data_5A24
# 
_entry.id   5A24 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5A24         
PDBE  EBI-63767    
WWPDB D_1290063767 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5A24 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-05-12 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Risor, M.W.'       1  
'Thomsen, L.R.'     2  
'Sanggaard, K.W.'   3  
'Nielsen, T.A.'     4  
'Thogersen, I.B.'   5  
'Lukassen, M.V.'    6  
'Rossen, L.'        7  
'Garcia-Ferrer, I.' 8  
'Guevara, T.'       9  
'Meinjohanns, E.'   10 
'Nielsen, N.C.'     11 
'Gomis-Ruth, F.X.'  12 
'Enghild, J.J.'     13 
# 
_citation.id                        primary 
_citation.title                     
'Enzymatic and Structural Characterization of the Major Endopeptidase in the Venus Flytrap Digestion Fluid.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            291 
_citation.page_first                2271 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26627834 
_citation.pdbx_database_id_DOI      10.1074/JBC.M115.672550 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Risor, M.W.'       1  
primary 'Thomsen, L.R.'     2  
primary 'Sanggaard, K.W.'   3  
primary 'Nielsen, T.A.'     4  
primary 'Thogersen, I.B.'   5  
primary 'Lukassen, M.V.'    6  
primary 'Rossen, L.'        7  
primary 'Garcia-Ferrer, I.' 8  
primary 'Guevara, T.'       9  
primary 'Scavenius, C.'     10 
primary 'Meinjohanns, E.'   11 
primary 'Gomis-Ruth, F.X.'  12 
primary 'Enghild, J.J.'     13 
# 
_cell.entry_id           5A24 
_cell.length_a           73.850 
_cell.length_b           47.790 
_cell.length_c           57.790 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.44 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5A24 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man DIONAIN-1                                                           23036.906 1   ? ? 'MATURE ENZYME' ? 
2 non-polymer syn 'N-[N-[1-HYDROXYCARBOXYETHYL-CARBONYL]LEUCYLAMINO-BUTYL]-GUANIDINE' 360.429   1   ? ? ?               ? 
3 non-polymer syn 'PHOSPHATE ION'                                                     94.971    1   ? ? ?               ? 
4 water       nat water                                                               18.015    297 ? ? ?               ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VPAAVDWRTAGAVTPVKNQQQCGCCWAFSAVAAIEGATQIKTGTLTSLSEEQIVDCDTNGNDKGCNGGTPDGAFQYVVNN
QGIDTESDYPYTAGGGSPGTCSASSYQPAASITGYQDVPANNEQALQQAAATQPISVAIDASDPSFQSYSSGIYSGPCNT
NLDHAVTVVGYGTDPNSGNSYWIVKNSWGTSWGQEGYIWMQMGLNAPYGVCGIAMQASYPTA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VPAAVDWRTAGAVTPVKNQQQCGCCWAFSAVAAIEGATQIKTGTLTSLSEEQIVDCDTNGNDKGCNGGTPDGAFQYVVNN
QGIDTESDYPYTAGGGSPGTCSASSYQPAASITGYQDVPANNEQALQQAAATQPISVAIDASDPSFQSYSSGIYSGPCNT
NLDHAVTVVGYGTDPNSGNSYWIVKNSWGTSWGQEGYIWMQMGLNAPYGVCGIAMQASYPTA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   PRO n 
1 3   ALA n 
1 4   ALA n 
1 5   VAL n 
1 6   ASP n 
1 7   TRP n 
1 8   ARG n 
1 9   THR n 
1 10  ALA n 
1 11  GLY n 
1 12  ALA n 
1 13  VAL n 
1 14  THR n 
1 15  PRO n 
1 16  VAL n 
1 17  LYS n 
1 18  ASN n 
1 19  GLN n 
1 20  GLN n 
1 21  GLN n 
1 22  CYS n 
1 23  GLY n 
1 24  CYS n 
1 25  CYS n 
1 26  TRP n 
1 27  ALA n 
1 28  PHE n 
1 29  SER n 
1 30  ALA n 
1 31  VAL n 
1 32  ALA n 
1 33  ALA n 
1 34  ILE n 
1 35  GLU n 
1 36  GLY n 
1 37  ALA n 
1 38  THR n 
1 39  GLN n 
1 40  ILE n 
1 41  LYS n 
1 42  THR n 
1 43  GLY n 
1 44  THR n 
1 45  LEU n 
1 46  THR n 
1 47  SER n 
1 48  LEU n 
1 49  SER n 
1 50  GLU n 
1 51  GLU n 
1 52  GLN n 
1 53  ILE n 
1 54  VAL n 
1 55  ASP n 
1 56  CYS n 
1 57  ASP n 
1 58  THR n 
1 59  ASN n 
1 60  GLY n 
1 61  ASN n 
1 62  ASP n 
1 63  LYS n 
1 64  GLY n 
1 65  CYS n 
1 66  ASN n 
1 67  GLY n 
1 68  GLY n 
1 69  THR n 
1 70  PRO n 
1 71  ASP n 
1 72  GLY n 
1 73  ALA n 
1 74  PHE n 
1 75  GLN n 
1 76  TYR n 
1 77  VAL n 
1 78  VAL n 
1 79  ASN n 
1 80  ASN n 
1 81  GLN n 
1 82  GLY n 
1 83  ILE n 
1 84  ASP n 
1 85  THR n 
1 86  GLU n 
1 87  SER n 
1 88  ASP n 
1 89  TYR n 
1 90  PRO n 
1 91  TYR n 
1 92  THR n 
1 93  ALA n 
1 94  GLY n 
1 95  GLY n 
1 96  GLY n 
1 97  SER n 
1 98  PRO n 
1 99  GLY n 
1 100 THR n 
1 101 CYS n 
1 102 SER n 
1 103 ALA n 
1 104 SER n 
1 105 SER n 
1 106 TYR n 
1 107 GLN n 
1 108 PRO n 
1 109 ALA n 
1 110 ALA n 
1 111 SER n 
1 112 ILE n 
1 113 THR n 
1 114 GLY n 
1 115 TYR n 
1 116 GLN n 
1 117 ASP n 
1 118 VAL n 
1 119 PRO n 
1 120 ALA n 
1 121 ASN n 
1 122 ASN n 
1 123 GLU n 
1 124 GLN n 
1 125 ALA n 
1 126 LEU n 
1 127 GLN n 
1 128 GLN n 
1 129 ALA n 
1 130 ALA n 
1 131 ALA n 
1 132 THR n 
1 133 GLN n 
1 134 PRO n 
1 135 ILE n 
1 136 SER n 
1 137 VAL n 
1 138 ALA n 
1 139 ILE n 
1 140 ASP n 
1 141 ALA n 
1 142 SER n 
1 143 ASP n 
1 144 PRO n 
1 145 SER n 
1 146 PHE n 
1 147 GLN n 
1 148 SER n 
1 149 TYR n 
1 150 SER n 
1 151 SER n 
1 152 GLY n 
1 153 ILE n 
1 154 TYR n 
1 155 SER n 
1 156 GLY n 
1 157 PRO n 
1 158 CYS n 
1 159 ASN n 
1 160 THR n 
1 161 ASN n 
1 162 LEU n 
1 163 ASP n 
1 164 HIS n 
1 165 ALA n 
1 166 VAL n 
1 167 THR n 
1 168 VAL n 
1 169 VAL n 
1 170 GLY n 
1 171 TYR n 
1 172 GLY n 
1 173 THR n 
1 174 ASP n 
1 175 PRO n 
1 176 ASN n 
1 177 SER n 
1 178 GLY n 
1 179 ASN n 
1 180 SER n 
1 181 TYR n 
1 182 TRP n 
1 183 ILE n 
1 184 VAL n 
1 185 LYS n 
1 186 ASN n 
1 187 SER n 
1 188 TRP n 
1 189 GLY n 
1 190 THR n 
1 191 SER n 
1 192 TRP n 
1 193 GLY n 
1 194 GLN n 
1 195 GLU n 
1 196 GLY n 
1 197 TYR n 
1 198 ILE n 
1 199 TRP n 
1 200 MET n 
1 201 GLN n 
1 202 MET n 
1 203 GLY n 
1 204 LEU n 
1 205 ASN n 
1 206 ALA n 
1 207 PRO n 
1 208 TYR n 
1 209 GLY n 
1 210 VAL n 
1 211 CYS n 
1 212 GLY n 
1 213 ILE n 
1 214 ALA n 
1 215 MET n 
1 216 GLN n 
1 217 ALA n 
1 218 SER n 
1 219 TYR n 
1 220 PRO n 
1 221 THR n 
1 222 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'VENUS FLYTRAP' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'DIONAEA MUSCIPULA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4362 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'KOMAGATAELLA PASTORIS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               KM71H 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPICZALPHAC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'FROM THE PLANT DIGESTIVE JUICE' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    5A24 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          5A24 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5A24 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 222 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             5A24 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  223 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       223 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                             ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                            ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                          ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                     ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                            ? 'C3 H7 N O2 S'    121.158 
E64 non-polymer         . 'N-[N-[1-HYDROXYCARBOXYETHYL-CARBONYL]LEUCYLAMINO-BUTYL]-GUANIDINE' ? 'C15 H30 N5 O5 1' 360.429 
GLN 'L-peptide linking' y GLUTAMINE                                                           ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                     ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                             ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                           ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                               ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                          ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                             ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                              ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                          ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                       ? 'C9 H11 N O2'     165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                                                     ? 'O4 P -3'         94.971  
PRO 'L-peptide linking' y PROLINE                                                             ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                              ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                           ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                          ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                            ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                              ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          5A24 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_percent_sol   44 
_exptl_crystal.description           'THE SIDE CHAINS OF THE SEARCHING MODEL WERE TRIMMED WITH CHAINSAW' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'DI-POTASSIUM HYDROGEN PHOSPHATE 0.8 M, SODIUM DIHYDROGEN PHOSPHATE 0.9 M, LITHIUM SULFATE ANHYDROUS 0.2 M, CAPS 0.1 M, PH 10.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0052 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             1.0052 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5A24 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.10 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   30734 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            0.03 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        30.70 
_reflns.B_iso_Wilson_estimate        15.44 
_reflns.pdbx_redundancy              3.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.70 
_reflns_shell.percent_possible_all   94.8 
_reflns_shell.Rmerge_I_obs           0.09 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    16.00 
_reflns_shell.pdbx_redundancy        3.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5A24 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30697 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             13.27 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    95.00 
_refine.ls_R_factor_obs                          0.1579 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1575 
_refine.ls_R_factor_R_free                       0.1720 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.52 
_refine.ls_number_reflns_R_free                  774 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9594 
_refine.correlation_coeff_Fo_to_Fc_free          0.9570 
_refine.B_iso_mean                               19.55 
_refine.aniso_B[1][1]                            -0.0350 
_refine.aniso_B[2][2]                            0.0827 
_refine.aniso_B[3][3]                            -0.0476 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -2.2552 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1S4V' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.070 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.066 
_refine.pdbx_overall_SU_R_Blow_DPI               0.077 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.071 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        5A24 
_refine_analyze.Luzzati_coordinate_error_obs    0.153 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1616 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             297 
_refine_hist.number_atoms_total               1936 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        13.27 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  1688 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.01  ? 2.00  2317 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  720  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  50   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  249  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 1688 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           4.01  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           2.46  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  227  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? 1.00  3    'X-RAY DIFFRACTION' HARMONIC     
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  2322 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   15 
_refine_ls_shell.d_res_high                       1.50 
_refine_ls_shell.d_res_low                        1.55 
_refine_ls_shell.number_reflns_R_work             2877 
_refine_ls_shell.R_factor_R_work                  0.1642 
_refine_ls_shell.percent_reflns_obs               93.11 
_refine_ls_shell.R_factor_R_free                  0.1986 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            2.44 
_refine_ls_shell.number_reflns_R_free             72 
_refine_ls_shell.number_reflns_all                2949 
_refine_ls_shell.R_factor_all                     0.1651 
# 
_struct.entry_id                  5A24 
_struct.title                     'Crystal structure of Dionain-1, the major endopeptidase in the Venus flytrap digestive juice' 
_struct.pdbx_descriptor           DIONAIN-1 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5A24 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, CYSTEINE PEPTIDASE, VENUS FLYTRAP, DIGESTIVE ENZYME, ACIDIC ENZYME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TRP A 7   ? GLY A 11  ? TRP A 8   GLY A 12  1 ? 5  
HELX_P HELX_P2  2  CYS A 24  ? GLY A 43  ? CYS A 25  GLY A 44  1 ? 20 
HELX_P HELX_P3  3  SER A 49  ? ASP A 57  ? SER A 50  ASP A 58  1 ? 9  
HELX_P HELX_P4  4  LYS A 63  ? CYS A 65  ? LYS A 64  CYS A 66  5 ? 3  
HELX_P HELX_P5  5  THR A 69  ? GLN A 81  ? THR A 70  GLN A 82  1 ? 13 
HELX_P HELX_P6  6  THR A 92  ? GLY A 96  ? THR A 93  GLY A 97  5 ? 5  
HELX_P HELX_P7  7  SER A 102 ? TYR A 106 ? SER A 103 TYR A 107 5 ? 5  
HELX_P HELX_P8  8  ASN A 122 ? ALA A 131 ? ASN A 123 ALA A 132 1 ? 10 
HELX_P HELX_P9  9  ASP A 143 ? SER A 148 ? ASP A 144 SER A 149 1 ? 6  
HELX_P HELX_P10 10 GLY A 209 ? ILE A 213 ? GLY A 210 ILE A 214 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22  SG ? ? ? 1_555 A CYS 65  SG ? ? A CYS 23  A CYS 66   1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf2 disulf ? ? A CYS 56  SG ? ? ? 1_555 A CYS 101 SG ? ? A CYS 57  A CYS 102  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf3 disulf ? ? A CYS 158 SG ? ? ? 1_555 A CYS 211 SG ? ? A CYS 159 A CYS 212  1_555 ? ? ? ? ? ? ? 2.090 ? 
covale1 covale ? ? A CYS 25  SG ? ? ? 1_555 B E64 .   C2 ? ? A CYS 26  A E64 1224 1_555 ? ? ? ? ? ? ? 1.795 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 156 A . ? GLY 157 A PRO 157 A ? PRO 158 A 1 6.41 
2 ALA 206 A . ? ALA 207 A PRO 207 A ? PRO 208 A 1 1.91 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 7 ? 
AC ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 5   ? ASP A 6   ? VAL A 6   ASP A 7   
AA 2 HIS A 164 ? THR A 173 ? HIS A 165 THR A 174 
AB 1 GLY A 114 ? ASP A 117 ? GLY A 115 ASP A 118 
AB 2 ALA A 217 ? THR A 221 ? ALA A 218 THR A 222 
AB 3 ILE A 135 ? ILE A 139 ? ILE A 136 ILE A 140 
AB 4 HIS A 164 ? THR A 173 ? HIS A 165 THR A 174 
AB 5 SER A 180 ? LYS A 185 ? SER A 181 LYS A 186 
AB 6 TYR A 197 ? GLN A 201 ? TYR A 198 GLN A 202 
AB 7 ILE A 153 ? TYR A 154 ? ILE A 154 TYR A 155 
AC 1 GLY A 114 ? ASP A 117 ? GLY A 115 ASP A 118 
AC 2 ALA A 217 ? THR A 221 ? ALA A 218 THR A 222 
AC 3 ILE A 135 ? ILE A 139 ? ILE A 136 ILE A 140 
AC 4 HIS A 164 ? THR A 173 ? HIS A 165 THR A 174 
AC 5 VAL A 5   ? ASP A 6   ? VAL A 6   ASP A 7   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 5   ? N VAL A 6   O TYR A 171 ? O TYR A 172 
AB 1 2 N GLN A 116 ? N GLN A 117 O TYR A 219 ? O TYR A 220 
AB 2 3 N SER A 218 ? N SER A 219 O SER A 136 ? O SER A 137 
AB 3 4 N ILE A 139 ? N ILE A 140 O HIS A 164 ? O HIS A 165 
AB 4 5 N GLY A 172 ? N GLY A 173 O TYR A 181 ? O TYR A 182 
AB 5 6 N VAL A 184 ? N VAL A 185 O ILE A 198 ? O ILE A 199 
AB 6 7 N GLN A 201 ? N GLN A 202 O TYR A 154 ? O TYR A 155 
AC 1 2 N GLN A 116 ? N GLN A 117 O TYR A 219 ? O TYR A 220 
AC 2 3 N SER A 218 ? N SER A 219 O SER A 136 ? O SER A 137 
AC 3 4 N ILE A 139 ? N ILE A 140 O HIS A 164 ? O HIS A 165 
AC 4 5 N TYR A 171 ? N TYR A 172 O VAL A 5   ? O VAL A 6   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE E64 A 1224' 
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PO4 A 1225' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLN A 19  ? GLN A 20   . ? 1_555 ? 
2  AC1 12 GLY A 23  ? GLY A 24   . ? 1_555 ? 
3  AC1 12 CYS A 24  ? CYS A 25   . ? 1_555 ? 
4  AC1 12 CYS A 25  ? CYS A 26   . ? 1_555 ? 
5  AC1 12 TRP A 26  ? TRP A 27   . ? 1_555 ? 
6  AC1 12 GLY A 67  ? GLY A 68   . ? 1_555 ? 
7  AC1 12 GLY A 68  ? GLY A 69   . ? 1_555 ? 
8  AC1 12 ASP A 163 ? ASP A 164  . ? 1_555 ? 
9  AC1 12 HIS A 164 ? HIS A 165  . ? 1_555 ? 
10 AC1 12 HOH D .   ? HOH A 2057 . ? 1_555 ? 
11 AC1 12 HOH D .   ? HOH A 2122 . ? 1_555 ? 
12 AC1 12 HOH D .   ? HOH A 2255 . ? 1_555 ? 
13 AC2 9  ALA A 3   ? ALA A 4    . ? 1_555 ? 
14 AC2 9  GLN A 127 ? GLN A 128  . ? 1_555 ? 
15 AC2 9  TYR A 171 ? TYR A 172  . ? 1_555 ? 
16 AC2 9  GLY A 172 ? GLY A 173  . ? 1_555 ? 
17 AC2 9  THR A 173 ? THR A 174  . ? 1_555 ? 
18 AC2 9  SER A 180 ? SER A 181  . ? 1_555 ? 
19 AC2 9  MET A 202 ? MET A 203  . ? 1_555 ? 
20 AC2 9  HOH D .   ? HOH A 2204 . ? 1_555 ? 
21 AC2 9  HOH D .   ? HOH A 2262 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5A24 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5A24 
_atom_sites.fract_transf_matrix[1][1]   0.013541 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000577 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020925 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017320 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 1   ? 19.908  33.400 36.931 1.00 23.46 ? 2    VAL A N   1 
ATOM   2    C CA  . VAL A 1 1   ? 19.269  33.537 35.604 1.00 20.22 ? 2    VAL A CA  1 
ATOM   3    C C   . VAL A 1 1   ? 18.500  34.871 35.576 1.00 17.72 ? 2    VAL A C   1 
ATOM   4    O O   . VAL A 1 1   ? 17.649  35.116 36.452 1.00 19.82 ? 2    VAL A O   1 
ATOM   5    C CB  . VAL A 1 1   ? 18.366  32.340 35.233 1.00 24.26 ? 2    VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 1   ? 17.729  32.538 33.851 1.00 22.96 ? 2    VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 1   ? 19.163  31.034 35.264 1.00 25.02 ? 2    VAL A CG2 1 
ATOM   8    N N   . PRO A 1 2   ? 18.812  35.753 34.588 1.00 12.98 ? 3    PRO A N   1 
ATOM   9    C CA  . PRO A 1 2   ? 18.144  37.071 34.555 1.00 12.61 ? 3    PRO A CA  1 
ATOM   10   C C   . PRO A 1 2   ? 16.664  36.964 34.261 1.00 13.13 ? 3    PRO A C   1 
ATOM   11   O O   . PRO A 1 2   ? 16.214  36.068 33.534 1.00 12.27 ? 3    PRO A O   1 
ATOM   12   C CB  . PRO A 1 2   ? 18.855  37.795 33.429 1.00 14.20 ? 3    PRO A CB  1 
ATOM   13   C CG  . PRO A 1 2   ? 19.373  36.686 32.534 1.00 17.89 ? 3    PRO A CG  1 
ATOM   14   C CD  . PRO A 1 2   ? 19.773  35.599 33.479 1.00 14.26 ? 3    PRO A CD  1 
ATOM   15   N N   . ALA A 1 3   ? 15.897  37.915 34.812 1.00 13.62 ? 4    ALA A N   1 
ATOM   16   C CA  . ALA A 1 3   ? 14.463  37.946 34.584 1.00 13.03 ? 4    ALA A CA  1 
ATOM   17   C C   . ALA A 1 3   ? 14.081  38.350 33.162 1.00 12.60 ? 4    ALA A C   1 
ATOM   18   O O   . ALA A 1 3   ? 13.004  37.965 32.696 1.00 13.27 ? 4    ALA A O   1 
ATOM   19   C CB  . ALA A 1 3   ? 13.804  38.908 35.561 1.00 15.25 ? 4    ALA A CB  1 
ATOM   20   N N   . ALA A 1 4   ? 14.944  39.144 32.470 1.00 10.00 ? 5    ALA A N   1 
ATOM   21   C CA  . ALA A 1 4   ? 14.644  39.537 31.099 1.00 8.64  ? 5    ALA A CA  1 
ATOM   22   C C   . ALA A 1 4   ? 15.902  39.522 30.258 1.00 8.37  ? 5    ALA A C   1 
ATOM   23   O O   . ALA A 1 4   ? 16.990  39.859 30.757 1.00 9.59  ? 5    ALA A O   1 
ATOM   24   C CB  . ALA A 1 4   ? 14.065  40.938 31.090 1.00 9.31  ? 5    ALA A CB  1 
ATOM   25   N N   . VAL A 1 5   ? 15.762  39.143 28.990 1.00 7.34  ? 6    VAL A N   1 
ATOM   26   C CA  . VAL A 1 5   ? 16.879  39.072 28.022 1.00 7.10  ? 6    VAL A CA  1 
ATOM   27   C C   . VAL A 1 5   ? 16.376  39.517 26.668 1.00 8.13  ? 6    VAL A C   1 
ATOM   28   O O   . VAL A 1 5   ? 15.287  39.104 26.239 1.00 8.21  ? 6    VAL A O   1 
ATOM   29   C CB  . VAL A 1 5   ? 17.408  37.609 27.934 1.00 10.23 ? 6    VAL A CB  1 
ATOM   30   C CG1 . VAL A 1 5   ? 18.452  37.458 26.821 1.00 9.58  ? 6    VAL A CG1 1 
ATOM   31   C CG2 . VAL A 1 5   ? 18.036  37.186 29.262 1.00 11.14 ? 6    VAL A CG2 1 
ATOM   32   N N   . ASP A 1 6   ? 17.165  40.360 25.982 1.00 7.61  ? 7    ASP A N   1 
ATOM   33   C CA  . ASP A 1 6   ? 16.799  40.727 24.614 1.00 7.25  ? 7    ASP A CA  1 
ATOM   34   C C   . ASP A 1 6   ? 18.058  40.837 23.776 1.00 7.27  ? 7    ASP A C   1 
ATOM   35   O O   . ASP A 1 6   ? 18.753  41.872 23.819 1.00 8.60  ? 7    ASP A O   1 
ATOM   36   C CB  . ASP A 1 6   ? 15.978  42.023 24.560 1.00 9.07  ? 7    ASP A CB  1 
ATOM   37   C CG  . ASP A 1 6   ? 15.290  42.227 23.216 1.00 13.41 ? 7    ASP A CG  1 
ATOM   38   O OD1 . ASP A 1 6   ? 15.826  41.743 22.197 1.00 11.68 ? 7    ASP A OD1 1 
ATOM   39   O OD2 . ASP A 1 6   ? 14.243  42.907 23.185 1.00 12.67 ? 7    ASP A OD2 1 
ATOM   40   N N   . TRP A 1 7   ? 18.397  39.746 23.059 1.00 6.64  ? 8    TRP A N   1 
ATOM   41   C CA  . TRP A 1 7   ? 19.614  39.723 22.235 1.00 7.82  ? 8    TRP A CA  1 
ATOM   42   C C   . TRP A 1 7   ? 19.538  40.715 21.063 1.00 9.61  ? 8    TRP A C   1 
ATOM   43   O O   . TRP A 1 7   ? 20.584  41.045 20.514 1.00 9.81  ? 8    TRP A O   1 
ATOM   44   C CB  . TRP A 1 7   ? 19.939  38.306 21.746 1.00 8.09  ? 8    TRP A CB  1 
ATOM   45   C CG  . TRP A 1 7   ? 20.484  37.473 22.856 1.00 6.94  ? 8    TRP A CG  1 
ATOM   46   C CD1 . TRP A 1 7   ? 19.838  36.466 23.525 1.00 8.75  ? 8    TRP A CD1 1 
ATOM   47   C CD2 . TRP A 1 7   ? 21.753  37.640 23.499 1.00 6.91  ? 8    TRP A CD2 1 
ATOM   48   N NE1 . TRP A 1 7   ? 20.655  35.972 24.530 1.00 8.54  ? 8    TRP A NE1 1 
ATOM   49   C CE2 . TRP A 1 7   ? 21.800  36.721 24.581 1.00 8.96  ? 8    TRP A CE2 1 
ATOM   50   C CE3 . TRP A 1 7   ? 22.842  38.499 23.287 1.00 7.44  ? 8    TRP A CE3 1 
ATOM   51   C CZ2 . TRP A 1 7   ? 22.923  36.612 25.408 1.00 9.65  ? 8    TRP A CZ2 1 
ATOM   52   C CZ3 . TRP A 1 7   ? 23.945  38.405 24.127 1.00 8.58  ? 8    TRP A CZ3 1 
ATOM   53   C CH2 . TRP A 1 7   ? 23.984  37.442 25.147 1.00 8.33  ? 8    TRP A CH2 1 
ATOM   54   N N   . ARG A 1 8   ? 18.342  41.210 20.686 1.00 8.62  ? 9    ARG A N   1 
ATOM   55   C CA  . ARG A 1 8   ? 18.247  42.153 19.567 1.00 9.20  ? 9    ARG A CA  1 
ATOM   56   C C   . ARG A 1 8   ? 18.887  43.493 19.920 1.00 11.85 ? 9    ARG A C   1 
ATOM   57   O O   . ARG A 1 8   ? 19.759  43.973 19.199 1.00 12.06 ? 9    ARG A O   1 
ATOM   58   C CB  . ARG A 1 8   ? 16.789  42.366 19.191 1.00 10.55 ? 9    ARG A CB  1 
ATOM   59   C CG  . ARG A 1 8   ? 16.104  41.091 18.779 1.00 11.58 ? 9    ARG A CG  1 
ATOM   60   C CD  . ARG A 1 8   ? 14.631  41.331 18.613 1.00 12.78 ? 9    ARG A CD  1 
ATOM   61   N NE  . ARG A 1 8   ? 14.026  41.741 19.874 1.00 15.32 ? 9    ARG A NE  1 
ATOM   62   C CZ  . ARG A 1 8   ? 12.745  42.023 20.005 1.00 18.56 ? 9    ARG A CZ  1 
ATOM   63   N NH1 . ARG A 1 8   ? 11.919  41.892 18.967 1.00 18.36 ? 9    ARG A NH1 1 
ATOM   64   N NH2 . ARG A 1 8   ? 12.259  42.402 21.182 1.00 16.30 ? 9    ARG A NH2 1 
ATOM   65   N N   . THR A 1 9   ? 18.482  44.085 21.058 1.00 9.69  ? 10   THR A N   1 
ATOM   66   C CA  . THR A 1 9   ? 19.067  45.349 21.454 1.00 9.77  ? 10   THR A CA  1 
ATOM   67   C C   . THR A 1 9   ? 20.466  45.153 22.055 1.00 10.78 ? 10   THR A C   1 
ATOM   68   O O   . THR A 1 9   ? 21.223  46.116 22.155 1.00 11.86 ? 10   THR A O   1 
ATOM   69   C CB  . THR A 1 9   ? 18.128  46.064 22.431 1.00 12.19 ? 10   THR A CB  1 
ATOM   70   O OG1 . THR A 1 9   ? 17.647  45.117 23.389 1.00 12.17 ? 10   THR A OG1 1 
ATOM   71   C CG2 . THR A 1 9   ? 16.938  46.704 21.711 1.00 16.70 ? 10   THR A CG2 1 
ATOM   72   N N   . ALA A 1 10  ? 20.847  43.902 22.429 1.00 9.90  ? 11   ALA A N   1 
ATOM   73   C CA  . ALA A 1 10  ? 22.202  43.618 22.884 1.00 9.64  ? 11   ALA A CA  1 
ATOM   74   C C   . ALA A 1 10  ? 23.174  43.508 21.686 1.00 12.93 ? 11   ALA A C   1 
ATOM   75   O O   . ALA A 1 10  ? 24.395  43.506 21.875 1.00 16.01 ? 11   ALA A O   1 
ATOM   76   C CB  . ALA A 1 10  ? 22.207  42.336 23.701 1.00 10.27 ? 11   ALA A CB  1 
ATOM   77   N N   . GLY A 1 11  ? 22.642  43.447 20.470 1.00 10.03 ? 12   GLY A N   1 
ATOM   78   C CA  . GLY A 1 11  ? 23.440  43.476 19.250 1.00 9.36  ? 12   GLY A CA  1 
ATOM   79   C C   . GLY A 1 11  ? 23.793  42.151 18.616 1.00 11.12 ? 12   GLY A C   1 
ATOM   80   O O   . GLY A 1 11  ? 24.688  42.134 17.754 1.00 11.97 ? 12   GLY A O   1 
ATOM   81   N N   . ALA A 1 12  ? 23.108  41.076 18.982 1.00 8.87  ? 13   ALA A N   1 
ATOM   82   C CA  . ALA A 1 12  ? 23.485  39.756 18.461 1.00 8.26  ? 13   ALA A CA  1 
ATOM   83   C C   . ALA A 1 12  ? 22.498  39.192 17.455 1.00 9.72  ? 13   ALA A C   1 
ATOM   84   O O   . ALA A 1 12  ? 22.568  37.985 17.172 1.00 10.33 ? 13   ALA A O   1 
ATOM   85   C CB  . ALA A 1 12  ? 23.656  38.760 19.622 1.00 10.05 ? 13   ALA A CB  1 
ATOM   86   N N   . VAL A 1 13  ? 21.578  40.036 16.922 1.00 7.42  ? 14   VAL A N   1 
ATOM   87   C CA  . VAL A 1 13  ? 20.570  39.517 15.975 1.00 6.52  ? 14   VAL A CA  1 
ATOM   88   C C   . VAL A 1 13  ? 20.526  40.375 14.727 1.00 10.01 ? 14   VAL A C   1 
ATOM   89   O O   . VAL A 1 13  ? 20.410  41.615 14.783 1.00 10.54 ? 14   VAL A O   1 
ATOM   90   C CB  . VAL A 1 13  ? 19.170  39.476 16.654 1.00 9.50  ? 14   VAL A CB  1 
ATOM   91   C CG1 . VAL A 1 13  ? 18.144  38.745 15.794 1.00 10.39 ? 14   VAL A CG1 1 
ATOM   92   C CG2 . VAL A 1 13  ? 19.250  38.783 18.016 1.00 9.51  ? 14   VAL A CG2 1 
ATOM   93   N N   . THR A 1 14  ? 20.628  39.689 13.582 1.00 9.59  ? 15   THR A N   1 
ATOM   94   C CA  . THR A 1 14  ? 20.556  40.378 12.304 1.00 9.74  ? 15   THR A CA  1 
ATOM   95   C C   . THR A 1 14  ? 19.089  40.664 11.929 1.00 11.92 ? 15   THR A C   1 
ATOM   96   O O   . THR A 1 14  ? 18.181  40.119 12.576 1.00 11.04 ? 15   THR A O   1 
ATOM   97   C CB  . THR A 1 14  ? 21.206  39.495 11.201 1.00 10.52 ? 15   THR A CB  1 
ATOM   98   O OG1 . THR A 1 14  ? 20.430  38.293 11.073 1.00 11.68 ? 15   THR A OG1 1 
ATOM   99   C CG2 . THR A 1 14  ? 22.663  39.141 11.503 1.00 12.36 ? 15   THR A CG2 1 
ATOM   100  N N   . PRO A 1 15  ? 18.821  41.466 10.864 1.00 12.05 ? 16   PRO A N   1 
ATOM   101  C CA  . PRO A 1 15  ? 17.431  41.677 10.457 1.00 12.86 ? 16   PRO A CA  1 
ATOM   102  C C   . PRO A 1 15  ? 16.709  40.379 10.069 1.00 13.09 ? 16   PRO A C   1 
ATOM   103  O O   . PRO A 1 15  ? 17.324  39.348 9.749  1.00 13.06 ? 16   PRO A O   1 
ATOM   104  C CB  . PRO A 1 15  ? 17.550  42.641 9.264  1.00 15.60 ? 16   PRO A CB  1 
ATOM   105  C CG  . PRO A 1 15  ? 18.877  43.363 9.477  1.00 18.90 ? 16   PRO A CG  1 
ATOM   106  C CD  . PRO A 1 15  ? 19.768  42.265 10.057 1.00 14.57 ? 16   PRO A CD  1 
ATOM   107  N N   . VAL A 1 16  ? 15.386  40.441 10.109 1.00 11.98 ? 17   VAL A N   1 
ATOM   108  C CA  . VAL A 1 16  ? 14.520  39.321 9.756  1.00 11.75 ? 17   VAL A CA  1 
ATOM   109  C C   . VAL A 1 16  ? 14.686  38.987 8.291  1.00 15.53 ? 17   VAL A C   1 
ATOM   110  O O   . VAL A 1 16  ? 14.774  39.881 7.426  1.00 17.34 ? 17   VAL A O   1 
ATOM   111  C CB  . VAL A 1 16  ? 13.061  39.676 10.122 1.00 15.95 ? 17   VAL A CB  1 
ATOM   112  C CG1 . VAL A 1 16  ? 12.048  38.727 9.485  1.00 15.87 ? 17   VAL A CG1 1 
ATOM   113  C CG2 . VAL A 1 16  ? 12.892  39.671 11.635 1.00 15.83 ? 17   VAL A CG2 1 
ATOM   114  N N   . LYS A 1 17  ? 14.728  37.690 8.026  1.00 13.63 ? 18   LYS A N   1 
ATOM   115  C CA  . LYS A 1 17  ? 14.865  37.131 6.684  1.00 14.08 ? 18   LYS A CA  1 
ATOM   116  C C   . LYS A 1 17  ? 13.548  36.419 6.263  1.00 17.86 ? 18   LYS A C   1 
ATOM   117  O O   . LYS A 1 17  ? 12.632  36.237 7.084  1.00 16.66 ? 18   LYS A O   1 
ATOM   118  C CB  . LYS A 1 17  ? 16.047  36.140 6.669  1.00 14.86 ? 18   LYS A CB  1 
ATOM   119  C CG  . LYS A 1 17  ? 17.367  36.744 7.162  1.00 16.31 ? 18   LYS A CG  1 
ATOM   120  C CD  . LYS A 1 17  ? 18.519  35.785 7.020  1.00 18.17 ? 18   LYS A CD  1 
ATOM   121  C CE  . LYS A 1 17  ? 19.818  36.340 7.558  1.00 20.91 ? 18   LYS A CE  1 
ATOM   122  N NZ  . LYS A 1 17  ? 20.950  35.375 7.420  1.00 15.78 ? 18   LYS A NZ  1 
ATOM   123  N N   . ASN A 1 18  ? 13.468  36.003 4.977  1.00 18.34 ? 19   ASN A N   1 
ATOM   124  C CA  . ASN A 1 18  ? 12.281  35.305 4.476  1.00 19.04 ? 19   ASN A CA  1 
ATOM   125  C C   . ASN A 1 18  ? 12.679  34.066 3.680  1.00 20.65 ? 19   ASN A C   1 
ATOM   126  O O   . ASN A 1 18  ? 13.295  34.189 2.604  1.00 21.75 ? 19   ASN A O   1 
ATOM   127  C CB  . ASN A 1 18  ? 11.446  36.251 3.621  1.00 20.30 ? 19   ASN A CB  1 
ATOM   128  C CG  . ASN A 1 18  ? 10.038  35.782 3.396  1.00 25.68 ? 19   ASN A CG  1 
ATOM   129  O OD1 . ASN A 1 18  ? 9.689   34.599 3.561  1.00 23.15 ? 19   ASN A OD1 1 
ATOM   130  N ND2 . ASN A 1 18  ? 9.170   36.727 3.139  1.00 21.50 ? 19   ASN A ND2 1 
ATOM   131  N N   . GLN A 1 19  ? 12.296  32.881 4.190  1.00 18.07 ? 20   GLN A N   1 
ATOM   132  C CA  . GLN A 1 19  ? 12.603  31.603 3.549  1.00 17.54 ? 20   GLN A CA  1 
ATOM   133  C C   . GLN A 1 19  ? 11.716  31.387 2.316  1.00 22.60 ? 20   GLN A C   1 
ATOM   134  O O   . GLN A 1 19  ? 12.014  30.515 1.504  1.00 22.49 ? 20   GLN A O   1 
ATOM   135  C CB  . GLN A 1 19  ? 12.426  30.437 4.520  1.00 19.22 ? 20   GLN A CB  1 
ATOM   136  C CG  . GLN A 1 19  ? 10.990  30.162 4.983  1.00 20.62 ? 20   GLN A CG  1 
ATOM   137  C CD  . GLN A 1 19  ? 10.957  28.997 5.908  1.00 28.89 ? 20   GLN A CD  1 
ATOM   138  O OE1 . GLN A 1 19  ? 11.095  29.135 7.128  1.00 20.54 ? 20   GLN A OE1 1 
ATOM   139  N NE2 . GLN A 1 19  ? 10.770  27.815 5.357  1.00 21.94 ? 20   GLN A NE2 1 
ATOM   140  N N   . GLN A 1 20  ? 10.598  32.126 2.239  1.00 19.84 ? 21   GLN A N   1 
ATOM   141  C CA  . GLN A 1 20  ? 9.628   32.019 1.138  1.00 21.34 ? 21   GLN A CA  1 
ATOM   142  C C   . GLN A 1 20  ? 9.127   30.557 0.993  1.00 26.83 ? 21   GLN A C   1 
ATOM   143  O O   . GLN A 1 20  ? 8.795   29.943 2.016  1.00 26.55 ? 21   GLN A O   1 
ATOM   144  C CB  . GLN A 1 20  ? 10.228  32.581 -0.156 1.00 22.77 ? 21   GLN A CB  1 
ATOM   145  C CG  . GLN A 1 20  ? 10.015  34.080 -0.249 1.00 38.31 ? 21   GLN A CG  1 
ATOM   146  C CD  . GLN A 1 20  ? 11.241  34.850 -0.656 1.00 58.73 ? 21   GLN A CD  1 
ATOM   147  O OE1 . GLN A 1 20  ? 12.131  34.361 -1.365 1.00 51.20 ? 21   GLN A OE1 1 
ATOM   148  N NE2 . GLN A 1 20  ? 11.290  36.105 -0.237 1.00 53.06 ? 21   GLN A NE2 1 
ATOM   149  N N   . GLN A 1 21  ? 9.096   30.001 -0.236 1.00 28.04 ? 22   GLN A N   1 
ATOM   150  C CA  . GLN A 1 21  ? 8.547   28.671 -0.525 1.00 29.28 ? 22   GLN A CA  1 
ATOM   151  C C   . GLN A 1 21  ? 9.613   27.556 -0.595 1.00 34.54 ? 22   GLN A C   1 
ATOM   152  O O   . GLN A 1 21  ? 9.600   26.730 -1.510 1.00 37.64 ? 22   GLN A O   1 
ATOM   153  C CB  . GLN A 1 21  ? 7.717   28.688 -1.832 1.00 31.72 ? 22   GLN A CB  1 
ATOM   154  C CG  . GLN A 1 21  ? 6.631   29.770 -1.906 1.00 49.86 ? 22   GLN A CG  1 
ATOM   155  C CD  . GLN A 1 21  ? 7.150   31.079 -2.471 1.00 77.89 ? 22   GLN A CD  1 
ATOM   156  O OE1 . GLN A 1 21  ? 7.688   31.146 -3.587 1.00 76.57 ? 22   GLN A OE1 1 
ATOM   157  N NE2 . GLN A 1 21  ? 6.995   32.154 -1.711 1.00 70.97 ? 22   GLN A NE2 1 
ATOM   158  N N   . CYS A 1 22  ? 10.533  27.545 0.369  1.00 28.71 ? 23   CYS A N   1 
ATOM   159  C CA  . CYS A 1 22  ? 11.545  26.502 0.553  1.00 26.09 ? 23   CYS A CA  1 
ATOM   160  C C   . CYS A 1 22  ? 11.399  25.991 1.955  1.00 28.90 ? 23   CYS A C   1 
ATOM   161  O O   . CYS A 1 22  ? 11.495  26.796 2.885  1.00 29.60 ? 23   CYS A O   1 
ATOM   162  C CB  . CYS A 1 22  ? 12.951  27.042 0.322  1.00 23.37 ? 23   CYS A CB  1 
ATOM   163  S SG  . CYS A 1 22  ? 14.246  25.797 0.433  1.00 24.90 ? 23   CYS A SG  1 
ATOM   164  N N   . GLY A 1 23  ? 11.224  24.685 2.114  1.00 23.44 ? 24   GLY A N   1 
ATOM   165  C CA  . GLY A 1 23  ? 11.109  24.056 3.423  1.00 20.97 ? 24   GLY A CA  1 
ATOM   166  C C   . GLY A 1 23  ? 12.450  23.909 4.114  1.00 23.15 ? 24   GLY A C   1 
ATOM   167  O O   . GLY A 1 23  ? 12.839  22.807 4.539  1.00 22.19 ? 24   GLY A O   1 
ATOM   168  N N   . CYS A 1 24  ? 13.150  25.031 4.274  1.00 17.59 ? 25   CYS A N   1 
ATOM   169  C CA  . CYS A 1 24  ? 14.475  25.000 4.906  1.00 17.65 ? 25   CYS A CA  1 
ATOM   170  C C   . CYS A 1 24  ? 14.534  25.838 6.183  1.00 20.36 ? 25   CYS A C   1 
ATOM   171  O O   . CYS A 1 24  ? 15.585  26.403 6.520  1.00 18.23 ? 25   CYS A O   1 
ATOM   172  C CB  . CYS A 1 24  ? 15.524  25.451 3.912  1.00 19.22 ? 25   CYS A CB  1 
ATOM   173  S SG  . CYS A 1 24  ? 15.343  27.174 3.444  1.00 23.15 ? 25   CYS A SG  1 
ATOM   174  N N   . CYS A 1 25  ? 13.440  25.873 6.948  1.00 15.90 ? 26   CYS A N   1 
ATOM   175  C CA  . CYS A 1 25  ? 13.393  26.611 8.221  1.00 14.85 ? 26   CYS A CA  1 
ATOM   176  C C   . CYS A 1 25  ? 14.562  26.182 9.112  1.00 16.65 ? 26   CYS A C   1 
ATOM   177  O O   . CYS A 1 25  ? 15.114  26.994 9.837  1.00 15.12 ? 26   CYS A O   1 
ATOM   178  C CB  . CYS A 1 25  ? 12.049  26.375 8.921  1.00 15.72 ? 26   CYS A CB  1 
ATOM   179  S SG  . CYS A 1 25  ? 11.745  24.653 9.404  1.00 19.44 ? 26   CYS A SG  1 
ATOM   180  N N   . TRP A 1 26  ? 14.952  24.907 9.025  1.00 15.24 ? 27   TRP A N   1 
ATOM   181  C CA  . TRP A 1 26  ? 16.041  24.339 9.807  1.00 13.35 ? 27   TRP A CA  1 
ATOM   182  C C   . TRP A 1 26  ? 17.338  25.134 9.604  1.00 13.00 ? 27   TRP A C   1 
ATOM   183  O O   . TRP A 1 26  ? 18.083  25.363 10.564 1.00 13.36 ? 27   TRP A O   1 
ATOM   184  C CB  . TRP A 1 26  ? 16.246  22.863 9.411  1.00 13.44 ? 27   TRP A CB  1 
ATOM   185  C CG  . TRP A 1 26  ? 16.570  22.617 7.963  1.00 15.03 ? 27   TRP A CG  1 
ATOM   186  C CD1 . TRP A 1 26  ? 15.697  22.518 6.916  1.00 18.24 ? 27   TRP A CD1 1 
ATOM   187  C CD2 . TRP A 1 26  ? 17.874  22.390 7.425  1.00 15.16 ? 27   TRP A CD2 1 
ATOM   188  N NE1 . TRP A 1 26  ? 16.390  22.299 5.739  1.00 18.30 ? 27   TRP A NE1 1 
ATOM   189  C CE2 . TRP A 1 26  ? 17.731  22.214 6.026  1.00 17.82 ? 27   TRP A CE2 1 
ATOM   190  C CE3 . TRP A 1 26  ? 19.157  22.316 7.990  1.00 15.71 ? 27   TRP A CE3 1 
ATOM   191  C CZ2 . TRP A 1 26  ? 18.828  21.999 5.184  1.00 17.52 ? 27   TRP A CZ2 1 
ATOM   192  C CZ3 . TRP A 1 26  ? 20.233  22.047 7.158  1.00 16.79 ? 27   TRP A CZ3 1 
ATOM   193  C CH2 . TRP A 1 26  ? 20.073  21.973 5.763  1.00 17.68 ? 27   TRP A CH2 1 
ATOM   194  N N   . ALA A 1 27  ? 17.598  25.543 8.351  1.00 11.73 ? 28   ALA A N   1 
ATOM   195  C CA  . ALA A 1 27  ? 18.809  26.273 8.033  1.00 11.79 ? 28   ALA A CA  1 
ATOM   196  C C   . ALA A 1 27  ? 18.716  27.733 8.489  1.00 13.88 ? 28   ALA A C   1 
ATOM   197  O O   . ALA A 1 27  ? 19.707  28.274 8.958  1.00 12.43 ? 28   ALA A O   1 
ATOM   198  C CB  . ALA A 1 27  ? 19.073  26.197 6.537  1.00 13.31 ? 28   ALA A CB  1 
ATOM   199  N N   . PHE A 1 28  ? 17.530  28.358 8.400  1.00 12.60 ? 29   PHE A N   1 
ATOM   200  C CA  . PHE A 1 28  ? 17.337  29.733 8.877  1.00 11.42 ? 29   PHE A CA  1 
ATOM   201  C C   . PHE A 1 28  ? 17.515  29.779 10.390 1.00 12.02 ? 29   PHE A C   1 
ATOM   202  O O   . PHE A 1 28  ? 18.183  30.674 10.902 1.00 11.39 ? 29   PHE A O   1 
ATOM   203  C CB  . PHE A 1 28  ? 15.939  30.225 8.462  1.00 12.27 ? 29   PHE A CB  1 
ATOM   204  C CG  . PHE A 1 28  ? 15.962  30.755 7.047  1.00 12.46 ? 29   PHE A CG  1 
ATOM   205  C CD1 . PHE A 1 28  ? 15.872  29.889 5.957  1.00 14.85 ? 29   PHE A CD1 1 
ATOM   206  C CD2 . PHE A 1 28  ? 16.154  32.110 6.799  1.00 13.87 ? 29   PHE A CD2 1 
ATOM   207  C CE1 . PHE A 1 28  ? 16.013  30.372 4.647  1.00 16.24 ? 29   PHE A CE1 1 
ATOM   208  C CE2 . PHE A 1 28  ? 16.250  32.593 5.492  1.00 16.93 ? 29   PHE A CE2 1 
ATOM   209  C CZ  . PHE A 1 28  ? 16.172  31.723 4.422  1.00 16.22 ? 29   PHE A CZ  1 
ATOM   210  N N   . SER A 1 29  ? 16.930  28.835 11.109 1.00 10.36 ? 30   SER A N   1 
ATOM   211  C CA  . SER A 1 29  ? 17.071  28.791 12.564 1.00 9.43  ? 30   SER A CA  1 
ATOM   212  C C   . SER A 1 29  ? 18.545  28.586 12.970 1.00 11.13 ? 30   SER A C   1 
ATOM   213  O O   . SER A 1 29  ? 19.083  29.289 13.844 1.00 11.47 ? 30   SER A O   1 
ATOM   214  C CB  . SER A 1 29  ? 16.229  27.625 13.067 1.00 11.04 ? 30   SER A CB  1 
ATOM   215  O OG  . SER A 1 29  ? 16.427  27.417 14.453 1.00 13.54 ? 30   SER A OG  1 
ATOM   216  N N   . ALA A 1 30  ? 19.236  27.627 12.309 1.00 10.01 ? 31   ALA A N   1 
ATOM   217  C CA  . ALA A 1 30  ? 20.651  27.413 12.612 1.00 9.58  ? 31   ALA A CA  1 
ATOM   218  C C   . ALA A 1 30  ? 21.494  28.631 12.344 1.00 10.88 ? 31   ALA A C   1 
ATOM   219  O O   . ALA A 1 30  ? 22.344  28.977 13.189 1.00 10.30 ? 31   ALA A O   1 
ATOM   220  C CB  . ALA A 1 30  ? 21.182  26.265 11.784 1.00 11.15 ? 31   ALA A CB  1 
ATOM   221  N N   . VAL A 1 31  ? 21.257  29.304 11.202 1.00 9.21  ? 32   VAL A N   1 
ATOM   222  C CA  . VAL A 1 31  ? 22.051  30.473 10.856 1.00 8.58  ? 32   VAL A CA  1 
ATOM   223  C C   . VAL A 1 31  ? 21.819  31.610 11.858 1.00 9.58  ? 32   VAL A C   1 
ATOM   224  O O   . VAL A 1 31  ? 22.813  32.248 12.271 1.00 9.47  ? 32   VAL A O   1 
ATOM   225  C CB  . VAL A 1 31  ? 21.836  30.925 9.398  1.00 12.69 ? 32   VAL A CB  1 
ATOM   226  C CG1 . VAL A 1 31  ? 22.388  32.344 9.188  1.00 12.78 ? 32   VAL A CG1 1 
ATOM   227  C CG2 . VAL A 1 31  ? 22.531  29.944 8.448  1.00 13.80 ? 32   VAL A CG2 1 
ATOM   228  N N   . ALA A 1 32  ? 20.575  31.855 12.278 1.00 8.10  ? 33   ALA A N   1 
ATOM   229  C CA  . ALA A 1 32  ? 20.353  32.905 13.273 1.00 7.87  ? 33   ALA A CA  1 
ATOM   230  C C   . ALA A 1 32  ? 21.115  32.589 14.561 1.00 7.65  ? 33   ALA A C   1 
ATOM   231  O O   . ALA A 1 32  ? 21.747  33.468 15.164 1.00 9.17  ? 33   ALA A O   1 
ATOM   232  C CB  . ALA A 1 32  ? 18.876  33.045 13.558 1.00 9.15  ? 33   ALA A CB  1 
ATOM   233  N N   . ALA A 1 33  ? 21.124  31.318 14.973 1.00 7.40  ? 34   ALA A N   1 
ATOM   234  C CA  . ALA A 1 33  ? 21.862  30.959 16.166 1.00 7.91  ? 34   ALA A CA  1 
ATOM   235  C C   . ALA A 1 33  ? 23.375  31.125 15.989 1.00 9.84  ? 34   ALA A C   1 
ATOM   236  O O   . ALA A 1 33  ? 24.025  31.600 16.905 1.00 9.42  ? 34   ALA A O   1 
ATOM   237  C CB  . ALA A 1 33  ? 21.502  29.541 16.582 1.00 8.82  ? 34   ALA A CB  1 
ATOM   238  N N   . ILE A 1 34  ? 23.917  30.793 14.797 1.00 8.19  ? 35   ILE A N   1 
ATOM   239  C CA  . ILE A 1 34  ? 25.339  30.963 14.520 1.00 7.55  ? 35   ILE A CA  1 
ATOM   240  C C   . ILE A 1 34  ? 25.693  32.457 14.484 1.00 8.70  ? 35   ILE A C   1 
ATOM   241  O O   . ILE A 1 34  ? 26.718  32.878 15.055 1.00 9.32  ? 35   ILE A O   1 
ATOM   242  C CB  . ILE A 1 34  ? 25.758  30.249 13.218 1.00 10.37 ? 35   ILE A CB  1 
ATOM   243  C CG1 . ILE A 1 34  ? 25.595  28.720 13.357 1.00 10.90 ? 35   ILE A CG1 1 
ATOM   244  C CG2 . ILE A 1 34  ? 27.227  30.605 12.920 1.00 11.88 ? 35   ILE A CG2 1 
ATOM   245  C CD1 . ILE A 1 34  ? 25.708  27.929 12.033 1.00 11.59 ? 35   ILE A CD1 1 
ATOM   246  N N   . GLU A 1 35  ? 24.840  33.264 13.911 1.00 8.33  ? 36   GLU A N   1 
ATOM   247  C CA  . GLU A 1 35  ? 25.084  34.721 13.875 1.00 8.70  ? 36   GLU A CA  1 
ATOM   248  C C   . GLU A 1 35  ? 25.167  35.285 15.299 1.00 9.73  ? 36   GLU A C   1 
ATOM   249  O O   . GLU A 1 35  ? 26.045  36.102 15.607 1.00 10.04 ? 36   GLU A O   1 
ATOM   250  C CB  . GLU A 1 35  ? 23.923  35.414 13.137 1.00 9.83  ? 36   GLU A CB  1 
ATOM   251  C CG  . GLU A 1 35  ? 23.950  35.194 11.635 1.00 10.22 ? 36   GLU A CG  1 
ATOM   252  C CD  . GLU A 1 35  ? 22.681  35.581 10.890 1.00 10.98 ? 36   GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 35  ? 21.641  35.861 11.534 1.00 10.35 ? 36   GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 35  ? 22.719  35.589 9.636  1.00 10.64 ? 36   GLU A OE2 1 
ATOM   255  N N   . GLY A 1 36  ? 24.296  34.800 16.167 1.00 8.49  ? 37   GLY A N   1 
ATOM   256  C CA  . GLY A 1 36  ? 24.281  35.262 17.545 1.00 9.56  ? 37   GLY A CA  1 
ATOM   257  C C   . GLY A 1 36  ? 25.506  34.808 18.317 1.00 9.03  ? 37   GLY A C   1 
ATOM   258  O O   . GLY A 1 36  ? 26.186  35.630 18.951 1.00 9.01  ? 37   GLY A O   1 
ATOM   259  N N   . ALA A 1 37  ? 25.829  33.506 18.229 1.00 8.50  ? 38   ALA A N   1 
ATOM   260  C CA  . ALA A 1 37  ? 26.999  33.005 18.955 1.00 8.84  ? 38   ALA A CA  1 
ATOM   261  C C   . ALA A 1 37  ? 28.280  33.705 18.478 1.00 11.05 ? 38   ALA A C   1 
ATOM   262  O O   . ALA A 1 37  ? 29.162  34.016 19.298 1.00 10.85 ? 38   ALA A O   1 
ATOM   263  C CB  . ALA A 1 37  ? 27.128  31.493 18.735 1.00 9.75  ? 38   ALA A CB  1 
ATOM   264  N N   . THR A 1 38  ? 28.387  33.944 17.139 1.00 9.53  ? 39   THR A N   1 
ATOM   265  C CA  . THR A 1 38  ? 29.568  34.594 16.539 1.00 9.46  ? 39   THR A CA  1 
ATOM   266  C C   . THR A 1 38  ? 29.689  36.024 17.062 1.00 11.58 ? 39   THR A C   1 
ATOM   267  O O   . THR A 1 38  ? 30.788  36.471 17.405 1.00 11.84 ? 39   THR A O   1 
ATOM   268  C CB  . THR A 1 38  ? 29.447  34.591 14.998 1.00 12.74 ? 39   THR A CB  1 
ATOM   269  O OG1 . THR A 1 38  ? 29.503  33.232 14.612 1.00 15.26 ? 39   THR A OG1 1 
ATOM   270  C CG2 . THR A 1 38  ? 30.615  35.372 14.339 1.00 13.84 ? 39   THR A CG2 1 
ATOM   271  N N   . GLN A 1 39  ? 28.584  36.765 17.092 1.00 9.10  ? 40   GLN A N   1 
ATOM   272  C CA  . GLN A 1 39  ? 28.675  38.131 17.591 1.00 9.71  ? 40   GLN A CA  1 
ATOM   273  C C   . GLN A 1 39  ? 29.082  38.170 19.070 1.00 11.78 ? 40   GLN A C   1 
ATOM   274  O O   . GLN A 1 39  ? 29.836  39.058 19.478 1.00 11.86 ? 40   GLN A O   1 
ATOM   275  C CB  . GLN A 1 39  ? 27.340  38.856 17.371 1.00 10.33 ? 40   GLN A CB  1 
ATOM   276  C CG  . GLN A 1 39  ? 27.435  40.357 17.583 1.00 11.08 ? 40   GLN A CG  1 
ATOM   277  C CD  . GLN A 1 39  ? 27.349  40.814 19.006 1.00 14.43 ? 40   GLN A CD  1 
ATOM   278  O OE1 . GLN A 1 39  ? 27.847  41.892 19.310 1.00 18.25 ? 40   GLN A OE1 1 
ATOM   279  N NE2 . GLN A 1 39  ? 26.783  40.036 19.905 1.00 10.42 ? 40   GLN A NE2 1 
ATOM   280  N N   . ILE A 1 40  ? 28.526  37.266 19.889 1.00 9.81  ? 41   ILE A N   1 
ATOM   281  C CA  . ILE A 1 40  ? 28.855  37.281 21.310 1.00 9.79  ? 41   ILE A CA  1 
ATOM   282  C C   . ILE A 1 40  ? 30.355  37.004 21.509 1.00 14.13 ? 41   ILE A C   1 
ATOM   283  O O   . ILE A 1 40  ? 31.011  37.629 22.367 1.00 15.38 ? 41   ILE A O   1 
ATOM   284  C CB  . ILE A 1 40  ? 27.952  36.259 22.007 1.00 10.64 ? 41   ILE A CB  1 
ATOM   285  C CG1 . ILE A 1 40  ? 26.490  36.770 21.973 1.00 10.40 ? 41   ILE A CG1 1 
ATOM   286  C CG2 . ILE A 1 40  ? 28.437  35.986 23.443 1.00 11.85 ? 41   ILE A CG2 1 
ATOM   287  C CD1 . ILE A 1 40  ? 25.435  35.710 22.281 1.00 10.60 ? 41   ILE A CD1 1 
ATOM   288  N N   . LYS A 1 41  ? 30.914  36.126 20.684 1.00 11.30 ? 42   LYS A N   1 
ATOM   289  C CA  . LYS A 1 41  ? 32.316  35.791 20.816 1.00 12.68 ? 42   LYS A CA  1 
ATOM   290  C C   . LYS A 1 41  ? 33.214  36.872 20.258 1.00 14.40 ? 42   LYS A C   1 
ATOM   291  O O   . LYS A 1 41  ? 34.258  37.144 20.876 1.00 17.39 ? 42   LYS A O   1 
ATOM   292  C CB  . LYS A 1 41  ? 32.582  34.456 20.083 1.00 15.46 ? 42   LYS A CB  1 
ATOM   293  C CG  . LYS A 1 41  ? 34.067  34.030 20.037 1.00 19.57 ? 42   LYS A CG  1 
ATOM   294  C CD  . LYS A 1 41  ? 34.315  32.789 20.885 1.00 33.32 ? 42   LYS A CD  1 
ATOM   295  C CE  . LYS A 1 41  ? 35.763  32.336 20.833 1.00 41.79 ? 42   LYS A CE  1 
ATOM   296  N NZ  . LYS A 1 41  ? 36.147  31.854 19.478 1.00 53.29 ? 42   LYS A NZ  1 
ATOM   297  N N   . THR A 1 42  ? 32.924  37.379 19.039 1.00 12.41 ? 43   THR A N   1 
ATOM   298  C CA  . THR A 1 42  ? 33.892  38.258 18.341 1.00 12.39 ? 43   THR A CA  1 
ATOM   299  C C   . THR A 1 42  ? 33.559  39.726 18.365 1.00 15.16 ? 43   THR A C   1 
ATOM   300  O O   . THR A 1 42  ? 34.446  40.564 18.098 1.00 14.35 ? 43   THR A O   1 
ATOM   301  C CB  . THR A 1 42  ? 33.999  37.848 16.846 1.00 17.34 ? 43   THR A CB  1 
ATOM   302  O OG1 . THR A 1 42  ? 32.780  38.227 16.198 1.00 15.99 ? 43   THR A OG1 1 
ATOM   303  C CG2 . THR A 1 42  ? 34.244  36.338 16.651 1.00 16.96 ? 43   THR A CG2 1 
ATOM   304  N N   . GLY A 1 43  ? 32.306  40.032 18.653 1.00 12.02 ? 44   GLY A N   1 
ATOM   305  C CA  . GLY A 1 43  ? 31.815  41.403 18.657 1.00 12.78 ? 44   GLY A CA  1 
ATOM   306  C C   . GLY A 1 43  ? 31.257  41.868 17.330 1.00 16.58 ? 44   GLY A C   1 
ATOM   307  O O   . GLY A 1 43  ? 30.719  42.967 17.250 1.00 18.70 ? 44   GLY A O   1 
ATOM   308  N N   . THR A 1 44  ? 31.426  41.061 16.271 1.00 12.33 ? 45   THR A N   1 
ATOM   309  C CA  . THR A 1 44  ? 30.979  41.409 14.944 1.00 11.96 ? 45   THR A CA  1 
ATOM   310  C C   . THR A 1 44  ? 29.659  40.700 14.621 1.00 13.32 ? 45   THR A C   1 
ATOM   311  O O   . THR A 1 44  ? 29.547  39.469 14.738 1.00 12.74 ? 45   THR A O   1 
ATOM   312  C CB  . THR A 1 44  ? 32.052  41.045 13.924 1.00 17.90 ? 45   THR A CB  1 
ATOM   313  O OG1 . THR A 1 44  ? 33.241  41.799 14.230 1.00 17.68 ? 45   THR A OG1 1 
ATOM   314  C CG2 . THR A 1 44  ? 31.636  41.385 12.502 1.00 20.60 ? 45   THR A CG2 1 
ATOM   315  N N   . LEU A 1 45  ? 28.702  41.482 14.126 1.00 11.20 ? 46   LEU A N   1 
ATOM   316  C CA  . LEU A 1 45  ? 27.400  40.964 13.675 1.00 10.57 ? 46   LEU A CA  1 
ATOM   317  C C   . LEU A 1 45  ? 27.384  40.956 12.152 1.00 12.85 ? 46   LEU A C   1 
ATOM   318  O O   . LEU A 1 45  ? 27.497  42.013 11.513 1.00 14.11 ? 46   LEU A O   1 
ATOM   319  C CB  . LEU A 1 45  ? 26.267  41.855 14.190 1.00 11.21 ? 46   LEU A CB  1 
ATOM   320  C CG  . LEU A 1 45  ? 24.844  41.366 13.848 1.00 12.98 ? 46   LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 45  ? 24.570  39.995 14.518 1.00 11.71 ? 46   LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 45  ? 23.791  42.429 14.281 1.00 14.66 ? 46   LEU A CD2 1 
ATOM   323  N N   . THR A 1 46  ? 27.320  39.735 11.570 1.00 10.81 ? 47   THR A N   1 
ATOM   324  C CA  . THR A 1 46  ? 27.313  39.595 10.114 1.00 10.64 ? 47   THR A CA  1 
ATOM   325  C C   . THR A 1 46  ? 26.277  38.565 9.688  1.00 11.44 ? 47   THR A C   1 
ATOM   326  O O   . THR A 1 46  ? 26.188  37.481 10.289 1.00 12.86 ? 47   THR A O   1 
ATOM   327  C CB  . THR A 1 46  ? 28.718  39.206 9.607  1.00 21.26 ? 47   THR A CB  1 
ATOM   328  O OG1 . THR A 1 46  ? 29.619  40.282 9.911  1.00 21.16 ? 47   THR A OG1 1 
ATOM   329  C CG2 . THR A 1 46  ? 28.767  38.936 8.085  1.00 21.08 ? 47   THR A CG2 1 
ATOM   330  N N   . SER A 1 47  ? 25.459  38.919 8.670  1.00 10.72 ? 48   SER A N   1 
ATOM   331  C CA  A SER A 1 47  ? 24.458  37.972 8.168  0.48 10.13 ? 48   SER A CA  1 
ATOM   332  C CA  B SER A 1 47  ? 24.465  37.998 8.146  0.52 10.60 ? 48   SER A CA  1 
ATOM   333  C C   . SER A 1 47  ? 25.164  36.864 7.400  1.00 12.42 ? 48   SER A C   1 
ATOM   334  O O   . SER A 1 47  ? 26.015  37.133 6.532  1.00 12.34 ? 48   SER A O   1 
ATOM   335  C CB  A SER A 1 47  ? 23.409  38.654 7.301  0.48 11.36 ? 48   SER A CB  1 
ATOM   336  C CB  B SER A 1 47  ? 23.515  38.739 7.229  0.52 13.14 ? 48   SER A CB  1 
ATOM   337  O OG  A SER A 1 47  ? 22.492  39.426 8.063  0.48 12.54 ? 48   SER A OG  1 
ATOM   338  O OG  B SER A 1 47  ? 22.478  37.868 6.837  0.52 15.86 ? 48   SER A OG  1 
ATOM   339  N N   . LEU A 1 48  ? 24.810  35.616 7.726  1.00 9.41  ? 49   LEU A N   1 
ATOM   340  C CA  . LEU A 1 48  ? 25.460  34.447 7.143  1.00 9.67  ? 49   LEU A CA  1 
ATOM   341  C C   . LEU A 1 48  ? 24.553  33.707 6.194  1.00 10.99 ? 49   LEU A C   1 
ATOM   342  O O   . LEU A 1 48  ? 23.346  33.970 6.110  1.00 11.85 ? 49   LEU A O   1 
ATOM   343  C CB  . LEU A 1 48  ? 25.971  33.524 8.243  1.00 9.29  ? 49   LEU A CB  1 
ATOM   344  C CG  . LEU A 1 48  ? 26.926  34.227 9.234  1.00 9.45  ? 49   LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 48  ? 27.175  33.352 10.444 1.00 11.94 ? 49   LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 48  ? 28.311  34.484 8.572  1.00 11.26 ? 49   LEU A CD2 1 
ATOM   347  N N   . SER A 1 49  ? 25.154  32.803 5.417  1.00 10.94 ? 50   SER A N   1 
ATOM   348  C CA  . SER A 1 49  ? 24.473  32.163 4.304  1.00 10.82 ? 50   SER A CA  1 
ATOM   349  C C   . SER A 1 49  ? 23.642  30.909 4.608  1.00 13.42 ? 50   SER A C   1 
ATOM   350  O O   . SER A 1 49  ? 24.187  29.801 4.728  1.00 14.33 ? 50   SER A O   1 
ATOM   351  C CB  . SER A 1 49  ? 25.485  31.807 3.214  1.00 13.54 ? 50   SER A CB  1 
ATOM   352  O OG  . SER A 1 49  ? 24.828  31.253 2.085  1.00 13.57 ? 50   SER A OG  1 
ATOM   353  N N   . GLU A 1 50  ? 22.296  31.059 4.577  1.00 12.19 ? 51   GLU A N   1 
ATOM   354  C CA  . GLU A 1 50  ? 21.414  29.901 4.628  1.00 11.19 ? 51   GLU A CA  1 
ATOM   355  C C   . GLU A 1 50  ? 21.602  29.064 3.376  1.00 14.24 ? 51   GLU A C   1 
ATOM   356  O O   . GLU A 1 50  ? 21.491  27.832 3.447  1.00 13.98 ? 51   GLU A O   1 
ATOM   357  C CB  . GLU A 1 50  ? 19.937  30.325 4.675  1.00 13.54 ? 51   GLU A CB  1 
ATOM   358  C CG  . GLU A 1 50  ? 19.510  30.908 6.003  1.00 15.55 ? 51   GLU A CG  1 
ATOM   359  C CD  . GLU A 1 50  ? 19.831  32.371 6.176  1.00 18.99 ? 51   GLU A CD  1 
ATOM   360  O OE1 . GLU A 1 50  ? 20.220  33.027 5.183  1.00 21.58 ? 51   GLU A OE1 1 
ATOM   361  O OE2 . GLU A 1 50  ? 19.723  32.852 7.324  1.00 18.74 ? 51   GLU A OE2 1 
ATOM   362  N N   . GLU A 1 51  ? 21.772  29.746 2.206  1.00 13.52 ? 52   GLU A N   1 
ATOM   363  C CA  . GLU A 1 51  ? 21.883  29.032 0.938  1.00 13.48 ? 52   GLU A CA  1 
ATOM   364  C C   . GLU A 1 51  ? 23.058  28.069 0.955  1.00 14.95 ? 52   GLU A C   1 
ATOM   365  O O   . GLU A 1 51  ? 22.942  26.989 0.382  1.00 16.31 ? 52   GLU A O   1 
ATOM   366  C CB  . GLU A 1 51  ? 22.009  30.010 -0.238 1.00 15.22 ? 52   GLU A CB  1 
ATOM   367  C CG  . GLU A 1 51  ? 21.748  29.316 -1.566 1.00 16.68 ? 52   GLU A CG  1 
ATOM   368  C CD  . GLU A 1 51  ? 20.325  28.829 -1.750 1.00 21.49 ? 52   GLU A CD  1 
ATOM   369  O OE1 . GLU A 1 51  ? 19.402  29.594 -1.406 1.00 21.34 ? 52   GLU A OE1 1 
ATOM   370  O OE2 . GLU A 1 51  ? 20.123  27.699 -2.256 1.00 24.95 ? 52   GLU A OE2 1 
ATOM   371  N N   . GLN A 1 52  ? 24.180  28.448 1.593  1.00 12.50 ? 53   GLN A N   1 
ATOM   372  C CA  . GLN A 1 52  ? 25.303  27.531 1.687  1.00 12.75 ? 53   GLN A CA  1 
ATOM   373  C C   . GLN A 1 52  ? 24.872  26.236 2.369  1.00 15.39 ? 53   GLN A C   1 
ATOM   374  O O   . GLN A 1 52  ? 25.208  25.158 1.880  1.00 15.37 ? 53   GLN A O   1 
ATOM   375  C CB  . GLN A 1 52  ? 26.468  28.172 2.441  1.00 12.80 ? 53   GLN A CB  1 
ATOM   376  C CG  . GLN A 1 52  ? 27.628  27.193 2.616  1.00 14.50 ? 53   GLN A CG  1 
ATOM   377  C CD  . GLN A 1 52  ? 28.787  27.825 3.305  1.00 15.36 ? 53   GLN A CD  1 
ATOM   378  O OE1 . GLN A 1 52  ? 28.923  29.038 3.310  1.00 14.01 ? 53   GLN A OE1 1 
ATOM   379  N NE2 . GLN A 1 52  ? 29.694  26.984 3.791  1.00 13.57 ? 53   GLN A NE2 1 
ATOM   380  N N   . ILE A 1 53  ? 24.183  26.329 3.509  1.00 13.97 ? 54   ILE A N   1 
ATOM   381  C CA  . ILE A 1 53  ? 23.781  25.117 4.197  1.00 13.37 ? 54   ILE A CA  1 
ATOM   382  C C   . ILE A 1 53  ? 22.793  24.320 3.342  1.00 17.57 ? 54   ILE A C   1 
ATOM   383  O O   . ILE A 1 53  ? 22.975  23.117 3.181  1.00 16.71 ? 54   ILE A O   1 
ATOM   384  C CB  . ILE A 1 53  ? 23.182  25.491 5.570  1.00 14.75 ? 54   ILE A CB  1 
ATOM   385  C CG1 . ILE A 1 53  ? 24.223  26.296 6.403  1.00 15.30 ? 54   ILE A CG1 1 
ATOM   386  C CG2 . ILE A 1 53  ? 22.777  24.218 6.315  1.00 17.46 ? 54   ILE A CG2 1 
ATOM   387  C CD1 . ILE A 1 53  ? 23.771  26.585 7.871  1.00 18.83 ? 54   ILE A CD1 1 
ATOM   388  N N   . VAL A 1 54  ? 21.811  24.983 2.731  1.00 14.57 ? 55   VAL A N   1 
ATOM   389  C CA  . VAL A 1 54  ? 20.809  24.279 1.913  1.00 14.98 ? 55   VAL A CA  1 
ATOM   390  C C   . VAL A 1 54  ? 21.485  23.564 0.735  1.00 19.77 ? 55   VAL A C   1 
ATOM   391  O O   . VAL A 1 54  ? 21.196  22.388 0.473  1.00 21.22 ? 55   VAL A O   1 
ATOM   392  C CB  . VAL A 1 54  ? 19.731  25.296 1.463  1.00 18.79 ? 55   VAL A CB  1 
ATOM   393  C CG1 . VAL A 1 54  ? 18.829  24.749 0.363  1.00 20.26 ? 55   VAL A CG1 1 
ATOM   394  C CG2 . VAL A 1 54  ? 18.922  25.791 2.656  1.00 18.09 ? 55   VAL A CG2 1 
ATOM   395  N N   . ASP A 1 55  ? 22.418  24.246 0.066  1.00 17.43 ? 56   ASP A N   1 
ATOM   396  C CA  . ASP A 1 55  ? 23.090  23.673 -1.098 1.00 17.65 ? 56   ASP A CA  1 
ATOM   397  C C   . ASP A 1 55  ? 24.158  22.622 -0.809 1.00 21.45 ? 56   ASP A C   1 
ATOM   398  O O   . ASP A 1 55  ? 24.370  21.735 -1.654 1.00 23.00 ? 56   ASP A O   1 
ATOM   399  C CB  . ASP A 1 55  ? 23.803  24.789 -1.883 1.00 18.67 ? 56   ASP A CB  1 
ATOM   400  C CG  . ASP A 1 55  ? 22.926  25.885 -2.450 1.00 22.39 ? 56   ASP A CG  1 
ATOM   401  O OD1 . ASP A 1 55  ? 21.691  25.730 -2.426 1.00 20.66 ? 56   ASP A OD1 1 
ATOM   402  O OD2 . ASP A 1 55  ? 23.473  26.825 -3.040 1.00 22.40 ? 56   ASP A OD2 1 
ATOM   403  N N   . CYS A 1 56  ? 24.893  22.782 0.308  1.00 19.26 ? 57   CYS A N   1 
ATOM   404  C CA  . CYS A 1 56  ? 26.108  22.006 0.615  1.00 19.11 ? 57   CYS A CA  1 
ATOM   405  C C   . CYS A 1 56  ? 25.941  20.899 1.637  1.00 22.32 ? 57   CYS A C   1 
ATOM   406  O O   . CYS A 1 56  ? 26.760  19.983 1.617  1.00 23.12 ? 57   CYS A O   1 
ATOM   407  C CB  . CYS A 1 56  ? 27.206  22.960 1.067  1.00 17.75 ? 57   CYS A CB  1 
ATOM   408  S SG  . CYS A 1 56  ? 27.547  24.298 -0.103 1.00 20.75 ? 57   CYS A SG  1 
ATOM   409  N N   . ASP A 1 57  ? 25.001  21.031 2.586  1.00 18.35 ? 58   ASP A N   1 
ATOM   410  C CA  . ASP A 1 57  ? 24.788  20.044 3.641  1.00 18.03 ? 58   ASP A CA  1 
ATOM   411  C C   . ASP A 1 57  ? 23.894  18.933 3.080  1.00 24.97 ? 58   ASP A C   1 
ATOM   412  O O   . ASP A 1 57  ? 22.695  18.879 3.392  1.00 25.30 ? 58   ASP A O   1 
ATOM   413  C CB  . ASP A 1 57  ? 24.161  20.752 4.841  1.00 17.94 ? 58   ASP A CB  1 
ATOM   414  C CG  . ASP A 1 57  ? 23.789  19.839 5.972  1.00 17.14 ? 58   ASP A CG  1 
ATOM   415  O OD1 . ASP A 1 57  ? 24.274  18.676 5.989  1.00 19.21 ? 58   ASP A OD1 1 
ATOM   416  O OD2 . ASP A 1 57  ? 23.069  20.286 6.852  1.00 16.97 ? 58   ASP A OD2 1 
ATOM   417  N N   . THR A 1 58  ? 24.493  18.068 2.259  1.00 24.07 ? 59   THR A N   1 
ATOM   418  C CA  . THR A 1 58  ? 23.786  17.007 1.521  1.00 26.49 ? 59   THR A CA  1 
ATOM   419  C C   . THR A 1 58  ? 24.377  15.610 1.789  1.00 34.89 ? 59   THR A C   1 
ATOM   420  O O   . THR A 1 58  ? 23.945  14.649 1.154  1.00 37.40 ? 59   THR A O   1 
ATOM   421  C CB  . THR A 1 58  ? 23.837  17.339 0.008  1.00 37.76 ? 59   THR A CB  1 
ATOM   422  O OG1 . THR A 1 58  ? 25.205  17.431 -0.415 1.00 36.25 ? 59   THR A OG1 1 
ATOM   423  C CG2 . THR A 1 58  ? 23.081  18.628 -0.349 1.00 38.16 ? 59   THR A CG2 1 
ATOM   424  N N   . ASN A 1 59  ? 25.366  15.489 2.697  1.00 31.44 ? 60   ASN A N   1 
ATOM   425  C CA  . ASN A 1 59  ? 25.989  14.189 2.980  1.00 31.90 ? 60   ASN A CA  1 
ATOM   426  C C   . ASN A 1 59  ? 25.485  13.587 4.302  1.00 35.26 ? 60   ASN A C   1 
ATOM   427  O O   . ASN A 1 59  ? 25.929  12.505 4.699  1.00 37.37 ? 60   ASN A O   1 
ATOM   428  C CB  . ASN A 1 59  ? 27.523  14.312 2.966  1.00 32.75 ? 60   ASN A CB  1 
ATOM   429  C CG  . ASN A 1 59  ? 28.082  14.541 1.579  1.00 57.87 ? 60   ASN A CG  1 
ATOM   430  O OD1 . ASN A 1 59  ? 27.964  13.696 0.684  1.00 54.45 ? 60   ASN A OD1 1 
ATOM   431  N ND2 . ASN A 1 59  ? 28.704  15.689 1.363  1.00 49.68 ? 60   ASN A ND2 1 
ATOM   432  N N   . GLY A 1 60  ? 24.522  14.254 4.933  1.00 28.81 ? 61   GLY A N   1 
ATOM   433  C CA  . GLY A 1 60  ? 23.943  13.789 6.188  1.00 28.06 ? 61   GLY A CA  1 
ATOM   434  C C   . GLY A 1 60  ? 22.443  13.587 6.135  1.00 31.75 ? 61   GLY A C   1 
ATOM   435  O O   . GLY A 1 60  ? 21.921  13.062 5.149  1.00 32.54 ? 61   GLY A O   1 
ATOM   436  N N   . ASN A 1 61  ? 21.736  14.014 7.196  1.00 28.05 ? 62   ASN A N   1 
ATOM   437  C CA  . ASN A 1 61  ? 20.284  13.823 7.284  1.00 27.41 ? 62   ASN A CA  1 
ATOM   438  C C   . ASN A 1 61  ? 19.485  15.048 6.812  1.00 29.01 ? 62   ASN A C   1 
ATOM   439  O O   . ASN A 1 61  ? 18.247  15.042 6.877  1.00 28.72 ? 62   ASN A O   1 
ATOM   440  C CB  . ASN A 1 61  ? 19.891  13.483 8.733  1.00 28.57 ? 62   ASN A CB  1 
ATOM   441  C CG  . ASN A 1 61  ? 20.576  12.251 9.282  1.00 51.91 ? 62   ASN A CG  1 
ATOM   442  O OD1 . ASN A 1 61  ? 20.490  11.164 8.716  1.00 48.72 ? 62   ASN A OD1 1 
ATOM   443  N ND2 . ASN A 1 61  ? 21.286  12.398 10.392 1.00 41.88 ? 62   ASN A ND2 1 
ATOM   444  N N   . ASP A 1 62  ? 20.185  16.120 6.399  1.00 21.91 ? 63   ASP A N   1 
ATOM   445  C CA  . ASP A 1 62  ? 19.527  17.341 5.949  1.00 19.50 ? 63   ASP A CA  1 
ATOM   446  C C   . ASP A 1 62  ? 19.339  17.315 4.441  1.00 23.22 ? 63   ASP A C   1 
ATOM   447  O O   . ASP A 1 62  ? 20.236  16.913 3.684  1.00 25.63 ? 63   ASP A O   1 
ATOM   448  C CB  . ASP A 1 62  ? 20.318  18.570 6.392  1.00 17.99 ? 63   ASP A CB  1 
ATOM   449  C CG  . ASP A 1 62  ? 20.495  18.621 7.882  1.00 19.62 ? 63   ASP A CG  1 
ATOM   450  O OD1 . ASP A 1 62  ? 19.524  18.314 8.607  1.00 17.81 ? 63   ASP A OD1 1 
ATOM   451  O OD2 . ASP A 1 62  ? 21.593  18.997 8.329  1.00 18.38 ? 63   ASP A OD2 1 
ATOM   452  N N   . LYS A 1 63  ? 18.149  17.741 4.015  1.00 20.67 ? 64   LYS A N   1 
ATOM   453  C CA  . LYS A 1 63  ? 17.674  17.576 2.635  1.00 22.26 ? 64   LYS A CA  1 
ATOM   454  C C   . LYS A 1 63  ? 17.193  18.864 1.956  1.00 27.02 ? 64   LYS A C   1 
ATOM   455  O O   . LYS A 1 63  ? 16.164  18.839 1.292  1.00 27.72 ? 64   LYS A O   1 
ATOM   456  C CB  . LYS A 1 63  ? 16.516  16.539 2.635  1.00 25.32 ? 64   LYS A CB  1 
ATOM   457  C CG  . LYS A 1 63  ? 16.856  15.206 3.300  1.00 26.58 ? 64   LYS A CG  1 
ATOM   458  C CD  . LYS A 1 63  ? 17.934  14.452 2.515  1.00 28.69 ? 64   LYS A CD  1 
ATOM   459  C CE  . LYS A 1 63  ? 18.584  13.380 3.338  1.00 38.16 ? 64   LYS A CE  1 
ATOM   460  N NZ  . LYS A 1 63  ? 19.744  12.777 2.624  1.00 43.12 ? 64   LYS A NZ  1 
ATOM   461  N N   . GLY A 1 64  ? 17.940  19.959 2.093  1.00 25.12 ? 65   GLY A N   1 
ATOM   462  C CA  . GLY A 1 64  ? 17.595  21.221 1.443  1.00 25.71 ? 65   GLY A CA  1 
ATOM   463  C C   . GLY A 1 64  ? 16.189  21.718 1.711  1.00 26.68 ? 65   GLY A C   1 
ATOM   464  O O   . GLY A 1 64  ? 15.786  21.847 2.873  1.00 23.57 ? 65   GLY A O   1 
ATOM   465  N N   . CYS A 1 65  ? 15.415  21.964 0.619  1.00 24.82 ? 66   CYS A N   1 
ATOM   466  C CA  . CYS A 1 65  ? 14.029  22.436 0.718  1.00 24.11 ? 66   CYS A CA  1 
ATOM   467  C C   . CYS A 1 65  ? 13.095  21.329 1.264  1.00 25.18 ? 66   CYS A C   1 
ATOM   468  O O   . CYS A 1 65  ? 11.955  21.627 1.603  1.00 25.66 ? 66   CYS A O   1 
ATOM   469  C CB  . CYS A 1 65  ? 13.520  22.967 -0.624 1.00 25.80 ? 66   CYS A CB  1 
ATOM   470  S SG  . CYS A 1 65  ? 14.300  24.516 -1.176 1.00 28.61 ? 66   CYS A SG  1 
ATOM   471  N N   . ASN A 1 66  ? 13.587  20.090 1.406  1.00 22.86 ? 67   ASN A N   1 
ATOM   472  C CA  . ASN A 1 66  ? 12.786  18.946 1.894  1.00 23.31 ? 67   ASN A CA  1 
ATOM   473  C C   . ASN A 1 66  ? 12.928  18.696 3.410  1.00 26.87 ? 67   ASN A C   1 
ATOM   474  O O   . ASN A 1 66  ? 12.429  17.681 3.908  1.00 28.55 ? 67   ASN A O   1 
ATOM   475  C CB  . ASN A 1 66  ? 13.146  17.675 1.117  1.00 24.77 ? 67   ASN A CB  1 
ATOM   476  C CG  . ASN A 1 66  ? 12.966  17.823 -0.368 1.00 38.52 ? 67   ASN A CG  1 
ATOM   477  O OD1 . ASN A 1 66  ? 12.089  18.562 -0.836 1.00 30.88 ? 67   ASN A OD1 1 
ATOM   478  N ND2 . ASN A 1 66  ? 13.771  17.102 -1.145 1.00 35.76 ? 67   ASN A ND2 1 
ATOM   479  N N   . GLY A 1 67  ? 13.547  19.635 4.126  1.00 21.82 ? 68   GLY A N   1 
ATOM   480  C CA  . GLY A 1 67  ? 13.686  19.567 5.575  1.00 20.35 ? 68   GLY A CA  1 
ATOM   481  C C   . GLY A 1 67  ? 15.026  19.115 6.102  1.00 22.85 ? 68   GLY A C   1 
ATOM   482  O O   . GLY A 1 67  ? 15.882  18.616 5.372  1.00 24.27 ? 68   GLY A O   1 
ATOM   483  N N   . GLY A 1 68  ? 15.213  19.336 7.388  1.00 20.21 ? 69   GLY A N   1 
ATOM   484  C CA  . GLY A 1 68  ? 16.427  18.990 8.096  1.00 17.90 ? 69   GLY A CA  1 
ATOM   485  C C   . GLY A 1 68  ? 16.272  19.399 9.546  1.00 19.08 ? 69   GLY A C   1 
ATOM   486  O O   . GLY A 1 68  ? 15.150  19.593 10.031 1.00 18.96 ? 69   GLY A O   1 
ATOM   487  N N   . THR A 1 69  ? 17.380  19.527 10.271 1.00 15.24 ? 70   THR A N   1 
ATOM   488  C CA  . THR A 1 69  ? 17.300  19.973 11.654 1.00 13.81 ? 70   THR A CA  1 
ATOM   489  C C   . THR A 1 69  ? 18.385  20.993 11.940 1.00 14.54 ? 70   THR A C   1 
ATOM   490  O O   . THR A 1 69  ? 19.486  20.928 11.339 1.00 15.26 ? 70   THR A O   1 
ATOM   491  C CB  . THR A 1 69  ? 17.454  18.822 12.684 1.00 18.57 ? 70   THR A CB  1 
ATOM   492  O OG1 . THR A 1 69  ? 18.775  18.300 12.644 1.00 19.81 ? 70   THR A OG1 1 
ATOM   493  C CG2 . THR A 1 69  ? 16.396  17.721 12.565 1.00 17.91 ? 70   THR A CG2 1 
ATOM   494  N N   . PRO A 1 70  ? 18.173  21.884 12.920 1.00 12.46 ? 71   PRO A N   1 
ATOM   495  C CA  . PRO A 1 70  ? 19.267  22.800 13.305 1.00 11.28 ? 71   PRO A CA  1 
ATOM   496  C C   . PRO A 1 70  ? 20.550  22.069 13.701 1.00 13.00 ? 71   PRO A C   1 
ATOM   497  O O   . PRO A 1 70  ? 21.629  22.514 13.297 1.00 11.99 ? 71   PRO A O   1 
ATOM   498  C CB  . PRO A 1 70  ? 18.681  23.577 14.491 1.00 12.06 ? 71   PRO A CB  1 
ATOM   499  C CG  . PRO A 1 70  ? 17.177  23.555 14.247 1.00 15.03 ? 71   PRO A CG  1 
ATOM   500  C CD  . PRO A 1 70  ? 16.930  22.149 13.679 1.00 12.54 ? 71   PRO A CD  1 
ATOM   501  N N   . ASP A 1 71  ? 20.468  20.892 14.366 1.00 12.20 ? 72   ASP A N   1 
ATOM   502  C CA  . ASP A 1 71  ? 21.708  20.182 14.729 1.00 12.58 ? 72   ASP A CA  1 
ATOM   503  C C   . ASP A 1 71  ? 22.450  19.688 13.504 1.00 15.35 ? 72   ASP A C   1 
ATOM   504  O O   . ASP A 1 71  ? 23.671  19.711 13.498 1.00 15.82 ? 72   ASP A O   1 
ATOM   505  C CB  . ASP A 1 71  ? 21.450  19.013 15.666 1.00 13.87 ? 72   ASP A CB  1 
ATOM   506  C CG  . ASP A 1 71  ? 21.118  19.382 17.087 1.00 17.45 ? 72   ASP A CG  1 
ATOM   507  O OD1 . ASP A 1 71  ? 21.243  20.584 17.439 1.00 16.61 ? 72   ASP A OD1 1 
ATOM   508  O OD2 . ASP A 1 71  ? 20.789  18.466 17.864 1.00 16.17 ? 72   ASP A OD2 1 
ATOM   509  N N   . GLY A 1 72  ? 21.723  19.210 12.490 1.00 13.51 ? 73   GLY A N   1 
ATOM   510  C CA  . GLY A 1 72  ? 22.373  18.785 11.250 1.00 11.65 ? 73   GLY A CA  1 
ATOM   511  C C   . GLY A 1 72  ? 23.105  19.948 10.589 1.00 15.49 ? 73   GLY A C   1 
ATOM   512  O O   . GLY A 1 72  ? 24.213  19.773 10.062 1.00 16.11 ? 73   GLY A O   1 
ATOM   513  N N   . ALA A 1 73  ? 22.480  21.145 10.615 1.00 12.97 ? 74   ALA A N   1 
ATOM   514  C CA  . ALA A 1 73  ? 23.110  22.356 10.078 1.00 11.98 ? 74   ALA A CA  1 
ATOM   515  C C   . ALA A 1 73  ? 24.360  22.710 10.869 1.00 14.11 ? 74   ALA A C   1 
ATOM   516  O O   . ALA A 1 73  ? 25.392  23.006 10.278 1.00 12.73 ? 74   ALA A O   1 
ATOM   517  C CB  . ALA A 1 73  ? 22.121  23.506 10.093 1.00 11.66 ? 74   ALA A CB  1 
ATOM   518  N N   . PHE A 1 74  ? 24.289  22.665 12.223 1.00 11.98 ? 75   PHE A N   1 
ATOM   519  C CA  . PHE A 1 74  ? 25.482  22.930 13.023 1.00 10.97 ? 75   PHE A CA  1 
ATOM   520  C C   . PHE A 1 74  ? 26.601  21.929 12.663 1.00 14.82 ? 75   PHE A C   1 
ATOM   521  O O   . PHE A 1 74  ? 27.745  22.341 12.473 1.00 13.92 ? 75   PHE A O   1 
ATOM   522  C CB  . PHE A 1 74  ? 25.166  22.882 14.523 1.00 10.70 ? 75   PHE A CB  1 
ATOM   523  C CG  . PHE A 1 74  ? 24.113  23.862 15.012 1.00 9.71  ? 75   PHE A CG  1 
ATOM   524  C CD1 . PHE A 1 74  ? 24.035  25.155 14.487 1.00 9.32  ? 75   PHE A CD1 1 
ATOM   525  C CD2 . PHE A 1 74  ? 23.258  23.517 16.043 1.00 9.58  ? 75   PHE A CD2 1 
ATOM   526  C CE1 . PHE A 1 74  ? 23.066  26.059 14.944 1.00 11.23 ? 75   PHE A CE1 1 
ATOM   527  C CE2 . PHE A 1 74  ? 22.264  24.411 16.476 1.00 11.09 ? 75   PHE A CE2 1 
ATOM   528  C CZ  . PHE A 1 74  ? 22.187  25.677 15.946 1.00 10.95 ? 75   PHE A CZ  1 
ATOM   529  N N   . GLN A 1 75  ? 26.259  20.634 12.558 1.00 13.55 ? 76   GLN A N   1 
ATOM   530  C CA  . GLN A 1 75  ? 27.254  19.613 12.239 1.00 13.82 ? 76   GLN A CA  1 
ATOM   531  C C   . GLN A 1 75  ? 27.924  19.918 10.903 1.00 16.15 ? 76   GLN A C   1 
ATOM   532  O O   . GLN A 1 75  ? 29.139  19.781 10.776 1.00 16.49 ? 76   GLN A O   1 
ATOM   533  C CB  . GLN A 1 75  ? 26.634  18.224 12.217 1.00 16.61 ? 76   GLN A CB  1 
ATOM   534  C CG  . GLN A 1 75  ? 27.705  17.123 12.223 1.00 22.91 ? 76   GLN A CG  1 
ATOM   535  C CD  . GLN A 1 75  ? 28.698  17.248 13.364 1.00 35.46 ? 76   GLN A CD  1 
ATOM   536  O OE1 . GLN A 1 75  ? 28.351  17.107 14.541 1.00 33.30 ? 76   GLN A OE1 1 
ATOM   537  N NE2 . GLN A 1 75  ? 29.962  17.517 13.034 1.00 30.92 ? 76   GLN A NE2 1 
ATOM   538  N N   . TYR A 1 76  ? 27.133  20.358 9.910  1.00 13.68 ? 77   TYR A N   1 
ATOM   539  C CA  . TYR A 1 76  ? 27.703  20.714 8.613  1.00 14.59 ? 77   TYR A CA  1 
ATOM   540  C C   . TYR A 1 76  ? 28.698  21.870 8.756  1.00 16.33 ? 77   TYR A C   1 
ATOM   541  O O   . TYR A 1 76  ? 29.776  21.821 8.169  1.00 15.56 ? 77   TYR A O   1 
ATOM   542  C CB  . TYR A 1 76  ? 26.596  21.106 7.616  1.00 14.71 ? 77   TYR A CB  1 
ATOM   543  C CG  . TYR A 1 76  ? 27.172  21.877 6.451  1.00 15.22 ? 77   TYR A CG  1 
ATOM   544  C CD1 . TYR A 1 76  ? 27.883  21.222 5.443  1.00 16.01 ? 77   TYR A CD1 1 
ATOM   545  C CD2 . TYR A 1 76  ? 27.136  23.262 6.428  1.00 16.36 ? 77   TYR A CD2 1 
ATOM   546  C CE1 . TYR A 1 76  ? 28.511  21.935 4.424  1.00 17.07 ? 77   TYR A CE1 1 
ATOM   547  C CE2 . TYR A 1 76  ? 27.776  23.986 5.433  1.00 15.74 ? 77   TYR A CE2 1 
ATOM   548  C CZ  . TYR A 1 76  ? 28.432  23.319 4.410  1.00 17.10 ? 77   TYR A CZ  1 
ATOM   549  O OH  . TYR A 1 76  ? 29.101  24.042 3.460  1.00 18.08 ? 77   TYR A OH  1 
ATOM   550  N N   . VAL A 1 77  ? 28.349  22.917 9.522  1.00 12.18 ? 78   VAL A N   1 
ATOM   551  C CA  . VAL A 1 77  ? 29.251  24.071 9.641  1.00 11.54 ? 78   VAL A CA  1 
ATOM   552  C C   . VAL A 1 77  ? 30.503  23.669 10.393 1.00 15.71 ? 78   VAL A C   1 
ATOM   553  O O   . VAL A 1 77  ? 31.609  24.100 10.000 1.00 16.55 ? 78   VAL A O   1 
ATOM   554  C CB  . VAL A 1 77  ? 28.530  25.288 10.267 1.00 12.74 ? 78   VAL A CB  1 
ATOM   555  C CG1 . VAL A 1 77  ? 29.486  26.487 10.425 1.00 12.80 ? 78   VAL A CG1 1 
ATOM   556  C CG2 . VAL A 1 77  ? 27.327  25.676 9.398  1.00 12.57 ? 78   VAL A CG2 1 
ATOM   557  N N   . VAL A 1 78  ? 30.358  22.786 11.418 1.00 14.14 ? 79   VAL A N   1 
ATOM   558  C CA  . VAL A 1 78  ? 31.525  22.257 12.137 1.00 15.96 ? 79   VAL A CA  1 
ATOM   559  C C   . VAL A 1 78  ? 32.432  21.513 11.154 1.00 20.11 ? 79   VAL A C   1 
ATOM   560  O O   . VAL A 1 78  ? 33.639  21.784 11.093 1.00 21.78 ? 79   VAL A O   1 
ATOM   561  C CB  . VAL A 1 78  ? 31.095  21.337 13.308 1.00 18.04 ? 79   VAL A CB  1 
ATOM   562  C CG1 . VAL A 1 78  ? 32.299  20.579 13.882 1.00 19.36 ? 79   VAL A CG1 1 
ATOM   563  C CG2 . VAL A 1 78  ? 30.381  22.141 14.411 1.00 17.40 ? 79   VAL A CG2 1 
ATOM   564  N N   . ASN A 1 79  ? 31.856  20.598 10.364 1.00 16.56 ? 80   ASN A N   1 
ATOM   565  C CA  . ASN A 1 79  ? 32.629  19.781 9.399  1.00 17.21 ? 80   ASN A CA  1 
ATOM   566  C C   . ASN A 1 79  ? 33.261  20.622 8.285  1.00 21.20 ? 80   ASN A C   1 
ATOM   567  O O   . ASN A 1 79  ? 34.393  20.364 7.856  1.00 22.53 ? 80   ASN A O   1 
ATOM   568  C CB  . ASN A 1 79  ? 31.721  18.710 8.806  1.00 18.33 ? 80   ASN A CB  1 
ATOM   569  C CG  . ASN A 1 79  ? 31.317  17.615 9.763  1.00 26.18 ? 80   ASN A CG  1 
ATOM   570  O OD1 . ASN A 1 79  ? 31.796  17.538 10.896 1.00 29.20 ? 80   ASN A OD1 1 
ATOM   571  N ND2 . ASN A 1 79  ? 30.356  16.815 9.352  1.00 27.41 ? 80   ASN A ND2 1 
ATOM   572  N N   . ASN A 1 80  ? 32.547  21.654 7.843  1.00 16.95 ? 81   ASN A N   1 
ATOM   573  C CA  . ASN A 1 80  ? 33.053  22.528 6.795  1.00 17.92 ? 81   ASN A CA  1 
ATOM   574  C C   . ASN A 1 80  ? 34.137  23.505 7.280  1.00 18.51 ? 81   ASN A C   1 
ATOM   575  O O   . ASN A 1 80  ? 34.862  24.084 6.455  1.00 19.89 ? 81   ASN A O   1 
ATOM   576  C CB  . ASN A 1 80  ? 31.905  23.323 6.162  1.00 16.68 ? 81   ASN A CB  1 
ATOM   577  C CG  . ASN A 1 80  ? 32.356  23.940 4.859  1.00 17.97 ? 81   ASN A CG  1 
ATOM   578  O OD1 . ASN A 1 80  ? 32.877  23.240 3.938  1.00 20.43 ? 81   ASN A OD1 1 
ATOM   579  N ND2 . ASN A 1 80  ? 32.328  25.273 4.815  1.00 16.70 ? 81   ASN A ND2 1 
ATOM   580  N N   . GLN A 1 81  ? 34.238  23.707 8.606  1.00 16.79 ? 82   GLN A N   1 
ATOM   581  C CA  . GLN A 1 81  ? 35.179  24.635 9.260  1.00 16.56 ? 82   GLN A CA  1 
ATOM   582  C C   . GLN A 1 81  ? 34.894  26.107 8.879  1.00 18.69 ? 82   GLN A C   1 
ATOM   583  O O   . GLN A 1 81  ? 35.731  26.993 9.054  1.00 19.40 ? 82   GLN A O   1 
ATOM   584  C CB  . GLN A 1 81  ? 36.643  24.271 8.979  1.00 18.74 ? 82   GLN A CB  1 
ATOM   585  C CG  . GLN A 1 81  ? 37.047  22.961 9.631  1.00 27.83 ? 82   GLN A CG  1 
ATOM   586  C CD  . GLN A 1 81  ? 38.522  22.642 9.484  1.00 45.12 ? 82   GLN A CD  1 
ATOM   587  O OE1 . GLN A 1 81  ? 39.306  23.386 8.887  1.00 42.25 ? 82   GLN A OE1 1 
ATOM   588  N NE2 . GLN A 1 81  ? 38.930  21.514 10.024 1.00 42.13 ? 82   GLN A NE2 1 
ATOM   589  N N   . GLY A 1 82  ? 33.668  26.368 8.464  1.00 16.27 ? 83   GLY A N   1 
ATOM   590  C CA  . GLY A 1 82  ? 33.252  27.720 8.180  1.00 16.04 ? 83   GLY A CA  1 
ATOM   591  C C   . GLY A 1 82  ? 31.917  27.848 7.493  1.00 15.47 ? 83   GLY A C   1 
ATOM   592  O O   . GLY A 1 82  ? 31.340  26.874 6.984  1.00 14.18 ? 83   GLY A O   1 
ATOM   593  N N   . ILE A 1 83  ? 31.442  29.091 7.485  1.00 11.19 ? 84   ILE A N   1 
ATOM   594  C CA  . ILE A 1 83  ? 30.231  29.468 6.776  1.00 11.06 ? 84   ILE A CA  1 
ATOM   595  C C   . ILE A 1 83  ? 30.452  30.854 6.178  1.00 14.13 ? 84   ILE A C   1 
ATOM   596  O O   . ILE A 1 83  ? 31.056  31.750 6.805  1.00 13.88 ? 84   ILE A O   1 
ATOM   597  C CB  . ILE A 1 83  ? 28.948  29.364 7.632  1.00 11.05 ? 84   ILE A CB  1 
ATOM   598  C CG1 . ILE A 1 83  ? 27.688  29.671 6.770  1.00 10.59 ? 84   ILE A CG1 1 
ATOM   599  C CG2 . ILE A 1 83  ? 29.043  30.231 8.894  1.00 12.09 ? 84   ILE A CG2 1 
ATOM   600  C CD1 . ILE A 1 83  ? 26.339  29.413 7.499  1.00 13.94 ? 84   ILE A CD1 1 
ATOM   601  N N   . ASP A 1 84  ? 29.948  31.013 4.960  1.00 10.51 ? 85   ASP A N   1 
ATOM   602  C CA  . ASP A 1 84  ? 30.091  32.242 4.189  1.00 10.36 ? 85   ASP A CA  1 
ATOM   603  C C   . ASP A 1 84  ? 29.036  33.280 4.527  1.00 11.70 ? 85   ASP A C   1 
ATOM   604  O O   . ASP A 1 84  ? 28.032  32.978 5.197  1.00 12.25 ? 85   ASP A O   1 
ATOM   605  C CB  . ASP A 1 84  ? 30.038  31.905 2.703  1.00 12.13 ? 85   ASP A CB  1 
ATOM   606  C CG  . ASP A 1 84  ? 31.136  30.985 2.173  1.00 14.94 ? 85   ASP A CG  1 
ATOM   607  O OD1 . ASP A 1 84  ? 32.152  30.770 2.894  1.00 15.77 ? 85   ASP A OD1 1 
ATOM   608  O OD2 . ASP A 1 84  ? 30.922  30.371 1.105  1.00 15.01 ? 85   ASP A OD2 1 
ATOM   609  N N   . THR A 1 85  ? 29.261  34.531 4.042  1.00 11.70 ? 86   THR A N   1 
ATOM   610  C CA  . THR A 1 85  ? 28.288  35.593 4.278  1.00 10.54 ? 86   THR A CA  1 
ATOM   611  C C   . THR A 1 85  ? 27.088  35.477 3.356  1.00 12.51 ? 86   THR A C   1 
ATOM   612  O O   . THR A 1 85  ? 27.160  34.903 2.265  1.00 13.04 ? 86   THR A O   1 
ATOM   613  C CB  . THR A 1 85  ? 28.888  36.990 4.119  1.00 11.16 ? 86   THR A CB  1 
ATOM   614  O OG1 . THR A 1 85  ? 29.245  37.195 2.756  1.00 12.60 ? 86   THR A OG1 1 
ATOM   615  C CG2 . THR A 1 85  ? 30.085  37.218 5.013  1.00 13.49 ? 86   THR A CG2 1 
ATOM   616  N N   . GLU A 1 86  ? 25.956  36.050 3.819  1.00 11.03 ? 87   GLU A N   1 
ATOM   617  C CA  . GLU A 1 86  ? 24.749  36.180 2.997  1.00 12.11 ? 87   GLU A CA  1 
ATOM   618  C C   . GLU A 1 86  ? 25.050  37.031 1.772  1.00 17.13 ? 87   GLU A C   1 
ATOM   619  O O   . GLU A 1 86  ? 24.587  36.725 0.670  1.00 16.35 ? 87   GLU A O   1 
ATOM   620  C CB  . GLU A 1 86  ? 23.651  36.834 3.847  1.00 12.97 ? 87   GLU A CB  1 
ATOM   621  C CG  . GLU A 1 86  ? 22.308  36.926 3.156  1.00 18.15 ? 87   GLU A CG  1 
ATOM   622  C CD  . GLU A 1 86  ? 21.411  35.743 3.467  1.00 42.76 ? 87   GLU A CD  1 
ATOM   623  O OE1 . GLU A 1 86  ? 21.184  35.446 4.665  1.00 31.55 ? 87   GLU A OE1 1 
ATOM   624  O OE2 . GLU A 1 86  ? 20.936  35.104 2.503  1.00 47.13 ? 87   GLU A OE2 1 
ATOM   625  N N   . SER A 1 87  ? 25.873  38.076 1.977  1.00 13.09 ? 88   SER A N   1 
ATOM   626  C CA  . SER A 1 87  ? 26.222  38.986 0.882  1.00 14.06 ? 88   SER A CA  1 
ATOM   627  C C   . SER A 1 87  ? 26.928  38.254 -0.261 1.00 17.54 ? 88   SER A C   1 
ATOM   628  O O   . SER A 1 87  ? 26.623  38.492 -1.437 1.00 20.57 ? 88   SER A O   1 
ATOM   629  C CB  A SER A 1 87  ? 27.126  40.099 1.401  0.59 17.03 ? 88   SER A CB  1 
ATOM   630  C CB  B SER A 1 87  ? 27.066  40.145 1.394  0.41 17.85 ? 88   SER A CB  1 
ATOM   631  O OG  A SER A 1 87  ? 27.542  40.946 0.337  0.59 19.19 ? 88   SER A OG  1 
ATOM   632  O OG  B SER A 1 87  ? 28.183  39.708 2.141  0.41 23.07 ? 88   SER A OG  1 
ATOM   633  N N   . ASP A 1 88  ? 27.862  37.357 0.078  1.00 13.79 ? 89   ASP A N   1 
ATOM   634  C CA  . ASP A 1 88  ? 28.598  36.623 -0.949 1.00 14.15 ? 89   ASP A CA  1 
ATOM   635  C C   . ASP A 1 88  ? 27.784  35.486 -1.526 1.00 16.06 ? 89   ASP A C   1 
ATOM   636  O O   . ASP A 1 88  ? 27.899  35.205 -2.717 1.00 17.62 ? 89   ASP A O   1 
ATOM   637  C CB  . ASP A 1 88  ? 29.904  36.044 -0.367 1.00 15.14 ? 89   ASP A CB  1 
ATOM   638  C CG  . ASP A 1 88  ? 31.030  37.023 -0.189 1.00 17.90 ? 89   ASP A CG  1 
ATOM   639  O OD1 . ASP A 1 88  ? 31.017  38.079 -0.877 1.00 22.63 ? 89   ASP A OD1 1 
ATOM   640  O OD2 . ASP A 1 88  ? 32.000  36.686 0.543  1.00 16.21 ? 89   ASP A OD2 1 
ATOM   641  N N   . TYR A 1 89  ? 27.008  34.789 -0.654 1.00 13.77 ? 90   TYR A N   1 
ATOM   642  C CA  . TYR A 1 89  ? 26.273  33.578 -1.052 1.00 14.08 ? 90   TYR A CA  1 
ATOM   643  C C   . TYR A 1 89  ? 24.796  33.797 -0.674 1.00 16.88 ? 90   TYR A C   1 
ATOM   644  O O   . TYR A 1 89  ? 24.310  33.223 0.287  1.00 14.71 ? 90   TYR A O   1 
ATOM   645  C CB  . TYR A 1 89  ? 26.936  32.395 -0.322 1.00 14.37 ? 90   TYR A CB  1 
ATOM   646  C CG  . TYR A 1 89  ? 26.706  31.001 -0.886 1.00 14.76 ? 90   TYR A CG  1 
ATOM   647  C CD1 . TYR A 1 89  ? 25.609  30.722 -1.696 1.00 15.58 ? 90   TYR A CD1 1 
ATOM   648  C CD2 . TYR A 1 89  ? 27.544  29.948 -0.540 1.00 15.53 ? 90   TYR A CD2 1 
ATOM   649  C CE1 . TYR A 1 89  ? 25.398  29.436 -2.211 1.00 16.34 ? 90   TYR A CE1 1 
ATOM   650  C CE2 . TYR A 1 89  ? 27.344  28.667 -1.041 1.00 16.95 ? 90   TYR A CE2 1 
ATOM   651  C CZ  . TYR A 1 89  ? 26.271  28.413 -1.875 1.00 18.84 ? 90   TYR A CZ  1 
ATOM   652  O OH  . TYR A 1 89  ? 26.057  27.126 -2.323 1.00 17.71 ? 90   TYR A OH  1 
ATOM   653  N N   . PRO A 1 90  ? 24.066  34.583 -1.497 1.00 19.39 ? 91   PRO A N   1 
ATOM   654  C CA  . PRO A 1 90  ? 22.682  34.936 -1.166 1.00 18.82 ? 91   PRO A CA  1 
ATOM   655  C C   . PRO A 1 90  ? 21.676  33.821 -1.356 1.00 18.55 ? 91   PRO A C   1 
ATOM   656  O O   . PRO A 1 90  ? 21.917  32.814 -2.017 1.00 19.54 ? 91   PRO A O   1 
ATOM   657  C CB  . PRO A 1 90  ? 22.377  36.090 -2.134 1.00 22.44 ? 91   PRO A CB  1 
ATOM   658  C CG  . PRO A 1 90  ? 23.269  35.862 -3.291 1.00 27.12 ? 91   PRO A CG  1 
ATOM   659  C CD  . PRO A 1 90  ? 24.531  35.323 -2.696 1.00 22.35 ? 91   PRO A CD  1 
ATOM   660  N N   . TYR A 1 91  ? 20.533  34.026 -0.729 1.00 17.89 ? 92   TYR A N   1 
ATOM   661  C CA  . TYR A 1 91  ? 19.451  33.048 -0.745 1.00 18.09 ? 92   TYR A CA  1 
ATOM   662  C C   . TYR A 1 91  ? 18.694  33.062 -2.049 1.00 23.89 ? 92   TYR A C   1 
ATOM   663  O O   . TYR A 1 91  ? 18.073  34.068 -2.398 1.00 24.86 ? 92   TYR A O   1 
ATOM   664  C CB  . TYR A 1 91  ? 18.508  33.360 0.396  1.00 18.49 ? 92   TYR A CB  1 
ATOM   665  C CG  . TYR A 1 91  ? 17.439  32.316 0.590  1.00 18.12 ? 92   TYR A CG  1 
ATOM   666  C CD1 . TYR A 1 91  ? 17.764  31.020 0.982  1.00 18.69 ? 92   TYR A CD1 1 
ATOM   667  C CD2 . TYR A 1 91  ? 16.093  32.623 0.386  1.00 18.35 ? 92   TYR A CD2 1 
ATOM   668  C CE1 . TYR A 1 91  ? 16.775  30.058 1.187  1.00 19.28 ? 92   TYR A CE1 1 
ATOM   669  C CE2 . TYR A 1 91  ? 15.097  31.677 0.615  1.00 18.51 ? 92   TYR A CE2 1 
ATOM   670  C CZ  . TYR A 1 91  ? 15.449  30.397 1.007  1.00 20.63 ? 92   TYR A CZ  1 
ATOM   671  O OH  . TYR A 1 91  ? 14.487  29.460 1.241  1.00 21.86 ? 92   TYR A OH  1 
ATOM   672  N N   . THR A 1 92  ? 18.739  31.941 -2.775 1.00 21.82 ? 93   THR A N   1 
ATOM   673  C CA  . THR A 1 92  ? 18.085  31.808 -4.075 1.00 22.51 ? 93   THR A CA  1 
ATOM   674  C C   . THR A 1 92  ? 17.057  30.682 -4.110 1.00 26.31 ? 93   THR A C   1 
ATOM   675  O O   . THR A 1 92  ? 16.386  30.532 -5.141 1.00 27.30 ? 93   THR A O   1 
ATOM   676  C CB  . THR A 1 92  ? 19.124  31.573 -5.183 1.00 29.01 ? 93   THR A CB  1 
ATOM   677  O OG1 . THR A 1 92  ? 19.827  30.365 -4.901 1.00 32.96 ? 93   THR A OG1 1 
ATOM   678  C CG2 . THR A 1 92  ? 20.106  32.739 -5.342 1.00 31.44 ? 93   THR A CG2 1 
ATOM   679  N N   . ALA A 1 93  ? 16.929  29.895 -3.022 1.00 22.59 ? 94   ALA A N   1 
ATOM   680  C CA  . ALA A 1 93  ? 16.017  28.752 -2.993 1.00 23.51 ? 94   ALA A CA  1 
ATOM   681  C C   . ALA A 1 93  ? 14.548  29.123 -2.693 1.00 30.37 ? 94   ALA A C   1 
ATOM   682  O O   . ALA A 1 93  ? 13.729  28.220 -2.568 1.00 29.05 ? 94   ALA A O   1 
ATOM   683  C CB  . ALA A 1 93  ? 16.504  27.719 -1.988 1.00 23.46 ? 94   ALA A CB  1 
ATOM   684  N N   . GLY A 1 94  ? 14.224  30.419 -2.653 1.00 28.79 ? 95   GLY A N   1 
ATOM   685  C CA  . GLY A 1 94  ? 12.879  30.940 -2.386 1.00 29.15 ? 95   GLY A CA  1 
ATOM   686  C C   . GLY A 1 94  ? 11.743  30.408 -3.240 1.00 32.79 ? 95   GLY A C   1 
ATOM   687  O O   . GLY A 1 94  ? 10.592  30.414 -2.800 1.00 30.68 ? 95   GLY A O   1 
ATOM   688  N N   . GLY A 1 95  ? 12.055  29.956 -4.450 1.00 32.45 ? 96   GLY A N   1 
ATOM   689  C CA  . GLY A 1 95  ? 11.069  29.356 -5.350 1.00 34.73 ? 96   GLY A CA  1 
ATOM   690  C C   . GLY A 1 95  ? 10.928  27.851 -5.169 1.00 40.84 ? 96   GLY A C   1 
ATOM   691  O O   . GLY A 1 95  ? 10.159  27.203 -5.884 1.00 41.65 ? 96   GLY A O   1 
ATOM   692  N N   . GLY A 1 96  ? 11.678  27.299 -4.220 1.00 38.06 ? 97   GLY A N   1 
ATOM   693  C CA  . GLY A 1 96  ? 11.680  25.876 -3.888 1.00 39.21 ? 97   GLY A CA  1 
ATOM   694  C C   . GLY A 1 96  ? 12.777  25.056 -4.546 1.00 45.51 ? 97   GLY A C   1 
ATOM   695  O O   . GLY A 1 96  ? 12.713  23.821 -4.530 1.00 46.64 ? 97   GLY A O   1 
ATOM   696  N N   . SER A 1 97  ? 13.794  25.721 -5.119 1.00 41.17 ? 98   SER A N   1 
ATOM   697  C CA  . SER A 1 97  ? 14.889  25.022 -5.790 1.00 41.33 ? 98   SER A CA  1 
ATOM   698  C C   . SER A 1 97  ? 16.286  25.456 -5.310 1.00 42.62 ? 98   SER A C   1 
ATOM   699  O O   . SER A 1 97  ? 16.699  26.575 -5.608 1.00 41.43 ? 98   SER A O   1 
ATOM   700  C CB  . SER A 1 97  ? 14.796  25.215 -7.299 1.00 46.04 ? 98   SER A CB  1 
ATOM   701  O OG  . SER A 1 97  ? 13.668  24.544 -7.833 1.00 56.28 ? 98   SER A OG  1 
ATOM   702  N N   . PRO A 1 98  ? 17.064  24.573 -4.628 1.00 38.39 ? 99   PRO A N   1 
ATOM   703  C CA  . PRO A 1 98  ? 18.451  24.938 -4.279 1.00 36.40 ? 99   PRO A CA  1 
ATOM   704  C C   . PRO A 1 98  ? 19.346  24.824 -5.513 1.00 39.21 ? 99   PRO A C   1 
ATOM   705  O O   . PRO A 1 98  ? 18.865  24.458 -6.580 1.00 38.21 ? 99   PRO A O   1 
ATOM   706  C CB  . PRO A 1 98  ? 18.844  23.901 -3.210 1.00 37.96 ? 99   PRO A CB  1 
ATOM   707  C CG  . PRO A 1 98  ? 17.664  23.012 -3.033 1.00 43.68 ? 99   PRO A CG  1 
ATOM   708  C CD  . PRO A 1 98  ? 16.774  23.186 -4.221 1.00 40.34 ? 99   PRO A CD  1 
ATOM   709  N N   . GLY A 1 99  ? 20.625  25.140 -5.363 1.00 34.65 ? 100  GLY A N   1 
ATOM   710  C CA  . GLY A 1 99  ? 21.605  25.030 -6.433 1.00 33.41 ? 100  GLY A CA  1 
ATOM   711  C C   . GLY A 1 99  ? 22.808  24.204 -6.030 1.00 33.37 ? 100  GLY A C   1 
ATOM   712  O O   . GLY A 1 99  ? 22.834  23.639 -4.929 1.00 31.51 ? 100  GLY A O   1 
ATOM   713  N N   . THR A 1 100 ? 23.824  24.161 -6.917 1.00 29.68 ? 101  THR A N   1 
ATOM   714  C CA  . THR A 1 100 ? 25.114  23.479 -6.735 1.00 29.32 ? 101  THR A CA  1 
ATOM   715  C C   . THR A 1 100 ? 25.844  24.139 -5.537 1.00 29.60 ? 101  THR A C   1 
ATOM   716  O O   . THR A 1 100 ? 25.698  25.346 -5.330 1.00 28.08 ? 101  THR A O   1 
ATOM   717  C CB  . THR A 1 100 ? 25.928  23.517 -8.065 1.00 41.89 ? 101  THR A CB  1 
ATOM   718  O OG1 . THR A 1 100 ? 26.438  22.220 -8.385 1.00 49.22 ? 101  THR A OG1 1 
ATOM   719  C CG2 . THR A 1 100 ? 27.063  24.540 -8.080 1.00 37.20 ? 101  THR A CG2 1 
ATOM   720  N N   . CYS A 1 101 ? 26.620  23.361 -4.766 1.00 25.29 ? 102  CYS A N   1 
ATOM   721  C CA  . CYS A 1 101 ? 27.355  23.903 -3.618 1.00 23.59 ? 102  CYS A CA  1 
ATOM   722  C C   . CYS A 1 101 ? 28.466  24.858 -4.090 1.00 27.65 ? 102  CYS A C   1 
ATOM   723  O O   . CYS A 1 101 ? 29.261  24.498 -4.951 1.00 30.84 ? 102  CYS A O   1 
ATOM   724  C CB  . CYS A 1 101 ? 27.925  22.790 -2.750 1.00 23.44 ? 102  CYS A CB  1 
ATOM   725  S SG  . CYS A 1 101 ? 28.896  23.402 -1.350 1.00 24.80 ? 102  CYS A SG  1 
ATOM   726  N N   . SER A 1 102 ? 28.506  26.063 -3.526 1.00 21.56 ? 103  SER A N   1 
ATOM   727  C CA  . SER A 1 102 ? 29.506  27.080 -3.872 1.00 21.37 ? 103  SER A CA  1 
ATOM   728  C C   . SER A 1 102 ? 30.239  27.577 -2.645 1.00 21.49 ? 103  SER A C   1 
ATOM   729  O O   . SER A 1 102 ? 30.793  28.677 -2.673 1.00 21.93 ? 103  SER A O   1 
ATOM   730  C CB  . SER A 1 102 ? 28.845  28.260 -4.577 1.00 26.47 ? 103  SER A CB  1 
ATOM   731  O OG  . SER A 1 102 ? 28.220  27.853 -5.779 1.00 32.02 ? 103  SER A OG  1 
ATOM   732  N N   . ALA A 1 103 ? 30.284  26.767 -1.568 1.00 17.77 ? 104  ALA A N   1 
ATOM   733  C CA  . ALA A 1 103 ? 30.919  27.164 -0.306 1.00 16.95 ? 104  ALA A CA  1 
ATOM   734  C C   . ALA A 1 103 ? 32.367  27.643 -0.509 1.00 18.11 ? 104  ALA A C   1 
ATOM   735  O O   . ALA A 1 103 ? 32.716  28.708 -0.003 1.00 16.60 ? 104  ALA A O   1 
ATOM   736  C CB  . ALA A 1 103 ? 30.881  26.016 0.685  1.00 17.84 ? 104  ALA A CB  1 
ATOM   737  N N   . SER A 1 104 ? 33.158  26.934 -1.338 1.00 17.78 ? 105  SER A N   1 
ATOM   738  C CA  . SER A 1 104 ? 34.575  27.262 -1.555 1.00 18.73 ? 105  SER A CA  1 
ATOM   739  C C   . SER A 1 104 ? 34.797  28.470 -2.468 1.00 20.66 ? 105  SER A C   1 
ATOM   740  O O   . SER A 1 104 ? 35.943  28.878 -2.679 1.00 19.49 ? 105  SER A O   1 
ATOM   741  C CB  . SER A 1 104 ? 35.305  26.055 -2.123 1.00 23.38 ? 105  SER A CB  1 
ATOM   742  O OG  . SER A 1 104 ? 34.880  25.840 -3.455 1.00 29.69 ? 105  SER A OG  1 
ATOM   743  N N   . SER A 1 105 ? 33.722  29.073 -2.989 1.00 17.51 ? 106  SER A N   1 
ATOM   744  C CA  . SER A 1 105 ? 33.879  30.226 -3.888 1.00 17.04 ? 106  SER A CA  1 
ATOM   745  C C   . SER A 1 105 ? 34.105  31.513 -3.126 1.00 17.79 ? 106  SER A C   1 
ATOM   746  O O   . SER A 1 105 ? 34.464  32.524 -3.747 1.00 16.98 ? 106  SER A O   1 
ATOM   747  C CB  . SER A 1 105 ? 32.641  30.385 -4.766 1.00 21.15 ? 106  SER A CB  1 
ATOM   748  O OG  . SER A 1 105 ? 32.516  29.281 -5.650 1.00 25.88 ? 106  SER A OG  1 
ATOM   749  N N   . TYR A 1 106 ? 33.866  31.492 -1.794 1.00 16.12 ? 107  TYR A N   1 
ATOM   750  C CA  . TYR A 1 106 ? 33.944  32.695 -0.976 1.00 15.65 ? 107  TYR A CA  1 
ATOM   751  C C   . TYR A 1 106 ? 34.779  32.497 0.282  1.00 16.94 ? 107  TYR A C   1 
ATOM   752  O O   . TYR A 1 106 ? 35.048  31.375 0.727  1.00 16.34 ? 107  TYR A O   1 
ATOM   753  C CB  . TYR A 1 106 ? 32.521  33.154 -0.589 1.00 15.32 ? 107  TYR A CB  1 
ATOM   754  C CG  . TYR A 1 106 ? 31.595  33.179 -1.786 1.00 16.25 ? 107  TYR A CG  1 
ATOM   755  C CD1 . TYR A 1 106 ? 31.792  34.091 -2.831 1.00 18.73 ? 107  TYR A CD1 1 
ATOM   756  C CD2 . TYR A 1 106 ? 30.583  32.234 -1.930 1.00 17.57 ? 107  TYR A CD2 1 
ATOM   757  C CE1 . TYR A 1 106 ? 30.958  34.104 -3.944 1.00 19.78 ? 107  TYR A CE1 1 
ATOM   758  C CE2 . TYR A 1 106 ? 29.756  32.228 -3.053 1.00 19.60 ? 107  TYR A CE2 1 
ATOM   759  C CZ  . TYR A 1 106 ? 29.948  33.165 -4.053 1.00 24.85 ? 107  TYR A CZ  1 
ATOM   760  O OH  . TYR A 1 106 ? 29.126  33.176 -5.150 1.00 28.45 ? 107  TYR A OH  1 
ATOM   761  N N   . GLN A 1 107 ? 35.178  33.628 0.857  1.00 14.62 ? 108  GLN A N   1 
ATOM   762  C CA  . GLN A 1 107 ? 35.923  33.626 2.099  1.00 13.26 ? 108  GLN A CA  1 
ATOM   763  C C   . GLN A 1 107 ? 34.970  33.344 3.276  1.00 15.32 ? 108  GLN A C   1 
ATOM   764  O O   . GLN A 1 107 ? 34.046  34.122 3.499  1.00 14.07 ? 108  GLN A O   1 
ATOM   765  C CB  . GLN A 1 107 ? 36.621  34.976 2.303  1.00 14.42 ? 108  GLN A CB  1 
ATOM   766  C CG  . GLN A 1 107 ? 37.415  35.053 3.622  1.00 15.29 ? 108  GLN A CG  1 
ATOM   767  C CD  . GLN A 1 107 ? 38.166  36.352 3.738  1.00 29.65 ? 108  GLN A CD  1 
ATOM   768  O OE1 . GLN A 1 107 ? 38.973  36.721 2.881  1.00 27.85 ? 108  GLN A OE1 1 
ATOM   769  N NE2 . GLN A 1 107 ? 37.960  37.048 4.840  1.00 30.52 ? 108  GLN A NE2 1 
ATOM   770  N N   . PRO A 1 108 ? 35.139  32.257 4.036  1.00 12.44 ? 109  PRO A N   1 
ATOM   771  C CA  . PRO A 1 108 ? 34.236  32.044 5.199  1.00 11.45 ? 109  PRO A CA  1 
ATOM   772  C C   . PRO A 1 108 ? 34.349  33.208 6.213  1.00 15.63 ? 109  PRO A C   1 
ATOM   773  O O   . PRO A 1 108 ? 35.437  33.765 6.427  1.00 15.20 ? 109  PRO A O   1 
ATOM   774  C CB  . PRO A 1 108 ? 34.720  30.713 5.790  1.00 13.57 ? 109  PRO A CB  1 
ATOM   775  C CG  . PRO A 1 108 ? 35.461  30.043 4.663  1.00 18.34 ? 109  PRO A CG  1 
ATOM   776  C CD  . PRO A 1 108 ? 36.140  31.183 3.925  1.00 14.88 ? 109  PRO A CD  1 
ATOM   777  N N   . ALA A 1 109 ? 33.210  33.573 6.823  1.00 12.75 ? 110  ALA A N   1 
ATOM   778  C CA  . ALA A 1 109 ? 33.143  34.706 7.745  1.00 13.18 ? 110  ALA A CA  1 
ATOM   779  C C   . ALA A 1 109 ? 32.989  34.293 9.199  1.00 16.82 ? 110  ALA A C   1 
ATOM   780  O O   . ALA A 1 109 ? 33.181  35.125 10.087 1.00 16.81 ? 110  ALA A O   1 
ATOM   781  C CB  . ALA A 1 109 ? 31.995  35.614 7.360  1.00 14.40 ? 110  ALA A CB  1 
ATOM   782  N N   . ALA A 1 110 ? 32.589  33.047 9.445  1.00 12.20 ? 111  ALA A N   1 
ATOM   783  C CA  . ALA A 1 110 ? 32.356  32.589 10.813 1.00 13.07 ? 111  ALA A CA  1 
ATOM   784  C C   . ALA A 1 110 ? 32.621  31.112 10.889 1.00 14.64 ? 111  ALA A C   1 
ATOM   785  O O   . ALA A 1 110 ? 32.555  30.416 9.875  1.00 12.84 ? 111  ALA A O   1 
ATOM   786  C CB  . ALA A 1 110 ? 30.904  32.863 11.220 1.00 14.28 ? 111  ALA A CB  1 
ATOM   787  N N   . SER A 1 111 ? 32.816  30.592 12.107 1.00 13.04 ? 112  SER A N   1 
ATOM   788  C CA  . SER A 1 111 ? 32.989  29.158 12.306 1.00 12.61 ? 112  SER A CA  1 
ATOM   789  C C   . SER A 1 111 ? 32.487  28.807 13.679 1.00 14.14 ? 112  SER A C   1 
ATOM   790  O O   . SER A 1 111 ? 32.389  29.684 14.537 1.00 14.54 ? 112  SER A O   1 
ATOM   791  C CB  . SER A 1 111 ? 34.454  28.752 12.154 1.00 15.69 ? 112  SER A CB  1 
ATOM   792  O OG  . SER A 1 111 ? 35.262  29.520 13.030 1.00 21.25 ? 112  SER A OG  1 
ATOM   793  N N   . ILE A 1 112 ? 32.217  27.526 13.882 1.00 12.02 ? 113  ILE A N   1 
ATOM   794  C CA  . ILE A 1 112 ? 31.805  27.015 15.195 1.00 12.20 ? 113  ILE A CA  1 
ATOM   795  C C   . ILE A 1 112 ? 32.537  25.704 15.430 1.00 17.04 ? 113  ILE A C   1 
ATOM   796  O O   . ILE A 1 112 ? 32.997  25.060 14.476 1.00 17.85 ? 113  ILE A O   1 
ATOM   797  C CB  . ILE A 1 112 ? 30.273  26.829 15.288 1.00 12.74 ? 113  ILE A CB  1 
ATOM   798  C CG1 . ILE A 1 112 ? 29.770  25.873 14.163 1.00 13.55 ? 113  ILE A CG1 1 
ATOM   799  C CG2 . ILE A 1 112 ? 29.542  28.225 15.333 1.00 12.61 ? 113  ILE A CG2 1 
ATOM   800  C CD1 . ILE A 1 112 ? 28.272  25.398 14.355 1.00 14.05 ? 113  ILE A CD1 1 
ATOM   801  N N   . THR A 1 113 ? 32.697  25.328 16.695 1.00 17.20 ? 114  THR A N   1 
ATOM   802  C CA  . THR A 1 113 ? 33.436  24.094 17.018 1.00 19.02 ? 114  THR A CA  1 
ATOM   803  C C   . THR A 1 113 ? 32.517  22.933 17.421 1.00 18.00 ? 114  THR A C   1 
ATOM   804  O O   . THR A 1 113 ? 32.979  21.781 17.529 1.00 20.51 ? 114  THR A O   1 
ATOM   805  C CB  . THR A 1 113 ? 34.444  24.352 18.127 1.00 26.05 ? 114  THR A CB  1 
ATOM   806  O OG1 . THR A 1 113 ? 33.735  24.871 19.251 1.00 25.98 ? 114  THR A OG1 1 
ATOM   807  C CG2 . THR A 1 113 ? 35.541  25.314 17.702 1.00 24.39 ? 114  THR A CG2 1 
ATOM   808  N N   . GLY A 1 114 ? 31.240  23.227 17.645 1.00 13.56 ? 115  GLY A N   1 
ATOM   809  C CA  . GLY A 1 114 ? 30.307  22.194 18.027 1.00 13.41 ? 115  GLY A CA  1 
ATOM   810  C C   . GLY A 1 114 ? 28.959  22.807 18.337 1.00 12.93 ? 115  GLY A C   1 
ATOM   811  O O   . GLY A 1 114 ? 28.675  23.945 17.959 1.00 13.02 ? 115  GLY A O   1 
ATOM   812  N N   . TYR A 1 115 ? 28.136  22.033 19.017 1.00 11.70 ? 116  TYR A N   1 
ATOM   813  C CA  . TYR A 1 115 ? 26.828  22.502 19.425 1.00 10.74 ? 116  TYR A CA  1 
ATOM   814  C C   . TYR A 1 115 ? 26.372  21.740 20.659 1.00 11.97 ? 116  TYR A C   1 
ATOM   815  O O   . TYR A 1 115 ? 26.913  20.682 20.978 1.00 13.29 ? 116  TYR A O   1 
ATOM   816  C CB  . TYR A 1 115 ? 25.797  22.394 18.292 1.00 12.69 ? 116  TYR A CB  1 
ATOM   817  C CG  . TYR A 1 115 ? 25.499  20.974 17.875 1.00 15.65 ? 116  TYR A CG  1 
ATOM   818  C CD1 . TYR A 1 115 ? 24.489  20.241 18.496 1.00 17.93 ? 116  TYR A CD1 1 
ATOM   819  C CD2 . TYR A 1 115 ? 26.235  20.353 16.876 1.00 17.89 ? 116  TYR A CD2 1 
ATOM   820  C CE1 . TYR A 1 115 ? 24.249  18.914 18.156 1.00 21.04 ? 116  TYR A CE1 1 
ATOM   821  C CE2 . TYR A 1 115 ? 25.987  19.028 16.513 1.00 20.07 ? 116  TYR A CE2 1 
ATOM   822  C CZ  . TYR A 1 115 ? 24.972  18.325 17.139 1.00 28.25 ? 116  TYR A CZ  1 
ATOM   823  O OH  . TYR A 1 115 ? 24.706  17.019 16.797 1.00 34.77 ? 116  TYR A OH  1 
ATOM   824  N N   . GLN A 1 116 ? 25.386  22.293 21.335 1.00 10.29 ? 117  GLN A N   1 
ATOM   825  C CA  . GLN A 1 116 ? 24.820  21.670 22.528 1.00 10.99 ? 117  GLN A CA  1 
ATOM   826  C C   . GLN A 1 116 ? 23.315  21.547 22.397 1.00 11.30 ? 117  GLN A C   1 
ATOM   827  O O   . GLN A 1 116 ? 22.646  22.457 21.874 1.00 10.22 ? 117  GLN A O   1 
ATOM   828  C CB  . GLN A 1 116 ? 25.123  22.558 23.741 1.00 13.00 ? 117  GLN A CB  1 
ATOM   829  C CG  . GLN A 1 116 ? 26.626  22.780 24.020 1.00 22.09 ? 117  GLN A CG  1 
ATOM   830  C CD  . GLN A 1 116 ? 26.903  23.431 25.360 1.00 41.68 ? 117  GLN A CD  1 
ATOM   831  O OE1 . GLN A 1 116 ? 26.750  22.818 26.425 1.00 34.36 ? 117  GLN A OE1 1 
ATOM   832  N NE2 . GLN A 1 116 ? 27.402  24.657 25.338 1.00 32.02 ? 117  GLN A NE2 1 
ATOM   833  N N   . ASP A 1 117 ? 22.783  20.412 22.850 1.00 10.87 ? 118  ASP A N   1 
ATOM   834  C CA  . ASP A 1 117 ? 21.344  20.189 22.923 1.00 10.53 ? 118  ASP A CA  1 
ATOM   835  C C   . ASP A 1 117 ? 20.858  20.570 24.293 1.00 11.86 ? 118  ASP A C   1 
ATOM   836  O O   . ASP A 1 117 ? 21.461  20.179 25.302 1.00 12.40 ? 118  ASP A O   1 
ATOM   837  C CB  . ASP A 1 117 ? 21.020  18.715 22.647 1.00 11.96 ? 118  ASP A CB  1 
ATOM   838  C CG  . ASP A 1 117 ? 21.254  18.406 21.178 1.00 16.19 ? 118  ASP A CG  1 
ATOM   839  O OD1 . ASP A 1 117 ? 20.458  18.897 20.344 1.00 15.00 ? 118  ASP A OD1 1 
ATOM   840  O OD2 . ASP A 1 117 ? 22.207  17.641 20.875 1.00 21.23 ? 118  ASP A OD2 1 
ATOM   841  N N   . VAL A 1 118 ? 19.782  21.358 24.331 1.00 8.84  ? 119  VAL A N   1 
ATOM   842  C CA  . VAL A 1 118 ? 19.177  21.745 25.599 1.00 8.84  ? 119  VAL A CA  1 
ATOM   843  C C   . VAL A 1 118 ? 18.436  20.540 26.148 1.00 9.72  ? 119  VAL A C   1 
ATOM   844  O O   . VAL A 1 118 ? 17.765  19.844 25.372 1.00 10.08 ? 119  VAL A O   1 
ATOM   845  C CB  . VAL A 1 118 ? 18.184  22.932 25.403 1.00 10.05 ? 119  VAL A CB  1 
ATOM   846  C CG1 . VAL A 1 118 ? 17.468  23.300 26.706 1.00 9.55  ? 119  VAL A CG1 1 
ATOM   847  C CG2 . VAL A 1 118 ? 18.894  24.164 24.810 1.00 10.34 ? 119  VAL A CG2 1 
ATOM   848  N N   . PRO A 1 119 ? 18.476  20.281 27.492 1.00 8.14  ? 120  PRO A N   1 
ATOM   849  C CA  . PRO A 1 119 ? 17.604  19.246 28.081 1.00 7.39  ? 120  PRO A CA  1 
ATOM   850  C C   . PRO A 1 119 ? 16.184  19.344 27.534 1.00 9.53  ? 120  PRO A C   1 
ATOM   851  O O   . PRO A 1 119 ? 15.614  20.426 27.527 1.00 9.77  ? 120  PRO A O   1 
ATOM   852  C CB  . PRO A 1 119 ? 17.640  19.594 29.564 1.00 9.15  ? 120  PRO A CB  1 
ATOM   853  C CG  . PRO A 1 119 ? 19.077  20.086 29.740 1.00 9.94  ? 120  PRO A CG  1 
ATOM   854  C CD  . PRO A 1 119 ? 19.296  20.944 28.543 1.00 8.90  ? 120  PRO A CD  1 
ATOM   855  N N   . ALA A 1 120 ? 15.637  18.204 27.052 1.00 9.21  ? 121  ALA A N   1 
ATOM   856  C CA  . ALA A 1 120 ? 14.326  18.176 26.400 1.00 8.92  ? 121  ALA A CA  1 
ATOM   857  C C   . ALA A 1 120 ? 13.205  18.445 27.350 1.00 9.21  ? 121  ALA A C   1 
ATOM   858  O O   . ALA A 1 120 ? 13.242  18.025 28.516 1.00 9.79  ? 121  ALA A O   1 
ATOM   859  C CB  . ALA A 1 120 ? 14.129  16.798 25.794 1.00 11.22 ? 121  ALA A CB  1 
ATOM   860  N N   . ASN A 1 121 ? 12.104  19.034 26.805 1.00 9.89  ? 122  ASN A N   1 
ATOM   861  C CA  . ASN A 1 121 ? 10.859  19.234 27.553 1.00 9.23  ? 122  ASN A CA  1 
ATOM   862  C C   . ASN A 1 121 ? 11.147  19.930 28.874 1.00 9.38  ? 122  ASN A C   1 
ATOM   863  O O   . ASN A 1 121 ? 10.716  19.472 29.950 1.00 10.62 ? 122  ASN A O   1 
ATOM   864  C CB  . ASN A 1 121 ? 10.176  17.896 27.778 1.00 9.89  ? 122  ASN A CB  1 
ATOM   865  C CG  . ASN A 1 121 ? 9.696   17.225 26.516 1.00 11.61 ? 122  ASN A CG  1 
ATOM   866  O OD1 . ASN A 1 121 ? 9.721   17.805 25.410 1.00 12.49 ? 122  ASN A OD1 1 
ATOM   867  N ND2 . ASN A 1 121 ? 9.297   15.979 26.634 1.00 13.06 ? 122  ASN A ND2 1 
ATOM   868  N N   . ASN A 1 122 ? 11.877  21.048 28.802 1.00 7.84  ? 123  ASN A N   1 
ATOM   869  C CA  . ASN A 1 122 ? 12.418  21.682 29.984 1.00 8.55  ? 123  ASN A CA  1 
ATOM   870  C C   . ASN A 1 122 ? 12.568  23.159 29.776 1.00 9.90  ? 123  ASN A C   1 
ATOM   871  O O   . ASN A 1 122 ? 13.630  23.630 29.332 1.00 11.17 ? 123  ASN A O   1 
ATOM   872  C CB  . ASN A 1 122 ? 13.782  21.013 30.305 1.00 10.17 ? 123  ASN A CB  1 
ATOM   873  C CG  . ASN A 1 122 ? 14.321  21.282 31.662 1.00 9.52  ? 123  ASN A CG  1 
ATOM   874  O OD1 . ASN A 1 122 ? 14.120  22.364 32.243 1.00 10.18 ? 123  ASN A OD1 1 
ATOM   875  N ND2 . ASN A 1 122 ? 15.094  20.315 32.180 1.00 8.92  ? 123  ASN A ND2 1 
ATOM   876  N N   . GLU A 1 123 ? 11.505  23.928 30.113 1.00 8.41  ? 124  GLU A N   1 
ATOM   877  C CA  . GLU A 1 123 ? 11.576  25.386 29.881 1.00 7.83  ? 124  GLU A CA  1 
ATOM   878  C C   . GLU A 1 123 ? 12.560  26.073 30.794 1.00 10.75 ? 124  GLU A C   1 
ATOM   879  O O   . GLU A 1 123 ? 13.125  27.105 30.407 1.00 11.29 ? 124  GLU A O   1 
ATOM   880  C CB  . GLU A 1 123 ? 10.193  26.036 30.054 1.00 10.46 ? 124  GLU A CB  1 
ATOM   881  C CG  . GLU A 1 123 ? 9.419   26.097 28.759 1.00 17.19 ? 124  GLU A CG  1 
ATOM   882  C CD  . GLU A 1 123 ? 8.231   27.034 28.779 1.00 21.03 ? 124  GLU A CD  1 
ATOM   883  O OE1 . GLU A 1 123 ? 7.564   27.097 29.831 1.00 17.60 ? 124  GLU A OE1 1 
ATOM   884  O OE2 . GLU A 1 123 ? 7.909   27.611 27.718 1.00 14.01 ? 124  GLU A OE2 1 
ATOM   885  N N   . GLN A 1 124 ? 12.830  25.522 31.991 1.00 8.78  ? 125  GLN A N   1 
ATOM   886  C CA  . GLN A 1 124 ? 13.833  26.124 32.869 1.00 9.21  ? 125  GLN A CA  1 
ATOM   887  C C   . GLN A 1 124 ? 15.193  26.024 32.201 1.00 10.13 ? 125  GLN A C   1 
ATOM   888  O O   . GLN A 1 124 ? 15.926  27.001 32.151 1.00 9.83  ? 125  GLN A O   1 
ATOM   889  C CB  . GLN A 1 124 ? 13.836  25.438 34.242 1.00 10.65 ? 125  GLN A CB  1 
ATOM   890  C CG  . GLN A 1 124 ? 14.844  26.085 35.153 1.00 15.71 ? 125  GLN A CG  1 
ATOM   891  C CD  . GLN A 1 124 ? 14.739  25.718 36.615 1.00 33.23 ? 125  GLN A CD  1 
ATOM   892  O OE1 . GLN A 1 124 ? 15.367  26.364 37.450 1.00 29.38 ? 125  GLN A OE1 1 
ATOM   893  N NE2 . GLN A 1 124 ? 13.967  24.686 36.970 1.00 24.32 ? 125  GLN A NE2 1 
ATOM   894  N N   . ALA A 1 125 ? 15.538  24.837 31.683 1.00 8.26  ? 126  ALA A N   1 
ATOM   895  C CA  . ALA A 1 125 ? 16.820  24.658 30.992 1.00 8.66  ? 126  ALA A CA  1 
ATOM   896  C C   . ALA A 1 125 ? 16.867  25.540 29.721 1.00 7.53  ? 126  ALA A C   1 
ATOM   897  O O   . ALA A 1 125 ? 17.924  26.097 29.411 1.00 8.65  ? 126  ALA A O   1 
ATOM   898  C CB  . ALA A 1 125 ? 17.032  23.191 30.626 1.00 10.17 ? 126  ALA A CB  1 
ATOM   899  N N   . LEU A 1 126 ? 15.734  25.687 28.996 1.00 7.18  ? 127  LEU A N   1 
ATOM   900  C CA  . LEU A 1 126 ? 15.705  26.529 27.813 1.00 8.14  ? 127  LEU A CA  1 
ATOM   901  C C   . LEU A 1 126 ? 15.966  27.980 28.219 1.00 8.32  ? 127  LEU A C   1 
ATOM   902  O O   . LEU A 1 126 ? 16.716  28.670 27.520 1.00 9.01  ? 127  LEU A O   1 
ATOM   903  C CB  . LEU A 1 126 ? 14.352  26.399 27.083 1.00 8.04  ? 127  LEU A CB  1 
ATOM   904  C CG  . LEU A 1 126 ? 14.182  27.268 25.802 1.00 9.97  ? 127  LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 126 ? 15.302  27.066 24.775 1.00 10.27 ? 127  LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 126 ? 12.804  27.082 25.160 1.00 11.04 ? 127  LEU A CD2 1 
ATOM   907  N N   . GLN A 1 127 ? 15.367  28.440 29.329 1.00 7.49  ? 128  GLN A N   1 
ATOM   908  C CA  . GLN A 1 127 ? 15.611  29.817 29.791 1.00 8.17  ? 128  GLN A CA  1 
ATOM   909  C C   . GLN A 1 127 ? 17.080  30.038 30.165 1.00 10.01 ? 128  GLN A C   1 
ATOM   910  O O   . GLN A 1 127 ? 17.659  31.065 29.816 1.00 9.20  ? 128  GLN A O   1 
ATOM   911  C CB  . GLN A 1 127 ? 14.701  30.140 30.978 1.00 10.12 ? 128  GLN A CB  1 
ATOM   912  C CG  . GLN A 1 127 ? 14.761  31.623 31.386 1.00 10.53 ? 128  GLN A CG  1 
ATOM   913  C CD  . GLN A 1 127 ? 13.847  31.911 32.549 1.00 21.98 ? 128  GLN A CD  1 
ATOM   914  O OE1 . GLN A 1 127 ? 13.275  31.016 33.198 1.00 24.53 ? 128  GLN A OE1 1 
ATOM   915  N NE2 . GLN A 1 127 ? 13.592  33.170 32.789 1.00 21.80 ? 128  GLN A NE2 1 
ATOM   916  N N   . GLN A 1 128 ? 17.694  29.072 30.841 1.00 8.02  ? 129  GLN A N   1 
ATOM   917  C CA  . GLN A 1 128 ? 19.114  29.175 31.203 1.00 8.69  ? 129  GLN A CA  1 
ATOM   918  C C   . GLN A 1 128 ? 19.990  29.294 29.936 1.00 9.86  ? 129  GLN A C   1 
ATOM   919  O O   . GLN A 1 128 ? 20.902  30.129 29.875 1.00 12.11 ? 129  GLN A O   1 
ATOM   920  C CB  . GLN A 1 128 ? 19.509  27.924 32.017 1.00 10.08 ? 129  GLN A CB  1 
ATOM   921  C CG  . GLN A 1 128 ? 18.854  27.849 33.398 1.00 15.49 ? 129  GLN A CG  1 
ATOM   922  C CD  . GLN A 1 128 ? 19.283  26.660 34.236 1.00 21.92 ? 129  GLN A CD  1 
ATOM   923  O OE1 . GLN A 1 128 ? 20.120  25.846 33.829 1.00 27.41 ? 129  GLN A OE1 1 
ATOM   924  N NE2 . GLN A 1 128 ? 18.714  26.555 35.422 1.00 22.98 ? 129  GLN A NE2 1 
ATOM   925  N N   . ALA A 1 129 ? 19.680  28.516 28.898 1.00 9.62  ? 130  ALA A N   1 
ATOM   926  C CA  . ALA A 1 129 ? 20.437  28.578 27.663 1.00 9.49  ? 130  ALA A CA  1 
ATOM   927  C C   . ALA A 1 129 ? 20.184  29.917 26.944 1.00 8.40  ? 130  ALA A C   1 
ATOM   928  O O   . ALA A 1 129 ? 21.138  30.565 26.459 1.00 8.30  ? 130  ALA A O   1 
ATOM   929  C CB  . ALA A 1 129 ? 20.067  27.394 26.772 1.00 10.34 ? 130  ALA A CB  1 
ATOM   930  N N   . ALA A 1 130 ? 18.913  30.360 26.871 1.00 7.36  ? 131  ALA A N   1 
ATOM   931  C CA  . ALA A 1 130 ? 18.562  31.599 26.152 1.00 6.89  ? 131  ALA A CA  1 
ATOM   932  C C   . ALA A 1 130 ? 19.174  32.822 26.762 1.00 7.39  ? 131  ALA A C   1 
ATOM   933  O O   . ALA A 1 130 ? 19.450  33.784 26.043 1.00 8.56  ? 131  ALA A O   1 
ATOM   934  C CB  . ALA A 1 130 ? 17.051  31.756 26.117 1.00 8.01  ? 131  ALA A CB  1 
ATOM   935  N N   . ALA A 1 131 ? 19.451  32.775 28.080 1.00 7.31  ? 132  ALA A N   1 
ATOM   936  C CA  . ALA A 1 131 ? 20.127  33.911 28.735 1.00 8.39  ? 132  ALA A CA  1 
ATOM   937  C C   . ALA A 1 131 ? 21.552  34.036 28.260 1.00 9.74  ? 132  ALA A C   1 
ATOM   938  O O   . ALA A 1 131 ? 22.155  35.101 28.430 1.00 12.17 ? 132  ALA A O   1 
ATOM   939  C CB  . ALA A 1 131 ? 20.127  33.725 30.249 1.00 10.08 ? 132  ALA A CB  1 
ATOM   940  N N   . THR A 1 132 ? 22.150  32.964 27.706 1.00 7.16  ? 133  THR A N   1 
ATOM   941  C CA  . THR A 1 132 ? 23.549  33.026 27.274 1.00 7.82  ? 133  THR A CA  1 
ATOM   942  C C   . THR A 1 132 ? 23.719  33.289 25.776 1.00 9.10  ? 133  THR A C   1 
ATOM   943  O O   . THR A 1 132 ? 24.752  33.818 25.381 1.00 9.99  ? 133  THR A O   1 
ATOM   944  C CB  . THR A 1 132 ? 24.268  31.728 27.663 1.00 13.51 ? 133  THR A CB  1 
ATOM   945  O OG1 . THR A 1 132 ? 23.784  30.657 26.874 1.00 16.72 ? 133  THR A OG1 1 
ATOM   946  C CG2 . THR A 1 132 ? 24.120  31.394 29.127 1.00 13.67 ? 133  THR A CG2 1 
ATOM   947  N N   . GLN A 1 133 ? 22.713  32.978 24.945 1.00 7.68  ? 134  GLN A N   1 
ATOM   948  C CA  . GLN A 1 133 ? 22.809  33.199 23.502 1.00 7.13  ? 134  GLN A CA  1 
ATOM   949  C C   . GLN A 1 133 ? 21.491  32.832 22.808 1.00 6.81  ? 134  GLN A C   1 
ATOM   950  O O   . GLN A 1 133 ? 20.670  32.117 23.412 1.00 7.57  ? 134  GLN A O   1 
ATOM   951  C CB  . GLN A 1 133 ? 23.963  32.363 22.872 1.00 8.35  ? 134  GLN A CB  1 
ATOM   952  C CG  . GLN A 1 133 ? 23.754  30.867 23.083 1.00 8.14  ? 134  GLN A CG  1 
ATOM   953  C CD  . GLN A 1 133 ? 24.998  30.110 22.691 1.00 11.91 ? 134  GLN A CD  1 
ATOM   954  O OE1 . GLN A 1 133 ? 25.776  29.699 23.566 1.00 16.78 ? 134  GLN A OE1 1 
ATOM   955  N NE2 . GLN A 1 133 ? 25.231  29.966 21.392 1.00 11.30 ? 134  GLN A NE2 1 
ATOM   956  N N   . PRO A 1 134 ? 21.266  33.287 21.563 1.00 6.66  ? 135  PRO A N   1 
ATOM   957  C CA  . PRO A 1 134 ? 20.076  32.833 20.819 1.00 6.99  ? 135  PRO A CA  1 
ATOM   958  C C   . PRO A 1 134 ? 20.051  31.308 20.641 1.00 7.15  ? 135  PRO A C   1 
ATOM   959  O O   . PRO A 1 134 ? 21.095  30.641 20.484 1.00 8.60  ? 135  PRO A O   1 
ATOM   960  C CB  . PRO A 1 134 ? 20.209  33.540 19.472 1.00 8.25  ? 135  PRO A CB  1 
ATOM   961  C CG  . PRO A 1 134 ? 20.950  34.833 19.837 1.00 8.67  ? 135  PRO A CG  1 
ATOM   962  C CD  . PRO A 1 134 ? 22.013  34.319 20.796 1.00 7.56  ? 135  PRO A CD  1 
ATOM   963  N N   . ILE A 1 135 ? 18.845  30.749 20.700 1.00 6.55  ? 136  ILE A N   1 
ATOM   964  C CA  . ILE A 1 135 ? 18.659  29.294 20.665 1.00 6.50  ? 136  ILE A CA  1 
ATOM   965  C C   . ILE A 1 135 ? 17.764  28.841 19.524 1.00 8.73  ? 136  ILE A C   1 
ATOM   966  O O   . ILE A 1 135 ? 16.674  29.408 19.330 1.00 8.82  ? 136  ILE A O   1 
ATOM   967  C CB  . ILE A 1 135 ? 17.978  28.871 22.024 1.00 8.64  ? 136  ILE A CB  1 
ATOM   968  C CG1 . ILE A 1 135 ? 18.694  29.450 23.253 1.00 8.04  ? 136  ILE A CG1 1 
ATOM   969  C CG2 . ILE A 1 135 ? 17.922  27.329 22.143 1.00 10.25 ? 136  ILE A CG2 1 
ATOM   970  C CD1 . ILE A 1 135 ? 20.115  28.963 23.431 1.00 9.64  ? 136  ILE A CD1 1 
ATOM   971  N N   . SER A 1 136 ? 18.205  27.807 18.783 1.00 7.12  ? 137  SER A N   1 
ATOM   972  C CA  . SER A 1 136 ? 17.317  27.205 17.770 1.00 7.66  ? 137  SER A CA  1 
ATOM   973  C C   . SER A 1 136 ? 16.306  26.316 18.464 1.00 8.85  ? 137  SER A C   1 
ATOM   974  O O   . SER A 1 136 ? 16.674  25.496 19.320 1.00 8.85  ? 137  SER A O   1 
ATOM   975  C CB  . SER A 1 136 ? 18.135  26.343 16.818 1.00 8.34  ? 137  SER A CB  1 
ATOM   976  O OG  . SER A 1 136 ? 19.024  27.189 16.096 1.00 9.67  ? 137  SER A OG  1 
ATOM   977  N N   . VAL A 1 137 ? 15.025  26.476 18.113 1.00 9.28  ? 138  VAL A N   1 
ATOM   978  C CA  . VAL A 1 137 ? 13.940  25.682 18.705 1.00 8.01  ? 138  VAL A CA  1 
ATOM   979  C C   . VAL A 1 137 ? 12.999  25.200 17.635 1.00 9.41  ? 138  VAL A C   1 
ATOM   980  O O   . VAL A 1 137 ? 12.864  25.838 16.578 1.00 9.64  ? 138  VAL A O   1 
ATOM   981  C CB  . VAL A 1 137 ? 13.153  26.477 19.780 1.00 8.91  ? 138  VAL A CB  1 
ATOM   982  C CG1 . VAL A 1 137 ? 14.067  26.993 20.892 1.00 9.33  ? 138  VAL A CG1 1 
ATOM   983  C CG2 . VAL A 1 137 ? 12.386  27.632 19.166 1.00 10.00 ? 138  VAL A CG2 1 
ATOM   984  N N   . ALA A 1 138 ? 12.283  24.111 17.956 1.00 9.09  ? 139  ALA A N   1 
ATOM   985  C CA  . ALA A 1 138 ? 11.245  23.557 17.083 1.00 9.51  ? 139  ALA A CA  1 
ATOM   986  C C   . ALA A 1 138 ? 9.857   23.817 17.662 1.00 12.32 ? 139  ALA A C   1 
ATOM   987  O O   . ALA A 1 138 ? 9.650   23.737 18.870 1.00 12.79 ? 139  ALA A O   1 
ATOM   988  C CB  . ALA A 1 138 ? 11.449  22.034 16.927 1.00 12.10 ? 139  ALA A CB  1 
ATOM   989  N N   . ILE A 1 139 ? 8.900   24.161 16.805 1.00 12.08 ? 140  ILE A N   1 
ATOM   990  C CA  . ILE A 1 139 ? 7.526   24.383 17.224 1.00 11.13 ? 140  ILE A CA  1 
ATOM   991  C C   . ILE A 1 139 ? 6.563   23.776 16.224 1.00 13.24 ? 140  ILE A C   1 
ATOM   992  O O   . ILE A 1 139 ? 6.917   23.498 15.070 1.00 13.92 ? 140  ILE A O   1 
ATOM   993  C CB  . ILE A 1 139 ? 7.196   25.917 17.357 1.00 12.31 ? 140  ILE A CB  1 
ATOM   994  C CG1 . ILE A 1 139 ? 7.471   26.673 16.039 1.00 14.13 ? 140  ILE A CG1 1 
ATOM   995  C CG2 . ILE A 1 139 ? 7.971   26.560 18.537 1.00 13.33 ? 140  ILE A CG2 1 
ATOM   996  C CD1 . ILE A 1 139 ? 6.789   28.016 15.960 1.00 16.18 ? 140  ILE A CD1 1 
ATOM   997  N N   . ASP A 1 140 ? 5.306   23.633 16.660 1.00 11.98 ? 141  ASP A N   1 
ATOM   998  C CA  . ASP A 1 140 ? 4.205   23.294 15.765 1.00 12.11 ? 141  ASP A CA  1 
ATOM   999  C C   . ASP A 1 140 ? 3.616   24.647 15.329 1.00 16.79 ? 141  ASP A C   1 
ATOM   1000 O O   . ASP A 1 140 ? 3.010   25.342 16.143 1.00 15.64 ? 141  ASP A O   1 
ATOM   1001 C CB  . ASP A 1 140 ? 3.158   22.455 16.526 1.00 12.06 ? 141  ASP A CB  1 
ATOM   1002 C CG  . ASP A 1 140 ? 1.939   22.038 15.709 1.00 17.15 ? 141  ASP A CG  1 
ATOM   1003 O OD1 . ASP A 1 140 ? 1.642   22.699 14.691 1.00 18.45 ? 141  ASP A OD1 1 
ATOM   1004 O OD2 . ASP A 1 140 ? 1.247   21.108 16.128 1.00 18.08 ? 141  ASP A OD2 1 
ATOM   1005 N N   . ALA A 1 141 ? 3.826   25.034 14.088 1.00 15.47 ? 142  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 141 ? 3.349   26.331 13.573 1.00 15.59 ? 142  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 141 ? 2.134   26.174 12.640 1.00 18.76 ? 142  ALA A C   1 
ATOM   1008 O O   . ALA A 1 141 ? 1.816   27.094 11.883 1.00 19.80 ? 142  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 141 ? 4.511   26.999 12.830 1.00 16.50 ? 142  ALA A CB  1 
ATOM   1010 N N   . SER A 1 142 ? 1.438   25.027 12.716 1.00 17.18 ? 143  SER A N   1 
ATOM   1011 C CA  . SER A 1 142 ? 0.362   24.697 11.777 1.00 17.96 ? 143  SER A CA  1 
ATOM   1012 C C   . SER A 1 142 ? -1.004  25.330 12.099 1.00 22.33 ? 143  SER A C   1 
ATOM   1013 O O   . SER A 1 142 ? -1.873  25.340 11.211 1.00 23.80 ? 143  SER A O   1 
ATOM   1014 C CB  . SER A 1 142 ? 0.202   23.179 11.671 1.00 19.36 ? 143  SER A CB  1 
ATOM   1015 O OG  . SER A 1 142 ? -0.333  22.613 12.856 1.00 24.39 ? 143  SER A OG  1 
ATOM   1016 N N   . ASP A 1 143 ? -1.211  25.891 13.304 1.00 18.98 ? 144  ASP A N   1 
ATOM   1017 C CA  . ASP A 1 143 ? -2.525  26.442 13.602 1.00 19.68 ? 144  ASP A CA  1 
ATOM   1018 C C   . ASP A 1 143 ? -2.790  27.754 12.845 1.00 23.25 ? 144  ASP A C   1 
ATOM   1019 O O   . ASP A 1 143 ? -1.882  28.591 12.754 1.00 20.31 ? 144  ASP A O   1 
ATOM   1020 C CB  . ASP A 1 143 ? -2.739  26.647 15.114 1.00 20.85 ? 144  ASP A CB  1 
ATOM   1021 C CG  . ASP A 1 143 ? -4.214  26.813 15.466 1.00 24.30 ? 144  ASP A CG  1 
ATOM   1022 O OD1 . ASP A 1 143 ? -4.910  25.780 15.644 1.00 26.09 ? 144  ASP A OD1 1 
ATOM   1023 O OD2 . ASP A 1 143 ? -4.713  27.956 15.418 1.00 24.81 ? 144  ASP A OD2 1 
ATOM   1024 N N   . PRO A 1 144 ? -4.034  27.995 12.356 1.00 21.82 ? 145  PRO A N   1 
ATOM   1025 C CA  . PRO A 1 144 ? -4.299  29.282 11.680 1.00 22.99 ? 145  PRO A CA  1 
ATOM   1026 C C   . PRO A 1 144 ? -3.978  30.480 12.560 1.00 25.22 ? 145  PRO A C   1 
ATOM   1027 O O   . PRO A 1 144 ? -3.595  31.511 12.016 1.00 23.59 ? 145  PRO A O   1 
ATOM   1028 C CB  . PRO A 1 144 ? -5.805  29.230 11.396 1.00 25.63 ? 145  PRO A CB  1 
ATOM   1029 C CG  . PRO A 1 144 ? -6.135  27.789 11.317 1.00 29.70 ? 145  PRO A CG  1 
ATOM   1030 C CD  . PRO A 1 144 ? -5.229  27.118 12.318 1.00 23.97 ? 145  PRO A CD  1 
ATOM   1031 N N   . SER A 1 145 ? -4.128  30.348 13.918 1.00 22.00 ? 146  SER A N   1 
ATOM   1032 C CA  . SER A 1 145 ? -3.809  31.428 14.870 1.00 20.47 ? 146  SER A CA  1 
ATOM   1033 C C   . SER A 1 145 ? -2.302  31.793 14.825 1.00 22.44 ? 146  SER A C   1 
ATOM   1034 O O   . SER A 1 145 ? -1.947  32.949 15.070 1.00 22.88 ? 146  SER A O   1 
ATOM   1035 C CB  . SER A 1 145 ? -4.205  31.041 16.292 1.00 22.41 ? 146  SER A CB  1 
ATOM   1036 O OG  . SER A 1 145 ? -3.487  29.898 16.738 1.00 23.48 ? 146  SER A OG  1 
ATOM   1037 N N   . PHE A 1 146 ? -1.431  30.830 14.466 1.00 19.04 ? 147  PHE A N   1 
ATOM   1038 C CA  . PHE A 1 146 ? 0.004   31.096 14.353 1.00 17.94 ? 147  PHE A CA  1 
ATOM   1039 C C   . PHE A 1 146 ? 0.309   31.695 12.978 1.00 22.70 ? 147  PHE A C   1 
ATOM   1040 O O   . PHE A 1 146 ? 1.057   32.685 12.868 1.00 21.66 ? 147  PHE A O   1 
ATOM   1041 C CB  . PHE A 1 146 ? 0.832   29.809 14.587 1.00 18.40 ? 147  PHE A CB  1 
ATOM   1042 C CG  . PHE A 1 146 ? 2.323   30.064 14.629 1.00 18.46 ? 147  PHE A CG  1 
ATOM   1043 C CD1 . PHE A 1 146 ? 3.052   30.226 13.456 1.00 19.73 ? 147  PHE A CD1 1 
ATOM   1044 C CD2 . PHE A 1 146 ? 2.982   30.213 15.838 1.00 19.02 ? 147  PHE A CD2 1 
ATOM   1045 C CE1 . PHE A 1 146 ? 4.416   30.522 13.499 1.00 19.44 ? 147  PHE A CE1 1 
ATOM   1046 C CE2 . PHE A 1 146 ? 4.341   30.510 15.875 1.00 19.69 ? 147  PHE A CE2 1 
ATOM   1047 C CZ  . PHE A 1 146 ? 5.048   30.669 14.708 1.00 17.33 ? 147  PHE A CZ  1 
ATOM   1048 N N   . GLN A 1 147 ? -0.289  31.103 11.919 1.00 21.84 ? 148  GLN A N   1 
ATOM   1049 C CA  . GLN A 1 147 ? -0.094  31.540 10.535 1.00 23.59 ? 148  GLN A CA  1 
ATOM   1050 C C   . GLN A 1 147 ? -0.499  33.003 10.373 1.00 26.93 ? 148  GLN A C   1 
ATOM   1051 O O   . GLN A 1 147 ? 0.196   33.754 9.682  1.00 26.49 ? 148  GLN A O   1 
ATOM   1052 C CB  . GLN A 1 147 ? -0.913  30.653 9.570  1.00 26.58 ? 148  GLN A CB  1 
ATOM   1053 C CG  . GLN A 1 147 ? -0.556  29.160 9.619  1.00 38.81 ? 148  GLN A CG  1 
ATOM   1054 C CD  . GLN A 1 147 ? 0.624   28.778 8.747  1.00 52.31 ? 148  GLN A CD  1 
ATOM   1055 O OE1 . GLN A 1 147 ? 0.767   29.219 7.594  1.00 43.27 ? 148  GLN A OE1 1 
ATOM   1056 N NE2 . GLN A 1 147 ? 1.477   27.904 9.263  1.00 37.27 ? 148  GLN A NE2 1 
ATOM   1057 N N   . SER A 1 148 ? -1.573  33.422 11.064 1.00 24.58 ? 149  SER A N   1 
ATOM   1058 C CA  . SER A 1 148 ? -2.100  34.780 10.970 1.00 25.57 ? 149  SER A CA  1 
ATOM   1059 C C   . SER A 1 148 ? -1.723  35.669 12.155 1.00 28.23 ? 149  SER A C   1 
ATOM   1060 O O   . SER A 1 148 ? -2.249  36.773 12.275 1.00 29.57 ? 149  SER A O   1 
ATOM   1061 C CB  . SER A 1 148 ? -3.618  34.742 10.813 1.00 30.03 ? 149  SER A CB  1 
ATOM   1062 O OG  . SER A 1 148 ? -4.202  34.174 11.971 1.00 34.48 ? 149  SER A OG  1 
ATOM   1063 N N   . TYR A 1 149 ? -0.762  35.230 13.008 1.00 21.91 ? 150  TYR A N   1 
ATOM   1064 C CA  . TYR A 1 149 ? -0.361  36.056 14.137 1.00 20.99 ? 150  TYR A CA  1 
ATOM   1065 C C   . TYR A 1 149 ? 0.082   37.436 13.690 1.00 24.77 ? 150  TYR A C   1 
ATOM   1066 O O   . TYR A 1 149 ? 0.895   37.541 12.766 1.00 25.41 ? 150  TYR A O   1 
ATOM   1067 C CB  . TYR A 1 149 ? 0.785   35.374 14.903 1.00 19.92 ? 150  TYR A CB  1 
ATOM   1068 C CG  . TYR A 1 149 ? 1.416   36.255 15.958 1.00 18.80 ? 150  TYR A CG  1 
ATOM   1069 C CD1 . TYR A 1 149 ? 0.851   36.375 17.228 1.00 18.55 ? 150  TYR A CD1 1 
ATOM   1070 C CD2 . TYR A 1 149 ? 2.602   36.940 15.703 1.00 17.74 ? 150  TYR A CD2 1 
ATOM   1071 C CE1 . TYR A 1 149 ? 1.444   37.160 18.211 1.00 15.05 ? 150  TYR A CE1 1 
ATOM   1072 C CE2 . TYR A 1 149 ? 3.156   37.794 16.648 1.00 17.89 ? 150  TYR A CE2 1 
ATOM   1073 C CZ  . TYR A 1 149 ? 2.600   37.872 17.916 1.00 18.15 ? 150  TYR A CZ  1 
ATOM   1074 O OH  . TYR A 1 149 ? 3.220   38.639 18.867 1.00 15.64 ? 150  TYR A OH  1 
ATOM   1075 N N   . SER A 1 150 ? -0.335  38.462 14.442 1.00 22.67 ? 151  SER A N   1 
ATOM   1076 C CA  . SER A 1 150 ? 0.008   39.858 14.192 1.00 24.57 ? 151  SER A CA  1 
ATOM   1077 C C   . SER A 1 150 ? 0.695   40.525 15.402 1.00 27.00 ? 151  SER A C   1 
ATOM   1078 O O   . SER A 1 150 ? 1.759   41.131 15.234 1.00 28.66 ? 151  SER A O   1 
ATOM   1079 C CB  . SER A 1 150 ? -1.257  40.626 13.803 1.00 30.32 ? 151  SER A CB  1 
ATOM   1080 O OG  . SER A 1 150 ? -0.942  41.606 12.828 1.00 47.45 ? 151  SER A OG  1 
ATOM   1081 N N   . SER A 1 151 ? 0.123   40.407 16.621 1.00 21.02 ? 152  SER A N   1 
ATOM   1082 C CA  . SER A 1 151 ? 0.725   41.016 17.821 1.00 19.90 ? 152  SER A CA  1 
ATOM   1083 C C   . SER A 1 151 ? 0.254   40.338 19.121 1.00 21.45 ? 152  SER A C   1 
ATOM   1084 O O   . SER A 1 151 ? -0.614  39.469 19.074 1.00 24.57 ? 152  SER A O   1 
ATOM   1085 C CB  . SER A 1 151 ? 0.409   42.507 17.888 1.00 25.88 ? 152  SER A CB  1 
ATOM   1086 O OG  . SER A 1 151 ? -0.984  42.675 18.116 1.00 32.87 ? 152  SER A OG  1 
ATOM   1087 N N   . GLY A 1 152 ? 0.768   40.812 20.252 1.00 18.48 ? 153  GLY A N   1 
ATOM   1088 C CA  . GLY A 1 152 ? 0.412   40.299 21.572 1.00 17.68 ? 153  GLY A CA  1 
ATOM   1089 C C   . GLY A 1 152 ? 1.195   39.055 21.949 1.00 17.62 ? 153  GLY A C   1 
ATOM   1090 O O   . GLY A 1 152 ? 2.142   38.654 21.255 1.00 16.71 ? 153  GLY A O   1 
ATOM   1091 N N   . ILE A 1 153 ? 0.795   38.446 23.062 1.00 14.28 ? 154  ILE A N   1 
ATOM   1092 C CA  . ILE A 1 153 ? 1.410   37.254 23.608 1.00 12.87 ? 154  ILE A CA  1 
ATOM   1093 C C   . ILE A 1 153 ? 0.652   36.069 23.050 1.00 17.41 ? 154  ILE A C   1 
ATOM   1094 O O   . ILE A 1 153 ? -0.523  35.876 23.396 1.00 21.81 ? 154  ILE A O   1 
ATOM   1095 C CB  . ILE A 1 153 ? 1.409   37.288 25.159 1.00 16.08 ? 154  ILE A CB  1 
ATOM   1096 C CG1 . ILE A 1 153 ? 2.317   38.445 25.676 1.00 16.58 ? 154  ILE A CG1 1 
ATOM   1097 C CG2 . ILE A 1 153 ? 1.912   35.928 25.706 1.00 17.80 ? 154  ILE A CG2 1 
ATOM   1098 C CD1 . ILE A 1 153 ? 2.341   38.578 27.157 1.00 24.46 ? 154  ILE A CD1 1 
ATOM   1099 N N   . TYR A 1 154 ? 1.298   35.291 22.182 1.00 12.76 ? 155  TYR A N   1 
ATOM   1100 C CA  . TYR A 1 154 ? 0.658   34.128 21.561 1.00 11.36 ? 155  TYR A CA  1 
ATOM   1101 C C   . TYR A 1 154 ? 0.602   32.979 22.555 1.00 13.07 ? 155  TYR A C   1 
ATOM   1102 O O   . TYR A 1 154 ? 1.650   32.556 23.084 1.00 11.58 ? 155  TYR A O   1 
ATOM   1103 C CB  . TYR A 1 154 ? 1.466   33.718 20.310 1.00 12.23 ? 155  TYR A CB  1 
ATOM   1104 C CG  . TYR A 1 154 ? 0.853   32.563 19.552 1.00 14.53 ? 155  TYR A CG  1 
ATOM   1105 C CD1 . TYR A 1 154 ? -0.279  32.746 18.764 1.00 16.07 ? 155  TYR A CD1 1 
ATOM   1106 C CD2 . TYR A 1 154 ? 1.314   31.266 19.732 1.00 15.34 ? 155  TYR A CD2 1 
ATOM   1107 C CE1 . TYR A 1 154 ? -0.903  31.674 18.135 1.00 19.47 ? 155  TYR A CE1 1 
ATOM   1108 C CE2 . TYR A 1 154 ? 0.713   30.191 19.090 1.00 17.09 ? 155  TYR A CE2 1 
ATOM   1109 C CZ  . TYR A 1 154 ? -0.382  30.403 18.273 1.00 21.99 ? 155  TYR A CZ  1 
ATOM   1110 O OH  . TYR A 1 154 ? -0.977  29.341 17.640 1.00 22.25 ? 155  TYR A OH  1 
ATOM   1111 N N   . SER A 1 155 ? -0.613  32.451 22.796 1.00 12.72 ? 156  SER A N   1 
ATOM   1112 C CA  . SER A 1 155 ? -0.810  31.350 23.717 1.00 12.92 ? 156  SER A CA  1 
ATOM   1113 C C   . SER A 1 155 ? -1.465  30.145 23.037 1.00 17.65 ? 156  SER A C   1 
ATOM   1114 O O   . SER A 1 155 ? -1.847  29.213 23.719 1.00 20.47 ? 156  SER A O   1 
ATOM   1115 C CB  . SER A 1 155 ? -1.652  31.798 24.906 1.00 14.47 ? 156  SER A CB  1 
ATOM   1116 O OG  . SER A 1 155 ? -2.905  32.318 24.479 1.00 18.46 ? 156  SER A OG  1 
ATOM   1117 N N   . GLY A 1 156 ? -1.603  30.202 21.723 1.00 16.21 ? 157  GLY A N   1 
ATOM   1118 C CA  . GLY A 1 156 ? -2.285  29.149 20.982 1.00 16.67 ? 157  GLY A CA  1 
ATOM   1119 C C   . GLY A 1 156 ? -3.608  29.621 20.411 1.00 19.11 ? 157  GLY A C   1 
ATOM   1120 O O   . GLY A 1 156 ? -3.823  30.827 20.220 1.00 19.20 ? 157  GLY A O   1 
ATOM   1121 N N   . PRO A 1 157 ? -4.482  28.681 20.025 1.00 17.55 ? 158  PRO A N   1 
ATOM   1122 C CA  . PRO A 1 157 ? -4.358  27.223 20.212 1.00 18.22 ? 158  PRO A CA  1 
ATOM   1123 C C   . PRO A 1 157 ? -3.305  26.597 19.305 1.00 20.18 ? 158  PRO A C   1 
ATOM   1124 O O   . PRO A 1 157 ? -3.154  27.022 18.166 1.00 22.35 ? 158  PRO A O   1 
ATOM   1125 C CB  . PRO A 1 157 ? -5.766  26.703 19.901 1.00 20.83 ? 158  PRO A CB  1 
ATOM   1126 C CG  . PRO A 1 157 ? -6.390  27.741 18.995 1.00 24.31 ? 158  PRO A CG  1 
ATOM   1127 C CD  . PRO A 1 157 ? -5.786  29.060 19.435 1.00 20.51 ? 158  PRO A CD  1 
ATOM   1128 N N   . CYS A 1 158 ? -2.525  25.652 19.819 1.00 17.50 ? 159  CYS A N   1 
ATOM   1129 C CA  . CYS A 1 158 ? -1.531  24.947 18.995 1.00 17.53 ? 159  CYS A CA  1 
ATOM   1130 C C   . CYS A 1 158 ? -1.189  23.633 19.648 1.00 22.71 ? 159  CYS A C   1 
ATOM   1131 O O   . CYS A 1 158 ? -1.261  23.497 20.872 1.00 23.49 ? 159  CYS A O   1 
ATOM   1132 C CB  . CYS A 1 158 ? -0.285  25.781 18.716 1.00 18.39 ? 159  CYS A CB  1 
ATOM   1133 S SG  . CYS A 1 158 ? 0.535   26.347 20.210 1.00 20.31 ? 159  CYS A SG  1 
ATOM   1134 N N   . ASN A 1 159 ? -0.881  22.645 18.826 1.00 17.82 ? 160  ASN A N   1 
ATOM   1135 C CA  . ASN A 1 159 ? -0.512  21.308 19.285 1.00 15.31 ? 160  ASN A CA  1 
ATOM   1136 C C   . ASN A 1 159 ? 0.995   21.185 19.401 1.00 16.41 ? 160  ASN A C   1 
ATOM   1137 O O   . ASN A 1 159 ? 1.699   22.206 19.440 1.00 14.91 ? 160  ASN A O   1 
ATOM   1138 C CB  . ASN A 1 159 ? -1.047  20.258 18.312 1.00 16.03 ? 160  ASN A CB  1 
ATOM   1139 C CG  . ASN A 1 159 ? -2.524  20.352 18.084 1.00 22.60 ? 160  ASN A CG  1 
ATOM   1140 O OD1 . ASN A 1 159 ? -3.012  20.265 16.938 1.00 24.78 ? 160  ASN A OD1 1 
ATOM   1141 N ND2 . ASN A 1 159 ? -3.275  20.486 19.153 1.00 17.78 ? 160  ASN A ND2 1 
ATOM   1142 N N   . THR A 1 160 ? 1.508   19.937 19.496 1.00 14.83 ? 161  THR A N   1 
ATOM   1143 C CA  . THR A 1 160 ? 2.952   19.689 19.603 1.00 13.99 ? 161  THR A CA  1 
ATOM   1144 C C   . THR A 1 160 ? 3.455   18.786 18.462 1.00 18.64 ? 161  THR A C   1 
ATOM   1145 O O   . THR A 1 160 ? 4.432   18.039 18.628 1.00 19.04 ? 161  THR A O   1 
ATOM   1146 C CB  . THR A 1 160 ? 3.361   19.135 20.970 1.00 20.52 ? 161  THR A CB  1 
ATOM   1147 O OG1 . THR A 1 160 ? 2.640   17.925 21.192 1.00 19.72 ? 161  THR A OG1 1 
ATOM   1148 C CG2 . THR A 1 160 ? 3.150   20.119 22.083 1.00 18.97 ? 161  THR A CG2 1 
ATOM   1149 N N   . ASN A 1 161 ? 2.837   18.928 17.282 1.00 16.97 ? 162  ASN A N   1 
ATOM   1150 C CA  . ASN A 1 161 ? 3.223   18.199 16.077 1.00 16.91 ? 162  ASN A CA  1 
ATOM   1151 C C   . ASN A 1 161 ? 4.265   19.100 15.396 1.00 19.23 ? 162  ASN A C   1 
ATOM   1152 O O   . ASN A 1 161 ? 3.933   19.944 14.559 1.00 18.65 ? 162  ASN A O   1 
ATOM   1153 C CB  . ASN A 1 161 ? 1.990   17.908 15.221 1.00 18.14 ? 162  ASN A CB  1 
ATOM   1154 C CG  . ASN A 1 161 ? 0.960   17.119 15.993 1.00 23.76 ? 162  ASN A CG  1 
ATOM   1155 O OD1 . ASN A 1 161 ? 1.294   16.126 16.646 1.00 27.18 ? 162  ASN A OD1 1 
ATOM   1156 N ND2 . ASN A 1 161 ? -0.291  17.585 16.024 1.00 21.61 ? 162  ASN A ND2 1 
ATOM   1157 N N   . LEU A 1 162 ? 5.516   18.979 15.851 1.00 15.23 ? 163  LEU A N   1 
ATOM   1158 C CA  . LEU A 1 162 ? 6.613   19.875 15.453 1.00 14.75 ? 163  LEU A CA  1 
ATOM   1159 C C   . LEU A 1 162 ? 6.815   19.881 13.962 1.00 18.13 ? 163  LEU A C   1 
ATOM   1160 O O   . LEU A 1 162 ? 6.874   18.811 13.349 1.00 19.28 ? 163  LEU A O   1 
ATOM   1161 C CB  . LEU A 1 162 ? 7.917   19.539 16.142 1.00 14.07 ? 163  LEU A CB  1 
ATOM   1162 C CG  . LEU A 1 162 ? 7.857   19.520 17.678 1.00 15.97 ? 163  LEU A CG  1 
ATOM   1163 C CD1 . LEU A 1 162 ? 9.159   18.993 18.247 1.00 15.82 ? 163  LEU A CD1 1 
ATOM   1164 C CD2 . LEU A 1 162 ? 7.503   20.873 18.260 1.00 15.80 ? 163  LEU A CD2 1 
ATOM   1165 N N   . ASP A 1 163 ? 6.904   21.092 13.369 1.00 14.67 ? 164  ASP A N   1 
ATOM   1166 C CA  . ASP A 1 163 ? 7.064   21.180 11.906 1.00 15.26 ? 164  ASP A CA  1 
ATOM   1167 C C   . ASP A 1 163 ? 7.827   22.414 11.474 1.00 17.86 ? 164  ASP A C   1 
ATOM   1168 O O   . ASP A 1 163 ? 7.992   22.636 10.269 1.00 18.26 ? 164  ASP A O   1 
ATOM   1169 C CB  . ASP A 1 163 ? 5.682   21.144 11.216 1.00 17.55 ? 164  ASP A CB  1 
ATOM   1170 C CG  . ASP A 1 163 ? 4.705   22.274 11.538 1.00 21.60 ? 164  ASP A CG  1 
ATOM   1171 O OD1 . ASP A 1 163 ? 5.080   23.203 12.301 1.00 18.82 ? 164  ASP A OD1 1 
ATOM   1172 O OD2 . ASP A 1 163 ? 3.557   22.219 11.050 1.00 25.51 ? 164  ASP A OD2 1 
ATOM   1173 N N   . HIS A 1 164 ? 8.304   23.231 12.418 1.00 13.32 ? 165  HIS A N   1 
ATOM   1174 C CA  . HIS A 1 164 ? 8.965   24.469 11.998 1.00 13.27 ? 165  HIS A CA  1 
ATOM   1175 C C   . HIS A 1 164 ? 10.034  24.843 12.998 1.00 15.09 ? 165  HIS A C   1 
ATOM   1176 O O   . HIS A 1 164 ? 9.767   24.890 14.194 1.00 16.64 ? 165  HIS A O   1 
ATOM   1177 C CB  . HIS A 1 164 ? 7.886   25.577 11.908 1.00 15.11 ? 165  HIS A CB  1 
ATOM   1178 C CG  . HIS A 1 164 ? 8.333   26.883 11.363 1.00 17.98 ? 165  HIS A CG  1 
ATOM   1179 N ND1 . HIS A 1 164 ? 8.928   26.995 10.112 1.00 21.28 ? 165  HIS A ND1 1 
ATOM   1180 C CD2 . HIS A 1 164 ? 8.156   28.121 11.867 1.00 19.65 ? 165  HIS A CD2 1 
ATOM   1181 C CE1 . HIS A 1 164 ? 9.208   28.282 9.964  1.00 20.45 ? 165  HIS A CE1 1 
ATOM   1182 N NE2 . HIS A 1 164 ? 8.760   28.998 10.986 1.00 19.38 ? 165  HIS A NE2 1 
ATOM   1183 N N   . ALA A 1 165 ? 11.205  25.229 12.510 1.00 12.83 ? 166  ALA A N   1 
ATOM   1184 C CA  . ALA A 1 165 ? 12.282  25.701 13.367 1.00 12.36 ? 166  ALA A CA  1 
ATOM   1185 C C   . ALA A 1 165 ? 12.353  27.235 13.346 1.00 13.46 ? 166  ALA A C   1 
ATOM   1186 O O   . ALA A 1 165 ? 12.222  27.868 12.275 1.00 13.10 ? 166  ALA A O   1 
ATOM   1187 C CB  . ALA A 1 165 ? 13.604  25.106 12.914 1.00 13.86 ? 166  ALA A CB  1 
ATOM   1188 N N   . VAL A 1 166 ? 12.519  27.828 14.535 1.00 10.57 ? 167  VAL A N   1 
ATOM   1189 C CA  . VAL A 1 166 ? 12.590  29.278 14.727 1.00 9.93  ? 167  VAL A CA  1 
ATOM   1190 C C   . VAL A 1 166 ? 13.723  29.565 15.709 1.00 9.31  ? 167  VAL A C   1 
ATOM   1191 O O   . VAL A 1 166 ? 14.428  28.625 16.094 1.00 9.79  ? 167  VAL A O   1 
ATOM   1192 C CB  . VAL A 1 166 ? 11.247  29.891 15.188 1.00 12.01 ? 167  VAL A CB  1 
ATOM   1193 C CG1 . VAL A 1 166 ? 10.168  29.803 14.093 1.00 13.31 ? 167  VAL A CG1 1 
ATOM   1194 C CG2 . VAL A 1 166 ? 10.749  29.240 16.481 1.00 11.66 ? 167  VAL A CG2 1 
ATOM   1195 N N   . THR A 1 167 ? 13.917  30.841 16.125 1.00 8.90  ? 168  THR A N   1 
ATOM   1196 C CA  . THR A 1 167 ? 15.033  31.163 16.997 1.00 7.08  ? 168  THR A CA  1 
ATOM   1197 C C   . THR A 1 167 ? 14.553  32.007 18.155 1.00 9.64  ? 168  THR A C   1 
ATOM   1198 O O   . THR A 1 167 ? 13.992  33.087 17.974 1.00 9.14  ? 168  THR A O   1 
ATOM   1199 C CB  . THR A 1 167 ? 16.133  31.908 16.210 1.00 10.58 ? 168  THR A CB  1 
ATOM   1200 O OG1 . THR A 1 167 ? 16.374  31.216 14.978 1.00 11.19 ? 168  THR A OG1 1 
ATOM   1201 C CG2 . THR A 1 167 ? 17.426  32.005 16.984 1.00 10.22 ? 168  THR A CG2 1 
ATOM   1202 N N   . VAL A 1 168 ? 14.845  31.546 19.359 1.00 7.52  ? 169  VAL A N   1 
ATOM   1203 C CA  . VAL A 1 168 ? 14.572  32.325 20.572 1.00 6.69  ? 169  VAL A CA  1 
ATOM   1204 C C   . VAL A 1 168 ? 15.723  33.331 20.752 1.00 7.04  ? 169  VAL A C   1 
ATOM   1205 O O   . VAL A 1 168 ? 16.906  32.914 20.881 1.00 8.00  ? 169  VAL A O   1 
ATOM   1206 C CB  . VAL A 1 168 ? 14.457  31.424 21.809 1.00 9.13  ? 169  VAL A CB  1 
ATOM   1207 C CG1 . VAL A 1 168 ? 14.444  32.261 23.089 1.00 9.04  ? 169  VAL A CG1 1 
ATOM   1208 C CG2 . VAL A 1 168 ? 13.215  30.540 21.719 1.00 9.67  ? 169  VAL A CG2 1 
ATOM   1209 N N   . VAL A 1 169 ? 15.375  34.606 20.823 1.00 7.11  ? 170  VAL A N   1 
ATOM   1210 C CA  . VAL A 1 169 ? 16.360  35.673 20.981 1.00 6.85  ? 170  VAL A CA  1 
ATOM   1211 C C   . VAL A 1 169 ? 16.180  36.407 22.284 1.00 8.93  ? 170  VAL A C   1 
ATOM   1212 O O   . VAL A 1 169 ? 16.850  37.412 22.520 1.00 9.86  ? 170  VAL A O   1 
ATOM   1213 C CB  . VAL A 1 169 ? 16.409  36.646 19.779 1.00 8.76  ? 170  VAL A CB  1 
ATOM   1214 C CG1 . VAL A 1 169 ? 16.761  35.892 18.484 1.00 9.55  ? 170  VAL A CG1 1 
ATOM   1215 C CG2 . VAL A 1 169 ? 15.071  37.373 19.617 1.00 10.09 ? 170  VAL A CG2 1 
ATOM   1216 N N   . GLY A 1 170 ? 15.319  35.920 23.165 1.00 9.06  ? 171  GLY A N   1 
ATOM   1217 C CA  . GLY A 1 170 ? 15.196  36.544 24.474 1.00 8.57  ? 171  GLY A CA  1 
ATOM   1218 C C   . GLY A 1 170 ? 13.881  36.151 25.114 1.00 9.44  ? 171  GLY A C   1 
ATOM   1219 O O   . GLY A 1 170 ? 13.208  35.209 24.672 1.00 8.92  ? 171  GLY A O   1 
ATOM   1220 N N   . TYR A 1 171 ? 13.563  36.847 26.216 1.00 7.25  ? 172  TYR A N   1 
ATOM   1221 C CA  . TYR A 1 171 ? 12.328  36.647 26.938 1.00 8.03  ? 172  TYR A CA  1 
ATOM   1222 C C   . TYR A 1 171 ? 12.025  37.874 27.763 1.00 10.39 ? 172  TYR A C   1 
ATOM   1223 O O   . TYR A 1 171 ? 12.914  38.663 28.127 1.00 9.22  ? 172  TYR A O   1 
ATOM   1224 C CB  . TYR A 1 171 ? 12.328  35.352 27.797 1.00 9.16  ? 172  TYR A CB  1 
ATOM   1225 C CG  . TYR A 1 171 ? 13.520  35.216 28.707 1.00 9.18  ? 172  TYR A CG  1 
ATOM   1226 C CD1 . TYR A 1 171 ? 13.511  35.774 29.987 1.00 9.42  ? 172  TYR A CD1 1 
ATOM   1227 C CD2 . TYR A 1 171 ? 14.629  34.473 28.321 1.00 9.35  ? 172  TYR A CD2 1 
ATOM   1228 C CE1 . TYR A 1 171 ? 14.587  35.610 30.849 1.00 8.13  ? 172  TYR A CE1 1 
ATOM   1229 C CE2 . TYR A 1 171 ? 15.727  34.331 29.160 1.00 10.10 ? 172  TYR A CE2 1 
ATOM   1230 C CZ  . TYR A 1 171 ? 15.688  34.874 30.436 1.00 10.12 ? 172  TYR A CZ  1 
ATOM   1231 O OH  . TYR A 1 171 ? 16.753  34.709 31.285 1.00 11.45 ? 172  TYR A OH  1 
ATOM   1232 N N   . GLY A 1 172 ? 10.740  38.086 27.997 1.00 11.43 ? 173  GLY A N   1 
ATOM   1233 C CA  . GLY A 1 172 ? 10.310  39.238 28.762 1.00 12.05 ? 173  GLY A CA  1 
ATOM   1234 C C   . GLY A 1 172 ? 9.005   38.983 29.478 1.00 13.43 ? 173  GLY A C   1 
ATOM   1235 O O   . GLY A 1 172 ? 8.493   37.867 29.463 1.00 13.28 ? 173  GLY A O   1 
ATOM   1236 N N   . THR A 1 173 ? 8.446   40.018 30.076 1.00 12.70 ? 174  THR A N   1 
ATOM   1237 C CA  . THR A 1 173 ? 7.178   39.949 30.807 1.00 13.62 ? 174  THR A CA  1 
ATOM   1238 C C   . THR A 1 173 ? 6.372   41.178 30.468 1.00 18.57 ? 174  THR A C   1 
ATOM   1239 O O   . THR A 1 173 ? 6.890   42.301 30.510 1.00 17.53 ? 174  THR A O   1 
ATOM   1240 C CB  . THR A 1 173 ? 7.420   39.843 32.328 1.00 14.91 ? 174  THR A CB  1 
ATOM   1241 O OG1 . THR A 1 173 ? 8.227   38.694 32.643 1.00 16.45 ? 174  THR A OG1 1 
ATOM   1242 C CG2 . THR A 1 173 ? 6.113   39.793 33.138 1.00 19.06 ? 174  THR A CG2 1 
ATOM   1243 N N   . ASP A 1 174 ? 5.083   40.973 30.165 1.00 16.63 ? 175  ASP A N   1 
ATOM   1244 C CA  . ASP A 1 174 ? 4.160   42.048 29.889 1.00 17.37 ? 175  ASP A CA  1 
ATOM   1245 C C   . ASP A 1 174 ? 3.716   42.637 31.211 1.00 21.07 ? 175  ASP A C   1 
ATOM   1246 O O   . ASP A 1 174 ? 3.174   41.894 32.063 1.00 19.14 ? 175  ASP A O   1 
ATOM   1247 C CB  . ASP A 1 174 ? 2.954   41.509 29.100 1.00 18.07 ? 175  ASP A CB  1 
ATOM   1248 C CG  . ASP A 1 174 ? 1.861   42.527 28.858 1.00 25.43 ? 175  ASP A CG  1 
ATOM   1249 O OD1 . ASP A 1 174 ? 2.170   43.622 28.373 1.00 27.50 ? 175  ASP A OD1 1 
ATOM   1250 O OD2 . ASP A 1 174 ? 0.703   42.219 29.136 1.00 26.55 ? 175  ASP A OD2 1 
ATOM   1251 N N   . PRO A 1 175 ? 3.893   43.968 31.409 1.00 21.87 ? 176  PRO A N   1 
ATOM   1252 C CA  . PRO A 1 175 ? 3.544   44.539 32.716 1.00 23.95 ? 176  PRO A CA  1 
ATOM   1253 C C   . PRO A 1 175 ? 2.069   44.448 33.075 1.00 29.10 ? 176  PRO A C   1 
ATOM   1254 O O   . PRO A 1 175 ? 1.795   44.164 34.231 1.00 30.28 ? 176  PRO A O   1 
ATOM   1255 C CB  . PRO A 1 175 ? 4.005   45.997 32.632 1.00 25.60 ? 176  PRO A CB  1 
ATOM   1256 C CG  . PRO A 1 175 ? 4.269   46.275 31.191 1.00 29.05 ? 176  PRO A CG  1 
ATOM   1257 C CD  . PRO A 1 175 ? 4.525   44.963 30.515 1.00 23.39 ? 176  PRO A CD  1 
ATOM   1258 N N   . ASN A 1 176 ? 1.140   44.631 32.124 1.00 26.80 ? 177  ASN A N   1 
ATOM   1259 C CA  . ASN A 1 176 ? -0.281  44.619 32.498 1.00 28.67 ? 177  ASN A CA  1 
ATOM   1260 C C   . ASN A 1 176 ? -0.820  43.212 32.782 1.00 29.78 ? 177  ASN A C   1 
ATOM   1261 O O   . ASN A 1 176 ? -1.462  43.020 33.826 1.00 31.80 ? 177  ASN A O   1 
ATOM   1262 C CB  . ASN A 1 176 ? -1.151  45.332 31.471 1.00 33.82 ? 177  ASN A CB  1 
ATOM   1263 C CG  . ASN A 1 176 ? -2.468  45.811 32.063 1.00 65.30 ? 177  ASN A CG  1 
ATOM   1264 O OD1 . ASN A 1 176 ? -2.534  46.338 33.187 1.00 61.36 ? 177  ASN A OD1 1 
ATOM   1265 N ND2 . ASN A 1 176 ? -3.554  45.633 31.325 1.00 57.28 ? 177  ASN A ND2 1 
ATOM   1266 N N   . SER A 1 177 ? -0.571  42.224 31.894 1.00 21.60 ? 178  SER A N   1 
ATOM   1267 C CA  . SER A 1 177 ? -1.056  40.858 32.154 1.00 20.62 ? 178  SER A CA  1 
ATOM   1268 C C   . SER A 1 177 ? -0.184  40.131 33.167 1.00 22.59 ? 178  SER A C   1 
ATOM   1269 O O   . SER A 1 177 ? -0.631  39.189 33.836 1.00 22.29 ? 178  SER A O   1 
ATOM   1270 C CB  . SER A 1 177 ? -1.128  40.044 30.870 1.00 21.03 ? 178  SER A CB  1 
ATOM   1271 O OG  . SER A 1 177 ? 0.181   39.881 30.347 1.00 22.13 ? 178  SER A OG  1 
ATOM   1272 N N   . GLY A 1 178 ? 1.107   40.476 33.199 1.00 19.30 ? 179  GLY A N   1 
ATOM   1273 C CA  . GLY A 1 178 ? 2.030   39.777 34.088 1.00 18.87 ? 179  GLY A CA  1 
ATOM   1274 C C   . GLY A 1 178 ? 2.522   38.462 33.497 1.00 21.02 ? 179  GLY A C   1 
ATOM   1275 O O   . GLY A 1 178 ? 3.217   37.684 34.162 1.00 20.72 ? 179  GLY A O   1 
ATOM   1276 N N   . ASN A 1 179 ? 2.148   38.201 32.245 1.00 14.16 ? 180  ASN A N   1 
ATOM   1277 C CA  . ASN A 1 179 ? 2.580   36.965 31.608 1.00 14.15 ? 180  ASN A CA  1 
ATOM   1278 C C   . ASN A 1 179 ? 3.894   37.151 30.907 1.00 14.51 ? 180  ASN A C   1 
ATOM   1279 O O   . ASN A 1 179 ? 4.171   38.190 30.322 1.00 14.25 ? 180  ASN A O   1 
ATOM   1280 C CB  . ASN A 1 179 ? 1.539   36.444 30.698 1.00 16.85 ? 180  ASN A CB  1 
ATOM   1281 C CG  . ASN A 1 179 ? 0.358   35.871 31.474 1.00 27.51 ? 180  ASN A CG  1 
ATOM   1282 O OD1 . ASN A 1 179 ? 0.479   35.242 32.574 1.00 24.04 ? 180  ASN A OD1 1 
ATOM   1283 N ND2 . ASN A 1 179 ? -0.788  36.122 30.928 1.00 25.35 ? 180  ASN A ND2 1 
ATOM   1284 N N   . SER A 1 180 ? 4.706   36.106 31.002 1.00 12.31 ? 181  SER A N   1 
ATOM   1285 C CA  . SER A 1 180 ? 6.040   36.100 30.419 1.00 11.47 ? 181  SER A CA  1 
ATOM   1286 C C   . SER A 1 180 ? 6.002   35.437 29.053 1.00 11.54 ? 181  SER A C   1 
ATOM   1287 O O   . SER A 1 180 ? 5.071   34.670 28.739 1.00 11.53 ? 181  SER A O   1 
ATOM   1288 C CB  . SER A 1 180 ? 7.003   35.395 31.350 1.00 14.32 ? 181  SER A CB  1 
ATOM   1289 O OG  . SER A 1 180 ? 7.164   36.185 32.522 1.00 19.51 ? 181  SER A OG  1 
ATOM   1290 N N   . TYR A 1 181 ? 6.987   35.762 28.216 1.00 9.69  ? 182  TYR A N   1 
ATOM   1291 C CA  . TYR A 1 181 ? 7.013   35.265 26.844 1.00 10.46 ? 182  TYR A CA  1 
ATOM   1292 C C   . TYR A 1 181 ? 8.407   35.120 26.337 1.00 11.26 ? 182  TYR A C   1 
ATOM   1293 O O   . TYR A 1 181 ? 9.322   35.844 26.759 1.00 10.10 ? 182  TYR A O   1 
ATOM   1294 C CB  . TYR A 1 181 ? 6.259   36.227 25.926 1.00 11.84 ? 182  TYR A CB  1 
ATOM   1295 C CG  . TYR A 1 181 ? 6.734   37.664 26.026 1.00 12.21 ? 182  TYR A CG  1 
ATOM   1296 C CD1 . TYR A 1 181 ? 6.149   38.555 26.930 1.00 15.39 ? 182  TYR A CD1 1 
ATOM   1297 C CD2 . TYR A 1 181 ? 7.737   38.145 25.195 1.00 12.85 ? 182  TYR A CD2 1 
ATOM   1298 C CE1 . TYR A 1 181 ? 6.586   39.873 27.023 1.00 16.55 ? 182  TYR A CE1 1 
ATOM   1299 C CE2 . TYR A 1 181 ? 8.199   39.450 25.298 1.00 14.36 ? 182  TYR A CE2 1 
ATOM   1300 C CZ  . TYR A 1 181 ? 7.614   40.313 26.204 1.00 17.16 ? 182  TYR A CZ  1 
ATOM   1301 O OH  . TYR A 1 181 ? 8.077   41.593 26.281 1.00 17.18 ? 182  TYR A OH  1 
ATOM   1302 N N   . TRP A 1 182 ? 8.569   34.200 25.413 1.00 8.07  ? 183  TRP A N   1 
ATOM   1303 C CA  . TRP A 1 182 ? 9.746   34.017 24.613 1.00 7.94  ? 183  TRP A CA  1 
ATOM   1304 C C   . TRP A 1 182 ? 9.696   35.008 23.459 1.00 10.01 ? 183  TRP A C   1 
ATOM   1305 O O   . TRP A 1 182 ? 8.628   35.195 22.841 1.00 9.99  ? 183  TRP A O   1 
ATOM   1306 C CB  . TRP A 1 182 ? 9.795   32.586 24.026 1.00 7.80  ? 183  TRP A CB  1 
ATOM   1307 C CG  . TRP A 1 182 ? 9.815   31.517 25.054 1.00 8.05  ? 183  TRP A CG  1 
ATOM   1308 C CD1 . TRP A 1 182 ? 8.785   30.681 25.375 1.00 10.30 ? 183  TRP A CD1 1 
ATOM   1309 C CD2 . TRP A 1 182 ? 10.925  31.130 25.878 1.00 7.23  ? 183  TRP A CD2 1 
ATOM   1310 N NE1 . TRP A 1 182 ? 9.197   29.756 26.310 1.00 9.82  ? 183  TRP A NE1 1 
ATOM   1311 C CE2 . TRP A 1 182 ? 10.495  30.038 26.670 1.00 9.76  ? 183  TRP A CE2 1 
ATOM   1312 C CE3 . TRP A 1 182 ? 12.221  31.646 26.072 1.00 7.20  ? 183  TRP A CE3 1 
ATOM   1313 C CZ2 . TRP A 1 182 ? 11.351  29.403 27.593 1.00 9.14  ? 183  TRP A CZ2 1 
ATOM   1314 C CZ3 . TRP A 1 182 ? 13.067  31.013 26.981 1.00 9.07  ? 183  TRP A CZ3 1 
ATOM   1315 C CH2 . TRP A 1 182 ? 12.616  29.935 27.751 1.00 9.41  ? 183  TRP A CH2 1 
ATOM   1316 N N   . ILE A 1 183 ? 10.832  35.638 23.146 1.00 8.31  ? 184  ILE A N   1 
ATOM   1317 C CA  . ILE A 1 183 ? 10.941  36.516 21.971 1.00 7.63  ? 184  ILE A CA  1 
ATOM   1318 C C   . ILE A 1 183 ? 11.513  35.663 20.853 1.00 8.94  ? 184  ILE A C   1 
ATOM   1319 O O   . ILE A 1 183 ? 12.631  35.166 20.955 1.00 9.15  ? 184  ILE A O   1 
ATOM   1320 C CB  . ILE A 1 183 ? 11.798  37.784 22.239 1.00 10.03 ? 184  ILE A CB  1 
ATOM   1321 C CG1 . ILE A 1 183 ? 11.239  38.562 23.436 1.00 8.81  ? 184  ILE A CG1 1 
ATOM   1322 C CG2 . ILE A 1 183 ? 11.852  38.675 20.978 1.00 11.79 ? 184  ILE A CG2 1 
ATOM   1323 C CD1 . ILE A 1 183 ? 12.247  39.642 23.951 1.00 12.39 ? 184  ILE A CD1 1 
ATOM   1324 N N   . VAL A 1 184 ? 10.708  35.453 19.798 1.00 8.63  ? 185  VAL A N   1 
ATOM   1325 C CA  . VAL A 1 184 ? 11.041  34.504 18.750 1.00 8.60  ? 185  VAL A CA  1 
ATOM   1326 C C   . VAL A 1 184 ? 11.144  35.135 17.377 1.00 11.09 ? 185  VAL A C   1 
ATOM   1327 O O   . VAL A 1 184 ? 10.203  35.811 16.920 1.00 11.20 ? 185  VAL A O   1 
ATOM   1328 C CB  . VAL A 1 184 ? 9.961   33.399 18.754 1.00 11.13 ? 185  VAL A CB  1 
ATOM   1329 C CG1 . VAL A 1 184 ? 10.146  32.452 17.576 1.00 12.62 ? 185  VAL A CG1 1 
ATOM   1330 C CG2 . VAL A 1 184 ? 9.980   32.626 20.068 1.00 10.75 ? 185  VAL A CG2 1 
ATOM   1331 N N   . LYS A 1 185 ? 12.305  34.958 16.741 1.00 9.14  ? 186  LYS A N   1 
ATOM   1332 C CA  . LYS A 1 185 ? 12.589  35.413 15.397 1.00 9.21  ? 186  LYS A CA  1 
ATOM   1333 C C   . LYS A 1 185 ? 12.120  34.357 14.422 1.00 11.10 ? 186  LYS A C   1 
ATOM   1334 O O   . LYS A 1 185 ? 12.596  33.213 14.474 1.00 11.13 ? 186  LYS A O   1 
ATOM   1335 C CB  . LYS A 1 185 ? 14.111  35.667 15.238 1.00 9.93  ? 186  LYS A CB  1 
ATOM   1336 C CG  . LYS A 1 185 ? 14.471  36.370 13.933 1.00 10.31 ? 186  LYS A CG  1 
ATOM   1337 C CD  . LYS A 1 185 ? 15.977  36.364 13.720 1.00 10.10 ? 186  LYS A CD  1 
ATOM   1338 C CE  . LYS A 1 185 ? 16.326  37.284 12.566 1.00 12.50 ? 186  LYS A CE  1 
ATOM   1339 N NZ  . LYS A 1 185 ? 17.798  37.245 12.219 1.00 11.63 ? 186  LYS A NZ  1 
ATOM   1340 N N   . ASN A 1 186 ? 11.135  34.710 13.599 1.00 11.20 ? 187  ASN A N   1 
ATOM   1341 C CA  . ASN A 1 186 ? 10.670  33.793 12.573 1.00 11.72 ? 187  ASN A CA  1 
ATOM   1342 C C   . ASN A 1 186 ? 11.377  34.147 11.241 1.00 14.13 ? 187  ASN A C   1 
ATOM   1343 O O   . ASN A 1 186 ? 12.034  35.206 11.145 1.00 12.38 ? 187  ASN A O   1 
ATOM   1344 C CB  . ASN A 1 186 ? 9.135   33.826 12.468 1.00 13.41 ? 187  ASN A CB  1 
ATOM   1345 C CG  . ASN A 1 186 ? 8.525   32.605 11.807 1.00 15.28 ? 187  ASN A CG  1 
ATOM   1346 O OD1 . ASN A 1 186 ? 9.218   31.679 11.385 1.00 14.16 ? 187  ASN A OD1 1 
ATOM   1347 N ND2 . ASN A 1 186 ? 7.197   32.553 11.748 1.00 18.13 ? 187  ASN A ND2 1 
ATOM   1348 N N   . SER A 1 187 ? 11.222  33.280 10.221 1.00 13.01 ? 188  SER A N   1 
ATOM   1349 C CA  . SER A 1 187 ? 11.877  33.437 8.913  1.00 13.82 ? 188  SER A CA  1 
ATOM   1350 C C   . SER A 1 187 ? 10.813  33.591 7.815  1.00 17.70 ? 188  SER A C   1 
ATOM   1351 O O   . SER A 1 187 ? 10.985  33.084 6.692  1.00 18.83 ? 188  SER A O   1 
ATOM   1352 C CB  . SER A 1 187 ? 12.769  32.220 8.640  1.00 16.15 ? 188  SER A CB  1 
ATOM   1353 O OG  . SER A 1 187 ? 12.083  31.001 8.887  1.00 17.38 ? 188  SER A OG  1 
ATOM   1354 N N   . TRP A 1 188 ? 9.739   34.313 8.129  1.00 14.44 ? 189  TRP A N   1 
ATOM   1355 C CA  . TRP A 1 188 ? 8.624   34.527 7.168  1.00 15.86 ? 189  TRP A CA  1 
ATOM   1356 C C   . TRP A 1 188 ? 8.537   36.005 6.737  1.00 18.71 ? 189  TRP A C   1 
ATOM   1357 O O   . TRP A 1 188 ? 7.481   36.478 6.286  1.00 21.04 ? 189  TRP A O   1 
ATOM   1358 C CB  . TRP A 1 188 ? 7.290   34.065 7.768  1.00 17.13 ? 189  TRP A CB  1 
ATOM   1359 C CG  . TRP A 1 188 ? 7.147   32.572 7.928  1.00 17.91 ? 189  TRP A CG  1 
ATOM   1360 C CD1 . TRP A 1 188 ? 7.977   31.605 7.443  1.00 20.46 ? 189  TRP A CD1 1 
ATOM   1361 C CD2 . TRP A 1 188 ? 6.139   31.889 8.690  1.00 17.90 ? 189  TRP A CD2 1 
ATOM   1362 N NE1 . TRP A 1 188 ? 7.533   30.359 7.837  1.00 20.66 ? 189  TRP A NE1 1 
ATOM   1363 C CE2 . TRP A 1 188 ? 6.395   30.507 8.579  1.00 21.52 ? 189  TRP A CE2 1 
ATOM   1364 C CE3 . TRP A 1 188 ? 4.991   32.310 9.384  1.00 19.86 ? 189  TRP A CE3 1 
ATOM   1365 C CZ2 . TRP A 1 188 ? 5.587   29.545 9.202  1.00 21.91 ? 189  TRP A CZ2 1 
ATOM   1366 C CZ3 . TRP A 1 188 ? 4.161   31.355 9.950  1.00 22.24 ? 189  TRP A CZ3 1 
ATOM   1367 C CH2 . TRP A 1 188 ? 4.487   29.994 9.896  1.00 22.78 ? 189  TRP A CH2 1 
ATOM   1368 N N   . GLY A 1 189 ? 9.660   36.703 6.852  1.00 17.08 ? 190  GLY A N   1 
ATOM   1369 C CA  . GLY A 1 189 ? 9.765   38.107 6.497  1.00 16.47 ? 190  GLY A CA  1 
ATOM   1370 C C   . GLY A 1 189 ? 9.127   39.032 7.514  1.00 18.84 ? 190  GLY A C   1 
ATOM   1371 O O   . GLY A 1 189 ? 8.559   38.562 8.505  1.00 16.47 ? 190  GLY A O   1 
ATOM   1372 N N   . THR A 1 190 ? 9.167   40.351 7.251  1.00 18.58 ? 191  THR A N   1 
ATOM   1373 C CA  . THR A 1 190 ? 8.671   41.364 8.201  1.00 18.82 ? 191  THR A CA  1 
ATOM   1374 C C   . THR A 1 190 ? 7.159   41.626 8.110  1.00 25.22 ? 191  THR A C   1 
ATOM   1375 O O   . THR A 1 190 ? 6.641   42.345 8.960  1.00 25.77 ? 191  THR A O   1 
ATOM   1376 C CB  . THR A 1 190 ? 9.429   42.675 8.080  1.00 21.36 ? 191  THR A CB  1 
ATOM   1377 O OG1 . THR A 1 190 ? 9.297   43.158 6.736  1.00 24.28 ? 191  THR A OG1 1 
ATOM   1378 C CG2 . THR A 1 190 ? 10.897  42.536 8.441  1.00 20.65 ? 191  THR A CG2 1 
ATOM   1379 N N   . SER A 1 191 ? 6.459   41.059 7.118  1.00 22.78 ? 192  SER A N   1 
ATOM   1380 C CA  . SER A 1 191 ? 5.021   41.246 6.981  1.00 23.75 ? 192  SER A CA  1 
ATOM   1381 C C   . SER A 1 191 ? 4.228   40.361 7.927  1.00 27.46 ? 192  SER A C   1 
ATOM   1382 O O   . SER A 1 191 ? 3.041   40.607 8.137  1.00 30.06 ? 192  SER A O   1 
ATOM   1383 C CB  . SER A 1 191 ? 4.596   40.968 5.544  1.00 25.28 ? 192  SER A CB  1 
ATOM   1384 O OG  . SER A 1 191 ? 5.077   42.021 4.726  1.00 32.74 ? 192  SER A OG  1 
ATOM   1385 N N   . TRP A 1 192 ? 4.864   39.318 8.458  1.00 21.42 ? 193  TRP A N   1 
ATOM   1386 C CA  . TRP A 1 192 ? 4.245   38.401 9.392  1.00 20.70 ? 193  TRP A CA  1 
ATOM   1387 C C   . TRP A 1 192 ? 4.580   38.850 10.818 1.00 21.49 ? 193  TRP A C   1 
ATOM   1388 O O   . TRP A 1 192 ? 5.704   39.304 11.075 1.00 17.84 ? 193  TRP A O   1 
ATOM   1389 C CB  . TRP A 1 192 ? 4.786   36.980 9.126  1.00 18.78 ? 193  TRP A CB  1 
ATOM   1390 C CG  . TRP A 1 192 ? 4.202   35.954 10.041 1.00 18.62 ? 193  TRP A CG  1 
ATOM   1391 C CD1 . TRP A 1 192 ? 3.026   35.282 9.878  1.00 22.00 ? 193  TRP A CD1 1 
ATOM   1392 C CD2 . TRP A 1 192 ? 4.722   35.556 11.313 1.00 16.64 ? 193  TRP A CD2 1 
ATOM   1393 N NE1 . TRP A 1 192 ? 2.794   34.465 10.961 1.00 21.89 ? 193  TRP A NE1 1 
ATOM   1394 C CE2 . TRP A 1 192 ? 3.833   34.600 11.851 1.00 20.73 ? 193  TRP A CE2 1 
ATOM   1395 C CE3 . TRP A 1 192 ? 5.869   35.901 12.051 1.00 16.01 ? 193  TRP A CE3 1 
ATOM   1396 C CZ2 . TRP A 1 192 ? 4.053   33.985 13.087 1.00 18.80 ? 193  TRP A CZ2 1 
ATOM   1397 C CZ3 . TRP A 1 192 ? 6.077   35.301 13.286 1.00 17.10 ? 193  TRP A CZ3 1 
ATOM   1398 C CH2 . TRP A 1 192 ? 5.193   34.329 13.777 1.00 17.84 ? 193  TRP A CH2 1 
ATOM   1399 N N   . GLY A 1 193 ? 3.621   38.710 11.730 1.00 19.59 ? 194  GLY A N   1 
ATOM   1400 C CA  . GLY A 1 193 ? 3.864   39.046 13.134 1.00 18.61 ? 194  GLY A CA  1 
ATOM   1401 C C   . GLY A 1 193 ? 4.268   40.475 13.431 1.00 21.02 ? 194  GLY A C   1 
ATOM   1402 O O   . GLY A 1 193 ? 3.839   41.398 12.739 1.00 21.47 ? 194  GLY A O   1 
ATOM   1403 N N   . GLN A 1 194 ? 5.053   40.663 14.506 1.00 17.40 ? 195  GLN A N   1 
ATOM   1404 C CA  . GLN A 1 194 ? 5.568   41.964 14.930 1.00 17.26 ? 195  GLN A CA  1 
ATOM   1405 C C   . GLN A 1 194 ? 6.862   42.208 14.162 1.00 19.11 ? 195  GLN A C   1 
ATOM   1406 O O   . GLN A 1 194 ? 7.964   41.933 14.661 1.00 17.78 ? 195  GLN A O   1 
ATOM   1407 C CB  . GLN A 1 194 ? 5.819   42.020 16.448 1.00 18.15 ? 195  GLN A CB  1 
ATOM   1408 C CG  . GLN A 1 194 ? 4.598   41.881 17.332 1.00 24.21 ? 195  GLN A CG  1 
ATOM   1409 C CD  . GLN A 1 194 ? 4.980   41.988 18.792 1.00 43.89 ? 195  GLN A CD  1 
ATOM   1410 O OE1 . GLN A 1 194 ? 5.351   43.055 19.290 1.00 46.19 ? 195  GLN A OE1 1 
ATOM   1411 N NE2 . GLN A 1 194 ? 4.914   40.879 19.512 1.00 29.22 ? 195  GLN A NE2 1 
ATOM   1412 N N   . GLU A 1 195 ? 6.726   42.717 12.913 1.00 17.36 ? 196  GLU A N   1 
ATOM   1413 C CA  . GLU A 1 195 ? 7.892   42.923 12.054 1.00 16.99 ? 196  GLU A CA  1 
ATOM   1414 C C   . GLU A 1 195 ? 8.763   41.618 11.981 1.00 17.24 ? 196  GLU A C   1 
ATOM   1415 O O   . GLU A 1 195 ? 9.996   41.678 12.026 1.00 16.56 ? 196  GLU A O   1 
ATOM   1416 C CB  . GLU A 1 195 ? 8.743   44.138 12.490 1.00 19.02 ? 196  GLU A CB  1 
ATOM   1417 C CG  . GLU A 1 195 ? 7.933   45.403 12.746 1.00 30.32 ? 196  GLU A CG  1 
ATOM   1418 C CD  . GLU A 1 195 ? 8.054   46.442 11.656 1.00 64.73 ? 196  GLU A CD  1 
ATOM   1419 O OE1 . GLU A 1 195 ? 7.255   46.388 10.694 1.00 68.15 ? 196  GLU A OE1 1 
ATOM   1420 O OE2 . GLU A 1 195 ? 8.947   47.313 11.765 1.00 66.17 ? 196  GLU A OE2 1 
ATOM   1421 N N   . GLY A 1 196 ? 8.104   40.455 11.913 1.00 15.27 ? 197  GLY A N   1 
ATOM   1422 C CA  . GLY A 1 196 ? 8.818   39.187 11.774 1.00 12.89 ? 197  GLY A CA  1 
ATOM   1423 C C   . GLY A 1 196 ? 8.995   38.378 13.043 1.00 13.67 ? 197  GLY A C   1 
ATOM   1424 O O   . GLY A 1 196 ? 9.462   37.231 12.974 1.00 14.23 ? 197  GLY A O   1 
ATOM   1425 N N   . TYR A 1 197 ? 8.636   38.975 14.198 1.00 12.34 ? 198  TYR A N   1 
ATOM   1426 C CA  . TYR A 1 197 ? 8.770   38.381 15.529 1.00 11.64 ? 198  TYR A CA  1 
ATOM   1427 C C   . TYR A 1 197 ? 7.442   37.974 16.115 1.00 13.11 ? 198  TYR A C   1 
ATOM   1428 O O   . TYR A 1 197 ? 6.409   38.575 15.833 1.00 13.76 ? 198  TYR A O   1 
ATOM   1429 C CB  . TYR A 1 197 ? 9.443   39.377 16.495 1.00 13.02 ? 198  TYR A CB  1 
ATOM   1430 C CG  . TYR A 1 197 ? 10.924  39.481 16.230 1.00 11.77 ? 198  TYR A CG  1 
ATOM   1431 C CD1 . TYR A 1 197 ? 11.421  40.376 15.285 1.00 12.40 ? 198  TYR A CD1 1 
ATOM   1432 C CD2 . TYR A 1 197 ? 11.833  38.673 16.915 1.00 12.32 ? 198  TYR A CD2 1 
ATOM   1433 C CE1 . TYR A 1 197 ? 12.788  40.465 15.023 1.00 13.00 ? 198  TYR A CE1 1 
ATOM   1434 C CE2 . TYR A 1 197 ? 13.193  38.746 16.650 1.00 13.39 ? 198  TYR A CE2 1 
ATOM   1435 C CZ  . TYR A 1 197 ? 13.656  39.627 15.689 1.00 14.74 ? 198  TYR A CZ  1 
ATOM   1436 O OH  . TYR A 1 197 ? 14.998  39.684 15.452 1.00 14.86 ? 198  TYR A OH  1 
ATOM   1437 N N   . ILE A 1 198 ? 7.487   36.988 17.003 1.00 10.81 ? 199  ILE A N   1 
ATOM   1438 C CA  . ILE A 1 198 ? 6.346   36.545 17.770 1.00 9.83  ? 199  ILE A CA  1 
ATOM   1439 C C   . ILE A 1 198 ? 6.749   36.430 19.220 1.00 12.23 ? 199  ILE A C   1 
ATOM   1440 O O   . ILE A 1 198 ? 7.868   36.011 19.529 1.00 12.29 ? 199  ILE A O   1 
ATOM   1441 C CB  . ILE A 1 198 ? 5.714   35.228 17.224 1.00 11.97 ? 199  ILE A CB  1 
ATOM   1442 C CG1 . ILE A 1 198 ? 4.477   34.813 18.045 1.00 13.48 ? 199  ILE A CG1 1 
ATOM   1443 C CG2 . ILE A 1 198 ? 6.714   34.070 17.118 1.00 12.02 ? 199  ILE A CG2 1 
ATOM   1444 C CD1 . ILE A 1 198 ? 3.691   33.656 17.393 1.00 16.22 ? 199  ILE A CD1 1 
ATOM   1445 N N   . TRP A 1 199 ? 5.857   36.861 20.107 1.00 11.12 ? 200  TRP A N   1 
ATOM   1446 C CA  . TRP A 1 199 ? 6.007   36.647 21.551 1.00 10.78 ? 200  TRP A CA  1 
ATOM   1447 C C   . TRP A 1 199 ? 5.206   35.396 21.862 1.00 11.35 ? 200  TRP A C   1 
ATOM   1448 O O   . TRP A 1 199 ? 3.981   35.404 21.647 1.00 12.30 ? 200  TRP A O   1 
ATOM   1449 C CB  . TRP A 1 199 ? 5.475   37.830 22.355 1.00 12.52 ? 200  TRP A CB  1 
ATOM   1450 C CG  . TRP A 1 199 ? 6.215   39.122 22.262 1.00 15.38 ? 200  TRP A CG  1 
ATOM   1451 C CD1 . TRP A 1 199 ? 7.334   39.415 21.541 1.00 19.31 ? 200  TRP A CD1 1 
ATOM   1452 C CD2 . TRP A 1 199 ? 5.813   40.337 22.904 1.00 17.22 ? 200  TRP A CD2 1 
ATOM   1453 N NE1 . TRP A 1 199 ? 7.679   40.740 21.734 1.00 19.87 ? 200  TRP A NE1 1 
ATOM   1454 C CE2 . TRP A 1 199 ? 6.764   41.322 22.574 1.00 22.70 ? 200  TRP A CE2 1 
ATOM   1455 C CE3 . TRP A 1 199 ? 4.759   40.674 23.766 1.00 19.96 ? 200  TRP A CE3 1 
ATOM   1456 C CZ2 . TRP A 1 199 ? 6.678   42.639 23.064 1.00 23.96 ? 200  TRP A CZ2 1 
ATOM   1457 C CZ3 . TRP A 1 199 ? 4.694   41.957 24.276 1.00 23.35 ? 200  TRP A CZ3 1 
ATOM   1458 C CH2 . TRP A 1 199 ? 5.648   42.921 23.929 1.00 24.58 ? 200  TRP A CH2 1 
ATOM   1459 N N   . MET A 1 200 ? 5.885   34.316 22.324 1.00 9.17  ? 201  MET A N   1 
ATOM   1460 C CA  . MET A 1 200 ? 5.198   33.034 22.614 1.00 8.86  ? 201  MET A CA  1 
ATOM   1461 C C   . MET A 1 200 ? 5.207   32.820 24.116 1.00 10.54 ? 201  MET A C   1 
ATOM   1462 O O   . MET A 1 200 ? 6.251   32.859 24.732 1.00 9.31  ? 201  MET A O   1 
ATOM   1463 C CB  . MET A 1 200 ? 5.904   31.896 21.862 1.00 10.01 ? 201  MET A CB  1 
ATOM   1464 C CG  . MET A 1 200 ? 5.892   32.124 20.352 1.00 12.09 ? 201  MET A CG  1 
ATOM   1465 S SD  . MET A 1 200 ? 6.499   30.767 19.346 1.00 12.68 ? 201  MET A SD  1 
ATOM   1466 C CE  . MET A 1 200 ? 5.175   29.614 19.559 1.00 12.91 ? 201  MET A CE  1 
ATOM   1467 N N   . GLN A 1 201 ? 4.028   32.691 24.719 1.00 8.74  ? 202  GLN A N   1 
ATOM   1468 C CA  . GLN A 1 201 ? 3.906   32.684 26.164 1.00 8.48  ? 202  GLN A CA  1 
ATOM   1469 C C   . GLN A 1 201 ? 4.721   31.568 26.804 1.00 10.71 ? 202  GLN A C   1 
ATOM   1470 O O   . GLN A 1 201 ? 4.700   30.443 26.346 1.00 10.29 ? 202  GLN A O   1 
ATOM   1471 C CB  . GLN A 1 201 ? 2.428   32.578 26.548 1.00 9.76  ? 202  GLN A CB  1 
ATOM   1472 C CG  . GLN A 1 201 ? 2.177   32.852 28.040 1.00 11.64 ? 202  GLN A CG  1 
ATOM   1473 C CD  . GLN A 1 201 ? 0.748   33.105 28.355 1.00 10.04 ? 202  GLN A CD  1 
ATOM   1474 O OE1 . GLN A 1 201 ? -0.082  33.321 27.451 1.00 13.47 ? 202  GLN A OE1 1 
ATOM   1475 N NE2 . GLN A 1 201 ? 0.424   33.007 29.647 1.00 12.39 ? 202  GLN A NE2 1 
ATOM   1476 N N   . MET A 1 202 ? 5.384   31.915 27.904 1.00 9.60  ? 203  MET A N   1 
ATOM   1477 C CA  . MET A 1 202 ? 6.121   30.962 28.713 1.00 9.43  ? 203  MET A CA  1 
ATOM   1478 C C   . MET A 1 202 ? 5.198   30.232 29.710 1.00 12.31 ? 203  MET A C   1 
ATOM   1479 O O   . MET A 1 202 ? 4.132   30.732 30.065 1.00 14.54 ? 203  MET A O   1 
ATOM   1480 C CB  . MET A 1 202 ? 7.196   31.704 29.503 1.00 11.64 ? 203  MET A CB  1 
ATOM   1481 C CG  . MET A 1 202 ? 8.308   32.286 28.607 1.00 14.71 ? 203  MET A CG  1 
ATOM   1482 S SD  . MET A 1 202 ? 9.479   33.256 29.595 1.00 18.13 ? 203  MET A SD  1 
ATOM   1483 C CE  A MET A 1 202 ? 9.629   32.120 30.855 0.68 9.86  ? 203  MET A CE  1 
ATOM   1484 C CE  B MET A 1 202 ? 10.792  32.271 29.607 0.32 11.89 ? 203  MET A CE  1 
ATOM   1485 N N   . GLY A 1 203 ? 5.612   29.043 30.136 1.00 11.10 ? 204  GLY A N   1 
ATOM   1486 C CA  . GLY A 1 203 ? 4.877   28.300 31.156 1.00 11.34 ? 204  GLY A CA  1 
ATOM   1487 C C   . GLY A 1 203 ? 3.635   27.566 30.704 1.00 16.22 ? 204  GLY A C   1 
ATOM   1488 O O   . GLY A 1 203 ? 2.828   27.169 31.556 1.00 17.70 ? 204  GLY A O   1 
ATOM   1489 N N   . LEU A 1 204 ? 3.474   27.343 29.380 1.00 11.57 ? 205  LEU A N   1 
ATOM   1490 C CA  . LEU A 1 204 ? 2.286   26.663 28.879 1.00 12.17 ? 205  LEU A CA  1 
ATOM   1491 C C   . LEU A 1 204 ? 2.560   25.247 28.417 1.00 14.88 ? 205  LEU A C   1 
ATOM   1492 O O   . LEU A 1 204 ? 3.713   24.882 28.148 1.00 11.99 ? 205  LEU A O   1 
ATOM   1493 C CB  . LEU A 1 204 ? 1.651   27.438 27.703 1.00 11.84 ? 205  LEU A CB  1 
ATOM   1494 C CG  . LEU A 1 204 ? 1.304   28.921 27.902 1.00 15.69 ? 205  LEU A CG  1 
ATOM   1495 C CD1 . LEU A 1 204 ? 0.477   29.430 26.720 1.00 14.96 ? 205  LEU A CD1 1 
ATOM   1496 C CD2 . LEU A 1 204 ? 0.548   29.150 29.208 1.00 17.00 ? 205  LEU A CD2 1 
ATOM   1497 N N   . ASN A 1 205 ? 1.484   24.433 28.290 1.00 14.32 ? 206  ASN A N   1 
ATOM   1498 C CA  . ASN A 1 205 ? 1.564   23.070 27.753 1.00 12.11 ? 206  ASN A CA  1 
ATOM   1499 C C   . ASN A 1 205 ? 2.737   22.274 28.374 1.00 13.67 ? 206  ASN A C   1 
ATOM   1500 O O   . ASN A 1 205 ? 3.540   21.662 27.656 1.00 12.44 ? 206  ASN A O   1 
ATOM   1501 C CB  . ASN A 1 205 ? 1.684   23.129 26.258 1.00 13.93 ? 206  ASN A CB  1 
ATOM   1502 C CG  . ASN A 1 205 ? 1.312   21.846 25.578 1.00 24.84 ? 206  ASN A CG  1 
ATOM   1503 O OD1 . ASN A 1 205 ? 0.772   20.924 26.174 1.00 19.42 ? 206  ASN A OD1 1 
ATOM   1504 N ND2 . ASN A 1 205 ? 1.549   21.788 24.289 1.00 39.24 ? 206  ASN A ND2 1 
ATOM   1505 N N   . ALA A 1 206 ? 2.851   22.337 29.710 1.00 12.93 ? 207  ALA A N   1 
ATOM   1506 C CA  . ALA A 1 206 ? 3.951   21.686 30.405 1.00 12.72 ? 207  ALA A CA  1 
ATOM   1507 C C   . ALA A 1 206 ? 3.932   20.187 30.186 1.00 13.56 ? 207  ALA A C   1 
ATOM   1508 O O   . ALA A 1 206 ? 2.871   19.573 30.173 1.00 14.85 ? 207  ALA A O   1 
ATOM   1509 C CB  . ALA A 1 206 ? 3.911   21.987 31.897 1.00 14.63 ? 207  ALA A CB  1 
ATOM   1510 N N   . PRO A 1 207 ? 5.104   19.564 29.982 1.00 10.67 ? 208  PRO A N   1 
ATOM   1511 C CA  . PRO A 1 207 ? 6.448   20.151 29.979 1.00 9.75  ? 208  PRO A CA  1 
ATOM   1512 C C   . PRO A 1 207 ? 6.982   20.557 28.596 1.00 11.31 ? 208  PRO A C   1 
ATOM   1513 O O   . PRO A 1 207 ? 8.160   20.895 28.482 1.00 11.12 ? 208  PRO A O   1 
ATOM   1514 C CB  . PRO A 1 207 ? 7.274   18.994 30.517 1.00 11.29 ? 208  PRO A CB  1 
ATOM   1515 C CG  . PRO A 1 207 ? 6.666   17.800 29.831 1.00 13.21 ? 208  PRO A CG  1 
ATOM   1516 C CD  . PRO A 1 207 ? 5.162   18.100 29.821 1.00 11.47 ? 208  PRO A CD  1 
ATOM   1517 N N   . TYR A 1 208 ? 6.120   20.532 27.549 1.00 9.64  ? 209  TYR A N   1 
ATOM   1518 C CA  . TYR A 1 208 ? 6.523   20.753 26.164 1.00 8.65  ? 209  TYR A CA  1 
ATOM   1519 C C   . TYR A 1 208 ? 6.727   22.209 25.820 1.00 10.94 ? 209  TYR A C   1 
ATOM   1520 O O   . TYR A 1 208 ? 7.473   22.516 24.892 1.00 10.10 ? 209  TYR A O   1 
ATOM   1521 C CB  . TYR A 1 208 ? 5.487   20.151 25.194 1.00 11.12 ? 209  TYR A CB  1 
ATOM   1522 C CG  . TYR A 1 208 ? 5.048   18.763 25.593 1.00 11.50 ? 209  TYR A CG  1 
ATOM   1523 C CD1 . TYR A 1 208 ? 5.951   17.704 25.608 1.00 12.56 ? 209  TYR A CD1 1 
ATOM   1524 C CD2 . TYR A 1 208 ? 3.761   18.532 26.082 1.00 13.33 ? 209  TYR A CD2 1 
ATOM   1525 C CE1 . TYR A 1 208 ? 5.580   16.446 26.062 1.00 12.83 ? 209  TYR A CE1 1 
ATOM   1526 C CE2 . TYR A 1 208 ? 3.366   17.263 26.514 1.00 14.86 ? 209  TYR A CE2 1 
ATOM   1527 C CZ  . TYR A 1 208 ? 4.290   16.232 26.526 1.00 15.47 ? 209  TYR A CZ  1 
ATOM   1528 O OH  . TYR A 1 208 ? 3.902   14.982 26.963 1.00 19.99 ? 209  TYR A OH  1 
ATOM   1529 N N   . GLY A 1 209 ? 6.023   23.091 26.506 1.00 10.20 ? 210  GLY A N   1 
ATOM   1530 C CA  . GLY A 1 209 ? 6.052   24.513 26.170 1.00 10.00 ? 210  GLY A CA  1 
ATOM   1531 C C   . GLY A 1 209 ? 5.005   24.823 25.113 1.00 10.58 ? 210  GLY A C   1 
ATOM   1532 O O   . GLY A 1 209 ? 4.510   23.918 24.428 1.00 10.85 ? 210  GLY A O   1 
ATOM   1533 N N   . VAL A 1 210 ? 4.675   26.115 24.945 1.00 9.16  ? 211  VAL A N   1 
ATOM   1534 C CA  . VAL A 1 210 ? 3.674   26.519 23.951 1.00 11.49 ? 211  VAL A CA  1 
ATOM   1535 C C   . VAL A 1 210 ? 4.107   26.052 22.553 1.00 11.73 ? 211  VAL A C   1 
ATOM   1536 O O   . VAL A 1 210 ? 5.267   26.250 22.155 1.00 10.57 ? 211  VAL A O   1 
ATOM   1537 C CB  . VAL A 1 210 ? 3.483   28.065 24.005 1.00 14.09 ? 211  VAL A CB  1 
ATOM   1538 C CG1 . VAL A 1 210 ? 4.771   28.840 23.716 1.00 13.75 ? 211  VAL A CG1 1 
ATOM   1539 C CG2 . VAL A 1 210 ? 2.341   28.523 23.082 1.00 15.04 ? 211  VAL A CG2 1 
ATOM   1540 N N   . CYS A 1 211 ? 3.200   25.357 21.855 1.00 11.68 ? 212  CYS A N   1 
ATOM   1541 C CA  . CYS A 1 211 ? 3.473   24.786 20.528 1.00 12.39 ? 212  CYS A CA  1 
ATOM   1542 C C   . CYS A 1 211 ? 4.694   23.891 20.524 1.00 12.54 ? 212  CYS A C   1 
ATOM   1543 O O   . CYS A 1 211 ? 5.283   23.688 19.476 1.00 12.84 ? 212  CYS A O   1 
ATOM   1544 C CB  . CYS A 1 211 ? 3.600   25.855 19.456 1.00 13.79 ? 212  CYS A CB  1 
ATOM   1545 S SG  . CYS A 1 211 ? 2.335   27.148 19.514 1.00 18.26 ? 212  CYS A SG  1 
ATOM   1546 N N   . GLY A 1 212 ? 5.066   23.347 21.672 1.00 9.95  ? 213  GLY A N   1 
ATOM   1547 C CA  . GLY A 1 212 ? 6.240   22.484 21.750 1.00 9.07  ? 213  GLY A CA  1 
ATOM   1548 C C   . GLY A 1 212 ? 7.595   23.172 21.778 1.00 10.26 ? 213  GLY A C   1 
ATOM   1549 O O   . GLY A 1 212 ? 8.615   22.496 21.573 1.00 10.26 ? 213  GLY A O   1 
ATOM   1550 N N   . ILE A 1 213 ? 7.664   24.483 22.076 1.00 9.17  ? 214  ILE A N   1 
ATOM   1551 C CA  . ILE A 1 213 ? 8.908   25.258 21.985 1.00 7.81  ? 214  ILE A CA  1 
ATOM   1552 C C   . ILE A 1 213 ? 10.040  24.694 22.839 1.00 8.61  ? 214  ILE A C   1 
ATOM   1553 O O   . ILE A 1 213 ? 11.205  24.946 22.508 1.00 9.52  ? 214  ILE A O   1 
ATOM   1554 C CB  . ILE A 1 213 ? 8.629   26.746 22.303 1.00 9.27  ? 214  ILE A CB  1 
ATOM   1555 C CG1 . ILE A 1 213 ? 9.778   27.613 21.785 1.00 9.39  ? 214  ILE A CG1 1 
ATOM   1556 C CG2 . ILE A 1 213 ? 8.310   26.983 23.801 1.00 11.40 ? 214  ILE A CG2 1 
ATOM   1557 C CD1 . ILE A 1 213 ? 9.462   29.111 21.871 1.00 11.00 ? 214  ILE A CD1 1 
ATOM   1558 N N   . ALA A 1 214 ? 9.720   23.993 23.962 1.00 9.62  ? 215  ALA A N   1 
ATOM   1559 C CA  . ALA A 1 214 ? 10.790  23.463 24.813 1.00 9.83  ? 215  ALA A CA  1 
ATOM   1560 C C   . ALA A 1 214 ? 11.138  22.005 24.490 1.00 12.13 ? 215  ALA A C   1 
ATOM   1561 O O   . ALA A 1 214 ? 11.889  21.372 25.263 1.00 11.59 ? 215  ALA A O   1 
ATOM   1562 C CB  . ALA A 1 214 ? 10.379  23.602 26.280 1.00 10.82 ? 215  ALA A CB  1 
ATOM   1563 N N   . MET A 1 215 ? 10.638  21.465 23.370 1.00 9.58  ? 216  MET A N   1 
ATOM   1564 C CA  . MET A 1 215 ? 10.859  20.060 23.064 1.00 9.00  ? 216  MET A CA  1 
ATOM   1565 C C   . MET A 1 215 ? 12.207  19.747 22.428 1.00 11.73 ? 216  MET A C   1 
ATOM   1566 O O   . MET A 1 215 ? 12.780  18.668 22.707 1.00 13.01 ? 216  MET A O   1 
ATOM   1567 C CB  . MET A 1 215 ? 9.742   19.535 22.154 1.00 9.89  ? 216  MET A CB  1 
ATOM   1568 C CG  . MET A 1 215 ? 8.426   19.482 22.873 1.00 10.45 ? 216  MET A CG  1 
ATOM   1569 S SD  . MET A 1 215 ? 7.037   18.921 21.856 1.00 13.85 ? 216  MET A SD  1 
ATOM   1570 C CE  . MET A 1 215 ? 7.375   17.201 21.806 1.00 14.98 ? 216  MET A CE  1 
ATOM   1571 N N   . GLN A 1 216 ? 12.680  20.583 21.480 1.00 10.55 ? 217  GLN A N   1 
ATOM   1572 C CA  . GLN A 1 216 ? 13.876  20.253 20.681 1.00 9.99  ? 217  GLN A CA  1 
ATOM   1573 C C   . GLN A 1 216 ? 14.662  21.518 20.445 1.00 12.56 ? 217  GLN A C   1 
ATOM   1574 O O   . GLN A 1 216 ? 14.422  22.227 19.460 1.00 12.98 ? 217  GLN A O   1 
ATOM   1575 C CB  . GLN A 1 216 ? 13.455  19.613 19.346 1.00 12.79 ? 217  GLN A CB  1 
ATOM   1576 C CG  . GLN A 1 216 ? 12.783  18.248 19.462 1.00 17.72 ? 217  GLN A CG  1 
ATOM   1577 C CD  . GLN A 1 216 ? 12.472  17.608 18.115 1.00 33.29 ? 217  GLN A CD  1 
ATOM   1578 O OE1 . GLN A 1 216 ? 12.880  18.079 17.053 1.00 28.69 ? 217  GLN A OE1 1 
ATOM   1579 N NE2 . GLN A 1 216 ? 11.767  16.490 18.136 1.00 27.51 ? 217  GLN A NE2 1 
ATOM   1580 N N   . ALA A 1 217 ? 15.514  21.857 21.402 1.00 9.52  ? 218  ALA A N   1 
ATOM   1581 C CA  . ALA A 1 217 ? 16.271  23.119 21.365 1.00 8.52  ? 218  ALA A CA  1 
ATOM   1582 C C   . ALA A 1 217 ? 17.768  22.872 21.392 1.00 9.99  ? 218  ALA A C   1 
ATOM   1583 O O   . ALA A 1 217 ? 18.240  21.923 22.020 1.00 11.05 ? 218  ALA A O   1 
ATOM   1584 C CB  . ALA A 1 217 ? 15.865  24.000 22.532 1.00 8.69  ? 218  ALA A CB  1 
ATOM   1585 N N   . SER A 1 218 ? 18.524  23.731 20.693 1.00 8.87  ? 219  SER A N   1 
ATOM   1586 C CA  . SER A 1 218 ? 19.966  23.561 20.631 1.00 8.79  ? 219  SER A CA  1 
ATOM   1587 C C   . SER A 1 218 ? 20.623  24.833 20.209 1.00 8.58  ? 219  SER A C   1 
ATOM   1588 O O   . SER A 1 218 ? 19.953  25.753 19.731 1.00 8.74  ? 219  SER A O   1 
ATOM   1589 C CB  . SER A 1 218 ? 20.356  22.437 19.675 1.00 11.42 ? 219  SER A CB  1 
ATOM   1590 O OG  . SER A 1 218 ? 19.915  22.737 18.366 1.00 12.13 ? 219  SER A OG  1 
ATOM   1591 N N   . TYR A 1 219 ? 21.952  24.880 20.366 1.00 7.70  ? 220  TYR A N   1 
ATOM   1592 C CA  . TYR A 1 219 ? 22.672  26.105 20.063 1.00 8.14  ? 220  TYR A CA  1 
ATOM   1593 C C   . TYR A 1 219 ? 24.113  25.790 19.776 1.00 10.41 ? 220  TYR A C   1 
ATOM   1594 O O   . TYR A 1 219 ? 24.670  24.837 20.329 1.00 10.16 ? 220  TYR A O   1 
ATOM   1595 C CB  . TYR A 1 219 ? 22.578  27.111 21.252 1.00 8.56  ? 220  TYR A CB  1 
ATOM   1596 C CG  . TYR A 1 219 ? 22.983  26.549 22.595 1.00 10.53 ? 220  TYR A CG  1 
ATOM   1597 C CD1 . TYR A 1 219 ? 22.071  25.851 23.377 1.00 10.32 ? 220  TYR A CD1 1 
ATOM   1598 C CD2 . TYR A 1 219 ? 24.253  26.772 23.112 1.00 13.70 ? 220  TYR A CD2 1 
ATOM   1599 C CE1 . TYR A 1 219 ? 22.413  25.362 24.636 1.00 13.78 ? 220  TYR A CE1 1 
ATOM   1600 C CE2 . TYR A 1 219 ? 24.611  26.295 24.377 1.00 15.54 ? 220  TYR A CE2 1 
ATOM   1601 C CZ  . TYR A 1 219 ? 23.678  25.604 25.142 1.00 15.97 ? 220  TYR A CZ  1 
ATOM   1602 O OH  . TYR A 1 219 ? 24.005  25.064 26.379 1.00 21.06 ? 220  TYR A OH  1 
ATOM   1603 N N   . PRO A 1 220 ? 24.748  26.618 18.940 1.00 8.24  ? 221  PRO A N   1 
ATOM   1604 C CA  . PRO A 1 220 ? 26.125  26.330 18.533 1.00 8.41  ? 221  PRO A CA  1 
ATOM   1605 C C   . PRO A 1 220 ? 27.151  26.900 19.482 1.00 11.97 ? 221  PRO A C   1 
ATOM   1606 O O   . PRO A 1 220 ? 26.883  27.917 20.136 1.00 12.25 ? 221  PRO A O   1 
ATOM   1607 C CB  . PRO A 1 220 ? 26.222  26.995 17.158 1.00 10.16 ? 221  PRO A CB  1 
ATOM   1608 C CG  . PRO A 1 220 ? 25.289  28.196 17.303 1.00 9.88  ? 221  PRO A CG  1 
ATOM   1609 C CD  . PRO A 1 220 ? 24.150  27.725 18.156 1.00 8.37  ? 221  PRO A CD  1 
ATOM   1610 N N   . THR A 1 221 ? 28.344  26.270 19.518 1.00 13.12 ? 222  THR A N   1 
ATOM   1611 C CA  . THR A 1 221 ? 29.502  26.697 20.283 1.00 14.04 ? 222  THR A CA  1 
ATOM   1612 C C   . THR A 1 221 ? 30.442  27.446 19.330 1.00 17.48 ? 222  THR A C   1 
ATOM   1613 O O   . THR A 1 221 ? 31.028  26.830 18.462 1.00 18.12 ? 222  THR A O   1 
ATOM   1614 C CB  . THR A 1 221 ? 30.191  25.444 20.896 1.00 17.18 ? 222  THR A CB  1 
ATOM   1615 O OG1 . THR A 1 221 ? 29.233  24.732 21.680 1.00 24.17 ? 222  THR A OG1 1 
ATOM   1616 C CG2 . THR A 1 221 ? 31.419  25.807 21.742 1.00 26.56 ? 222  THR A CG2 1 
ATOM   1617 N N   . ALA A 1 222 ? 30.556  28.771 19.456 1.00 19.48 ? 223  ALA A N   1 
ATOM   1618 C CA  . ALA A 1 222 ? 31.430  29.553 18.559 1.00 20.88 ? 223  ALA A CA  1 
ATOM   1619 C C   . ALA A 1 222 ? 32.909  29.324 18.862 1.00 29.15 ? 223  ALA A C   1 
ATOM   1620 O O   . ALA A 1 222 ? 33.752  29.569 17.962 1.00 34.50 ? 223  ALA A O   1 
ATOM   1621 C CB  . ALA A 1 222 ? 31.099  31.028 18.668 1.00 21.43 ? 223  ALA A CB  1 
ATOM   1622 O OXT . ALA A 1 222 ? 33.233  28.908 19.994 1.00 31.16 ? 223  ALA A OXT 1 
HETATM 1623 C C1  . E64 B 2 .   ? 10.086  24.946 7.400  1.00 24.13 ? 1224 E64 A C1  1 
HETATM 1624 O O1  . E64 B 2 .   ? 9.072   25.554 7.804  1.00 26.66 ? 1224 E64 A O1  1 
HETATM 1625 O O2  . E64 B 2 .   ? 10.664  25.232 6.325  1.00 24.57 ? 1224 E64 A O2  1 
HETATM 1626 C C2  . E64 B 2 .   ? 10.619  23.833 8.272  1.00 21.45 ? 1224 E64 A C2  1 
HETATM 1627 C C3  . E64 B 2 .   ? 11.121  22.628 7.467  1.00 23.52 ? 1224 E64 A C3  1 
HETATM 1628 O O3  . E64 B 2 .   ? 10.008  22.103 6.729  1.00 24.81 ? 1224 E64 A O3  1 
HETATM 1629 C C4  . E64 B 2 .   ? 11.810  21.612 8.362  1.00 24.95 ? 1224 E64 A C4  1 
HETATM 1630 O O4  . E64 B 2 .   ? 13.031  21.484 8.311  1.00 26.24 ? 1224 E64 A O4  1 
HETATM 1631 N N1  . E64 B 2 .   ? 11.040  21.020 9.281  1.00 30.01 ? 1224 E64 A N1  1 
HETATM 1632 C C6  . E64 B 2 .   ? 10.928  19.657 9.826  1.00 37.24 ? 1224 E64 A C6  1 
HETATM 1633 C C7  . E64 B 2 .   ? 11.416  19.582 11.278 1.00 33.93 ? 1224 E64 A C7  1 
HETATM 1634 C C8  . E64 B 2 .   ? 11.434  20.858 12.102 1.00 28.87 ? 1224 E64 A C8  1 
HETATM 1635 C C9  . E64 B 2 .   ? 10.615  20.629 13.377 1.00 29.37 ? 1224 E64 A C9  1 
HETATM 1636 C C10 . E64 B 2 .   ? 12.885  21.171 12.451 1.00 25.24 ? 1224 E64 A C10 1 
HETATM 1637 C C11 . E64 B 2 .   ? 11.572  18.594 8.985  1.00 42.60 ? 1224 E64 A C11 1 
HETATM 1638 O O5  . E64 B 2 .   ? 10.892  18.040 8.137  1.00 46.22 ? 1224 E64 A O5  1 
HETATM 1639 N N2  . E64 B 2 .   ? 12.834  18.237 9.225  1.00 43.40 ? 1224 E64 A N2  1 
HETATM 1640 C C12 . E64 B 2 .   ? 13.180  16.861 9.566  1.00 43.68 ? 1224 E64 A C12 1 
HETATM 1641 P P   . PO4 C 3 .   ? 10.616  35.568 33.047 0.49 29.82 ? 1225 PO4 A P   1 
HETATM 1642 O O1  . PO4 C 3 .   ? 10.517  35.834 31.543 0.49 25.96 ? 1225 PO4 A O1  1 
HETATM 1643 O O2  . PO4 C 3 .   ? 9.985   36.834 33.792 0.49 32.57 ? 1225 PO4 A O2  1 
HETATM 1644 O O3  . PO4 C 3 .   ? 9.808   34.255 33.473 0.49 31.57 ? 1225 PO4 A O3  1 
HETATM 1645 O O4  . PO4 C 3 .   ? 12.137  35.436 33.520 0.49 27.65 ? 1225 PO4 A O4  1 
HETATM 1646 O O   . HOH D 4 .   ? 15.060  35.224 37.224 1.00 40.57 ? 2001 HOH A O   1 
HETATM 1647 O O   . HOH D 4 .   ? 16.734  39.238 37.226 1.00 27.52 ? 2002 HOH A O   1 
HETATM 1648 O O   . HOH D 4 .   ? 10.824  39.531 32.071 1.00 24.89 ? 2003 HOH A O   1 
HETATM 1649 O O   . HOH D 4 .   ? 14.174  45.978 19.391 1.00 36.71 ? 2004 HOH A O   1 
HETATM 1650 O O   . HOH D 4 .   ? 11.973  45.525 26.041 1.00 23.12 ? 2005 HOH A O   1 
HETATM 1651 O O   . HOH D 4 .   ? 12.924  41.422 27.553 1.00 13.06 ? 2006 HOH A O   1 
HETATM 1652 O O   . HOH D 4 .   ? 22.322  45.339 16.061 1.00 28.03 ? 2007 HOH A O   1 
HETATM 1653 O O   . HOH D 4 .   ? 17.110  44.477 13.431 1.00 54.38 ? 2008 HOH A O   1 
HETATM 1654 O O   . HOH D 4 .   ? 13.780  45.247 21.941 1.00 32.87 ? 2009 HOH A O   1 
HETATM 1655 O O   . HOH D 4 .   ? 12.499  42.971 25.322 1.00 12.35 ? 2010 HOH A O   1 
HETATM 1656 O O   . HOH D 4 .   ? 15.246  45.483 24.494 1.00 22.14 ? 2011 HOH A O   1 
HETATM 1657 O O   . HOH D 4 .   ? 26.015  41.302 24.583 1.00 17.50 ? 2012 HOH A O   1 
HETATM 1658 O O   . HOH D 4 .   ? 24.881  45.964 15.406 1.00 39.73 ? 2013 HOH A O   1 
HETATM 1659 O O   . HOH D 4 .   ? 26.832  45.606 19.785 1.00 38.86 ? 2014 HOH A O   1 
HETATM 1660 O O   . HOH D 4 .   ? 16.293  44.409 6.266  1.00 36.78 ? 2015 HOH A O   1 
HETATM 1661 O O   . HOH D 4 .   ? 15.882  45.392 11.181 1.00 32.07 ? 2016 HOH A O   1 
HETATM 1662 O O   . HOH D 4 .   ? 21.142  42.988 17.041 1.00 12.60 ? 2017 HOH A O   1 
HETATM 1663 O O   . HOH D 4 .   ? 17.443  46.049 18.033 1.00 41.91 ? 2018 HOH A O   1 
HETATM 1664 O O   . HOH D 4 .   ? 21.439  47.038 18.247 1.00 43.18 ? 2019 HOH A O   1 
HETATM 1665 O O   . HOH D 4 .   ? 18.196  44.424 15.975 1.00 55.34 ? 2020 HOH A O   1 
HETATM 1666 O O   . HOH D 4 .   ? 9.040   42.332 19.123 1.00 31.39 ? 2021 HOH A O   1 
HETATM 1667 O O   . HOH D 4 .   ? 9.643   42.630 21.864 1.00 40.77 ? 2022 HOH A O   1 
HETATM 1668 O O   . HOH D 4 .   ? 15.804  33.584 10.765 1.00 16.77 ? 2023 HOH A O   1 
HETATM 1669 O O   . HOH D 4 .   ? 18.003  38.288 3.762  1.00 44.86 ? 2024 HOH A O   1 
HETATM 1670 O O   . HOH D 4 .   ? 5.246   29.056 4.892  1.00 84.51 ? 2025 HOH A O   1 
HETATM 1671 O O   . HOH D 4 .   ? 5.126   29.581 1.904  1.00 53.95 ? 2026 HOH A O   1 
HETATM 1672 O O   . HOH D 4 .   ? 25.384  40.930 22.094 1.00 16.85 ? 2027 HOH A O   1 
HETATM 1673 O O   . HOH D 4 .   ? 25.107  44.581 24.885 1.00 31.84 ? 2028 HOH A O   1 
HETATM 1674 O O   . HOH D 4 .   ? 26.234  44.404 17.166 1.00 22.41 ? 2029 HOH A O   1 
HETATM 1675 O O   . HOH D 4 .   ? 20.863  35.918 16.295 1.00 10.33 ? 2030 HOH A O   1 
HETATM 1676 O O   . HOH D 4 .   ? 19.782  43.935 13.257 1.00 29.42 ? 2031 HOH A O   1 
HETATM 1677 O O   A HOH D 4 .   ? 16.009  41.315 13.748 0.50 10.56 ? 2032 HOH A O   1 
HETATM 1678 O O   B HOH D 4 .   ? 16.920  42.242 14.972 0.50 28.50 ? 2032 HOH A O   1 
HETATM 1679 O O   . HOH D 4 .   ? 20.283  36.797 13.785 1.00 9.84  ? 2033 HOH A O   1 
HETATM 1680 O O   . HOH D 4 .   ? 19.067  35.340 10.657 1.00 15.76 ? 2034 HOH A O   1 
HETATM 1681 O O   . HOH D 4 .   ? 19.650  39.461 8.131  1.00 23.60 ? 2035 HOH A O   1 
HETATM 1682 O O   . HOH D 4 .   ? 31.579  33.317 23.459 1.00 38.78 ? 2036 HOH A O   1 
HETATM 1683 O O   . HOH D 4 .   ? 14.532  42.657 7.369  1.00 25.30 ? 2037 HOH A O   1 
HETATM 1684 O O   A HOH D 4 .   ? 14.164  43.087 10.303 0.50 12.54 ? 2038 HOH A O   1 
HETATM 1685 O O   B HOH D 4 .   ? 14.558  43.036 11.482 0.50 18.88 ? 2038 HOH A O   1 
HETATM 1686 O O   . HOH D 4 .   ? 27.821  39.282 25.287 1.00 22.20 ? 2039 HOH A O   1 
HETATM 1687 O O   . HOH D 4 .   ? 14.505  35.832 10.131 1.00 13.11 ? 2040 HOH A O   1 
HETATM 1688 O O   . HOH D 4 .   ? 15.594  37.115 3.304  1.00 30.10 ? 2041 HOH A O   1 
HETATM 1689 O O   . HOH D 4 .   ? 13.914  35.965 0.615  1.00 31.92 ? 2042 HOH A O   1 
HETATM 1690 O O   . HOH D 4 .   ? 7.277   33.406 3.988  1.00 35.37 ? 2043 HOH A O   1 
HETATM 1691 O O   . HOH D 4 .   ? 6.881   35.817 1.836  1.00 55.58 ? 2044 HOH A O   1 
HETATM 1692 O O   . HOH D 4 .   ? 23.195  43.069 11.003 1.00 32.63 ? 2045 HOH A O   1 
HETATM 1693 O O   . HOH D 4 .   ? 32.772  39.246 6.777  1.00 45.35 ? 2046 HOH A O   1 
HETATM 1694 O O   . HOH D 4 .   ? 34.430  40.208 10.205 1.00 39.31 ? 2047 HOH A O   1 
HETATM 1695 O O   . HOH D 4 .   ? 33.276  42.489 9.239  1.00 48.79 ? 2048 HOH A O   1 
HETATM 1696 O O   . HOH D 4 .   ? 8.352   27.247 3.304  1.00 48.79 ? 2049 HOH A O   1 
HETATM 1697 O O   A HOH D 4 .   ? 6.402   26.425 6.347  0.50 8.12  ? 2050 HOH A O   1 
HETATM 1698 O O   B HOH D 4 .   ? 7.856   27.528 6.370  0.50 22.97 ? 2050 HOH A O   1 
HETATM 1699 O O   . HOH D 4 .   ? 21.303  43.744 6.482  1.00 45.44 ? 2051 HOH A O   1 
HETATM 1700 O O   . HOH D 4 .   ? 7.310   30.697 4.138  1.00 40.26 ? 2052 HOH A O   1 
HETATM 1701 O O   . HOH D 4 .   ? 14.286  35.565 -2.549 1.00 48.01 ? 2053 HOH A O   1 
HETATM 1702 O O   . HOH D 4 .   ? 21.003  18.961 -3.427 1.00 77.54 ? 2054 HOH A O   1 
HETATM 1703 O O   . HOH D 4 .   ? 15.219  12.431 6.480  1.00 62.15 ? 2055 HOH A O   1 
HETATM 1704 O O   . HOH D 4 .   ? 10.071  22.867 -0.223 1.00 41.18 ? 2056 HOH A O   1 
HETATM 1705 O O   . HOH D 4 .   ? 10.650  20.578 4.645  1.00 32.41 ? 2057 HOH A O   1 
HETATM 1706 O O   . HOH D 4 .   ? 18.029  19.357 -5.275 1.00 58.88 ? 2058 HOH A O   1 
HETATM 1707 O O   . HOH D 4 .   ? 23.502  13.454 19.598 1.00 31.98 ? 2059 HOH A O   1 
HETATM 1708 O O   . HOH D 4 .   ? 18.322  33.040 9.582  1.00 15.56 ? 2060 HOH A O   1 
HETATM 1709 O O   . HOH D 4 .   ? 32.714  22.836 0.094  1.00 43.64 ? 2061 HOH A O   1 
HETATM 1710 O O   . HOH D 4 .   ? 31.071  41.023 5.698  1.00 38.72 ? 2062 HOH A O   1 
HETATM 1711 O O   . HOH D 4 .   ? 23.540  31.344 19.602 1.00 10.70 ? 2063 HOH A O   1 
HETATM 1712 O O   . HOH D 4 .   ? 24.972  36.910 -6.030 1.00 69.65 ? 2064 HOH A O   1 
HETATM 1713 O O   . HOH D 4 .   ? 27.618  37.572 13.678 1.00 13.63 ? 2065 HOH A O   1 
HETATM 1714 O O   . HOH D 4 .   ? 23.533  33.831 -6.375 1.00 33.24 ? 2066 HOH A O   1 
HETATM 1715 O O   . HOH D 4 .   ? 29.441  32.723 21.813 1.00 18.78 ? 2067 HOH A O   1 
HETATM 1716 O O   A HOH D 4 .   ? 33.523  32.936 14.050 0.50 18.07 ? 2068 HOH A O   1 
HETATM 1717 O O   B HOH D 4 .   ? 32.180  32.398 14.362 0.50 16.60 ? 2068 HOH A O   1 
HETATM 1718 O O   A HOH D 4 .   ? 30.095  41.006 21.708 0.50 16.26 ? 2069 HOH A O   1 
HETATM 1719 O O   B HOH D 4 .   ? 30.163  39.629 23.994 0.50 20.82 ? 2069 HOH A O   1 
HETATM 1720 O O   . HOH D 4 .   ? 28.197  42.905 21.311 1.00 21.59 ? 2070 HOH A O   1 
HETATM 1721 O O   . HOH D 4 .   ? 36.810  41.279 19.551 1.00 25.35 ? 2071 HOH A O   1 
HETATM 1722 O O   . HOH D 4 .   ? 33.069  37.620 13.404 1.00 23.54 ? 2072 HOH A O   1 
HETATM 1723 O O   . HOH D 4 .   ? 33.056  40.741 22.068 1.00 39.13 ? 2073 HOH A O   1 
HETATM 1724 O O   . HOH D 4 .   ? 32.393  44.536 13.816 1.00 28.76 ? 2074 HOH A O   1 
HETATM 1725 O O   . HOH D 4 .   ? 23.184  21.420 28.835 1.00 30.11 ? 2075 HOH A O   1 
HETATM 1726 O O   . HOH D 4 .   ? 29.517  44.315 13.752 1.00 25.36 ? 2076 HOH A O   1 
HETATM 1727 O O   . HOH D 4 .   ? 25.815  44.072 10.886 1.00 39.47 ? 2077 HOH A O   1 
HETATM 1728 O O   . HOH D 4 .   ? 29.373  44.931 11.119 1.00 41.54 ? 2078 HOH A O   1 
HETATM 1729 O O   . HOH D 4 .   ? 29.545  42.899 9.306  1.00 33.88 ? 2079 HOH A O   1 
HETATM 1730 O O   . HOH D 4 .   ? 28.604  36.295 11.570 1.00 20.02 ? 2080 HOH A O   1 
HETATM 1731 O O   . HOH D 4 .   ? 32.057  39.153 9.376  1.00 27.84 ? 2081 HOH A O   1 
HETATM 1732 O O   . HOH D 4 .   ? 12.859  15.840 31.516 1.00 11.92 ? 2082 HOH A O   1 
HETATM 1733 O O   . HOH D 4 .   ? 6.974   23.393 31.750 1.00 25.58 ? 2083 HOH A O   1 
HETATM 1734 O O   . HOH D 4 .   ? 9.338   14.453 22.179 1.00 22.59 ? 2084 HOH A O   1 
HETATM 1735 O O   . HOH D 4 .   ? 11.928  14.015 24.032 1.00 29.32 ? 2085 HOH A O   1 
HETATM 1736 O O   . HOH D 4 .   ? 7.290   13.701 30.413 1.00 18.21 ? 2086 HOH A O   1 
HETATM 1737 O O   . HOH D 4 .   ? 9.760   25.125 34.695 1.00 53.79 ? 2087 HOH A O   1 
HETATM 1738 O O   . HOH D 4 .   ? 25.571  41.566 7.606  1.00 23.77 ? 2088 HOH A O   1 
HETATM 1739 O O   . HOH D 4 .   ? 26.295  39.314 4.754  1.00 15.50 ? 2089 HOH A O   1 
HETATM 1740 O O   A HOH D 4 .   ? 23.802  40.740 4.140  0.50 17.48 ? 2090 HOH A O   1 
HETATM 1741 O O   B HOH D 4 .   ? 21.537  39.870 4.705  0.50 30.79 ? 2090 HOH A O   1 
HETATM 1742 O O   . HOH D 4 .   ? 22.931  42.288 8.238  1.00 33.56 ? 2091 HOH A O   1 
HETATM 1743 O O   . HOH D 4 .   ? 11.425  27.890 34.601 1.00 41.16 ? 2092 HOH A O   1 
HETATM 1744 O O   . HOH D 4 .   ? 22.558  33.377 33.037 1.00 35.01 ? 2093 HOH A O   1 
HETATM 1745 O O   . HOH D 4 .   ? 26.105  29.768 31.799 1.00 57.53 ? 2094 HOH A O   1 
HETATM 1746 O O   . HOH D 4 .   ? 21.822  32.672 1.841  1.00 15.70 ? 2095 HOH A O   1 
HETATM 1747 O O   . HOH D 4 .   ? 24.306  34.680 31.410 1.00 52.75 ? 2096 HOH A O   1 
HETATM 1748 O O   . HOH D 4 .   ? 18.381  34.774 3.617  1.00 51.18 ? 2097 HOH A O   1 
HETATM 1749 O O   . HOH D 4 .   ? 28.849  33.341 26.182 1.00 32.67 ? 2098 HOH A O   1 
HETATM 1750 O O   . HOH D 4 .   ? 26.364  34.413 29.632 1.00 33.06 ? 2099 HOH A O   1 
HETATM 1751 O O   . HOH D 4 .   ? 28.535  30.862 27.293 1.00 46.72 ? 2100 HOH A O   1 
HETATM 1752 O O   A HOH D 4 .   ? 22.081  28.118 -5.129 0.50 25.15 ? 2101 HOH A O   1 
HETATM 1753 O O   B HOH D 4 .   ? 23.833  29.955 -5.686 0.50 22.98 ? 2101 HOH A O   1 
HETATM 1754 O O   . HOH D 4 .   ? 32.314  28.352 4.259  1.00 17.24 ? 2102 HOH A O   1 
HETATM 1755 O O   . HOH D 4 .   ? 20.654  20.483 2.606  1.00 21.48 ? 2103 HOH A O   1 
HETATM 1756 O O   . HOH D 4 .   ? -2.857  35.088 18.975 1.00 32.05 ? 2104 HOH A O   1 
HETATM 1757 O O   . HOH D 4 .   ? 20.238  20.891 -1.667 1.00 28.73 ? 2105 HOH A O   1 
HETATM 1758 O O   . HOH D 4 .   ? 3.849   33.431 5.696  1.00 54.80 ? 2106 HOH A O   1 
HETATM 1759 O O   . HOH D 4 .   ? 22.539  21.181 -3.812 1.00 40.55 ? 2107 HOH A O   1 
HETATM 1760 O O   . HOH D 4 .   ? 29.557  20.125 1.037  1.00 35.87 ? 2108 HOH A O   1 
HETATM 1761 O O   . HOH D 4 .   ? 22.684  16.537 4.957  1.00 22.40 ? 2109 HOH A O   1 
HETATM 1762 O O   . HOH D 4 .   ? 26.535  17.290 4.822  1.00 27.84 ? 2110 HOH A O   1 
HETATM 1763 O O   . HOH D 4 .   ? 24.648  17.617 8.426  1.00 19.75 ? 2111 HOH A O   1 
HETATM 1764 O O   . HOH D 4 .   ? -6.886  33.460 21.961 1.00 43.60 ? 2112 HOH A O   1 
HETATM 1765 O O   . HOH D 4 .   ? -8.183  31.305 18.422 1.00 44.15 ? 2113 HOH A O   1 
HETATM 1766 O O   . HOH D 4 .   ? -5.885  35.477 19.894 1.00 41.00 ? 2114 HOH A O   1 
HETATM 1767 O O   . HOH D 4 .   ? 23.217  15.465 9.314  1.00 32.31 ? 2115 HOH A O   1 
HETATM 1768 O O   . HOH D 4 .   ? 14.884  15.342 6.721  1.00 73.45 ? 2116 HOH A O   1 
HETATM 1769 O O   . HOH D 4 .   ? 21.666  15.364 11.535 1.00 36.24 ? 2117 HOH A O   1 
HETATM 1770 O O   . HOH D 4 .   ? 19.231  16.600 10.659 1.00 25.56 ? 2118 HOH A O   1 
HETATM 1771 O O   . HOH D 4 .   ? 16.202  20.289 -1.892 1.00 41.55 ? 2119 HOH A O   1 
HETATM 1772 O O   . HOH D 4 .   ? 19.908  13.260 -0.183 1.00 44.16 ? 2120 HOH A O   1 
HETATM 1773 O O   . HOH D 4 .   ? 9.817   19.773 0.073  1.00 37.00 ? 2121 HOH A O   1 
HETATM 1774 O O   . HOH D 4 .   ? 9.756   18.237 5.699  1.00 53.86 ? 2122 HOH A O   1 
HETATM 1775 O O   . HOH D 4 .   ? 11.213  19.919 -3.019 1.00 45.54 ? 2123 HOH A O   1 
HETATM 1776 O O   . HOH D 4 .   ? 16.498  15.464 -0.968 1.00 41.81 ? 2124 HOH A O   1 
HETATM 1777 O O   . HOH D 4 .   ? 19.346  16.275 14.345 1.00 33.34 ? 2125 HOH A O   1 
HETATM 1778 O O   . HOH D 4 .   ? 18.181  19.874 15.886 1.00 18.63 ? 2126 HOH A O   1 
HETATM 1779 O O   . HOH D 4 .   ? 19.539  15.569 18.333 1.00 39.93 ? 2127 HOH A O   1 
HETATM 1780 O O   . HOH D 4 .   ? 18.073  17.191 16.517 1.00 35.67 ? 2128 HOH A O   1 
HETATM 1781 O O   . HOH D 4 .   ? 22.367  15.812 18.814 1.00 22.43 ? 2129 HOH A O   1 
HETATM 1782 O O   . HOH D 4 .   ? -1.227  18.246 28.887 0.50 55.85 ? 2130 HOH A O   1 
HETATM 1783 O O   . HOH D 4 .   ? 29.655  18.818 16.320 1.00 31.71 ? 2131 HOH A O   1 
HETATM 1784 O O   . HOH D 4 .   ? 30.615  22.483 1.815  1.00 21.06 ? 2132 HOH A O   1 
HETATM 1785 O O   . HOH D 4 .   ? 32.942  25.833 11.646 1.00 16.95 ? 2133 HOH A O   1 
HETATM 1786 O O   . HOH D 4 .   ? 13.367  14.247 21.149 1.00 41.96 ? 2134 HOH A O   1 
HETATM 1787 O O   . HOH D 4 .   ? 13.609  15.117 12.739 1.00 52.27 ? 2135 HOH A O   1 
HETATM 1788 O O   A HOH D 4 .   ? 10.758  12.386 19.947 0.50 10.15 ? 2136 HOH A O   1 
HETATM 1789 O O   B HOH D 4 .   ? -13.218 12.386 37.791 0.50 23.63 ? 2136 HOH A O   1 
HETATM 1790 O O   . HOH D 4 .   ? 7.933   12.960 20.369 1.00 64.45 ? 2137 HOH A O   1 
HETATM 1791 O O   . HOH D 4 .   ? 35.647  26.434 5.249  1.00 30.54 ? 2138 HOH A O   1 
HETATM 1792 O O   . HOH D 4 .   ? 35.805  23.088 4.100  1.00 35.36 ? 2139 HOH A O   1 
HETATM 1793 O O   . HOH D 4 .   ? 32.399  20.579 4.001  1.00 39.81 ? 2140 HOH A O   1 
HETATM 1794 O O   . HOH D 4 .   ? 34.444  24.304 1.612  1.00 29.05 ? 2141 HOH A O   1 
HETATM 1795 O O   . HOH D 4 .   ? 34.378  26.735 2.842  1.00 18.52 ? 2142 HOH A O   1 
HETATM 1796 O O   . HOH D 4 .   ? 36.382  29.623 8.842  1.00 43.00 ? 2143 HOH A O   1 
HETATM 1797 O O   . HOH D 4 .   ? 41.776  21.534 8.357  1.00 56.87 ? 2144 HOH A O   1 
HETATM 1798 O O   . HOH D 4 .   ? 31.620  34.709 2.491  1.00 13.28 ? 2145 HOH A O   1 
HETATM 1799 O O   . HOH D 4 .   ? 30.715  39.555 2.591  1.00 25.64 ? 2146 HOH A O   1 
HETATM 1800 O O   . HOH D 4 .   ? 22.586  38.492 -0.241 1.00 31.73 ? 2147 HOH A O   1 
HETATM 1801 O O   . HOH D 4 .   ? 20.053  36.590 0.445  1.00 28.87 ? 2148 HOH A O   1 
HETATM 1802 O O   . HOH D 4 .   ? 27.301  40.972 -2.908 1.00 34.68 ? 2149 HOH A O   1 
HETATM 1803 O O   . HOH D 4 .   ? 26.587  38.507 -4.299 1.00 44.81 ? 2150 HOH A O   1 
HETATM 1804 O O   . HOH D 4 .   ? 28.570  40.941 4.687  1.00 28.51 ? 2151 HOH A O   1 
HETATM 1805 O O   . HOH D 4 .   ? 28.756  36.919 -4.694 1.00 33.46 ? 2152 HOH A O   1 
HETATM 1806 O O   . HOH D 4 .   ? 33.101  38.364 2.404  1.00 32.71 ? 2153 HOH A O   1 
HETATM 1807 O O   . HOH D 4 .   ? 34.545  36.206 -0.272 1.00 17.40 ? 2154 HOH A O   1 
HETATM 1808 O O   . HOH D 4 .   ? 23.848  32.272 -4.153 1.00 25.16 ? 2155 HOH A O   1 
HETATM 1809 O O   . HOH D 4 .   ? 15.140  33.032 -3.077 1.00 31.31 ? 2156 HOH A O   1 
HETATM 1810 O O   . HOH D 4 .   ? 14.190  28.561 -6.091 1.00 33.06 ? 2157 HOH A O   1 
HETATM 1811 O O   . HOH D 4 .   ? 10.309  22.831 -2.920 1.00 38.64 ? 2158 HOH A O   1 
HETATM 1812 O O   . HOH D 4 .   ? 16.125  22.224 -7.722 1.00 39.91 ? 2159 HOH A O   1 
HETATM 1813 O O   . HOH D 4 .   ? 20.145  22.248 -8.732 1.00 46.88 ? 2160 HOH A O   1 
HETATM 1814 O O   . HOH D 4 .   ? 25.346  27.527 -6.829 1.00 38.35 ? 2161 HOH A O   1 
HETATM 1815 O O   . HOH D 4 .   ? 32.396  24.539 -2.722 1.00 32.12 ? 2162 HOH A O   1 
HETATM 1816 O O   . HOH D 4 .   ? 38.301  28.671 -1.335 1.00 17.72 ? 2163 HOH A O   1 
HETATM 1817 O O   . HOH D 4 .   ? 32.723  26.565 -5.235 1.00 32.91 ? 2164 HOH A O   1 
HETATM 1818 O O   . HOH D 4 .   ? 35.707  27.180 -5.916 1.00 41.08 ? 2165 HOH A O   1 
HETATM 1819 O O   . HOH D 4 .   ? 33.793  33.932 -6.160 1.00 30.80 ? 2166 HOH A O   1 
HETATM 1820 O O   . HOH D 4 .   ? 35.085  29.998 -7.283 1.00 28.14 ? 2167 HOH A O   1 
HETATM 1821 O O   . HOH D 4 .   ? 26.656  32.120 -5.012 1.00 42.32 ? 2168 HOH A O   1 
HETATM 1822 O O   . HOH D 4 .   ? 34.049  36.824 4.462  1.00 20.37 ? 2169 HOH A O   1 
HETATM 1823 O O   . HOH D 4 .   ? 37.635  34.832 7.731  1.00 43.79 ? 2170 HOH A O   1 
HETATM 1824 O O   . HOH D 4 .   ? 35.217  37.618 6.756  1.00 38.85 ? 2171 HOH A O   1 
HETATM 1825 O O   . HOH D 4 .   ? 37.926  32.466 6.474  1.00 38.10 ? 2172 HOH A O   1 
HETATM 1826 O O   . HOH D 4 .   ? 31.398  37.106 11.223 1.00 24.58 ? 2173 HOH A O   1 
HETATM 1827 O O   . HOH D 4 .   ? 35.057  37.281 9.462  1.00 36.00 ? 2174 HOH A O   1 
HETATM 1828 O O   . HOH D 4 .   ? 34.083  35.233 12.761 1.00 29.28 ? 2175 HOH A O   1 
HETATM 1829 O O   . HOH D 4 .   ? 35.106  28.616 15.783 1.00 33.25 ? 2176 HOH A O   1 
HETATM 1830 O O   . HOH D 4 .   ? 36.396  31.249 11.082 1.00 43.69 ? 2177 HOH A O   1 
HETATM 1831 O O   . HOH D 4 .   ? 36.812  31.712 13.728 1.00 42.30 ? 2178 HOH A O   1 
HETATM 1832 O O   . HOH D 4 .   ? 33.401  22.536 21.080 1.00 33.90 ? 2179 HOH A O   1 
HETATM 1833 O O   . HOH D 4 .   ? 29.269  19.263 19.312 1.00 26.31 ? 2180 HOH A O   1 
HETATM 1834 O O   . HOH D 4 .   ? 30.139  21.993 21.685 1.00 31.19 ? 2181 HOH A O   1 
HETATM 1835 O O   A HOH D 4 .   ? 28.879  19.636 22.250 0.50 22.95 ? 2182 HOH A O   1 
HETATM 1836 O O   B HOH D 4 .   ? 27.544  19.380 23.552 0.50 31.45 ? 2182 HOH A O   1 
HETATM 1837 O O   . HOH D 4 .   ? 26.321  21.853 28.937 1.00 43.31 ? 2183 HOH A O   1 
HETATM 1838 O O   . HOH D 4 .   ? 25.687  20.386 26.117 1.00 48.72 ? 2184 HOH A O   1 
HETATM 1839 O O   . HOH D 4 .   ? 24.902  18.663 24.019 1.00 27.85 ? 2185 HOH A O   1 
HETATM 1840 O O   . HOH D 4 .   ? 17.776  19.448 20.897 1.00 28.91 ? 2186 HOH A O   1 
HETATM 1841 O O   . HOH D 4 .   ? 24.517  16.865 22.078 1.00 32.09 ? 2187 HOH A O   1 
HETATM 1842 O O   . HOH D 4 .   ? 15.606  20.389 23.773 1.00 12.99 ? 2188 HOH A O   1 
HETATM 1843 O O   . HOH D 4 .   ? 17.759  17.224 23.977 1.00 14.21 ? 2189 HOH A O   1 
HETATM 1844 O O   . HOH D 4 .   ? 14.445  22.184 25.615 1.00 17.54 ? 2190 HOH A O   1 
HETATM 1845 O O   . HOH D 4 .   ? 14.833  17.567 30.707 1.00 9.62  ? 2191 HOH A O   1 
HETATM 1846 O O   . HOH D 4 .   ? 9.138   22.324 30.643 1.00 16.61 ? 2192 HOH A O   1 
HETATM 1847 O O   . HOH D 4 .   ? 10.384  17.007 31.148 1.00 10.79 ? 2193 HOH A O   1 
HETATM 1848 O O   . HOH D 4 .   ? 11.118  16.539 23.381 1.00 17.57 ? 2194 HOH A O   1 
HETATM 1849 O O   . HOH D 4 .   ? 9.479   14.957 29.372 1.00 14.14 ? 2195 HOH A O   1 
HETATM 1850 O O   . HOH D 4 .   ? 8.082   14.099 24.467 1.00 25.43 ? 2196 HOH A O   1 
HETATM 1851 O O   . HOH D 4 .   ? 11.418  23.198 33.415 1.00 14.65 ? 2197 HOH A O   1 
HETATM 1852 O O   . HOH D 4 .   ? 11.182  29.039 32.232 1.00 25.73 ? 2198 HOH A O   1 
HETATM 1853 O O   . HOH D 4 .   ? 5.291   27.852 27.133 1.00 10.31 ? 2199 HOH A O   1 
HETATM 1854 O O   . HOH D 4 .   ? 5.817   24.945 29.915 1.00 22.63 ? 2200 HOH A O   1 
HETATM 1855 O O   . HOH D 4 .   ? 8.555   28.291 32.217 1.00 36.30 ? 2201 HOH A O   1 
HETATM 1856 O O   . HOH D 4 .   ? 16.740  28.526 36.488 1.00 31.98 ? 2202 HOH A O   1 
HETATM 1857 O O   . HOH D 4 .   ? 20.313  24.696 29.562 1.00 16.94 ? 2203 HOH A O   1 
HETATM 1858 O O   . HOH D 4 .   ? 13.175  34.138 35.583 1.00 40.08 ? 2204 HOH A O   1 
HETATM 1859 O O   . HOH D 4 .   ? 22.251  30.811 32.200 1.00 24.48 ? 2205 HOH A O   1 
HETATM 1860 O O   . HOH D 4 .   ? 20.469  23.464 31.878 1.00 25.08 ? 2206 HOH A O   1 
HETATM 1861 O O   . HOH D 4 .   ? 21.296  23.937 35.388 1.00 53.31 ? 2207 HOH A O   1 
HETATM 1862 O O   . HOH D 4 .   ? 19.854  24.894 37.586 1.00 34.33 ? 2208 HOH A O   1 
HETATM 1863 O O   . HOH D 4 .   ? 22.066  29.128 35.661 1.00 48.95 ? 2209 HOH A O   1 
HETATM 1864 O O   . HOH D 4 .   ? 22.712  26.829 30.035 1.00 29.11 ? 2210 HOH A O   1 
HETATM 1865 O O   . HOH D 4 .   ? 17.736  33.892 23.636 1.00 14.27 ? 2211 HOH A O   1 
HETATM 1866 O O   A HOH D 4 .   ? 22.153  37.892 28.698 0.50 12.62 ? 2212 HOH A O   1 
HETATM 1867 O O   B HOH D 4 .   ? 21.288  38.915 28.824 0.50 16.89 ? 2212 HOH A O   1 
HETATM 1868 O O   . HOH D 4 .   ? 22.857  36.995 31.173 1.00 50.33 ? 2214 HOH A O   1 
HETATM 1869 O O   . HOH D 4 .   ? 27.587  32.417 23.862 1.00 27.91 ? 2215 HOH A O   1 
HETATM 1870 O O   . HOH D 4 .   ? 26.618  34.987 26.962 1.00 14.80 ? 2216 HOH A O   1 
HETATM 1871 O O   . HOH D 4 .   ? 26.058  29.212 26.206 1.00 26.58 ? 2217 HOH A O   1 
HETATM 1872 O O   . HOH D 4 .   ? 27.774  31.765 29.758 1.00 44.31 ? 2218 HOH A O   1 
HETATM 1873 O O   . HOH D 4 .   ? 28.092  28.362 23.485 1.00 23.04 ? 2219 HOH A O   1 
HETATM 1874 O O   . HOH D 4 .   ? 15.156  22.177 16.801 1.00 22.61 ? 2220 HOH A O   1 
HETATM 1875 O O   . HOH D 4 .   ? 11.633  23.040 20.575 1.00 11.45 ? 2221 HOH A O   1 
HETATM 1876 O O   . HOH D 4 .   ? 0.536   26.490 15.606 1.00 22.83 ? 2222 HOH A O   1 
HETATM 1877 O O   . HOH D 4 .   ? 2.275   20.155 12.365 1.00 22.02 ? 2223 HOH A O   1 
HETATM 1878 O O   . HOH D 4 .   ? -0.907  23.445 15.963 1.00 24.64 ? 2224 HOH A O   1 
HETATM 1879 O O   . HOH D 4 .   ? 3.082   24.754 9.751  1.00 31.49 ? 2225 HOH A O   1 
HETATM 1880 O O   . HOH D 4 .   ? -3.201  22.905 13.519 1.00 37.44 ? 2226 HOH A O   1 
HETATM 1881 O O   . HOH D 4 .   ? -0.449  19.748 12.138 1.00 27.73 ? 2227 HOH A O   1 
HETATM 1882 O O   . HOH D 4 .   ? -7.471  24.908 15.473 1.00 44.94 ? 2228 HOH A O   1 
HETATM 1883 O O   . HOH D 4 .   ? -7.401  29.197 15.311 1.00 39.76 ? 2229 HOH A O   1 
HETATM 1884 O O   . HOH D 4 .   ? -3.167  35.018 16.256 1.00 31.25 ? 2230 HOH A O   1 
HETATM 1885 O O   . HOH D 4 .   ? 1.642   32.705 7.101  1.00 67.20 ? 2231 HOH A O   1 
HETATM 1886 O O   . HOH D 4 .   ? 3.449   30.552 6.312  1.00 46.38 ? 2232 HOH A O   1 
HETATM 1887 O O   . HOH D 4 .   ? -2.596  38.385 9.832  1.00 43.25 ? 2233 HOH A O   1 
HETATM 1888 O O   . HOH D 4 .   ? 0.390   37.976 10.026 1.00 33.90 ? 2234 HOH A O   1 
HETATM 1889 O O   . HOH D 4 .   ? -2.324  38.031 16.428 1.00 35.13 ? 2235 HOH A O   1 
HETATM 1890 O O   . HOH D 4 .   ? 2.146   43.635 14.238 1.00 29.35 ? 2236 HOH A O   1 
HETATM 1891 O O   . HOH D 4 .   ? -1.248  36.965 19.954 1.00 31.32 ? 2237 HOH A O   1 
HETATM 1892 O O   . HOH D 4 .   ? -2.083  44.165 16.286 1.00 37.19 ? 2238 HOH A O   1 
HETATM 1893 O O   . HOH D 4 .   ? -2.670  36.948 22.236 1.00 24.26 ? 2239 HOH A O   1 
HETATM 1894 O O   . HOH D 4 .   ? -2.948  33.267 21.283 1.00 17.24 ? 2240 HOH A O   1 
HETATM 1895 O O   . HOH D 4 .   ? -4.833  29.496 23.787 1.00 36.79 ? 2241 HOH A O   1 
HETATM 1896 O O   . HOH D 4 .   ? -1.171  26.466 24.088 1.00 30.07 ? 2242 HOH A O   1 
HETATM 1897 O O   . HOH D 4 .   ? -5.914  32.419 19.355 1.00 27.38 ? 2243 HOH A O   1 
HETATM 1898 O O   . HOH D 4 .   ? -3.247  25.436 22.705 1.00 25.77 ? 2244 HOH A O   1 
HETATM 1899 O O   . HOH D 4 .   ? -4.900  23.237 18.502 1.00 46.81 ? 2245 HOH A O   1 
HETATM 1900 O O   . HOH D 4 .   ? 0.630   24.608 23.115 1.00 19.09 ? 2246 HOH A O   1 
HETATM 1901 O O   . HOH D 4 .   ? -3.606  23.495 16.106 1.00 41.99 ? 2247 HOH A O   1 
HETATM 1902 O O   . HOH D 4 .   ? -5.164  21.453 16.494 1.00 23.50 ? 2248 HOH A O   1 
HETATM 1903 O O   . HOH D 4 .   ? -0.876  20.063 14.827 1.00 18.26 ? 2249 HOH A O   1 
HETATM 1904 O O   . HOH D 4 .   ? -2.629  19.170 21.447 1.00 31.84 ? 2250 HOH A O   1 
HETATM 1905 O O   . HOH D 4 .   ? -0.216  19.180 22.621 1.00 32.42 ? 2251 HOH A O   1 
HETATM 1906 O O   . HOH D 4 .   ? 6.401   16.114 16.801 1.00 32.06 ? 2252 HOH A O   1 
HETATM 1907 O O   . HOH D 4 .   ? 4.901   16.791 13.321 1.00 43.24 ? 2253 HOH A O   1 
HETATM 1908 O O   . HOH D 4 .   ? 0.400   13.987 18.059 1.00 51.38 ? 2254 HOH A O   1 
HETATM 1909 O O   . HOH D 4 .   ? 8.058   20.669 8.389  1.00 41.06 ? 2255 HOH A O   1 
HETATM 1910 O O   . HOH D 4 .   ? 3.026   20.869 8.745  1.00 44.25 ? 2256 HOH A O   1 
HETATM 1911 O O   . HOH D 4 .   ? 13.267  30.209 11.258 1.00 15.75 ? 2257 HOH A O   1 
HETATM 1912 O O   . HOH D 4 .   ? 14.623  32.073 12.835 1.00 12.53 ? 2258 HOH A O   1 
HETATM 1913 O O   . HOH D 4 .   ? 10.727  42.439 28.886 1.00 25.52 ? 2259 HOH A O   1 
HETATM 1914 O O   . HOH D 4 .   ? 9.747   41.829 31.162 1.00 17.33 ? 2260 HOH A O   1 
HETATM 1915 O O   . HOH D 4 .   ? 6.667   43.523 27.423 1.00 29.21 ? 2261 HOH A O   1 
HETATM 1916 O O   . HOH D 4 .   ? 9.080   38.153 35.942 1.00 56.00 ? 2262 HOH A O   1 
HETATM 1917 O O   . HOH D 4 .   ? 1.190   46.028 29.172 1.00 29.67 ? 2263 HOH A O   1 
HETATM 1918 O O   . HOH D 4 .   ? -4.060  42.205 32.915 1.00 36.01 ? 2264 HOH A O   1 
HETATM 1919 O O   . HOH D 4 .   ? 2.289   34.995 35.176 1.00 19.02 ? 2265 HOH A O   1 
HETATM 1920 O O   . HOH D 4 .   ? 5.399   36.110 34.663 1.00 27.37 ? 2266 HOH A O   1 
HETATM 1921 O O   A HOH D 4 .   ? 2.452   32.150 31.464 0.50 12.38 ? 2267 HOH A O   1 
HETATM 1922 O O   B HOH D 4 .   ? 3.164   33.512 30.884 0.50 16.09 ? 2267 HOH A O   1 
HETATM 1923 O O   . HOH D 4 .   ? 4.134   33.982 33.102 1.00 23.58 ? 2268 HOH A O   1 
HETATM 1924 O O   . HOH D 4 .   ? 9.880   42.665 24.644 1.00 18.33 ? 2269 HOH A O   1 
HETATM 1925 O O   . HOH D 4 .   ? 9.080   36.343 10.151 1.00 16.19 ? 2270 HOH A O   1 
HETATM 1926 O O   . HOH D 4 .   ? 10.666  40.929 4.999  1.00 29.17 ? 2271 HOH A O   1 
HETATM 1927 O O   . HOH D 4 .   ? 10.608  44.471 4.781  1.00 42.50 ? 2272 HOH A O   1 
HETATM 1928 O O   . HOH D 4 .   ? 12.644  42.984 5.528  1.00 40.58 ? 2273 HOH A O   1 
HETATM 1929 O O   . HOH D 4 .   ? 2.062   41.547 10.641 1.00 32.34 ? 2274 HOH A O   1 
HETATM 1930 O O   . HOH D 4 .   ? 4.457   44.025 11.924 1.00 31.71 ? 2275 HOH A O   1 
HETATM 1931 O O   . HOH D 4 .   ? 9.388   43.444 16.420 1.00 24.24 ? 2276 HOH A O   1 
HETATM 1932 O O   . HOH D 4 .   ? 3.397   43.376 21.269 1.00 39.37 ? 2277 HOH A O   1 
HETATM 1933 O O   . HOH D 4 .   ? 12.085  43.459 12.270 1.00 21.05 ? 2278 HOH A O   1 
HETATM 1934 O O   . HOH D 4 .   ? 11.319  46.062 11.344 1.00 36.06 ? 2279 HOH A O   1 
HETATM 1935 O O   . HOH D 4 .   ? 6.884   30.070 33.396 1.00 39.99 ? 2280 HOH A O   1 
HETATM 1936 O O   . HOH D 4 .   ? -0.221  25.878 31.248 1.00 32.46 ? 2281 HOH A O   1 
HETATM 1937 O O   . HOH D 4 .   ? -1.231  25.349 28.861 0.50 22.70 ? 2282 HOH A O   1 
HETATM 1938 O O   . HOH D 4 .   ? 0.115   23.114 31.131 1.00 32.74 ? 2283 HOH A O   1 
HETATM 1939 O O   . HOH D 4 .   ? 0.974   19.508 28.373 1.00 30.64 ? 2284 HOH A O   1 
HETATM 1940 O O   . HOH D 4 .   ? -0.105  18.372 25.377 1.00 34.34 ? 2285 HOH A O   1 
HETATM 1941 O O   . HOH D 4 .   ? -1.228  20.883 28.883 0.50 39.46 ? 2286 HOH A O   1 
HETATM 1942 O O   . HOH D 4 .   ? 1.763   17.025 30.330 1.00 34.42 ? 2287 HOH A O   1 
HETATM 1943 O O   . HOH D 4 .   ? 5.679   13.266 28.139 1.00 31.30 ? 2288 HOH A O   1 
HETATM 1944 O O   . HOH D 4 .   ? 15.119  17.110 22.480 1.00 21.85 ? 2289 HOH A O   1 
HETATM 1945 O O   . HOH D 4 .   ? 17.538  21.420 18.013 1.00 21.91 ? 2290 HOH A O   1 
HETATM 1946 O O   . HOH D 4 .   ? 15.582  16.876 17.609 1.00 46.57 ? 2291 HOH A O   1 
HETATM 1947 O O   . HOH D 4 .   ? 14.660  19.734 15.835 1.00 33.22 ? 2292 HOH A O   1 
HETATM 1948 O O   . HOH D 4 .   ? 12.625  17.404 14.394 1.00 50.33 ? 2293 HOH A O   1 
HETATM 1949 O O   . HOH D 4 .   ? 10.834  15.620 20.483 1.00 37.69 ? 2294 HOH A O   1 
HETATM 1950 O O   . HOH D 4 .   ? 21.909  23.667 27.601 1.00 17.70 ? 2295 HOH A O   1 
HETATM 1951 O O   . HOH D 4 .   ? 29.430  30.008 21.773 1.00 26.43 ? 2296 HOH A O   1 
HETATM 1952 O O   . HOH D 4 .   ? 32.409  29.450 22.385 1.00 29.71 ? 2297 HOH A O   1 
HETATM 1953 O O   . HOH D 4 .   ? 5.769   25.423 8.904  1.00 34.27 ? 2298 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 1   ? 0.2776 0.3398 0.2741 -0.0364 0.0115  -0.0146 2    VAL A N   
2    C CA  . VAL A 1   ? 0.2368 0.2881 0.2434 -0.0302 0.0129  -0.0153 2    VAL A CA  
3    C C   . VAL A 1   ? 0.2095 0.2486 0.2151 -0.0331 0.0190  -0.0230 2    VAL A C   
4    O O   . VAL A 1   ? 0.2393 0.2734 0.2404 -0.0353 0.0242  -0.0265 2    VAL A O   
5    C CB  . VAL A 1   ? 0.2866 0.3348 0.3002 -0.0227 0.0130  -0.0104 2    VAL A CB  
6    C CG1 . VAL A 1   ? 0.2702 0.3092 0.2929 -0.0178 0.0136  -0.0111 2    VAL A CG1 
7    C CG2 . VAL A 1   ? 0.2926 0.3506 0.3075 -0.0193 0.0087  -0.0026 2    VAL A CG2 
8    N N   . PRO A 2   ? 0.1500 0.1837 0.1596 -0.0331 0.0193  -0.0253 3    PRO A N   
9    C CA  . PRO A 2   ? 0.1495 0.1708 0.1590 -0.0353 0.0262  -0.0318 3    PRO A CA  
10   C C   . PRO A 2   ? 0.1562 0.1689 0.1737 -0.0291 0.0303  -0.0308 3    PRO A C   
11   O O   . PRO A 2   ? 0.1421 0.1568 0.1673 -0.0229 0.0269  -0.0255 3    PRO A O   
12   C CB  . PRO A 2   ? 0.1691 0.1879 0.1827 -0.0353 0.0246  -0.0320 3    PRO A CB  
13   C CG  . PRO A 2   ? 0.2111 0.2381 0.2305 -0.0298 0.0177  -0.0251 3    PRO A CG  
14   C CD  . PRO A 2   ? 0.1630 0.2011 0.1777 -0.0308 0.0144  -0.0218 3    PRO A CD  
15   N N   . ALA A 3   ? 0.1662 0.1692 0.1821 -0.0313 0.0384  -0.0361 4    ALA A N   
16   C CA  . ALA A 3   ? 0.1580 0.1541 0.1832 -0.0254 0.0433  -0.0346 4    ALA A CA  
17   C C   . ALA A 3   ? 0.1499 0.1419 0.1871 -0.0194 0.0423  -0.0310 4    ALA A C   
18   O O   . ALA A 3   ? 0.1551 0.1470 0.2022 -0.0137 0.0425  -0.0269 4    ALA A O   
19   C CB  . ALA A 3   ? 0.1908 0.1769 0.2116 -0.0288 0.0536  -0.0409 4    ALA A CB  
20   N N   . ALA A 4   ? 0.1180 0.1075 0.1544 -0.0213 0.0413  -0.0323 5    ALA A N   
21   C CA  . ALA A 4   ? 0.0984 0.0847 0.1450 -0.0160 0.0401  -0.0281 5    ALA A CA  
22   C C   . ALA A 4   ? 0.0945 0.0848 0.1386 -0.0175 0.0341  -0.0270 5    ALA A C   
23   O O   . ALA A 4   ? 0.1123 0.1042 0.1481 -0.0237 0.0339  -0.0309 5    ALA A O   
24   C CB  . ALA A 4   ? 0.1096 0.0838 0.1602 -0.0155 0.0492  -0.0306 5    ALA A CB  
25   N N   . VAL A 5   ? 0.0783 0.0711 0.1294 -0.0126 0.0293  -0.0215 6    VAL A N   
26   C CA  . VAL A 5   ? 0.0746 0.0708 0.1243 -0.0132 0.0242  -0.0198 6    VAL A CA  
27   C C   . VAL A 5   ? 0.0863 0.0790 0.1437 -0.0087 0.0236  -0.0154 6    VAL A C   
28   O O   . VAL A 5   ? 0.0846 0.0784 0.1488 -0.0044 0.0225  -0.0114 6    VAL A O   
29   C CB  . VAL A 5   ? 0.1120 0.1177 0.1591 -0.0123 0.0176  -0.0170 6    VAL A CB  
30   C CG1 . VAL A 5   ? 0.1028 0.1115 0.1497 -0.0119 0.0133  -0.0146 6    VAL A CG1 
31   C CG2 . VAL A 5   ? 0.1240 0.1354 0.1637 -0.0167 0.0175  -0.0197 6    VAL A CG2 
32   N N   . ASP A 6   ? 0.0811 0.0704 0.1376 -0.0102 0.0241  -0.0156 7    ASP A N   
33   C CA  . ASP A 6   ? 0.0751 0.0624 0.1379 -0.0061 0.0228  -0.0103 7    ASP A CA  
34   C C   . ASP A 6   ? 0.0762 0.0652 0.1350 -0.0081 0.0197  -0.0098 7    ASP A C   
35   O O   . ASP A 6   ? 0.0954 0.0792 0.1523 -0.0114 0.0235  -0.0123 7    ASP A O   
36   C CB  . ASP A 6   ? 0.0990 0.0771 0.1685 -0.0039 0.0299  -0.0091 7    ASP A CB  
37   C CG  . ASP A 6   ? 0.1509 0.1300 0.2285 0.0014  0.0276  -0.0014 7    ASP A CG  
38   O OD1 . ASP A 6   ? 0.1283 0.1123 0.2034 0.0015  0.0216  0.0014  7    ASP A OD1 
39   O OD2 . ASP A 6   ? 0.1399 0.1152 0.2263 0.0054  0.0323  0.0022  7    ASP A OD2 
40   N N   . TRP A 7   ? 0.0665 0.0622 0.1237 -0.0067 0.0138  -0.0071 8    TRP A N   
41   C CA  . TRP A 7   ? 0.0819 0.0797 0.1356 -0.0082 0.0114  -0.0063 8    TRP A CA  
42   C C   . TRP A 7   ? 0.1053 0.0979 0.1618 -0.0068 0.0127  -0.0029 8    TRP A C   
43   O O   . TRP A 7   ? 0.1088 0.1014 0.1624 -0.0088 0.0126  -0.0030 8    TRP A O   
44   C CB  . TRP A 7   ? 0.0839 0.0882 0.1351 -0.0067 0.0065  -0.0045 8    TRP A CB  
45   C CG  . TRP A 7   ? 0.0685 0.0784 0.1168 -0.0083 0.0058  -0.0068 8    TRP A CG  
46   C CD1 . TRP A 7   ? 0.0906 0.1029 0.1390 -0.0068 0.0048  -0.0067 8    TRP A CD1 
47   C CD2 . TRP A 7   ? 0.0675 0.0822 0.1128 -0.0120 0.0063  -0.0089 8    TRP A CD2 
48   N NE1 . TRP A 7   ? 0.0869 0.1052 0.1323 -0.0088 0.0046  -0.0079 8    TRP A NE1 
49   C CE2 . TRP A 7   ? 0.0920 0.1127 0.1356 -0.0123 0.0052  -0.0093 8    TRP A CE2 
50   C CE3 . TRP A 7   ? 0.0743 0.0898 0.1185 -0.0156 0.0074  -0.0101 8    TRP A CE3 
51   C CZ2 . TRP A 7   ? 0.0988 0.1278 0.1399 -0.0158 0.0045  -0.0100 8    TRP A CZ2 
52   C CZ3 . TRP A 7   ? 0.0868 0.1105 0.1287 -0.0198 0.0068  -0.0116 8    TRP A CZ3 
53   C CH2 . TRP A 7   ? 0.0816 0.1128 0.1221 -0.0197 0.0049  -0.0111 8    TRP A CH2 
54   N N   . ARG A 8   ? 0.0920 0.0810 0.1545 -0.0033 0.0141  0.0008  9    ARG A N   
55   C CA  . ARG A 8   ? 0.0997 0.0846 0.1651 -0.0015 0.0153  0.0057  9    ARG A CA  
56   C C   . ARG A 8   ? 0.1362 0.1126 0.2015 -0.0042 0.0218  0.0029  9    ARG A C   
57   O O   . ARG A 8   ? 0.1403 0.1149 0.2031 -0.0059 0.0221  0.0039  9    ARG A O   
58   C CB  . ARG A 8   ? 0.1140 0.0992 0.1876 0.0032  0.0153  0.0117  9    ARG A CB  
59   C CG  . ARG A 8   ? 0.1242 0.1179 0.1977 0.0044  0.0088  0.0141  9    ARG A CG  
60   C CD  . ARG A 8   ? 0.1354 0.1318 0.2186 0.0083  0.0089  0.0201  9    ARG A CD  
61   N NE  . ARG A 8   ? 0.1670 0.1594 0.2559 0.0096  0.0149  0.0175  9    ARG A NE  
62   C CZ  . ARG A 8   ? 0.2039 0.1983 0.3032 0.0135  0.0169  0.0223  9    ARG A CZ  
63   N NH1 . ARG A 8   ? 0.1966 0.1989 0.3021 0.0161  0.0122  0.0305  9    ARG A NH1 
64   N NH2 . ARG A 8   ? 0.1753 0.1649 0.2790 0.0145  0.0237  0.0192  9    ARG A NH2 
65   N N   . THR A 9   ? 0.1102 0.0806 0.1774 -0.0054 0.0278  -0.0010 10   THR A N   
66   C CA  . THR A 9   ? 0.1149 0.0755 0.1807 -0.0093 0.0350  -0.0049 10   THR A CA  
67   C C   . THR A 9   ? 0.1293 0.0935 0.1868 -0.0167 0.0338  -0.0114 10   THR A C   
68   O O   . THR A 9   ? 0.1459 0.1038 0.2011 -0.0216 0.0384  -0.0146 10   THR A O   
69   C CB  . THR A 9   ? 0.1473 0.0988 0.2170 -0.0085 0.0431  -0.0074 10   THR A CB  
70   O OG1 . THR A 9   ? 0.1455 0.1031 0.2137 -0.0087 0.0409  -0.0104 10   THR A OG1 
71   C CG2 . THR A 9   ? 0.2024 0.1492 0.2829 -0.0011 0.0466  0.0007  10   THR A CG2 
72   N N   . ALA A 10  ? 0.1158 0.0908 0.1695 -0.0176 0.0276  -0.0128 11   ALA A N   
73   C CA  . ALA A 10  ? 0.1122 0.0941 0.1601 -0.0236 0.0254  -0.0166 11   ALA A CA  
74   C C   . ALA A 10  ? 0.1525 0.1383 0.2003 -0.0233 0.0223  -0.0131 11   ALA A C   
75   O O   . ALA A 10  ? 0.1905 0.1822 0.2355 -0.0282 0.0214  -0.0153 11   ALA A O   
76   C CB  . ALA A 10  ? 0.1177 0.1095 0.1631 -0.0235 0.0209  -0.0177 11   ALA A CB  
77   N N   . GLY A 11  ? 0.1156 0.0991 0.1664 -0.0180 0.0209  -0.0076 12   GLY A N   
78   C CA  . GLY A 11  ? 0.1069 0.0921 0.1566 -0.0177 0.0192  -0.0041 12   GLY A CA  
79   C C   . GLY A 11  ? 0.1271 0.1207 0.1746 -0.0152 0.0139  -0.0018 12   GLY A C   
80   O O   . GLY A 11  ? 0.1379 0.1334 0.1836 -0.0159 0.0134  0.0000  12   GLY A O   
81   N N   . ALA A 12  ? 0.0974 0.0947 0.1448 -0.0125 0.0108  -0.0017 13   ALA A N   
82   C CA  . ALA A 12  ? 0.0886 0.0920 0.1333 -0.0106 0.0072  -0.0002 13   ALA A CA  
83   C C   . ALA A 12  ? 0.1080 0.1096 0.1518 -0.0072 0.0046  0.0033  13   ALA A C   
84   O O   . ALA A 12  ? 0.1157 0.1203 0.1566 -0.0060 0.0025  0.0035  13   ALA A O   
85   C CB  . ALA A 12  ? 0.1092 0.1189 0.1536 -0.0110 0.0058  -0.0026 13   ALA A CB  
86   N N   . VAL A 13  ? 0.0795 0.0765 0.1259 -0.0058 0.0050  0.0064  14   VAL A N   
87   C CA  . VAL A 13  ? 0.0679 0.0660 0.1136 -0.0036 0.0016  0.0105  14   VAL A CA  
88   C C   . VAL A 13  ? 0.1133 0.1089 0.1582 -0.0032 0.0016  0.0155  14   VAL A C   
89   O O   . VAL A 13  ? 0.1200 0.1112 0.1694 -0.0025 0.0049  0.0176  14   VAL A O   
90   C CB  . VAL A 13  ? 0.1036 0.1022 0.1552 -0.0017 0.0009  0.0113  14   VAL A CB  
91   C CG1 . VAL A 13  ? 0.1138 0.1162 0.1647 -0.0008 -0.0036 0.0151  14   VAL A CG1 
92   C CG2 . VAL A 13  ? 0.1029 0.1033 0.1549 -0.0024 0.0017  0.0065  14   VAL A CG2 
93   N N   . THR A 14  ? 0.1094 0.1071 0.1479 -0.0038 -0.0013 0.0175  15   THR A N   
94   C CA  . THR A 14  ? 0.1124 0.1091 0.1485 -0.0038 -0.0020 0.0231  15   THR A CA  
95   C C   . THR A 14  ? 0.1375 0.1372 0.1782 -0.0018 -0.0052 0.0292  15   THR A C   
96   O O   . THR A 14  ? 0.1239 0.1268 0.1688 -0.0010 -0.0071 0.0283  15   THR A O   
97   C CB  . THR A 14  ? 0.1255 0.1233 0.1511 -0.0060 -0.0035 0.0224  15   THR A CB  
98   O OG1 . THR A 14  ? 0.1403 0.1411 0.1624 -0.0069 -0.0072 0.0212  15   THR A OG1 
99   C CG2 . THR A 14  ? 0.1500 0.1466 0.1731 -0.0071 0.0001  0.0177  15   THR A CG2 
100  N N   . PRO A 15  ? 0.1391 0.1392 0.1795 -0.0011 -0.0060 0.0364  16   PRO A N   
101  C CA  . PRO A 15  ? 0.1455 0.1515 0.1915 0.0009  -0.0098 0.0440  16   PRO A CA  
102  C C   . PRO A 15  ? 0.1477 0.1613 0.1885 -0.0020 -0.0160 0.0432  16   PRO A C   
103  O O   . PRO A 15  ? 0.1510 0.1638 0.1815 -0.0057 -0.0171 0.0379  16   PRO A O   
104  C CB  . PRO A 15  ? 0.1808 0.1867 0.2251 0.0016  -0.0097 0.0522  16   PRO A CB  
105  C CG  . PRO A 15  ? 0.2262 0.2230 0.2688 0.0012  -0.0035 0.0486  16   PRO A CG  
106  C CD  . PRO A 15  ? 0.1738 0.1698 0.2101 -0.0018 -0.0032 0.0389  16   PRO A CD  
107  N N   . VAL A 16  ? 0.1285 0.1495 0.1772 -0.0005 -0.0194 0.0488  17   VAL A N   
108  C CA  . VAL A 16  ? 0.1239 0.1533 0.1691 -0.0042 -0.0255 0.0489  17   VAL A CA  
109  C C   . VAL A 16  ? 0.1747 0.2080 0.2074 -0.0091 -0.0300 0.0516  17   VAL A C   
110  O O   . VAL A 16  ? 0.1973 0.2323 0.2292 -0.0081 -0.0306 0.0590  17   VAL A O   
111  C CB  . VAL A 16  ? 0.1696 0.2078 0.2287 -0.0012 -0.0278 0.0559  17   VAL A CB  
112  C CG1 . VAL A 16  ? 0.1656 0.2155 0.2219 -0.0061 -0.0353 0.0584  17   VAL A CG1 
113  C CG2 . VAL A 16  ? 0.1665 0.2000 0.2348 0.0021  -0.0229 0.0508  17   VAL A CG2 
114  N N   . LYS A 17  ? 0.1539 0.1877 0.1761 -0.0147 -0.0325 0.0457  18   LYS A N   
115  C CA  . LYS A 17  ? 0.1638 0.2000 0.1710 -0.0212 -0.0361 0.0459  18   LYS A CA  
116  C C   . LYS A 17  ? 0.2084 0.2560 0.2144 -0.0267 -0.0433 0.0487  18   LYS A C   
117  O O   . LYS A 17  ? 0.1877 0.2405 0.2050 -0.0251 -0.0448 0.0494  18   LYS A O   
118  C CB  . LYS A 17  ? 0.1814 0.2072 0.1762 -0.0241 -0.0315 0.0359  18   LYS A CB  
119  C CG  . LYS A 17  ? 0.2017 0.2188 0.1990 -0.0193 -0.0249 0.0333  18   LYS A CG  
120  C CD  . LYS A 17  ? 0.2315 0.2406 0.2181 -0.0216 -0.0203 0.0254  18   LYS A CD  
121  C CE  . LYS A 17  ? 0.2668 0.2701 0.2574 -0.0175 -0.0144 0.0234  18   LYS A CE  
122  N NZ  . LYS A 17  ? 0.2068 0.2039 0.1891 -0.0188 -0.0093 0.0171  18   LYS A NZ  
123  N N   . ASN A 18  ? 0.2178 0.2697 0.2095 -0.0341 -0.0475 0.0498  19   ASN A N   
124  C CA  . ASN A 18  ? 0.2237 0.2875 0.2122 -0.0416 -0.0549 0.0520  19   ASN A CA  
125  C C   . ASN A 18  ? 0.2530 0.3110 0.2208 -0.0515 -0.0547 0.0432  19   ASN A C   
126  O O   . ASN A 18  ? 0.2724 0.3280 0.2259 -0.0553 -0.0544 0.0435  19   ASN A O   
127  C CB  . ASN A 18  ? 0.2329 0.3122 0.2261 -0.0417 -0.0618 0.0653  19   ASN A CB  
128  C CG  . ASN A 18  ? 0.2942 0.3903 0.2913 -0.0477 -0.0701 0.0701  19   ASN A CG  
129  O OD1 . ASN A 18  ? 0.2644 0.3601 0.2553 -0.0548 -0.0714 0.0624  19   ASN A OD1 
130  N ND2 . ASN A 18  ? 0.2319 0.3431 0.2418 -0.0441 -0.0751 0.0835  19   ASN A ND2 
131  N N   . GLN A 19  ? 0.2218 0.2771 0.1877 -0.0560 -0.0542 0.0356  20   GLN A N   
132  C CA  . GLN A 19  ? 0.2242 0.2714 0.1709 -0.0657 -0.0523 0.0262  20   GLN A CA  
133  C C   . GLN A 19  ? 0.2880 0.3478 0.2229 -0.0771 -0.0605 0.0298  20   GLN A C   
134  O O   . GLN A 19  ? 0.2954 0.3484 0.2108 -0.0866 -0.0588 0.0226  20   GLN A O   
135  C CB  . GLN A 19  ? 0.2471 0.2868 0.1965 -0.0667 -0.0485 0.0177  20   GLN A CB  
136  C CG  . GLN A 19  ? 0.2570 0.3094 0.2170 -0.0700 -0.0548 0.0209  20   GLN A CG  
137  C CD  . GLN A 19  ? 0.3647 0.4073 0.3257 -0.0709 -0.0498 0.0123  20   GLN A CD  
138  O OE1 . GLN A 19  ? 0.2556 0.2948 0.2299 -0.0626 -0.0461 0.0120  20   GLN A OE1 
139  N NE2 . GLN A 19  ? 0.2833 0.3208 0.2297 -0.0816 -0.0490 0.0051  20   GLN A NE2 
140  N N   . GLN A 20  ? 0.2428 0.3210 0.1900 -0.0763 -0.0688 0.0409  21   GLN A N   
141  C CA  . GLN A 20  ? 0.2589 0.3541 0.1979 -0.0871 -0.0783 0.0468  21   GLN A CA  
142  C C   . GLN A 20  ? 0.3332 0.4264 0.2596 -0.1001 -0.0794 0.0369  21   GLN A C   
143  O O   . GLN A 20  ? 0.3278 0.4169 0.2639 -0.0983 -0.0767 0.0319  21   GLN A O   
144  C CB  . GLN A 20  ? 0.2819 0.3780 0.2053 -0.0903 -0.0797 0.0509  21   GLN A CB  
145  C CG  . GLN A 20  ? 0.4698 0.5777 0.4082 -0.0809 -0.0832 0.0657  21   GLN A CG  
146  C CD  . GLN A 20  ? 0.7342 0.8309 0.6664 -0.0752 -0.0773 0.0666  21   GLN A CD  
147  O OE1 . GLN A 20  ? 0.6491 0.7346 0.5614 -0.0809 -0.0732 0.0590  21   GLN A OE1 
148  N NE2 . GLN A 20  ? 0.6558 0.7551 0.6051 -0.0641 -0.0762 0.0762  21   GLN A NE2 
149  N N   . GLN A 21  ? 0.3555 0.4503 0.2597 -0.1134 -0.0824 0.0335  22   GLN A N   
150  C CA  . GLN A 21  ? 0.3763 0.4696 0.2666 -0.1279 -0.0835 0.0242  22   GLN A CA  
151  C C   . GLN A 21  ? 0.4579 0.5253 0.3292 -0.1320 -0.0720 0.0088  22   GLN A C   
152  O O   . GLN A 21  ? 0.5062 0.5688 0.3552 -0.1459 -0.0714 0.0011  22   GLN A O   
153  C CB  . GLN A 21  ? 0.4054 0.5179 0.2819 -0.1424 -0.0942 0.0297  22   GLN A CB  
154  C CG  . GLN A 21  ? 0.6195 0.7601 0.5149 -0.1387 -0.1058 0.0470  22   GLN A CG  
155  C CD  . GLN A 21  ? 0.9721 1.1176 0.8696 -0.1302 -0.1072 0.0583  22   GLN A CD  
156  O OE1 . GLN A 21  ? 0.9631 1.1063 0.8400 -0.1368 -0.1076 0.0576  22   GLN A OE1 
157  N NE2 . GLN A 21  ? 0.8744 1.0258 0.7962 -0.1155 -0.1072 0.0689  22   GLN A NE2 
158  N N   . CYS A 22  ? 0.3864 0.4377 0.2668 -0.1200 -0.0626 0.0045  23   CYS A N   
159  C CA  . CYS A 22  ? 0.3652 0.3926 0.2337 -0.1206 -0.0506 -0.0082 23   CYS A CA  
160  C C   . CYS A 22  ? 0.3973 0.4187 0.2819 -0.1136 -0.0464 -0.0113 23   CYS A C   
161  O O   . CYS A 22  ? 0.3983 0.4242 0.3021 -0.1014 -0.0470 -0.0050 23   CYS A O   
162  C CB  . CYS A 22  ? 0.3360 0.3517 0.2003 -0.1122 -0.0431 -0.0087 23   CYS A CB  
163  S SG  . CYS A 22  ? 0.3690 0.3571 0.2199 -0.1120 -0.0276 -0.0225 23   CYS A SG  
164  N N   . GLY A 23  ? 0.3349 0.3447 0.2110 -0.1213 -0.0412 -0.0210 24   GLY A N   
165  C CA  . GLY A 23  ? 0.3016 0.3041 0.1911 -0.1155 -0.0363 -0.0242 24   GLY A CA  
166  C C   . GLY A 23  ? 0.3339 0.3190 0.2267 -0.1039 -0.0252 -0.0278 24   GLY A C   
167  O O   . GLY A 23  ? 0.3285 0.2973 0.2172 -0.1044 -0.0161 -0.0355 24   GLY A O   
168  N N   . CYS A 24  ? 0.2592 0.2484 0.1606 -0.0933 -0.0259 -0.0214 25   CYS A N   
169  C CA  . CYS A 24  ? 0.2629 0.2390 0.1686 -0.0827 -0.0164 -0.0237 25   CYS A CA  
170  C C   . CYS A 24  ? 0.2878 0.2711 0.2147 -0.0706 -0.0183 -0.0172 25   CYS A C   
171  O O   . CYS A 24  ? 0.2603 0.2401 0.1923 -0.0618 -0.0142 -0.0156 25   CYS A O   
172  C CB  . CYS A 24  ? 0.2885 0.2594 0.1823 -0.0823 -0.0129 -0.0240 25   CYS A CB  
173  S SG  . CYS A 24  ? 0.3301 0.3185 0.2309 -0.0785 -0.0224 -0.0129 25   CYS A SG  
174  N N   . CYS A 25  ? 0.2241 0.2169 0.1631 -0.0705 -0.0236 -0.0142 26   CYS A N   
175  C CA  . CYS A 25  ? 0.2026 0.2013 0.1605 -0.0601 -0.0246 -0.0090 26   CYS A CA  
176  C C   . CYS A 25  ? 0.2286 0.2149 0.1893 -0.0523 -0.0157 -0.0127 26   CYS A C   
177  O O   . CYS A 25  ? 0.2048 0.1936 0.1759 -0.0438 -0.0151 -0.0092 26   CYS A O   
178  C CB  . CYS A 25  ? 0.2070 0.2149 0.1755 -0.0623 -0.0293 -0.0070 26   CYS A CB  
179  S SG  . CYS A 25  ? 0.2598 0.2560 0.2229 -0.0683 -0.0236 -0.0153 26   CYS A SG  
180  N N   . TRP A 26  ? 0.2182 0.1913 0.1696 -0.0556 -0.0087 -0.0195 27   TRP A N   
181  C CA  . TRP A 26  ? 0.1969 0.1591 0.1512 -0.0484 0.0002  -0.0219 27   TRP A CA  
182  C C   . TRP A 26  ? 0.1924 0.1540 0.1474 -0.0418 0.0029  -0.0196 27   TRP A C   
183  O O   . TRP A 26  ? 0.1936 0.1556 0.1586 -0.0336 0.0058  -0.0175 27   TRP A O   
184  C CB  . TRP A 26  ? 0.2073 0.1539 0.1493 -0.0540 0.0085  -0.0291 27   TRP A CB  
185  C CG  . TRP A 26  ? 0.2359 0.1751 0.1601 -0.0617 0.0112  -0.0337 27   TRP A CG  
186  C CD1 . TRP A 26  ? 0.2797 0.2219 0.1915 -0.0733 0.0061  -0.0361 27   TRP A CD1 
187  C CD2 . TRP A 26  ? 0.2439 0.1717 0.1602 -0.0588 0.0201  -0.0363 27   TRP A CD2 
188  N NE1 . TRP A 26  ? 0.2891 0.2219 0.1842 -0.0781 0.0113  -0.0406 27   TRP A NE1 
189  C CE2 . TRP A 26  ? 0.2853 0.2085 0.1833 -0.0690 0.0205  -0.0408 27   TRP A CE2 
190  C CE3 . TRP A 26  ? 0.2504 0.1726 0.1738 -0.0487 0.0280  -0.0349 27   TRP A CE3 
191  C CZ2 . TRP A 26  ? 0.2892 0.2011 0.1755 -0.0689 0.0292  -0.0444 27   TRP A CZ2 
192  C CZ3 . TRP A 26  ? 0.2709 0.1825 0.1843 -0.0484 0.0367  -0.0378 27   TRP A CZ3 
193  C CH2 . TRP A 26  ? 0.2900 0.1965 0.1852 -0.0581 0.0372  -0.0425 27   TRP A CH2 
194  N N   . ALA A 27  ? 0.1801 0.1415 0.1242 -0.0461 0.0019  -0.0200 28   ALA A N   
195  C CA  . ALA A 27  ? 0.1811 0.1417 0.1250 -0.0409 0.0049  -0.0180 28   ALA A CA  
196  C C   . ALA A 27  ? 0.1995 0.1723 0.1557 -0.0356 -0.0015 -0.0112 28   ALA A C   
197  O O   . ALA A 27  ? 0.1788 0.1519 0.1417 -0.0292 0.0015  -0.0094 28   ALA A O   
198  C CB  . ALA A 27  ? 0.2076 0.1634 0.1347 -0.0478 0.0065  -0.0206 28   ALA A CB  
199  N N   . PHE A 28  ? 0.1787 0.1615 0.1386 -0.0385 -0.0096 -0.0073 29   PHE A N   
200  C CA  . PHE A 28  ? 0.1565 0.1489 0.1287 -0.0332 -0.0141 -0.0009 29   PHE A CA  
201  C C   . PHE A 28  ? 0.1596 0.1523 0.1449 -0.0266 -0.0120 -0.0009 29   PHE A C   
202  O O   . PHE A 28  ? 0.1487 0.1431 0.1411 -0.0213 -0.0108 0.0014  29   PHE A O   
203  C CB  . PHE A 28  ? 0.1627 0.1660 0.1374 -0.0373 -0.0222 0.0040  29   PHE A CB  
204  C CG  . PHE A 28  ? 0.1675 0.1740 0.1318 -0.0418 -0.0254 0.0072  29   PHE A CG  
205  C CD1 . PHE A 28  ? 0.2045 0.2074 0.1523 -0.0506 -0.0254 0.0030  29   PHE A CD1 
206  C CD2 . PHE A 28  ? 0.1817 0.1937 0.1515 -0.0377 -0.0275 0.0140  29   PHE A CD2 
207  C CE1 . PHE A 28  ? 0.2250 0.2308 0.1613 -0.0552 -0.0278 0.0059  29   PHE A CE1 
208  C CE2 . PHE A 28  ? 0.2228 0.2378 0.1826 -0.0416 -0.0301 0.0176  29   PHE A CE2 
209  C CZ  . PHE A 28  ? 0.2204 0.2328 0.1630 -0.0504 -0.0306 0.0137  29   PHE A CZ  
210  N N   . SER A 29  ? 0.1383 0.1294 0.1261 -0.0275 -0.0112 -0.0036 30   SER A N   
211  C CA  . SER A 29  ? 0.1227 0.1143 0.1212 -0.0219 -0.0092 -0.0034 30   SER A CA  
212  C C   . SER A 29  ? 0.1461 0.1323 0.1445 -0.0171 -0.0030 -0.0049 30   SER A C   
213  O O   . SER A 29  ? 0.1465 0.1364 0.1530 -0.0124 -0.0025 -0.0030 30   SER A O   
214  C CB  . SER A 29  ? 0.1438 0.1331 0.1425 -0.0247 -0.0086 -0.0061 30   SER A CB  
215  O OG  . SER A 29  ? 0.1727 0.1618 0.1798 -0.0196 -0.0060 -0.0059 30   SER A OG  
216  N N   . ALA A 30  ? 0.1379 0.1156 0.1270 -0.0187 0.0023  -0.0082 31   ALA A N   
217  C CA  . ALA A 30  ? 0.1330 0.1073 0.1237 -0.0137 0.0085  -0.0083 31   ALA A CA  
218  C C   . ALA A 30  ? 0.1470 0.1262 0.1402 -0.0114 0.0077  -0.0056 31   ALA A C   
219  O O   . ALA A 30  ? 0.1357 0.1189 0.1368 -0.0068 0.0093  -0.0038 31   ALA A O   
220  C CB  . ALA A 30  ? 0.1600 0.1233 0.1404 -0.0158 0.0155  -0.0121 31   ALA A CB  
221  N N   . VAL A 31  ? 0.1278 0.1075 0.1145 -0.0150 0.0049  -0.0049 32   VAL A N   
222  C CA  . VAL A 31  ? 0.1181 0.1014 0.1067 -0.0132 0.0047  -0.0021 32   VAL A CA  
223  C C   . VAL A 31  ? 0.1246 0.1150 0.1245 -0.0103 0.0011  0.0009  32   VAL A C   
224  O O   . VAL A 31  ? 0.1207 0.1135 0.1256 -0.0076 0.0032  0.0020  32   VAL A O   
225  C CB  . VAL A 31  ? 0.1739 0.1560 0.1522 -0.0178 0.0028  -0.0012 32   VAL A CB  
226  C CG1 . VAL A 31  ? 0.1723 0.1587 0.1547 -0.0158 0.0017  0.0029  32   VAL A CG1 
227  C CG2 . VAL A 31  ? 0.1950 0.1684 0.1611 -0.0203 0.0091  -0.0051 32   VAL A CG2 
228  N N   . ALA A 32  ? 0.1033 0.0971 0.1074 -0.0112 -0.0035 0.0022  33   ALA A N   
229  C CA  . ALA A 32  ? 0.0954 0.0940 0.1097 -0.0085 -0.0052 0.0043  33   ALA A CA  
230  C C   . ALA A 32  ? 0.0905 0.0900 0.1102 -0.0055 -0.0021 0.0025  33   ALA A C   
231  O O   . ALA A 32  ? 0.1071 0.1094 0.1318 -0.0042 -0.0012 0.0032  33   ALA A O   
232  C CB  . ALA A 32  ? 0.1089 0.1109 0.1278 -0.0093 -0.0093 0.0060  33   ALA A CB  
233  N N   . ALA A 33  ? 0.0886 0.0860 0.1068 -0.0050 -0.0002 0.0005  34   ALA A N   
234  C CA  . ALA A 33  ? 0.0924 0.0924 0.1158 -0.0021 0.0023  0.0003  34   ALA A CA  
235  C C   . ALA A 33  ? 0.1162 0.1179 0.1398 -0.0004 0.0057  0.0012  34   ALA A C   
236  O O   . ALA A 33  ? 0.1069 0.1147 0.1362 0.0007  0.0058  0.0022  34   ALA A O   
237  C CB  . ALA A 33  ? 0.1054 0.1021 0.1276 -0.0014 0.0042  -0.0008 34   ALA A CB  
238  N N   . ILE A 34  ? 0.0988 0.0961 0.1163 -0.0010 0.0085  0.0008  35   ILE A N   
239  C CA  . ILE A 34  ? 0.0896 0.0891 0.1082 0.0006  0.0123  0.0021  35   ILE A CA  
240  C C   . ILE A 34  ? 0.1016 0.1057 0.1234 -0.0008 0.0101  0.0033  35   ILE A C   
241  O O   . ILE A 34  ? 0.1054 0.1160 0.1328 0.0000  0.0113  0.0046  35   ILE A O   
242  C CB  . ILE A 34  ? 0.1306 0.1227 0.1408 0.0001  0.0170  0.0009  35   ILE A CB  
243  C CG1 . ILE A 34  ? 0.1402 0.1259 0.1479 0.0016  0.0213  -0.0007 35   ILE A CG1 
244  C CG2 . ILE A 34  ? 0.1475 0.1432 0.1607 0.0020  0.0212  0.0029  35   ILE A CG2 
245  C CD1 . ILE A 34  ? 0.1562 0.1312 0.1528 -0.0005 0.0268  -0.0036 35   ILE A CD1 
246  N N   . GLU A 35  ? 0.0986 0.1003 0.1175 -0.0031 0.0069  0.0034  36   GLU A N   
247  C CA  . GLU A 35  ? 0.1015 0.1054 0.1236 -0.0044 0.0059  0.0049  36   GLU A CA  
248  C C   . GLU A 35  ? 0.1104 0.1192 0.1400 -0.0043 0.0051  0.0042  36   GLU A C   
249  O O   . GLU A 35  ? 0.1121 0.1243 0.1450 -0.0056 0.0064  0.0044  36   GLU A O   
250  C CB  . GLU A 35  ? 0.1179 0.1186 0.1371 -0.0059 0.0027  0.0065  36   GLU A CB  
251  C CG  . GLU A 35  ? 0.1270 0.1241 0.1372 -0.0076 0.0030  0.0076  36   GLU A CG  
252  C CD  . GLU A 35  ? 0.1379 0.1345 0.1449 -0.0093 -0.0013 0.0104  36   GLU A CD  
253  O OE1 . GLU A 35  ? 0.1272 0.1260 0.1401 -0.0086 -0.0043 0.0115  36   GLU A OE1 
254  O OE2 . GLU A 35  ? 0.1370 0.1318 0.1356 -0.0116 -0.0015 0.0119  36   GLU A OE2 
255  N N   . GLY A 36  ? 0.0939 0.1031 0.1254 -0.0035 0.0033  0.0032  37   GLY A N   
256  C CA  . GLY A 36  ? 0.1043 0.1177 0.1411 -0.0041 0.0029  0.0021  37   GLY A CA  
257  C C   . GLY A 36  ? 0.0944 0.1151 0.1337 -0.0039 0.0043  0.0023  37   GLY A C   
258  O O   . GLY A 36  ? 0.0916 0.1172 0.1336 -0.0065 0.0045  0.0017  37   GLY A O   
259  N N   . ALA A 37  ? 0.0875 0.1093 0.1261 -0.0011 0.0056  0.0035  38   ALA A N   
260  C CA  . ALA A 37  ? 0.0875 0.1181 0.1303 0.0001  0.0070  0.0057  38   ALA A CA  
261  C C   . ALA A 37  ? 0.1129 0.1487 0.1580 -0.0014 0.0085  0.0069  38   ALA A C   
262  O O   . ALA A 37  ? 0.1054 0.1515 0.1552 -0.0031 0.0080  0.0083  38   ALA A O   
263  C CB  . ALA A 37  ? 0.0999 0.1285 0.1422 0.0044  0.0098  0.0076  38   ALA A CB  
264  N N   . THR A 38  ? 0.0972 0.1266 0.1385 -0.0013 0.0104  0.0067  39   THR A N   
265  C CA  . THR A 38  ? 0.0944 0.1276 0.1376 -0.0028 0.0127  0.0081  39   THR A CA  
266  C C   . THR A 38  ? 0.1194 0.1556 0.1648 -0.0076 0.0108  0.0066  39   THR A C   
267  O O   . THR A 38  ? 0.1183 0.1633 0.1683 -0.0102 0.0115  0.0077  39   THR A O   
268  C CB  . THR A 38  ? 0.1410 0.1653 0.1777 -0.0023 0.0151  0.0079  39   THR A CB  
269  O OG1 . THR A 38  ? 0.1749 0.1959 0.2090 0.0013  0.0182  0.0084  39   THR A OG1 
270  C CG2 . THR A 38  ? 0.1534 0.1809 0.1917 -0.0041 0.0178  0.0094  39   THR A CG2 
271  N N   . GLN A 39  ? 0.0915 0.1203 0.1340 -0.0092 0.0090  0.0044  40   GLN A N   
272  C CA  . GLN A 39  ? 0.0986 0.1275 0.1428 -0.0139 0.0090  0.0026  40   GLN A CA  
273  C C   . GLN A 39  ? 0.1208 0.1587 0.1683 -0.0171 0.0078  0.0010  40   GLN A C   
274  O O   . GLN A 39  ? 0.1197 0.1620 0.1689 -0.0224 0.0085  -0.0004 40   GLN A O   
275  C CB  . GLN A 39  ? 0.1105 0.1293 0.1525 -0.0138 0.0085  0.0015  40   GLN A CB  
276  C CG  . GLN A 39  ? 0.1209 0.1358 0.1642 -0.0181 0.0107  -0.0001 40   GLN A CG  
277  C CD  . GLN A 39  ? 0.1623 0.1791 0.2070 -0.0220 0.0111  -0.0039 40   GLN A CD  
278  O OE1 . GLN A 39  ? 0.2109 0.2262 0.2561 -0.0272 0.0136  -0.0062 40   GLN A OE1 
279  N NE2 . GLN A 39  ? 0.1104 0.1304 0.1550 -0.0205 0.0091  -0.0050 40   GLN A NE2 
280  N N   . ILE A 40  ? 0.0950 0.1353 0.1424 -0.0148 0.0059  0.0010  41   ILE A N   
281  C CA  . ILE A 40  ? 0.0912 0.1408 0.1402 -0.0182 0.0044  -0.0001 41   ILE A CA  
282  C C   . ILE A 40  ? 0.1398 0.2036 0.1934 -0.0197 0.0041  0.0032  41   ILE A C   
283  O O   . ILE A 40  ? 0.1522 0.2252 0.2069 -0.0259 0.0030  0.0020  41   ILE A O   
284  C CB  . ILE A 40  ? 0.1025 0.1515 0.1504 -0.0147 0.0030  0.0004  41   ILE A CB  
285  C CG1 . ILE A 40  ? 0.1042 0.1417 0.1494 -0.0145 0.0033  -0.0027 41   ILE A CG1 
286  C CG2 . ILE A 40  ? 0.1134 0.1745 0.1624 -0.0175 0.0011  0.0010  41   ILE A CG2 
287  C CD1 . ILE A 40  ? 0.1078 0.1426 0.1523 -0.0105 0.0024  -0.0020 41   ILE A CD1 
288  N N   . LYS A 41  ? 0.1024 0.1683 0.1588 -0.0146 0.0056  0.0073  42   LYS A N   
289  C CA  . LYS A 41  ? 0.1128 0.1932 0.1757 -0.0147 0.0060  0.0117  42   LYS A CA  
290  C C   . LYS A 41  ? 0.1330 0.2162 0.1978 -0.0197 0.0074  0.0110  42   LYS A C   
291  O O   . LYS A 41  ? 0.1643 0.2622 0.2343 -0.0241 0.0061  0.0129  42   LYS A O   
292  C CB  . LYS A 41  ? 0.1475 0.2270 0.2130 -0.0069 0.0091  0.0162  42   LYS A CB  
293  C CG  . LYS A 41  ? 0.1916 0.2859 0.2661 -0.0051 0.0111  0.0224  42   LYS A CG  
294  C CD  . LYS A 41  ? 0.3606 0.4648 0.4408 0.0000  0.0108  0.0282  42   LYS A CD  
295  C CE  . LYS A 41  ? 0.4586 0.5790 0.5500 0.0029  0.0133  0.0359  42   LYS A CE  
296  N NZ  . LYS A 41  ? 0.6069 0.7187 0.6994 0.0084  0.0202  0.0371  42   LYS A NZ  
297  N N   . THR A 42  ? 0.1131 0.1841 0.1744 -0.0189 0.0100  0.0094  43   THR A N   
298  C CA  . THR A 42  ? 0.1112 0.1846 0.1748 -0.0227 0.0124  0.0098  43   THR A CA  
299  C C   . THR A 42  ? 0.1501 0.2157 0.2103 -0.0292 0.0127  0.0054  43   THR A C   
300  O O   . THR A 42  ? 0.1377 0.2070 0.2005 -0.0343 0.0145  0.0054  43   THR A O   
301  C CB  . THR A 42  ? 0.1772 0.2428 0.2388 -0.0176 0.0163  0.0119  43   THR A CB  
302  O OG1 . THR A 42  ? 0.1677 0.2180 0.2217 -0.0168 0.0161  0.0092  43   THR A OG1 
303  C CG2 . THR A 42  ? 0.1705 0.2394 0.2345 -0.0105 0.0181  0.0156  43   THR A CG2 
304  N N   . GLY A 43  ? 0.1157 0.1703 0.1709 -0.0290 0.0118  0.0022  44   GLY A N   
305  C CA  . GLY A 43  ? 0.1297 0.1740 0.1820 -0.0338 0.0136  -0.0016 44   GLY A CA  
306  C C   . GLY A 43  ? 0.1830 0.2145 0.2324 -0.0307 0.0161  -0.0001 44   GLY A C   
307  O O   . GLY A 43  ? 0.2137 0.2352 0.2616 -0.0331 0.0183  -0.0019 44   GLY A O   
308  N N   . THR A 44  ? 0.1295 0.1611 0.1779 -0.0256 0.0163  0.0034  45   THR A N   
309  C CA  . THR A 44  ? 0.1294 0.1511 0.1738 -0.0233 0.0180  0.0055  45   THR A CA  
310  C C   . THR A 44  ? 0.1502 0.1655 0.1903 -0.0183 0.0156  0.0062  45   THR A C   
311  O O   . THR A 44  ? 0.1420 0.1608 0.1813 -0.0150 0.0141  0.0064  45   THR A O   
312  C CB  . THR A 44  ? 0.2035 0.2290 0.2478 -0.0223 0.0206  0.0083  45   THR A CB  
313  O OG1 . THR A 44  ? 0.1966 0.2291 0.2460 -0.0277 0.0227  0.0080  45   THR A OG1 
314  C CG2 . THR A 44  ? 0.2429 0.2587 0.2811 -0.0206 0.0223  0.0108  45   THR A CG2 
315  N N   . LEU A 45  ? 0.1271 0.1334 0.1650 -0.0178 0.0157  0.0073  46   LEU A N   
316  C CA  . LEU A 45  ? 0.1217 0.1236 0.1564 -0.0141 0.0130  0.0089  46   LEU A CA  
317  C C   . LEU A 45  ? 0.1537 0.1520 0.1826 -0.0130 0.0134  0.0127  46   LEU A C   
318  O O   . LEU A 45  ? 0.1712 0.1652 0.1996 -0.0142 0.0155  0.0154  46   LEU A O   
319  C CB  . LEU A 45  ? 0.1308 0.1269 0.1684 -0.0139 0.0129  0.0090  46   LEU A CB  
320  C CG  . LEU A 45  ? 0.1542 0.1484 0.1906 -0.0104 0.0096  0.0114  46   LEU A CG  
321  C CD1 . LEU A 45  ? 0.1367 0.1357 0.1724 -0.0091 0.0069  0.0087  46   LEU A CD1 
322  C CD2 . LEU A 45  ? 0.1756 0.1643 0.2171 -0.0094 0.0109  0.0129  46   LEU A CD2 
323  N N   . THR A 46  ? 0.1292 0.1288 0.1527 -0.0112 0.0122  0.0127  47   THR A N   
324  C CA  . THR A 46  ? 0.1308 0.1272 0.1462 -0.0112 0.0128  0.0154  47   THR A CA  
325  C C   . THR A 46  ? 0.1434 0.1385 0.1526 -0.0103 0.0095  0.0152  47   THR A C   
326  O O   . THR A 46  ? 0.1607 0.1574 0.1705 -0.0092 0.0091  0.0122  47   THR A O   
327  C CB  . THR A 46  ? 0.2653 0.2638 0.2787 -0.0118 0.0172  0.0148  47   THR A CB  
328  O OG1 . THR A 46  ? 0.2614 0.2618 0.2807 -0.0139 0.0198  0.0154  47   THR A OG1 
329  C CG2 . THR A 46  ? 0.2680 0.2623 0.2708 -0.0125 0.0188  0.0168  47   THR A CG2 
330  N N   . SER A 47  ? 0.1371 0.1298 0.1406 -0.0111 0.0071  0.0189  48   SER A N   
331  C CA  A SER A 47  ? 0.1319 0.1246 0.1285 -0.0120 0.0035  0.0187  48   SER A CA  
332  C CA  B SER A 47  ? 0.1379 0.1306 0.1344 -0.0120 0.0035  0.0188  48   SER A CA  
333  C C   . SER A 47  ? 0.1651 0.1553 0.1517 -0.0136 0.0067  0.0156  48   SER A C   
334  O O   . SER A 47  ? 0.1666 0.1547 0.1476 -0.0147 0.0102  0.0166  48   SER A O   
335  C CB  A SER A 47  ? 0.1482 0.1418 0.1418 -0.0131 -0.0006 0.0246  48   SER A CB  
336  C CB  B SER A 47  ? 0.1708 0.1642 0.1642 -0.0131 -0.0002 0.0248  48   SER A CB  
337  O OG  A SER A 47  ? 0.1590 0.1546 0.1628 -0.0108 -0.0029 0.0275  48   SER A OG  
338  O OG  B SER A 47  ? 0.2065 0.2020 0.1940 -0.0151 -0.0045 0.0246  48   SER A OG  
339  N N   . LEU A 48  ? 0.1281 0.1173 0.1123 -0.0138 0.0064  0.0117  49   LEU A N   
340  C CA  . LEU A 48  ? 0.1359 0.1204 0.1112 -0.0149 0.0113  0.0080  49   LEU A CA  
341  C C   . LEU A 48  ? 0.1580 0.1390 0.1206 -0.0195 0.0091  0.0066  49   LEU A C   
342  O O   . LEU A 48  ? 0.1679 0.1522 0.1302 -0.0216 0.0029  0.0089  49   LEU A O   
343  C CB  . LEU A 48  ? 0.1287 0.1134 0.1109 -0.0116 0.0145  0.0049  49   LEU A CB  
344  C CG  . LEU A 48  ? 0.1247 0.1152 0.1190 -0.0084 0.0160  0.0063  49   LEU A CG  
345  C CD1 . LEU A 48  ? 0.1529 0.1461 0.1545 -0.0054 0.0173  0.0047  49   LEU A CD1 
346  C CD2 . LEU A 48  ? 0.1480 0.1386 0.1411 -0.0081 0.0217  0.0073  49   LEU A CD2 
347  N N   . SER A 49  ? 0.1632 0.1376 0.1150 -0.0216 0.0148  0.0030  50   SER A N   
348  C CA  . SER A 49  ? 0.1684 0.1384 0.1045 -0.0279 0.0139  0.0008  50   SER A CA  
349  C C   . SER A 49  ? 0.2038 0.1701 0.1361 -0.0308 0.0133  -0.0040 50   SER A C   
350  O O   . SER A 49  ? 0.2191 0.1772 0.1482 -0.0302 0.0205  -0.0089 50   SER A O   
351  C CB  . SER A 49  ? 0.2094 0.1720 0.1330 -0.0300 0.0217  -0.0018 50   SER A CB  
352  O OG  . SER A 49  ? 0.2171 0.1753 0.1230 -0.0377 0.0209  -0.0045 50   SER A OG  
353  N N   . GLU A 50  ? 0.1865 0.1584 0.1182 -0.0346 0.0053  -0.0022 51   GLU A N   
354  C CA  . GLU A 50  ? 0.1769 0.1455 0.1027 -0.0395 0.0043  -0.0067 51   GLU A CA  
355  C C   . GLU A 50  ? 0.2251 0.1847 0.1313 -0.0471 0.0090  -0.0120 51   GLU A C   
356  O O   . GLU A 50  ? 0.2269 0.1775 0.1268 -0.0502 0.0138  -0.0183 51   GLU A O   
357  C CB  . GLU A 50  ? 0.2022 0.1810 0.1314 -0.0430 -0.0055 -0.0026 51   GLU A CB  
358  C CG  . GLU A 50  ? 0.2194 0.2050 0.1667 -0.0365 -0.0090 0.0010  51   GLU A CG  
359  C CD  . GLU A 50  ? 0.2578 0.2491 0.2146 -0.0313 -0.0108 0.0073  51   GLU A CD  
360  O OE1 . GLU A 50  ? 0.2927 0.2845 0.2427 -0.0328 -0.0109 0.0104  51   GLU A OE1 
361  O OE2 . GLU A 50  ? 0.2490 0.2434 0.2195 -0.0260 -0.0115 0.0090  51   GLU A OE2 
362  N N   . GLU A 51  ? 0.2188 0.1805 0.1144 -0.0509 0.0075  -0.0093 52   GLU A N   
363  C CA  . GLU A 51  ? 0.2281 0.1815 0.1025 -0.0595 0.0117  -0.0145 52   GLU A CA  
364  C C   . GLU A 51  ? 0.2530 0.1919 0.1230 -0.0571 0.0245  -0.0213 52   GLU A C   
365  O O   . GLU A 51  ? 0.2788 0.2070 0.1338 -0.0639 0.0300  -0.0284 52   GLU A O   
366  C CB  . GLU A 51  ? 0.2517 0.2104 0.1163 -0.0629 0.0085  -0.0095 52   GLU A CB  
367  C CG  . GLU A 51  ? 0.2802 0.2332 0.1205 -0.0745 0.0101  -0.0145 52   GLU A CG  
368  C CD  . GLU A 51  ? 0.3412 0.3005 0.1749 -0.0838 0.0017  -0.0155 52   GLU A CD  
369  O OE1 . GLU A 51  ? 0.3306 0.3044 0.1758 -0.0824 -0.0086 -0.0078 52   GLU A OE1 
370  O OE2 . GLU A 51  ? 0.3937 0.3436 0.2109 -0.0930 0.0059  -0.0239 52   GLU A OE2 
371  N N   . GLN A 52  ? 0.2177 0.1565 0.1007 -0.0478 0.0297  -0.0189 53   GLN A N   
372  C CA  . GLN A 52  ? 0.2251 0.1522 0.1073 -0.0442 0.0421  -0.0236 53   GLN A CA  
373  C C   . GLN A 52  ? 0.2608 0.1799 0.1442 -0.0445 0.0457  -0.0287 53   GLN A C   
374  O O   . GLN A 52  ? 0.2689 0.1741 0.1411 -0.0474 0.0557  -0.0350 53   GLN A O   
375  C CB  . GLN A 52  ? 0.2182 0.1506 0.1174 -0.0343 0.0452  -0.0189 53   GLN A CB  
376  C CG  . GLN A 52  ? 0.2422 0.1649 0.1437 -0.0294 0.0581  -0.0219 53   GLN A CG  
377  C CD  . GLN A 52  ? 0.2449 0.1756 0.1633 -0.0209 0.0603  -0.0166 53   GLN A CD  
378  O OE1 . GLN A 52  ? 0.2227 0.1630 0.1466 -0.0202 0.0545  -0.0120 53   GLN A OE1 
379  N NE2 . GLN A 52  ? 0.2210 0.1475 0.1471 -0.0148 0.0699  -0.0171 53   GLN A NE2 
380  N N   . ILE A 53  ? 0.2357 0.1623 0.1329 -0.0413 0.0389  -0.0261 54   ILE A N   
381  C CA  . ILE A 53  ? 0.2300 0.1491 0.1290 -0.0413 0.0426  -0.0303 54   ILE A CA  
382  C C   . ILE A 53  ? 0.2917 0.2031 0.1727 -0.0528 0.0421  -0.0367 54   ILE A C   
383  O O   . ILE A 53  ? 0.2885 0.1852 0.1612 -0.0553 0.0518  -0.0430 54   ILE A O   
384  C CB  . ILE A 53  ? 0.2380 0.1679 0.1546 -0.0362 0.0349  -0.0258 54   ILE A CB  
385  C CG1 . ILE A 53  ? 0.2371 0.1748 0.1696 -0.0265 0.0355  -0.0202 54   ILE A CG1 
386  C CG2 . ILE A 53  ? 0.2743 0.1962 0.1930 -0.0361 0.0391  -0.0294 54   ILE A CG2 
387  C CD1 . ILE A 53  ? 0.2733 0.2202 0.2220 -0.0215 0.0296  -0.0165 54   ILE A CD1 
388  N N   . VAL A 54  ? 0.2528 0.1736 0.1271 -0.0602 0.0318  -0.0348 55   VAL A N   
389  C CA  . VAL A 54  ? 0.2652 0.1818 0.1221 -0.0728 0.0298  -0.0404 55   VAL A CA  
390  C C   . VAL A 54  ? 0.3382 0.2391 0.1740 -0.0793 0.0405  -0.0479 55   VAL A C   
391  O O   . VAL A 54  ? 0.3650 0.2526 0.1886 -0.0867 0.0470  -0.0559 55   VAL A O   
392  C CB  . VAL A 54  ? 0.3081 0.2417 0.1642 -0.0783 0.0159  -0.0345 55   VAL A CB  
393  C CG1 . VAL A 54  ? 0.3338 0.2665 0.1695 -0.0930 0.0127  -0.0392 55   VAL A CG1 
394  C CG2 . VAL A 54  ? 0.2883 0.2346 0.1643 -0.0727 0.0074  -0.0286 55   VAL A CG2 
395  N N   . ASP A 55  ? 0.3097 0.2109 0.1415 -0.0766 0.0437  -0.0455 56   ASP A N   
396  C CA  . ASP A 55  ? 0.3243 0.2109 0.1356 -0.0826 0.0546  -0.0523 56   ASP A CA  
397  C C   . ASP A 55  ? 0.3779 0.2465 0.1906 -0.0767 0.0709  -0.0577 56   ASP A C   
398  O O   . ASP A 55  ? 0.4094 0.2614 0.2032 -0.0840 0.0816  -0.0660 56   ASP A O   
399  C CB  . ASP A 55  ? 0.3361 0.2292 0.1439 -0.0808 0.0534  -0.0472 56   ASP A CB  
400  C CG  . ASP A 55  ? 0.3792 0.2885 0.1829 -0.0865 0.0394  -0.0408 56   ASP A CG  
401  O OD1 . ASP A 55  ? 0.3559 0.2723 0.1567 -0.0938 0.0302  -0.0408 56   ASP A OD1 
402  O OD2 . ASP A 55  ? 0.3783 0.2928 0.1801 -0.0846 0.0385  -0.0358 56   ASP A OD2 
403  N N   . CYS A 56  ? 0.3417 0.2139 0.1762 -0.0637 0.0735  -0.0525 57   CYS A N   
404  C CA  . CYS A 56  ? 0.3421 0.2015 0.1825 -0.0554 0.0886  -0.0541 57   CYS A CA  
405  C C   . CYS A 56  ? 0.3823 0.2335 0.2322 -0.0511 0.0942  -0.0559 57   CYS A C   
406  O O   . CYS A 56  ? 0.3975 0.2340 0.2471 -0.0469 0.1088  -0.0587 57   CYS A O   
407  C CB  . CYS A 56  ? 0.3153 0.1861 0.1731 -0.0442 0.0883  -0.0460 57   CYS A CB  
408  S SG  . CYS A 56  ? 0.3537 0.2330 0.2018 -0.0480 0.0835  -0.0429 57   CYS A SG  
409  N N   . ASP A 57  ? 0.3251 0.1863 0.1858 -0.0507 0.0836  -0.0530 58   ASP A N   
410  C CA  . ASP A 57  ? 0.3199 0.1746 0.1904 -0.0464 0.0880  -0.0535 58   ASP A CA  
411  C C   . ASP A 57  ? 0.4190 0.2581 0.2716 -0.0582 0.0923  -0.0628 58   ASP A C   
412  O O   . ASP A 57  ? 0.4214 0.2662 0.2736 -0.0646 0.0830  -0.0637 58   ASP A O   
413  C CB  . ASP A 57  ? 0.3070 0.1794 0.1952 -0.0417 0.0750  -0.0467 58   ASP A CB  
414  C CG  . ASP A 57  ? 0.2950 0.1631 0.1931 -0.0381 0.0776  -0.0464 58   ASP A CG  
415  O OD1 . ASP A 57  ? 0.3276 0.1793 0.2230 -0.0361 0.0908  -0.0497 58   ASP A OD1 
416  O OD2 . ASP A 57  ? 0.2853 0.1655 0.1940 -0.0367 0.0676  -0.0425 58   ASP A OD2 
417  N N   . THR A 58  ? 0.4190 0.2386 0.2572 -0.0615 0.1070  -0.0698 59   THR A N   
418  C CA  . THR A 58  ? 0.4626 0.2642 0.2796 -0.0748 0.1135  -0.0805 59   THR A CA  
419  C C   . THR A 58  ? 0.5768 0.3549 0.3938 -0.0706 0.1323  -0.0851 59   THR A C   
420  O O   . THR A 58  ? 0.6211 0.3803 0.4196 -0.0816 0.1408  -0.0950 59   THR A O   
421  C CB  . THR A 58  ? 0.6145 0.4124 0.4078 -0.0860 0.1142  -0.0863 59   THR A CB  
422  O OG1 . THR A 58  ? 0.5977 0.3883 0.3912 -0.0783 0.1264  -0.0853 59   THR A OG1 
423  C CG2 . THR A 58  ? 0.6127 0.4330 0.4043 -0.0915 0.0958  -0.0814 59   THR A CG2 
424  N N   . ASN A 59  ? 0.5261 0.3051 0.3634 -0.0553 0.1392  -0.0777 60   ASN A N   
425  C CA  . ASN A 59  ? 0.5382 0.2957 0.3782 -0.0494 0.1579  -0.0798 60   ASN A CA  
426  C C   . ASN A 59  ? 0.5751 0.3337 0.4308 -0.0440 0.1562  -0.0756 60   ASN A C   
427  O O   . ASN A 59  ? 0.6058 0.3477 0.4665 -0.0379 0.1710  -0.0755 60   ASN A O   
428  C CB  . ASN A 59  ? 0.5454 0.3023 0.3968 -0.0361 0.1693  -0.0738 60   ASN A CB  
429  C CG  . ASN A 59  ? 0.8725 0.6208 0.7056 -0.0420 0.1768  -0.0798 60   ASN A CG  
430  O OD1 . ASN A 59  ? 0.8435 0.5692 0.6561 -0.0511 0.1894  -0.0902 60   ASN A OD1 
431  N ND2 . ASN A 59  ? 0.7610 0.5264 0.6003 -0.0376 0.1697  -0.0739 60   ASN A ND2 
432  N N   . GLY A 60  ? 0.4850 0.2620 0.3475 -0.0466 0.1391  -0.0721 61   GLY A N   
433  C CA  . GLY A 60  ? 0.4700 0.2498 0.3463 -0.0424 0.1360  -0.0680 61   GLY A CA  
434  C C   . GLY A 60  ? 0.5199 0.3000 0.3864 -0.0557 0.1271  -0.0740 61   GLY A C   
435  O O   . GLY A 60  ? 0.5413 0.3076 0.3875 -0.0690 0.1312  -0.0839 61   GLY A O   
436  N N   . ASN A 61  ? 0.4628 0.2594 0.3435 -0.0528 0.1148  -0.0679 62   ASN A N   
437  C CA  . ASN A 61  ? 0.4557 0.2551 0.3308 -0.0643 0.1062  -0.0720 62   ASN A CA  
438  C C   . ASN A 61  ? 0.4702 0.2901 0.3419 -0.0716 0.0890  -0.0711 62   ASN A C   
439  O O   . ASN A 61  ? 0.4651 0.2917 0.3344 -0.0809 0.0802  -0.0730 62   ASN A O   
440  C CB  . ASN A 61  ? 0.4630 0.2671 0.3554 -0.0572 0.1042  -0.0660 62   ASN A CB  
441  C CG  . ASN A 61  ? 0.7634 0.5483 0.6607 -0.0495 0.1206  -0.0651 62   ASN A CG  
442  O OD1 . ASN A 61  ? 0.7347 0.4971 0.6191 -0.0563 0.1332  -0.0730 62   ASN A OD1 
443  N ND2 . ASN A 61  ? 0.6273 0.4206 0.5433 -0.0353 0.1213  -0.0551 62   ASN A ND2 
444  N N   . ASP A 62  ? 0.3760 0.2070 0.2494 -0.0668 0.0845  -0.0670 63   ASP A N   
445  C CA  . ASP A 62  ? 0.3397 0.1898 0.2113 -0.0720 0.0694  -0.0645 63   ASP A CA  
446  C C   . ASP A 62  ? 0.3964 0.2405 0.2454 -0.0850 0.0701  -0.0717 63   ASP A C   
447  O O   . ASP A 62  ? 0.4357 0.2651 0.2731 -0.0854 0.0816  -0.0762 63   ASP A O   
448  C CB  . ASP A 62  ? 0.3106 0.1760 0.1968 -0.0604 0.0639  -0.0558 63   ASP A CB  
449  C CG  . ASP A 62  ? 0.3222 0.1946 0.2287 -0.0491 0.0627  -0.0490 63   ASP A CG  
450  O OD1 . ASP A 62  ? 0.2965 0.1720 0.2083 -0.0514 0.0582  -0.0487 63   ASP A OD1 
451  O OD2 . ASP A 62  ? 0.3018 0.1777 0.2187 -0.0386 0.0660  -0.0438 63   ASP A OD2 
452  N N   . LYS A 63  ? 0.3620 0.2185 0.2049 -0.0958 0.0578  -0.0722 64   LYS A N   
453  C CA  . LYS A 63  ? 0.3911 0.2440 0.2108 -0.1113 0.0565  -0.0792 64   LYS A CA  
454  C C   . LYS A 63  ? 0.4451 0.3191 0.2625 -0.1154 0.0420  -0.0735 64   LYS A C   
455  O O   . LYS A 63  ? 0.4553 0.3367 0.2613 -0.1287 0.0341  -0.0758 64   LYS A O   
456  C CB  . LYS A 63  ? 0.4349 0.2812 0.2460 -0.1246 0.0565  -0.0863 64   LYS A CB  
457  C CG  . LYS A 63  ? 0.4576 0.2816 0.2707 -0.1215 0.0714  -0.0916 64   LYS A CG  
458  C CD  . LYS A 63  ? 0.4978 0.2975 0.2949 -0.1225 0.0886  -0.0994 64   LYS A CD  
459  C CE  . LYS A 63  ? 0.6215 0.4013 0.4271 -0.1132 0.1042  -0.1006 64   LYS A CE  
460  N NZ  . LYS A 63  ? 0.6958 0.4532 0.4893 -0.1113 0.1218  -0.1063 64   LYS A NZ  
461  N N   . GLY A 64  ? 0.4143 0.2981 0.2422 -0.1044 0.0390  -0.0659 65   GLY A N   
462  C CA  . GLY A 64  ? 0.4161 0.3181 0.2425 -0.1068 0.0269  -0.0595 65   GLY A CA  
463  C C   . GLY A 64  ? 0.4193 0.3407 0.2537 -0.1115 0.0125  -0.0542 65   GLY A C   
464  O O   . GLY A 64  ? 0.3714 0.2996 0.2244 -0.1043 0.0090  -0.0499 65   GLY A O   
465  N N   . CYS A 65  ? 0.3974 0.3284 0.2174 -0.1242 0.0043  -0.0541 66   CYS A N   
466  C CA  . CYS A 65  ? 0.3789 0.3307 0.2063 -0.1297 -0.0096 -0.0479 66   CYS A CA  
467  C C   . CYS A 65  ? 0.3933 0.3416 0.2219 -0.1373 -0.0091 -0.0535 66   CYS A C   
468  O O   . CYS A 65  ? 0.3901 0.3556 0.2294 -0.1400 -0.0195 -0.0480 66   CYS A O   
469  C CB  . CYS A 65  ? 0.4013 0.3660 0.2130 -0.1413 -0.0185 -0.0451 66   CYS A CB  
470  S SG  . CYS A 65  ? 0.4325 0.4070 0.2473 -0.1320 -0.0222 -0.0349 66   CYS A SG  
471  N N   . ASN A 66  ? 0.3743 0.3003 0.1939 -0.1397 0.0036  -0.0636 67   ASN A N   
472  C CA  . ASN A 66  ? 0.3825 0.3016 0.2017 -0.1475 0.0062  -0.0698 67   ASN A CA  
473  C C   . ASN A 66  ? 0.4218 0.3369 0.2624 -0.1344 0.0105  -0.0670 67   ASN A C   
474  O O   . ASN A 66  ? 0.4459 0.3521 0.2869 -0.1391 0.0149  -0.0721 67   ASN A O   
475  C CB  . ASN A 66  ? 0.4168 0.3120 0.2121 -0.1593 0.0188  -0.0827 67   ASN A CB  
476  C CG  . ASN A 66  ? 0.5979 0.4963 0.3693 -0.1742 0.0150  -0.0865 67   ASN A CG  
477  O OD1 . ASN A 66  ? 0.4937 0.4147 0.2650 -0.1810 0.0008  -0.0803 67   ASN A OD1 
478  N ND2 . ASN A 66  ? 0.5775 0.4536 0.3278 -0.1798 0.0281  -0.0965 67   ASN A ND2 
479  N N   . GLY A 67  ? 0.3497 0.2720 0.2071 -0.1193 0.0087  -0.0590 68   GLY A N   
480  C CA  . GLY A 67  ? 0.3247 0.2465 0.2019 -0.1071 0.0112  -0.0552 68   GLY A CA  
481  C C   . GLY A 67  ? 0.3610 0.2661 0.2411 -0.0962 0.0238  -0.0570 68   GLY A C   
482  O O   . GLY A 67  ? 0.3886 0.2785 0.2552 -0.0980 0.0335  -0.0625 68   GLY A O   
483  N N   . GLY A 68  ? 0.3200 0.2293 0.2184 -0.0846 0.0238  -0.0515 69   GLY A N   
484  C CA  . GLY A 68  ? 0.2921 0.1905 0.1973 -0.0730 0.0340  -0.0507 69   GLY A CA  
485  C C   . GLY A 68  ? 0.2972 0.2059 0.2221 -0.0631 0.0300  -0.0438 69   GLY A C   
486  O O   . GLY A 68  ? 0.2898 0.2089 0.2215 -0.0661 0.0224  -0.0418 69   GLY A O   
487  N N   . THR A 69  ? 0.2460 0.1527 0.1802 -0.0516 0.0353  -0.0401 70   THR A N   
488  C CA  . THR A 69  ? 0.2189 0.1359 0.1699 -0.0429 0.0315  -0.0338 70   THR A CA  
489  C C   . THR A 69  ? 0.2227 0.1478 0.1818 -0.0336 0.0304  -0.0286 70   THR A C   
490  O O   . THR A 69  ? 0.2357 0.1543 0.1898 -0.0311 0.0366  -0.0294 70   THR A O   
491  C CB  . THR A 69  ? 0.2806 0.1878 0.2373 -0.0385 0.0397  -0.0337 70   THR A CB  
492  O OG1 . THR A 69  ? 0.3000 0.1968 0.2560 -0.0318 0.0501  -0.0333 70   THR A OG1 
493  C CG2 . THR A 69  ? 0.2775 0.1753 0.2275 -0.0477 0.0421  -0.0390 70   THR A CG2 
494  N N   . PRO A 70  ? 0.1878 0.1259 0.1596 -0.0284 0.0237  -0.0233 71   PRO A N   
495  C CA  . PRO A 70  ? 0.1681 0.1132 0.1474 -0.0204 0.0234  -0.0188 71   PRO A CA  
496  C C   . PRO A 70  ? 0.1913 0.1294 0.1733 -0.0136 0.0327  -0.0176 71   PRO A C   
497  O O   . PRO A 70  ? 0.1781 0.1173 0.1600 -0.0101 0.0352  -0.0161 71   PRO A O   
498  C CB  . PRO A 70  ? 0.1699 0.1271 0.1613 -0.0172 0.0167  -0.0147 71   PRO A CB  
499  C CG  . PRO A 70  ? 0.2071 0.1672 0.1966 -0.0242 0.0109  -0.0162 71   PRO A CG  
500  C CD  . PRO A 70  ? 0.1833 0.1305 0.1627 -0.0302 0.0168  -0.0214 71   PRO A CD  
501  N N   . ASP A 71  ? 0.1831 0.1133 0.1671 -0.0117 0.0388  -0.0178 72   ASP A N   
502  C CA  . ASP A 71  ? 0.1884 0.1130 0.1766 -0.0041 0.0482  -0.0148 72   ASP A CA  
503  C C   . ASP A 71  ? 0.2309 0.1431 0.2093 -0.0056 0.0569  -0.0186 72   ASP A C   
504  O O   . ASP A 71  ? 0.2350 0.1480 0.2179 0.0010  0.0624  -0.0151 72   ASP A O   
505  C CB  . ASP A 71  ? 0.2054 0.1234 0.1980 -0.0014 0.0538  -0.0132 72   ASP A CB  
506  C CG  . ASP A 71  ? 0.2430 0.1732 0.2466 0.0025  0.0479  -0.0080 72   ASP A CG  
507  O OD1 . ASP A 71  ? 0.2261 0.1700 0.2349 0.0039  0.0402  -0.0055 72   ASP A OD1 
508  O OD2 . ASP A 71  ? 0.2275 0.1528 0.2341 0.0042  0.0517  -0.0062 72   ASP A OD2 
509  N N   . GLY A 72  ? 0.2158 0.1170 0.1806 -0.0145 0.0585  -0.0255 73   GLY A N   
510  C CA  . GLY A 72  ? 0.2006 0.0889 0.1533 -0.0173 0.0672  -0.0302 73   GLY A CA  
511  C C   . GLY A 72  ? 0.2464 0.1437 0.1983 -0.0159 0.0635  -0.0283 73   GLY A C   
512  O O   . GLY A 72  ? 0.2569 0.1483 0.2070 -0.0123 0.0720  -0.0282 73   GLY A O   
513  N N   . ALA A 73  ? 0.2091 0.1204 0.1632 -0.0186 0.0515  -0.0266 74   ALA A N   
514  C CA  . ALA A 73  ? 0.1934 0.1137 0.1480 -0.0173 0.0475  -0.0241 74   ALA A CA  
515  C C   . ALA A 73  ? 0.2135 0.1411 0.1816 -0.0075 0.0503  -0.0181 74   ALA A C   
516  O O   . ALA A 73  ? 0.1964 0.1237 0.1634 -0.0052 0.0548  -0.0172 74   ALA A O   
517  C CB  . ALA A 73  ? 0.1847 0.1175 0.1409 -0.0212 0.0353  -0.0223 74   ALA A CB  
518  N N   . PHE A 74  ? 0.1799 0.1149 0.1605 -0.0023 0.0478  -0.0139 75   PHE A N   
519  C CA  . PHE A 74  ? 0.1600 0.1038 0.1531 0.0059  0.0499  -0.0078 75   PHE A CA  
520  C C   . PHE A 74  ? 0.2118 0.1463 0.2050 0.0108  0.0623  -0.0069 75   PHE A C   
521  O O   . PHE A 74  ? 0.1968 0.1369 0.1951 0.0150  0.0652  -0.0035 75   PHE A O   
522  C CB  . PHE A 74  ? 0.1499 0.1024 0.1541 0.0096  0.0457  -0.0037 75   PHE A CB  
523  C CG  . PHE A 74  ? 0.1339 0.0952 0.1397 0.0058  0.0353  -0.0041 75   PHE A CG  
524  C CD1 . PHE A 74  ? 0.1275 0.0951 0.1316 0.0030  0.0292  -0.0046 75   PHE A CD1 
525  C CD2 . PHE A 74  ? 0.1303 0.0934 0.1402 0.0059  0.0325  -0.0034 75   PHE A CD2 
526  C CE1 . PHE A 74  ? 0.1484 0.1231 0.1553 0.0004  0.0211  -0.0044 75   PHE A CE1 
527  C CE2 . PHE A 74  ? 0.1463 0.1168 0.1583 0.0029  0.0242  -0.0038 75   PHE A CE2 
528  C CZ  . PHE A 74  ? 0.1430 0.1191 0.1540 0.0005  0.0189  -0.0041 75   PHE A CZ  
529  N N   . GLN A 75  ? 0.2023 0.1223 0.1904 0.0101  0.0701  -0.0098 76   GLN A N   
530  C CA  . GLN A 75  ? 0.2092 0.1181 0.1980 0.0154  0.0838  -0.0088 76   GLN A CA  
531  C C   . GLN A 75  ? 0.2435 0.1468 0.2232 0.0131  0.0890  -0.0123 76   GLN A C   
532  O O   . GLN A 75  ? 0.2453 0.1495 0.2316 0.0197  0.0971  -0.0083 76   GLN A O   
533  C CB  . GLN A 75  ? 0.2526 0.1436 0.2349 0.0134  0.0921  -0.0128 76   GLN A CB  
534  C CG  . GLN A 75  ? 0.3343 0.2143 0.3218 0.0216  0.1075  -0.0094 76   GLN A CG  
535  C CD  . GLN A 75  ? 0.4817 0.3773 0.4885 0.0327  0.1074  0.0018  76   GLN A CD  
536  O OE1 . GLN A 75  ? 0.4486 0.3522 0.4642 0.0357  0.1026  0.0069  76   GLN A OE1 
537  N NE2 . GLN A 75  ? 0.4200 0.3214 0.4336 0.0386  0.1127  0.0063  76   GLN A NE2 
538  N N   . TYR A 76  ? 0.2186 0.1175 0.1835 0.0037  0.0841  -0.0189 77   TYR A N   
539  C CA  . TYR A 76  ? 0.2353 0.1293 0.1896 0.0005  0.0884  -0.0222 77   TYR A CA  
540  C C   . TYR A 76  ? 0.2486 0.1583 0.2136 0.0057  0.0846  -0.0160 77   TYR A C   
541  O O   . TYR A 76  ? 0.2397 0.1467 0.2049 0.0090  0.0932  -0.0150 77   TYR A O   
542  C CB  . TYR A 76  ? 0.2438 0.1344 0.1810 -0.0110 0.0815  -0.0288 77   TYR A CB  
543  C CG  . TYR A 76  ? 0.2527 0.1443 0.1811 -0.0138 0.0822  -0.0298 77   TYR A CG  
544  C CD1 . TYR A 76  ? 0.2714 0.1485 0.1885 -0.0150 0.0950  -0.0341 77   TYR A CD1 
545  C CD2 . TYR A 76  ? 0.2608 0.1673 0.1934 -0.0141 0.0717  -0.0259 77   TYR A CD2 
546  C CE1 . TYR A 76  ? 0.2868 0.1653 0.1965 -0.0170 0.0965  -0.0344 77   TYR A CE1 
547  C CE2 . TYR A 76  ? 0.2548 0.1625 0.1808 -0.0157 0.0731  -0.0257 77   TYR A CE2 
548  C CZ  . TYR A 76  ? 0.2805 0.1747 0.1945 -0.0175 0.0851  -0.0300 77   TYR A CZ  
549  O OH  . TYR A 76  ? 0.2945 0.1902 0.2022 -0.0189 0.0870  -0.0294 77   TYR A OH  
550  N N   . VAL A 77  ? 0.1879 0.1133 0.1616 0.0060  0.0727  -0.0122 78   VAL A N   
551  C CA  . VAL A 77  ? 0.1722 0.1115 0.1549 0.0093  0.0691  -0.0073 78   VAL A CA  
552  C C   . VAL A 77  ? 0.2178 0.1636 0.2155 0.0182  0.0758  -0.0008 78   VAL A C   
553  O O   . VAL A 77  ? 0.2252 0.1763 0.2273 0.0210  0.0797  0.0021  78   VAL A O   
554  C CB  . VAL A 77  ? 0.1816 0.1337 0.1688 0.0067  0.0561  -0.0055 78   VAL A CB  
555  C CG1 . VAL A 77  ? 0.1750 0.1402 0.1712 0.0091  0.0533  -0.0010 78   VAL A CG1 
556  C CG2 . VAL A 77  ? 0.1856 0.1328 0.1593 -0.0015 0.0501  -0.0103 78   VAL A CG2 
557  N N   . VAL A 78  ? 0.1953 0.1409 0.2009 0.0228  0.0777  0.0020  79   VAL A N   
558  C CA  . VAL A 78  ? 0.2111 0.1638 0.2317 0.0319  0.0845  0.0097  79   VAL A CA  
559  C C   . VAL A 78  ? 0.2685 0.2094 0.2863 0.0352  0.0986  0.0092  79   VAL A C   
560  O O   . VAL A 78  ? 0.2831 0.2334 0.3110 0.0404  0.1028  0.0147  79   VAL A O   
561  C CB  . VAL A 78  ? 0.2353 0.1875 0.2627 0.0359  0.0849  0.0131  79   VAL A CB  
562  C CG1 . VAL A 78  ? 0.2452 0.2029 0.2875 0.0459  0.0939  0.0222  79   VAL A CG1 
563  C CG2 . VAL A 78  ? 0.2211 0.1870 0.2530 0.0334  0.0718  0.0146  79   VAL A CG2 
564  N N   . ASN A 79  ? 0.2349 0.1555 0.2388 0.0317  0.1065  0.0022  80   ASN A N   
565  C CA  . ASN A 79  ? 0.2498 0.1553 0.2487 0.0343  0.1222  0.0003  80   ASN A CA  
566  C C   . ASN A 79  ? 0.3019 0.2093 0.2944 0.0313  0.1234  -0.0018 80   ASN A C   
567  O O   . ASN A 79  ? 0.3174 0.2233 0.3152 0.0369  0.1346  0.0012  80   ASN A O   
568  C CB  . ASN A 79  ? 0.2773 0.1596 0.2597 0.0285  0.1293  -0.0084 80   ASN A CB  
569  C CG  . ASN A 79  ? 0.3766 0.2526 0.3655 0.0327  0.1332  -0.0060 80   ASN A CG  
570  O OD1 . ASN A 79  ? 0.4047 0.2936 0.4111 0.0411  0.1316  0.0032  80   ASN A OD1 
571  N ND2 . ASN A 79  ? 0.4032 0.2606 0.3776 0.0257  0.1370  -0.0142 80   ASN A ND2 
572  N N   . ASN A 80  ? 0.2500 0.1617 0.2324 0.0231  0.1122  -0.0060 81   ASN A N   
573  C CA  . ASN A 80  ? 0.2639 0.1775 0.2393 0.0197  0.1124  -0.0075 81   ASN A CA  
574  C C   . ASN A 80  ? 0.2593 0.1925 0.2515 0.0250  0.1089  0.0004  81   ASN A C   
575  O O   . ASN A 80  ? 0.2771 0.2120 0.2669 0.0241  0.1124  0.0006  81   ASN A O   
576  C CB  . ASN A 80  ? 0.2537 0.1662 0.2137 0.0095  0.1015  -0.0131 81   ASN A CB  
577  C CG  . ASN A 80  ? 0.2750 0.1845 0.2234 0.0052  0.1046  -0.0155 81   ASN A CG  
578  O OD1 . ASN A 80  ? 0.3140 0.2097 0.2525 0.0047  0.1174  -0.0193 81   ASN A OD1 
579  N ND2 . ASN A 80  ? 0.2537 0.1761 0.2047 0.0030  0.0946  -0.0126 81   ASN A ND2 
580  N N   . GLN A 81  ? 0.2271 0.1754 0.2355 0.0296  0.1020  0.0068  82   GLN A N   
581  C CA  . GLN A 81  ? 0.2119 0.1807 0.2364 0.0330  0.0972  0.0141  82   GLN A CA  
582  C C   . GLN A 81  ? 0.2385 0.2141 0.2576 0.0261  0.0872  0.0120  82   GLN A C   
583  O O   . GLN A 81  ? 0.2397 0.2291 0.2684 0.0268  0.0848  0.0163  82   GLN A O   
584  C CB  . GLN A 81  ? 0.2344 0.2074 0.2700 0.0400  0.1089  0.0198  82   GLN A CB  
585  C CG  . GLN A 81  ? 0.3467 0.3175 0.3932 0.0487  0.1181  0.0251  82   GLN A CG  
586  C CD  . GLN A 81  ? 0.5582 0.5366 0.6196 0.0569  0.1294  0.0328  82   GLN A CD  
587  O OE1 . GLN A 81  ? 0.5186 0.5043 0.5824 0.0559  0.1308  0.0340  82   GLN A OE1 
588  N NE2 . GLN A 81  ? 0.5169 0.4941 0.5896 0.0656  0.1384  0.0390  82   GLN A NE2 
589  N N   . GLY A 82  ? 0.2153 0.1823 0.2203 0.0194  0.0809  0.0060  83   GLY A N   
590  C CA  . GLY A 82  ? 0.2121 0.1847 0.2128 0.0137  0.0716  0.0051  83   GLY A CA  
591  C C   . GLY A 82  ? 0.2135 0.1761 0.1981 0.0068  0.0664  -0.0005 83   GLY A C   
592  O O   . GLY A 82  ? 0.2052 0.1549 0.1786 0.0047  0.0707  -0.0051 83   GLY A O   
593  N N   . ILE A 83  ? 0.1573 0.1265 0.1414 0.0031  0.0574  0.0004  84   ILE A N   
594  C CA  . ILE A 83  ? 0.1618 0.1255 0.1328 -0.0033 0.0513  -0.0027 84   ILE A CA  
595  C C   . ILE A 83  ? 0.1995 0.1683 0.1691 -0.0059 0.0477  -0.0002 84   ILE A C   
596  O O   . ILE A 83  ? 0.1893 0.1677 0.1705 -0.0038 0.0455  0.0034  84   ILE A O   
597  C CB  . ILE A 83  ? 0.1604 0.1258 0.1336 -0.0046 0.0432  -0.0036 84   ILE A CB  
598  C CG1 . ILE A 83  ? 0.1602 0.1217 0.1205 -0.0113 0.0373  -0.0057 84   ILE A CG1 
599  C CG2 . ILE A 83  ? 0.1648 0.1423 0.1525 -0.0017 0.0372  0.0002  84   ILE A CG2 
600  C CD1 . ILE A 83  ? 0.2015 0.1644 0.1637 -0.0129 0.0303  -0.0066 84   ILE A CD1 
601  N N   . ASP A 84  ? 0.1607 0.1230 0.1155 -0.0112 0.0472  -0.0020 85   ASP A N   
602  C CA  . ASP A 84  ? 0.1591 0.1243 0.1101 -0.0139 0.0447  0.0010  85   ASP A CA  
603  C C   . ASP A 84  ? 0.1732 0.1441 0.1274 -0.0157 0.0346  0.0039  85   ASP A C   
604  O O   . ASP A 84  ? 0.1789 0.1509 0.1356 -0.0159 0.0293  0.0030  85   ASP A O   
605  C CB  . ASP A 84  ? 0.1906 0.1470 0.1232 -0.0189 0.0490  -0.0015 85   ASP A CB  
606  C CG  . ASP A 84  ? 0.2304 0.1790 0.1583 -0.0173 0.0612  -0.0045 85   ASP A CG  
607  O OD1 . ASP A 84  ? 0.2349 0.1876 0.1767 -0.0112 0.0665  -0.0028 85   ASP A OD1 
608  O OD2 . ASP A 84  ? 0.2404 0.1790 0.1511 -0.0222 0.0657  -0.0086 85   ASP A OD2 
609  N N   . THR A 85  ? 0.1720 0.1461 0.1264 -0.0169 0.0329  0.0080  86   THR A N   
610  C CA  . THR A 85  ? 0.1547 0.1330 0.1128 -0.0179 0.0249  0.0117  86   THR A CA  
611  C C   . THR A 85  ? 0.1845 0.1608 0.1300 -0.0224 0.0200  0.0127  86   THR A C   
612  O O   . THR A 85  ? 0.1977 0.1690 0.1286 -0.0263 0.0228  0.0107  86   THR A O   
613  C CB  . THR A 85  ? 0.1598 0.1411 0.1232 -0.0176 0.0254  0.0163  86   THR A CB  
614  O OG1 . THR A 85  ? 0.1832 0.1609 0.1345 -0.0205 0.0286  0.0181  86   THR A OG1 
615  C CG2 . THR A 85  ? 0.1838 0.1692 0.1597 -0.0148 0.0295  0.0157  86   THR A CG2 
616  N N   . GLU A 86  ? 0.1624 0.1432 0.1136 -0.0222 0.0127  0.0158  87   GLU A N   
617  C CA  . GLU A 86  ? 0.1783 0.1612 0.1207 -0.0263 0.0065  0.0191  87   GLU A CA  
618  C C   . GLU A 86  ? 0.2448 0.2277 0.1785 -0.0286 0.0071  0.0243  87   GLU A C   
619  O O   . GLU A 86  ? 0.2397 0.2225 0.1591 -0.0339 0.0050  0.0252  87   GLU A O   
620  C CB  . GLU A 86  ? 0.1831 0.1720 0.1376 -0.0239 0.0000  0.0231  87   GLU A CB  
621  C CG  . GLU A 86  ? 0.2487 0.2430 0.1978 -0.0275 -0.0072 0.0278  87   GLU A CG  
622  C CD  . GLU A 86  ? 0.5609 0.5563 0.5074 -0.0304 -0.0104 0.0234  87   GLU A CD  
623  O OE1 . GLU A 86  ? 0.4152 0.4110 0.3725 -0.0271 -0.0103 0.0207  87   GLU A OE1 
624  O OE2 . GLU A 86  ? 0.6206 0.6166 0.5534 -0.0368 -0.0127 0.0224  87   GLU A OE2 
625  N N   . SER A 87  ? 0.1908 0.1737 0.1327 -0.0255 0.0102  0.0274  88   SER A N   
626  C CA  . SER A 87  ? 0.2056 0.1880 0.1407 -0.0271 0.0115  0.0332  88   SER A CA  
627  C C   . SER A 87  ? 0.2568 0.2344 0.1754 -0.0312 0.0168  0.0299  88   SER A C   
628  O O   . SER A 87  ? 0.2993 0.2774 0.2047 -0.0354 0.0152  0.0338  88   SER A O   
629  C CB  A SER A 87  ? 0.2394 0.2212 0.1865 -0.0237 0.0155  0.0355  88   SER A CB  
630  C CB  B SER A 87  ? 0.2497 0.2317 0.1969 -0.0237 0.0152  0.0359  88   SER A CB  
631  O OG  A SER A 87  ? 0.2694 0.2498 0.2099 -0.0253 0.0178  0.0411  88   SER A OG  
632  O OG  B SER A 87  ? 0.3140 0.2947 0.2678 -0.0219 0.0208  0.0303  88   SER A OG  
633  N N   . ASP A 88  ? 0.2105 0.1838 0.1296 -0.0301 0.0235  0.0232  89   ASP A N   
634  C CA  . ASP A 88  ? 0.2221 0.1892 0.1263 -0.0333 0.0307  0.0194  89   ASP A CA  
635  C C   . ASP A 88  ? 0.2528 0.2161 0.1414 -0.0388 0.0291  0.0148  89   ASP A C   
636  O O   . ASP A 88  ? 0.2798 0.2388 0.1508 -0.0442 0.0322  0.0136  89   ASP A O   
637  C CB  . ASP A 88  ? 0.2329 0.1971 0.1452 -0.0293 0.0396  0.0149  89   ASP A CB  
638  C CG  . ASP A 88  ? 0.2633 0.2307 0.1862 -0.0264 0.0437  0.0185  89   ASP A CG  
639  O OD1 . ASP A 88  ? 0.3241 0.2924 0.2434 -0.0282 0.0423  0.0238  89   ASP A OD1 
640  O OD2 . ASP A 88  ? 0.2376 0.2068 0.1717 -0.0226 0.0489  0.0163  89   ASP A OD2 
641  N N   . TYR A 89  ? 0.2215 0.1858 0.1160 -0.0380 0.0252  0.0116  90   TYR A N   
642  C CA  . TYR A 89  ? 0.2315 0.1912 0.1123 -0.0438 0.0246  0.0059  90   TYR A CA  
643  C C   . TYR A 89  ? 0.2628 0.2307 0.1479 -0.0457 0.0137  0.0092  90   TYR A C   
644  O O   . TYR A 89  ? 0.2322 0.2006 0.1259 -0.0438 0.0118  0.0064  90   TYR A O   
645  C CB  . TYR A 89  ? 0.2361 0.1883 0.1216 -0.0405 0.0326  -0.0012 90   TYR A CB  
646  C CG  . TYR A 89  ? 0.2498 0.1917 0.1192 -0.0463 0.0378  -0.0090 90   TYR A CG  
647  C CD1 . TYR A 89  ? 0.2657 0.2075 0.1188 -0.0554 0.0322  -0.0105 90   TYR A CD1 
648  C CD2 . TYR A 89  ? 0.2622 0.1945 0.1333 -0.0430 0.0484  -0.0146 90   TYR A CD2 
649  C CE1 . TYR A 89  ? 0.2843 0.2152 0.1212 -0.0623 0.0377  -0.0187 90   TYR A CE1 
650  C CE2 . TYR A 89  ? 0.2892 0.2094 0.1453 -0.0484 0.0548  -0.0222 90   TYR A CE2 
651  C CZ  . TYR A 89  ? 0.3197 0.2384 0.1579 -0.0587 0.0496  -0.0250 90   TYR A CZ  
652  O OH  . TYR A 89  ? 0.3149 0.2203 0.1375 -0.0654 0.0566  -0.0336 90   TYR A OH  
653  N N   . PRO A 90  ? 0.2944 0.2692 0.1729 -0.0496 0.0068  0.0159  91   PRO A N   
654  C CA  . PRO A 90  ? 0.2816 0.2665 0.1669 -0.0504 -0.0034 0.0212  91   PRO A CA  
655  C C   . PRO A 90  ? 0.2812 0.2670 0.1567 -0.0577 -0.0074 0.0165  91   PRO A C   
656  O O   . PRO A 90  ? 0.3019 0.2797 0.1608 -0.0642 -0.0028 0.0093  91   PRO A O   
657  C CB  . PRO A 90  ? 0.3266 0.3189 0.2073 -0.0521 -0.0083 0.0310  91   PRO A CB  
658  C CG  . PRO A 90  ? 0.3941 0.3796 0.2567 -0.0568 -0.0020 0.0283  91   PRO A CG  
659  C CD  . PRO A 90  ? 0.3357 0.3108 0.2029 -0.0523 0.0082  0.0206  91   PRO A CD  
660  N N   . TYR A 91  ? 0.2660 0.2610 0.1526 -0.0567 -0.0152 0.0205  92   TYR A N   
661  C CA  . TYR A 91  ? 0.2695 0.2674 0.1503 -0.0637 -0.0200 0.0169  92   TYR A CA  
662  C C   . TYR A 91  ? 0.3459 0.3517 0.2101 -0.0736 -0.0265 0.0205  92   TYR A C   
663  O O   . TYR A 91  ? 0.3524 0.3707 0.2215 -0.0728 -0.0339 0.0310  92   TYR A O   
664  C CB  . TYR A 91  ? 0.2653 0.2718 0.1654 -0.0587 -0.0258 0.0209  92   TYR A CB  
665  C CG  . TYR A 91  ? 0.2606 0.2701 0.1579 -0.0652 -0.0299 0.0168  92   TYR A CG  
666  C CD1 . TYR A 91  ? 0.2735 0.2715 0.1653 -0.0675 -0.0236 0.0066  92   TYR A CD1 
667  C CD2 . TYR A 91  ? 0.2572 0.2816 0.1584 -0.0689 -0.0397 0.0239  92   TYR A CD2 
668  C CE1 . TYR A 91  ? 0.2811 0.2808 0.1705 -0.0740 -0.0268 0.0026  92   TYR A CE1 
669  C CE2 . TYR A 91  ? 0.2584 0.2866 0.1584 -0.0754 -0.0436 0.0202  92   TYR A CE2 
670  C CZ  . TYR A 91  ? 0.2918 0.3070 0.1853 -0.0783 -0.0369 0.0091  92   TYR A CZ  
671  O OH  . TYR A 91  ? 0.3068 0.3246 0.1991 -0.0852 -0.0400 0.0052  92   TYR A OH  
672  N N   . THR A 92  ? 0.3286 0.3273 0.1730 -0.0834 -0.0235 0.0121  93   THR A N   
673  C CA  . THR A 92  ? 0.3417 0.3474 0.1663 -0.0953 -0.0293 0.0139  93   THR A CA  
674  C C   . THR A 92  ? 0.3917 0.3997 0.2081 -0.1059 -0.0334 0.0079  93   THR A C   
675  O O   . THR A 92  ? 0.4070 0.4233 0.2069 -0.1175 -0.0396 0.0093  93   THR A O   
676  C CB  . THR A 92  ? 0.4350 0.4293 0.2379 -0.1004 -0.0211 0.0088  93   THR A CB  
677  O OG1 . THR A 92  ? 0.4931 0.4699 0.2893 -0.1014 -0.0101 -0.0037 93   THR A OG1 
678  C CG2 . THR A 92  ? 0.4640 0.4576 0.2731 -0.0918 -0.0176 0.0157  93   THR A CG2 
679  N N   . ALA A 93  ? 0.3434 0.3446 0.1703 -0.1027 -0.0300 0.0013  94   ALA A N   
680  C CA  . ALA A 93  ? 0.3576 0.3586 0.1770 -0.1130 -0.0323 -0.0054 94   ALA A CA  
681  C C   . ALA A 93  ? 0.4336 0.4550 0.2654 -0.1153 -0.0451 0.0030  94   ALA A C   
682  O O   . ALA A 93  ? 0.4176 0.4405 0.2457 -0.1238 -0.0476 -0.0020 94   ALA A O   
683  C CB  . ALA A 93  ? 0.3605 0.3452 0.1856 -0.1087 -0.0226 -0.0152 94   ALA A CB  
684  N N   . GLY A 94  ? 0.4039 0.4404 0.2497 -0.1083 -0.0523 0.0157  95   GLY A N   
685  C CA  . GLY A 94  ? 0.3965 0.4537 0.2571 -0.1084 -0.0636 0.0261  95   GLY A CA  
686  C C   . GLY A 94  ? 0.4422 0.5137 0.2901 -0.1232 -0.0728 0.0272  95   GLY A C   
687  O O   . GLY A 94  ? 0.4059 0.4926 0.2672 -0.1245 -0.0805 0.0326  95   GLY A O   
688  N N   . GLY A 95  ? 0.4477 0.5151 0.2700 -0.1351 -0.0719 0.0223  96   GLY A N   
689  C CA  . GLY A 95  ? 0.4778 0.5580 0.2837 -0.1520 -0.0803 0.0216  96   GLY A CA  
690  C C   . GLY A 95  ? 0.5640 0.6305 0.3573 -0.1630 -0.0749 0.0065  96   GLY A C   
691  O O   . GLY A 95  ? 0.5768 0.6513 0.3543 -0.1791 -0.0806 0.0034  96   GLY A O   
692  N N   . GLY A 96  ? 0.5333 0.5794 0.3335 -0.1546 -0.0637 -0.0026 97   GLY A N   
693  C CA  . GLY A 96  ? 0.5565 0.5858 0.3476 -0.1621 -0.0560 -0.0166 97   GLY A CA  
694  C C   . GLY A 96  ? 0.6524 0.6575 0.4194 -0.1676 -0.0431 -0.0294 97   GLY A C   
695  O O   . GLY A 96  ? 0.6756 0.6659 0.4305 -0.1767 -0.0361 -0.0414 97   GLY A O   
696  N N   . SER A 97  ? 0.6013 0.6012 0.3617 -0.1621 -0.0387 -0.0270 98   SER A N   
697  C CA  . SER A 97  ? 0.6182 0.5955 0.3565 -0.1664 -0.0254 -0.0383 98   SER A CA  
698  C C   . SER A 97  ? 0.6354 0.5998 0.3842 -0.1505 -0.0148 -0.0377 98   SER A C   
699  O O   . SER A 97  ? 0.6160 0.5888 0.3695 -0.1439 -0.0181 -0.0287 98   SER A O   
700  C CB  . SER A 97  ? 0.6848 0.6677 0.3967 -0.1801 -0.0291 -0.0380 98   SER A CB  
701  O OG  . SER A 97  ? 0.8166 0.8080 0.5137 -0.1978 -0.0365 -0.0418 98   SER A OG  
702  N N   . PRO A 98  ? 0.5875 0.5315 0.3395 -0.1448 -0.0018 -0.0467 99   PRO A N   
703  C CA  . PRO A 98  ? 0.5629 0.4964 0.3237 -0.1311 0.0083  -0.0458 99   PRO A CA  
704  C C   . PRO A 98  ? 0.6102 0.5319 0.3477 -0.1369 0.0173  -0.0508 99   PRO A C   
705  O O   . PRO A 98  ? 0.6054 0.5268 0.3196 -0.1515 0.0155  -0.0553 99   PRO A O   
706  C CB  . PRO A 98  ? 0.5846 0.5023 0.3555 -0.1248 0.0188  -0.0529 99   PRO A CB  
707  C CG  . PRO A 98  ? 0.6584 0.5766 0.4247 -0.1354 0.0147  -0.0580 99   PRO A CG  
708  C CD  . PRO A 98  ? 0.6188 0.5482 0.3658 -0.1510 0.0053  -0.0576 99   PRO A CD  
709  N N   . GLY A 99  ? 0.5531 0.4664 0.2971 -0.1260 0.0267  -0.0499 100  GLY A N   
710  C CA  . GLY A 99  ? 0.5481 0.4490 0.2725 -0.1295 0.0373  -0.0546 100  GLY A CA  
711  C C   . GLY A 99  ? 0.5533 0.4338 0.2809 -0.1218 0.0544  -0.0618 100  GLY A C   
712  O O   . GLY A 99  ? 0.5259 0.4017 0.2697 -0.1146 0.0577  -0.0633 100  GLY A O   
713  N N   . THR A 100 ? 0.5152 0.3844 0.2283 -0.1228 0.0657  -0.0653 101  THR A N   
714  C CA  . THR A 100 ? 0.5159 0.3665 0.2316 -0.1150 0.0836  -0.0707 101  THR A CA  
715  C C   . THR A 100 ? 0.5062 0.3656 0.2526 -0.0979 0.0826  -0.0620 101  THR A C   
716  O O   . THR A 100 ? 0.4774 0.3538 0.2355 -0.0935 0.0714  -0.0526 101  THR A O   
717  C CB  . THR A 100 ? 0.6861 0.5265 0.3792 -0.1207 0.0941  -0.0748 101  THR A CB  
718  O OG1 . THR A 100 ? 0.7917 0.6080 0.4706 -0.1244 0.1118  -0.0864 101  THR A OG1 
719  C CG2 . THR A 100 ? 0.6203 0.4672 0.3260 -0.1095 0.0967  -0.0666 101  THR A CG2 
720  N N   . CYS A 101 ? 0.4514 0.2993 0.2102 -0.0888 0.0946  -0.0648 102  CYS A N   
721  C CA  . CYS A 101 ? 0.4175 0.2746 0.2041 -0.0740 0.0939  -0.0568 102  CYS A CA  
722  C C   . CYS A 101 ? 0.4662 0.3284 0.2561 -0.0685 0.0972  -0.0514 102  CYS A C   
723  O O   . CYS A 101 ? 0.5149 0.3652 0.2917 -0.0705 0.1097  -0.0557 102  CYS A O   
724  C CB  . CYS A 101 ? 0.4157 0.2607 0.2140 -0.0660 0.1059  -0.0599 102  CYS A CB  
725  S SG  . CYS A 101 ? 0.4177 0.2759 0.2487 -0.0491 0.1049  -0.0499 102  CYS A SG  
726  N N   . SER A 102 ? 0.3777 0.2568 0.1847 -0.0622 0.0867  -0.0423 103  SER A N   
727  C CA  . SER A 102 ? 0.3715 0.2568 0.1836 -0.0574 0.0887  -0.0364 103  SER A CA  
728  C C   . SER A 102 ? 0.3607 0.2558 0.1999 -0.0454 0.0879  -0.0299 103  SER A C   
729  O O   . SER A 102 ? 0.3603 0.2650 0.2078 -0.0419 0.0851  -0.0237 103  SER A O   
730  C CB  . SER A 102 ? 0.4351 0.3318 0.2390 -0.0634 0.0768  -0.0310 103  SER A CB  
731  O OG  . SER A 102 ? 0.5163 0.4063 0.2938 -0.0756 0.0769  -0.0362 103  SER A OG  
732  N N   . ALA A 103 ? 0.3100 0.2027 0.1624 -0.0395 0.0908  -0.0313 104  ALA A N   
733  C CA  . ALA A 103 ? 0.2877 0.1912 0.1651 -0.0291 0.0891  -0.0251 104  ALA A CA  
734  C C   . ALA A 103 ? 0.2985 0.2053 0.1843 -0.0232 0.0973  -0.0212 104  ALA A C   
735  O O   . ALA A 103 ? 0.2704 0.1902 0.1701 -0.0196 0.0911  -0.0150 104  ALA A O   
736  C CB  . ALA A 103 ? 0.2975 0.1958 0.1846 -0.0242 0.0937  -0.0273 104  ALA A CB  
737  N N   . SER A 104 ? 0.3016 0.1963 0.1776 -0.0235 0.1113  -0.0251 105  SER A N   
738  C CA  . SER A 104 ? 0.3096 0.2074 0.1946 -0.0177 0.1207  -0.0213 105  SER A CA  
739  C C   . SER A 104 ? 0.3349 0.2381 0.2120 -0.0220 0.1174  -0.0184 105  SER A C   
740  O O   . SER A 104 ? 0.3163 0.2234 0.2010 -0.0180 0.1244  -0.0148 105  SER A O   
741  C CB  . SER A 104 ? 0.3763 0.2581 0.2539 -0.0159 0.1383  -0.0262 105  SER A CB  
742  O OG  . SER A 104 ? 0.4696 0.3380 0.3205 -0.0257 0.1424  -0.0331 105  SER A OG  
743  N N   . SER A 105 ? 0.2993 0.2038 0.1625 -0.0299 0.1067  -0.0189 106  SER A N   
744  C CA  . SER A 105 ? 0.2944 0.2036 0.1496 -0.0339 0.1036  -0.0151 106  SER A CA  
745  C C   . SER A 105 ? 0.2924 0.2167 0.1669 -0.0293 0.0950  -0.0072 106  SER A C   
746  O O   . SER A 105 ? 0.2817 0.2099 0.1535 -0.0310 0.0942  -0.0030 106  SER A O   
747  C CB  . SER A 105 ? 0.3546 0.2610 0.1880 -0.0439 0.0954  -0.0171 106  SER A CB  
748  O OG  . SER A 105 ? 0.4267 0.3182 0.2386 -0.0504 0.1044  -0.0253 106  SER A OG  
749  N N   . TYR A 106 ? 0.2627 0.1945 0.1553 -0.0242 0.0888  -0.0054 107  TYR A N   
750  C CA  . TYR A 106 ? 0.2468 0.1917 0.1562 -0.0212 0.0805  0.0008  107  TYR A CA  
751  C C   . TYR A 106 ? 0.2533 0.2060 0.1844 -0.0139 0.0829  0.0028  107  TYR A C   
752  O O   . TYR A 106 ? 0.2454 0.1946 0.1808 -0.0101 0.0888  0.0002  107  TYR A O   
753  C CB  . TYR A 106 ? 0.2419 0.1903 0.1499 -0.0242 0.0675  0.0019  107  TYR A CB  
754  C CG  . TYR A 106 ? 0.2625 0.2055 0.1494 -0.0319 0.0641  0.0007  107  TYR A CG  
755  C CD1 . TYR A 106 ? 0.2969 0.2406 0.1742 -0.0354 0.0641  0.0046  107  TYR A CD1 
756  C CD2 . TYR A 106 ? 0.2849 0.2222 0.1604 -0.0363 0.0617  -0.0042 107  TYR A CD2 
757  C CE1 . TYR A 106 ? 0.3179 0.2586 0.1752 -0.0429 0.0605  0.0044  107  TYR A CE1 
758  C CE2 . TYR A 106 ? 0.3183 0.2526 0.1736 -0.0446 0.0581  -0.0052 107  TYR A CE2 
759  C CZ  . TYR A 106 ? 0.3871 0.3238 0.2332 -0.0478 0.0572  -0.0005 107  TYR A CZ  
760  O OH  . TYR A 106 ? 0.4398 0.3756 0.2657 -0.0565 0.0528  -0.0004 107  TYR A OH  
761  N N   . GLN A 107 ? 0.2157 0.1794 0.1605 -0.0124 0.0782  0.0077  108  GLN A N   
762  C CA  . GLN A 107 ? 0.1881 0.1624 0.1532 -0.0071 0.0783  0.0103  108  GLN A CA  
763  C C   . GLN A 107 ? 0.2113 0.1884 0.1825 -0.0059 0.0699  0.0092  108  GLN A C   
764  O O   . GLN A 107 ? 0.1954 0.1740 0.1651 -0.0087 0.0610  0.0099  108  GLN A O   
765  C CB  . GLN A 107 ? 0.1959 0.1803 0.1716 -0.0080 0.0761  0.0149  108  GLN A CB  
766  C CG  . GLN A 107 ? 0.1957 0.1934 0.1919 -0.0042 0.0752  0.0177  108  GLN A CG  
767  C CD  . GLN A 107 ? 0.3715 0.3783 0.3768 -0.0067 0.0741  0.0214  108  GLN A CD  
768  O OE1 . GLN A 107 ? 0.3494 0.3559 0.3528 -0.0079 0.0805  0.0231  108  GLN A OE1 
769  N NE2 . GLN A 107 ? 0.3765 0.3914 0.3919 -0.0080 0.0668  0.0223  108  GLN A NE2 
770  N N   . PRO A 108 ? 0.1722 0.1498 0.1507 -0.0014 0.0730  0.0082  109  PRO A N   
771  C CA  . PRO A 108 ? 0.1566 0.1374 0.1409 -0.0005 0.0650  0.0076  109  PRO A CA  
772  C C   . PRO A 108 ? 0.2010 0.1944 0.1986 -0.0007 0.0575  0.0110  109  PRO A C   
773  O O   . PRO A 108 ? 0.1892 0.1915 0.1969 0.0003  0.0599  0.0143  109  PRO A O   
774  C CB  . PRO A 108 ? 0.1813 0.1614 0.1728 0.0052  0.0718  0.0075  109  PRO A CB  
775  C CG  . PRO A 108 ? 0.2475 0.2184 0.2310 0.0061  0.0837  0.0059  109  PRO A CG  
776  C CD  . PRO A 108 ? 0.2024 0.1778 0.1850 0.0035  0.0843  0.0083  109  PRO A CD  
777  N N   . ALA A 109 ? 0.1647 0.1582 0.1616 -0.0025 0.0490  0.0101  110  ALA A N   
778  C CA  . ALA A 109 ? 0.1639 0.1661 0.1706 -0.0037 0.0426  0.0121  110  ALA A CA  
779  C C   . ALA A 109 ? 0.2043 0.2136 0.2213 -0.0013 0.0392  0.0121  110  ALA A C   
780  O O   . ALA A 109 ? 0.1986 0.2160 0.2241 -0.0027 0.0354  0.0133  110  ALA A O   
781  C CB  . ALA A 109 ? 0.1834 0.1808 0.1829 -0.0074 0.0365  0.0119  110  ALA A CB  
782  N N   . ALA A 110 ? 0.1478 0.1531 0.1628 0.0015  0.0406  0.0106  111  ALA A N   
783  C CA  . ALA A 110 ? 0.1538 0.1653 0.1774 0.0039  0.0374  0.0112  111  ALA A CA  
784  C C   . ALA A 110 ? 0.1746 0.1828 0.1989 0.0085  0.0434  0.0114  111  ALA A C   
785  O O   . ALA A 110 ? 0.1584 0.1561 0.1735 0.0087  0.0491  0.0092  111  ALA A O   
786  C CB  . ALA A 110 ? 0.1718 0.1794 0.1912 0.0015  0.0304  0.0088  111  ALA A CB  
787  N N   . SER A 111 ? 0.1483 0.1645 0.1824 0.0118  0.0424  0.0140  112  SER A N   
788  C CA  . SER A 111 ? 0.1435 0.1560 0.1796 0.0170  0.0485  0.0152  112  SER A CA  
789  C C   . SER A 111 ? 0.1588 0.1772 0.2012 0.0186  0.0437  0.0169  112  SER A C   
790  O O   . SER A 111 ? 0.1590 0.1873 0.2062 0.0161  0.0369  0.0177  112  SER A O   
791  C CB  . SER A 111 ? 0.1772 0.1964 0.2227 0.0219  0.0565  0.0202  112  SER A CB  
792  O OG  . SER A 111 ? 0.2375 0.2745 0.2955 0.0217  0.0523  0.0249  112  SER A OG  
793  N N   . ILE A 112 ? 0.1344 0.1460 0.1762 0.0224  0.0482  0.0173  113  ILE A N   
794  C CA  . ILE A 112 ? 0.1329 0.1498 0.1807 0.0246  0.0450  0.0198  113  ILE A CA  
795  C C   . ILE A 112 ? 0.1920 0.2085 0.2469 0.0318  0.0535  0.0250  113  ILE A C   
796  O O   . ILE A 112 ? 0.2064 0.2133 0.2584 0.0344  0.0625  0.0244  113  ILE A O   
797  C CB  . ILE A 112 ? 0.1462 0.1530 0.1850 0.0211  0.0407  0.0146  113  ILE A CB  
798  C CG1 . ILE A 112 ? 0.1658 0.1553 0.1936 0.0203  0.0472  0.0102  113  ILE A CG1 
799  C CG2 . ILE A 112 ? 0.1445 0.1546 0.1800 0.0153  0.0321  0.0115  113  ILE A CG2 
800  C CD1 . ILE A 112 ? 0.1775 0.1582 0.1981 0.0168  0.0437  0.0059  113  ILE A CD1 
801  N N   . THR A 113 ? 0.1874 0.2145 0.2518 0.0353  0.0514  0.0306  114  THR A N   
802  C CA  . THR A 113 ? 0.2069 0.2354 0.2804 0.0433  0.0597  0.0377  114  THR A CA  
803  C C   . THR A 113 ? 0.1993 0.2155 0.2690 0.0455  0.0626  0.0369  114  THR A C   
804  O O   . THR A 113 ? 0.2305 0.2426 0.3061 0.0524  0.0715  0.0422  114  THR A O   
805  C CB  . THR A 113 ? 0.2835 0.3347 0.3717 0.0464  0.0563  0.0470  114  THR A CB  
806  O OG1 . THR A 113 ? 0.2803 0.3394 0.3673 0.0422  0.0466  0.0462  114  THR A OG1 
807  C CG2 . THR A 113 ? 0.2563 0.3201 0.3503 0.0447  0.0554  0.0489  114  THR A CG2 
808  N N   . GLY A 114 ? 0.1479 0.1583 0.2089 0.0399  0.0559  0.0309  115  GLY A N   
809  C CA  . GLY A 114 ? 0.1511 0.1502 0.2083 0.0407  0.0583  0.0297  115  GLY A CA  
810  C C   . GLY A 114 ? 0.1480 0.1455 0.1978 0.0340  0.0494  0.0239  115  GLY A C   
811  O O   . GLY A 114 ? 0.1494 0.1500 0.1951 0.0288  0.0431  0.0198  115  GLY A O   
812  N N   . TYR A 115 ? 0.1344 0.1267 0.1834 0.0345  0.0497  0.0241  116  TYR A N   
813  C CA  . TYR A 115 ? 0.1243 0.1158 0.1681 0.0289  0.0422  0.0195  116  TYR A CA  
814  C C   . TYR A 115 ? 0.1378 0.1311 0.1858 0.0314  0.0423  0.0235  116  TYR A C   
815  O O   . TYR A 115 ? 0.1538 0.1447 0.2067 0.0373  0.0492  0.0291  116  TYR A O   
816  C CB  . TYR A 115 ? 0.1575 0.1344 0.1900 0.0230  0.0426  0.0116  116  TYR A CB  
817  C CG  . TYR A 115 ? 0.2020 0.1628 0.2297 0.0238  0.0513  0.0098  116  TYR A CG  
818  C CD1 . TYR A 115 ? 0.2331 0.1883 0.2597 0.0223  0.0514  0.0089  116  TYR A CD1 
819  C CD2 . TYR A 115 ? 0.2351 0.1854 0.2592 0.0255  0.0606  0.0086  116  TYR A CD2 
820  C CE1 . TYR A 115 ? 0.2794 0.2185 0.3017 0.0224  0.0604  0.0071  116  TYR A CE1 
821  C CE2 . TYR A 115 ? 0.2701 0.2033 0.2890 0.0257  0.0702  0.0063  116  TYR A CE2 
822  C CZ  . TYR A 115 ? 0.3761 0.3034 0.3938 0.0237  0.0699  0.0053  116  TYR A CZ  
823  O OH  . TYR A 115 ? 0.4665 0.3757 0.4789 0.0230  0.0800  0.0025  116  TYR A OH  
824  N N   . GLN A 116 ? 0.1159 0.1129 0.1622 0.0274  0.0353  0.0211  117  GLN A N   
825  C CA  . GLN A 116 ? 0.1233 0.1220 0.1722 0.0289  0.0350  0.0244  117  GLN A CA  
826  C C   . GLN A 116 ? 0.1325 0.1218 0.1752 0.0236  0.0330  0.0184  117  GLN A C   
827  O O   . GLN A 116 ? 0.1202 0.1094 0.1588 0.0186  0.0279  0.0131  117  GLN A O   
828  C CB  . GLN A 116 ? 0.1415 0.1572 0.1951 0.0286  0.0284  0.0281  117  GLN A CB  
829  C CG  . GLN A 116 ? 0.2496 0.2792 0.3106 0.0325  0.0287  0.0349  117  GLN A CG  
830  C CD  . GLN A 116 ? 0.4910 0.5375 0.5553 0.0310  0.0227  0.0388  117  GLN A CD  
831  O OE1 . GLN A 116 ? 0.3960 0.4473 0.4624 0.0331  0.0227  0.0440  117  GLN A OE1 
832  N NE2 . GLN A 116 ? 0.3653 0.4216 0.4298 0.0271  0.0178  0.0368  117  GLN A NE2 
833  N N   . ASP A 117 ? 0.1295 0.1112 0.1722 0.0250  0.0374  0.0199  118  ASP A N   
834  C CA  . ASP A 117 ? 0.1289 0.1037 0.1674 0.0199  0.0357  0.0153  118  ASP A CA  
835  C C   . ASP A 117 ? 0.1412 0.1261 0.1834 0.0200  0.0310  0.0182  118  ASP A C   
836  O O   . ASP A 117 ? 0.1443 0.1356 0.1911 0.0246  0.0327  0.0248  118  ASP A O   
837  C CB  . ASP A 117 ? 0.1530 0.1125 0.1889 0.0204  0.0440  0.0149  118  ASP A CB  
838  C CG  . ASP A 117 ? 0.2129 0.1601 0.2419 0.0178  0.0487  0.0097  118  ASP A CG  
839  O OD1 . ASP A 117 ? 0.2009 0.1455 0.2235 0.0110  0.0445  0.0032  118  ASP A OD1 
840  O OD2 . ASP A 117 ? 0.2788 0.2190 0.3089 0.0227  0.0571  0.0125  118  ASP A OD2 
841  N N   . VAL A 118 ? 0.1028 0.0898 0.1433 0.0150  0.0255  0.0137  119  VAL A N   
842  C CA  . VAL A 118 ? 0.0994 0.0942 0.1423 0.0144  0.0222  0.0152  119  VAL A CA  
843  C C   . VAL A 118 ? 0.1127 0.1006 0.1559 0.0146  0.0265  0.0169  119  VAL A C   
844  O O   . VAL A 118 ? 0.1219 0.0988 0.1623 0.0118  0.0293  0.0134  119  VAL A O   
845  C CB  . VAL A 118 ? 0.1139 0.1118 0.1563 0.0096  0.0167  0.0102  119  VAL A CB  
846  C CG1 . VAL A 118 ? 0.1048 0.1087 0.1492 0.0088  0.0150  0.0111  119  VAL A CG1 
847  C CG2 . VAL A 118 ? 0.1159 0.1189 0.1579 0.0091  0.0133  0.0087  119  VAL A CG2 
848  N N   . PRO A 119 ? 0.0899 0.0839 0.1355 0.0171  0.0270  0.0220  120  PRO A N   
849  C CA  . PRO A 119 ? 0.0826 0.0700 0.1283 0.0167  0.0309  0.0235  120  PRO A CA  
850  C C   . PRO A 119 ? 0.1122 0.0935 0.1564 0.0106  0.0294  0.0171  120  PRO A C   
851  O O   . PRO A 119 ? 0.1129 0.1005 0.1578 0.0077  0.0243  0.0138  120  PRO A O   
852  C CB  . PRO A 119 ? 0.1006 0.0993 0.1477 0.0181  0.0287  0.0281  120  PRO A CB  
853  C CG  . PRO A 119 ? 0.1067 0.1160 0.1551 0.0216  0.0267  0.0324  120  PRO A CG  
854  C CD  . PRO A 119 ? 0.0942 0.1021 0.1417 0.0194  0.0239  0.0266  120  PRO A CD  
855  N N   . ALA A 120 ? 0.1127 0.0819 0.1554 0.0086  0.0344  0.0156  121  ALA A N   
856  C CA  . ALA A 120 ? 0.1109 0.0755 0.1525 0.0017  0.0329  0.0099  121  ALA A CA  
857  C C   . ALA A 120 ? 0.1114 0.0820 0.1566 -0.0004 0.0307  0.0103  121  ALA A C   
858  O O   . ALA A 120 ? 0.1176 0.0899 0.1644 0.0025  0.0335  0.0148  121  ALA A O   
859  C CB  . ALA A 120 ? 0.1462 0.0959 0.1844 -0.0008 0.0397  0.0082  121  ALA A CB  
860  N N   . ASN A 121 ? 0.1185 0.0921 0.1653 -0.0059 0.0265  0.0060  122  ASN A N   
861  C CA  . ASN A 121 ? 0.1067 0.0856 0.1584 -0.0085 0.0254  0.0062  122  ASN A CA  
862  C C   . ASN A 121 ? 0.1053 0.0924 0.1588 -0.0041 0.0249  0.0095  122  ASN A C   
863  O O   . ASN A 121 ? 0.1203 0.1080 0.1752 -0.0036 0.0280  0.0122  122  ASN A O   
864  C CB  . ASN A 121 ? 0.1179 0.0883 0.1696 -0.0115 0.0306  0.0066  122  ASN A CB  
865  C CG  . ASN A 121 ? 0.1435 0.1057 0.1921 -0.0183 0.0313  0.0020  122  ASN A CG  
866  O OD1 . ASN A 121 ? 0.1546 0.1189 0.2012 -0.0212 0.0269  -0.0014 122  ASN A OD1 
867  N ND2 . ASN A 121 ? 0.1657 0.1178 0.2129 -0.0214 0.0371  0.0018  122  ASN A ND2 
868  N N   . ASN A 122 ? 0.0838 0.0772 0.1367 -0.0018 0.0214  0.0091  123  ASN A N   
869  C CA  . ASN A 122 ? 0.0907 0.0913 0.1428 0.0012  0.0212  0.0115  123  ASN A CA  
870  C C   . ASN A 122 ? 0.1056 0.1123 0.1585 0.0008  0.0173  0.0088  123  ASN A C   
871  O O   . ASN A 122 ? 0.1219 0.1301 0.1725 0.0024  0.0154  0.0087  123  ASN A O   
872  C CB  . ASN A 122 ? 0.1126 0.1125 0.1613 0.0055  0.0233  0.0161  123  ASN A CB  
873  C CG  . ASN A 122 ? 0.1023 0.1104 0.1492 0.0076  0.0233  0.0201  123  ASN A CG  
874  O OD1 . ASN A 122 ? 0.1087 0.1233 0.1548 0.0059  0.0211  0.0179  123  ASN A OD1 
875  N ND2 . ASN A 122 ? 0.0950 0.1030 0.1409 0.0113  0.0263  0.0263  123  ASN A ND2 
876  N N   . GLU A 123 ? 0.0843 0.0942 0.1411 -0.0010 0.0168  0.0069  124  GLU A N   
877  C CA  . GLU A 123 ? 0.0751 0.0890 0.1334 -0.0011 0.0144  0.0045  124  GLU A CA  
878  C C   . GLU A 123 ? 0.1125 0.1302 0.1659 -0.0001 0.0148  0.0045  124  GLU A C   
879  O O   . GLU A 123 ? 0.1191 0.1383 0.1718 -0.0002 0.0130  0.0026  124  GLU A O   
880  C CB  . GLU A 123 ? 0.1054 0.1215 0.1705 -0.0025 0.0153  0.0033  124  GLU A CB  
881  C CG  . GLU A 123 ? 0.1887 0.2050 0.2595 -0.0043 0.0124  0.0030  124  GLU A CG  
882  C CD  . GLU A 123 ? 0.2329 0.2537 0.3126 -0.0044 0.0128  0.0033  124  GLU A CD  
883  O OE1 . GLU A 123 ? 0.1880 0.2102 0.2706 -0.0041 0.0167  0.0035  124  GLU A OE1 
884  O OE2 . GLU A 123 ? 0.1416 0.1649 0.2258 -0.0049 0.0095  0.0039  124  GLU A OE2 
885  N N   . GLN A 124 ? 0.0880 0.1079 0.1377 0.0004  0.0171  0.0069  125  GLN A N   
886  C CA  . GLN A 124 ? 0.0934 0.1190 0.1373 0.0000  0.0166  0.0072  125  GLN A CA  
887  C C   . GLN A 124 ? 0.1050 0.1326 0.1473 0.0016  0.0138  0.0090  125  GLN A C   
888  O O   . GLN A 124 ? 0.1006 0.1319 0.1409 0.0003  0.0120  0.0071  125  GLN A O   
889  C CB  . GLN A 124 ? 0.1120 0.1410 0.1516 -0.0001 0.0191  0.0107  125  GLN A CB  
890  C CG  . GLN A 124 ? 0.1758 0.2126 0.2084 -0.0020 0.0179  0.0110  125  GLN A CG  
891  C CD  . GLN A 124 ? 0.3982 0.4398 0.4247 -0.0036 0.0201  0.0138  125  GLN A CD  
892  O OE1 . GLN A 124 ? 0.3495 0.3980 0.3688 -0.0070 0.0192  0.0131  125  GLN A OE1 
893  N NE2 . GLN A 124 ? 0.2859 0.3242 0.3141 -0.0019 0.0230  0.0172  125  GLN A NE2 
894  N N   . ALA A 125 ? 0.0818 0.1064 0.1254 0.0043  0.0144  0.0126  126  ALA A N   
895  C CA  . ALA A 125 ? 0.0865 0.1126 0.1297 0.0066  0.0130  0.0148  126  ALA A CA  
896  C C   . ALA A 125 ? 0.0728 0.0960 0.1174 0.0054  0.0107  0.0104  126  ALA A C   
897  O O   . ALA A 125 ? 0.0860 0.1132 0.1297 0.0056  0.0090  0.0106  126  ALA A O   
898  C CB  . ALA A 125 ? 0.1071 0.1276 0.1516 0.0099  0.0160  0.0190  126  ALA A CB  
899  N N   . LEU A 126 ? 0.0694 0.0869 0.1165 0.0038  0.0105  0.0072  127  LEU A N   
900  C CA  . LEU A 126 ? 0.0817 0.0975 0.1299 0.0027  0.0081  0.0043  127  LEU A CA  
901  C C   . LEU A 126 ? 0.0827 0.1028 0.1307 0.0014  0.0070  0.0022  127  LEU A C   
902  O O   . LEU A 126 ? 0.0914 0.1121 0.1387 0.0012  0.0054  0.0013  127  LEU A O   
903  C CB  . LEU A 126 ? 0.0807 0.0924 0.1322 0.0007  0.0076  0.0026  127  LEU A CB  
904  C CG  . LEU A 126 ? 0.1048 0.1160 0.1578 -0.0005 0.0046  0.0009  127  LEU A CG  
905  C CD1 . LEU A 126 ? 0.1109 0.1196 0.1597 0.0001  0.0039  0.0009  127  LEU A CD1 
906  C CD2 . LEU A 126 ? 0.1173 0.1278 0.1743 -0.0030 0.0032  0.0006  127  LEU A CD2 
907  N N   . GLN A 127 ? 0.0714 0.0936 0.1195 0.0001  0.0086  0.0011  128  GLN A N   
908  C CA  . GLN A 127 ? 0.0799 0.1040 0.1265 -0.0020 0.0091  -0.0019 128  GLN A CA  
909  C C   . GLN A 127 ? 0.1030 0.1328 0.1448 -0.0031 0.0078  -0.0013 128  GLN A C   
910  O O   . GLN A 127 ? 0.0928 0.1229 0.1338 -0.0049 0.0071  -0.0035 128  GLN A O   
911  C CB  . GLN A 127 ? 0.1047 0.1287 0.1510 -0.0035 0.0126  -0.0036 128  GLN A CB  
912  C CG  . GLN A 127 ? 0.1109 0.1337 0.1555 -0.0062 0.0149  -0.0078 128  GLN A CG  
913  C CD  . GLN A 127 ? 0.2568 0.2781 0.3003 -0.0077 0.0198  -0.0099 128  GLN A CD  
914  O OE1 . GLN A 127 ? 0.2887 0.3114 0.3320 -0.0071 0.0210  -0.0080 128  GLN A OE1 
915  N NE2 . GLN A 127 ? 0.2560 0.2731 0.2993 -0.0095 0.0238  -0.0139 128  GLN A NE2 
916  N N   . GLN A 128 ? 0.0768 0.1117 0.1161 -0.0022 0.0075  0.0025  129  GLN A N   
917  C CA  . GLN A 128 ? 0.0835 0.1270 0.1198 -0.0032 0.0056  0.0047  129  GLN A CA  
918  C C   . GLN A 128 ? 0.0975 0.1405 0.1365 -0.0015 0.0040  0.0054  129  GLN A C   
919  O O   . GLN A 128 ? 0.1248 0.1726 0.1626 -0.0040 0.0026  0.0043  129  GLN A O   
920  C CB  . GLN A 128 ? 0.0994 0.1489 0.1347 -0.0009 0.0058  0.0109  129  GLN A CB  
921  C CG  . GLN A 128 ? 0.1685 0.2204 0.1994 -0.0032 0.0074  0.0109  129  GLN A CG  
922  C CD  . GLN A 128 ? 0.2481 0.3069 0.2779 -0.0008 0.0075  0.0183  129  GLN A CD  
923  O OE1 . GLN A 128 ? 0.3155 0.3773 0.3487 0.0032  0.0070  0.0241  129  GLN A OE1 
924  N NE2 . GLN A 128 ? 0.2624 0.3233 0.2873 -0.0031 0.0090  0.0187  129  GLN A NE2 
925  N N   . ALA A 129 ? 0.0957 0.1322 0.1376 0.0019  0.0046  0.0066  130  ALA A N   
926  C CA  . ALA A 129 ? 0.0942 0.1290 0.1375 0.0032  0.0039  0.0069  130  ALA A CA  
927  C C   . ALA A 129 ? 0.0813 0.1129 0.1247 0.0006  0.0028  0.0026  130  ALA A C   
928  O O   . ALA A 129 ? 0.0793 0.1135 0.1226 -0.0003 0.0020  0.0024  130  ALA A O   
929  C CB  . ALA A 129 ? 0.1071 0.1344 0.1514 0.0062  0.0057  0.0083  130  ALA A CB  
930  N N   . ALA A 130 ? 0.0696 0.0959 0.1141 -0.0003 0.0032  0.0000  131  ALA A N   
931  C CA  . ALA A 130 ? 0.0644 0.0871 0.1104 -0.0017 0.0028  -0.0026 131  ALA A CA  
932  C C   . ALA A 130 ? 0.0704 0.0956 0.1148 -0.0048 0.0037  -0.0050 131  ALA A C   
933  O O   . ALA A 130 ? 0.0858 0.1085 0.1308 -0.0058 0.0037  -0.0062 131  ALA A O   
934  C CB  . ALA A 130 ? 0.0786 0.0974 0.1282 -0.0015 0.0036  -0.0034 131  ALA A CB  
935  N N   . ALA A 131 ? 0.0688 0.0989 0.1101 -0.0070 0.0045  -0.0057 132  ALA A N   
936  C CA  . ALA A 131 ? 0.0827 0.1154 0.1205 -0.0118 0.0055  -0.0089 132  ALA A CA  
937  C C   . ALA A 131 ? 0.0980 0.1367 0.1354 -0.0130 0.0033  -0.0074 132  ALA A C   
938  O O   . ALA A 131 ? 0.1291 0.1690 0.1644 -0.0177 0.0040  -0.0104 132  ALA A O   
939  C CB  . ALA A 131 ? 0.1040 0.1421 0.1369 -0.0150 0.0064  -0.0098 132  ALA A CB  
940  N N   . THR A 132 ? 0.0633 0.1060 0.1028 -0.0093 0.0015  -0.0029 133  THR A N   
941  C CA  . THR A 132 ? 0.0690 0.1187 0.1095 -0.0098 0.0001  -0.0006 133  THR A CA  
942  C C   . THR A 132 ? 0.0865 0.1302 0.1292 -0.0078 0.0005  -0.0007 133  THR A C   
943  O O   . THR A 132 ? 0.0960 0.1438 0.1396 -0.0096 0.0002  -0.0004 133  THR A O   
944  C CB  . THR A 132 ? 0.1374 0.1960 0.1797 -0.0065 -0.0008 0.0053  133  THR A CB  
945  O OG1 . THR A 132 ? 0.1798 0.2314 0.2241 -0.0011 0.0006  0.0074  133  THR A OG1 
946  C CG2 . THR A 132 ? 0.1380 0.2038 0.1776 -0.0084 -0.0016 0.0066  133  THR A CG2 
947  N N   . GLN A 133 ? 0.0712 0.1061 0.1146 -0.0049 0.0010  -0.0011 134  GLN A N   
948  C CA  . GLN A 133 ? 0.0659 0.0955 0.1096 -0.0036 0.0011  -0.0008 134  GLN A CA  
949  C C   . GLN A 133 ? 0.0643 0.0863 0.1080 -0.0018 0.0008  -0.0011 134  GLN A C   
950  O O   . GLN A 133 ? 0.0740 0.0953 0.1182 -0.0009 0.0008  -0.0010 134  GLN A O   
951  C CB  . GLN A 133 ? 0.0801 0.1131 0.1242 -0.0012 0.0017  0.0023  134  GLN A CB  
952  C CG  . GLN A 133 ? 0.0775 0.1099 0.1218 0.0024  0.0027  0.0048  134  GLN A CG  
953  C CD  . GLN A 133 ? 0.1233 0.1597 0.1695 0.0054  0.0049  0.0085  134  GLN A CD  
954  O OE1 . GLN A 133 ? 0.1809 0.2265 0.2303 0.0067  0.0051  0.0123  134  GLN A OE1 
955  N NE2 . GLN A 133 ? 0.1182 0.1485 0.1626 0.0065  0.0068  0.0081  134  GLN A NE2 
956  N N   . PRO A 134 ? 0.0642 0.0815 0.1073 -0.0018 0.0003  -0.0010 135  PRO A N   
957  C CA  . PRO A 134 ? 0.0699 0.0828 0.1127 -0.0011 -0.0009 -0.0005 135  PRO A CA  
958  C C   . PRO A 134 ? 0.0734 0.0847 0.1136 0.0001  -0.0004 0.0000  135  PRO A C   
959  O O   . PRO A 134 ? 0.0921 0.1040 0.1305 0.0014  0.0014  0.0008  135  PRO A O   
960  C CB  . PRO A 134 ? 0.0874 0.0976 0.1285 -0.0018 -0.0018 0.0004  135  PRO A CB  
961  C CG  . PRO A 134 ? 0.0917 0.1032 0.1346 -0.0029 -0.0004 -0.0002 135  PRO A CG  
962  C CD  . PRO A 134 ? 0.0760 0.0927 0.1186 -0.0032 0.0006  -0.0010 135  PRO A CD  
963  N N   . ILE A 135 ? 0.0663 0.0755 0.1072 -0.0004 -0.0013 -0.0002 136  ILE A N   
964  C CA  . ILE A 135 ? 0.0675 0.0735 0.1059 0.0000  0.0001  -0.0003 136  ILE A CA  
965  C C   . ILE A 135 ? 0.0982 0.1001 0.1334 -0.0027 -0.0013 -0.0011 136  ILE A C   
966  O O   . ILE A 135 ? 0.0977 0.1017 0.1357 -0.0044 -0.0043 -0.0006 136  ILE A O   
967  C CB  . ILE A 135 ? 0.0928 0.1009 0.1347 0.0006  0.0008  0.0000  136  ILE A CB  
968  C CG1 . ILE A 135 ? 0.0826 0.0963 0.1264 0.0017  0.0015  0.0005  136  ILE A CG1 
969  C CG2 . ILE A 135 ? 0.1153 0.1192 0.1551 0.0013  0.0034  0.0004  136  ILE A CG2 
970  C CD1 . ILE A 135 ? 0.1023 0.1190 0.1448 0.0036  0.0031  0.0025  136  ILE A CD1 
971  N N   . SER A 136 ? 0.0817 0.0779 0.1110 -0.0035 0.0011  -0.0022 137  SER A N   
972  C CA  . SER A 136 ? 0.0917 0.0836 0.1159 -0.0079 -0.0001 -0.0039 137  SER A CA  
973  C C   . SER A 136 ? 0.1063 0.0971 0.1328 -0.0094 0.0004  -0.0045 137  SER A C   
974  O O   . SER A 136 ? 0.1068 0.0949 0.1345 -0.0068 0.0042  -0.0042 137  SER A O   
975  C CB  . SER A 136 ? 0.1056 0.0896 0.1214 -0.0089 0.0041  -0.0059 137  SER A CB  
976  O OG  . SER A 136 ? 0.1229 0.1083 0.1365 -0.0080 0.0038  -0.0052 137  SER A OG  
977  N N   . VAL A 137 ? 0.1102 0.1042 0.1382 -0.0134 -0.0035 -0.0045 138  VAL A N   
978  C CA  . VAL A 137 ? 0.0931 0.0871 0.1241 -0.0157 -0.0033 -0.0049 138  VAL A CA  
979  C C   . VAL A 137 ? 0.1125 0.1061 0.1390 -0.0228 -0.0061 -0.0065 138  VAL A C   
980  O O   . VAL A 137 ? 0.1151 0.1124 0.1387 -0.0256 -0.0100 -0.0057 138  VAL A O   
981  C CB  . VAL A 137 ? 0.0986 0.1004 0.1396 -0.0133 -0.0052 -0.0024 138  VAL A CB  
982  C CG1 . VAL A 137 ? 0.1028 0.1054 0.1464 -0.0080 -0.0027 -0.0016 138  VAL A CG1 
983  C CG2 . VAL A 137 ? 0.1084 0.1176 0.1540 -0.0145 -0.0100 0.0001  138  VAL A CG2 
984  N N   . ALA A 138 ? 0.1097 0.0999 0.1359 -0.0264 -0.0042 -0.0082 139  ALA A N   
985  C CA  . ALA A 138 ? 0.1159 0.1071 0.1382 -0.0350 -0.0070 -0.0101 139  ALA A CA  
986  C C   . ALA A 138 ? 0.1446 0.1462 0.1774 -0.0367 -0.0109 -0.0072 139  ALA A C   
987  O O   . ALA A 138 ? 0.1478 0.1501 0.1880 -0.0326 -0.0084 -0.0059 139  ALA A O   
988  C CB  . ALA A 138 ? 0.1560 0.1340 0.1696 -0.0393 -0.0009 -0.0149 139  ALA A CB  
989  N N   . ILE A 139 ? 0.1379 0.1489 0.1720 -0.0426 -0.0169 -0.0055 140  ILE A N   
990  C CA  . ILE A 139 ? 0.1182 0.1410 0.1638 -0.0445 -0.0206 -0.0019 140  ILE A CA  
991  C C   . ILE A 139 ? 0.1443 0.1727 0.1860 -0.0553 -0.0251 -0.0028 140  ILE A C   
992  O O   . ILE A 139 ? 0.1581 0.1829 0.1877 -0.0613 -0.0267 -0.0057 140  ILE A O   
993  C CB  . ILE A 139 ? 0.1253 0.1600 0.1823 -0.0386 -0.0244 0.0045  140  ILE A CB  
994  C CG1 . ILE A 139 ? 0.1486 0.1878 0.2006 -0.0403 -0.0293 0.0069  140  ILE A CG1 
995  C CG2 . ILE A 139 ? 0.1383 0.1683 0.1997 -0.0294 -0.0197 0.0048  140  ILE A CG2 
996  C CD1 . ILE A 139 ? 0.1659 0.2183 0.2304 -0.0363 -0.0334 0.0145  140  ILE A CD1 
997  N N   . ASP A 140 ? 0.1215 0.1599 0.1737 -0.0584 -0.0274 -0.0001 141  ASP A N   
998  C CA  . ASP A 140 ? 0.1195 0.1690 0.1715 -0.0692 -0.0335 0.0009  141  ASP A CA  
999  C C   . ASP A 140 ? 0.1692 0.2367 0.2322 -0.0662 -0.0406 0.0094  141  ASP A C   
1000 O O   . ASP A 140 ? 0.1465 0.2229 0.2250 -0.0598 -0.0405 0.0149  141  ASP A O   
1001 C CB  . ASP A 140 ? 0.1154 0.1678 0.1751 -0.0737 -0.0319 0.0003  141  ASP A CB  
1002 C CG  . ASP A 140 ? 0.1749 0.2409 0.2358 -0.0862 -0.0384 0.0014  141  ASP A CG  
1003 O OD1 . ASP A 140 ? 0.1871 0.2662 0.2478 -0.0897 -0.0459 0.0056  141  ASP A OD1 
1004 O OD2 . ASP A 140 ? 0.1863 0.2514 0.2494 -0.0925 -0.0363 -0.0011 141  ASP A OD2 
1005 N N   . ALA A 141 ? 0.1535 0.2256 0.2086 -0.0702 -0.0458 0.0108  142  ALA A N   
1006 C CA  . ALA A 141 ? 0.1462 0.2348 0.2112 -0.0668 -0.0522 0.0202  142  ALA A CA  
1007 C C   . ALA A 141 ? 0.1791 0.2868 0.2468 -0.0773 -0.0610 0.0251  142  ALA A C   
1008 O O   . ALA A 141 ? 0.1860 0.3080 0.2584 -0.0766 -0.0672 0.0334  142  ALA A O   
1009 C CB  . ALA A 141 ? 0.1636 0.2452 0.2181 -0.0632 -0.0521 0.0199  142  ALA A CB  
1010 N N   . SER A 142 ? 0.1595 0.2683 0.2249 -0.0873 -0.0614 0.0208  143  SER A N   
1011 C CA  . SER A 142 ? 0.1635 0.2903 0.2286 -0.1002 -0.0700 0.0240  143  SER A CA  
1012 C C   . SER A 142 ? 0.2030 0.3543 0.2911 -0.0983 -0.0754 0.0352  143  SER A C   
1013 O O   . SER A 142 ? 0.2143 0.3855 0.3043 -0.1078 -0.0842 0.0408  143  SER A O   
1014 C CB  . SER A 142 ? 0.1889 0.3058 0.2410 -0.1133 -0.0675 0.0140  143  SER A CB  
1015 O OG  . SER A 142 ? 0.2498 0.3640 0.3129 -0.1115 -0.0625 0.0125  143  SER A OG  
1016 N N   . ASP A 143 ? 0.1549 0.3062 0.2601 -0.0866 -0.0703 0.0391  144  ASP A N   
1017 C CA  . ASP A 143 ? 0.1486 0.3227 0.2765 -0.0845 -0.0741 0.0498  144  ASP A CA  
1018 C C   . ASP A 143 ? 0.1847 0.3763 0.3225 -0.0793 -0.0804 0.0621  144  ASP A C   
1019 O O   . ASP A 143 ? 0.1521 0.3339 0.2858 -0.0704 -0.0776 0.0628  144  ASP A O   
1020 C CB  . ASP A 143 ? 0.1602 0.3288 0.3031 -0.0741 -0.0657 0.0501  144  ASP A CB  
1021 C CG  . ASP A 143 ? 0.1889 0.3799 0.3543 -0.0748 -0.0682 0.0593  144  ASP A CG  
1022 O OD1 . ASP A 143 ? 0.2099 0.4053 0.3762 -0.0845 -0.0690 0.0561  144  ASP A OD1 
1023 O OD2 . ASP A 143 ? 0.1848 0.3905 0.3672 -0.0668 -0.0698 0.0704  144  ASP A OD2 
1024 N N   . PRO A 144 ? 0.1526 0.3710 0.3052 -0.0839 -0.0883 0.0730  145  PRO A N   
1025 C CA  . PRO A 144 ? 0.1579 0.3936 0.3220 -0.0774 -0.0935 0.0867  145  PRO A CA  
1026 C C   . PRO A 144 ? 0.1842 0.4119 0.3623 -0.0603 -0.0852 0.0914  145  PRO A C   
1027 O O   . PRO A 144 ? 0.1625 0.3920 0.3418 -0.0537 -0.0864 0.0984  145  PRO A O   
1028 C CB  . PRO A 144 ? 0.1749 0.4414 0.3577 -0.0836 -0.1015 0.0980  145  PRO A CB  
1029 C CG  . PRO A 144 ? 0.2305 0.4961 0.4019 -0.0992 -0.1039 0.0883  145  PRO A CG  
1030 C CD  . PRO A 144 ? 0.1719 0.4073 0.3315 -0.0958 -0.0931 0.0741  145  PRO A CD  
1031 N N   . SER A 145 ? 0.1432 0.3614 0.3310 -0.0538 -0.0764 0.0874  146  SER A N   
1032 C CA  . SER A 145 ? 0.1235 0.3317 0.3226 -0.0389 -0.0671 0.0899  146  SER A CA  
1033 C C   . SER A 145 ? 0.1621 0.3472 0.3434 -0.0342 -0.0627 0.0822  146  SER A C   
1034 O O   . SER A 145 ? 0.1671 0.3471 0.3551 -0.0237 -0.0579 0.0866  146  SER A O   
1035 C CB  . SER A 145 ? 0.1472 0.3488 0.3554 -0.0354 -0.0587 0.0854  146  SER A CB  
1036 O OG  . SER A 145 ? 0.1729 0.3561 0.3631 -0.0412 -0.0558 0.0721  146  SER A OG  
1037 N N   . PHE A 146 ? 0.1308 0.3024 0.2903 -0.0422 -0.0641 0.0713  147  PHE A N   
1038 C CA  . PHE A 146 ? 0.1288 0.2808 0.2722 -0.0386 -0.0604 0.0645  147  PHE A CA  
1039 C C   . PHE A 146 ? 0.1890 0.3479 0.3257 -0.0406 -0.0670 0.0704  147  PHE A C   
1040 O O   . PHE A 146 ? 0.1786 0.3301 0.3143 -0.0329 -0.0641 0.0726  147  PHE A O   
1041 C CB  . PHE A 146 ? 0.1468 0.2811 0.2713 -0.0450 -0.0576 0.0513  147  PHE A CB  
1042 C CG  . PHE A 146 ? 0.1584 0.2738 0.2692 -0.0403 -0.0529 0.0449  147  PHE A CG  
1043 C CD1 . PHE A 146 ? 0.1798 0.2928 0.2771 -0.0436 -0.0566 0.0446  147  PHE A CD1 
1044 C CD2 . PHE A 146 ? 0.1698 0.2712 0.2816 -0.0329 -0.0448 0.0401  147  PHE A CD2 
1045 C CE1 . PHE A 146 ? 0.1850 0.2821 0.2716 -0.0389 -0.0520 0.0395  147  PHE A CE1 
1046 C CE2 . PHE A 146 ? 0.1869 0.2737 0.2877 -0.0289 -0.0410 0.0352  147  PHE A CE2 
1047 C CZ  . PHE A 146 ? 0.1615 0.2463 0.2507 -0.0317 -0.0445 0.0351  147  PHE A CZ  
1048 N N   . GLN A 147 ? 0.1749 0.3485 0.3064 -0.0517 -0.0760 0.0730  148  GLN A N   
1049 C CA  . GLN A 147 ? 0.1971 0.3793 0.3200 -0.0557 -0.0833 0.0788  148  GLN A CA  
1050 C C   . GLN A 147 ? 0.2291 0.4241 0.3699 -0.0454 -0.0842 0.0933  148  GLN A C   
1051 O O   . GLN A 147 ? 0.2270 0.4183 0.3611 -0.0421 -0.0848 0.0966  148  GLN A O   
1052 C CB  . GLN A 147 ? 0.2314 0.4308 0.3479 -0.0707 -0.0930 0.0800  148  GLN A CB  
1053 C CG  . GLN A 147 ? 0.3972 0.5825 0.4950 -0.0821 -0.0912 0.0655  148  GLN A CG  
1054 C CD  . GLN A 147 ? 0.5818 0.7513 0.6545 -0.0876 -0.0906 0.0569  148  GLN A CD  
1055 O OE1 . GLN A 147 ? 0.4675 0.6450 0.5318 -0.0914 -0.0966 0.0618  148  GLN A OE1 
1056 N NE2 . GLN A 147 ? 0.4031 0.5500 0.4631 -0.0885 -0.0830 0.0442  148  GLN A NE2 
1057 N N   . SER A 148 ? 0.1873 0.3956 0.3512 -0.0395 -0.0828 0.1018  149  SER A N   
1058 C CA  . SER A 148 ? 0.1889 0.4098 0.3729 -0.0290 -0.0822 0.1167  149  SER A CA  
1059 C C   . SER A 148 ? 0.2245 0.4291 0.4190 -0.0154 -0.0702 0.1155  149  SER A C   
1060 O O   . SER A 148 ? 0.2325 0.4450 0.4459 -0.0057 -0.0671 0.1273  149  SER A O   
1061 C CB  . SER A 148 ? 0.2290 0.4783 0.4335 -0.0314 -0.0884 0.1293  149  SER A CB  
1062 O OG  . SER A 148 ? 0.2825 0.5301 0.4973 -0.0308 -0.0832 0.1244  149  SER A OG  
1063 N N   . TYR A 149 ? 0.1563 0.3378 0.3382 -0.0147 -0.0630 0.1015  150  TYR A N   
1064 C CA  . TYR A 149 ? 0.1474 0.3135 0.3368 -0.0037 -0.0519 0.0992  150  TYR A CA  
1065 C C   . TYR A 149 ? 0.1950 0.3578 0.3885 0.0046  -0.0490 0.1070  150  TYR A C   
1066 O O   . TYR A 149 ? 0.2092 0.3679 0.3885 0.0016  -0.0529 0.1061  150  TYR A O   
1067 C CB  . TYR A 149 ? 0.1470 0.2908 0.3190 -0.0057 -0.0465 0.0839  150  TYR A CB  
1068 C CG  . TYR A 149 ? 0.1373 0.2646 0.3124 0.0036  -0.0359 0.0804  150  TYR A CG  
1069 C CD1 . TYR A 149 ? 0.1310 0.2557 0.3181 0.0085  -0.0283 0.0792  150  TYR A CD1 
1070 C CD2 . TYR A 149 ? 0.1318 0.2455 0.2967 0.0065  -0.0331 0.0775  150  TYR A CD2 
1071 C CE1 . TYR A 149 ? 0.0918 0.2008 0.2793 0.0153  -0.0182 0.0748  150  TYR A CE1 
1072 C CE2 . TYR A 149 ? 0.1377 0.2369 0.3050 0.0136  -0.0234 0.0741  150  TYR A CE2 
1073 C CZ  . TYR A 149 ? 0.1386 0.2350 0.3161 0.0175  -0.0161 0.0721  150  TYR A CZ  
1074 O OH  . TYR A 149 ? 0.1123 0.1932 0.2888 0.0225  -0.0064 0.0671  150  TYR A OH  
1075 N N   . SER A 150 ? 0.1631 0.3239 0.3742 0.0150  -0.0405 0.1129  151  SER A N   
1076 C CA  . SER A 150 ? 0.1871 0.3420 0.4045 0.0239  -0.0352 0.1204  151  SER A CA  
1077 C C   . SER A 150 ? 0.2256 0.3579 0.4425 0.0308  -0.0222 0.1122  151  SER A C   
1078 O O   . SER A 150 ? 0.2550 0.3725 0.4616 0.0325  -0.0188 0.1085  151  SER A O   
1079 C CB  . SER A 150 ? 0.2451 0.4205 0.4865 0.0303  -0.0362 0.1381  151  SER A CB  
1080 O OG  . SER A 150 ? 0.4612 0.6384 0.7034 0.0344  -0.0377 0.1482  151  SER A OG  
1081 N N   . SER A 151 ? 0.1475 0.2768 0.3742 0.0339  -0.0148 0.1088  152  SER A N   
1082 C CA  . SER A 151 ? 0.1410 0.2494 0.3656 0.0389  -0.0024 0.1004  152  SER A CA  
1083 C C   . SER A 151 ? 0.1606 0.2664 0.3880 0.0379  0.0027  0.0930  152  SER A C   
1084 O O   . SER A 151 ? 0.1932 0.3137 0.4267 0.0342  -0.0028 0.0955  152  SER A O   
1085 C CB  . SER A 151 ? 0.2129 0.3172 0.4533 0.0491  0.0071  0.1098  152  SER A CB  
1086 O OG  . SER A 151 ? 0.2889 0.4081 0.5518 0.0544  0.0096  0.1204  152  SER A OG  
1087 N N   . GLY A 152 ? 0.1302 0.2180 0.3538 0.0410  0.0135  0.0848  153  GLY A N   
1088 C CA  . GLY A 152 ? 0.1213 0.2046 0.3459 0.0404  0.0199  0.0776  153  GLY A CA  
1089 C C   . GLY A 152 ? 0.1287 0.2065 0.3344 0.0323  0.0150  0.0658  153  GLY A C   
1090 O O   . GLY A 152 ? 0.1229 0.1978 0.3140 0.0277  0.0082  0.0621  153  GLY A O   
1091 N N   . ILE A 153 ? 0.0867 0.1628 0.2931 0.0311  0.0194  0.0606  154  ILE A N   
1092 C CA  . ILE A 153 ? 0.0758 0.1467 0.2666 0.0246  0.0166  0.0508  154  ILE A CA  
1093 C C   . ILE A 153 ? 0.1272 0.2129 0.3213 0.0194  0.0079  0.0540  154  ILE A C   
1094 O O   . ILE A 153 ? 0.1749 0.2709 0.3831 0.0204  0.0097  0.0588  154  ILE A O   
1095 C CB  . ILE A 153 ? 0.1206 0.1810 0.3092 0.0259  0.0267  0.0437  154  ILE A CB  
1096 C CG1 . ILE A 153 ? 0.1346 0.1790 0.3163 0.0288  0.0350  0.0388  154  ILE A CG1 
1097 C CG2 . ILE A 153 ? 0.1480 0.2057 0.3225 0.0196  0.0232  0.0358  154  ILE A CG2 
1098 C CD1 . ILE A 153 ? 0.2393 0.2734 0.4169 0.0289  0.0451  0.0316  154  ILE A CD1 
1099 N N   . TYR A 154 ? 0.0723 0.1589 0.2536 0.0134  -0.0007 0.0514  155  TYR A N   
1100 C CA  . TYR A 154 ? 0.0502 0.1492 0.2320 0.0065  -0.0089 0.0532  155  TYR A CA  
1101 C C   . TYR A 154 ? 0.0755 0.1696 0.2516 0.0027  -0.0063 0.0460  155  TYR A C   
1102 O O   . TYR A 154 ? 0.0658 0.1467 0.2274 0.0015  -0.0041 0.0379  155  TYR A O   
1103 C CB  . TYR A 154 ? 0.0662 0.1647 0.2339 0.0011  -0.0171 0.0516  155  TYR A CB  
1104 C CG  . TYR A 154 ? 0.0921 0.2019 0.2579 -0.0076 -0.0252 0.0525  155  TYR A CG  
1105 C CD1 . TYR A 154 ? 0.1010 0.2297 0.2798 -0.0094 -0.0311 0.0622  155  TYR A CD1 
1106 C CD2 . TYR A 154 ? 0.1095 0.2116 0.2617 -0.0141 -0.0262 0.0442  155  TYR A CD2 
1107 C CE1 . TYR A 154 ? 0.1411 0.2809 0.3177 -0.0191 -0.0384 0.0625  155  TYR A CE1 
1108 C CE2 . TYR A 154 ? 0.1296 0.2402 0.2794 -0.0231 -0.0322 0.0440  155  TYR A CE2 
1109 C CZ  . TYR A 154 ? 0.1816 0.3111 0.3427 -0.0263 -0.0387 0.0526  155  TYR A CZ  
1110 O OH  . TYR A 154 ? 0.1832 0.3215 0.3408 -0.0369 -0.0449 0.0518  155  TYR A OH  
1111 N N   . SER A 155 ? 0.0631 0.1689 0.2512 0.0006  -0.0068 0.0497  156  SER A N   
1112 C CA  . SER A 155 ? 0.0682 0.1703 0.2525 -0.0032 -0.0040 0.0442  156  SER A CA  
1113 C C   . SER A 155 ? 0.1245 0.2371 0.3089 -0.0120 -0.0113 0.0451  156  SER A C   
1114 O O   . SER A 155 ? 0.1607 0.2722 0.3447 -0.0156 -0.0090 0.0420  156  SER A O   
1115 C CB  . SER A 155 ? 0.0827 0.1865 0.2806 0.0021  0.0048  0.0463  156  SER A CB  
1116 O OG  . SER A 155 ? 0.1209 0.2416 0.3389 0.0043  0.0037  0.0563  156  SER A OG  
1117 N N   . GLY A 156 ? 0.1029 0.2255 0.2874 -0.0160 -0.0195 0.0494  157  GLY A N   
1118 C CA  . GLY A 156 ? 0.1052 0.2389 0.2892 -0.0260 -0.0267 0.0503  157  GLY A CA  
1119 C C   . GLY A 156 ? 0.1220 0.2787 0.3254 -0.0267 -0.0315 0.0613  157  GLY A C   
1120 O O   . GLY A 156 ? 0.1169 0.2804 0.3321 -0.0191 -0.0307 0.0693  157  GLY A O   
1121 N N   . PRO A 157 ? 0.0968 0.2665 0.3037 -0.0364 -0.0369 0.0626  158  PRO A N   
1122 C CA  . PRO A 157 ? 0.1123 0.2736 0.3065 -0.0460 -0.0370 0.0537  158  PRO A CA  
1123 C C   . PRO A 157 ? 0.1484 0.2978 0.3205 -0.0528 -0.0411 0.0464  158  PRO A C   
1124 O O   . PRO A 157 ? 0.1747 0.3313 0.3432 -0.0552 -0.0479 0.0498  158  PRO A O   
1125 C CB  . PRO A 157 ? 0.1335 0.3162 0.3416 -0.0545 -0.0421 0.0595  158  PRO A CB  
1126 C CG  . PRO A 157 ? 0.1657 0.3700 0.3880 -0.0522 -0.0489 0.0714  158  PRO A CG  
1127 C CD  . PRO A 157 ? 0.1192 0.3146 0.3457 -0.0382 -0.0427 0.0743  158  PRO A CD  
1128 N N   . CYS A 158 ? 0.1256 0.2562 0.2830 -0.0549 -0.0363 0.0369  159  CYS A N   
1129 C CA  . CYS A 158 ? 0.1371 0.2550 0.2740 -0.0611 -0.0384 0.0296  159  CYS A CA  
1130 C C   . CYS A 158 ? 0.2114 0.3134 0.3382 -0.0652 -0.0326 0.0214  159  CYS A C   
1131 O O   . CYS A 158 ? 0.2213 0.3178 0.3535 -0.0600 -0.0261 0.0207  159  CYS A O   
1132 C CB  . CYS A 158 ? 0.1542 0.2620 0.2823 -0.0537 -0.0376 0.0285  159  CYS A CB  
1133 S SG  . CYS A 158 ? 0.1828 0.2764 0.3125 -0.0413 -0.0282 0.0262  159  CYS A SG  
1134 N N   . ASN A 159 ? 0.1567 0.2516 0.2688 -0.0751 -0.0345 0.0155  160  ASN A N   
1135 C CA  . ASN A 159 ? 0.1341 0.2121 0.2356 -0.0795 -0.0282 0.0079  160  ASN A CA  
1136 C C   . ASN A 159 ? 0.1593 0.2177 0.2466 -0.0734 -0.0231 0.0027  160  ASN A C   
1137 O O   . ASN A 159 ? 0.1400 0.1984 0.2281 -0.0647 -0.0236 0.0051  160  ASN A O   
1138 C CB  . ASN A 159 ? 0.1455 0.2249 0.2386 -0.0946 -0.0317 0.0038  160  ASN A CB  
1139 C CG  . ASN A 159 ? 0.2165 0.3183 0.3238 -0.1021 -0.0380 0.0094  160  ASN A CG  
1140 O OD1 . ASN A 159 ? 0.2414 0.3549 0.3452 -0.1128 -0.0455 0.0101  160  ASN A OD1 
1141 N ND2 . ASN A 159 ? 0.1478 0.2566 0.2710 -0.0975 -0.0349 0.0136  160  ASN A ND2 
1142 N N   . THR A 160 ? 0.1488 0.1904 0.2242 -0.0778 -0.0174 -0.0039 161  THR A N   
1143 C CA  . THR A 160 ? 0.1482 0.1720 0.2115 -0.0719 -0.0118 -0.0079 161  THR A CA  
1144 C C   . THR A 160 ? 0.2165 0.2283 0.2634 -0.0808 -0.0106 -0.0144 161  THR A C   
1145 O O   . THR A 160 ? 0.2307 0.2249 0.2679 -0.0785 -0.0034 -0.0185 161  THR A O   
1146 C CB  . THR A 160 ? 0.2340 0.2467 0.2989 -0.0653 -0.0037 -0.0083 161  THR A CB  
1147 O OG1 . THR A 160 ? 0.2257 0.2335 0.2902 -0.0732 0.0000  -0.0108 161  THR A OG1 
1148 C CG2 . THR A 160 ? 0.2072 0.2289 0.2845 -0.0561 -0.0036 -0.0030 161  THR A CG2 
1149 N N   . ASN A 161 ? 0.1931 0.2149 0.2368 -0.0905 -0.0176 -0.0148 162  ASN A N   
1150 C CA  . ASN A 161 ? 0.2014 0.2132 0.2279 -0.1005 -0.0170 -0.0214 162  ASN A CA  
1151 C C   . ASN A 161 ? 0.2333 0.2441 0.2533 -0.0944 -0.0191 -0.0204 162  ASN A C   
1152 O O   . ASN A 161 ? 0.2208 0.2458 0.2418 -0.0969 -0.0271 -0.0168 162  ASN A O   
1153 C CB  . ASN A 161 ? 0.2127 0.2378 0.2386 -0.1153 -0.0239 -0.0220 162  ASN A CB  
1154 C CG  . ASN A 161 ? 0.2803 0.3077 0.3149 -0.1207 -0.0216 -0.0223 162  ASN A CG  
1155 O OD1 . ASN A 161 ? 0.3309 0.3406 0.3613 -0.1202 -0.0126 -0.0268 162  ASN A OD1 
1156 N ND2 . ASN A 161 ? 0.2411 0.2905 0.2897 -0.1246 -0.0291 -0.0163 162  ASN A ND2 
1157 N N   . LEU A 162 ? 0.1892 0.1849 0.2046 -0.0854 -0.0119 -0.0223 163  LEU A N   
1158 C CA  . LEU A 162 ? 0.1847 0.1793 0.1964 -0.0778 -0.0128 -0.0208 163  LEU A CA  
1159 C C   . LEU A 162 ? 0.2324 0.2262 0.2302 -0.0861 -0.0159 -0.0240 163  LEU A C   
1160 O O   . LEU A 162 ? 0.2554 0.2372 0.2401 -0.0953 -0.0117 -0.0308 163  LEU A O   
1161 C CB  . LEU A 162 ? 0.1821 0.1614 0.1909 -0.0685 -0.0042 -0.0224 163  LEU A CB  
1162 C CG  . LEU A 162 ? 0.2022 0.1820 0.2226 -0.0602 -0.0008 -0.0189 163  LEU A CG  
1163 C CD1 . LEU A 162 ? 0.2064 0.1720 0.2228 -0.0526 0.0075  -0.0199 163  LEU A CD1 
1164 C CD2 . LEU A 162 ? 0.1907 0.1858 0.2239 -0.0535 -0.0064 -0.0129 163  LEU A CD2 
1165 N N   . ASP A 163 ? 0.1838 0.1897 0.1838 -0.0833 -0.0227 -0.0192 164  ASP A N   
1166 C CA  . ASP A 163 ? 0.1956 0.2025 0.1816 -0.0916 -0.0263 -0.0214 164  ASP A CA  
1167 C C   . ASP A 163 ? 0.2269 0.2385 0.2132 -0.0841 -0.0292 -0.0169 164  ASP A C   
1168 O O   . ASP A 163 ? 0.2350 0.2487 0.2100 -0.0901 -0.0325 -0.0175 164  ASP A O   
1169 C CB  . ASP A 163 ? 0.2188 0.2422 0.2057 -0.1038 -0.0351 -0.0194 164  ASP A CB  
1170 C CG  . ASP A 163 ? 0.2564 0.3025 0.2617 -0.0995 -0.0436 -0.0093 164  ASP A CG  
1171 O OD1 . ASP A 163 ? 0.2167 0.2647 0.2336 -0.0870 -0.0425 -0.0042 164  ASP A OD1 
1172 O OD2 . ASP A 163 ? 0.2996 0.3615 0.3081 -0.1089 -0.0508 -0.0063 164  ASP A OD2 
1173 N N   . HIS A 164 ? 0.1650 0.1780 0.1632 -0.0719 -0.0277 -0.0125 165  HIS A N   
1174 C CA  . HIS A 164 ? 0.1625 0.1801 0.1617 -0.0656 -0.0303 -0.0081 165  HIS A CA  
1175 C C   . HIS A 164 ? 0.1862 0.1961 0.1909 -0.0543 -0.0244 -0.0078 165  HIS A C   
1176 O O   . HIS A 164 ? 0.2017 0.2131 0.2174 -0.0490 -0.0227 -0.0063 165  HIS A O   
1177 C CB  . HIS A 164 ? 0.1750 0.2120 0.1871 -0.0649 -0.0386 0.0005  165  HIS A CB  
1178 C CG  . HIS A 164 ? 0.2089 0.2518 0.2227 -0.0596 -0.0417 0.0062  165  HIS A CG  
1179 N ND1 . HIS A 164 ? 0.2561 0.2965 0.2560 -0.0640 -0.0432 0.0052  165  HIS A ND1 
1180 C CD2 . HIS A 164 ? 0.2226 0.2736 0.2503 -0.0512 -0.0433 0.0133  165  HIS A CD2 
1181 C CE1 . HIS A 164 ? 0.2416 0.2879 0.2476 -0.0572 -0.0452 0.0117  165  HIS A CE1 
1182 N NE2 . HIS A 164 ? 0.2205 0.2727 0.2432 -0.0496 -0.0452 0.0166  165  HIS A NE2 
1183 N N   . ALA A 165 ? 0.1620 0.1657 0.1598 -0.0509 -0.0219 -0.0087 166  ALA A N   
1184 C CA  . ALA A 165 ? 0.1558 0.1548 0.1588 -0.0412 -0.0174 -0.0079 166  ALA A CA  
1185 C C   . ALA A 165 ? 0.1641 0.1724 0.1749 -0.0359 -0.0214 -0.0020 166  ALA A C   
1186 O O   . ALA A 165 ? 0.1591 0.1727 0.1659 -0.0387 -0.0257 0.0007  166  ALA A O   
1187 C CB  . ALA A 165 ? 0.1829 0.1690 0.1747 -0.0404 -0.0109 -0.0123 166  ALA A CB  
1188 N N   . VAL A 166 ? 0.1233 0.1333 0.1448 -0.0287 -0.0197 0.0000  167  VAL A N   
1189 C CA  . VAL A 166 ? 0.1104 0.1267 0.1402 -0.0235 -0.0216 0.0048  167  VAL A CA  
1190 C C   . VAL A 166 ? 0.1037 0.1145 0.1355 -0.0174 -0.0167 0.0032  167  VAL A C   
1191 O O   . VAL A 166 ? 0.1136 0.1177 0.1409 -0.0169 -0.0126 -0.0004 167  VAL A O   
1192 C CB  . VAL A 166 ? 0.1291 0.1557 0.1714 -0.0226 -0.0251 0.0097  167  VAL A CB  
1193 C CG1 . VAL A 166 ? 0.1428 0.1787 0.1842 -0.0290 -0.0313 0.0132  167  VAL A CG1 
1194 C CG2 . VAL A 166 ? 0.1230 0.1486 0.1715 -0.0214 -0.0222 0.0078  167  VAL A CG2 
1195 N N   . THR A 167 ? 0.0951 0.1091 0.1339 -0.0130 -0.0166 0.0061  168  THR A N   
1196 C CA  . THR A 167 ? 0.0730 0.0833 0.1127 -0.0089 -0.0126 0.0043  168  THR A CA  
1197 C C   . THR A 167 ? 0.1012 0.1146 0.1503 -0.0058 -0.0115 0.0057  168  THR A C   
1198 O O   . THR A 167 ? 0.0920 0.1085 0.1470 -0.0046 -0.0126 0.0090  168  THR A O   
1199 C CB  . THR A 167 ? 0.1195 0.1278 0.1547 -0.0082 -0.0120 0.0049  168  THR A CB  
1200 O OG1 . THR A 167 ? 0.1314 0.1368 0.1571 -0.0117 -0.0128 0.0039  168  THR A OG1 
1201 C CG2 . THR A 167 ? 0.1157 0.1217 0.1508 -0.0055 -0.0082 0.0029  168  THR A CG2 
1202 N N   . VAL A 168 ? 0.0746 0.0865 0.1247 -0.0044 -0.0086 0.0033  169  VAL A N   
1203 C CA  . VAL A 168 ? 0.0615 0.0748 0.1179 -0.0022 -0.0064 0.0033  169  VAL A CA  
1204 C C   . VAL A 168 ? 0.0669 0.0786 0.1218 -0.0011 -0.0044 0.0023  169  VAL A C   
1205 O O   . VAL A 168 ? 0.0810 0.0919 0.1310 -0.0013 -0.0035 0.0007  169  VAL A O   
1206 C CB  . VAL A 168 ? 0.0924 0.1056 0.1489 -0.0019 -0.0042 0.0014  169  VAL A CB  
1207 C CG1 . VAL A 168 ? 0.0899 0.1038 0.1499 -0.0006 -0.0011 0.0004  169  VAL A CG1 
1208 C CG2 . VAL A 168 ? 0.0979 0.1126 0.1572 -0.0036 -0.0055 0.0023  169  VAL A CG2 
1209 N N   . VAL A 169 ? 0.0663 0.0776 0.1261 -0.0002 -0.0032 0.0036  170  VAL A N   
1210 C CA  . VAL A 169 ? 0.0644 0.0732 0.1229 -0.0003 -0.0007 0.0023  170  VAL A CA  
1211 C C   . VAL A 169 ? 0.0903 0.0974 0.1517 -0.0004 0.0035  -0.0001 170  VAL A C   
1212 O O   . VAL A 169 ? 0.1034 0.1075 0.1638 -0.0016 0.0063  -0.0019 170  VAL A O   
1213 C CB  . VAL A 169 ? 0.0887 0.0959 0.1483 0.0002  -0.0014 0.0056  170  VAL A CB  
1214 C CG1 . VAL A 169 ? 0.1002 0.1086 0.1540 -0.0009 -0.0051 0.0071  170  VAL A CG1 
1215 C CG2 . VAL A 169 ? 0.1024 0.1103 0.1704 0.0023  -0.0010 0.0097  170  VAL A CG2 
1216 N N   . GLY A 170 ? 0.0906 0.0990 0.1547 0.0001  0.0045  -0.0008 171  GLY A N   
1217 C CA  . GLY A 170 ? 0.0850 0.0911 0.1496 -0.0007 0.0093  -0.0039 171  GLY A CA  
1218 C C   . GLY A 170 ? 0.0938 0.1011 0.1637 0.0007  0.0109  -0.0031 171  GLY A C   
1219 O O   . GLY A 170 ? 0.0851 0.0961 0.1575 0.0016  0.0077  -0.0005 171  GLY A O   
1220 N N   . TYR A 171 ? 0.0669 0.0708 0.1377 0.0002  0.0165  -0.0059 172  TYR A N   
1221 C CA  . TYR A 171 ? 0.0747 0.0792 0.1511 0.0016  0.0197  -0.0054 172  TYR A CA  
1222 C C   . TYR A 171 ? 0.1063 0.1040 0.1843 0.0015  0.0277  -0.0083 172  TYR A C   
1223 O O   . TYR A 171 ? 0.0954 0.0881 0.1670 -0.0016 0.0307  -0.0124 172  TYR A O   
1224 C CB  . TYR A 171 ? 0.0894 0.0977 0.1611 0.0002  0.0183  -0.0066 172  TYR A CB  
1225 C CG  . TYR A 171 ? 0.0928 0.1014 0.1545 -0.0032 0.0187  -0.0104 172  TYR A CG  
1226 C CD1 . TYR A 171 ? 0.0981 0.1042 0.1555 -0.0059 0.0241  -0.0145 172  TYR A CD1 
1227 C CD2 . TYR A 171 ? 0.0955 0.1077 0.1519 -0.0040 0.0140  -0.0096 172  TYR A CD2 
1228 C CE1 . TYR A 171 ? 0.0841 0.0930 0.1317 -0.0101 0.0235  -0.0173 172  TYR A CE1 
1229 C CE2 . TYR A 171 ? 0.1065 0.1219 0.1554 -0.0070 0.0138  -0.0115 172  TYR A CE2 
1230 C CZ  . TYR A 171 ? 0.1085 0.1232 0.1528 -0.0104 0.0179  -0.0151 172  TYR A CZ  
1231 O OH  . TYR A 171 ? 0.1261 0.1464 0.1625 -0.0143 0.0168  -0.0164 172  TYR A OH  
1232 N N   . GLY A 172 ? 0.1166 0.1139 0.2037 0.0045  0.0318  -0.0060 173  GLY A N   
1233 C CA  . GLY A 172 ? 0.1263 0.1156 0.2160 0.0050  0.0413  -0.0086 173  GLY A CA  
1234 C C   . GLY A 172 ? 0.1408 0.1315 0.2380 0.0074  0.0462  -0.0072 173  GLY A C   
1235 O O   . GLY A 172 ? 0.1355 0.1340 0.2351 0.0079  0.0416  -0.0047 173  GLY A O   
1236 N N   . THR A 173 ? 0.1327 0.1155 0.2342 0.0090  0.0561  -0.0088 174  THR A N   
1237 C CA  . THR A 173 ? 0.1414 0.1246 0.2513 0.0118  0.0629  -0.0076 174  THR A CA  
1238 C C   . THR A 173 ? 0.2016 0.1791 0.3249 0.0174  0.0714  -0.0035 174  THR A C   
1239 O O   . THR A 173 ? 0.1931 0.1595 0.3133 0.0167  0.0779  -0.0067 174  THR A O   
1240 C CB  . THR A 173 ? 0.1637 0.1413 0.2615 0.0069  0.0693  -0.0155 174  THR A CB  
1241 O OG1 . THR A 173 ? 0.1850 0.1689 0.2711 0.0023  0.0613  -0.0177 174  THR A OG1 
1242 C CG2 . THR A 173 ? 0.2138 0.1909 0.3197 0.0096  0.0777  -0.0145 174  THR A CG2 
1243 N N   . ASP A 174 ? 0.1691 0.1544 0.3084 0.0228  0.0721  0.0040  175  ASP A N   
1244 C CA  . ASP A 174 ? 0.1742 0.1564 0.3295 0.0295  0.0807  0.0100  175  ASP A CA  
1245 C C   . ASP A 174 ? 0.2250 0.1960 0.3796 0.0297  0.0950  0.0044  175  ASP A C   
1246 O O   . ASP A 174 ? 0.1997 0.1745 0.3532 0.0283  0.0966  0.0024  175  ASP A O   
1247 C CB  . ASP A 174 ? 0.1717 0.1698 0.3450 0.0345  0.0751  0.0209  175  ASP A CB  
1248 C CG  . ASP A 174 ? 0.2582 0.2566 0.4516 0.0426  0.0840  0.0295  175  ASP A CG  
1249 O OD1 . ASP A 174 ? 0.2860 0.2764 0.4823 0.0458  0.0884  0.0319  175  ASP A OD1 
1250 O OD2 . ASP A 174 ? 0.2648 0.2720 0.4718 0.0459  0.0867  0.0346  175  ASP A OD2 
1251 N N   . PRO A 175 ? 0.2400 0.1960 0.3948 0.0313  0.1065  0.0018  176  PRO A N   
1252 C CA  . PRO A 175 ? 0.2720 0.2148 0.4230 0.0301  0.1215  -0.0052 176  PRO A CA  
1253 C C   . PRO A 175 ? 0.3299 0.2776 0.4981 0.0368  0.1292  0.0008  176  PRO A C   
1254 O O   . PRO A 175 ? 0.3484 0.2922 0.5099 0.0338  0.1361  -0.0054 176  PRO A O   
1255 C CB  . PRO A 175 ? 0.2995 0.2245 0.4487 0.0306  0.1324  -0.0083 176  PRO A CB  
1256 C CG  . PRO A 175 ? 0.3382 0.2691 0.4964 0.0348  0.1241  0.0004  176  PRO A CG  
1257 C CD  . PRO A 175 ? 0.2613 0.2102 0.4171 0.0328  0.1068  0.0040  176  PRO A CD  
1258 N N   . ASN A 176 ? 0.2900 0.2479 0.4801 0.0452  0.1277  0.0131  177  ASN A N   
1259 C CA  . ASN A 176 ? 0.3057 0.2694 0.5144 0.0518  0.1361  0.0196  177  ASN A CA  
1260 C C   . ASN A 176 ? 0.3140 0.2937 0.5237 0.0491  0.1275  0.0208  177  ASN A C   
1261 O O   . ASN A 176 ? 0.3402 0.3175 0.5507 0.0491  0.1366  0.0177  177  ASN A O   
1262 C CB  . ASN A 176 ? 0.3601 0.3313 0.5937 0.0618  0.1381  0.0336  177  ASN A CB  
1263 C CG  . ASN A 176 ? 0.7525 0.7230 1.0055 0.0696  0.1530  0.0391  177  ASN A CG  
1264 O OD1 . ASN A 176 ? 0.7102 0.6641 0.9571 0.0689  0.1685  0.0308  177  ASN A OD1 
1265 N ND2 . ASN A 176 ? 0.6367 0.6262 0.9136 0.0768  0.1491  0.0532  177  ASN A ND2 
1266 N N   . SER A 177 ? 0.2058 0.2004 0.4144 0.0465  0.1112  0.0248  178  SER A N   
1267 C CA  . SER A 177 ? 0.1889 0.1969 0.3977 0.0433  0.1038  0.0255  178  SER A CA  
1268 C C   . SER A 177 ? 0.2239 0.2243 0.4099 0.0354  0.1026  0.0143  178  SER A C   
1269 O O   . SER A 177 ? 0.2188 0.2248 0.4033 0.0329  0.1021  0.0131  178  SER A O   
1270 C CB  . SER A 177 ? 0.1866 0.2114 0.4011 0.0424  0.0882  0.0331  178  SER A CB  
1271 O OG  . SER A 177 ? 0.2077 0.2277 0.4055 0.0377  0.0795  0.0282  178  SER A OG  
1272 N N   . GLY A 178 ? 0.1915 0.1815 0.3603 0.0310  0.1008  0.0071  179  GLY A N   
1273 C CA  . GLY A 178 ? 0.1946 0.1802 0.3423 0.0234  0.0982  -0.0021 179  GLY A CA  
1274 C C   . GLY A 178 ? 0.2198 0.2166 0.3621 0.0200  0.0837  -0.0002 179  GLY A C   
1275 O O   . GLY A 178 ? 0.2213 0.2174 0.3486 0.0147  0.0804  -0.0055 179  GLY A O   
1276 N N   . ASN A 179 ? 0.1255 0.1328 0.2799 0.0230  0.0754  0.0076  180  ASN A N   
1277 C CA  . ASN A 179 ? 0.1242 0.1402 0.2731 0.0195  0.0629  0.0088  180  ASN A CA  
1278 C C   . ASN A 179 ? 0.1338 0.1458 0.2715 0.0172  0.0563  0.0063  180  ASN A C   
1279 O O   . ASN A 179 ? 0.1310 0.1387 0.2717 0.0196  0.0581  0.0076  180  ASN A O   
1280 C CB  . ASN A 179 ? 0.1487 0.1782 0.3133 0.0217  0.0571  0.0173  180  ASN A CB  
1281 C CG  . ASN A 179 ? 0.2787 0.3141 0.4525 0.0222  0.0619  0.0192  180  ASN A CG  
1282 O OD1 . ASN A 179 ? 0.2393 0.2707 0.4035 0.0191  0.0653  0.0140  180  ASN A OD1 
1283 N ND2 . ASN A 179 ? 0.2416 0.2873 0.4343 0.0262  0.0624  0.0274  180  ASN A ND2 
1284 N N   . SER A 180 ? 0.1095 0.1231 0.2349 0.0128  0.0495  0.0031  181  SER A N   
1285 C CA  . SER A 180 ? 0.1035 0.1145 0.2179 0.0103  0.0434  0.0007  181  SER A CA  
1286 C C   . SER A 180 ? 0.1004 0.1192 0.2189 0.0106  0.0339  0.0057  181  SER A C   
1287 O O   . SER A 180 ? 0.0950 0.1218 0.2215 0.0107  0.0308  0.0098  181  SER A O   
1288 C CB  . SER A 180 ? 0.1454 0.1539 0.2446 0.0059  0.0425  -0.0049 181  SER A CB  
1289 O OG  . SER A 180 ? 0.2158 0.2168 0.3088 0.0043  0.0510  -0.0102 181  SER A OG  
1290 N N   . TYR A 181 ? 0.0796 0.0963 0.1925 0.0099  0.0295  0.0053  182  TYR A N   
1291 C CA  . TYR A 181 ? 0.0865 0.1094 0.2015 0.0096  0.0212  0.0095  182  TYR A CA  
1292 C C   . TYR A 181 ? 0.1017 0.1211 0.2051 0.0073  0.0170  0.0067  182  TYR A C   
1293 O O   . TYR A 181 ? 0.0913 0.1044 0.1882 0.0068  0.0202  0.0029  182  TYR A O   
1294 C CB  . TYR A 181 ? 0.0985 0.1252 0.2260 0.0133  0.0213  0.0161  182  TYR A CB  
1295 C CG  . TYR A 181 ? 0.1059 0.1241 0.2337 0.0159  0.0274  0.0152  182  TYR A CG  
1296 C CD1 . TYR A 181 ? 0.1460 0.1586 0.2803 0.0188  0.0372  0.0144  182  TYR A CD1 
1297 C CD2 . TYR A 181 ? 0.1173 0.1320 0.2390 0.0152  0.0244  0.0149  182  TYR A CD2 
1298 C CE1 . TYR A 181 ? 0.1642 0.1667 0.2980 0.0205  0.0441  0.0129  182  TYR A CE1 
1299 C CE2 . TYR A 181 ? 0.1395 0.1452 0.2610 0.0168  0.0306  0.0137  182  TYR A CE2 
1300 C CZ  . TYR A 181 ? 0.1751 0.1743 0.3027 0.0193  0.0405  0.0126  182  TYR A CZ  
1301 O OH  . TYR A 181 ? 0.1792 0.1676 0.3059 0.0201  0.0476  0.0109  182  TYR A OH  
1302 N N   . TRP A 182 ? 0.0608 0.0843 0.1615 0.0055  0.0104  0.0083  183  TRP A N   
1303 C CA  . TRP A 182 ? 0.0628 0.0842 0.1546 0.0039  0.0062  0.0070  183  TRP A CA  
1304 C C   . TRP A 182 ? 0.0872 0.1096 0.1834 0.0055  0.0044  0.0110  183  TRP A C   
1305 O O   . TRP A 182 ? 0.0819 0.1105 0.1874 0.0067  0.0026  0.0163  183  TRP A O   
1306 C CB  . TRP A 182 ? 0.0617 0.0857 0.1489 0.0011  0.0013  0.0071  183  TRP A CB  
1307 C CG  . TRP A 182 ? 0.0665 0.0892 0.1501 -0.0001 0.0032  0.0045  183  TRP A CG  
1308 C CD1 . TRP A 182 ? 0.0925 0.1184 0.1805 -0.0013 0.0034  0.0056  183  TRP A CD1 
1309 C CD2 . TRP A 182 ? 0.0601 0.0792 0.1354 -0.0003 0.0050  0.0014  183  TRP A CD2 
1310 N NE1 . TRP A 182 ? 0.0893 0.1122 0.1715 -0.0020 0.0056  0.0034  183  TRP A NE1 
1311 C CE2 . TRP A 182 ? 0.0922 0.1117 0.1668 -0.0011 0.0065  0.0012  183  TRP A CE2 
1312 C CE3 . TRP A 182 ? 0.0626 0.0793 0.1315 0.0000  0.0056  -0.0007 183  TRP A CE3 
1313 C CZ2 . TRP A 182 ? 0.0873 0.1050 0.1549 -0.0011 0.0082  -0.0001 183  TRP A CZ2 
1314 C CZ3 . TRP A 182 ? 0.0886 0.1051 0.1511 -0.0005 0.0068  -0.0021 183  TRP A CZ3 
1315 C CH2 . TRP A 182 ? 0.0927 0.1099 0.1548 -0.0007 0.0081  -0.0014 183  TRP A CH2 
1316 N N   . ILE A 183 ? 0.0694 0.0870 0.1594 0.0054  0.0047  0.0092  184  ILE A N   
1317 C CA  . ILE A 183 ? 0.0598 0.0777 0.1522 0.0066  0.0030  0.0133  184  ILE A CA  
1318 C C   . ILE A 183 ? 0.0782 0.0984 0.1630 0.0039  -0.0031 0.0136  184  ILE A C   
1319 O O   . ILE A 183 ? 0.0849 0.1017 0.1609 0.0022  -0.0034 0.0096  184  ILE A O   
1320 C CB  . ILE A 183 ? 0.0934 0.1037 0.1840 0.0075  0.0079  0.0112  184  ILE A CB  
1321 C CG1 . ILE A 183 ? 0.0776 0.0834 0.1737 0.0092  0.0155  0.0094  184  ILE A CG1 
1322 C CG2 . ILE A 183 ? 0.1148 0.1251 0.2083 0.0092  0.0064  0.0166  184  ILE A CG2 
1323 C CD1 . ILE A 183 ? 0.1278 0.1245 0.2186 0.0077  0.0211  0.0047  184  ILE A CD1 
1324 N N   . VAL A 184 ? 0.0709 0.0976 0.1593 0.0032  -0.0078 0.0186  185  VAL A N   
1325 C CA  . VAL A 184 ? 0.0728 0.1012 0.1527 -0.0006 -0.0129 0.0181  185  VAL A CA  
1326 C C   . VAL A 184 ? 0.1040 0.1350 0.1824 -0.0011 -0.0164 0.0229  185  VAL A C   
1327 O O   . VAL A 184 ? 0.1002 0.1380 0.1874 0.0005  -0.0181 0.0295  185  VAL A O   
1328 C CB  . VAL A 184 ? 0.1020 0.1364 0.1843 -0.0036 -0.0159 0.0187  185  VAL A CB  
1329 C CG1 . VAL A 184 ? 0.1238 0.1592 0.1967 -0.0089 -0.0206 0.0179  185  VAL A CG1 
1330 C CG2 . VAL A 184 ? 0.0986 0.1295 0.1805 -0.0035 -0.0122 0.0142  185  VAL A CG2 
1331 N N   . LYS A 185 ? 0.0843 0.1106 0.1524 -0.0028 -0.0169 0.0202  186  LYS A N   
1332 C CA  . LYS A 185 ? 0.0862 0.1139 0.1498 -0.0040 -0.0199 0.0239  186  LYS A CA  
1333 C C   . LYS A 185 ? 0.1108 0.1433 0.1676 -0.0094 -0.0251 0.0242  186  LYS A C   
1334 O O   . LYS A 185 ? 0.1156 0.1435 0.1638 -0.0125 -0.0244 0.0186  186  LYS A O   
1335 C CB  . LYS A 185 ? 0.1005 0.1207 0.1559 -0.0037 -0.0170 0.0203  186  LYS A CB  
1336 C CG  . LYS A 185 ? 0.1065 0.1272 0.1578 -0.0044 -0.0188 0.0246  186  LYS A CG  
1337 C CD  . LYS A 185 ? 0.1088 0.1230 0.1517 -0.0050 -0.0159 0.0206  186  LYS A CD  
1338 C CE  . LYS A 185 ? 0.1403 0.1543 0.1803 -0.0050 -0.0166 0.0254  186  LYS A CE  
1339 N NZ  . LYS A 185 ? 0.1338 0.1424 0.1658 -0.0060 -0.0136 0.0219  186  LYS A NZ  
1340 N N   . ASN A 186 ? 0.1076 0.1493 0.1686 -0.0108 -0.0298 0.0310  187  ASN A N   
1341 C CA  . ASN A 186 ? 0.1150 0.1623 0.1680 -0.0177 -0.0353 0.0312  187  ASN A CA  
1342 C C   . ASN A 186 ? 0.1495 0.1957 0.1916 -0.0201 -0.0373 0.0330  187  ASN A C   
1343 O O   . ASN A 186 ? 0.1278 0.1707 0.1718 -0.0157 -0.0348 0.0358  187  ASN A O   
1344 C CB  . ASN A 186 ? 0.1284 0.1893 0.1919 -0.0193 -0.0403 0.0378  187  ASN A CB  
1345 C CG  . ASN A 186 ? 0.1528 0.2194 0.2086 -0.0283 -0.0454 0.0357  187  ASN A CG  
1346 O OD1 . ASN A 186 ? 0.1461 0.2045 0.1874 -0.0335 -0.0445 0.0288  187  ASN A OD1 
1347 N ND2 . ASN A 186 ? 0.1809 0.2613 0.2465 -0.0307 -0.0501 0.0415  187  ASN A ND2 
1348 N N   . SER A 187 ? 0.1384 0.1870 0.1687 -0.0278 -0.0413 0.0315  188  SER A N   
1349 C CA  . SER A 187 ? 0.1535 0.2007 0.1707 -0.0314 -0.0428 0.0323  188  SER A CA  
1350 C C   . SER A 187 ? 0.1984 0.2597 0.2142 -0.0371 -0.0508 0.0398  188  SER A C   
1351 O O   . SER A 187 ? 0.2177 0.2795 0.2184 -0.0447 -0.0535 0.0381  188  SER A O   
1352 C CB  . SER A 187 ? 0.1920 0.2279 0.1937 -0.0363 -0.0392 0.0228  188  SER A CB  
1353 O OG  . SER A 187 ? 0.2083 0.2444 0.2075 -0.0419 -0.0401 0.0182  188  SER A OG  
1354 N N   . TRP A 188 ? 0.1479 0.2213 0.1794 -0.0335 -0.0542 0.0485  189  TRP A N   
1355 C CA  . TRP A 188 ? 0.1593 0.2503 0.1930 -0.0383 -0.0625 0.0580  189  TRP A CA  
1356 C C   . TRP A 188 ? 0.1901 0.2878 0.2330 -0.0315 -0.0636 0.0699  189  TRP A C   
1357 O O   . TRP A 188 ? 0.2109 0.3253 0.2634 -0.0317 -0.0696 0.0811  189  TRP A O   
1358 C CB  . TRP A 188 ? 0.1673 0.2701 0.2135 -0.0401 -0.0660 0.0603  189  TRP A CB  
1359 C CG  . TRP A 188 ? 0.1818 0.2806 0.2181 -0.0488 -0.0663 0.0504  189  TRP A CG  
1360 C CD1 . TRP A 188 ? 0.2245 0.3111 0.2417 -0.0556 -0.0641 0.0406  189  TRP A CD1 
1361 C CD2 . TRP A 188 ? 0.1764 0.2814 0.2223 -0.0511 -0.0673 0.0493  189  TRP A CD2 
1362 N NE1 . TRP A 188 ? 0.2290 0.3132 0.2430 -0.0621 -0.0635 0.0335  189  TRP A NE1 
1363 C CE2 . TRP A 188 ? 0.2302 0.3262 0.2614 -0.0599 -0.0660 0.0387  189  TRP A CE2 
1364 C CE3 . TRP A 188 ? 0.1903 0.3082 0.2560 -0.0469 -0.0689 0.0567  189  TRP A CE3 
1365 C CZ2 . TRP A 188 ? 0.2329 0.3313 0.2684 -0.0647 -0.0662 0.0351  189  TRP A CZ2 
1366 C CZ3 . TRP A 188 ? 0.2175 0.3397 0.2877 -0.0519 -0.0697 0.0533  189  TRP A CZ3 
1367 C CH2 . TRP A 188 ? 0.2329 0.3447 0.2879 -0.0607 -0.0683 0.0425  189  TRP A CH2 
1368 N N   . GLY A 189 ? 0.1745 0.2597 0.2149 -0.0260 -0.0575 0.0680  190  GLY A N   
1369 C CA  . GLY A 189 ? 0.1635 0.2508 0.2115 -0.0195 -0.0564 0.0782  190  GLY A CA  
1370 C C   . GLY A 189 ? 0.1861 0.2750 0.2549 -0.0103 -0.0525 0.0841  190  GLY A C   
1371 O O   . GLY A 189 ? 0.1529 0.2426 0.2302 -0.0093 -0.0512 0.0804  190  GLY A O   
1372 N N   . THR A 190 ? 0.1798 0.2690 0.2572 -0.0037 -0.0501 0.0938  191  THR A N   
1373 C CA  . THR A 190 ? 0.1771 0.2642 0.2737 0.0055  -0.0438 0.0990  191  THR A CA  
1374 C C   . THR A 190 ? 0.2464 0.3517 0.3603 0.0083  -0.0481 0.1116  191  THR A C   
1375 O O   . THR A 190 ? 0.2483 0.3518 0.3789 0.0160  -0.0419 0.1156  191  THR A O   
1376 C CB  . THR A 190 ? 0.2121 0.2885 0.3110 0.0115  -0.0371 0.1030  191  THR A CB  
1377 O OG1 . THR A 190 ? 0.2471 0.3327 0.3427 0.0107  -0.0422 0.1144  191  THR A OG1 
1378 C CG2 . THR A 190 ? 0.2130 0.2722 0.2993 0.0097  -0.0316 0.0907  191  THR A CG2 
1379 N N   . SER A 191 ? 0.2110 0.3337 0.3209 0.0019  -0.0579 0.1179  192  SER A N   
1380 C CA  . SER A 191 ? 0.2106 0.3540 0.3377 0.0038  -0.0630 0.1309  192  SER A CA  
1381 C C   . SER A 191 ? 0.2534 0.4016 0.3882 0.0017  -0.0635 0.1252  192  SER A C   
1382 O O   . SER A 191 ? 0.2751 0.4386 0.4283 0.0052  -0.0651 0.1353  192  SER A O   
1383 C CB  . SER A 191 ? 0.2266 0.3888 0.3453 -0.0039 -0.0742 0.1399  192  SER A CB  
1384 O OG  . SER A 191 ? 0.3221 0.4828 0.4391 0.0003  -0.0732 0.1493  192  SER A OG  
1385 N N   . TRP A 192 ? 0.1855 0.3214 0.3069 -0.0039 -0.0619 0.1101  193  TRP A N   
1386 C CA  . TRP A 192 ? 0.1740 0.3119 0.3005 -0.0063 -0.0614 0.1036  193  TRP A CA  
1387 C C   . TRP A 192 ? 0.1863 0.3087 0.3214 0.0019  -0.0508 0.0977  193  TRP A C   
1388 O O   . TRP A 192 ? 0.1481 0.2541 0.2757 0.0049  -0.0448 0.0917  193  TRP A O   
1389 C CB  . TRP A 192 ? 0.1583 0.2906 0.2645 -0.0171 -0.0649 0.0911  193  TRP A CB  
1390 C CG  . TRP A 192 ? 0.1548 0.2878 0.2648 -0.0203 -0.0642 0.0843  193  TRP A CG  
1391 C CD1 . TRP A 192 ? 0.1901 0.3397 0.3062 -0.0265 -0.0705 0.0879  193  TRP A CD1 
1392 C CD2 . TRP A 192 ? 0.1352 0.2526 0.2445 -0.0173 -0.0566 0.0737  193  TRP A CD2 
1393 N NE1 . TRP A 192 ? 0.1897 0.3336 0.3086 -0.0274 -0.0667 0.0798  193  TRP A NE1 
1394 C CE2 . TRP A 192 ? 0.1831 0.3072 0.2973 -0.0217 -0.0582 0.0712  193  TRP A CE2 
1395 C CE3 . TRP A 192 ? 0.1348 0.2340 0.2394 -0.0120 -0.0487 0.0664  193  TRP A CE3 
1396 C CZ2 . TRP A 192 ? 0.1624 0.2752 0.2767 -0.0203 -0.0521 0.0622  193  TRP A CZ2 
1397 C CZ3 . TRP A 192 ? 0.1518 0.2414 0.2566 -0.0109 -0.0433 0.0577  193  TRP A CZ3 
1398 C CH2 . TRP A 192 ? 0.1577 0.2535 0.2667 -0.0149 -0.0449 0.0557  193  TRP A CH2 
1399 N N   . GLY A 193 ? 0.1554 0.2836 0.3054 0.0046  -0.0485 0.0991  194  GLY A N   
1400 C CA  . GLY A 193 ? 0.1457 0.2596 0.3020 0.0110  -0.0383 0.0927  194  GLY A CA  
1401 C C   . GLY A 193 ? 0.1772 0.2806 0.3409 0.0200  -0.0298 0.0966  194  GLY A C   
1402 O O   . GLY A 193 ? 0.1768 0.2881 0.3506 0.0246  -0.0305 0.1088  194  GLY A O   
1403 N N   . GLN A 194 ? 0.1387 0.2245 0.2981 0.0223  -0.0212 0.0866  195  GLN A N   
1404 C CA  . GLN A 194 ? 0.1399 0.2122 0.3038 0.0291  -0.0117 0.0873  195  GLN A CA  
1405 C C   . GLN A 194 ? 0.1712 0.2348 0.3201 0.0264  -0.0131 0.0842  195  GLN A C   
1406 O O   . GLN A 194 ? 0.1627 0.2136 0.2992 0.0235  -0.0103 0.0732  195  GLN A O   
1407 C CB  . GLN A 194 ? 0.1555 0.2142 0.3198 0.0309  -0.0023 0.0774  195  GLN A CB  
1408 C CG  . GLN A 194 ? 0.2253 0.2902 0.4044 0.0341  0.0014  0.0798  195  GLN A CG  
1409 C CD  . GLN A 194 ? 0.4804 0.5306 0.6566 0.0349  0.0110  0.0694  195  GLN A CD  
1410 O OE1 . GLN A 194 ? 0.5133 0.5504 0.6913 0.0388  0.0204  0.0678  195  GLN A OE1 
1411 N NE2 . GLN A 194 ? 0.2962 0.3476 0.4667 0.0306  0.0091  0.0618  195  GLN A NE2 
1412 N N   . GLU A 195 ? 0.1459 0.2176 0.2961 0.0273  -0.0178 0.0947  196  GLU A N   
1413 C CA  . GLU A 195 ? 0.1483 0.2131 0.2842 0.0244  -0.0194 0.0928  196  GLU A CA  
1414 C C   . GLU A 195 ? 0.1588 0.2202 0.2762 0.0162  -0.0240 0.0808  196  GLU A C   
1415 O O   . GLU A 195 ? 0.1578 0.2073 0.2640 0.0145  -0.0210 0.0735  196  GLU A O   
1416 C CB  . GLU A 195 ? 0.1793 0.2272 0.3162 0.0291  -0.0094 0.0909  196  GLU A CB  
1417 C CG  . GLU A 195 ? 0.3166 0.3636 0.4719 0.0377  -0.0019 0.1012  196  GLU A CG  
1418 C CD  . GLU A 195 ? 0.7512 0.7989 0.9095 0.0414  -0.0015 0.1131  196  GLU A CD  
1419 O OE1 . GLU A 195 ? 0.7870 0.8514 0.9511 0.0423  -0.0088 0.1255  196  GLU A OE1 
1420 O OE2 . GLU A 195 ? 0.7757 0.8079 0.9304 0.0429  0.0060  0.1103  196  GLU A OE2 
1421 N N   . GLY A 196 ? 0.1310 0.2026 0.2464 0.0112  -0.0304 0.0791  197  GLY A N   
1422 C CA  . GLY A 196 ? 0.1077 0.1755 0.2066 0.0039  -0.0337 0.0688  197  GLY A CA  
1423 C C   . GLY A 196 ? 0.1203 0.1810 0.2181 0.0031  -0.0300 0.0586  197  GLY A C   
1424 O O   . GLY A 196 ? 0.1323 0.1903 0.2182 -0.0024 -0.0321 0.0511  197  GLY A O   
1425 N N   . TYR A 197 ? 0.1008 0.1577 0.2104 0.0086  -0.0236 0.0585  198  TYR A N   
1426 C CA  . TYR A 197 ? 0.0942 0.1445 0.2034 0.0084  -0.0192 0.0499  198  TYR A CA  
1427 C C   . TYR A 197 ? 0.1060 0.1653 0.2268 0.0091  -0.0198 0.0526  198  TYR A C   
1428 O O   . TYR A 197 ? 0.1065 0.1755 0.2406 0.0124  -0.0206 0.0619  198  TYR A O   
1429 C CB  . TYR A 197 ? 0.1150 0.1531 0.2264 0.0128  -0.0106 0.0462  198  TYR A CB  
1430 C CG  . TYR A 197 ? 0.1066 0.1354 0.2053 0.0107  -0.0096 0.0407  198  TYR A CG  
1431 C CD1 . TYR A 197 ? 0.1158 0.1426 0.2128 0.0118  -0.0096 0.0454  198  TYR A CD1 
1432 C CD2 . TYR A 197 ? 0.1186 0.1418 0.2078 0.0077  -0.0086 0.0317  198  TYR A CD2 
1433 C CE1 . TYR A 197 ? 0.1295 0.1488 0.2158 0.0096  -0.0084 0.0405  198  TYR A CE1 
1434 C CE2 . TYR A 197 ? 0.1374 0.1543 0.2168 0.0059  -0.0078 0.0276  198  TYR A CE2 
1435 C CZ  . TYR A 197 ? 0.1556 0.1707 0.2336 0.0066  -0.0077 0.0317  198  TYR A CZ  
1436 O OH  . TYR A 197 ? 0.1620 0.1717 0.2311 0.0046  -0.0065 0.0278  198  TYR A OH  
1437 N N   . ILE A 198 ? 0.0792 0.1353 0.1960 0.0066  -0.0186 0.0451  199  ILE A N   
1438 C CA  . ILE A 198 ? 0.0612 0.1239 0.1883 0.0070  -0.0177 0.0462  199  ILE A CA  
1439 C C   . ILE A 198 ? 0.0956 0.1480 0.2210 0.0087  -0.0106 0.0386  199  ILE A C   
1440 O O   . ILE A 198 ? 0.1034 0.1469 0.2167 0.0066  -0.0096 0.0314  199  ILE A O   
1441 C CB  . ILE A 198 ? 0.0862 0.1586 0.2101 0.0002  -0.0249 0.0462  199  ILE A CB  
1442 C CG1 . ILE A 198 ? 0.0986 0.1788 0.2349 0.0005  -0.0235 0.0479  199  ILE A CG1 
1443 C CG2 . ILE A 198 ? 0.0952 0.1592 0.2023 -0.0054 -0.0263 0.0372  199  ILE A CG2 
1444 C CD1 . ILE A 198 ? 0.1299 0.2216 0.2649 -0.0073 -0.0308 0.0491  199  ILE A CD1 
1445 N N   . TRP A 199 ? 0.0769 0.1311 0.2146 0.0125  -0.0053 0.0409  200  TRP A N   
1446 C CA  . TRP A 199 ? 0.0758 0.1222 0.2117 0.0132  0.0013  0.0340  200  TRP A CA  
1447 C C   . TRP A 199 ? 0.0799 0.1335 0.2177 0.0097  -0.0016 0.0333  200  TRP A C   
1448 O O   . TRP A 199 ? 0.0840 0.1487 0.2347 0.0106  -0.0029 0.0399  200  TRP A O   
1449 C CB  . TRP A 199 ? 0.0953 0.1378 0.2424 0.0189  0.0102  0.0362  200  TRP A CB  
1450 C CG  . TRP A 199 ? 0.1353 0.1680 0.2809 0.0219  0.0154  0.0360  200  TRP A CG  
1451 C CD1 . TRP A 199 ? 0.1901 0.2178 0.3260 0.0203  0.0126  0.0344  200  TRP A CD1 
1452 C CD2 . TRP A 199 ? 0.1578 0.1837 0.3128 0.0270  0.0253  0.0376  200  TRP A CD2 
1453 N NE1 . TRP A 199 ? 0.1994 0.2176 0.3378 0.0236  0.0200  0.0347  200  TRP A NE1 
1454 C CE2 . TRP A 199 ? 0.2323 0.2483 0.3818 0.0277  0.0282  0.0363  200  TRP A CE2 
1455 C CE3 . TRP A 199 ? 0.1884 0.2146 0.3554 0.0309  0.0331  0.0395  200  TRP A CE3 
1456 C CZ2 . TRP A 199 ? 0.2499 0.2550 0.4054 0.0317  0.0390  0.0366  200  TRP A CZ2 
1457 C CZ3 . TRP A 199 ? 0.2331 0.2484 0.4058 0.0354  0.0442  0.0396  200  TRP A CZ3 
1458 C CH2 . TRP A 199 ? 0.2544 0.2587 0.4210 0.0355  0.0472  0.0379  200  TRP A CH2 
1459 N N   . MET A 200 ? 0.0580 0.1063 0.1840 0.0058  -0.0024 0.0263  201  MET A N   
1460 C CA  . MET A 200 ? 0.0524 0.1055 0.1789 0.0020  -0.0044 0.0253  201  MET A CA  
1461 C C   . MET A 200 ? 0.0757 0.1230 0.2016 0.0033  0.0023  0.0208  201  MET A C   
1462 O O   . MET A 200 ? 0.0663 0.1049 0.1824 0.0037  0.0051  0.0157  201  MET A O   
1463 C CB  . MET A 200 ? 0.0719 0.1228 0.1857 -0.0035 -0.0097 0.0217  201  MET A CB  
1464 C CG  . MET A 200 ? 0.0968 0.1534 0.2092 -0.0058 -0.0161 0.0258  201  MET A CG  
1465 S SD  . MET A 200 ? 0.1103 0.1639 0.2077 -0.0133 -0.0212 0.0214  201  MET A SD  
1466 C CE  . MET A 200 ? 0.1088 0.1701 0.2118 -0.0189 -0.0230 0.0219  201  MET A CE  
1467 N N   . GLN A 201 ? 0.0474 0.1006 0.1841 0.0041  0.0051  0.0234  202  GLN A N   
1468 C CA  . GLN A 201 ? 0.0459 0.0938 0.1826 0.0057  0.0125  0.0199  202  GLN A CA  
1469 C C   . GLN A 201 ? 0.0806 0.1223 0.2041 0.0024  0.0123  0.0142  202  GLN A C   
1470 O O   . GLN A 201 ? 0.0759 0.1194 0.1957 -0.0014 0.0080  0.0140  202  GLN A O   
1471 C CB  . GLN A 201 ? 0.0542 0.1110 0.2056 0.0066  0.0152  0.0244  202  GLN A CB  
1472 C CG  . GLN A 201 ? 0.0795 0.1308 0.2321 0.0091  0.0246  0.0214  202  GLN A CG  
1473 C CD  . GLN A 201 ? 0.0508 0.1104 0.2203 0.0116  0.0291  0.0267  202  GLN A CD  
1474 O OE1 . GLN A 201 ? 0.0860 0.1570 0.2689 0.0126  0.0253  0.0339  202  GLN A OE1 
1475 N NE2 . GLN A 201 ? 0.0821 0.1375 0.2513 0.0123  0.0370  0.0238  202  GLN A NE2 
1476 N N   . MET A 202 ? 0.0713 0.1056 0.1880 0.0038  0.0177  0.0100  203  MET A N   
1477 C CA  . MET A 202 ? 0.0743 0.1041 0.1798 0.0016  0.0184  0.0061  203  MET A CA  
1478 C C   . MET A 202 ? 0.1090 0.1407 0.2181 0.0007  0.0223  0.0065  203  MET A C   
1479 O O   . MET A 202 ? 0.1326 0.1678 0.2521 0.0024  0.0265  0.0085  203  MET A O   
1480 C CB  . MET A 202 ? 0.1074 0.1308 0.2039 0.0023  0.0220  0.0021  203  MET A CB  
1481 C CG  . MET A 202 ? 0.1488 0.1699 0.2403 0.0024  0.0183  0.0013  203  MET A CG  
1482 S SD  . MET A 202 ? 0.1973 0.2124 0.2792 0.0016  0.0228  -0.0037 203  MET A SD  
1483 C CE  A MET A 202 ? 0.0946 0.1108 0.1692 -0.0004 0.0241  -0.0051 203  MET A CE  
1484 C CE  B MET A 202 ? 0.1214 0.1374 0.1928 -0.0004 0.0184  -0.0047 203  MET A CE  
1485 N N   . GLY A 203 ? 0.0970 0.1265 0.1983 -0.0015 0.0216  0.0052  204  GLY A N   
1486 C CA  . GLY A 203 ? 0.0991 0.1294 0.2021 -0.0026 0.0258  0.0057  204  GLY A CA  
1487 C C   . GLY A 203 ? 0.1557 0.1918 0.2687 -0.0048 0.0245  0.0087  204  GLY A C   
1488 O O   . GLY A 203 ? 0.1726 0.2103 0.2898 -0.0054 0.0289  0.0096  204  GLY A O   
1489 N N   . LEU A 204 ? 0.0945 0.1343 0.2109 -0.0069 0.0184  0.0104  205  LEU A N   
1490 C CA  . LEU A 204 ? 0.0965 0.1436 0.2222 -0.0107 0.0163  0.0132  205  LEU A CA  
1491 C C   . LEU A 204 ? 0.1348 0.1777 0.2530 -0.0159 0.0136  0.0115  205  LEU A C   
1492 O O   . LEU A 204 ? 0.1045 0.1396 0.2114 -0.0157 0.0123  0.0090  205  LEU A O   
1493 C CB  . LEU A 204 ? 0.0857 0.1423 0.2218 -0.0108 0.0115  0.0170  205  LEU A CB  
1494 C CG  . LEU A 204 ? 0.1300 0.1903 0.2758 -0.0051 0.0147  0.0199  205  LEU A CG  
1495 C CD1 . LEU A 204 ? 0.1125 0.1850 0.2708 -0.0055 0.0095  0.0260  205  LEU A CD1 
1496 C CD2 . LEU A 204 ? 0.1440 0.2048 0.2970 -0.0025 0.0228  0.0203  205  LEU A CD2 
1497 N N   . ASN A 205 ? 0.1237 0.1717 0.2486 -0.0207 0.0132  0.0130  206  ASN A N   
1498 C CA  . ASN A 205 ? 0.0995 0.1425 0.2179 -0.0271 0.0115  0.0111  206  ASN A CA  
1499 C C   . ASN A 205 ? 0.1280 0.1579 0.2335 -0.0252 0.0154  0.0084  206  ASN A C   
1500 O O   . ASN A 205 ? 0.1179 0.1403 0.2143 -0.0271 0.0138  0.0062  206  ASN A O   
1501 C CB  . ASN A 205 ? 0.1225 0.1683 0.2386 -0.0312 0.0048  0.0106  206  ASN A CB  
1502 C CG  . ASN A 205 ? 0.2626 0.3061 0.3749 -0.0400 0.0033  0.0085  206  ASN A CG  
1503 O OD1 . ASN A 205 ? 0.1944 0.2354 0.3082 -0.0433 0.0071  0.0080  206  ASN A OD1 
1504 N ND2 . ASN A 205 ? 0.4467 0.4907 0.5535 -0.0446 -0.0019 0.0070  206  ASN A ND2 
1505 N N   . ALA A 206 ? 0.1196 0.1473 0.2245 -0.0213 0.0207  0.0092  207  ALA A N   
1506 C CA  . ALA A 206 ? 0.1236 0.1418 0.2177 -0.0188 0.0240  0.0085  207  ALA A CA  
1507 C C   . ALA A 206 ? 0.1383 0.1487 0.2283 -0.0229 0.0260  0.0082  207  ALA A C   
1508 O O   . ALA A 206 ? 0.1522 0.1643 0.2479 -0.0278 0.0273  0.0086  207  ALA A O   
1509 C CB  . ALA A 206 ? 0.1477 0.1668 0.2414 -0.0152 0.0291  0.0099  207  ALA A CB  
1510 N N   . PRO A 207 ? 0.1079 0.1091 0.1885 -0.0213 0.0269  0.0077  208  PRO A N   
1511 C CA  . PRO A 207 ? 0.0988 0.0987 0.1730 -0.0161 0.0255  0.0077  208  PRO A CA  
1512 C C   . PRO A 207 ? 0.1197 0.1189 0.1913 -0.0171 0.0208  0.0052  208  PRO A C   
1513 O O   . PRO A 207 ? 0.1196 0.1170 0.1860 -0.0133 0.0201  0.0052  208  PRO A O   
1514 C CB  . PRO A 207 ? 0.1234 0.1144 0.1911 -0.0139 0.0303  0.0100  208  PRO A CB  
1515 C CG  . PRO A 207 ? 0.1504 0.1335 0.2182 -0.0195 0.0325  0.0085  208  PRO A CG  
1516 C CD  . PRO A 207 ? 0.1228 0.1136 0.1992 -0.0246 0.0308  0.0075  208  PRO A CD  
1517 N N   . TYR A 208 ? 0.0964 0.0983 0.1717 -0.0227 0.0175  0.0034  209  TYR A N   
1518 C CA  . TYR A 208 ? 0.0854 0.0863 0.1568 -0.0251 0.0133  0.0011  209  TYR A CA  
1519 C C   . TYR A 208 ? 0.1109 0.1197 0.1852 -0.0219 0.0088  0.0018  209  TYR A C   
1520 O O   . TYR A 208 ? 0.1026 0.1094 0.1717 -0.0218 0.0062  0.0005  209  TYR A O   
1521 C CB  . TYR A 208 ? 0.1157 0.1179 0.1887 -0.0336 0.0110  -0.0007 209  TYR A CB  
1522 C CG  . TYR A 208 ? 0.1238 0.1180 0.1953 -0.0380 0.0161  -0.0017 209  TYR A CG  
1523 C CD1 . TYR A 208 ? 0.1448 0.1248 0.2074 -0.0372 0.0216  -0.0031 209  TYR A CD1 
1524 C CD2 . TYR A 208 ? 0.1419 0.1425 0.2219 -0.0420 0.0167  -0.0003 209  TYR A CD2 
1525 C CE1 . TYR A 208 ? 0.1516 0.1226 0.2131 -0.0405 0.0277  -0.0033 209  TYR A CE1 
1526 C CE2 . TYR A 208 ? 0.1644 0.1569 0.2431 -0.0462 0.0222  -0.0010 209  TYR A CE2 
1527 C CZ  . TYR A 208 ? 0.1806 0.1575 0.2497 -0.0452 0.0279  -0.0025 209  TYR A CZ  
1528 O OH  . TYR A 208 ? 0.2413 0.2088 0.3095 -0.0491 0.0343  -0.0027 209  TYR A OH  
1529 N N   . GLY A 209 ? 0.0960 0.1129 0.1788 -0.0197 0.0086  0.0038  210  GLY A N   
1530 C CA  . GLY A 209 ? 0.0898 0.1132 0.1768 -0.0168 0.0055  0.0049  210  GLY A CA  
1531 C C   . GLY A 209 ? 0.0918 0.1239 0.1863 -0.0209 0.0007  0.0067  210  GLY A C   
1532 O O   . GLY A 209 ? 0.0956 0.1279 0.1888 -0.0271 -0.0012 0.0059  210  GLY A O   
1533 N N   . VAL A 210 ? 0.0689 0.1083 0.1710 -0.0178 -0.0010 0.0094  211  VAL A N   
1534 C CA  . VAL A 210 ? 0.0918 0.1423 0.2027 -0.0207 -0.0060 0.0132  211  VAL A CA  
1535 C C   . VAL A 210 ? 0.0982 0.1473 0.2001 -0.0260 -0.0113 0.0117  211  VAL A C   
1536 O O   . VAL A 210 ? 0.0891 0.1310 0.1816 -0.0242 -0.0115 0.0094  211  VAL A O   
1537 C CB  . VAL A 210 ? 0.1197 0.1760 0.2397 -0.0148 -0.0056 0.0171  211  VAL A CB  
1538 C CG1 . VAL A 210 ? 0.1204 0.1697 0.2322 -0.0112 -0.0057 0.0153  211  VAL A CG1 
1539 C CG2 . VAL A 210 ? 0.1230 0.1934 0.2551 -0.0167 -0.0106 0.0234  211  VAL A CG2 
1540 N N   . CYS A 211 ? 0.0948 0.1504 0.1988 -0.0335 -0.0151 0.0124  212  CYS A N   
1541 C CA  . CYS A 211 ? 0.1077 0.1616 0.2014 -0.0406 -0.0196 0.0101  212  CYS A CA  
1542 C C   . CYS A 211 ? 0.1199 0.1577 0.1990 -0.0411 -0.0156 0.0041  212  CYS A C   
1543 O O   . CYS A 211 ? 0.1285 0.1620 0.1973 -0.0447 -0.0176 0.0016  212  CYS A O   
1544 C CB  . CYS A 211 ? 0.1227 0.1843 0.2171 -0.0397 -0.0252 0.0139  212  CYS A CB  
1545 S SG  . CYS A 211 ? 0.1664 0.2467 0.2805 -0.0358 -0.0284 0.0232  212  CYS A SG  
1546 N N   . GLY A 212 ? 0.0902 0.1195 0.1683 -0.0375 -0.0096 0.0022  213  GLY A N   
1547 C CA  . GLY A 212 ? 0.0877 0.1027 0.1542 -0.0367 -0.0050 -0.0018 213  GLY A CA  
1548 C C   . GLY A 212 ? 0.1059 0.1165 0.1675 -0.0299 -0.0040 -0.0020 213  GLY A C   
1549 O O   . GLY A 212 ? 0.1124 0.1127 0.1649 -0.0293 -0.0007 -0.0045 213  GLY A O   
1550 N N   . ILE A 213 ? 0.0877 0.1052 0.1554 -0.0247 -0.0059 0.0009  214  ILE A N   
1551 C CA  . ILE A 213 ? 0.0729 0.0875 0.1363 -0.0197 -0.0055 0.0006  214  ILE A CA  
1552 C C   . ILE A 213 ? 0.0874 0.0941 0.1456 -0.0159 -0.0006 -0.0007 214  ILE A C   
1553 O O   . ILE A 213 ? 0.1018 0.1052 0.1546 -0.0134 -0.0002 -0.0014 214  ILE A O   
1554 C CB  . ILE A 213 ? 0.0861 0.1083 0.1579 -0.0156 -0.0070 0.0036  214  ILE A CB  
1555 C CG1 . ILE A 213 ? 0.0899 0.1099 0.1570 -0.0127 -0.0078 0.0034  214  ILE A CG1 
1556 C CG2 . ILE A 213 ? 0.1107 0.1340 0.1884 -0.0120 -0.0029 0.0043  214  ILE A CG2 
1557 C CD1 . ILE A 213 ? 0.1058 0.1314 0.1806 -0.0094 -0.0087 0.0063  214  ILE A CD1 
1558 N N   . ALA A 214 ? 0.1001 0.1051 0.1604 -0.0151 0.0031  -0.0003 215  ALA A N   
1559 C CA  . ALA A 214 ? 0.1059 0.1055 0.1619 -0.0111 0.0073  0.0001  215  ALA A CA  
1560 C C   . ALA A 214 ? 0.1403 0.1301 0.1904 -0.0128 0.0111  -0.0009 215  ALA A C   
1561 O O   . ALA A 214 ? 0.1355 0.1213 0.1837 -0.0091 0.0154  0.0011  215  ALA A O   
1562 C CB  . ALA A 214 ? 0.1159 0.1191 0.1763 -0.0087 0.0097  0.0020  215  ALA A CB  
1563 N N   . MET A 215 ? 0.1104 0.0962 0.1574 -0.0185 0.0102  -0.0035 216  MET A N   
1564 C CA  . MET A 215 ? 0.1090 0.0831 0.1499 -0.0211 0.0154  -0.0054 216  MET A CA  
1565 C C   . MET A 215 ? 0.1487 0.1145 0.1824 -0.0184 0.0187  -0.0063 216  MET A C   
1566 O O   . MET A 215 ? 0.1691 0.1251 0.2001 -0.0163 0.0255  -0.0056 216  MET A O   
1567 C CB  . MET A 215 ? 0.1214 0.0939 0.1605 -0.0302 0.0137  -0.0088 216  MET A CB  
1568 C CG  . MET A 215 ? 0.1235 0.1028 0.1706 -0.0330 0.0125  -0.0073 216  MET A CG  
1569 S SD  . MET A 215 ? 0.1660 0.1477 0.2126 -0.0450 0.0093  -0.0105 216  MET A SD  
1570 C CE  . MET A 215 ? 0.1895 0.1525 0.2270 -0.0491 0.0181  -0.0144 216  MET A CE  
1571 N N   . GLN A 216 ? 0.1337 0.1026 0.1646 -0.0187 0.0151  -0.0076 217  GLN A N   
1572 C CA  . GLN A 216 ? 0.1317 0.0925 0.1554 -0.0171 0.0188  -0.0089 217  GLN A CA  
1573 C C   . GLN A 216 ? 0.1613 0.1298 0.1863 -0.0133 0.0149  -0.0074 217  GLN A C   
1574 O O   . GLN A 216 ? 0.1664 0.1381 0.1887 -0.0168 0.0105  -0.0091 217  GLN A O   
1575 C CB  . GLN A 216 ? 0.1729 0.1252 0.1877 -0.0252 0.0198  -0.0141 217  GLN A CB  
1576 C CG  . GLN A 216 ? 0.2399 0.1817 0.2518 -0.0303 0.0251  -0.0167 217  GLN A CG  
1577 C CD  . GLN A 216 ? 0.4439 0.3764 0.4446 -0.0398 0.0268  -0.0228 217  GLN A CD  
1578 O OE1 . GLN A 216 ? 0.3879 0.3206 0.3818 -0.0421 0.0247  -0.0250 217  GLN A OE1 
1579 N NE2 . GLN A 216 ? 0.3748 0.2980 0.3723 -0.0463 0.0312  -0.0261 217  GLN A NE2 
1580 N N   . ALA A 217 ? 0.1199 0.0927 0.1493 -0.0069 0.0160  -0.0039 218  ALA A N   
1581 C CA  . ALA A 217 ? 0.1040 0.0846 0.1352 -0.0039 0.0125  -0.0025 218  ALA A CA  
1582 C C   . ALA A 217 ? 0.1234 0.1024 0.1537 0.0010  0.0165  -0.0003 218  ALA A C   
1583 O O   . ALA A 217 ? 0.1376 0.1133 0.1690 0.0044  0.0215  0.0024  218  ALA A O   
1584 C CB  . ALA A 217 ? 0.1009 0.0907 0.1386 -0.0022 0.0094  -0.0005 218  ALA A CB  
1585 N N   . SER A 218 ? 0.1087 0.0907 0.1376 0.0015  0.0147  -0.0007 219  SER A N   
1586 C CA  . SER A 218 ? 0.1076 0.0897 0.1368 0.0060  0.0185  0.0018  219  SER A CA  
1587 C C   . SER A 218 ? 0.1025 0.0913 0.1323 0.0060  0.0151  0.0018  219  SER A C   
1588 O O   . SER A 218 ? 0.1042 0.0949 0.1329 0.0027  0.0107  -0.0003 219  SER A O   
1589 C CB  . SER A 218 ? 0.1467 0.1170 0.1703 0.0059  0.0252  0.0002  219  SER A CB  
1590 O OG  . SER A 218 ? 0.1596 0.1253 0.1759 0.0005  0.0234  -0.0043 219  SER A OG  
1591 N N   . TYR A 219 ? 0.0891 0.0819 0.1215 0.0099  0.0176  0.0049  220  TYR A N   
1592 C CA  . TYR A 219 ? 0.0921 0.0917 0.1257 0.0096  0.0148  0.0050  220  TYR A CA  
1593 C C   . TYR A 219 ? 0.1195 0.1210 0.1550 0.0133  0.0192  0.0081  220  TYR A C   
1594 O O   . TYR A 219 ? 0.1148 0.1171 0.1540 0.0175  0.0235  0.0119  220  TYR A O   
1595 C CB  . TYR A 219 ? 0.0925 0.1022 0.1308 0.0090  0.0104  0.0061  220  TYR A CB  
1596 C CG  . TYR A 219 ? 0.1137 0.1301 0.1562 0.0118  0.0115  0.0101  220  TYR A CG  
1597 C CD1 . TYR A 219 ? 0.1118 0.1258 0.1544 0.0120  0.0119  0.0105  220  TYR A CD1 
1598 C CD2 . TYR A 219 ? 0.1492 0.1756 0.1956 0.0138  0.0116  0.0140  220  TYR A CD2 
1599 C CE1 . TYR A 219 ? 0.1523 0.1731 0.1980 0.0144  0.0126  0.0149  220  TYR A CE1 
1600 C CE2 . TYR A 219 ? 0.1686 0.2034 0.2186 0.0159  0.0117  0.0188  220  TYR A CE2 
1601 C CZ  . TYR A 219 ? 0.1753 0.2070 0.2245 0.0163  0.0122  0.0193  220  TYR A CZ  
1602 O OH  . TYR A 219 ? 0.2362 0.2761 0.2880 0.0185  0.0124  0.0248  220  TYR A OH  
1603 N N   . PRO A 220 ? 0.0919 0.0951 0.1262 0.0121  0.0187  0.0072  221  PRO A N   
1604 C CA  . PRO A 220 ? 0.0926 0.0977 0.1294 0.0156  0.0236  0.0102  221  PRO A CA  
1605 C C   . PRO A 220 ? 0.1301 0.1497 0.1752 0.0175  0.0217  0.0148  221  PRO A C   
1606 O O   . PRO A 220 ? 0.1309 0.1574 0.1771 0.0144  0.0163  0.0138  221  PRO A O   
1607 C CB  . PRO A 220 ? 0.1184 0.1186 0.1490 0.0126  0.0237  0.0069  221  PRO A CB  
1608 C CG  . PRO A 220 ? 0.1143 0.1173 0.1437 0.0083  0.0167  0.0046  221  PRO A CG  
1609 C CD  . PRO A 220 ? 0.0954 0.0971 0.1255 0.0078  0.0145  0.0039  221  PRO A CD  
1610 N N   . THR A 221 ? 0.1412 0.1654 0.1920 0.0222  0.0267  0.0198  222  THR A N   
1611 C CA  . THR A 221 ? 0.1445 0.1850 0.2041 0.0237  0.0252  0.0254  222  THR A CA  
1612 C C   . THR A 221 ? 0.1868 0.2299 0.2473 0.0226  0.0266  0.0250  222  THR A C   
1613 O O   . THR A 221 ? 0.1966 0.2344 0.2575 0.0260  0.0331  0.0262  222  THR A O   
1614 C CB  . THR A 221 ? 0.1801 0.2254 0.2474 0.0305  0.0302  0.0331  222  THR A CB  
1615 O OG1 . THR A 221 ? 0.2709 0.3115 0.3361 0.0312  0.0295  0.0332  222  THR A OG1 
1616 C CG2 . THR A 221 ? 0.2886 0.3544 0.3662 0.0318  0.0278  0.0404  222  THR A CG2 
1617 N N   . ALA A 222 ? 0.2100 0.2599 0.2703 0.0175  0.0214  0.0229  223  ALA A N   
1618 C CA  . ALA A 222 ? 0.2266 0.2789 0.2878 0.0159  0.0229  0.0226  223  ALA A CA  
1619 C C   . ALA A 222 ? 0.3229 0.3899 0.3948 0.0189  0.0255  0.0294  223  ALA A C   
1620 O O   . ALA A 222 ? 0.3898 0.4575 0.4636 0.0194  0.0294  0.0303  223  ALA A O   
1621 C CB  . ALA A 222 ? 0.2340 0.2880 0.2924 0.0094  0.0175  0.0186  223  ALA A CB  
1622 O OXT . ALA A 222 ? 0.3421 0.4211 0.4208 0.0208  0.0238  0.0345  223  ALA A OXT 
1623 C C1  . E64 B .   ? 0.2936 0.3668 0.2564 -0.1005 -0.0562 -0.0322 1224 E64 A C1  
1624 O O1  . E64 B .   ? 0.3254 0.3986 0.2890 -0.1006 -0.0562 -0.0323 1224 E64 A O1  
1625 O O2  . E64 B .   ? 0.2990 0.3727 0.2617 -0.1008 -0.0568 -0.0323 1224 E64 A O2  
1626 C C2  . E64 B .   ? 0.2601 0.3326 0.2223 -0.1001 -0.0555 -0.0320 1224 E64 A C2  
1627 C C3  . E64 B .   ? 0.2865 0.3587 0.2485 -0.1001 -0.0553 -0.0322 1224 E64 A C3  
1628 O O3  . E64 B .   ? 0.3028 0.3746 0.2654 -0.1005 -0.0553 -0.0324 1224 E64 A O3  
1629 C C4  . E64 B .   ? 0.3049 0.3765 0.2665 -0.0997 -0.0548 -0.0319 1224 E64 A C4  
1630 O O4  . E64 B .   ? 0.3215 0.3931 0.2825 -0.0995 -0.0548 -0.0317 1224 E64 A O4  
1631 N N1  . E64 B .   ? 0.3689 0.4402 0.3310 -0.0998 -0.0545 -0.0318 1224 E64 A N1  
1632 C C6  . E64 B .   ? 0.4607 0.5314 0.4230 -0.0999 -0.0543 -0.0317 1224 E64 A C6  
1633 C C7  . E64 B .   ? 0.4188 0.4895 0.3811 -0.1000 -0.0540 -0.0313 1224 E64 A C7  
1634 C C8  . E64 B .   ? 0.3547 0.4257 0.3166 -0.1000 -0.0538 -0.0310 1224 E64 A C8  
1635 C C9  . E64 B .   ? 0.3608 0.4320 0.3232 -0.1004 -0.0535 -0.0308 1224 E64 A C9  
1636 C C10 . E64 B .   ? 0.3091 0.3796 0.2701 -0.0999 -0.0537 -0.0305 1224 E64 A C10 
1637 C C11 . E64 B .   ? 0.5287 0.5989 0.4909 -0.0998 -0.0545 -0.0320 1224 E64 A C11 
1638 O O5  . E64 B .   ? 0.5746 0.6445 0.5370 -0.0998 -0.0548 -0.0322 1224 E64 A O5  
1639 N N2  . E64 B .   ? 0.5390 0.6091 0.5009 -0.0995 -0.0544 -0.0318 1224 E64 A N2  
1640 C C12 . E64 B .   ? 0.5426 0.6121 0.5049 -0.0995 -0.0545 -0.0319 1224 E64 A C12 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'E64 A 1224 HAS WRONG CHIRALITY AT ATOM C6' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   2   2   VAL VAL A . n 
A 1 2   PRO 2   3   3   PRO PRO A . n 
A 1 3   ALA 3   4   4   ALA ALA A . n 
A 1 4   ALA 4   5   5   ALA ALA A . n 
A 1 5   VAL 5   6   6   VAL VAL A . n 
A 1 6   ASP 6   7   7   ASP ASP A . n 
A 1 7   TRP 7   8   8   TRP TRP A . n 
A 1 8   ARG 8   9   9   ARG ARG A . n 
A 1 9   THR 9   10  10  THR THR A . n 
A 1 10  ALA 10  11  11  ALA ALA A . n 
A 1 11  GLY 11  12  12  GLY GLY A . n 
A 1 12  ALA 12  13  13  ALA ALA A . n 
A 1 13  VAL 13  14  14  VAL VAL A . n 
A 1 14  THR 14  15  15  THR THR A . n 
A 1 15  PRO 15  16  16  PRO PRO A . n 
A 1 16  VAL 16  17  17  VAL VAL A . n 
A 1 17  LYS 17  18  18  LYS LYS A . n 
A 1 18  ASN 18  19  19  ASN ASN A . n 
A 1 19  GLN 19  20  20  GLN GLN A . n 
A 1 20  GLN 20  21  21  GLN GLN A . n 
A 1 21  GLN 21  22  22  GLN GLN A . n 
A 1 22  CYS 22  23  23  CYS CYS A . n 
A 1 23  GLY 23  24  24  GLY GLY A . n 
A 1 24  CYS 24  25  25  CYS CYS A . n 
A 1 25  CYS 25  26  26  CYS CYS A . n 
A 1 26  TRP 26  27  27  TRP TRP A . n 
A 1 27  ALA 27  28  28  ALA ALA A . n 
A 1 28  PHE 28  29  29  PHE PHE A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  VAL 31  32  32  VAL VAL A . n 
A 1 32  ALA 32  33  33  ALA ALA A . n 
A 1 33  ALA 33  34  34  ALA ALA A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  GLU 35  36  36  GLU GLU A . n 
A 1 36  GLY 36  37  37  GLY GLY A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  THR 38  39  39  THR THR A . n 
A 1 39  GLN 39  40  40  GLN GLN A . n 
A 1 40  ILE 40  41  41  ILE ILE A . n 
A 1 41  LYS 41  42  42  LYS LYS A . n 
A 1 42  THR 42  43  43  THR THR A . n 
A 1 43  GLY 43  44  44  GLY GLY A . n 
A 1 44  THR 44  45  45  THR THR A . n 
A 1 45  LEU 45  46  46  LEU LEU A . n 
A 1 46  THR 46  47  47  THR THR A . n 
A 1 47  SER 47  48  48  SER SER A . n 
A 1 48  LEU 48  49  49  LEU LEU A . n 
A 1 49  SER 49  50  50  SER SER A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  GLU 51  52  52  GLU GLU A . n 
A 1 52  GLN 52  53  53  GLN GLN A . n 
A 1 53  ILE 53  54  54  ILE ILE A . n 
A 1 54  VAL 54  55  55  VAL VAL A . n 
A 1 55  ASP 55  56  56  ASP ASP A . n 
A 1 56  CYS 56  57  57  CYS CYS A . n 
A 1 57  ASP 57  58  58  ASP ASP A . n 
A 1 58  THR 58  59  59  THR THR A . n 
A 1 59  ASN 59  60  60  ASN ASN A . n 
A 1 60  GLY 60  61  61  GLY GLY A . n 
A 1 61  ASN 61  62  62  ASN ASN A . n 
A 1 62  ASP 62  63  63  ASP ASP A . n 
A 1 63  LYS 63  64  64  LYS LYS A . n 
A 1 64  GLY 64  65  65  GLY GLY A . n 
A 1 65  CYS 65  66  66  CYS CYS A . n 
A 1 66  ASN 66  67  67  ASN ASN A . n 
A 1 67  GLY 67  68  68  GLY GLY A . n 
A 1 68  GLY 68  69  69  GLY GLY A . n 
A 1 69  THR 69  70  70  THR THR A . n 
A 1 70  PRO 70  71  71  PRO PRO A . n 
A 1 71  ASP 71  72  72  ASP ASP A . n 
A 1 72  GLY 72  73  73  GLY GLY A . n 
A 1 73  ALA 73  74  74  ALA ALA A . n 
A 1 74  PHE 74  75  75  PHE PHE A . n 
A 1 75  GLN 75  76  76  GLN GLN A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  VAL 77  78  78  VAL VAL A . n 
A 1 78  VAL 78  79  79  VAL VAL A . n 
A 1 79  ASN 79  80  80  ASN ASN A . n 
A 1 80  ASN 80  81  81  ASN ASN A . n 
A 1 81  GLN 81  82  82  GLN GLN A . n 
A 1 82  GLY 82  83  83  GLY GLY A . n 
A 1 83  ILE 83  84  84  ILE ILE A . n 
A 1 84  ASP 84  85  85  ASP ASP A . n 
A 1 85  THR 85  86  86  THR THR A . n 
A 1 86  GLU 86  87  87  GLU GLU A . n 
A 1 87  SER 87  88  88  SER SER A . n 
A 1 88  ASP 88  89  89  ASP ASP A . n 
A 1 89  TYR 89  90  90  TYR TYR A . n 
A 1 90  PRO 90  91  91  PRO PRO A . n 
A 1 91  TYR 91  92  92  TYR TYR A . n 
A 1 92  THR 92  93  93  THR THR A . n 
A 1 93  ALA 93  94  94  ALA ALA A . n 
A 1 94  GLY 94  95  95  GLY GLY A . n 
A 1 95  GLY 95  96  96  GLY GLY A . n 
A 1 96  GLY 96  97  97  GLY GLY A . n 
A 1 97  SER 97  98  98  SER SER A . n 
A 1 98  PRO 98  99  99  PRO PRO A . n 
A 1 99  GLY 99  100 100 GLY GLY A . n 
A 1 100 THR 100 101 101 THR THR A . n 
A 1 101 CYS 101 102 102 CYS CYS A . n 
A 1 102 SER 102 103 103 SER SER A . n 
A 1 103 ALA 103 104 104 ALA ALA A . n 
A 1 104 SER 104 105 105 SER SER A . n 
A 1 105 SER 105 106 106 SER SER A . n 
A 1 106 TYR 106 107 107 TYR TYR A . n 
A 1 107 GLN 107 108 108 GLN GLN A . n 
A 1 108 PRO 108 109 109 PRO PRO A . n 
A 1 109 ALA 109 110 110 ALA ALA A . n 
A 1 110 ALA 110 111 111 ALA ALA A . n 
A 1 111 SER 111 112 112 SER SER A . n 
A 1 112 ILE 112 113 113 ILE ILE A . n 
A 1 113 THR 113 114 114 THR THR A . n 
A 1 114 GLY 114 115 115 GLY GLY A . n 
A 1 115 TYR 115 116 116 TYR TYR A . n 
A 1 116 GLN 116 117 117 GLN GLN A . n 
A 1 117 ASP 117 118 118 ASP ASP A . n 
A 1 118 VAL 118 119 119 VAL VAL A . n 
A 1 119 PRO 119 120 120 PRO PRO A . n 
A 1 120 ALA 120 121 121 ALA ALA A . n 
A 1 121 ASN 121 122 122 ASN ASN A . n 
A 1 122 ASN 122 123 123 ASN ASN A . n 
A 1 123 GLU 123 124 124 GLU GLU A . n 
A 1 124 GLN 124 125 125 GLN GLN A . n 
A 1 125 ALA 125 126 126 ALA ALA A . n 
A 1 126 LEU 126 127 127 LEU LEU A . n 
A 1 127 GLN 127 128 128 GLN GLN A . n 
A 1 128 GLN 128 129 129 GLN GLN A . n 
A 1 129 ALA 129 130 130 ALA ALA A . n 
A 1 130 ALA 130 131 131 ALA ALA A . n 
A 1 131 ALA 131 132 132 ALA ALA A . n 
A 1 132 THR 132 133 133 THR THR A . n 
A 1 133 GLN 133 134 134 GLN GLN A . n 
A 1 134 PRO 134 135 135 PRO PRO A . n 
A 1 135 ILE 135 136 136 ILE ILE A . n 
A 1 136 SER 136 137 137 SER SER A . n 
A 1 137 VAL 137 138 138 VAL VAL A . n 
A 1 138 ALA 138 139 139 ALA ALA A . n 
A 1 139 ILE 139 140 140 ILE ILE A . n 
A 1 140 ASP 140 141 141 ASP ASP A . n 
A 1 141 ALA 141 142 142 ALA ALA A . n 
A 1 142 SER 142 143 143 SER SER A . n 
A 1 143 ASP 143 144 144 ASP ASP A . n 
A 1 144 PRO 144 145 145 PRO PRO A . n 
A 1 145 SER 145 146 146 SER SER A . n 
A 1 146 PHE 146 147 147 PHE PHE A . n 
A 1 147 GLN 147 148 148 GLN GLN A . n 
A 1 148 SER 148 149 149 SER SER A . n 
A 1 149 TYR 149 150 150 TYR TYR A . n 
A 1 150 SER 150 151 151 SER SER A . n 
A 1 151 SER 151 152 152 SER SER A . n 
A 1 152 GLY 152 153 153 GLY GLY A . n 
A 1 153 ILE 153 154 154 ILE ILE A . n 
A 1 154 TYR 154 155 155 TYR TYR A . n 
A 1 155 SER 155 156 156 SER SER A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PRO 157 158 158 PRO PRO A . n 
A 1 158 CYS 158 159 159 CYS CYS A . n 
A 1 159 ASN 159 160 160 ASN ASN A . n 
A 1 160 THR 160 161 161 THR THR A . n 
A 1 161 ASN 161 162 162 ASN ASN A . n 
A 1 162 LEU 162 163 163 LEU LEU A . n 
A 1 163 ASP 163 164 164 ASP ASP A . n 
A 1 164 HIS 164 165 165 HIS HIS A . n 
A 1 165 ALA 165 166 166 ALA ALA A . n 
A 1 166 VAL 166 167 167 VAL VAL A . n 
A 1 167 THR 167 168 168 THR THR A . n 
A 1 168 VAL 168 169 169 VAL VAL A . n 
A 1 169 VAL 169 170 170 VAL VAL A . n 
A 1 170 GLY 170 171 171 GLY GLY A . n 
A 1 171 TYR 171 172 172 TYR TYR A . n 
A 1 172 GLY 172 173 173 GLY GLY A . n 
A 1 173 THR 173 174 174 THR THR A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 PRO 175 176 176 PRO PRO A . n 
A 1 176 ASN 176 177 177 ASN ASN A . n 
A 1 177 SER 177 178 178 SER SER A . n 
A 1 178 GLY 178 179 179 GLY GLY A . n 
A 1 179 ASN 179 180 180 ASN ASN A . n 
A 1 180 SER 180 181 181 SER SER A . n 
A 1 181 TYR 181 182 182 TYR TYR A . n 
A 1 182 TRP 182 183 183 TRP TRP A . n 
A 1 183 ILE 183 184 184 ILE ILE A . n 
A 1 184 VAL 184 185 185 VAL VAL A . n 
A 1 185 LYS 185 186 186 LYS LYS A . n 
A 1 186 ASN 186 187 187 ASN ASN A . n 
A 1 187 SER 187 188 188 SER SER A . n 
A 1 188 TRP 188 189 189 TRP TRP A . n 
A 1 189 GLY 189 190 190 GLY GLY A . n 
A 1 190 THR 190 191 191 THR THR A . n 
A 1 191 SER 191 192 192 SER SER A . n 
A 1 192 TRP 192 193 193 TRP TRP A . n 
A 1 193 GLY 193 194 194 GLY GLY A . n 
A 1 194 GLN 194 195 195 GLN GLN A . n 
A 1 195 GLU 195 196 196 GLU GLU A . n 
A 1 196 GLY 196 197 197 GLY GLY A . n 
A 1 197 TYR 197 198 198 TYR TYR A . n 
A 1 198 ILE 198 199 199 ILE ILE A . n 
A 1 199 TRP 199 200 200 TRP TRP A . n 
A 1 200 MET 200 201 201 MET MET A . n 
A 1 201 GLN 201 202 202 GLN GLN A . n 
A 1 202 MET 202 203 203 MET MET A . n 
A 1 203 GLY 203 204 204 GLY GLY A . n 
A 1 204 LEU 204 205 205 LEU LEU A . n 
A 1 205 ASN 205 206 206 ASN ASN A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 PRO 207 208 208 PRO PRO A . n 
A 1 208 TYR 208 209 209 TYR TYR A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 VAL 210 211 211 VAL VAL A . n 
A 1 211 CYS 211 212 212 CYS CYS A . n 
A 1 212 GLY 212 213 213 GLY GLY A . n 
A 1 213 ILE 213 214 214 ILE ILE A . n 
A 1 214 ALA 214 215 215 ALA ALA A . n 
A 1 215 MET 215 216 216 MET MET A . n 
A 1 216 GLN 216 217 217 GLN GLN A . n 
A 1 217 ALA 217 218 218 ALA ALA A . n 
A 1 218 SER 218 219 219 SER SER A . n 
A 1 219 TYR 219 220 220 TYR TYR A . n 
A 1 220 PRO 220 221 221 PRO PRO A . n 
A 1 221 THR 221 222 222 THR THR A . n 
A 1 222 ALA 222 223 223 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 E64 1   1224 1224 E64 E64 A . 
C 3 PO4 1   1225 1225 PO4 PO4 A . 
D 4 HOH 1   2001 2001 HOH HOH A . 
D 4 HOH 2   2002 2002 HOH HOH A . 
D 4 HOH 3   2003 2003 HOH HOH A . 
D 4 HOH 4   2004 2004 HOH HOH A . 
D 4 HOH 5   2005 2005 HOH HOH A . 
D 4 HOH 6   2006 2006 HOH HOH A . 
D 4 HOH 7   2007 2007 HOH HOH A . 
D 4 HOH 8   2008 2008 HOH HOH A . 
D 4 HOH 9   2009 2009 HOH HOH A . 
D 4 HOH 10  2010 2010 HOH HOH A . 
D 4 HOH 11  2011 2011 HOH HOH A . 
D 4 HOH 12  2012 2012 HOH HOH A . 
D 4 HOH 13  2013 2013 HOH HOH A . 
D 4 HOH 14  2014 2014 HOH HOH A . 
D 4 HOH 15  2015 2015 HOH HOH A . 
D 4 HOH 16  2016 2016 HOH HOH A . 
D 4 HOH 17  2017 2017 HOH HOH A . 
D 4 HOH 18  2018 2018 HOH HOH A . 
D 4 HOH 19  2019 2019 HOH HOH A . 
D 4 HOH 20  2020 2020 HOH HOH A . 
D 4 HOH 21  2021 2021 HOH HOH A . 
D 4 HOH 22  2022 2022 HOH HOH A . 
D 4 HOH 23  2023 2023 HOH HOH A . 
D 4 HOH 24  2024 2024 HOH HOH A . 
D 4 HOH 25  2025 2025 HOH HOH A . 
D 4 HOH 26  2026 2026 HOH HOH A . 
D 4 HOH 27  2027 2027 HOH HOH A . 
D 4 HOH 28  2028 2028 HOH HOH A . 
D 4 HOH 29  2029 2029 HOH HOH A . 
D 4 HOH 30  2030 2030 HOH HOH A . 
D 4 HOH 31  2031 2031 HOH HOH A . 
D 4 HOH 32  2032 2032 HOH HOH A . 
D 4 HOH 33  2033 2033 HOH HOH A . 
D 4 HOH 34  2034 2034 HOH HOH A . 
D 4 HOH 35  2035 2035 HOH HOH A . 
D 4 HOH 36  2036 2036 HOH HOH A . 
D 4 HOH 37  2037 2037 HOH HOH A . 
D 4 HOH 38  2038 2038 HOH HOH A . 
D 4 HOH 39  2039 2039 HOH HOH A . 
D 4 HOH 40  2040 2040 HOH HOH A . 
D 4 HOH 41  2041 2041 HOH HOH A . 
D 4 HOH 42  2042 2042 HOH HOH A . 
D 4 HOH 43  2043 2043 HOH HOH A . 
D 4 HOH 44  2044 2044 HOH HOH A . 
D 4 HOH 45  2045 2045 HOH HOH A . 
D 4 HOH 46  2046 2046 HOH HOH A . 
D 4 HOH 47  2047 2047 HOH HOH A . 
D 4 HOH 48  2048 2048 HOH HOH A . 
D 4 HOH 49  2049 2049 HOH HOH A . 
D 4 HOH 50  2050 2050 HOH HOH A . 
D 4 HOH 51  2051 2051 HOH HOH A . 
D 4 HOH 52  2052 2052 HOH HOH A . 
D 4 HOH 53  2053 2053 HOH HOH A . 
D 4 HOH 54  2054 2054 HOH HOH A . 
D 4 HOH 55  2055 2055 HOH HOH A . 
D 4 HOH 56  2056 2056 HOH HOH A . 
D 4 HOH 57  2057 2057 HOH HOH A . 
D 4 HOH 58  2058 2058 HOH HOH A . 
D 4 HOH 59  2059 2059 HOH HOH A . 
D 4 HOH 60  2060 2060 HOH HOH A . 
D 4 HOH 61  2061 2061 HOH HOH A . 
D 4 HOH 62  2062 2062 HOH HOH A . 
D 4 HOH 63  2063 2063 HOH HOH A . 
D 4 HOH 64  2064 2064 HOH HOH A . 
D 4 HOH 65  2065 2065 HOH HOH A . 
D 4 HOH 66  2066 2066 HOH HOH A . 
D 4 HOH 67  2067 2067 HOH HOH A . 
D 4 HOH 68  2068 2068 HOH HOH A . 
D 4 HOH 69  2069 2069 HOH HOH A . 
D 4 HOH 70  2070 2070 HOH HOH A . 
D 4 HOH 71  2071 2071 HOH HOH A . 
D 4 HOH 72  2072 2072 HOH HOH A . 
D 4 HOH 73  2073 2073 HOH HOH A . 
D 4 HOH 74  2074 2074 HOH HOH A . 
D 4 HOH 75  2075 2075 HOH HOH A . 
D 4 HOH 76  2076 2076 HOH HOH A . 
D 4 HOH 77  2077 2077 HOH HOH A . 
D 4 HOH 78  2078 2078 HOH HOH A . 
D 4 HOH 79  2079 2079 HOH HOH A . 
D 4 HOH 80  2080 2080 HOH HOH A . 
D 4 HOH 81  2081 2081 HOH HOH A . 
D 4 HOH 82  2082 2082 HOH HOH A . 
D 4 HOH 83  2083 2083 HOH HOH A . 
D 4 HOH 84  2084 2084 HOH HOH A . 
D 4 HOH 85  2085 2085 HOH HOH A . 
D 4 HOH 86  2086 2086 HOH HOH A . 
D 4 HOH 87  2087 2087 HOH HOH A . 
D 4 HOH 88  2088 2088 HOH HOH A . 
D 4 HOH 89  2089 2089 HOH HOH A . 
D 4 HOH 90  2090 2090 HOH HOH A . 
D 4 HOH 91  2091 2091 HOH HOH A . 
D 4 HOH 92  2092 2092 HOH HOH A . 
D 4 HOH 93  2093 2093 HOH HOH A . 
D 4 HOH 94  2094 2094 HOH HOH A . 
D 4 HOH 95  2095 2095 HOH HOH A . 
D 4 HOH 96  2096 2096 HOH HOH A . 
D 4 HOH 97  2097 2097 HOH HOH A . 
D 4 HOH 98  2098 2098 HOH HOH A . 
D 4 HOH 99  2099 2099 HOH HOH A . 
D 4 HOH 100 2100 2100 HOH HOH A . 
D 4 HOH 101 2101 2101 HOH HOH A . 
D 4 HOH 102 2102 2102 HOH HOH A . 
D 4 HOH 103 2103 2103 HOH HOH A . 
D 4 HOH 104 2104 2104 HOH HOH A . 
D 4 HOH 105 2105 2105 HOH HOH A . 
D 4 HOH 106 2106 2106 HOH HOH A . 
D 4 HOH 107 2107 2107 HOH HOH A . 
D 4 HOH 108 2108 2108 HOH HOH A . 
D 4 HOH 109 2109 2109 HOH HOH A . 
D 4 HOH 110 2110 2110 HOH HOH A . 
D 4 HOH 111 2111 2111 HOH HOH A . 
D 4 HOH 112 2112 2112 HOH HOH A . 
D 4 HOH 113 2113 2113 HOH HOH A . 
D 4 HOH 114 2114 2114 HOH HOH A . 
D 4 HOH 115 2115 2115 HOH HOH A . 
D 4 HOH 116 2116 2116 HOH HOH A . 
D 4 HOH 117 2117 2117 HOH HOH A . 
D 4 HOH 118 2118 2118 HOH HOH A . 
D 4 HOH 119 2119 2119 HOH HOH A . 
D 4 HOH 120 2120 2120 HOH HOH A . 
D 4 HOH 121 2121 2121 HOH HOH A . 
D 4 HOH 122 2122 2122 HOH HOH A . 
D 4 HOH 123 2123 2123 HOH HOH A . 
D 4 HOH 124 2124 2124 HOH HOH A . 
D 4 HOH 125 2125 2125 HOH HOH A . 
D 4 HOH 126 2126 2126 HOH HOH A . 
D 4 HOH 127 2127 2127 HOH HOH A . 
D 4 HOH 128 2128 2128 HOH HOH A . 
D 4 HOH 129 2129 2129 HOH HOH A . 
D 4 HOH 130 2130 2130 HOH HOH A . 
D 4 HOH 131 2131 2131 HOH HOH A . 
D 4 HOH 132 2132 2132 HOH HOH A . 
D 4 HOH 133 2133 2133 HOH HOH A . 
D 4 HOH 134 2134 2134 HOH HOH A . 
D 4 HOH 135 2135 2135 HOH HOH A . 
D 4 HOH 136 2136 2136 HOH HOH A . 
D 4 HOH 137 2137 2137 HOH HOH A . 
D 4 HOH 138 2138 2138 HOH HOH A . 
D 4 HOH 139 2139 2139 HOH HOH A . 
D 4 HOH 140 2140 2140 HOH HOH A . 
D 4 HOH 141 2141 2141 HOH HOH A . 
D 4 HOH 142 2142 2142 HOH HOH A . 
D 4 HOH 143 2143 2143 HOH HOH A . 
D 4 HOH 144 2144 2144 HOH HOH A . 
D 4 HOH 145 2145 2145 HOH HOH A . 
D 4 HOH 146 2146 2146 HOH HOH A . 
D 4 HOH 147 2147 2147 HOH HOH A . 
D 4 HOH 148 2148 2148 HOH HOH A . 
D 4 HOH 149 2149 2149 HOH HOH A . 
D 4 HOH 150 2150 2150 HOH HOH A . 
D 4 HOH 151 2151 2151 HOH HOH A . 
D 4 HOH 152 2152 2152 HOH HOH A . 
D 4 HOH 153 2153 2153 HOH HOH A . 
D 4 HOH 154 2154 2154 HOH HOH A . 
D 4 HOH 155 2155 2155 HOH HOH A . 
D 4 HOH 156 2156 2156 HOH HOH A . 
D 4 HOH 157 2157 2157 HOH HOH A . 
D 4 HOH 158 2158 2158 HOH HOH A . 
D 4 HOH 159 2159 2159 HOH HOH A . 
D 4 HOH 160 2160 2160 HOH HOH A . 
D 4 HOH 161 2161 2161 HOH HOH A . 
D 4 HOH 162 2162 2162 HOH HOH A . 
D 4 HOH 163 2163 2163 HOH HOH A . 
D 4 HOH 164 2164 2164 HOH HOH A . 
D 4 HOH 165 2165 2165 HOH HOH A . 
D 4 HOH 166 2166 2166 HOH HOH A . 
D 4 HOH 167 2167 2167 HOH HOH A . 
D 4 HOH 168 2168 2168 HOH HOH A . 
D 4 HOH 169 2169 2169 HOH HOH A . 
D 4 HOH 170 2170 2170 HOH HOH A . 
D 4 HOH 171 2171 2171 HOH HOH A . 
D 4 HOH 172 2172 2172 HOH HOH A . 
D 4 HOH 173 2173 2173 HOH HOH A . 
D 4 HOH 174 2174 2174 HOH HOH A . 
D 4 HOH 175 2175 2175 HOH HOH A . 
D 4 HOH 176 2176 2176 HOH HOH A . 
D 4 HOH 177 2177 2177 HOH HOH A . 
D 4 HOH 178 2178 2178 HOH HOH A . 
D 4 HOH 179 2179 2179 HOH HOH A . 
D 4 HOH 180 2180 2180 HOH HOH A . 
D 4 HOH 181 2181 2181 HOH HOH A . 
D 4 HOH 182 2182 2182 HOH HOH A . 
D 4 HOH 183 2183 2183 HOH HOH A . 
D 4 HOH 184 2184 2184 HOH HOH A . 
D 4 HOH 185 2185 2185 HOH HOH A . 
D 4 HOH 186 2186 2186 HOH HOH A . 
D 4 HOH 187 2187 2187 HOH HOH A . 
D 4 HOH 188 2188 2188 HOH HOH A . 
D 4 HOH 189 2189 2189 HOH HOH A . 
D 4 HOH 190 2190 2190 HOH HOH A . 
D 4 HOH 191 2191 2191 HOH HOH A . 
D 4 HOH 192 2192 2192 HOH HOH A . 
D 4 HOH 193 2193 2193 HOH HOH A . 
D 4 HOH 194 2194 2194 HOH HOH A . 
D 4 HOH 195 2195 2195 HOH HOH A . 
D 4 HOH 196 2196 2196 HOH HOH A . 
D 4 HOH 197 2197 2197 HOH HOH A . 
D 4 HOH 198 2198 2198 HOH HOH A . 
D 4 HOH 199 2199 2199 HOH HOH A . 
D 4 HOH 200 2200 2200 HOH HOH A . 
D 4 HOH 201 2201 2201 HOH HOH A . 
D 4 HOH 202 2202 2202 HOH HOH A . 
D 4 HOH 203 2203 2203 HOH HOH A . 
D 4 HOH 204 2204 2204 HOH HOH A . 
D 4 HOH 205 2205 2205 HOH HOH A . 
D 4 HOH 206 2206 2206 HOH HOH A . 
D 4 HOH 207 2207 2207 HOH HOH A . 
D 4 HOH 208 2208 2208 HOH HOH A . 
D 4 HOH 209 2209 2209 HOH HOH A . 
D 4 HOH 210 2210 2210 HOH HOH A . 
D 4 HOH 211 2211 2211 HOH HOH A . 
D 4 HOH 212 2212 2212 HOH HOH A . 
D 4 HOH 213 2214 2214 HOH HOH A . 
D 4 HOH 214 2215 2215 HOH HOH A . 
D 4 HOH 215 2216 2216 HOH HOH A . 
D 4 HOH 216 2217 2217 HOH HOH A . 
D 4 HOH 217 2218 2218 HOH HOH A . 
D 4 HOH 218 2219 2219 HOH HOH A . 
D 4 HOH 219 2220 2220 HOH HOH A . 
D 4 HOH 220 2221 2221 HOH HOH A . 
D 4 HOH 221 2222 2222 HOH HOH A . 
D 4 HOH 222 2223 2223 HOH HOH A . 
D 4 HOH 223 2224 2224 HOH HOH A . 
D 4 HOH 224 2225 2225 HOH HOH A . 
D 4 HOH 225 2226 2226 HOH HOH A . 
D 4 HOH 226 2227 2227 HOH HOH A . 
D 4 HOH 227 2228 2228 HOH HOH A . 
D 4 HOH 228 2229 2229 HOH HOH A . 
D 4 HOH 229 2230 2230 HOH HOH A . 
D 4 HOH 230 2231 2231 HOH HOH A . 
D 4 HOH 231 2232 2232 HOH HOH A . 
D 4 HOH 232 2233 2233 HOH HOH A . 
D 4 HOH 233 2234 2234 HOH HOH A . 
D 4 HOH 234 2235 2235 HOH HOH A . 
D 4 HOH 235 2236 2236 HOH HOH A . 
D 4 HOH 236 2237 2237 HOH HOH A . 
D 4 HOH 237 2238 2238 HOH HOH A . 
D 4 HOH 238 2239 2239 HOH HOH A . 
D 4 HOH 239 2240 2240 HOH HOH A . 
D 4 HOH 240 2241 2241 HOH HOH A . 
D 4 HOH 241 2242 2242 HOH HOH A . 
D 4 HOH 242 2243 2243 HOH HOH A . 
D 4 HOH 243 2244 2244 HOH HOH A . 
D 4 HOH 244 2245 2245 HOH HOH A . 
D 4 HOH 245 2246 2246 HOH HOH A . 
D 4 HOH 246 2247 2247 HOH HOH A . 
D 4 HOH 247 2248 2248 HOH HOH A . 
D 4 HOH 248 2249 2249 HOH HOH A . 
D 4 HOH 249 2250 2250 HOH HOH A . 
D 4 HOH 250 2251 2251 HOH HOH A . 
D 4 HOH 251 2252 2252 HOH HOH A . 
D 4 HOH 252 2253 2253 HOH HOH A . 
D 4 HOH 253 2254 2254 HOH HOH A . 
D 4 HOH 254 2255 2255 HOH HOH A . 
D 4 HOH 255 2256 2256 HOH HOH A . 
D 4 HOH 256 2257 2257 HOH HOH A . 
D 4 HOH 257 2258 2258 HOH HOH A . 
D 4 HOH 258 2259 2259 HOH HOH A . 
D 4 HOH 259 2260 2260 HOH HOH A . 
D 4 HOH 260 2261 2261 HOH HOH A . 
D 4 HOH 261 2262 2262 HOH HOH A . 
D 4 HOH 262 2263 2263 HOH HOH A . 
D 4 HOH 263 2264 2264 HOH HOH A . 
D 4 HOH 264 2265 2265 HOH HOH A . 
D 4 HOH 265 2266 2266 HOH HOH A . 
D 4 HOH 266 2267 2267 HOH HOH A . 
D 4 HOH 267 2268 2268 HOH HOH A . 
D 4 HOH 268 2269 2269 HOH HOH A . 
D 4 HOH 269 2270 2270 HOH HOH A . 
D 4 HOH 270 2271 2271 HOH HOH A . 
D 4 HOH 271 2272 2272 HOH HOH A . 
D 4 HOH 272 2273 2273 HOH HOH A . 
D 4 HOH 273 2274 2274 HOH HOH A . 
D 4 HOH 274 2275 2275 HOH HOH A . 
D 4 HOH 275 2276 2276 HOH HOH A . 
D 4 HOH 276 2277 2277 HOH HOH A . 
D 4 HOH 277 2278 2278 HOH HOH A . 
D 4 HOH 278 2279 2279 HOH HOH A . 
D 4 HOH 279 2280 2280 HOH HOH A . 
D 4 HOH 280 2281 2281 HOH HOH A . 
D 4 HOH 281 2282 2282 HOH HOH A . 
D 4 HOH 282 2283 2283 HOH HOH A . 
D 4 HOH 283 2284 2284 HOH HOH A . 
D 4 HOH 284 2285 2285 HOH HOH A . 
D 4 HOH 285 2286 2286 HOH HOH A . 
D 4 HOH 286 2287 2287 HOH HOH A . 
D 4 HOH 287 2288 2288 HOH HOH A . 
D 4 HOH 288 2289 2289 HOH HOH A . 
D 4 HOH 289 2290 2290 HOH HOH A . 
D 4 HOH 290 2291 2291 HOH HOH A . 
D 4 HOH 291 2292 2292 HOH HOH A . 
D 4 HOH 292 2293 2293 HOH HOH A . 
D 4 HOH 293 2294 2294 HOH HOH A . 
D 4 HOH 294 2295 2295 HOH HOH A . 
D 4 HOH 295 2296 2296 HOH HOH A . 
D 4 HOH 296 2297 2297 HOH HOH A . 
D 4 HOH 297 2298 2298 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 2130 ? D HOH . 
2 1 A HOH 2282 ? D HOH . 
3 1 A HOH 2286 ? D HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-12-09 
2 'Structure model' 1 1 2015-12-16 
3 'Structure model' 1 2 2016-02-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 16.2022 30.0125 14.7960 -0.0159 -0.0138 0.0045  -0.0145 -0.0119 0.0011  1.1103 0.9067 1.0815 
0.4284 -0.7217 -0.4529 -0.0828 0.1470 0.0117  -0.1655 0.0757  0.0780 0.1047 -0.1005 0.0072 
'X-RAY DIFFRACTION' 2 ? refined 11.3003 21.2587 9.1849  0.0112  0.0825  -0.0270 -0.0998 -0.0545 -0.0318 0.0357 0.0096 0.0166 
0.1013 0.1507  -0.1154 -0.0034 0.0026 -0.0149 0.0006  -0.0016 0.0146 0.0108 -0.0006 0.0050 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER refinement       2.10.2 ? 1 
XDS    'data reduction' .      ? 2 
XSCALE 'data scaling'   .      ? 3 
PHASER phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             5A24 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE CRYSTALLIZED PROTEIN CORRESPONDS TO MATURE DIONAIN-1,
FROM V131 TO A352
GENBANK ID: KP663370
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 21  ? ? 55.86   -132.81 
2 1 GLN A 22  ? ? -97.26  45.20   
3 1 ASN A 123 ? ? -151.54 89.99   
4 1 ASP A 164 ? ? -150.53 2.62    
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C6 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    E64 
_pdbx_validate_chiral.auth_seq_id     1224 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 A E64 1224 ? C13 ? B E64 1 C13 
2 1 N 1 A E64 1224 ? C14 ? B E64 1 C14 
3 1 N 1 A E64 1224 ? C15 ? B E64 1 C15 
4 1 N 1 A E64 1224 ? N3  ? B E64 1 N3  
5 1 N 1 A E64 1224 ? C16 ? B E64 1 C16 
6 1 N 1 A E64 1224 ? N4  ? B E64 1 N4  
7 1 N 1 A E64 1224 ? N5  ? B E64 1 N5  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N-[N-[1-HYDROXYCARBOXYETHYL-CARBONYL]LEUCYLAMINO-BUTYL]-GUANIDINE' E64 
3 'PHOSPHATE ION'                                                     PO4 
4 water                                                               HOH 
#