133.542 33.666  24.418  1.00 13.32  ? 220 VAL C O   1 
ATOM   9133  C CB  . VAL C  1 223 ? 135.387 34.084  26.598  1.00 13.60  ? 220 VAL C CB  1 
ATOM   9134  C CG1 . VAL C  1 223 ? 135.112 32.733  27.226  1.00 13.83  ? 220 VAL C CG1 1 
ATOM   9135  C CG2 . VAL C  1 223 ? 136.537 34.725  27.337  1.00 13.80  ? 220 VAL C CG2 1 
ATOM   9136  N N   . SER C  1 224 ? 134.993 32.070  23.820  1.00 13.49  ? 221 SER C N   1 
ATOM   9137  C CA  . SER C  1 224 ? 133.991 31.200  23.215  1.00 13.57  ? 221 SER C CA  1 
ATOM   9138  C C   . SER C  1 224 ? 133.771 30.019  24.159  1.00 13.96  ? 221 SER C C   1 
ATOM   9139  O O   . SER C  1 224 ? 134.746 29.367  24.570  1.00 13.63  ? 221 SER C O   1 
ATOM   9140  C CB  . SER C  1 224 ? 134.456 30.716  21.841  1.00 13.51  ? 221 SER C CB  1 
ATOM   9141  O OG  . SER C  1 224 ? 134.519 31.788  20.914  1.00 13.57  ? 221 SER C OG  1 
ATOM   9142  N N   . PHE C  1 225 ? 132.505 29.790  24.531  1.00 14.21  ? 222 PHE C N   1 
ATOM   9143  C CA  . PHE C  1 225 ? 132.115 28.663  25.390  1.00 14.59  ? 222 PHE C CA  1 
ATOM   9144  C C   . PHE C  1 225 ? 130.978 27.803  24.845  1.00 15.09  ? 222 PHE C C   1 
ATOM   9145  O O   . PHE C  1 225 ? 129.932 28.304  24.424  1.00 14.43  ? 222 PHE C O   1 
ATOM   9146  C CB  . PHE C  1 225 ? 131.665 29.128  26.768  1.00 14.59  ? 222 PHE C CB  1 
ATOM   9147  C CG  . PHE C  1 225 ? 131.212 27.994  27.664  1.00 14.39  ? 222 PHE C CG  1 
ATOM   9148  C CD1 . PHE C  1 225 ? 132.137 27.224  28.330  1.00 14.56  ? 222 PHE C CD1 1 
ATOM   9149  C CD2 . PHE C  1 225 ? 129.861 27.673  27.803  1.00 14.38  ? 222 PHE C CD2 1 
ATOM   9150  C CE1 . PHE C  1 225 ? 131.731 26.166  29.141  1.00 14.63  ? 222 PHE C CE1 1 
ATOM   9151  C CE2 . PHE C  1 225 ? 129.443 26.624  28.607  1.00 14.00  ? 222 PHE C CE2 1 
ATOM   9152  C CZ  . PHE C  1 225 ? 130.380 25.870  29.279  1.00 14.41  ? 222 PHE C CZ  1 
ATOM   9153  N N   . VAL C  1 226 ? 131.169 26.492  24.952  1.00 15.81  ? 223 VAL C N   1 
ATOM   9154  C CA  . VAL C  1 226 ? 130.137 25.524  24.605  1.00 16.68  ? 223 VAL C CA  1 
ATOM   9155  C C   . VAL C  1 226 ? 130.031 24.456  25.702  1.00 16.94  ? 223 VAL C C   1 
ATOM   9156  O O   . VAL C  1 226 ? 130.929 23.665  25.881  1.00 18.14  ? 223 VAL C O   1 
ATOM   9157  C CB  . VAL C  1 226 ? 130.455 24.833  23.262  1.00 17.26  ? 223 VAL C CB  1 
ATOM   9158  C CG1 . VAL C  1 226 ? 129.450 23.727  22.984  1.00 17.68  ? 223 VAL C CG1 1 
ATOM   9159  C CG2 . VAL C  1 226 ? 130.469 25.828  22.105  1.00 17.16  ? 223 VAL C CG2 1 
ATOM   9160  N N   . GLY C  1 227 ? 128.936 24.432  26.435  1.00 17.23  ? 224 GLY C N   1 
ATOM   9161  C CA  . GLY C  1 227 ? 128.722 23.400  27.445  1.00 17.95  ? 224 GLY C CA  1 
ATOM   9162  C C   . GLY C  1 227 ? 127.309 23.468  28.000  1.00 19.14  ? 224 GLY C C   1 
ATOM   9163  O O   . GLY C  1 227 ? 126.364 23.717  27.260  1.00 20.72  ? 224 GLY C O   1 
ATOM   9164  N N   . SER C  1 228 ? 127.146 23.272  29.301  1.00 20.05  ? 225 SER C N   1 
ATOM   9165  C CA  . SER C  1 228 ? 125.818 23.334  29.916  1.00 20.58  ? 225 SER C CA  1 
ATOM   9166  C C   . SER C  1 228 ? 125.424 24.772  30.201  1.00 20.69  ? 225 SER C C   1 
ATOM   9167  O O   . SER C  1 228 ? 126.270 25.668  30.242  1.00 20.20  ? 225 SER C O   1 
ATOM   9168  C CB  . SER C  1 228 ? 125.740 22.494  31.192  1.00 20.81  ? 225 SER C CB  1 
ATOM   9169  O OG  . SER C  1 228 ? 126.390 23.129  32.274  1.00 22.35  ? 225 SER C OG  1 
ATOM   9170  N N   . THR C  1 229 ? 124.122 24.970  30.408  1.00 21.14  ? 226 THR C N   1 
ATOM   9171  C CA  . THR C  1 229 ? 123.539 26.315  30.559  1.00 20.51  ? 226 THR C CA  1 
ATOM   9172  C C   . THR C  1 229 ? 123.982 26.981  31.871  1.00 19.84  ? 226 THR C C   1 
ATOM   9173  O O   . THR C  1 229 ? 124.384 28.152  31.880  1.00 19.04  ? 226 THR C O   1 
ATOM   9174  C CB  . THR C  1 229 ? 121.989 26.303  30.417  1.00 19.90  ? 226 THR C CB  1 
ATOM   9175  O OG1 . THR C  1 229 ? 121.619 25.893  29.099  1.00 19.29  ? 226 THR C OG1 1 
ATOM   9176  C CG2 . THR C  1 229 ? 121.401 27.690  30.625  1.00 20.20  ? 226 THR C CG2 1 
ATOM   9177  N N   . PRO C  1 230 ? 123.912 26.238  32.980  1.00 20.06  ? 227 PRO C N   1 
ATOM   9178  C CA  . PRO C  1 230 ? 124.371 26.824  34.225  1.00 20.26  ? 227 PRO C CA  1 
ATOM   9179  C C   . PRO C  1 230 ? 125.792 27.385  34.130  1.00 20.28  ? 227 PRO C C   1 
ATOM   9180  O O   . PRO C  1 230 ? 126.043 28.500  34.639  1.00 19.86  ? 227 PRO C O   1 
ATOM   9181  C CB  . PRO C  1 230 ? 124.296 25.649  35.214  1.00 20.25  ? 227 PRO C CB  1 
ATOM   9182  C CG  . PRO C  1 230 ? 123.230 24.767  34.661  1.00 20.20  ? 227 PRO C CG  1 
ATOM   9183  C CD  . PRO C  1 230 ? 123.440 24.855  33.177  1.00 20.49  ? 227 PRO C CD  1 
ATOM   9184  N N   . ILE C  1 231 ? 126.683 26.650  33.452  1.00 19.78  ? 228 ILE C N   1 
ATOM   9185  C CA  . ILE C  1 231 ? 128.062 27.110  33.248  1.00 19.97  ? 228 ILE C CA  1 
ATOM   9186  C C   . ILE C  1 231 ? 128.111 28.195  32.183  1.00 19.74  ? 228 ILE C C   1 
ATOM   9187  O O   . ILE C  1 231 ? 128.720 29.236  32.380  1.00 20.13  ? 228 ILE C O   1 
ATOM   9188  C CB  . ILE C  1 231 ? 129.013 25.968  32.856  1.00 20.31  ? 228 ILE C CB  1 
ATOM   9189  C CG1 . ILE C  1 231 ? 128.836 24.774  33.804  1.00 20.15  ? 228 ILE C CG1 1 
ATOM   9190  C CG2 . ILE C  1 231 ? 130.465 26.466  32.865  1.00 20.30  ? 228 ILE C CG2 1 
ATOM   9191  C CD1 . ILE C  1 231 ? 128.930 25.149  35.270  1.00 20.64  ? 228 ILE C CD1 1 
ATOM   9192  N N   . ALA C  1 232 ? 127.469 27.942  31.054  1.00 20.06  ? 229 ALA C N   1 
ATOM   9193  C CA  . ALA C  1 232 ? 127.338 28.941  29.989  1.00 20.33  ? 229 ALA C CA  1 
ATOM   9194  C C   . ALA C  1 232 ? 127.005 30.327  30.539  1.00 20.50  ? 229 ALA C C   1 
ATOM   9195  O O   . ALA C  1 232 ? 127.679 31.321  30.217  1.00 19.79  ? 229 ALA C O   1 
ATOM   9196  C CB  . ALA C  1 232 ? 126.273 28.505  28.991  1.00 20.19  ? 229 ALA C CB  1 
ATOM   9197  N N   . GLU C  1 233 ? 125.976 30.357  31.383  1.00 21.05  ? 230 GLU C N   1 
ATOM   9198  C CA  . GLU C  1 233 ? 125.537 31.572  32.050  1.00 22.27  ? 230 GLU C CA  1 
ATOM   9199  C C   . GLU C  1 233 ? 126.637 32.199  32.909  1.00 20.73  ? 230 GLU C C   1 
ATOM   9200  O O   . GLU C  1 233 ? 126.818 33.398  32.868  1.00 18.77  ? 230 GLU C O   1 
ATOM   9201  C CB  . GLU C  1 233 ? 124.323 31.264  32.916  1.00 25.24  ? 230 GLU C CB  1 
ATOM   9202  C CG  . GLU C  1 233 ? 123.604 32.494  33.460  1.00 28.25  ? 230 GLU C CG  1 
ATOM   9203  C CD  . GLU C  1 233 ? 122.322 32.134  34.195  1.00 30.55  ? 230 GLU C CD  1 
ATOM   9204  O OE1 . GLU C  1 233 ? 122.171 30.952  34.595  1.00 30.67  ? 230 GLU C OE1 1 
ATOM   9205  O OE2 . GLU C  1 233 ? 121.458 33.030  34.361  1.00 32.91  ? 230 GLU C OE2 1 
ATOM   9206  N N   . TYR C  1 234 ? 127.347 31.377  33.688  1.00 20.61  ? 231 TYR C N   1 
ATOM   9207  C CA  . TYR C  1 234 ? 128.473 31.840  34.526  1.00 21.05  ? 231 TYR C CA  1 
ATOM   9208  C C   . TYR C  1 234 ? 129.571 32.444  33.663  1.00 20.63  ? 231 TYR C C   1 
ATOM   9209  O O   . TYR C  1 234 ? 130.056 33.550  33.932  1.00 19.24  ? 231 TYR C O   1 
ATOM   9210  C CB  . TYR C  1 234 ? 129.073 30.694  35.368  1.00 21.99  ? 231 TYR C CB  1 
ATOM   9211  C CG  . TYR C  1 234 ? 130.482 30.967  35.887  1.00 23.04  ? 231 TYR C CG  1 
ATOM   9212  C CD1 . TYR C  1 234 ? 130.691 31.784  37.003  1.00 24.25  ? 231 TYR C CD1 1 
ATOM   9213  C CD2 . TYR C  1 234 ? 131.605 30.420  35.253  1.00 23.72  ? 231 TYR C CD2 1 
ATOM   9214  C CE1 . TYR C  1 234 ? 131.982 32.048  37.476  1.00 25.20  ? 231 TYR C CE1 1 
ATOM   9215  C CE2 . TYR C  1 234 ? 132.898 30.669  35.718  1.00 24.43  ? 231 TYR C CE2 1 
ATOM   9216  C CZ  . TYR C  1 234 ? 133.091 31.483  36.821  1.00 24.90  ? 231 TYR C CZ  1 
ATOM   9217  O OH  . TYR C  1 234 ? 134.384 31.729  37.238  1.00 23.81  ? 231 TYR C OH  1 
ATOM   9218  N N   . ILE C  1 235 ? 129.961 31.694  32.635  1.00 19.96  ? 232 ILE C N   1 
ATOM   9219  C CA  . ILE C  1 235 ? 130.967 32.157  31.724  1.00 20.18  ? 232 ILE C CA  1 
ATOM   9220  C C   . ILE C  1 235 ? 130.527 33.486  31.078  1.00 21.03  ? 232 ILE C C   1 
ATOM   9221  O O   . ILE C  1 235 ? 131.345 34.407  30.966  1.00 20.49  ? 232 ILE C O   1 
ATOM   9222  C CB  . ILE C  1 235 ? 131.277 31.131  30.627  1.00 20.14  ? 232 ILE C CB  1 
ATOM   9223  C CG1 . ILE C  1 235 ? 131.761 29.789  31.224  1.00 20.01  ? 232 ILE C CG1 1 
ATOM   9224  C CG2 . ILE C  1 235 ? 132.319 31.710  29.658  1.00 20.02  ? 232 ILE C CG2 1 
ATOM   9225  C CD1 . ILE C  1 235 ? 133.156 29.796  31.804  1.00 19.82  ? 232 ILE C CD1 1 
ATOM   9226  N N   . TYR C  1 236 ? 129.254 33.588  30.671  1.00 21.39  ? 233 TYR C N   1 
ATOM   9227  C CA  . TYR C  1 236 ? 128.749 34.805  29.998  1.00 22.22  ? 233 TYR C CA  1 
ATOM   9228  C C   . TYR C  1 236 ? 128.651 36.053  30.896  1.00 24.74  ? 233 TYR C C   1 
ATOM   9229  O O   . TYR C  1 236 ? 129.082 37.143  30.511  1.00 26.04  ? 233 TYR C O   1 
ATOM   9230  C CB  . TYR C  1 236 ? 127.390 34.550  29.349  1.00 21.46  ? 233 TYR C CB  1 
ATOM   9231  C CG  . TYR C  1 236 ? 126.950 35.663  28.413  1.00 20.09  ? 233 TYR C CG  1 
ATOM   9232  C CD1 . TYR C  1 236 ? 127.506 35.778  27.159  1.00 20.30  ? 233 TYR C CD1 1 
ATOM   9233  C CD2 . TYR C  1 236 ? 125.987 36.591  28.787  1.00 19.18  ? 233 TYR C CD2 1 
ATOM   9234  C CE1 . TYR C  1 236 ? 127.131 36.794  26.292  1.00 20.60  ? 233 TYR C CE1 1 
ATOM   9235  C CE2 . TYR C  1 236 ? 125.599 37.612  27.932  1.00 19.16  ? 233 TYR C CE2 1 
ATOM   9236  C CZ  . TYR C  1 236 ? 126.182 37.714  26.676  1.00 19.95  ? 233 TYR C CZ  1 
ATOM   9237  O OH  . TYR C  1 236 ? 125.865 38.707  25.763  1.00 19.06  ? 233 TYR C OH  1 
ATOM   9238  N N   . ARG C  1 237 ? 128.080 35.891  32.088  1.00 27.61  ? 234 ARG C N   1 
ATOM   9239  C CA  . ARG C  1 237 ? 128.032 36.957  33.095  1.00 27.84  ? 234 ARG C CA  1 
ATOM   9240  C C   . ARG C  1 237 ? 129.440 37.411  33.529  1.00 25.30  ? 234 ARG C C   1 
ATOM   9241  O O   . ARG C  1 237 ? 129.701 38.606  33.544  1.00 24.14  ? 234 ARG C O   1 
ATOM   9242  C CB  . ARG C  1 237 ? 127.191 36.500  34.288  1.00 32.29  ? 234 ARG C CB  1 
ATOM   9243  C CG  . ARG C  1 237 ? 127.012 37.551  35.389  1.00 42.00  ? 234 ARG C CG  1 
ATOM   9244  C CD  . ARG C  1 237 ? 126.550 36.961  36.729  1.00 49.40  ? 234 ARG C CD  1 
ATOM   9245  N NE  . ARG C  1 237 ? 125.291 36.247  36.497  1.00 59.49  ? 234 ARG C NE  1 
ATOM   9246  C CZ  . ARG C  1 237 ? 125.079 34.927  36.615  1.00 64.69  ? 234 ARG C CZ  1 
ATOM   9247  N NH1 . ARG C  1 237 ? 126.031 34.074  37.051  1.00 59.95  ? 234 ARG C NH1 1 
ATOM   9248  N NH2 . ARG C  1 237 ? 123.860 34.460  36.310  1.00 67.14  ? 234 ARG C NH2 1 
ATOM   9249  N N   . THR C  1 238 ? 130.329 36.462  33.863  1.00 24.14  ? 235 THR C N   1 
ATOM   9250  C CA  . THR C  1 238 ? 131.709 36.750  34.309  1.00 23.04  ? 235 THR C CA  1 
ATOM   9251  C C   . THR C  1 238 ? 132.525 37.464  33.236  1.00 23.26  ? 235 THR C C   1 
ATOM   9252  O O   . THR C  1 238 ? 133.180 38.469  33.523  1.00 23.63  ? 235 THR C O   1 
ATOM   9253  C CB  . THR C  1 238 ? 132.461 35.468  34.725  1.00 22.96  ? 235 THR C CB  1 
ATOM   9254  O OG1 . THR C  1 238 ? 131.755 34.813  35.783  1.00 22.61  ? 235 THR C OG1 1 
ATOM   9255  C CG2 . THR C  1 238 ? 133.878 35.772  35.222  1.00 23.31  ? 235 THR C CG2 1 
ATOM   9256  N N   . ALA C  1 239 ? 132.501 36.943  32.011  1.00 23.07  ? 236 ALA C N   1 
ATOM   9257  C CA  . ALA C  1 239 ? 133.225 37.566  30.892  1.00 21.83  ? 236 ALA C CA  1 
ATOM   9258  C C   . ALA C  1 239 ? 132.699 38.955  30.677  1.00 21.38  ? 236 ALA C C   1 
ATOM   9259  O O   . ALA C  1 239 ? 133.457 39.904  30.608  1.00 21.28  ? 236 ALA C O   1 
ATOM   9260  C CB  . ALA C  1 239 ? 133.065 36.759  29.625  1.00 21.64  ? 236 ALA C CB  1 
ATOM   9261  N N   . SER C  1 240 ? 131.387 39.079  30.625  1.00 21.28  ? 237 SER C N   1 
ATOM   9262  C CA  . SER C  1 240 ? 130.766 40.387  30.401  1.00 22.99  ? 237 SER C CA  1 
ATOM   9263  C C   . SER C  1 240 ? 131.055 41.426  31.483  1.00 24.42  ? 237 SER C C   1 
ATOM   9264  O O   . SER C  1 240 ? 131.048 42.631  31.216  1.00 24.72  ? 237 SER C O   1 
ATOM   9265  C CB  . SER C  1 240 ? 129.252 40.246  30.284  1.00 22.30  ? 237 SER C CB  1 
ATOM   9266  O OG  . SER C  1 240 ? 128.892 39.496  29.147  1.00 21.79  ? 237 SER C OG  1 
ATOM   9267  N N   . ALA C  1 241 ? 131.253 40.947  32.703  1.00 26.37  ? 238 ALA C N   1 
ATOM   9268  C CA  . ALA C  1 241 ? 131.498 41.802  33.845  1.00 27.89  ? 238 ALA C CA  1 
ATOM   9269  C C   . ALA C  1 241 ? 132.938 42.335  33.839  1.00 31.49  ? 238 ALA C C   1 
ATOM   9270  O O   . ALA C  1 241 ? 133.195 43.354  34.455  1.00 32.41  ? 238 ALA C O   1 
ATOM   9271  C CB  . ALA C  1 241 ? 131.206 41.038  35.123  1.00 26.82  ? 238 ALA C CB  1 
ATOM   9272  N N   . ASN C  1 242 ? 133.853 41.640  33.151  1.00 34.80  ? 239 ASN C N   1 
ATOM   9273  C CA  . ASN C  1 242 ? 135.242 42.076  32.959  1.00 36.21  ? 239 ASN C CA  1 
ATOM   9274  C C   . ASN C  1 242 ? 135.425 42.854  31.648  1.00 35.18  ? 239 ASN C C   1 
ATOM   9275  O O   . ASN C  1 242 ? 136.557 43.073  31.209  1.00 37.42  ? 239 ASN C O   1 
ATOM   9276  C CB  . ASN C  1 242 ? 136.195 40.855  32.984  1.00 39.37  ? 239 ASN C CB  1 
ATOM   9277  C CG  . ASN C  1 242 ? 136.536 40.409  34.400  1.00 42.20  ? 239 ASN C CG  1 
ATOM   9278  O OD1 . ASN C  1 242 ? 137.712 40.377  34.791  1.00 45.13  ? 239 ASN C OD1 1 
ATOM   9279  N ND2 . ASN C  1 242 ? 135.513 40.071  35.181  1.00 41.54  ? 239 ASN C ND2 1 
ATOM   9280  N N   . GLY C  1 243 ? 134.322 43.244  31.007  1.00 31.99  ? 240 GLY C N   1 
ATOM   9281  C CA  . GLY C  1 243 ? 134.381 43.890  29.696  1.00 30.50  ? 240 GLY C CA  1 
ATOM   9282  C C   . GLY C  1 243 ? 134.388 43.004  28.441  1.00 28.23  ? 240 GLY C C   1 
ATOM   9283  O O   . GLY C  1 243 ? 133.596 43.265  27.539  1.00 26.14  ? 240 GLY C O   1 
ATOM   9284  N N   . LYS C  1 244 ? 135.254 41.971  28.378  1.00 25.40  ? 241 LYS C N   1 
ATOM   9285  C CA  . LYS C  1 244 ? 135.453 41.165  27.141  1.00 22.64  ? 241 LYS C CA  1 
ATOM   9286  C C   . LYS C  1 244 ? 134.228 40.481  26.531  1.00 20.06  ? 241 LYS C C   1 
ATOM   9287  O O   . LYS C  1 244 ? 133.297 40.095  27.239  1.00 19.13  ? 241 LYS C O   1 
ATOM   9288  C CB  . LYS C  1 244 ? 136.544 40.131  27.313  1.00 22.88  ? 241 LYS C CB  1 
ATOM   9289  C CG  . LYS C  1 244 ? 136.211 39.020  28.274  1.00 23.38  ? 241 LYS C CG  1 
ATOM   9290  C CD  . LYS C  1 244 ? 137.481 38.357  28.808  1.00 24.66  ? 241 LYS C CD  1 
ATOM   9291  C CE  . LYS C  1 244 ? 138.307 39.308  29.696  1.00 25.24  ? 241 LYS C CE  1 
ATOM   9292  N NZ  . LYS C  1 244 ? 139.626 38.756  30.080  1.00 25.31  ? 241 LYS C NZ  1 
ATOM   9293  N N   . ARG C  1 245 ? 134.274 40.329  25.202  1.00 17.51  ? 242 ARG C N   1 
ATOM   9294  C CA  . ARG C  1 245 ? 133.175 39.765  24.425  1.00 15.80  ? 242 ARG C CA  1 
ATOM   9295  C C   . ARG C  1 245 ? 133.106 38.251  24.607  1.00 14.99  ? 242 ARG C C   1 
ATOM   9296  O O   . ARG C  1 245 ? 134.102 37.596  24.938  1.00 14.72  ? 242 ARG C O   1 
ATOM   9297  C CB  . ARG C  1 245 ? 133.277 40.144  22.944  1.00 15.40  ? 242 ARG C CB  1 
ATOM   9298  C CG  . ARG C  1 245 ? 134.461 39.563  22.200  1.00 15.26  ? 242 ARG C CG  1 
ATOM   9299  C CD  . ARG C  1 245 ? 134.302 39.673  20.697  1.00 14.83  ? 242 ARG C CD  1 
ATOM   9300  N NE  . ARG C  1 245 ? 134.355 41.036  20.190  1.00 14.32  ? 242 ARG C NE  1 
ATOM   9301  C CZ  . ARG C  1 245 ? 134.278 41.351  18.892  1.00 14.39  ? 242 ARG C CZ  1 
ATOM   9302  N NH1 . ARG C  1 245 ? 134.130 40.415  17.947  1.00 13.78  ? 242 ARG C NH1 1 
ATOM   9303  N NH2 . ARG C  1 245 ? 134.335 42.624  18.523  1.00 14.78  ? 242 ARG C NH2 1 
ATOM   9304  N N   . CYS C  1 246 ? 131.915 37.701  24.385  1.00 14.09  ? 243 CYS C N   1 
ATOM   9305  C CA  . CYS C  1 246 ? 131.643 36.314  24.744  1.00 13.06  ? 243 CYS C CA  1 
ATOM   9306  C C   . CYS C  1 246 ? 130.453 35.741  24.013  1.00 12.81  ? 243 CYS C C   1 
ATOM   9307  O O   . CYS C  1 246 ? 129.470 36.433  23.770  1.00 12.44  ? 243 CYS C O   1 
ATOM   9308  C CB  . CYS C  1 246 ? 131.384 36.227  26.243  1.00 12.49  ? 243 CYS C CB  1 
ATOM   9309  S SG  . CYS C  1 246 ? 131.070 34.572  26.838  1.00 11.45  ? 243 CYS C SG  1 
ATOM   9310  N N   . GLN C  1 247 ? 130.571 34.469  23.659  1.00 12.97  ? 244 GLN C N   1 
ATOM   9311  C CA  . GLN C  1 247 ? 129.468 33.661  23.130  1.00 13.36  ? 244 GLN C CA  1 
ATOM   9312  C C   . GLN C  1 247 ? 129.492 32.368  23.919  1.00 13.80  ? 244 GLN C C   1 
ATOM   9313  O O   . GLN C  1 247 ? 130.547 31.713  24.017  1.00 13.65  ? 244 GLN C O   1 
ATOM   9314  C CB  . GLN C  1 247 ? 129.608 33.386  21.622  1.00 13.40  ? 244 GLN C CB  1 
ATOM   9315  C CG  . GLN C  1 247 ? 130.888 32.661  21.210  1.00 13.59  ? 244 GLN C CG  1 
ATOM   9316  C CD  . GLN C  1 247 ? 131.055 32.392  19.725  1.00 14.04  ? 244 GLN C CD  1 
ATOM   9317  O OE1 . GLN C  1 247 ? 132.051 31.772  19.313  1.00 14.49  ? 244 GLN C OE1 1 
ATOM   9318  N NE2 . GLN C  1 247 ? 130.102 32.833  18.903  1.00 14.51  ? 244 GLN C NE2 1 
ATOM   9319  N N   . ALA C  1 248 ? 128.351 32.022  24.518  1.00 14.36  ? 245 ALA C N   1 
ATOM   9320  C CA  . ALA C  1 248 ? 128.260 30.856  25.412  1.00 14.90  ? 245 ALA C CA  1 
ATOM   9321  C C   . ALA C  1 248 ? 127.014 30.059  25.079  1.00 14.99  ? 245 ALA C C   1 
ATOM   9322  O O   . ALA C  1 248 ? 125.896 30.546  25.223  1.00 15.22  ? 245 ALA C O   1 
ATOM   9323  C CB  . ALA C  1 248 ? 128.240 31.288  26.867  1.00 15.12  ? 245 ALA C CB  1 
ATOM   9324  N N   . LEU C  1 249 ? 127.217 28.843  24.599  1.00 14.86  ? 246 LEU C N   1 
ATOM   9325  C CA  . LEU C  1 249 ? 126.133 28.015  24.109  1.00 14.17  ? 246 LEU C CA  1 
ATOM   9326  C C   . LEU C  1 249 ? 125.832 27.021  25.205  1.00 13.85  ? 246 LEU C C   1 
ATOM   9327  O O   . LEU C  1 249 ? 126.719 26.463  25.832  1.00 12.49  ? 246 LEU C O   1 
ATOM   9328  C CB  . LEU C  1 249 ? 126.535 27.313  22.789  1.00 14.28  ? 246 LEU C CB  1 
ATOM   9329  C CG  . LEU C  1 249 ? 126.558 28.136  21.482  1.00 14.21  ? 246 LEU C CG  1 
ATOM   9330  C CD1 . LEU C  1 249 ? 127.702 29.147  21.444  1.00 14.04  ? 246 LEU C CD1 1 
ATOM   9331  C CD2 . LEU C  1 249 ? 126.631 27.225  20.266  1.00 14.16  ? 246 LEU C CD2 1 
ATOM   9332  N N   . GLY C  1 250 ? 124.553 26.801  25.418  1.00 14.90  ? 247 GLY C N   1 
ATOM   9333  C CA  . GLY C  1 250 ? 124.069 26.116  26.613  1.00 15.57  ? 247 GLY C CA  1 
ATOM   9334  C C   . GLY C  1 250 ? 123.513 24.776  26.238  1.00 16.09  ? 247 GLY C C   1 
ATOM   9335  O O   . GLY C  1 250 ? 123.883 24.208  25.213  1.00 15.99  ? 247 GLY C O   1 
ATOM   9336  N N   . GLY C  1 251 ? 122.604 24.287  27.063  1.00 16.80  ? 248 GLY C N   1 
ATOM   9337  C CA  . GLY C  1 251 ? 122.053 22.945  26.897  1.00 18.12  ? 248 GLY C CA  1 
ATOM   9338  C C   . GLY C  1 251 ? 120.815 22.945  26.062  1.00 19.08  ? 248 GLY C C   1 
ATOM   9339  O O   . GLY C  1 251 ? 120.476 23.970  25.447  1.00 20.09  ? 248 GLY C O   1 
ATOM   9340  N N   . ALA C  1 252 ? 120.118 21.811  26.067  1.00 19.53  ? 249 ALA C N   1 
ATOM   9341  C CA  . ALA C  1 252 ? 118.980 21.609  25.176  1.00 20.30  ? 249 ALA C CA  1 
ATOM   9342  C C   . ALA C  1 252 ? 117.990 20.543  25.608  1.00 20.76  ? 249 ALA C C   1 
ATOM   9343  O O   . ALA C  1 252 ? 118.298 19.700  26.418  1.00 20.35  ? 249 ALA C O   1 
ATOM   9344  C CB  . ALA C  1 252 ? 119.484 21.270  23.792  1.00 20.71  ? 249 ALA C CB  1 
ATOM   9345  N N   . LYS C  1 253 ? 116.790 20.634  25.040  1.00 21.74  ? 250 LYS C N   1 
ATOM   9346  C CA  . LYS C  1 253 ? 115.769 19.600  25.068  1.00 21.76  ? 250 LYS C CA  1 
ATOM   9347  C C   . LYS C  1 253 ? 115.075 19.623  23.729  1.00 21.80  ? 250 LYS C C   1 
ATOM   9348  O O   . LYS C  1 253 ? 114.026 20.244  23.565  1.00 21.84  ? 250 LYS C O   1 
ATOM   9349  C CB  . LYS C  1 253 ? 114.752 19.832  26.195  1.00 22.28  ? 250 LYS C CB  1 
ATOM   9350  C CG  . LYS C  1 253 ? 114.767 18.773  27.292  1.00 23.17  ? 250 LYS C CG  1 
ATOM   9351  C CD  . LYS C  1 253 ? 114.018 17.501  26.899  1.00 23.73  ? 250 LYS C CD  1 
ATOM   9352  C CE  . LYS C  1 253 ? 113.979 16.441  28.010  1.00 25.29  ? 250 LYS C CE  1 
ATOM   9353  N NZ  . LYS C  1 253 ? 115.218 15.611  28.095  1.00 26.70  ? 250 LYS C NZ  1 
ATOM   9354  N N   . ASN C  1 254 ? 115.669 18.949  22.758  1.00 22.45  ? 251 ASN C N   1 
ATOM   9355  C CA  . ASN C  1 254 ? 115.137 18.997  21.390  1.00 22.63  ? 251 ASN C CA  1 
ATOM   9356  C C   . ASN C  1 254 ? 113.900 18.131  21.198  1.00 21.83  ? 251 ASN C C   1 
ATOM   9357  O O   . ASN C  1 254 ? 113.915 16.946  21.535  1.00 20.48  ? 251 ASN C O   1 
ATOM   9358  C CB  . ASN C  1 254 ? 116.219 18.589  20.391  1.00 22.89  ? 251 ASN C CB  1 
ATOM   9359  C CG  . ASN C  1 254 ? 117.290 19.646  20.199  1.00 22.57  ? 251 ASN C CG  1 
ATOM   9360  O OD1 . ASN C  1 254 ? 118.070 19.547  19.264  1.00 24.09  ? 251 ASN C OD1 1 
ATOM   9361  N ND2 . ASN C  1 254 ? 117.348 20.651  21.061  1.00 22.01  ? 251 ASN C ND2 1 
ATOM   9362  N N   . HIS C  1 255 ? 112.857 18.739  20.629  1.00 21.95  ? 252 HIS C N   1 
ATOM   9363  C CA  . HIS C  1 255 ? 111.588 18.068  20.356  1.00 22.71  ? 252 HIS C CA  1 
ATOM   9364  C C   . HIS C  1 255 ? 111.412 17.850  18.870  1.00 22.61  ? 252 HIS C C   1 
ATOM   9365  O O   . HIS C  1 255 ? 111.908 18.626  18.072  1.00 22.88  ? 252 HIS C O   1 
ATOM   9366  C CB  . HIS C  1 255 ? 110.414 18.931  20.791  1.00 24.07  ? 252 HIS C CB  1 
ATOM   9367  C CG  . HIS C  1 255 ? 110.321 19.165  22.263  1.00 24.65  ? 252 HIS C CG  1 
ATOM   9368  N ND1 . HIS C  1 255 ? 111.382 19.605  23.028  1.00 25.51  ? 252 HIS C ND1 1 
ATOM   9369  C CD2 . HIS C  1 255 ? 109.266 19.080  23.102  1.00 25.27  ? 252 HIS C CD2 1 
ATOM   9370  C CE1 . HIS C  1 255 ? 110.989 19.755  24.278  1.00 25.33  ? 252 HIS C CE1 1 
ATOM   9371  N NE2 . HIS C  1 255 ? 109.711 19.438  24.352  1.00 25.63  ? 252 HIS C NE2 1 
ATOM   9372  N N   . ALA C  1 256 ? 110.659 16.815  18.517  1.00 23.11  ? 253 ALA C N   1 
ATOM   9373  C CA  . ALA C  1 256 ? 110.248 16.547  17.135  1.00 23.07  ? 253 ALA C CA  1 
ATOM   9374  C C   . ALA C  1 256 ? 108.741 16.393  17.127  1.00 23.31  ? 253 ALA C C   1 
ATOM   9375  O O   . ALA C  1 256 ? 108.169 15.724  18.001  1.00 23.86  ? 253 ALA C O   1 
ATOM   9376  C CB  . ALA C  1 256 ? 110.877 15.269  16.609  1.00 22.94  ? 253 ALA C CB  1 
ATOM   9377  N N   . ILE C  1 257 ? 108.096 17.011  16.149  1.00 21.88  ? 254 ILE C N   1 
ATOM   9378  C CA  . ILE C  1 257 ? 106.681 16.850  15.979  1.00 20.33  ? 254 ILE C CA  1 
ATOM   9379  C C   . ILE C  1 257 ? 106.554 15.804  14.922  1.00 21.05  ? 254 ILE C C   1 
ATOM   9380  O O   . ILE C  1 257 ? 107.162 15.941  13.859  1.00 22.32  ? 254 ILE C O   1 
ATOM   9381  C CB  . ILE C  1 257 ? 106.034 18.151  15.531  1.00 19.79  ? 254 ILE C CB  1 
ATOM   9382  C CG1 . ILE C  1 257 ? 106.210 19.194  16.627  1.00 19.14  ? 254 ILE C CG1 1 
ATOM   9383  C CG2 . ILE C  1 257 ? 104.560 17.932  15.229  1.00 20.06  ? 254 ILE C CG2 1 
ATOM   9384  C CD1 . ILE C  1 257 ? 105.792 20.580  16.232  1.00 19.21  ? 254 ILE C CD1 1 
ATOM   9385  N N   . VAL C  1 258 ? 105.799 14.751  15.225  1.00 21.40  ? 255 VAL C N   1 
ATOM   9386  C CA  . VAL C  1 258 ? 105.470 13.711  14.255  1.00 21.50  ? 255 VAL C CA  1 
ATOM   9387  C C   . VAL C  1 258 ? 104.017 13.922  13.891  1.00 21.80  ? 255 VAL C C   1 
ATOM   9388  O O   . VAL C  1 258 ? 103.141 13.701  14.709  1.00 21.24  ? 255 VAL C O   1 
ATOM   9389  C CB  . VAL C  1 258 ? 105.654 12.289  14.840  1.00 21.92  ? 255 VAL C CB  1 
ATOM   9390  C CG1 . VAL C  1 258 ? 105.337 11.206  13.806  1.00 21.61  ? 255 VAL C CG1 1 
ATOM   9391  C CG2 . VAL C  1 258 ? 107.060 12.099  15.373  1.00 21.43  ? 255 VAL C CG2 1 
ATOM   9392  N N   . MET C  1 259 ? 103.783 14.368  12.669  1.00 23.38  ? 256 MET C N   1 
ATOM   9393  C CA  . MET C  1 259 ? 102.436 14.646  12.183  1.00 25.63  ? 256 MET C CA  1 
ATOM   9394  C C   . MET C  1 259 ? 101.795 13.375  11.650  1.00 26.46  ? 256 MET C C   1 
ATOM   9395  O O   . MET C  1 259 ? 102.505 12.483  11.190  1.00 27.19  ? 256 MET C O   1 
ATOM   9396  C CB  . MET C  1 259 ? 102.471 15.669  11.034  1.00 26.30  ? 256 MET C CB  1 
ATOM   9397  C CG  . MET C  1 259 ? 102.952 17.055  11.416  1.00 26.24  ? 256 MET C CG  1 
ATOM   9398  S SD  . MET C  1 259 ? 101.833 17.868  12.543  1.00 24.74  ? 256 MET C SD  1 
ATOM   9399  C CE  . MET C  1 259 ? 100.548 18.364  11.412  1.00 26.56  ? 256 MET C CE  1 
ATOM   9400  N N   . PRO C  1 260 ? 100.452 13.324  11.638  1.00 26.97  ? 257 PRO C N   1 
ATOM   9401  C CA  . PRO C  1 260 ? 99.733  12.204  11.042  1.00 27.41  ? 257 PRO C CA  1 
ATOM   9402  C C   . PRO C  1 260 ? 100.200 11.840  9.642   1.00 28.09  ? 257 PRO C C   1 
ATOM   9403  O O   . PRO C  1 260 ? 100.257 10.655  9.327   1.00 29.43  ? 257 PRO C O   1 
ATOM   9404  C CB  . PRO C  1 260 ? 98.288  12.706  10.980  1.00 26.88  ? 257 PRO C CB  1 
ATOM   9405  C CG  . PRO C  1 260 ? 98.194  13.698  12.076  1.00 27.16  ? 257 PRO C CG  1 
ATOM   9406  C CD  . PRO C  1 260 ? 99.522  14.384  12.067  1.00 27.17  ? 257 PRO C CD  1 
ATOM   9407  N N   . ASP C  1 261 ? 100.542 12.836  8.821   1.00 27.55  ? 258 ASP C N   1 
ATOM   9408  C CA  . ASP C  1 261 ? 100.946 12.575  7.411   1.00 27.72  ? 258 ASP C CA  1 
ATOM   9409  C C   . ASP C  1 261 ? 102.399 12.149  7.216   1.00 29.20  ? 258 ASP C C   1 
ATOM   9410  O O   . ASP C  1 261 ? 102.804 11.821  6.107   1.00 29.29  ? 258 ASP C O   1 
ATOM   9411  C CB  . ASP C  1 261 ? 100.662 13.781  6.508   1.00 25.83  ? 258 ASP C CB  1 
ATOM   9412  C CG  . ASP C  1 261 ? 101.482 14.980  6.856   1.00 23.46  ? 258 ASP C CG  1 
ATOM   9413  O OD1 . ASP C  1 261 ? 101.921 15.117  8.013   1.00 22.60  ? 258 ASP C OD1 1 
ATOM   9414  O OD2 . ASP C  1 261 ? 101.668 15.800  5.964   1.00 21.87  ? 258 ASP C OD2 1 
ATOM   9415  N N   . ALA C  1 262 ? 103.180 12.163  8.287   1.00 30.69  ? 259 ALA C N   1 
ATOM   9416  C CA  . ALA C  1 262 ? 104.581 11.808  8.202   1.00 31.86  ? 259 ALA C CA  1 
ATOM   9417  C C   . ALA C  1 262 ? 104.710 10.377  7.817   1.00 33.88  ? 259 ALA C C   1 
ATOM   9418  O O   . ALA C  1 262 ? 103.830 9.590   8.106   1.00 33.90  ? 259 ALA C O   1 
ATOM   9419  C CB  . ALA C  1 262 ? 105.251 12.009  9.538   1.00 31.92  ? 259 ALA C CB  1 
ATOM   9420  N N   . ASP C  1 263 ? 105.817 10.053  7.167   1.00 38.41  ? 260 ASP C N   1 
ATOM   9421  C CA  . ASP C  1 263 ? 106.210 8.666   6.955   1.00 43.77  ? 260 ASP C CA  1 
ATOM   9422  C C   . ASP C  1 263 ? 106.846 8.134   8.242   1.00 42.57  ? 260 ASP C C   1 
ATOM   9423  O O   . ASP C  1 263 ? 107.990 8.472   8.579   1.00 42.26  ? 260 ASP C O   1 
ATOM   9424  C CB  . ASP C  1 263 ? 107.183 8.567   5.778   1.00 49.96  ? 260 ASP C CB  1 
ATOM   9425  C CG  . ASP C  1 263 ? 107.500 7.123   5.383   1.00 56.08  ? 260 ASP C CG  1 
ATOM   9426  O OD1 . ASP C  1 263 ? 106.909 6.146   5.927   1.00 55.21  ? 260 ASP C OD1 1 
ATOM   9427  O OD2 . ASP C  1 263 ? 108.360 6.980   4.490   1.00 66.47  ? 260 ASP C OD2 1 
ATOM   9428  N N   . MET C  1 264 ? 106.089 7.304   8.948   1.00 41.80  ? 261 MET C N   1 
ATOM   9429  C CA  . MET C  1 264 ? 106.458 6.837   10.278  1.00 43.33  ? 261 MET C CA  1 
ATOM   9430  C C   . MET C  1 264 ? 107.714 5.945   10.263  1.00 46.62  ? 261 MET C C   1 
ATOM   9431  O O   . MET C  1 264 ? 108.523 5.988   11.193  1.00 48.56  ? 261 MET C O   1 
ATOM   9432  C CB  . MET C  1 264 ? 105.279 6.092   10.897  1.00 43.31  ? 261 MET C CB  1 
ATOM   9433  C CG  . MET C  1 264 ? 105.372 5.899   12.395  1.00 45.48  ? 261 MET C CG  1 
ATOM   9434  S SD  . MET C  1 264 ? 105.356 7.430   13.337  1.00 46.34  ? 261 MET C SD  1 
ATOM   9435  C CE  . MET C  1 264 ? 103.741 8.079   12.907  1.00 48.06  ? 261 MET C CE  1 
ATOM   9436  N N   . ASP C  1 265 ? 107.879 5.146   9.211   1.00 47.55  ? 262 ASP C N   1 
ATOM   9437  C CA  . ASP C  1 265 ? 109.061 4.300   9.089   1.00 47.42  ? 262 ASP C CA  1 
ATOM   9438  C C   . ASP C  1 265 ? 110.303 5.177   9.079   1.00 45.80  ? 262 ASP C C   1 
ATOM   9439  O O   . ASP C  1 265 ? 111.150 5.049   9.951   1.00 45.57  ? 262 ASP C O   1 
ATOM   9440  C CB  . ASP C  1 265 ? 108.982 3.400   7.838   1.00 48.36  ? 262 ASP C CB  1 
ATOM   9441  C CG  . ASP C  1 265 ? 107.976 2.247   7.992   1.00 48.77  ? 262 ASP C CG  1 
ATOM   9442  O OD1 . ASP C  1 265 ? 107.505 1.952   9.121   1.00 46.22  ? 262 ASP C OD1 1 
ATOM   9443  O OD2 . ASP C  1 265 ? 107.654 1.623   6.967   1.00 51.42  ? 262 ASP C OD2 1 
ATOM   9444  N N   . ASN C  1 266 ? 110.373 6.094   8.119   1.00 47.26  ? 263 ASN C N   1 
ATOM   9445  C CA  . ASN C  1 266 ? 111.501 7.035   7.993   1.00 47.20  ? 263 ASN C CA  1 
ATOM   9446  C C   . ASN C  1 266 ? 111.721 7.843   9.266   1.00 45.57  ? 263 ASN C C   1 
ATOM   9447  O O   . ASN C  1 266 ? 112.850 8.138   9.621   1.00 46.59  ? 263 ASN C O   1 
ATOM   9448  C CB  . ASN C  1 266 ? 111.272 8.007   6.817   1.00 48.72  ? 263 ASN C CB  1 
ATOM   9449  C CG  . ASN C  1 266 ? 112.420 8.992   6.623   1.00 47.42  ? 263 ASN C CG  1 
ATOM   9450  O OD1 . ASN C  1 266 ? 112.339 10.152  7.035   1.00 50.49  ? 263 ASN C OD1 1 
ATOM   9451  N ND2 . ASN C  1 266 ? 113.496 8.529   6.007   1.00 48.57  ? 263 ASN C ND2 1 
ATOM   9452  N N   . ALA C  1 267 ? 110.636 8.219   9.929   1.00 43.31  ? 264 ALA C N   1 
ATOM   9453  C CA  . ALA C  1 267 ? 110.726 8.984   11.154  1.00 43.13  ? 264 ALA C CA  1 
ATOM   9454  C C   . ALA C  1 267 ? 111.387 8.173   12.242  1.00 41.74  ? 264 ALA C C   1 
ATOM   9455  O O   . ALA C  1 267 ? 112.252 8.661   12.946  1.00 42.23  ? 264 ALA C O   1 
ATOM   9456  C CB  . ALA C  1 267 ? 109.346 9.406   11.606  1.00 44.85  ? 264 ALA C CB  1 
ATOM   9457  N N   . VAL C  1 268 ? 110.959 6.931   12.381  1.00 42.04  ? 265 VAL C N   1 
ATOM   9458  C CA  . VAL C  1 268 ? 111.499 6.043   13.408  1.00 42.42  ? 265 VAL C CA  1 
ATOM   9459  C C   . VAL C  1 268 ? 112.945 5.663   13.133  1.00 40.68  ? 265 VAL C C   1 
ATOM   9460  O O   . VAL C  1 268 ? 113.754 5.561   14.048  1.00 37.99  ? 265 VAL C O   1 
ATOM   9461  C CB  . VAL C  1 268 ? 110.649 4.773   13.527  1.00 42.37  ? 265 VAL C CB  1 
ATOM   9462  C CG1 . VAL C  1 268 ? 111.356 3.716   14.360  1.00 43.35  ? 265 VAL C CG1 1 
ATOM   9463  C CG2 . VAL C  1 268 ? 109.308 5.128   14.147  1.00 43.42  ? 265 VAL C CG2 1 
ATOM   9464  N N   . ASN C  1 269 ? 113.255 5.429   11.873  1.00 41.96  ? 266 ASN C N   1 
ATOM   9465  C CA  . ASN C  1 269 ? 114.617 5.104   11.497  1.00 46.93  ? 266 ASN C CA  1 
ATOM   9466  C C   . ASN C  1 269 ? 115.561 6.280   11.813  1.00 43.71  ? 266 ASN C C   1 
ATOM   9467  O O   . ASN C  1 269 ? 116.664 6.079   12.317  1.00 45.81  ? 266 ASN C O   1 
ATOM   9468  C CB  . ASN C  1 269 ? 114.691 4.680   10.012  1.00 52.08  ? 266 ASN C CB  1 
ATOM   9469  C CG  . ASN C  1 269 ? 115.999 3.946   9.653   1.00 55.78  ? 266 ASN C CG  1 
ATOM   9470  O OD1 . ASN C  1 269 ? 116.499 3.123   10.427  1.00 60.06  ? 266 ASN C OD1 1 
ATOM   9471  N ND2 . ASN C  1 269 ? 116.539 4.226   8.464   1.00 54.46  ? 266 ASN C ND2 1 
ATOM   9472  N N   . GLN C  1 270 ? 115.118 7.503   11.562  1.00 40.52  ? 267 GLN C N   1 
ATOM   9473  C CA  . GLN C  1 270 ? 115.965 8.680   11.816  1.00 38.95  ? 267 GLN C CA  1 
ATOM   9474  C C   . GLN C  1 270 ? 116.072 9.047   13.290  1.00 35.69  ? 267 GLN C C   1 
ATOM   9475  O O   . GLN C  1 270 ? 117.115 9.494   13.761  1.00 33.92  ? 267 GLN C O   1 
ATOM   9476  C CB  . GLN C  1 270 ? 115.481 9.880   11.001  1.00 39.59  ? 267 GLN C CB  1 
ATOM   9477  C CG  . GLN C  1 270 ? 115.879 9.774   9.540   1.00 40.59  ? 267 GLN C CG  1 
ATOM   9478  C CD  . GLN C  1 270 ? 115.773 11.085  8.818   1.00 41.21  ? 267 GLN C CD  1 
ATOM   9479  O OE1 . GLN C  1 270 ? 116.780 11.609  8.353   1.00 40.04  ? 267 GLN C OE1 1 
ATOM   9480  N NE2 . GLN C  1 270 ? 114.548 11.636  8.727   1.00 41.31  ? 267 GLN C NE2 1 
ATOM   9481  N N   . LEU C  1 271 ? 114.987 8.836   14.013  1.00 33.71  ? 268 LEU C N   1 
ATOM   9482  C CA  . LEU C  1 271 ? 114.961 9.068   15.448  1.00 32.20  ? 268 LEU C CA  1 
ATOM   9483  C C   . LEU C  1 271 ? 115.825 8.093   16.266  1.00 31.27  ? 268 LEU C C   1 
ATOM   9484  O O   . LEU C  1 271 ? 116.115 8.361   17.420  1.00 30.87  ? 268 LEU C O   1 
ATOM   9485  C CB  . LEU C  1 271 ? 113.517 9.022   15.953  1.00 31.71  ? 268 LEU C CB  1 
ATOM   9486  C CG  . LEU C  1 271 ? 112.620 10.215  15.631  1.00 31.23  ? 268 LEU C CG  1 
ATOM   9487  C CD1 . LEU C  1 271 ? 111.165 9.860   15.924  1.00 32.02  ? 268 LEU C CD1 1 
ATOM   9488  C CD2 . LEU C  1 271 ? 113.044 11.432  16.433  1.00 30.52  ? 268 LEU C CD2 1 
ATOM   9489  N N   . LEU C  1 272 ? 116.209 6.962   15.685  1.00 31.70  ? 269 LEU C N   1 
ATOM   9490  C CA  . LEU C  1 272 ? 117.141 6.016   16.336  1.00 31.78  ? 269 LEU C CA  1 
ATOM   9491  C C   . LEU C  1 272 ? 118.512 6.632   16.513  1.00 31.06  ? 269 LEU C C   1 
ATOM   9492  O O   . LEU C  1 272 ? 119.051 6.661   17.620  1.00 31.15  ? 269 LEU C O   1 
ATOM   9493  C CB  . LEU C  1 272 ? 117.333 4.759   15.478  1.00 32.53  ? 269 LEU C CB  1 
ATOM   9494  C CG  . LEU C  1 272 ? 116.337 3.619   15.590  1.00 31.25  ? 269 LEU C CG  1 
ATOM   9495  C CD1 . LEU C  1 272 ? 116.542 2.711   14.390  1.00 30.62  ? 269 LEU C CD1 1 
ATOM   9496  C CD2 . LEU C  1 272 ? 116.550 2.893   16.905  1.00 30.49  ? 269 LEU C CD2 1 
ATOM   9497  N N   . GLY C  1 273 ? 119.073 7.080   15.389  1.00 30.27  ? 270 GLY C N   1 
ATOM   9498  C CA  . GLY C  1 273 ? 120.333 7.801   15.366  1.00 29.06  ? 270 GLY C CA  1 
ATOM   9499  C C   . GLY C  1 273 ? 120.284 9.072   16.189  1.00 26.94  ? 270 GLY C C   1 
ATOM   9500  O O   . GLY C  1 273 ? 121.183 9.340   16.973  1.00 26.15  ? 270 GLY C O   1 
ATOM   9501  N N   . ALA C  1 274 ? 119.221 9.847   16.034  1.00 25.81  ? 271 ALA C N   1 
ATOM   9502  C CA  . ALA C  1 274 ? 119.194 11.183  16.605  1.00 25.29  ? 271 ALA C CA  1 
ATOM   9503  C C   . ALA C  1 274 ? 119.070 11.102  18.098  1.00 24.11  ? 271 ALA C C   1 
ATOM   9504  O O   . ALA C  1 274 ? 119.780 11.802  18.820  1.00 25.79  ? 271 ALA C O   1 
ATOM   9505  C CB  . ALA C  1 274 ? 118.070 12.002  16.010  1.00 26.10  ? 271 ALA C CB  1 
ATOM   9506  N N   . ALA C  1 275 ? 118.200 10.218  18.556  1.00 22.92  ? 272 ALA C N   1 
ATOM   9507  C CA  . ALA C  1 275 ? 117.959 10.057  19.986  1.00 23.28  ? 272 ALA C CA  1 
ATOM   9508  C C   . ALA C  1 275 ? 119.100 9.350   20.718  1.00 22.21  ? 272 ALA C C   1 
ATOM   9509  O O   . ALA C  1 275 ? 119.544 9.814   21.770  1.00 21.70  ? 272 ALA C O   1 
ATOM   9510  C CB  . ALA C  1 275 ? 116.636 9.326   20.228  1.00 23.11  ? 272 ALA C CB  1 
ATOM   9511  N N   . PHE C  1 276 ? 119.550 8.232   20.158  1.00 21.56  ? 273 PHE C N   1 
ATOM   9512  C CA  . PHE C  1 276 ? 120.477 7.330   20.837  1.00 21.95  ? 273 PHE C CA  1 
ATOM   9513  C C   . PHE C  1 276 ? 121.914 7.406   20.370  1.00 21.68  ? 273 PHE C C   1 
ATOM   9514  O O   . PHE C  1 276 ? 122.795 6.886   21.032  1.00 21.14  ? 273 PHE C O   1 
ATOM   9515  C CB  . PHE C  1 276 ? 119.957 5.897   20.703  1.00 21.85  ? 273 PHE C CB  1 
ATOM   9516  C CG  . PHE C  1 276 ? 118.546 5.763   21.128  1.00 20.95  ? 273 PHE C CG  1 
ATOM   9517  C CD1 . PHE C  1 276 ? 118.181 6.104   22.424  1.00 21.18  ? 273 PHE C CD1 1 
ATOM   9518  C CD2 . PHE C  1 276 ? 117.581 5.355   20.245  1.00 20.65  ? 273 PHE C CD2 1 
ATOM   9519  C CE1 . PHE C  1 276 ? 116.866 6.011   22.832  1.00 21.72  ? 273 PHE C CE1 1 
ATOM   9520  C CE2 . PHE C  1 276 ? 116.265 5.255   20.648  1.00 21.02  ? 273 PHE C CE2 1 
ATOM   9521  C CZ  . PHE C  1 276 ? 115.901 5.591   21.935  1.00 21.04  ? 273 PHE C CZ  1 
ATOM   9522  N N   . GLY C  1 277 ? 122.150 8.066   19.250  1.00 23.04  ? 274 GLY C N   1 
ATOM   9523  C CA  . GLY C  1 277 ? 123.494 8.154   18.685  1.00 24.59  ? 274 GLY C CA  1 
ATOM   9524  C C   . GLY C  1 277 ? 124.372 8.970   19.595  1.00 26.16  ? 274 GLY C C   1 
ATOM   9525  O O   . GLY C  1 277 ? 123.901 9.929   20.236  1.00 28.09  ? 274 GLY C O   1 
ATOM   9526  N N   . SER C  1 278 ? 125.637 8.577   19.673  1.00 26.35  ? 275 SER C N   1 
ATOM   9527  C CA  . SER C  1 278 ? 126.547 9.057   20.737  1.00 26.65  ? 275 SER C CA  1 
ATOM   9528  C C   . SER C  1 278 ? 125.994 8.901   22.163  1.00 26.07  ? 275 SER C C   1 
ATOM   9529  O O   . SER C  1 278 ? 126.295 9.704   23.040  1.00 29.44  ? 275 SER C O   1 
ATOM   9530  C CB  . SER C  1 278 ? 126.963 10.495  20.482  1.00 25.92  ? 275 SER C CB  1 
ATOM   9531  O OG  . SER C  1 278 ? 127.684 10.518  19.280  1.00 28.94  ? 275 SER C OG  1 
ATOM   9532  N N   . SER C  1 279 ? 125.191 7.866   22.384  1.00 24.29  ? 276 SER C N   1 
ATOM   9533  C CA  . SER C  1 279 ? 124.657 7.532   23.698  1.00 23.69  ? 276 SER C CA  1 
ATOM   9534  C C   . SER C  1 279 ? 123.742 8.637   24.228  1.00 23.37  ? 276 SER C C   1 
ATOM   9535  O O   . SER C  1 279 ? 123.539 8.780   25.427  1.00 22.54  ? 276 SER C O   1 
ATOM   9536  C CB  . SER C  1 279 ? 125.801 7.213   24.666  1.00 23.35  ? 276 SER C CB  1 
ATOM   9537  O OG  . SER C  1 279 ? 126.839 6.496   23.999  1.00 23.29  ? 276 SER C OG  1 
ATOM   9538  N N   . GLY C  1 280 ? 123.172 9.398   23.302  1.00 23.33  ? 277 GLY C N   1 
ATOM   9539  C CA  . GLY C  1 280 ? 122.315 10.528  23.629  1.00 23.53  ? 277 GLY C CA  1 
ATOM   9540  C C   . GLY C  1 280 ? 122.993 11.744  24.231  1.00 23.59  ? 277 GLY C C   1 
ATOM   9541  O O   . GLY C  1 280 ? 122.310 12.677  24.656  1.00 22.86  ? 277 GLY C O   1 
ATOM   9542  N N   . GLU C  1 281 ? 124.327 11.745  24.240  1.00 24.06  ? 278 GLU C N   1 
ATOM   9543  C CA  . GLU C  1 281 ? 125.132 12.804  24.848  1.00 25.04  ? 278 GLU C CA  1 
ATOM   9544  C C   . GLU C  1 281 ? 125.451 13.852  23.810  1.00 25.74  ? 278 GLU C C   1 
ATOM   9545  O O   . GLU C  1 281 ? 126.608 14.114  23.503  1.00 25.78  ? 278 GLU C O   1 
ATOM   9546  C CB  . GLU C  1 281 ? 126.439 12.231  25.414  1.00 25.20  ? 278 GLU C CB  1 
ATOM   9547  C CG  . GLU C  1 281 ? 126.264 11.341  26.637  1.00 24.37  ? 278 GLU C CG  1 
ATOM   9548  C CD  . GLU C  1 281 ? 127.530 10.600  26.975  1.00 24.00  ? 278 GLU C CD  1 
ATOM   9549  O OE1 . GLU C  1 281 ? 128.214 10.100  26.048  1.00 23.65  ? 278 GLU C OE1 1 
ATOM   9550  O OE2 . GLU C  1 281 ? 127.836 10.505  28.171  1.00 24.41  ? 278 GLU C OE2 1 
ATOM   9551  N N   . ARG C  1 282 ? 124.398 14.453  23.281  1.00 26.68  ? 279 ARG C N   1 
ATOM   9552  C CA  . ARG C  1 282 ? 124.493 15.406  22.204  1.00 27.54  ? 279 ARG C CA  1 
ATOM   9553  C C   . ARG C  1 282 ? 123.625 16.613  22.580  1.00 28.22  ? 279 ARG C C   1 
ATOM   9554  O O   . ARG C  1 282 ? 122.560 16.460  23.172  1.00 26.74  ? 279 ARG C O   1 
ATOM   9555  C CB  . ARG C  1 282 ? 124.057 14.725  20.897  1.00 28.82  ? 279 ARG C CB  1 
ATOM   9556  C CG  . ARG C  1 282 ? 124.718 15.266  19.635  1.00 31.52  ? 279 ARG C CG  1 
ATOM   9557  C CD  . ARG C  1 282 ? 125.167 14.144  18.713  1.00 33.96  ? 279 ARG C CD  1 
ATOM   9558  N NE  . ARG C  1 282 ? 124.076 13.273  18.270  1.00 37.14  ? 279 ARG C NE  1 
ATOM   9559  C CZ  . ARG C  1 282 ? 124.213 12.098  17.618  1.00 37.66  ? 279 ARG C CZ  1 
ATOM   9560  N NH1 . ARG C  1 282 ? 125.406 11.567  17.313  1.00 34.32  ? 279 ARG C NH1 1 
ATOM   9561  N NH2 . ARG C  1 282 ? 123.121 11.420  17.273  1.00 38.96  ? 279 ARG C NH2 1 
ATOM   9562  N N   . CYS C  1 283 ? 124.108 17.820  22.294  1.00 30.97  ? 280 CYS C N   1 
ATOM   9563  C CA  . CYS C  1 283 ? 123.287 19.047  22.399  1.00 33.20  ? 280 CYS C CA  1 
ATOM   9564  C C   . CYS C  1 283 ? 122.132 19.065  21.389  1.00 32.34  ? 280 CYS C C   1 
ATOM   9565  O O   . CYS C  1 283 ? 121.116 19.716  21.608  1.00 30.39  ? 280 CYS C O   1 
ATOM   9566  C CB  . CYS C  1 283 ? 124.144 20.229  22.088  1.00 34.23  ? 280 CYS C CB  1 
ATOM   9567  S SG  . CYS C  1 283 ? 125.060 19.892  20.563  1.00 45.99  ? 280 CYS C SG  1 
ATOM   9568  N N   . MET C  1 284 ? 122.327 18.372  20.267  1.00 31.31  ? 281 MET C N   1 
ATOM   9569  C CA  . MET C  1 284 ? 121.317 18.233  19.238  1.00 30.39  ? 281 MET C CA  1 
ATOM   9570  C C   . MET C  1 284 ? 120.584 16.890  19.299  1.00 28.55  ? 281 MET C C   1 
ATOM   9571  O O   . MET C  1 284 ? 119.908 16.489  18.336  1.00 28.53  ? 281 MET C O   1 
ATOM   9572  C CB  . MET C  1 284 ? 121.981 18.439  17.885  1.00 31.73  ? 281 MET C CB  1 
ATOM   9573  C CG  . MET C  1 284 ? 122.378 19.891  17.640  1.00 32.24  ? 281 MET C CG  1 
ATOM   9574  S SD  . MET C  1 284 ? 120.988 20.922  17.130  1.00 32.53  ? 281 MET C SD  1 
ATOM   9575  C CE  . MET C  1 284 ? 120.672 21.697  18.690  1.00 32.39  ? 281 MET C CE  1 
ATOM   9576  N N   . ALA C  1 285 ? 120.690 16.223  20.445  1.00 26.24  ? 282 ALA C N   1 
ATOM   9577  C CA  . ALA C  1 285 ? 120.022 14.965  20.671  1.00 25.35  ? 282 ALA C CA  1 
ATOM   9578  C C   . ALA C  1 285 ? 118.532 15.208  20.635  1.00 24.75  ? 282 ALA C C   1 
ATOM   9579  O O   . ALA C  1 285 ? 118.030 16.186  21.205  1.00 23.24  ? 282 ALA C O   1 
ATOM   9580  C CB  . ALA C  1 285 ? 120.420 14.366  22.007  1.00 25.27  ? 282 ALA C CB  1 
ATOM   9581  N N   . LEU C  1 286 ? 117.841 14.311  19.940  1.00 24.39  ? 283 LEU C N   1 
ATOM   9582  C CA  . LEU C  1 286 ? 116.416 14.406  19.793  1.00 24.93  ? 283 LEU C CA  1 
ATOM   9583  C C   . LEU C  1 286 ? 115.794 13.575  20.861  1.00 23.78  ? 283 LEU C C   1 
ATOM   9584  O O   . LEU C  1 286 ? 115.516 12.402  20.651  1.00 23.56  ? 283 LEU C O   1 
ATOM   9585  C CB  . LEU C  1 286 ? 115.952 13.969  18.406  1.00 26.16  ? 283 LEU C CB  1 
ATOM   9586  C CG  . LEU C  1 286 ? 114.838 14.932  17.984  1.00 28.47  ? 283 LEU C CG  1 
ATOM   9587  C CD1 . LEU C  1 286 ? 114.572 14.794  16.515  1.00 29.56  ? 283 LEU C CD1 1 
ATOM   9588  C CD2 . LEU C  1 286 ? 113.570 14.686  18.778  1.00 30.51  ? 283 LEU C CD2 1 
ATOM   9589  N N   . SER C  1 287 ? 115.550 14.227  21.999  1.00 23.19  ? 284 SER C N   1 
ATOM   9590  C CA  . SER C  1 287 ? 115.161 13.569  23.243  1.00 21.15  ? 284 SER C CA  1 
ATOM   9591  C C   . SER C  1 287 ? 113.667 13.498  23.509  1.00 20.35  ? 284 SER C C   1 
ATOM   9592  O O   . SER C  1 287 ? 113.256 12.727  24.377  1.00 21.30  ? 284 SER C O   1 
ATOM   9593  C CB  . SER C  1 287 ? 115.810 14.299  24.399  1.00 20.51  ? 284 SER C CB  1 
ATOM   9594  O OG  . SER C  1 287 ? 115.534 15.669  24.296  1.00 19.39  ? 284 SER C OG  1 
ATOM   9595  N N   . VAL C  1 288 ? 112.874 14.310  22.808  1.00 19.38  ? 285 VAL C N   1 
ATOM   9596  C CA  . VAL C  1 288 ? 111.410 14.306  22.951  1.00 18.68  ? 285 VAL C CA  1 
ATOM   9597  C C   . VAL C  1 288 ? 110.719 14.216  21.591  1.00 18.64  ? 285 VAL C C   1 
ATOM   9598  O O   . VAL C  1 288 ? 110.976 15.014  20.691  1.00 17.86  ? 285 VAL C O   1 
ATOM   9599  C CB  . VAL C  1 288 ? 110.882 15.560  23.673  1.00 18.28  ? 285 VAL C CB  1 
ATOM   9600  C CG1 . VAL C  1 288 ? 109.374 15.489  23.841  1.00 18.57  ? 285 VAL C CG1 1 
ATOM   9601  C CG2 . VAL C  1 288 ? 111.510 15.713  25.036  1.00 17.89  ? 285 VAL C CG2 1 
ATOM   9602  N N   . ALA C  1 289 ? 109.827 13.238  21.468  1.00 19.08  ? 286 ALA C N   1 
ATOM   9603  C CA  . ALA C  1 289 ? 108.973 13.081  20.296  1.00 19.10  ? 286 ALA C CA  1 
ATOM   9604  C C   . ALA C  1 289 ? 107.572 13.457  20.748  1.00 19.78  ? 286 ALA C C   1 
ATOM   9605  O O   . ALA C  1 289 ? 107.027 12.866  21.672  1.00 18.78  ? 286 ALA C O   1 
ATOM   9606  C CB  . ALA C  1 289 ? 109.016 11.660  19.778  1.00 18.51  ? 286 ALA C CB  1 
ATOM   9607  N N   . VAL C  1 290 ? 107.024 14.493  20.126  1.00 20.99  ? 287 VAL C N   1 
ATOM   9608  C CA  . VAL C  1 290 ? 105.697 14.972  20.432  1.00 21.17  ? 287 VAL C CA  1 
ATOM   9609  C C   . VAL C  1 290 ? 104.772 14.473  19.359  1.00 22.26  ? 287 VAL C C   1 
ATOM   9610  O O   . VAL C  1 290 ? 104.746 15.007  18.257  1.00 21.80  ? 287 VAL C O   1 
ATOM   9611  C CB  . VAL C  1 290 ? 105.679 16.489  20.439  1.00 21.30  ? 287 VAL C CB  1 
ATOM   9612  C CG1 . VAL C  1 290 ? 104.313 17.003  20.833  1.00 21.33  ? 287 VAL C CG1 1 
ATOM   9613  C CG2 . VAL C  1 290 ? 106.732 17.001  21.396  1.00 21.79  ? 287 VAL C CG2 1 
ATOM   9614  N N   . ALA C  1 291 ? 104.014 13.432  19.674  1.00 24.89  ? 288 ALA C N   1 
ATOM   9615  C CA  . ALA C  1 291 ? 103.091 12.841  18.698  1.00 26.33  ? 288 ALA C CA  1 
ATOM   9616  C C   . ALA C  1 291 ? 101.761 13.586  18.705  1.00 27.18  ? 288 ALA C C   1 
ATOM   9617  O O   . ALA C  1 291 ? 101.125 13.724  19.754  1.00 26.58  ? 288 ALA C O   1 
ATOM   9618  C CB  . ALA C  1 291 ? 102.875 11.380  18.995  1.00 26.06  ? 288 ALA C CB  1 
ATOM   9619  N N   . VAL C  1 292 ? 101.359 14.076  17.533  1.00 28.99  ? 289 VAL C N   1 
ATOM   9620  C CA  . VAL C  1 292 ? 100.087 14.792  17.391  1.00 31.47  ? 289 VAL C CA  1 
ATOM   9621  C C   . VAL C  1 292 ? 99.066  13.755  16.943  1.00 33.82  ? 289 VAL C C   1 
ATOM   9622  O O   . VAL C  1 292 ? 99.159  13.187  15.853  1.00 32.68  ? 289 VAL C O   1 
ATOM   9623  C CB  . VAL C  1 292 ? 100.162 16.076  16.504  1.00 31.97  ? 289 VAL C CB  1 
ATOM   9624  C CG1 . VAL C  1 292 ? 100.891 15.834  15.225  1.00 33.19  ? 289 VAL C CG1 1 
ATOM   9625  C CG2 . VAL C  1 292 ? 98.788  16.641  16.190  1.00 32.15  ? 289 VAL C CG2 1 
ATOM   9626  N N   . GLY C  1 293 ? 98.116  13.492  17.838  1.00 38.80  ? 290 GLY C N   1 
ATOM   9627  C CA  . GLY C  1 293 ? 97.191  12.377  17.707  1.00 42.02  ? 290 GLY C CA  1 
ATOM   9628  C C   . GLY C  1 293 ? 97.756  11.092  18.286  1.00 44.70  ? 290 GLY C C   1 
ATOM   9629  O O   . GLY C  1 293 ? 98.906  11.032  18.711  1.00 41.40  ? 290 GLY C O   1 
ATOM   9630  N N   . ASP C  1 294 ? 96.915  10.065  18.324  1.00 50.62  ? 291 ASP C N   1 
ATOM   9631  C CA  . ASP C  1 294 ? 97.350  8.715   18.683  1.00 52.52  ? 291 ASP C CA  1 
ATOM   9632  C C   . ASP C  1 294 ? 96.275  7.704   18.335  1.00 57.19  ? 291 ASP C C   1 
ATOM   9633  O O   . ASP C  1 294 ? 95.522  7.320   19.226  1.00 65.25  ? 291 ASP C O   1 
ATOM   9634  C CB  . ASP C  1 294 ? 97.671  8.645   20.195  1.00 52.33  ? 291 ASP C CB  1 
ATOM   9635  C CG  . ASP C  1 294 ? 96.626  9.389   21.085  1.00 48.57  ? 291 ASP C CG  1 
ATOM   9636  O OD1 . ASP C  1 294 ? 95.694  10.007  20.530  1.00 49.96  ? 291 ASP C OD1 1 
ATOM   9637  O OD2 . ASP C  1 294 ? 96.738  9.360   22.334  1.00 41.37  ? 291 ASP C OD2 1 
ATOM   9638  N N   . ALA C  1 295 ? 96.109  7.266   17.080  1.00 61.36  ? 292 ALA C N   1 
ATOM   9639  C CA  . ALA C  1 295 ? 96.799  7.666   15.830  1.00 59.02  ? 292 ALA C CA  1 
ATOM   9640  C C   . ALA C  1 295 ? 98.333  7.449   15.796  1.00 59.57  ? 292 ALA C C   1 
ATOM   9641  O O   . ALA C  1 295 ? 98.794  6.309   15.841  1.00 56.64  ? 292 ALA C O   1 
ATOM   9642  C CB  . ALA C  1 295 ? 96.367  9.066   15.366  1.00 60.38  ? 292 ALA C CB  1 
ATOM   9643  N N   . ALA C  1 296 ? 99.099  8.540   15.719  1.00 60.85  ? 293 ALA C N   1 
ATOM   9644  C CA  . ALA C  1 296 ? 100.548 8.500   15.531  1.00 54.66  ? 293 ALA C CA  1 
ATOM   9645  C C   . ALA C  1 296 ? 101.312 8.089   16.797  1.00 52.70  ? 293 ALA C C   1 
ATOM   9646  O O   . ALA C  1 296 ? 102.338 7.416   16.709  1.00 54.29  ? 293 ALA C O   1 
ATOM   9647  C CB  . ALA C  1 296 ? 101.041 9.852   15.035  1.00 53.27  ? 293 ALA C CB  1 
ATOM   9648  N N   . GLY C  1 297 ? 100.845 8.513   17.965  1.00 48.10  ? 294 GLY C N   1 
ATOM   9649  C CA  . GLY C  1 297 ? 101.477 8.104   19.218  1.00 46.40  ? 294 GLY C CA  1 
ATOM   9650  C C   . GLY C  1 297 ? 101.711 6.608   19.297  1.00 44.34  ? 294 GLY C C   1 
ATOM   9651  O O   . GLY C  1 297 ? 102.840 6.146   19.446  1.00 42.52  ? 294 GLY C O   1 
ATOM   9652  N N   . ASP C  1 298 ? 100.629 5.856   19.162  1.00 44.28  ? 295 ASP C N   1 
ATOM   9653  C CA  . ASP C  1 298 ? 100.666 4.400   19.273  1.00 41.71  ? 295 ASP C CA  1 
ATOM   9654  C C   . ASP C  1 298 ? 101.609 3.759   18.248  1.00 38.40  ? 295 ASP C C   1 
ATOM   9655  O O   . ASP C  1 298 ? 102.442 2.932   18.601  1.00 35.76  ? 295 ASP C O   1 
ATOM   9656  C CB  . ASP C  1 298 ? 99.254  3.819   19.098  1.00 43.78  ? 295 ASP C CB  1 
ATOM   9657  C CG  . ASP C  1 298 ? 98.295  4.234   20.203  1.00 45.19  ? 295 ASP C CG  1 
ATOM   9658  O OD1 . ASP C  1 298 ? 98.726  4.474   21.363  1.00 47.51  ? 295 ASP C OD1 1 
ATOM   9659  O OD2 . ASP C  1 298 ? 97.092  4.305   19.899  1.00 43.49  ? 295 ASP C OD2 1 
ATOM   9660  N N   . ALA C  1 299 ? 101.457 4.156   16.986  1.00 37.06  ? 296 ALA C N   1 
ATOM   9661  C CA  . ALA C  1 299 ? 102.275 3.659   15.877  1.00 37.54  ? 296 ALA C CA  1 
ATOM   9662  C C   . ALA C  1 299 ? 103.761 3.976   16.062  1.00 42.35  ? 296 ALA C C   1 
ATOM   9663  O O   . ALA C  1 299 ? 104.620 3.165   15.703  1.00 45.51  ? 296 ALA C O   1 
ATOM   9664  C CB  . ALA C  1 299 ? 101.793 4.248   14.559  1.00 36.06  ? 296 ALA C CB  1 
ATOM   9665  N N   . LEU C  1 300 ? 104.058 5.165   16.603  1.00 45.41  ? 297 LEU C N   1 
ATOM   9666  C CA  . LEU C  1 300 ? 105.440 5.591   16.884  1.00 41.24  ? 297 LEU C CA  1 
ATOM   9667  C C   . LEU C  1 300 ? 106.036 4.688   17.946  1.00 40.23  ? 297 LEU C C   1 
ATOM   9668  O O   . LEU C  1 300 ? 107.096 4.117   17.736  1.00 39.31  ? 297 LEU C O   1 
ATOM   9669  C CB  . LEU C  1 300 ? 105.505 7.061   17.350  1.00 39.95  ? 297 LEU C CB  1 
ATOM   9670  C CG  . LEU C  1 300 ? 106.871 7.619   17.802  1.00 38.38  ? 297 LEU C CG  1 
ATOM   9671  C CD1 . LEU C  1 300 ? 107.838 7.779   16.644  1.00 37.40  ? 297 LEU C CD1 1 
ATOM   9672  C CD2 . LEU C  1 300 ? 106.719 8.941   18.525  1.00 38.52  ? 297 LEU C CD2 1 
ATOM   9673  N N   . VAL C  1 301 ? 105.357 4.567   19.083  1.00 39.44  ? 298 VAL C N   1 
ATOM   9674  C CA  . VAL C  1 301 ? 105.888 3.781   20.187  1.00 41.22  ? 298 VAL C CA  1 
ATOM   9675  C C   . VAL C  1 301 ? 105.995 2.314   19.795  1.00 44.50  ? 298 VAL C C   1 
ATOM   9676  O O   . VAL C  1 301 ? 106.925 1.621   20.212  1.00 46.01  ? 298 VAL C O   1 
ATOM   9677  C CB  . VAL C  1 301 ? 105.037 3.915   21.453  1.00 40.92  ? 298 VAL C CB  1 
ATOM   9678  C CG1 . VAL C  1 301 ? 105.538 2.975   22.549  1.00 40.67  ? 298 VAL C CG1 1 
ATOM   9679  C CG2 . VAL C  1 301 ? 105.070 5.349   21.957  1.00 41.03  ? 298 VAL C CG2 1 
ATOM   9680  N N   . SER C  1 302 ? 105.047 1.849   18.993  1.00 47.43  ? 299 SER C N   1 
ATOM   9681  C CA  . SER C  1 302 ? 105.089 0.481   18.495  1.00 49.54  ? 299 SER C CA  1 
ATOM   9682  C C   . SER C  1 302 ? 106.354 0.274   17.679  1.00 47.59  ? 299 SER C C   1 
ATOM   9683  O O   . SER C  1 302 ? 107.258 -0.434  18.111  1.00 48.63  ? 299 SER C O   1 
ATOM   9684  C CB  . SER C  1 302 ? 103.857 0.158   17.642  1.00 52.10  ? 299 SER C CB  1 
ATOM   9685  O OG  . SER C  1 302 ? 104.070 -1.015  16.871  1.00 51.31  ? 299 SER C OG  1 
ATOM   9686  N N   . LYS C  1 303 ? 106.426 0.933   16.528  1.00 46.03  ? 300 LYS C N   1 
ATOM   9687  C CA  . LYS C  1 303 ? 107.550 0.761   15.588  1.00 47.13  ? 300 LYS C CA  1 
ATOM   9688  C C   . LYS C  1 303 ? 108.936 1.060   16.192  1.00 46.34  ? 300 LYS C C   1 
ATOM   9689  O O   . LYS C  1 303 ? 109.923 0.394   15.860  1.00 43.38  ? 300 LYS C O   1 
ATOM   9690  C CB  . LYS C  1 303 ? 107.331 1.616   14.342  1.00 46.90  ? 300 LYS C CB  1 
ATOM   9691  C CG  . LYS C  1 303 ? 106.086 1.223   13.566  1.00 50.91  ? 300 LYS C CG  1 
ATOM   9692  C CD  . LYS C  1 303 ? 106.098 1.762   12.154  1.00 53.91  ? 300 LYS C CD  1 
ATOM   9693  C CE  . LYS C  1 303 ? 104.844 1.370   11.403  1.00 54.65  ? 300 LYS C CE  1 
ATOM   9694  N NZ  . LYS C  1 303 ? 104.983 1.826   9.995   1.00 57.48  ? 300 LYS C NZ  1 
ATOM   9695  N N   . MET C  1 304 ? 108.984 2.064   17.073  1.00 48.12  ? 301 MET C N   1 
ATOM   9696  C CA  . MET C  1 304 ? 110.194 2.428   17.827  1.00 46.73  ? 301 MET C CA  1 
ATOM   9697  C C   . MET C  1 304 ? 110.660 1.278   18.726  1.00 43.82  ? 301 MET C C   1 
ATOM   9698  O O   . MET C  1 304 ? 111.828 0.898   18.683  1.00 41.58  ? 301 MET C O   1 
ATOM   9699  C CB  . MET C  1 304 ? 109.945 3.683   18.678  1.00 47.38  ? 301 MET C CB  1 
ATOM   9700  C CG  . MET C  1 304 ? 111.187 4.254   19.339  1.00 47.53  ? 301 MET C CG  1 
ATOM   9701  S SD  . MET C  1 304 ? 112.416 4.937   18.196  1.00 49.54  ? 301 MET C SD  1 
ATOM   9702  C CE  . MET C  1 304 ? 113.608 3.640   18.026  1.00 47.66  ? 301 MET C CE  1 
ATOM   9703  N N   . THR C  1 305 ? 109.744 0.728   19.527  1.00 41.17  ? 302 THR C N   1 
ATOM   9704  C CA  . THR C  1 305 ? 110.043 -0.460  20.329  1.00 39.45  ? 302 THR C CA  1 
ATOM   9705  C C   . THR C  1 305 ? 110.712 -1.542  19.488  1.00 41.00  ? 302 THR C C   1 
ATOM   9706  O O   . THR C  1 305 ? 111.740 -2.075  19.888  1.00 39.95  ? 302 THR C O   1 
ATOM   9707  C CB  . THR C  1 305 ? 108.794 -1.072  20.970  1.00 37.03  ? 302 THR C CB  1 
ATOM   9708  O OG1 . THR C  1 305 ? 108.157 -0.114  21.819  1.00 35.36  ? 302 THR C OG1 1 
ATOM   9709  C CG2 . THR C  1 305 ? 109.181 -2.238  21.809  1.00 37.69  ? 302 THR C CG2 1 
ATOM   9710  N N   . GLN C  1 306 ? 110.123 -1.837  18.329  1.00 44.40  ? 303 GLN C N   1 
ATOM   9711  C CA  . GLN C  1 306 ? 110.613 -2.872  17.413  1.00 46.78  ? 303 GLN C CA  1 
ATOM   9712  C C   . GLN C  1 306 ? 112.034 -2.588  16.955  1.00 47.86  ? 303 GLN C C   1 
ATOM   9713  O O   . GLN C  1 306 ? 112.910 -3.450  17.072  1.00 52.33  ? 303 GLN C O   1 
ATOM   9714  C CB  . GLN C  1 306 ? 109.703 -3.006  16.178  1.00 50.79  ? 303 GLN C CB  1 
ATOM   9715  C CG  . GLN C  1 306 ? 108.381 -3.753  16.407  1.00 54.92  ? 303 GLN C CG  1 
ATOM   9716  C CD  . GLN C  1 306 ? 108.514 -5.280  16.479  1.00 57.62  ? 303 GLN C CD  1 
ATOM   9717  O OE1 . GLN C  1 306 ? 109.615 -5.832  16.496  1.00 59.81  ? 303 GLN C OE1 1 
ATOM   9718  N NE2 . GLN C  1 306 ? 107.378 -5.965  16.534  1.00 60.51  ? 303 GLN C NE2 1 
ATOM   9719  N N   . ALA C  1 307 ? 112.260 -1.385  16.434  1.00 46.63  ? 304 ALA C N   1 
ATOM   9720  C CA  . ALA C  1 307 ? 113.601 -0.978  15.982  1.00 44.11  ? 304 ALA C CA  1 
ATOM   9721  C C   . ALA C  1 307 ? 114.636 -0.870  17.134  1.00 43.51  ? 304 ALA C C   1 
ATOM   9722  O O   . ALA C  1 307 ? 115.830 -1.067  16.934  1.00 41.35  ? 304 ALA C O   1 
ATOM   9723  C CB  . ALA C  1 307 ? 113.521 0.317   15.189  1.00 40.51  ? 304 ALA C CB  1 
ATOM   9724  N N   . MET C  1 308 ? 114.163 -0.601  18.342  1.00 43.58  ? 305 MET C N   1 
ATOM   9725  C CA  . MET C  1 308 ? 115.040 -0.441  19.499  1.00 46.14  ? 305 MET C CA  1 
ATOM   9726  C C   . MET C  1 308 ? 115.636 -1.766  19.996  1.00 50.92  ? 305 MET C C   1 
ATOM   9727  O O   . MET C  1 308 ? 116.671 -1.768  20.668  1.00 48.89  ? 305 MET C O   1 
ATOM   9728  C CB  . MET C  1 308 ? 114.287 0.271   20.632  1.00 46.32  ? 305 MET C CB  1 
ATOM   9729  C CG  . MET C  1 308 ? 115.107 1.319   21.366  1.00 48.10  ? 305 MET C CG  1 
ATOM   9730  S SD  . MET C  1 308 ? 114.228 2.292   22.613  1.00 50.24  ? 305 MET C SD  1 
ATOM   9731  C CE  . MET C  1 308 ? 113.026 3.028   21.573  1.00 46.17  ? 305 MET C CE  1 
ATOM   9732  N N   . GLN C  1 309 ? 114.980 -2.884  19.671  1.00 59.74  ? 306 GLN C N   1 
ATOM   9733  C CA  . GLN C  1 309 ? 115.491 -4.235  20.004  1.00 62.03  ? 306 GLN C CA  1 
ATOM   9734  C C   . GLN C  1 309 ? 116.800 -4.579  19.265  1.00 55.72  ? 306 GLN C C   1 
ATOM   9735  O O   . GLN C  1 309 ? 117.658 -5.271  19.804  1.00 56.67  ? 306 GLN C O   1 
ATOM   9736  C CB  . GLN C  1 309 ? 114.416 -5.326  19.762  1.00 67.65  ? 306 GLN C CB  1 
ATOM   9737  C CG  . GLN C  1 309 ? 113.757 -5.855  21.041  1.00 75.23  ? 306 GLN C CG  1 
ATOM   9738  C CD  . GLN C  1 309 ? 112.898 -4.815  21.774  1.00 83.45  ? 306 GLN C CD  1 
ATOM   9739  O OE1 . GLN C  1 309 ? 111.911 -4.330  21.231  1.00 92.89  ? 306 GLN C OE1 1 
ATOM   9740  N NE2 . GLN C  1 309 ? 113.259 -4.489  23.020  1.00 82.52  ? 306 GLN C NE2 1 
ATOM   9741  N N   . LYS C  1 310 ? 116.962 -4.058  18.058  1.00 50.95  ? 307 LYS C N   1 
ATOM   9742  C CA  . LYS C  1 310 ? 118.155 -4.329  17.258  1.00 50.54  ? 307 LYS C CA  1 
ATOM   9743  C C   . LYS C  1 310 ? 119.398 -3.522  17.686  1.00 44.96  ? 307 LYS C C   1 
ATOM   9744  O O   . LYS C  1 310 ? 120.518 -3.835  17.253  1.00 40.31  ? 307 LYS C O   1 
ATOM   9745  C CB  . LYS C  1 310 ? 117.854 -4.053  15.791  1.00 56.19  ? 307 LYS C CB  1 
ATOM   9746  C CG  . LYS C  1 310 ? 116.660 -4.816  15.255  1.00 64.96  ? 307 LYS C CG  1 
ATOM   9747  C CD  . LYS C  1 310 ? 116.317 -4.396  13.828  1.00 76.43  ? 307 LYS C CD  1 
ATOM   9748  C CE  . LYS C  1 310 ? 117.121 -5.161  12.779  1.00 83.74  ? 307 LYS C CE  1 
ATOM   9749  N NZ  . LYS C  1 310 ? 116.563 -6.526  12.522  1.00 88.07  ? 307 LYS C NZ  1 
ATOM   9750  N N   . LEU C  1 311 ? 119.192 -2.482  18.503  1.00 40.50  ? 308 LEU C N   1 
ATOM   9751  C CA  . LEU C  1 311 ? 120.280 -1.640  18.999  1.00 38.18  ? 308 LEU C CA  1 
ATOM   9752  C C   . LEU C  1 311 ? 121.264 -2.441  19.790  1.00 36.12  ? 308 LEU C C   1 
ATOM   9753  O O   . LEU C  1 311 ? 120.867 -3.261  20.600  1.00 37.36  ? 308 LEU C O   1 
ATOM   9754  C CB  . LEU C  1 311 ? 119.764 -0.564  19.950  1.00 38.57  ? 308 LEU C CB  1 
ATOM   9755  C CG  . LEU C  1 311 ? 118.980 0.607   19.370  1.00 37.73  ? 308 LEU C CG  1 
ATOM   9756  C CD1 . LEU C  1 311 ? 118.596 1.522   20.510  1.00 37.35  ? 308 LEU C CD1 1 
ATOM   9757  C CD2 . LEU C  1 311 ? 119.769 1.384   18.334  1.00 37.22  ? 308 LEU C CD2 1 
ATOM   9758  N N   . LYS C  1 312 ? 122.538 -2.149  19.580  1.00 34.52  ? 309 LYS C N   1 
ATOM   9759  C CA  . LYS C  1 312 ? 123.627 -2.815  20.258  1.00 35.45  ? 309 LYS C CA  1 
ATOM   9760  C C   . LYS C  1 312 ? 124.423 -1.776  21.065  1.00 34.58  ? 309 LYS C C   1 
ATOM   9761  O O   . LYS C  1 312 ? 124.897 -0.778  20.511  1.00 34.57  ? 309 LYS C O   1 
ATOM   9762  C CB  . LYS C  1 312 ? 124.527 -3.513  19.236  1.00 38.32  ? 309 LYS C CB  1 
ATOM   9763  C CG  . LYS C  1 312 ? 123.804 -4.497  18.315  1.00 41.39  ? 309 LYS C CG  1 
ATOM   9764  C CD  . LYS C  1 312 ? 124.709 -4.997  17.188  1.00 44.95  ? 309 LYS C CD  1 
ATOM   9765  C CE  . LYS C  1 312 ? 123.958 -5.196  15.867  1.00 46.58  ? 309 LYS C CE  1 
ATOM   9766  N NZ  . LYS C  1 312 ? 124.900 -5.401  14.727  1.00 47.05  ? 309 LYS C NZ  1 
ATOM   9767  N N   . VAL C  1 313 ? 124.551 -2.024  22.370  1.00 33.05  ? 310 VAL C N   1 
ATOM   9768  C CA  . VAL C  1 313 ? 125.354 -1.215  23.276  1.00 31.41  ? 310 VAL C CA  1 
ATOM   9769  C C   . VAL C  1 313 ? 126.612 -1.967  23.730  1.00 31.69  ? 310 VAL C C   1 
ATOM   9770  O O   . VAL C  1 313 ? 126.541 -3.092  24.234  1.00 32.40  ? 310 VAL C O   1 
ATOM   9771  C CB  . VAL C  1 313 ? 124.561 -0.843  24.519  1.00 31.54  ? 310 VAL C CB  1 
ATOM   9772  C CG1 . VAL C  1 313 ? 125.234 0.314   25.224  1.00 32.68  ? 310 VAL C CG1 1 
ATOM   9773  C CG2 . VAL C  1 313 ? 123.146 -0.457  24.145  1.00 33.00  ? 310 VAL C CG2 1 
ATOM   9774  N N   . GLY C  1 314 ? 127.760 -1.331  23.562  1.00 30.87  ? 311 GLY C N   1 
ATOM   9775  C CA  . GLY C  1 314 ? 129.006 -1.933  23.960  1.00 31.01  ? 311 GLY C CA  1 
ATOM   9776  C C   . GLY C  1 314 ? 130.190 -1.035  23.680  1.00 30.17  ? 311 GLY C C   1 
ATOM   9777  O O   . GLY C  1 314 ? 130.012 0.065   23.222  1.00 31.26  ? 311 GLY C O   1 
ATOM   9778  N N   . PRO C  1 315 ? 131.406 -1.517  23.938  1.00 30.09  ? 312 PRO C N   1 
ATOM   9779  C CA  . PRO C  1 315 ? 132.604 -0.709  23.883  1.00 29.77  ? 312 PRO C CA  1 
ATOM   9780  C C   . PRO C  1 315 ? 133.069 -0.421  22.477  1.00 30.68  ? 312 PRO C C   1 
ATOM   9781  O O   . PRO C  1 315 ? 132.774 -1.197  21.566  1.00 32.37  ? 312 PRO C O   1 
ATOM   9782  C CB  . PRO C  1 315 ? 133.626 -1.608  24.547  1.00 31.44  ? 312 PRO C CB  1 
ATOM   9783  C CG  . PRO C  1 315 ? 133.190 -2.983  24.181  1.00 30.96  ? 312 PRO C CG  1 
ATOM   9784  C CD  . PRO C  1 315 ? 131.707 -2.916  24.297  1.00 30.43  ? 312 PRO C CD  1 
ATOM   9785  N N   . SER C  1 316 ? 133.861 0.644   22.322  1.00 30.47  ? 313 SER C N   1 
ATOM   9786  C CA  . SER C  1 316 ? 134.314 1.095   20.994  1.00 28.61  ? 313 SER C CA  1 
ATOM   9787  C C   . SER C  1 316 ? 135.255 0.130   20.315  1.00 27.68  ? 313 SER C C   1 
ATOM   9788  O O   . SER C  1 316 ? 135.502 0.257   19.141  1.00 26.77  ? 313 SER C O   1 
ATOM   9789  C CB  . SER C  1 316 ? 134.993 2.446   21.080  1.00 28.54  ? 313 SER C CB  1 
ATOM   9790  O OG  . SER C  1 316 ? 136.289 2.282   21.616  1.00 31.68  ? 313 SER C OG  1 
ATOM   9791  N N   . THR C  1 317 ? 135.803 -0.808  21.073  1.00 29.96  ? 314 THR C N   1 
ATOM   9792  C CA  . THR C  1 317 ? 136.642 -1.885  20.541  1.00 30.84  ? 314 THR C CA  1 
ATOM   9793  C C   . THR C  1 317 ? 135.853 -2.744  19.568  1.00 30.76  ? 314 THR C C   1 
ATOM   9794  O O   . THR C  1 317 ? 136.416 -3.295  18.631  1.00 33.54  ? 314 THR C O   1 
ATOM   9795  C CB  . THR C  1 317 ? 137.184 -2.773  21.686  1.00 30.83  ? 314 THR C CB  1 
ATOM   9796  O OG1 . THR C  1 317 ? 136.110 -3.141  22.574  1.00 30.78  ? 314 THR C OG1 1 
ATOM   9797  C CG2 . THR C  1 317 ? 138.232 -2.024  22.491  1.00 30.38  ? 314 THR C CG2 1 
ATOM   9798  N N   . ASP C  1 318 ? 134.550 -2.850  19.810  1.00 30.49  ? 315 ASP C N   1 
ATOM   9799  C CA  . ASP C  1 318 ? 133.625 -3.539  18.920  1.00 31.44  ? 315 ASP C CA  1 
ATOM   9800  C C   . ASP C  1 318 ? 132.944 -2.514  18.005  1.00 33.06  ? 315 ASP C C   1 
ATOM   9801  O O   . ASP C  1 318 ? 131.983 -1.847  18.395  1.00 32.33  ? 315 ASP C O   1 
ATOM   9802  C CB  . ASP C  1 318 ? 132.590 -4.314  19.761  1.00 31.23  ? 315 ASP C CB  1 
ATOM   9803  C CG  . ASP C  1 318 ? 131.567 -5.077  18.919  1.00 31.99  ? 315 ASP C CG  1 
ATOM   9804  O OD1 . ASP C  1 318 ? 131.801 -5.255  17.708  1.00 33.31  ? 315 ASP C OD1 1 
ATOM   9805  O OD2 . ASP C  1 318 ? 130.523 -5.511  19.477  1.00 29.61  ? 315 ASP C OD2 1 
ATOM   9806  N N   . SER C  1 319 ? 133.463 -2.379  16.788  1.00 35.45  ? 316 SER C N   1 
ATOM   9807  C CA  . SER C  1 319 ? 132.744 -1.693  15.700  1.00 36.77  ? 316 SER C CA  1 
ATOM   9808  C C   . SER C  1 319 ? 131.464 -2.461  15.397  1.00 37.62  ? 316 SER C C   1 
ATOM   9809  O O   . SER C  1 319 ? 131.434 -3.684  15.537  1.00 43.51  ? 316 SER C O   1 
ATOM   9810  C CB  . SER C  1 319 ? 133.594 -1.635  14.430  1.00 36.14  ? 316 SER C CB  1 
ATOM   9811  O OG  . SER C  1 319 ? 134.709 -0.798  14.635  1.00 36.22  ? 316 SER C OG  1 
ATOM   9812  N N   . GLY C  1 320 ? 130.405 -1.774  14.999  1.00 33.14  ? 317 GLY C N   1 
ATOM   9813  C CA  . GLY C  1 320 ? 129.126 -2.466  14.827  1.00 31.39  ? 317 GLY C CA  1 
ATOM   9814  C C   . GLY C  1 320 ? 128.193 -2.413  16.029  1.00 28.83  ? 317 GLY C C   1 
ATOM   9815  O O   . GLY C  1 320 ? 127.006 -2.755  15.908  1.00 28.98  ? 317 GLY C O   1 
ATOM   9816  N N   . ASN C  1 321 ? 128.709 -1.998  17.183  1.00 25.58  ? 318 ASN C N   1 
ATOM   9817  C CA  . ASN C  1 321 ? 127.855 -1.401  18.192  1.00 24.11  ? 318 ASN C CA  1 
ATOM   9818  C C   . ASN C  1 321 ? 127.235 -0.106  17.639  1.00 23.39  ? 318 ASN C C   1 
ATOM   9819  O O   . ASN C  1 321 ? 127.804 0.559   16.788  1.00 21.59  ? 318 ASN C O   1 
ATOM   9820  C CB  . ASN C  1 321 ? 128.631 -1.085  19.480  1.00 23.85  ? 318 ASN C CB  1 
ATOM   9821  C CG  . ASN C  1 321 ? 128.697 -2.250  20.421  1.00 23.01  ? 318 ASN C CG  1 
ATOM   9822  O OD1 . ASN C  1 321 ? 127.721 -2.957  20.589  1.00 22.60  ? 318 ASN C OD1 1 
ATOM   9823  N ND2 . ASN C  1 321 ? 129.854 -2.462  21.038  1.00 23.24  ? 318 ASN C ND2 1 
ATOM   9824  N N   . ASP C  1 322 ? 126.067 0.241   18.147  1.00 23.27  ? 319 ASP C N   1 
ATOM   9825  C CA  . ASP C  1 322 ? 125.413 1.468   17.767  1.00 24.21  ? 319 ASP C CA  1 
ATOM   9826  C C   . ASP C  1 322 ? 125.831 2.675   18.605  1.00 23.23  ? 319 ASP C C   1 
ATOM   9827  O O   . ASP C  1 322 ? 125.864 3.793   18.104  1.00 21.74  ? 319 ASP C O   1 
ATOM   9828  C CB  . ASP C  1 322 ? 123.909 1.248   17.821  1.00 26.38  ? 319 ASP C CB  1 
ATOM   9829  C CG  . ASP C  1 322 ? 123.432 0.344   16.702  1.00 27.63  ? 319 ASP C CG  1 
ATOM   9830  O OD1 . ASP C  1 322 ? 123.537 0.785   15.536  1.00 27.48  ? 319 ASP C OD1 1 
ATOM   9831  O OD2 . ASP C  1 322 ? 122.976 -0.801  16.974  1.00 31.16  ? 319 ASP C OD2 1 
ATOM   9832  N N   . PHE C  1 323 ? 126.123 2.452   19.880  1.00 23.13  ? 320 PHE C N   1 
ATOM   9833  C CA  . PHE C  1 323 ? 126.646 3.503   20.743  1.00 22.27  ? 320 PHE C CA  1 
ATOM   9834  C C   . PHE C  1 323 ? 127.305 2.946   21.983  1.00 21.86  ? 320 PHE C C   1 
ATOM   9835  O O   . PHE C  1 323 ? 127.089 1.817   22.362  1.00 21.91  ? 320 PHE C O   1 
ATOM   9836  C CB  . PHE C  1 323 ? 125.552 4.488   21.135  1.00 22.43  ? 320 PHE C CB  1 
ATOM   9837  C CG  . PHE C  1 323 ? 124.383 3.878   21.840  1.00 23.15  ? 320 PHE C CG  1 
ATOM   9838  C CD1 . PHE C  1 323 ? 123.290 3.427   21.124  1.00 23.98  ? 320 PHE C CD1 1 
ATOM   9839  C CD2 . PHE C  1 323 ? 124.343 3.793   23.238  1.00 23.80  ? 320 PHE C CD2 1 
ATOM   9840  C CE1 . PHE C  1 323 ? 122.181 2.893   21.789  1.00 24.39  ? 320 PHE C CE1 1 
ATOM   9841  C CE2 . PHE C  1 323 ? 123.241 3.246   23.900  1.00 23.06  ? 320 PHE C CE2 1 
ATOM   9842  C CZ  . PHE C  1 323 ? 122.158 2.809   23.177  1.00 22.90  ? 320 PHE C CZ  1 
ATOM   9843  N N   . GLY C  1 324 ? 128.116 3.763   22.620  1.00 22.24  ? 321 GLY C N   1 
ATOM   9844  C CA  . GLY C  1 324 ? 128.970 3.300   23.697  1.00 21.50  ? 321 GLY C CA  1 
ATOM   9845  C C   . GLY C  1 324 ? 128.494 3.747   25.054  1.00 21.83  ? 321 GLY C C   1 
ATOM   9846  O O   . GLY C  1 324 ? 127.335 4.119   25.228  1.00 21.39  ? 321 GLY C O   1 
ATOM   9847  N N   . PRO C  1 325 ? 129.402 3.724   26.033  1.00 22.80  ? 322 PRO C N   1 
ATOM   9848  C CA  . PRO C  1 325 ? 128.993 4.128   27.363  1.00 23.16  ? 322 PRO C CA  1 
ATOM   9849  C C   . PRO C  1 325 ? 128.819 5.640   27.519  1.00 23.39  ? 322 PRO C C   1 
ATOM   9850  O O   . PRO C  1 325 ? 129.191 6.438   26.651  1.00 21.96  ? 322 PRO C O   1 
ATOM   9851  C CB  . PRO C  1 325 ? 130.139 3.640   28.251  1.00 23.10  ? 322 PRO C CB  1 
ATOM   9852  C CG  . PRO C  1 325 ? 131.336 3.643   27.355  1.00 23.40  ? 322 PRO C CG  1 
ATOM   9853  C CD  . PRO C  1 325 ? 130.842 3.389   25.963  1.00 23.20  ? 322 PRO C CD  1 
ATOM   9854  N N   . VAL C  1 326 ? 128.244 5.980   28.662  1.00 23.60  ? 323 VAL C N   1 
ATOM   9855  C CA  . VAL C  1 326 ? 128.089 7.331   29.144  1.00 22.86  ? 323 VAL C CA  1 
ATOM   9856  C C   . VAL C  1 326 ? 129.462 7.727   29.705  1.00 23.03  ? 323 VAL C C   1 
ATOM   9857  O O   . VAL C  1 326 ? 130.301 6.858   29.959  1.00 23.24  ? 323 VAL C O   1 
ATOM   9858  C CB  . VAL C  1 326 ? 126.934 7.334   30.183  1.00 23.59  ? 323 VAL C CB  1 
ATOM   9859  C CG1 . VAL C  1 326 ? 127.298 8.015   31.504  1.00 24.71  ? 323 VAL C CG1 1 
ATOM   9860  C CG2 . VAL C  1 326 ? 125.677 7.897   29.555  1.00 23.24  ? 323 VAL C CG2 1 
ATOM   9861  N N   . ILE C  1 327 ? 129.690 9.020   29.902  1.00 22.56  ? 324 ILE C N   1 
ATOM   9862  C CA  . ILE C  1 327 ? 131.047 9.547   30.153  1.00 23.01  ? 324 ILE C CA  1 
ATOM   9863  C C   . ILE C  1 327 ? 131.684 9.239   31.519  1.00 24.06  ? 324 ILE C C   1 
ATOM   9864  O O   . ILE C  1 327 ? 132.915 9.080   31.604  1.00 24.15  ? 324 ILE C O   1 
ATOM   9865  C CB  . ILE C  1 327 ? 131.105 11.078  29.878  1.00 22.34  ? 324 ILE C CB  1 
ATOM   9866  C CG1 . ILE C  1 327 ? 132.540 11.575  29.812  1.00 21.95  ? 324 ILE C CG1 1 
ATOM   9867  C CG2 . ILE C  1 327 ? 130.318 11.890  30.910  1.00 22.15  ? 324 ILE C CG2 1 
ATOM   9868  C CD1 . ILE C  1 327 ? 133.323 11.011  28.655  1.00 22.01  ? 324 ILE C CD1 1 
ATOM   9869  N N   . THR C  1 328 ? 130.867 9.211   32.575  1.00 25.27  ? 325 THR C N   1 
ATOM   9870  C CA  . THR C  1 328 ? 131.342 8.995   33.959  1.00 25.62  ? 325 THR C CA  1 
ATOM   9871  C C   . THR C  1 328 ? 130.320 8.246   34.764  1.00 28.12  ? 325 THR C C   1 
ATOM   9872  O O   . THR C  1 328 ? 129.135 8.250   34.442  1.00 29.44  ? 325 THR C O   1 
ATOM   9873  C CB  . THR C  1 328 ? 131.614 10.306  34.743  1.00 24.06  ? 325 THR C CB  1 
ATOM   9874  O OG1 . THR C  1 328 ? 130.400 11.055  34.905  1.00 23.45  ? 325 THR C OG1 1 
ATOM   9875  C CG2 . THR C  1 328 ? 132.665 11.150  34.056  1.00 23.71  ? 325 THR C CG2 1 
ATOM   9876  N N   . ARG C  1 329 ? 130.783 7.644   35.846  1.00 30.88  ? 326 ARG C N   1 
ATOM   9877  C CA  . ARG C  1 329 ? 129.891 6.998   36.784  1.00 33.84  ? 326 ARG C CA  1 
ATOM   9878  C C   . ARG C  1 329 ? 128.839 7.967   37.299  1.00 34.31  ? 326 ARG C C   1 
ATOM   9879  O O   . ARG C  1 329 ? 127.650 7.635   37.384  1.00 32.21  ? 326 ARG C O   1 
ATOM   9880  C CB  . ARG C  1 329 ? 130.697 6.448   37.948  1.00 36.29  ? 326 ARG C CB  1 
ATOM   9881  C CG  . ARG C  1 329 ? 129.905 5.612   38.941  1.00 37.24  ? 326 ARG C CG  1 
ATOM   9882  C CD  . ARG C  1 329 ? 130.507 4.223   39.021  1.00 39.24  ? 326 ARG C CD  1 
ATOM   9883  N NE  . ARG C  1 329 ? 129.892 3.321   38.045  1.00 41.14  ? 326 ARG C NE  1 
ATOM   9884  C CZ  . ARG C  1 329 ? 130.435 2.194   37.588  1.00 41.90  ? 326 ARG C CZ  1 
ATOM   9885  N NH1 . ARG C  1 329 ? 131.642 1.806   37.976  1.00 41.68  ? 326 ARG C NH1 1 
ATOM   9886  N NH2 . ARG C  1 329 ? 129.760 1.452   36.713  1.00 44.26  ? 326 ARG C NH2 1 
ATOM   9887  N N   . GLN C  1 330 ? 129.284 9.168   37.640  1.00 37.55  ? 327 GLN C N   1 
ATOM   9888  C CA  . GLN C  1 330 ? 128.366 10.198  38.119  1.00 41.63  ? 327 GLN C CA  1 
ATOM   9889  C C   . GLN C  1 330 ? 127.261 10.389  37.101  1.00 37.41  ? 327 GLN C C   1 
ATOM   9890  O O   . GLN C  1 330 ? 126.079 10.355  37.451  1.00 34.81  ? 327 GLN C O   1 
ATOM   9891  C CB  . GLN C  1 330 ? 129.094 11.521  38.374  1.00 48.89  ? 327 GLN C CB  1 
ATOM   9892  C CG  . GLN C  1 330 ? 128.315 12.493  39.250  1.00 55.70  ? 327 GLN C CG  1 
ATOM   9893  C CD  . GLN C  1 330 ? 129.142 13.704  39.657  1.00 64.33  ? 327 GLN C CD  1 
ATOM   9894  O OE1 . GLN C  1 330 ? 130.164 14.021  39.034  1.00 70.95  ? 327 GLN C OE1 1 
ATOM   9895  N NE2 . GLN C  1 330 ? 128.697 14.395  40.702  1.00 67.70  ? 327 GLN C NE2 1 
ATOM   9896  N N   . HIS C  1 331 ? 127.655 10.532  35.834  1.00 34.05  ? 328 HIS C N   1 
ATOM   9897  C CA  . HIS C  1 331 ? 126.690 10.785  34.782  1.00 31.58  ? 328 HIS C CA  1 
ATOM   9898  C C   . HIS C  1 331 ? 125.722 9.617   34.602  1.00 29.16  ? 328 HIS C C   1 
ATOM   9899  O O   . HIS C  1 331 ? 124.516 9.817   34.443  1.00 27.33  ? 328 HIS C O   1 
ATOM   9900  C CB  . HIS C  1 331 ? 127.365 11.180  33.465  1.00 32.39  ? 328 HIS C CB  1 
ATOM   9901  C CG  . HIS C  1 331 ? 126.409 11.778  32.473  1.00 34.05  ? 328 HIS C CG  1 
ATOM   9902  N ND1 . HIS C  1 331 ? 125.647 12.897  32.753  1.00 36.18  ? 328 HIS C ND1 1 
ATOM   9903  C CD2 . HIS C  1 331 ? 126.041 11.382  31.233  1.00 33.37  ? 328 HIS C CD2 1 
ATOM   9904  C CE1 . HIS C  1 331 ? 124.871 13.173  31.719  1.00 34.99  ? 328 HIS C CE1 1 
ATOM   9905  N NE2 . HIS C  1 331 ? 125.091 12.268  30.784  1.00 33.87  ? 328 HIS C NE2 1 
ATOM   9906  N N   . GLN C  1 332 ? 126.242 8.402   34.674  1.00 28.86  ? 329 GLN C N   1 
ATOM   9907  C CA  . GLN C  1 332 ? 125.398 7.204   34.622  1.00 29.50  ? 329 GLN C CA  1 
ATOM   9908  C C   . GLN C  1 332 ? 124.356 7.219   35.730  1.00 29.93  ? 329 GLN C C   1 
ATOM   9909  O O   . GLN C  1 332 ? 123.179 6.968   35.503  1.00 25.91  ? 329 GLN C O   1 
ATOM   9910  C CB  . GLN C  1 332 ? 126.245 5.942   34.776  1.00 30.55  ? 329 GLN C CB  1 
ATOM   9911  C CG  . GLN C  1 332 ? 125.458 4.637   34.603  1.00 30.52  ? 329 GLN C CG  1 
ATOM   9912  C CD  . GLN C  1 332 ? 126.224 3.382   35.021  1.00 29.80  ? 329 GLN C CD  1 
ATOM   9913  O OE1 . GLN C  1 332 ? 127.047 3.388   35.954  1.00 29.22  ? 329 GLN C OE1 1 
ATOM   9914  N NE2 . GLN C  1 332 ? 125.947 2.293   34.328  1.00 28.91  ? 329 GLN C NE2 1 
ATOM   9915  N N   . GLU C  1 333 ? 124.812 7.499   36.943  1.00 32.78  ? 330 GLU C N   1 
ATOM   9916  C CA  . GLU C  1 333 ? 123.907 7.596   38.077  1.00 34.30  ? 330 GLU C CA  1 
ATOM   9917  C C   . GLU C  1 333 ? 122.829 8.665   37.844  1.00 34.41  ? 330 GLU C C   1 
ATOM   9918  O O   . GLU C  1 333 ? 121.658 8.420   38.127  1.00 34.03  ? 330 GLU C O   1 
ATOM   9919  C CB  . GLU C  1 333 ? 124.695 7.809   39.376  1.00 35.35  ? 330 GLU C CB  1 
ATOM   9920  C CG  . GLU C  1 333 ? 125.349 6.512   39.872  1.00 36.79  ? 330 GLU C CG  1 
ATOM   9921  C CD  . GLU C  1 333 ? 126.440 6.710   40.914  1.00 38.33  ? 330 GLU C CD  1 
ATOM   9922  O OE1 . GLU C  1 333 ? 126.701 7.866   41.315  1.00 39.55  ? 330 GLU C OE1 1 
ATOM   9923  O OE2 . GLU C  1 333 ? 127.053 5.696   41.322  1.00 38.35  ? 330 GLU C OE2 1 
ATOM   9924  N N   . LYS C  1 334 ? 123.217 9.809   37.269  1.00 35.18  ? 331 LYS C N   1 
ATOM   9925  C CA  . LYS C  1 334 ? 122.261 10.873  36.915  1.00 34.85  ? 331 LYS C CA  1 
ATOM   9926  C C   . LYS C  1 334 ? 121.234 10.412  35.874  1.00 31.98  ? 331 LYS C C   1 
ATOM   9927  O O   . LYS C  1 334 ? 120.030 10.581  36.070  1.00 31.09  ? 331 LYS C O   1 
ATOM   9928  C CB  . LYS C  1 334 ? 122.977 12.131  36.416  1.00 38.78  ? 331 LYS C CB  1 
ATOM   9929  C CG  . LYS C  1 334 ? 122.193 13.429  36.642  1.00 44.02  ? 331 LYS C CG  1 
ATOM   9930  C CD  . LYS C  1 334 ? 122.591 14.573  35.692  1.00 48.44  ? 331 LYS C CD  1 
ATOM   9931  C CE  . LYS C  1 334 ? 123.995 15.101  35.977  1.00 51.87  ? 331 LYS C CE  1 
ATOM   9932  N NZ  . LYS C  1 334 ? 124.391 16.220  35.085  1.00 53.65  ? 331 LYS C NZ  1 
ATOM   9933  N N   . VAL C  1 335 ? 121.697 9.816   34.785  1.00 29.05  ? 332 VAL C N   1 
ATOM   9934  C CA  . VAL C  1 335 ? 120.771 9.326   33.753  1.00 28.83  ? 332 VAL C CA  1 
ATOM   9935  C C   . VAL C  1 335 ? 119.774 8.299   34.325  1.00 28.19  ? 332 VAL C C   1 
ATOM   9936  O O   . VAL C  1 335 ? 118.587 8.376   34.071  1.00 26.73  ? 332 VAL C O   1 
ATOM   9937  C CB  . VAL C  1 335 ? 121.530 8.730   32.539  1.00 29.22  ? 332 VAL C CB  1 
ATOM   9938  C CG1 . VAL C  1 335 ? 120.581 8.131   31.499  1.00 29.02  ? 332 VAL C CG1 1 
ATOM   9939  C CG2 . VAL C  1 335 ? 122.381 9.785   31.859  1.00 29.41  ? 332 VAL C CG2 1 
ATOM   9940  N N   . ILE C  1 336 ? 120.273 7.353   35.105  1.00 30.57  ? 333 ILE C N   1 
ATOM   9941  C CA  . ILE C  1 336 ? 119.425 6.353   35.783  1.00 32.49  ? 333 ILE C CA  1 
ATOM   9942  C C   . ILE C  1 336 ? 118.422 7.052   36.709  1.00 31.59  ? 333 ILE C C   1 
ATOM   9943  O O   . ILE C  1 336 ? 117.262 6.660   36.767  1.00 28.90  ? 333 ILE C O   1 
ATOM   9944  C CB  . ILE C  1 336 ? 120.254 5.366   36.662  1.00 33.54  ? 333 ILE C CB  1 
ATOM   9945  C CG1 . ILE C  1 336 ? 121.258 4.530   35.847  1.00 33.85  ? 333 ILE C CG1 1 
ATOM   9946  C CG2 . ILE C  1 336 ? 119.342 4.432   37.435  1.00 33.46  ? 333 ILE C CG2 1 
ATOM   9947  C CD1 . ILE C  1 336 ? 120.670 3.570   34.842  1.00 33.82  ? 333 ILE C CD1 1 
ATOM   9948  N N   . GLY C  1 337 ? 118.892 8.058   37.449  1.00 31.24  ? 334 GLY C N   1 
ATOM   9949  C CA  . GLY C  1 337 ? 118.026 8.899   38.272  1.00 32.13  ? 334 GLY C CA  1 
ATOM   9950  C C   . GLY C  1 337 ? 116.820 9.456   37.524  1.00 34.04  ? 334 GLY C C   1 
ATOM   9951  O O   . GLY C  1 337 ? 115.684 9.352   38.000  1.00 34.22  ? 334 GLY C O   1 
ATOM   9952  N N   . TYR C  1 338 ? 117.071 10.022  36.342  1.00 35.34  ? 335 TYR C N   1 
ATOM   9953  C CA  . TYR C  1 338 ? 116.022 10.657  35.532  1.00 35.50  ? 335 TYR C CA  1 
ATOM   9954  C C   . TYR C  1 338 ? 114.978 9.652   35.081  1.00 37.06  ? 335 TYR C C   1 
ATOM   9955  O O   . TYR C  1 338 ? 113.781 9.964   35.062  1.00 41.39  ? 335 TYR C O   1 
ATOM   9956  C CB  . TYR C  1 338 ? 116.612 11.377  34.301  1.00 35.56  ? 335 TYR C CB  1 
ATOM   9957  C CG  . TYR C  1 338 ? 117.222 12.754  34.584  1.00 35.11  ? 335 TYR C CG  1 
ATOM   9958  C CD1 . TYR C  1 338 ? 116.452 13.774  35.148  1.00 33.66  ? 335 TYR C CD1 1 
ATOM   9959  C CD2 . TYR C  1 338 ? 118.565 13.033  34.280  1.00 34.00  ? 335 TYR C CD2 1 
ATOM   9960  C CE1 . TYR C  1 338 ? 116.990 15.014  35.414  1.00 33.00  ? 335 TYR C CE1 1 
ATOM   9961  C CE2 . TYR C  1 338 ? 119.110 14.275  34.538  1.00 33.86  ? 335 TYR C CE2 1 
ATOM   9962  C CZ  . TYR C  1 338 ? 118.313 15.269  35.099  1.00 34.68  ? 335 TYR C CZ  1 
ATOM   9963  O OH  . TYR C  1 338 ? 118.840 16.525  35.344  1.00 36.61  ? 335 TYR C OH  1 
ATOM   9964  N N   . ILE C  1 339 ? 115.425 8.452   34.718  1.00 35.37  ? 336 ILE C N   1 
ATOM   9965  C CA  . ILE C  1 339 ? 114.504 7.396   34.293  1.00 34.50  ? 336 ILE C CA  1 
ATOM   9966  C C   . ILE C  1 339 ? 113.643 7.010   35.497  1.00 35.62  ? 336 ILE C C   1 
ATOM   9967  O O   . ILE C  1 339 ? 112.430 6.900   35.390  1.00 37.46  ? 336 ILE C O   1 
ATOM   9968  C CB  . ILE C  1 339 ? 115.244 6.179   33.672  1.00 33.40  ? 336 ILE C CB  1 
ATOM   9969  C CG1 . ILE C  1 339 ? 116.051 6.636   32.429  1.00 34.85  ? 336 ILE C CG1 1 
ATOM   9970  C CG2 . ILE C  1 339 ? 114.254 5.098   33.266  1.00 31.24  ? 336 ILE C CG2 1 
ATOM   9971  C CD1 . ILE C  1 339 ? 116.998 5.625   31.807  1.00 34.99  ? 336 ILE C CD1 1 
ATOM   9972  N N   . ASN C  1 340 ? 114.270 6.860   36.654  1.00 36.32  ? 337 ASN C N   1 
ATOM   9973  C CA  . ASN C  1 340 ? 113.538 6.541   37.859  1.00 36.78  ? 337 ASN C CA  1 
ATOM   9974  C C   . ASN C  1 340 ? 112.482 7.588   38.107  1.00 38.75  ? 337 ASN C C   1 
ATOM   9975  O O   . ASN C  1 340 ? 111.318 7.244   38.285  1.00 42.44  ? 337 ASN C O   1 
ATOM   9976  C CB  . ASN C  1 340 ? 114.477 6.431   39.067  1.00 37.14  ? 337 ASN C CB  1 
ATOM   9977  C CG  . ASN C  1 340 ? 115.309 5.142   39.066  1.00 35.20  ? 337 ASN C CG  1 
ATOM   9978  O OD1 . ASN C  1 340 ? 115.029 4.180   38.322  1.00 32.62  ? 337 ASN C OD1 1 
ATOM   9979  N ND2 . ASN C  1 340 ? 116.345 5.124   39.904  1.00 33.12  ? 337 ASN C ND2 1 
ATOM   9980  N N   . SER C  1 341 ? 112.884 8.859   38.066  1.00 39.85  ? 338 SER C N   1 
ATOM   9981  C CA  . SER C  1 341 ? 111.953 9.994   38.242  1.00 38.67  ? 338 SER C CA  1 
ATOM   9982  C C   . SER C  1 341 ? 110.771 9.974   37.270  1.00 36.76  ? 338 SER C C   1 
ATOM   9983  O O   . SER C  1 341 ? 109.657 10.341  37.637  1.00 34.68  ? 338 SER C O   1 
ATOM   9984  C CB  . SER C  1 341 ? 112.684 11.328  38.097  1.00 39.76  ? 338 SER C CB  1 
ATOM   9985  O OG  . SER C  1 341 ? 111.791 12.402  38.335  1.00 42.60  ? 338 SER C OG  1 
ATOM   9986  N N   . ALA C  1 342 ? 111.015 9.541   36.040  1.00 34.95  ? 339 ALA C N   1 
ATOM   9987  C CA  . ALA C  1 342 ? 109.969 9.526   35.045  1.00 36.34  ? 339 ALA C CA  1 
ATOM   9988  C C   . ALA C  1 342 ? 108.935 8.484   35.394  1.00 39.86  ? 339 ALA C C   1 
ATOM   9989  O O   . ALA C  1 342 ? 107.732 8.778   35.439  1.00 39.19  ? 339 ALA C O   1 
ATOM   9990  C CB  . ALA C  1 342 ? 110.544 9.256   33.681  1.00 37.17  ? 339 ALA C CB  1 
ATOM   9991  N N   . GLU C  1 343 ? 109.413 7.267   35.649  1.00 43.72  ? 340 GLU C N   1 
ATOM   9992  C CA  . GLU C  1 343 ? 108.551 6.160   36.070  1.00 44.81  ? 340 GLU C CA  1 
ATOM   9993  C C   . GLU C  1 343 ? 107.743 6.536   37.305  1.00 45.32  ? 340 GLU C C   1 
ATOM   9994  O O   . GLU C  1 343 ? 106.517 6.427   37.304  1.00 45.66  ? 340 GLU C O   1 
ATOM   9995  C CB  . GLU C  1 343 ? 109.390 4.934   36.390  1.00 46.10  ? 340 GLU C CB  1 
ATOM   9996  C CG  . GLU C  1 343 ? 108.584 3.683   36.695  1.00 44.41  ? 340 GLU C CG  1 
ATOM   9997  C CD  . GLU C  1 343 ? 109.458 2.451   36.722  1.00 41.97  ? 340 GLU C CD  1 
ATOM   9998  O OE1 . GLU C  1 343 ? 109.169 1.530   35.928  1.00 36.66  ? 340 GLU C OE1 1 
ATOM   9999  O OE2 . GLU C  1 343 ? 110.441 2.433   37.513  1.00 40.83  ? 340 GLU C OE2 1 
ATOM   10000 N N   . GLN C  1 344 ? 108.444 7.014   38.329  1.00 44.35  ? 341 GLN C N   1 
ATOM   10001 C CA  . GLN C  1 344 ? 107.835 7.404   39.604  1.00 46.07  ? 341 GLN C CA  1 
ATOM   10002 C C   . GLN C  1 344 ? 106.776 8.493   39.493  1.00 44.76  ? 341 GLN C C   1 
ATOM   10003 O O   . GLN C  1 344 ? 105.862 8.538   40.323  1.00 46.69  ? 341 GLN C O   1 
ATOM   10004 C CB  . GLN C  1 344 ? 108.911 7.889   40.574  1.00 48.64  ? 341 GLN C CB  1 
ATOM   10005 C CG  . GLN C  1 344 ? 108.456 7.927   42.014  1.00 51.86  ? 341 GLN C CG  1 
ATOM   10006 C CD  . GLN C  1 344 ? 109.315 8.832   42.841  1.00 55.07  ? 341 GLN C CD  1 
ATOM   10007 O OE1 . GLN C  1 344 ? 110.507 8.963   42.594  1.00 58.55  ? 341 GLN C OE1 1 
ATOM   10008 N NE2 . GLN C  1 344 ? 108.722 9.459   43.831  1.00 60.74  ? 341 GLN C NE2 1 
ATOM   10009 N N   . GLN C  1 345 ? 106.921 9.389   38.510  1.00 42.00  ? 342 GLN C N   1 
ATOM   10010 C CA  . GLN C  1 345 ? 105.938 10.468  38.292  1.00 39.80  ? 342 GLN C CA  1 
ATOM   10011 C C   . GLN C  1 345 ? 104.801 10.076  37.352  1.00 38.28  ? 342 GLN C C   1 
ATOM   10012 O O   . GLN C  1 345 ? 103.890 10.873  37.093  1.00 35.45  ? 342 GLN C O   1 
ATOM   10013 C CB  . GLN C  1 345 ? 106.621 11.726  37.788  1.00 39.12  ? 342 GLN C CB  1 
ATOM   10014 C CG  . GLN C  1 345 ? 107.278 12.535  38.880  1.00 39.17  ? 342 GLN C CG  1 
ATOM   10015 C CD  . GLN C  1 345 ? 108.021 13.712  38.317  1.00 39.20  ? 342 GLN C CD  1 
ATOM   10016 O OE1 . GLN C  1 345 ? 108.746 13.588  37.322  1.00 45.10  ? 342 GLN C OE1 1 
ATOM   10017 N NE2 . GLN C  1 345 ? 107.875 14.853  38.949  1.00 38.42  ? 342 GLN C NE2 1 
ATOM   10018 N N   . GLY C  1 346 ? 104.860 8.846   36.858  1.00 36.34  ? 343 GLY C N   1 
ATOM   10019 C CA  . GLY C  1 346 ? 103.726 8.233   36.218  1.00 35.58  ? 343 GLY C CA  1 
ATOM   10020 C C   . GLY C  1 346 ? 103.962 7.863   34.792  1.00 37.46  ? 343 GLY C C   1 
ATOM   10021 O O   . GLY C  1 346 ? 103.048 7.398   34.130  1.00 40.03  ? 343 GLY C O   1 
ATOM   10022 N N   . ALA C  1 347 ? 105.178 8.058   34.302  1.00 39.66  ? 344 ALA C N   1 
ATOM   10023 C CA  . ALA C  1 347 ? 105.474 7.751   32.911  1.00 41.39  ? 344 ALA C CA  1 
ATOM   10024 C C   . ALA C  1 347 ? 105.611 6.235   32.722  1.00 41.02  ? 344 ALA C C   1 
ATOM   10025 O O   . ALA C  1 347 ? 105.870 5.518   33.682  1.00 45.50  ? 344 ALA C O   1 
ATOM   10026 C CB  . ALA C  1 347 ? 106.742 8.465   32.481  1.00 42.68  ? 344 ALA C CB  1 
ATOM   10027 N N   . THR C  1 348 ? 105.430 5.776   31.487  1.00 37.90  ? 345 THR C N   1 
ATOM   10028 C CA  . THR C  1 348 ? 105.523 4.364   31.113  1.00 36.81  ? 345 THR C CA  1 
ATOM   10029 C C   . THR C  1 348 ? 106.903 4.054   30.521  1.00 36.73  ? 345 THR C C   1 
ATOM   10030 O O   . THR C  1 348 ? 107.235 4.505   29.419  1.00 37.53  ? 345 THR C O   1 
ATOM   10031 C CB  . THR C  1 348 ? 104.448 4.011   30.047  1.00 37.40  ? 345 THR C CB  1 
ATOM   10032 O OG1 . THR C  1 348 ? 103.163 4.471   30.487  1.00 40.92  ? 345 THR C OG1 1 
ATOM   10033 C CG2 . THR C  1 348 ? 104.401 2.500   29.723  1.00 35.30  ? 345 THR C CG2 1 
ATOM   10034 N N   . ILE C  1 349 ? 107.693 3.244   31.220  1.00 35.37  ? 346 ILE C N   1 
ATOM   10035 C CA  . ILE C  1 349 ? 109.001 2.825   30.709  1.00 33.56  ? 346 ILE C CA  1 
ATOM   10036 C C   . ILE C  1 349 ? 108.820 1.677   29.705  1.00 32.34  ? 346 ILE C C   1 
ATOM   10037 O O   . ILE C  1 349 ? 108.964 0.512   30.053  1.00 31.48  ? 346 ILE C O   1 
ATOM   10038 C CB  . ILE C  1 349 ? 109.940 2.397   31.847  1.00 33.21  ? 346 ILE C CB  1 
ATOM   10039 C CG1 . ILE C  1 349 ? 110.037 3.482   32.922  1.00 34.89  ? 346 ILE C CG1 1 
ATOM   10040 C CG2 . ILE C  1 349 ? 111.330 2.054   31.324  1.00 32.60  ? 346 ILE C CG2 1 
ATOM   10041 C CD1 . ILE C  1 349 ? 110.615 4.804   32.466  1.00 36.09  ? 346 ILE C CD1 1 
ATOM   10042 N N   . VAL C  1 350 ? 108.520 2.019   28.457  1.00 30.79  ? 347 VAL C N   1 
ATOM   10043 C CA  . VAL C  1 350 ? 108.217 1.008   27.434  1.00 30.92  ? 347 VAL C CA  1 
ATOM   10044 C C   . VAL C  1 350 ? 109.402 0.087   27.216  1.00 32.37  ? 347 VAL C C   1 
ATOM   10045 O O   . VAL C  1 350 ? 109.238 -1.128  27.154  1.00 34.01  ? 347 VAL C O   1 
ATOM   10046 C CB  . VAL C  1 350 ? 107.826 1.644   26.078  1.00 30.66  ? 347 VAL C CB  1 
ATOM   10047 C CG1 . VAL C  1 350 ? 107.620 0.602   24.987  1.00 29.86  ? 347 VAL C CG1 1 
ATOM   10048 C CG2 . VAL C  1 350 ? 106.544 2.449   26.218  1.00 32.06  ? 347 VAL C CG2 1 
ATOM   10049 N N   . VAL C  1 351 ? 110.589 0.674   27.069  1.00 33.05  ? 348 VAL C N   1 
ATOM   10050 C CA  . VAL C  1 351 ? 111.845 -0.083  26.921  1.00 31.47  ? 348 VAL C CA  1 
ATOM   10051 C C   . VAL C  1 351 ? 112.765 0.414   28.026  1.00 32.38  ? 348 VAL C C   1 
ATOM   10052 O O   . VAL C  1 351 ? 113.014 1.602   28.128  1.00 34.83  ? 348 VAL C O   1 
ATOM   10053 C CB  . VAL C  1 351 ? 112.481 0.098   25.527  1.00 29.34  ? 348 VAL C CB  1 
ATOM   10054 C CG1 . VAL C  1 351 ? 113.801 -0.652  25.428  1.00 29.56  ? 348 VAL C CG1 1 
ATOM   10055 C CG2 . VAL C  1 351 ? 111.527 -0.371  24.432  1.00 27.89  ? 348 VAL C CG2 1 
ATOM   10056 N N   . ASP C  1 352 ? 113.224 -0.499  28.875  1.00 33.81  ? 349 ASP C N   1 
ATOM   10057 C CA  . ASP C  1 352 ? 114.008 -0.168  30.062  1.00 32.23  ? 349 ASP C CA  1 
ATOM   10058 C C   . ASP C  1 352 ? 115.417 -0.477  29.653  1.00 33.44  ? 349 ASP C C   1 
ATOM   10059 O O   . ASP C  1 352 ? 115.675 -1.533  29.068  1.00 36.01  ? 349 ASP C O   1 
ATOM   10060 C CB  . ASP C  1 352 ? 113.595 -1.033  31.268  1.00 31.04  ? 349 ASP C CB  1 
ATOM   10061 C CG  . ASP C  1 352 ? 114.036 -0.443  32.624  1.00 32.16  ? 349 ASP C CG  1 
ATOM   10062 O OD1 . ASP C  1 352 ? 114.930 0.415   32.714  1.00 33.57  ? 349 ASP C OD1 1 
ATOM   10063 O OD2 . ASP C  1 352 ? 113.484 -0.832  33.661  1.00 32.11  ? 349 ASP C OD2 1 
ATOM   10064 N N   . GLY C  1 353 ? 116.314 0.461   29.915  1.00 33.17  ? 350 GLY C N   1 
ATOM   10065 C CA  . GLY C  1 353 ? 117.739 0.250   29.719  1.00 32.61  ? 350 GLY C CA  1 
ATOM   10066 C C   . GLY C  1 353 ? 118.514 0.770   30.896  1.00 32.42  ? 350 GLY C C   1 
ATOM   10067 O O   . GLY C  1 353 ? 119.668 1.142   30.750  1.00 32.63  ? 350 GLY C O   1 
ATOM   10068 N N   . ARG C  1 354 ? 117.876 0.790   32.061  1.00 33.94  ? 351 ARG C N   1 
ATOM   10069 C CA  . ARG C  1 354 ? 118.547 1.138   33.312  1.00 36.51  ? 351 ARG C CA  1 
ATOM   10070 C C   . ARG C  1 354 ? 119.585 0.097   33.695  1.00 40.20  ? 351 ARG C C   1 
ATOM   10071 O O   . ARG C  1 354 ? 120.660 0.428   34.206  1.00 40.73  ? 351 ARG C O   1 
ATOM   10072 C CB  . ARG C  1 354 ? 117.538 1.283   34.451  1.00 33.97  ? 351 ARG C CB  1 
ATOM   10073 C CG  . ARG C  1 354 ? 116.897 2.652   34.466  1.00 33.38  ? 351 ARG C CG  1 
ATOM   10074 C CD  . ARG C  1 354 ? 115.791 2.733   35.487  1.00 32.34  ? 351 ARG C CD  1 
ATOM   10075 N NE  . ARG C  1 354 ? 114.626 1.958   35.073  1.00 31.14  ? 351 ARG C NE  1 
ATOM   10076 C CZ  . ARG C  1 354 ? 113.445 1.996   35.687  1.00 29.72  ? 351 ARG C CZ  1 
ATOM   10077 N NH1 . ARG C  1 354 ? 113.263 2.771   36.761  1.00 28.17  ? 351 ARG C NH1 1 
ATOM   10078 N NH2 . ARG C  1 354 ? 112.438 1.263   35.222  1.00 28.83  ? 351 ARG C NH2 1 
ATOM   10079 N N   . GLN C  1 355 ? 119.242 -1.160  33.441  1.00 46.12  ? 352 GLN C N   1 
ATOM   10080 C CA  . GLN C  1 355 ? 120.078 -2.296  33.766  1.00 51.88  ? 352 GLN C CA  1 
ATOM   10081 C C   . GLN C  1 355 ? 120.466 -2.949  32.444  1.00 49.74  ? 352 GLN C C   1 
ATOM   10082 O O   . GLN C  1 355 ? 119.959 -4.022  32.100  1.00 46.94  ? 352 GLN C O   1 
ATOM   10083 C CB  . GLN C  1 355 ? 119.314 -3.253  34.697  1.00 58.42  ? 352 GLN C CB  1 
ATOM   10084 C CG  . GLN C  1 355 ? 120.199 -3.984  35.693  1.00 65.77  ? 352 GLN C CG  1 
ATOM   10085 C CD  . GLN C  1 355 ? 120.417 -3.206  36.993  1.00 68.06  ? 352 GLN C CD  1 
ATOM   10086 O OE1 . GLN C  1 355 ? 120.608 -1.985  36.987  1.00 65.45  ? 352 GLN C OE1 1 
ATOM   10087 N NE2 . GLN C  1 355 ? 120.396 -3.921  38.118  1.00 71.32  ? 352 GLN C NE2 1 
ATOM   10088 N N   . PRO C  1 356 ? 121.362 -2.287  31.681  1.00 50.41  ? 353 PRO C N   1 
ATOM   10089 C CA  . PRO C  1 356 ? 121.722 -2.834  30.381  1.00 51.64  ? 353 PRO C CA  1 
ATOM   10090 C C   . PRO C  1 356 ? 122.393 -4.170  30.539  1.00 58.29  ? 353 PRO C C   1 
ATOM   10091 O O   . PRO C  1 356 ? 121.971 -5.104  29.881  1.00 63.66  ? 353 PRO C O   1 
ATOM   10092 C CB  . PRO C  1 356 ? 122.695 -1.820  29.801  1.00 47.53  ? 353 PRO C CB  1 
ATOM   10093 C CG  . PRO C  1 356 ? 123.248 -1.110  30.974  1.00 48.65  ? 353 PRO C CG  1 
ATOM   10094 C CD  . PRO C  1 356 ? 122.212 -1.143  32.049  1.00 48.25  ? 353 PRO C CD  1 
ATOM   10095 N N   . LYS C  1 357 ? 123.420 -4.262  31.397  1.00 63.94  ? 354 LYS C N   1 
ATOM   10096 C CA  . LYS C  1 357 ? 124.139 -5.518  31.645  1.00 71.79  ? 354 LYS C CA  1 
ATOM   10097 C C   . LYS C  1 357 ? 124.565 -6.223  30.348  1.00 76.23  ? 354 LYS C C   1 
ATOM   10098 O O   . LYS C  1 357 ? 124.951 -7.403  30.376  1.00 79.79  ? 354 LYS C O   1 
ATOM   10099 C CB  . LYS C  1 357 ? 123.243 -6.464  32.477  1.00 79.52  ? 354 LYS C CB  1 
ATOM   10100 C CG  . LYS C  1 357 ? 123.967 -7.481  33.367  1.00 78.69  ? 354 LYS C CG  1 
ATOM   10101 C CD  . LYS C  1 357 ? 123.012 -8.470  34.033  1.00 80.67  ? 354 LYS C CD  1 
ATOM   10102 C CE  . LYS C  1 357 ? 121.980 -7.818  34.944  1.00 85.02  ? 354 LYS C CE  1 
ATOM   10103 N NZ  . LYS C  1 357 ? 122.569 -7.046  36.074  1.00 87.58  ? 354 LYS C NZ  1 
ATOM   10104 N N   . VAL C  1 358 ? 124.476 -5.509  29.220  1.00 81.04  ? 355 VAL C N   1 
ATOM   10105 C CA  . VAL C  1 358 ? 124.686 -6.105  27.900  1.00 86.83  ? 355 VAL C CA  1 
ATOM   10106 C C   . VAL C  1 358 ? 126.152 -6.541  27.913  1.00 81.96  ? 355 VAL C C   1 
ATOM   10107 O O   . VAL C  1 358 ? 126.427 -7.719  27.687  1.00 78.16  ? 355 VAL C O   1 
ATOM   10108 C CB  . VAL C  1 358 ? 124.278 -5.157  26.714  1.00 88.54  ? 355 VAL C CB  1 
ATOM   10109 C CG1 . VAL C  1 358 ? 124.792 -5.647  25.358  1.00 83.81  ? 355 VAL C CG1 1 
ATOM   10110 C CG2 . VAL C  1 358 ? 122.762 -5.003  26.657  1.00 89.11  ? 355 VAL C CG2 1 
ATOM   10111 N N   . PRO C  1 359 ? 127.079 -5.618  28.265  1.00 72.32  ? 356 PRO C N   1 
ATOM   10112 C CA  . PRO C  1 359 ? 128.425 -6.103  28.504  1.00 69.83  ? 356 PRO C CA  1 
ATOM   10113 C C   . PRO C  1 359 ? 128.390 -7.069  29.685  1.00 68.28  ? 356 PRO C C   1 
ATOM   10114 O O   . PRO C  1 359 ? 127.661 -6.760  30.617  1.00 72.77  ? 356 PRO C O   1 
ATOM   10115 C CB  . PRO C  1 359 ? 129.190 -4.830  28.834  1.00 70.72  ? 356 PRO C CB  1 
ATOM   10116 C CG  . PRO C  1 359 ? 128.398 -3.715  28.243  1.00 66.73  ? 356 PRO C CG  1 
ATOM   10117 C CD  . PRO C  1 359 ? 126.994 -4.152  28.428  1.00 68.45  ? 356 PRO C CD  1 
ATOM   10118 N N   . ASN C  1 360 ? 129.111 -8.200  29.728  1.00 66.82  ? 357 ASN C N   1 
ATOM   10119 C CA  . ASN C  1 360 ? 130.259 -8.632  28.897  1.00 64.61  ? 357 ASN C CA  1 
ATOM   10120 C C   . ASN C  1 360 ? 131.536 -7.968  29.311  1.00 63.61  ? 357 ASN C C   1 
ATOM   10121 O O   . ASN C  1 360 ? 132.037 -7.077  28.645  1.00 65.48  ? 357 ASN C O   1 
ATOM   10122 C CB  . ASN C  1 360 ? 130.062 -8.518  27.387  1.00 67.56  ? 357 ASN C CB  1 
ATOM   10123 C CG  . ASN C  1 360 ? 128.734 -9.071  26.937  1.00 74.01  ? 357 ASN C CG  1 
ATOM   10124 O OD1 . ASN C  1 360 ? 127.916 -9.525  27.757  1.00 74.85  ? 357 ASN C OD1 1 
ATOM   10125 N ND2 . ASN C  1 360 ? 128.493 -9.018  25.632  1.00 74.66  ? 357 ASN C ND2 1 
ATOM   10126 N N   . HIS C  1 361 ? 132.062 -8.413  30.442  1.00 65.15  ? 358 HIS C N   1 
ATOM   10127 C CA  . HIS C  1 361 ? 133.381 -7.982  30.895  1.00 66.56  ? 358 HIS C CA  1 
ATOM   10128 C C   . HIS C  1 361 ? 133.455 -6.485  30.979  1.00 60.32  ? 358 HIS C C   1 
ATOM   10129 O O   . HIS C  1 361 ? 134.509 -5.900  30.704  1.00 62.51  ? 358 HIS C O   1 
ATOM   10130 C CB  . HIS C  1 361 ? 134.433 -8.505  29.923  1.00 70.93  ? 358 HIS C CB  1 
ATOM   10131 C CG  . HIS C  1 361 ? 134.050 -9.817  29.336  1.00 77.34  ? 358 HIS C CG  1 
ATOM   10132 N ND1 . HIS C  1 361 ? 133.827 -10.002 27.989  1.00 78.35  ? 358 HIS C ND1 1 
ATOM   10133 C CD2 . HIS C  1 361 ? 133.736 -10.986 29.937  1.00 76.57  ? 358 HIS C CD2 1 
ATOM   10134 C CE1 . HIS C  1 361 ? 133.453 -11.250 27.779  1.00 79.01  ? 358 HIS C CE1 1 
ATOM   10135 N NE2 . HIS C  1 361 ? 133.388 -11.868 28.945  1.00 78.95  ? 358 HIS C NE2 1 
ATOM   10136 N N   . GLU C  1 362 ? 132.332 -5.869  31.349  1.00 50.97  ? 359 GLU C N   1 
ATOM   10137 C CA  . GLU C  1 362 ? 132.286 -4.427  31.479  1.00 46.53  ? 359 GLU C CA  1 
ATOM   10138 C C   . GLU C  1 362 ? 131.300 -3.972  32.562  1.00 45.39  ? 359 GLU C C   1 
ATOM   10139 O O   . GLU C  1 362 ? 130.104 -3.945  32.330  1.00 45.79  ? 359 GLU C O   1 
ATOM   10140 C CB  . GLU C  1 362 ? 132.024 -3.772  30.109  1.00 40.87  ? 359 GLU C CB  1 
ATOM   10141 C CG  . GLU C  1 362 ? 133.298 -3.428  29.288  1.00 39.80  ? 359 GLU C CG  1 
ATOM   10142 C CD  . GLU C  1 362 ? 133.460 -4.183  27.982  1.00 33.86  ? 359 GLU C CD  1 
ATOM   10143 O OE1 . GLU C  1 362 ? 134.563 -4.314  27.454  1.00 28.36  ? 359 GLU C OE1 1 
ATOM   10144 O OE2 . GLU C  1 362 ? 132.460 -4.597  27.434  1.00 35.12  ? 359 GLU C OE2 1 
ATOM   10145 N N   . ASN C  1 363 ? 131.842 -3.667  33.752  1.00 41.54  ? 360 ASN C N   1 
ATOM   10146 C CA  . ASN C  1 363 ? 131.236 -2.736  34.722  1.00 37.92  ? 360 ASN C CA  1 
ATOM   10147 C C   . ASN C  1 363 ? 131.805 -1.284  34.540  1.00 36.66  ? 360 ASN C C   1 
ATOM   10148 O O   . ASN C  1 363 ? 132.348 -0.643  35.447  1.00 32.52  ? 360 ASN C O   1 
ATOM   10149 C CB  . ASN C  1 363 ? 131.410 -3.241  36.153  1.00 38.94  ? 360 ASN C CB  1 
ATOM   10150 C CG  . ASN C  1 363 ? 132.881 -3.208  36.664  1.00 36.97  ? 360 ASN C CG  1 
ATOM   10151 O OD1 . ASN C  1 363 ? 133.843 -3.122  35.911  1.00 33.43  ? 360 ASN C OD1 1 
ATOM   10152 N ND2 . ASN C  1 363 ? 133.029 -3.302  37.963  1.00 36.04  ? 360 ASN C ND2 1 
ATOM   10153 N N   . GLY C  1 364 ? 131.687 -0.794  33.314  1.00 35.28  ? 361 GLY C N   1 
ATOM   10154 C CA  . GLY C  1 364 ? 131.881 0.604   33.010  1.00 33.66  ? 361 GLY C CA  1 
ATOM   10155 C C   . GLY C  1 364 ? 130.535 1.268   33.019  1.00 31.19  ? 361 GLY C C   1 
ATOM   10156 O O   . GLY C  1 364 ? 129.582 0.698   33.530  1.00 33.32  ? 361 GLY C O   1 
ATOM   10157 N N   . PHE C  1 365 ? 130.443 2.449   32.419  1.00 29.00  ? 362 PHE C N   1 
ATOM   10158 C CA  . PHE C  1 365 ? 129.326 3.359   32.688  1.00 27.61  ? 362 PHE C CA  1 
ATOM   10159 C C   . PHE C  1 365 ? 128.236 3.270   31.623  1.00 24.97  ? 362 PHE C C   1 
ATOM   10160 O O   . PHE C  1 365 ? 127.800 4.281   31.087  1.00 24.98  ? 362 PHE C O   1 
ATOM   10161 C CB  . PHE C  1 365 ? 129.826 4.806   32.831  1.00 29.25  ? 362 PHE C CB  1 
ATOM   10162 C CG  . PHE C  1 365 ? 131.130 4.949   33.589  1.00 30.95  ? 362 PHE C CG  1 
ATOM   10163 C CD1 . PHE C  1 365 ? 131.313 4.342   34.832  1.00 30.62  ? 362 PHE C CD1 1 
ATOM   10164 C CD2 . PHE C  1 365 ? 132.178 5.731   33.064  1.00 30.78  ? 362 PHE C CD2 1 
ATOM   10165 C CE1 . PHE C  1 365 ? 132.507 4.493   35.525  1.00 30.26  ? 362 PHE C CE1 1 
ATOM   10166 C CE2 . PHE C  1 365 ? 133.366 5.888   33.763  1.00 30.28  ? 362 PHE C CE2 1 
ATOM   10167 C CZ  . PHE C  1 365 ? 133.531 5.268   34.995  1.00 30.15  ? 362 PHE C CZ  1 
ATOM   10168 N N   . PHE C  1 366 ? 127.776 2.051   31.356  1.00 23.13  ? 363 PHE C N   1 
ATOM   10169 C CA  . PHE C  1 366 ? 126.761 1.782   30.329  1.00 21.66  ? 363 PHE C CA  1 
ATOM   10170 C C   . PHE C  1 366 ? 125.292 2.065   30.743  1.00 21.58  ? 363 PHE C C   1 
ATOM   10171 O O   . PHE C  1 366 ? 124.867 1.829   31.886  1.00 19.86  ? 363 PHE C O   1 
ATOM   10172 C CB  . PHE C  1 366 ? 126.909 0.367   29.812  1.00 20.67  ? 363 PHE C CB  1 
ATOM   10173 C CG  . PHE C  1 366 ? 128.116 0.183   28.959  1.00 21.43  ? 363 PHE C CG  1 
ATOM   10174 C CD1 . PHE C  1 366 ? 128.109 0.585   27.622  1.00 22.31  ? 363 PHE C CD1 1 
ATOM   10175 C CD2 . PHE C  1 366 ? 129.285 -0.343  29.482  1.00 21.30  ? 363 PHE C CD2 1 
ATOM   10176 C CE1 . PHE C  1 366 ? 129.246 0.429   26.808  1.00 21.88  ? 363 PHE C CE1 1 
ATOM   10177 C CE2 . PHE C  1 366 ? 130.413 -0.494  28.683  1.00 21.38  ? 363 PHE C CE2 1 
ATOM   10178 C CZ  . PHE C  1 366 ? 130.398 -0.110  27.345  1.00 21.33  ? 363 PHE C CZ  1 
ATOM   10179 N N   . VAL C  1 367 ? 124.549 2.612   29.782  1.00 21.09  ? 364 VAL C N   1 
ATOM   10180 C CA  . VAL C  1 367 ? 123.117 2.783   29.864  1.00 21.22  ? 364 VAL C CA  1 
ATOM   10181 C C   . VAL C  1 367 ? 122.555 2.357   28.501  1.00 22.37  ? 364 VAL C C   1 
ATOM   10182 O O   . VAL C  1 367 ? 123.043 2.822   27.463  1.00 22.81  ? 364 VAL C O   1 
ATOM   10183 C CB  . VAL C  1 367 ? 122.742 4.248   30.176  1.00 21.11  ? 364 VAL C CB  1 
ATOM   10184 C CG1 . VAL C  1 367 ? 121.229 4.430   30.242  1.00 21.26  ? 364 VAL C CG1 1 
ATOM   10185 C CG2 . VAL C  1 367 ? 123.376 4.713   31.481  1.00 20.79  ? 364 VAL C CG2 1 
ATOM   10186 N N   . GLY C  1 368 ? 121.548 1.472   28.512  1.00 22.97  ? 365 GLY C N   1 
ATOM   10187 C CA  . GLY C  1 368 ? 120.902 0.967   27.282  1.00 23.51  ? 365 GLY C CA  1 
ATOM   10188 C C   . GLY C  1 368 ? 119.863 1.934   26.744  1.00 24.50  ? 365 GLY C C   1 
ATOM   10189 O O   . GLY C  1 368 ? 119.446 2.855   27.443  1.00 25.04  ? 365 GLY C O   1 
ATOM   10190 N N   . GLY C  1 369 ? 119.453 1.746   25.498  1.00 25.35  ? 366 GLY C N   1 
ATOM   10191 C CA  . GLY C  1 369 ? 118.451 2.629   24.886  1.00 27.40  ? 366 GLY C CA  1 
ATOM   10192 C C   . GLY C  1 369 ? 117.099 2.529   25.581  1.00 29.45  ? 366 GLY C C   1 
ATOM   10193 O O   . GLY C  1 369 ? 116.538 1.445   25.678  1.00 31.55  ? 366 GLY C O   1 
ATOM   10194 N N   . THR C  1 370 ? 116.573 3.643   26.085  1.00 30.65  ? 367 THR C N   1 
ATOM   10195 C CA  . THR C  1 370 ? 115.300 3.604   26.816  1.00 31.54  ? 367 THR C CA  1 
ATOM   10196 C C   . THR C  1 370 ? 114.194 4.492   26.178  1.00 31.46  ? 367 THR C C   1 
ATOM   10197 O O   . THR C  1 370 ? 114.454 5.602   25.697  1.00 29.04  ? 367 THR C O   1 
ATOM   10198 C CB  . THR C  1 370 ? 115.493 3.887   28.329  1.00 31.72  ? 367 THR C CB  1 
ATOM   10199 O OG1 . THR C  1 370 ? 115.290 5.265   28.620  1.00 35.92  ? 367 THR C OG1 1 
ATOM   10200 C CG2 . THR C  1 370 ? 116.865 3.520   28.759  1.00 31.21  ? 367 THR C CG2 1 
ATOM   10201 N N   . LEU C  1 371 ? 112.969 3.959   26.168  1.00 31.15  ? 368 LEU C N   1 
ATOM   10202 C CA  . LEU C  1 371 ? 111.793 4.643   25.643  1.00 30.33  ? 368 LEU C CA  1 
ATOM   10203 C C   . LEU C  1 371 ? 110.837 4.904   26.802  1.00 29.71  ? 368 LEU C C   1 
ATOM   10204 O O   . LEU C  1 371 ? 110.515 3.985   27.566  1.00 31.26  ? 368 LEU C O   1 
ATOM   10205 C CB  . LEU C  1 371 ? 111.105 3.788   24.589  1.00 30.89  ? 368 LEU C CB  1 
ATOM   10206 C CG  . LEU C  1 371 ? 110.455 4.567   23.442  1.00 32.58  ? 368 LEU C CG  1 
ATOM   10207 C CD1 . LEU C  1 371 ? 109.697 3.645   22.482  1.00 32.02  ? 368 LEU C CD1 1 
ATOM   10208 C CD2 . LEU C  1 371 ? 109.526 5.647   23.969  1.00 33.44  ? 368 LEU C CD2 1 
ATOM   10209 N N   . ILE C  1 372 ? 110.416 6.161   26.948  1.00 27.51  ? 369 ILE C N   1 
ATOM   10210 C CA  . ILE C  1 372 ? 109.502 6.562   27.993  1.00 25.92  ? 369 ILE C CA  1 
ATOM   10211 C C   . ILE C  1 372 ? 108.271 7.214   27.372  1.00 27.07  ? 369 ILE C C   1 
ATOM   10212 O O   . ILE C  1 372 ? 108.384 8.215   26.689  1.00 27.44  ? 369 ILE C O   1 
ATOM   10213 C CB  . ILE C  1 372 ? 110.170 7.526   28.953  1.00 25.50  ? 369 ILE C CB  1 
ATOM   10214 C CG1 . ILE C  1 372 ? 111.479 6.918   29.478  1.00 26.01  ? 369 ILE C CG1 1 
ATOM   10215 C CG2 . ILE C  1 372 ? 109.227 7.821   30.104  1.00 25.95  ? 369 ILE C CG2 1 
ATOM   10216 C CD1 . ILE C  1 372 ? 112.292 7.822   30.393  1.00 25.75  ? 369 ILE C CD1 1 
ATOM   10217 N N   . ASP C  1 373 ? 107.092 6.638   27.618  1.00 27.41  ? 370 ASP C N   1 
ATOM   10218 C CA  . ASP C  1 373 ? 105.842 7.099   27.016  1.00 26.03  ? 370 ASP C CA  1 
ATOM   10219 C C   . ASP C  1 373 ? 104.959 7.736   28.057  1.00 24.87  ? 370 ASP C C   1 
ATOM   10220 O O   . ASP C  1 373 ? 105.170 7.575   29.246  1.00 22.95  ? 370 ASP C O   1 
ATOM   10221 C CB  . ASP C  1 373 ? 105.120 5.929   26.376  1.00 28.01  ? 370 ASP C CB  1 
ATOM   10222 C CG  . ASP C  1 373 ? 103.949 6.352   25.481  1.00 29.82  ? 370 ASP C CG  1 
ATOM   10223 O OD1 . ASP C  1 373 ? 103.590 7.548   25.404  1.00 28.81  ? 370 ASP C OD1 1 
ATOM   10224 O OD2 . ASP C  1 373 ? 103.362 5.458   24.852  1.00 33.36  ? 370 ASP C OD2 1 
ATOM   10225 N N   . HIS C  1 374 ? 103.992 8.503   27.574  1.00 25.87  ? 371 HIS C N   1 
ATOM   10226 C CA  . HIS C  1 374 ? 103.033 9.257   28.396  1.00 28.07  ? 371 HIS C CA  1 
ATOM   10227 C C   . HIS C  1 374 ? 103.709 10.244  29.324  1.00 27.70  ? 371 HIS C C   1 
ATOM   10228 O O   . HIS C  1 374 ? 103.388 10.298  30.507  1.00 30.00  ? 371 HIS C O   1 
ATOM   10229 C CB  . HIS C  1 374 ? 102.059 8.326   29.148  1.00 29.20  ? 371 HIS C CB  1 
ATOM   10230 C CG  . HIS C  1 374 ? 101.376 7.358   28.246  1.00 32.03  ? 371 HIS C CG  1 
ATOM   10231 N ND1 . HIS C  1 374 ? 101.748 6.032   28.159  1.00 35.29  ? 371 HIS C ND1 1 
ATOM   10232 C CD2 . HIS C  1 374 ? 100.417 7.543   27.310  1.00 33.27  ? 371 HIS C CD2 1 
ATOM   10233 C CE1 . HIS C  1 374 ? 101.016 5.431   27.236  1.00 36.22  ? 371 HIS C CE1 1 
ATOM   10234 N NE2 . HIS C  1 374 ? 100.207 6.329   26.700  1.00 35.72  ? 371 HIS C NE2 1 
ATOM   10235 N N   . VAL C  1 375 ? 104.628 11.041  28.783  1.00 28.25  ? 372 VAL C N   1 
ATOM   10236 C CA  . VAL C  1 375 ? 105.352 11.997  29.621  1.00 29.28  ? 372 VAL C CA  1 
ATOM   10237 C C   . VAL C  1 375 ? 104.639 13.307  29.510  1.00 28.66  ? 372 VAL C C   1 
ATOM   10238 O O   . VAL C  1 375 ? 104.022 13.598  28.484  1.00 28.56  ? 372 VAL C O   1 
ATOM   10239 C CB  . VAL C  1 375 ? 106.870 12.151  29.319  1.00 29.77  ? 372 VAL C CB  1 
ATOM   10240 C CG1 . VAL C  1 375 ? 107.496 10.822  28.915  1.00 29.68  ? 372 VAL C CG1 1 
ATOM   10241 C CG2 . VAL C  1 375 ? 107.137 13.192  28.262  1.00 30.57  ? 372 VAL C CG2 1 
ATOM   10242 N N   . THR C  1 376 ? 104.744 14.090  30.573  1.00 27.87  ? 373 THR C N   1 
ATOM   10243 C CA  . THR C  1 376 ? 103.979 15.300  30.699  1.00 28.10  ? 373 THR C CA  1 
ATOM   10244 C C   . THR C  1 376 ? 104.892 16.466  31.048  1.00 28.37  ? 373 THR C C   1 
ATOM   10245 O O   . THR C  1 376 ? 105.977 16.266  31.576  1.00 28.49  ? 373 THR C O   1 
ATOM   10246 C CB  . THR C  1 376 ? 102.864 15.146  31.751  1.00 27.80  ? 373 THR C CB  1 
ATOM   10247 O OG1 . THR C  1 376 ? 103.413 14.774  33.022  1.00 27.50  ? 373 THR C OG1 1 
ATOM   10248 C CG2 . THR C  1 376 ? 101.891 14.104  31.314  1.00 26.90  ? 373 THR C CG2 1 
ATOM   10249 N N   . PRO C  1 377 ? 104.451 17.700  30.762  1.00 29.52  ? 374 PRO C N   1 
ATOM   10250 C CA  . PRO C  1 377 ? 105.280 18.870  31.046  1.00 29.71  ? 374 PRO C CA  1 
ATOM   10251 C C   . PRO C  1 377 ? 105.586 19.109  32.512  1.00 30.02  ? 374 PRO C C   1 
ATOM   10252 O O   . PRO C  1 377 ? 106.442 19.921  32.807  1.00 30.09  ? 374 PRO C O   1 
ATOM   10253 C CB  . PRO C  1 377 ? 104.445 20.038  30.497  1.00 29.76  ? 374 PRO C CB  1 
ATOM   10254 C CG  . PRO C  1 377 ? 103.528 19.417  29.498  1.00 29.73  ? 374 PRO C CG  1 
ATOM   10255 C CD  . PRO C  1 377 ? 103.207 18.079  30.070  1.00 29.96  ? 374 PRO C CD  1 
ATOM   10256 N N   . GLU C  1 378 ? 104.895 18.415  33.415  1.00 31.98  ? 375 GLU C N   1 
ATOM   10257 C CA  . GLU C  1 378 ? 105.092 18.587  34.870  1.00 33.59  ? 375 GLU C CA  1 
ATOM   10258 C C   . GLU C  1 378 ? 106.154 17.618  35.420  1.00 32.31  ? 375 GLU C C   1 
ATOM   10259 O O   . GLU C  1 378 ? 106.522 17.683  36.592  1.00 30.23  ? 375 GLU C O   1 
ATOM   10260 C CB  . GLU C  1 378 ? 103.773 18.512  35.679  1.00 35.61  ? 375 GLU C CB  1 
ATOM   10261 C CG  . GLU C  1 378 ? 102.619 17.730  35.064  1.00 39.70  ? 375 GLU C CG  1 
ATOM   10262 C CD  . GLU C  1 378 ? 101.947 18.454  33.872  1.00 44.38  ? 375 GLU C CD  1 
ATOM   10263 O OE1 . GLU C  1 378 ? 101.345 17.749  33.011  1.00 45.11  ? 375 GLU C OE1 1 
ATOM   10264 O OE2 . GLU C  1 378 ? 102.023 19.719  33.780  1.00 42.25  ? 375 GLU C OE2 1 
ATOM   10265 N N   . MET C  1 379 ? 106.669 16.749  34.554  1.00 31.61  ? 376 MET C N   1 
ATOM   10266 C CA  . MET C  1 379 ? 107.746 15.845  34.915  1.00 30.39  ? 376 MET C CA  1 
ATOM   10267 C C   . MET C  1 379 ? 109.112 16.510  34.878  1.00 30.86  ? 376 MET C C   1 
ATOM   10268 O O   . MET C  1 379 ? 109.509 17.053  33.858  1.00 30.81  ? 376 MET C O   1 
ATOM   10269 C CB  . MET C  1 379 ? 107.752 14.661  33.977  1.00 29.27  ? 376 MET C CB  1 
ATOM   10270 C CG  . MET C  1 379 ? 106.469 13.879  34.039  1.00 30.04  ? 376 MET C CG  1 
ATOM   10271 S SD  . MET C  1 379 ? 106.549 12.356  33.093  1.00 31.12  ? 376 MET C SD  1 
ATOM   10272 C CE  . MET C  1 379 ? 104.895 11.715  33.375  1.00 30.94  ? 376 MET C CE  1 
ATOM   10273 N N   . THR C  1 380 ? 109.834 16.425  35.992  1.00 31.89  ? 377 THR C N   1 
ATOM   10274 C CA  . THR C  1 380 ? 111.222 16.879  36.093  1.00 32.41  ? 377 THR C CA  1 
ATOM   10275 C C   . THR C  1 380 ? 112.103 16.345  34.963  1.00 32.99  ? 377 THR C C   1 
ATOM   10276 O O   . THR C  1 380 ? 112.866 17.107  34.364  1.00 33.22  ? 377 THR C O   1 
ATOM   10277 C CB  . THR C  1 380 ? 111.832 16.458  37.444  1.00 31.48  ? 377 THR C CB  1 
ATOM   10278 O OG1 . THR C  1 380 ? 110.946 16.871  38.481  1.00 29.45  ? 377 THR C OG1 1 
ATOM   10279 C CG2 . THR C  1 380 ? 113.191 17.117  37.670  1.00 31.73  ? 377 THR C CG2 1 
ATOM   10280 N N   . SER C  1 381 ? 111.985 15.050  34.675  1.00 33.16  ? 378 SER C N   1 
ATOM   10281 C CA  . SER C  1 381 ? 112.765 14.421  33.605  1.00 34.59  ? 378 SER C CA  1 
ATOM   10282 C C   . SER C  1 381 ? 112.512 15.021  32.228  1.00 34.72  ? 378 SER C C   1 
ATOM   10283 O O   . SER C  1 381 ? 113.377 14.961  31.354  1.00 40.23  ? 378 SER C O   1 
ATOM   10284 C CB  . SER C  1 381 ? 112.443 12.938  33.537  1.00 36.31  ? 378 SER C CB  1 
ATOM   10285 O OG  . SER C  1 381 ? 111.053 12.751  33.364  1.00 37.93  ? 378 SER C OG  1 
ATOM   10286 N N   . TYR C  1 382 ? 111.312 15.554  32.025  1.00 32.36  ? 379 TYR C N   1 
ATOM   10287 C CA  . TYR C  1 382 ? 110.965 16.273  30.801  1.00 30.31  ? 379 TYR C CA  1 
ATOM   10288 C C   . TYR C  1 382 ? 111.510 17.681  30.814  1.00 31.41  ? 379 TYR C C   1 
ATOM   10289 O O   . TYR C  1 382 ? 111.983 18.161  29.799  1.00 33.86  ? 379 TYR C O   1 
ATOM   10290 C CB  . TYR C  1 382 ? 109.452 16.357  30.616  1.00 28.72  ? 379 TYR C CB  1 
ATOM   10291 C CG  . TYR C  1 382 ? 109.045 17.326  29.549  1.00 26.09  ? 379 TYR C CG  1 
ATOM   10292 C CD1 . TYR C  1 382 ? 109.100 16.972  28.222  1.00 25.91  ? 379 TYR C CD1 1 
ATOM   10293 C CD2 . TYR C  1 382 ? 108.635 18.607  29.866  1.00 25.86  ? 379 TYR C CD2 1 
ATOM   10294 C CE1 . TYR C  1 382 ? 108.736 17.869  27.226  1.00 26.15  ? 379 TYR C CE1 1 
ATOM   10295 C CE2 . TYR C  1 382 ? 108.281 19.525  28.883  1.00 25.28  ? 379 TYR C CE2 1 
ATOM   10296 C CZ  . TYR C  1 382 ? 108.330 19.154  27.560  1.00 25.12  ? 379 TYR C CZ  1 
ATOM   10297 O OH  . TYR C  1 382 ? 107.989 20.046  26.573  1.00 23.36  ? 379 TYR C OH  1 
ATOM   10298 N N   . GLN C  1 383 ? 111.395 18.365  31.941  1.00 31.66  ? 380 GLN C N   1 
ATOM   10299 C CA  . GLN C  1 383 ? 111.875 19.731  32.032  1.00 32.95  ? 380 GLN C CA  1 
ATOM   10300 C C   . GLN C  1 383 ? 113.385 19.778  31.875  1.00 32.57  ? 380 GLN C C   1 
ATOM   10301 O O   . GLN C  1 383 ? 113.908 20.651  31.189  1.00 33.23  ? 380 GLN C O   1 
ATOM   10302 C CB  . GLN C  1 383 ? 111.479 20.360  33.364  1.00 36.45  ? 380 GLN C CB  1 
ATOM   10303 C CG  . GLN C  1 383 ? 109.972 20.551  33.543  1.00 38.24  ? 380 GLN C CG  1 
ATOM   10304 C CD  . GLN C  1 383 ? 109.526 20.543  35.016  1.00 39.04  ? 380 GLN C CD  1 
ATOM   10305 O OE1 . GLN C  1 383 ? 110.212 21.067  35.908  1.00 39.46  ? 380 GLN C OE1 1 
ATOM   10306 N NE2 . GLN C  1 383 ? 108.364 19.948  35.267  1.00 38.34  ? 380 GLN C NE2 1 
ATOM   10307 N N   . GLU C  1 384 ? 114.078 18.821  32.484  1.00 31.34  ? 381 GLU C N   1 
ATOM   10308 C CA  . GLU C  1 384 ? 115.530 18.849  32.529  1.00 30.20  ? 381 GLU C CA  1 
ATOM   10309 C C   . GLU C  1 384 ? 116.180 18.037  31.407  1.00 27.94  ? 381 GLU C C   1 
ATOM   10310 O O   . GLU C  1 384 ? 115.581 17.100  30.884  1.00 23.76  ? 381 GLU C O   1 
ATOM   10311 C CB  . GLU C  1 384 ? 116.004 18.394  33.905  1.00 31.64  ? 381 GLU C CB  1 
ATOM   10312 C CG  . GLU C  1 384 ? 115.612 19.343  35.038  1.00 32.77  ? 381 GLU C CG  1 
ATOM   10313 C CD  . GLU C  1 384 ? 116.141 18.884  36.389  1.00 35.67  ? 381 GLU C CD  1 
ATOM   10314 O OE1 . GLU C  1 384 ? 116.875 17.877  36.430  1.00 36.45  ? 381 GLU C OE1 1 
ATOM   10315 O OE2 . GLU C  1 384 ? 115.840 19.524  37.425  1.00 39.12  ? 381 GLU C OE2 1 
ATOM   10316 N N   . GLU C  1 385 ? 117.407 18.440  31.043  1.00 28.39  ? 382 GLU C N   1 
ATOM   10317 C CA  . GLU C  1 385 ? 118.206 17.763  30.015  1.00 27.20  ? 382 GLU C CA  1 
ATOM   10318 C C   . GLU C  1 385 ? 118.854 16.521  30.618  1.00 25.73  ? 382 GLU C C   1 
ATOM   10319 O O   . GLU C  1 385 ? 119.658 16.633  31.544  1.00 24.56  ? 382 GLU C O   1 
ATOM   10320 C CB  . GLU C  1 385 ? 119.297 18.696  29.454  1.00 28.34  ? 382 GLU C CB  1 
ATOM   10321 C CG  . GLU C  1 385 ? 120.132 18.074  28.314  1.00 29.91  ? 382 GLU C CG  1 
ATOM   10322 C CD  . GLU C  1 385 ? 121.168 19.008  27.684  1.00 29.82  ? 382 GLU C CD  1 
ATOM   10323 O OE1 . GLU C  1 385 ? 121.273 19.033  26.441  1.00 32.07  ? 382 GLU C OE1 1 
ATOM   10324 O OE2 . GLU C  1 385 ? 121.882 19.727  28.409  1.00 29.25  ? 382 GLU C OE2 1 
ATOM   10325 N N   . ILE C  1 386 ? 118.512 15.358  30.075  1.00 24.66  ? 383 ILE C N   1 
ATOM   10326 C CA  . ILE C  1 386 ? 118.957 14.078  30.611  1.00 25.92  ? 383 ILE C CA  1 
ATOM   10327 C C   . ILE C  1 386 ? 120.354 13.771  30.117  1.00 25.67  ? 383 ILE C C   1 
ATOM   10328 O O   . ILE C  1 386 ? 121.211 13.294  30.854  1.00 25.83  ? 383 ILE C O   1 
ATOM   10329 C CB  . ILE C  1 386 ? 118.012 12.925  30.179  1.00 27.45  ? 383 ILE C CB  1 
ATOM   10330 C CG1 . ILE C  1 386 ? 116.620 13.089  30.808  1.00 27.73  ? 383 ILE C CG1 1 
ATOM   10331 C CG2 . ILE C  1 386 ? 118.572 11.568  30.602  1.00 28.89  ? 383 ILE C CG2 1 
ATOM   10332 C CD1 . ILE C  1 386 ? 115.540 12.193  30.227  1.00 27.71  ? 383 ILE C CD1 1 
ATOM   10333 N N   . PHE C  1 387 ? 120.544 14.000  28.833  1.00 26.50  ? 384 PHE C N   1 
ATOM   10334 C CA  . PHE C  1 387 ? 121.844 13.881  28.181  1.00 26.80  ? 384 PHE C CA  1 
ATOM   10335 C C   . PHE C  1 387 ? 122.333 12.443  28.200  1.00 24.81  ? 384 PHE C C   1 
ATOM   10336 O O   . PHE C  1 387 ? 123.511 12.185  28.426  1.00 24.74  ? 384 PHE C O   1 
ATOM   10337 C CB  . PHE C  1 387 ? 122.864 14.863  28.803  1.00 27.79  ? 384 PHE C CB  1 
ATOM   10338 C CG  . PHE C  1 387 ? 123.868 15.398  27.818  1.00 28.60  ? 384 PHE C CG  1 
ATOM   10339 C CD1 . PHE C  1 387 ? 123.491 16.343  26.880  1.00 28.67  ? 384 PHE C CD1 1 
ATOM   10340 C CD2 . PHE C  1 387 ? 125.200 14.968  27.838  1.00 29.52  ? 384 PHE C CD2 1 
ATOM   10341 C CE1 . PHE C  1 387 ? 124.411 16.838  25.965  1.00 29.57  ? 384 PHE C CE1 1 
ATOM   10342 C CE2 . PHE C  1 387 ? 126.127 15.464  26.926  1.00 29.50  ? 384 PHE C CE2 1 
ATOM   10343 C CZ  . PHE C  1 387 ? 125.730 16.396  25.983  1.00 29.38  ? 384 PHE C CZ  1 
ATOM   10344 N N   . GLY C  1 388 ? 121.410 11.522  27.942  1.00 23.60  ? 385 GLY C N   1 
ATOM   10345 C CA  . GLY C  1 388 ? 121.721 10.088  27.843  1.00 24.08  ? 385 GLY C CA  1 
ATOM   10346 C C   . GLY C  1 388 ? 120.908 9.447   26.739  1.00 24.11  ? 385 GLY C C   1 
ATOM   10347 O O   . GLY C  1 388 ? 120.226 10.142  26.016  1.00 25.01  ? 385 GLY C O   1 
ATOM   10348 N N   . PRO C  1 389 ? 120.947 8.116   26.612  1.00 24.85  ? 386 PRO C N   1 
ATOM   10349 C CA  . PRO C  1 389 ? 120.219 7.446   25.526  1.00 25.20  ? 386 PRO C CA  1 
ATOM   10350 C C   . PRO C  1 389 ? 118.718 7.196   25.819  1.00 24.56  ? 386 PRO C C   1 
ATOM   10351 O O   . PRO C  1 389 ? 118.239 6.068   25.822  1.00 23.06  ? 386 PRO C O   1 
ATOM   10352 C CB  . PRO C  1 389 ? 121.000 6.150   25.367  1.00 25.52  ? 386 PRO C CB  1 
ATOM   10353 C CG  . PRO C  1 389 ? 121.433 5.832   26.768  1.00 25.31  ? 386 PRO C CG  1 
ATOM   10354 C CD  . PRO C  1 389 ? 121.731 7.158   27.413  1.00 25.23  ? 386 PRO C CD  1 
ATOM   10355 N N   . VAL C  1 390 ? 117.979 8.280   25.991  1.00 24.70  ? 387 VAL C N   1 
ATOM   10356 C CA  . VAL C  1 390 ? 116.593 8.232   26.413  1.00 24.64  ? 387 VAL C CA  1 
ATOM   10357 C C   . VAL C  1 390 ? 115.767 9.013   25.408  1.00 25.51  ? 387 VAL C C   1 
ATOM   10358 O O   . VAL C  1 390 ? 116.186 10.068  24.986  1.00 28.05  ? 387 VAL C O   1 
ATOM   10359 C CB  . VAL C  1 390 ? 116.443 8.859   27.804  1.00 23.55  ? 387 VAL C CB  1 
ATOM   10360 C CG1 . VAL C  1 390 ? 115.057 8.635   28.367  1.00 23.96  ? 387 VAL C CG1 1 
ATOM   10361 C CG2 . VAL C  1 390 ? 117.432 8.237   28.752  1.00 23.84  ? 387 VAL C CG2 1 
ATOM   10362 N N   . LEU C  1 391 ? 114.613 8.475   25.017  1.00 26.09  ? 388 LEU C N   1 
ATOM   10363 C CA  . LEU C  1 391 ? 113.639 9.173   24.181  1.00 24.97  ? 388 LEU C CA  1 
ATOM   10364 C C   . LEU C  1 391 ? 112.325 9.203   24.949  1.00 25.76  ? 388 LEU C C   1 
ATOM   10365 O O   . LEU C  1 391 ? 111.926 8.216   25.552  1.00 26.77  ? 388 LEU C O   1 
ATOM   10366 C CB  . LEU C  1 391 ? 113.467 8.461   22.833  1.00 24.03  ? 388 LEU C CB  1 
ATOM   10367 C CG  . LEU C  1 391 ? 112.501 9.060   21.802  1.00 23.03  ? 388 LEU C CG  1 
ATOM   10368 C CD1 . LEU C  1 391 ? 112.739 10.537  21.649  1.00 23.97  ? 388 LEU C CD1 1 
ATOM   10369 C CD2 . LEU C  1 391 ? 112.679 8.437   20.436  1.00 22.28  ? 388 LEU C CD2 1 
ATOM   10370 N N   . GLN C  1 392 ? 111.670 10.353  24.944  1.00 26.63  ? 389 GLN C N   1 
ATOM   10371 C CA  . GLN C  1 392 ? 110.449 10.573  25.691  1.00 26.08  ? 389 GLN C CA  1 
ATOM   10372 C C   . GLN C  1 392 ? 109.386 10.929  24.700  1.00 25.43  ? 389 GLN C C   1 
ATOM   10373 O O   . GLN C  1 392 ? 109.670 11.568  23.709  1.00 25.47  ? 389 GLN C O   1 
ATOM   10374 C CB  . GLN C  1 392 ? 110.640 11.707  26.689  1.00 26.58  ? 389 GLN C CB  1 
ATOM   10375 C CG  . GLN C  1 392 ? 111.578 11.352  27.824  1.00 27.47  ? 389 GLN C CG  1 
ATOM   10376 C CD  . GLN C  1 392 ? 111.854 12.532  28.723  1.00 29.38  ? 389 GLN C CD  1 
ATOM   10377 O OE1 . GLN C  1 392 ? 112.411 13.520  28.282  1.00 33.07  ? 389 GLN C OE1 1 
ATOM   10378 N NE2 . GLN C  1 392 ? 111.480 12.435  29.989  1.00 30.55  ? 389 GLN C NE2 1 
ATOM   10379 N N   . VAL C  1 393 ? 108.162 10.493  24.956  1.00 26.25  ? 390 VAL C N   1 
ATOM   10380 C CA  . VAL C  1 393 ? 107.050 10.765  24.061  1.00 25.00  ? 390 VAL C CA  1 
ATOM   10381 C C   . VAL C  1 393 ? 105.979 11.494  24.835  1.00 24.05  ? 390 VAL C C   1 
ATOM   10382 O O   . VAL C  1 393 ? 105.608 11.098  25.936  1.00 22.71  ? 390 VAL C O   1 
ATOM   10383 C CB  . VAL C  1 393 ? 106.457 9.492   23.452  1.00 24.94  ? 390 VAL C CB  1 
ATOM   10384 C CG1 . VAL C  1 393 ? 105.680 9.824   22.190  1.00 24.89  ? 390 VAL C CG1 1 
ATOM   10385 C CG2 . VAL C  1 393 ? 107.560 8.492   23.140  1.00 25.12  ? 390 VAL C CG2 1 
ATOM   10386 N N   . VAL C  1 394 ? 105.542 12.596  24.247  1.00 23.98  ? 391 VAL C N   1 
ATOM   10387 C CA  . VAL C  1 394 ? 104.401 13.369  24.697  1.00 23.10  ? 391 VAL C CA  1 
ATOM   10388 C C   . VAL C  1 394 ? 103.333 13.150  23.644  1.00 23.11  ? 391 VAL C C   1 
ATOM   10389 O O   . VAL C  1 394 ? 103.630 13.026  22.467  1.00 22.74  ? 391 VAL C O   1 
ATOM   10390 C CB  . VAL C  1 394 ? 104.761 14.860  24.785  1.00 21.94  ? 391 VAL C CB  1 
ATOM   10391 C CG1 . VAL C  1 394 ? 103.562 15.677  25.180  1.00 22.11  ? 391 VAL C CG1 1 
ATOM   10392 C CG2 . VAL C  1 394 ? 105.866 15.090  25.789  1.00 22.04  ? 391 VAL C CG2 1 
ATOM   10393 N N   . ARG C  1 395 ? 102.086 13.085  24.063  1.00 24.95  ? 392 ARG C N   1 
ATOM   10394 C CA  . ARG C  1 395 ? 100.974 13.010  23.123  1.00 25.73  ? 392 ARG C CA  1 
ATOM   10395 C C   . ARG C  1 395 ? 100.139 14.259  23.270  1.00 24.55  ? 392 ARG C C   1 
ATOM   10396 O O   . ARG C  1 395 ? 99.831  14.690  24.382  1.00 23.57  ? 392 ARG C O   1 
ATOM   10397 C CB  . ARG C  1 395 ? 100.150 11.768  23.377  1.00 28.52  ? 392 ARG C CB  1 
ATOM   10398 C CG  . ARG C  1