data_5A2E
# 
_entry.id   5A2E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5A2E         
PDBE  EBI-63808    
WWPDB D_1290063808 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          5A2F 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'TWO MEMBRANE DISTAL IGSF DOMAINS OF CD166' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5A2E 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-05-18 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chappell, P.E.' 1 
'Johnson, S.'    2 
'Lea, S.M.'      3 
'Brown, M.H.'    4 
# 
_citation.id                        primary 
_citation.title                     'Structures of Cd6 and its Ligand Cd166 Give Insight Into Their Interaction.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            23 
_citation.page_first                1426 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26146185 
_citation.pdbx_database_id_DOI      10.1016/J.STR.2015.05.019 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chappell, P.E.' 1 
primary 'Garner, L.I.'   2 
primary 'Yan, J.'        3 
primary 'Metcalfe, C.'   4 
primary 'Hatherley, D.'  5 
primary 'Johnson, S.'    6 
primary 'Robinson, C.V.' 7 
primary 'Lea, S.M.'      8 
primary 'Brown, M.H.'    9 
# 
_cell.entry_id           5A2E 
_cell.length_a           161.480 
_cell.length_b           161.480 
_cell.length_c           93.850 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5A2E 
_symmetry.space_group_name_H-M             'P 63 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                182 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'T-CELL DIFFERENTIATION ANTIGEN CD6' 39613.168 1  ? ? 'EXTRACELLULAR SRCR DOMAINS' ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE               221.208   1  ? ? ?                            ? 
3 non-polymer syn 1,2-ETHANEDIOL                       62.068    6  ? ? ?                            ? 
4 water       nat water                                18.015    43 ? ? ?                            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'T12, TP120, HUMAN CD6' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAE
AVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRA
LRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
PGLPGQHYCGHKEDAGVVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPH
SLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRGHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAE
AVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRA
LRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
PGLPGQHYCGHKEDAGVVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPH
SLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRGHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   TRP n 
1 3   LEU n 
1 4   PHE n 
1 5   PHE n 
1 6   GLY n 
1 7   ILE n 
1 8   THR n 
1 9   GLY n 
1 10  LEU n 
1 11  LEU n 
1 12  THR n 
1 13  ALA n 
1 14  ALA n 
1 15  LEU n 
1 16  SER n 
1 17  GLY n 
1 18  HIS n 
1 19  PRO n 
1 20  SER n 
1 21  PRO n 
1 22  ALA n 
1 23  PRO n 
1 24  PRO n 
1 25  ASP n 
1 26  GLN n 
1 27  LEU n 
1 28  ASN n 
1 29  THR n 
1 30  SER n 
1 31  SER n 
1 32  ALA n 
1 33  GLU n 
1 34  SER n 
1 35  GLU n 
1 36  LEU n 
1 37  TRP n 
1 38  GLU n 
1 39  PRO n 
1 40  GLY n 
1 41  GLU n 
1 42  ARG n 
1 43  LEU n 
1 44  PRO n 
1 45  VAL n 
1 46  ARG n 
1 47  LEU n 
1 48  THR n 
1 49  ASN n 
1 50  GLY n 
1 51  SER n 
1 52  SER n 
1 53  SER n 
1 54  CYS n 
1 55  SER n 
1 56  GLY n 
1 57  THR n 
1 58  VAL n 
1 59  GLU n 
1 60  VAL n 
1 61  ARG n 
1 62  LEU n 
1 63  GLU n 
1 64  ALA n 
1 65  SER n 
1 66  TRP n 
1 67  GLU n 
1 68  PRO n 
1 69  ALA n 
1 70  CYS n 
1 71  GLY n 
1 72  ALA n 
1 73  LEU n 
1 74  TRP n 
1 75  ASP n 
1 76  SER n 
1 77  ARG n 
1 78  ALA n 
1 79  ALA n 
1 80  GLU n 
1 81  ALA n 
1 82  VAL n 
1 83  CYS n 
1 84  ARG n 
1 85  ALA n 
1 86  LEU n 
1 87  GLY n 
1 88  CYS n 
1 89  GLY n 
1 90  GLY n 
1 91  ALA n 
1 92  GLU n 
1 93  ALA n 
1 94  ALA n 
1 95  SER n 
1 96  GLN n 
1 97  LEU n 
1 98  ALA n 
1 99  PRO n 
1 100 PRO n 
1 101 THR n 
1 102 PRO n 
1 103 GLU n 
1 104 LEU n 
1 105 PRO n 
1 106 PRO n 
1 107 PRO n 
1 108 PRO n 
1 109 ALA n 
1 110 ALA n 
1 111 GLY n 
1 112 ASN n 
1 113 THR n 
1 114 SER n 
1 115 VAL n 
1 116 ALA n 
1 117 ALA n 
1 118 ASN n 
1 119 ALA n 
1 120 THR n 
1 121 LEU n 
1 122 ALA n 
1 123 GLY n 
1 124 ALA n 
1 125 PRO n 
1 126 ALA n 
1 127 LEU n 
1 128 LEU n 
1 129 CYS n 
1 130 SER n 
1 131 GLY n 
1 132 ALA n 
1 133 GLU n 
1 134 TRP n 
1 135 ARG n 
1 136 LEU n 
1 137 CYS n 
1 138 GLU n 
1 139 VAL n 
1 140 VAL n 
1 141 GLU n 
1 142 HIS n 
1 143 ALA n 
1 144 CYS n 
1 145 ARG n 
1 146 SER n 
1 147 ASP n 
1 148 GLY n 
1 149 ARG n 
1 150 ARG n 
1 151 ALA n 
1 152 ARG n 
1 153 VAL n 
1 154 THR n 
1 155 CYS n 
1 156 ALA n 
1 157 GLU n 
1 158 ASN n 
1 159 ARG n 
1 160 ALA n 
1 161 LEU n 
1 162 ARG n 
1 163 LEU n 
1 164 VAL n 
1 165 ASP n 
1 166 GLY n 
1 167 GLY n 
1 168 GLY n 
1 169 ALA n 
1 170 CYS n 
1 171 ALA n 
1 172 GLY n 
1 173 ARG n 
1 174 VAL n 
1 175 GLU n 
1 176 MET n 
1 177 LEU n 
1 178 GLU n 
1 179 HIS n 
1 180 GLY n 
1 181 GLU n 
1 182 TRP n 
1 183 GLY n 
1 184 SER n 
1 185 VAL n 
1 186 CYS n 
1 187 ASP n 
1 188 ASP n 
1 189 THR n 
1 190 TRP n 
1 191 ASP n 
1 192 LEU n 
1 193 GLU n 
1 194 ASP n 
1 195 ALA n 
1 196 HIS n 
1 197 VAL n 
1 198 VAL n 
1 199 CYS n 
1 200 ARG n 
1 201 GLN n 
1 202 LEU n 
1 203 GLY n 
1 204 CYS n 
1 205 GLY n 
1 206 TRP n 
1 207 ALA n 
1 208 VAL n 
1 209 GLN n 
1 210 ALA n 
1 211 LEU n 
1 212 PRO n 
1 213 GLY n 
1 214 LEU n 
1 215 HIS n 
1 216 PHE n 
1 217 THR n 
1 218 PRO n 
1 219 GLY n 
1 220 ARG n 
1 221 GLY n 
1 222 PRO n 
1 223 ILE n 
1 224 HIS n 
1 225 ARG n 
1 226 ASP n 
1 227 GLN n 
1 228 VAL n 
1 229 ASN n 
1 230 CYS n 
1 231 SER n 
1 232 GLY n 
1 233 ALA n 
1 234 GLU n 
1 235 ALA n 
1 236 TYR n 
1 237 LEU n 
1 238 TRP n 
1 239 ASP n 
1 240 CYS n 
1 241 PRO n 
1 242 GLY n 
1 243 LEU n 
1 244 PRO n 
1 245 GLY n 
1 246 GLN n 
1 247 HIS n 
1 248 TYR n 
1 249 CYS n 
1 250 GLY n 
1 251 HIS n 
1 252 LYS n 
1 253 GLU n 
1 254 ASP n 
1 255 ALA n 
1 256 GLY n 
1 257 VAL n 
1 258 VAL n 
1 259 CYS n 
1 260 SER n 
1 261 GLU n 
1 262 HIS n 
1 263 GLN n 
1 264 SER n 
1 265 TRP n 
1 266 ARG n 
1 267 LEU n 
1 268 THR n 
1 269 GLY n 
1 270 GLY n 
1 271 ALA n 
1 272 ASP n 
1 273 ARG n 
1 274 CYS n 
1 275 GLU n 
1 276 GLY n 
1 277 GLN n 
1 278 VAL n 
1 279 GLU n 
1 280 VAL n 
1 281 HIS n 
1 282 PHE n 
1 283 ARG n 
1 284 GLY n 
1 285 VAL n 
1 286 TRP n 
1 287 ASN n 
1 288 THR n 
1 289 VAL n 
1 290 CYS n 
1 291 ASP n 
1 292 SER n 
1 293 GLU n 
1 294 TRP n 
1 295 TYR n 
1 296 PRO n 
1 297 SER n 
1 298 GLU n 
1 299 ALA n 
1 300 LYS n 
1 301 VAL n 
1 302 LEU n 
1 303 CYS n 
1 304 GLN n 
1 305 SER n 
1 306 LEU n 
1 307 GLY n 
1 308 CYS n 
1 309 GLY n 
1 310 THR n 
1 311 ALA n 
1 312 VAL n 
1 313 GLU n 
1 314 ARG n 
1 315 PRO n 
1 316 LYS n 
1 317 GLY n 
1 318 LEU n 
1 319 PRO n 
1 320 HIS n 
1 321 SER n 
1 322 LEU n 
1 323 SER n 
1 324 GLY n 
1 325 ARG n 
1 326 MET n 
1 327 TYR n 
1 328 TYR n 
1 329 SER n 
1 330 CYS n 
1 331 ASN n 
1 332 GLY n 
1 333 GLU n 
1 334 GLU n 
1 335 LEU n 
1 336 THR n 
1 337 LEU n 
1 338 SER n 
1 339 ASN n 
1 340 CYS n 
1 341 SER n 
1 342 TRP n 
1 343 ARG n 
1 344 PHE n 
1 345 ASN n 
1 346 ASN n 
1 347 SER n 
1 348 ASN n 
1 349 LEU n 
1 350 CYS n 
1 351 SER n 
1 352 GLN n 
1 353 SER n 
1 354 LEU n 
1 355 ALA n 
1 356 ALA n 
1 357 ARG n 
1 358 VAL n 
1 359 LEU n 
1 360 CYS n 
1 361 SER n 
1 362 ALA n 
1 363 SER n 
1 364 ARG n 
1 365 GLY n 
1 366 HIS n 
1 367 HIS n 
1 368 HIS n 
1 369 HIS n 
1 370 HIS n 
1 371 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            'CHO LEC 3.2.8.1' 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'CHINESE HAMSTER' 
_entity_src_gen.pdbx_host_org_scientific_name      'CRICETULUS GRISEUS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PEE14 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD6_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P30203 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5A2E 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 364 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P30203 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  364 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       364 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5A2E GLY A 365 ? UNP P30203 ?   ?   'expression tag' 365 1 
1 5A2E HIS A 366 ? UNP P30203 ?   ?   'expression tag' 366 2 
1 5A2E HIS A 367 ? UNP P30203 ?   ?   'expression tag' 367 3 
1 5A2E HIS A 368 ? UNP P30203 ?   ?   'expression tag' 368 4 
1 5A2E HIS A 369 ? UNP P30203 ?   ?   'expression tag' 369 5 
1 5A2E HIS A 370 ? UNP P30203 ?   ?   'expression tag' 370 6 
1 5A2E HIS A 371 ? UNP P30203 ?   ?   'expression tag' 371 7 
1 5A2E VAL A 257 ? UNP P30203 ALA 257 conflict         257 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL         'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE              ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ?                 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE ?                 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE          ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5A2E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.46 
_exptl_crystal.density_percent_sol   77.49 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1M AMMONIUM SULFATE, 0.3M SODIUM FORMATE, 0.1M SODIUM CACODYLATE, 3% W/V PGA-LM, 20% MPD, PH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS' 
_diffrn_detector.pdbx_collection_date   2013-01-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_wavelength             0.92 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5A2E 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             77.93 
_reflns.d_resolution_high            3.15 
_reflns.number_obs                   12884 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.23 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.20 
_reflns.B_iso_Wilson_estimate        71.97 
_reflns.pdbx_redundancy              5.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.15 
_reflns_shell.d_res_low              3.23 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.80 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.20 
_reflns_shell.pdbx_redundancy        5.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5A2E 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     12883 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             77.93 
_refine.ls_d_res_high                            3.15 
_refine.ls_percent_reflns_obs                    99.34 
_refine.ls_R_factor_obs                          0.2545 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2531 
_refine.ls_R_factor_R_free                       0.2831 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.88 
_refine.ls_number_reflns_R_free                  629 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.8352 
_refine.correlation_coeff_Fo_to_Fc_free          0.7738 
_refine.B_iso_mean                               37.69 
_refine.aniso_B[1][1]                            -3.5678 
_refine.aniso_B[2][2]                            -3.5678 
_refine.aniso_B[3][3]                            7.1357 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1BY2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               0.715 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.384 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        5A2E 
_refine_analyze.Luzzati_coordinate_error_obs    0.731 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2260 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         38 
_refine_hist.number_atoms_solvent             43 
_refine_hist.number_atoms_total               2341 
_refine_hist.d_res_high                       3.15 
_refine_hist.d_res_low                        77.93 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.006 ? 2.00  4549 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               0.76  ? 2.00  8155 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  968  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  53   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  736  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 4549 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           1.74  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           13.39 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  286  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? 1.00  2    'X-RAY DIFFRACTION' HARMONIC     
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  4423 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.15 
_refine_ls_shell.d_res_low                        3.45 
_refine_ls_shell.number_reflns_R_work             2851 
_refine_ls_shell.R_factor_R_work                  0.2848 
_refine_ls_shell.percent_reflns_obs               99.34 
_refine_ls_shell.R_factor_R_free                  0.3076 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.19 
_refine_ls_shell.number_reflns_R_free             156 
_refine_ls_shell.number_reflns_all                3007 
_refine_ls_shell.R_factor_all                     0.2860 
# 
_struct.entry_id                  5A2E 
_struct.title                     'Extracellular SRCR domains of human CD6' 
_struct.pdbx_descriptor           'T-CELL DIFFERENTIATION ANTIGEN CD6' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5A2E 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'IMMUNE SYSTEM, SCAVENGER RECEPTOR CYSTEINE RICH, SRCR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 75  ? GLY A 87  ? ASP A 75  GLY A 87  1 ? 13 
HELX_P HELX_P2 2 ASP A 191 ? GLY A 203 ? ASP A 191 GLY A 203 1 ? 13 
HELX_P HELX_P3 3 GLY A 250 ? GLU A 253 ? GLY A 250 GLU A 253 5 ? 4  
HELX_P HELX_P4 4 TYR A 295 ? GLY A 307 ? TYR A 295 GLY A 307 1 ? 13 
HELX_P HELX_P5 5 THR A 336 ? CYS A 340 ? THR A 336 CYS A 340 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 54  SG  ? ? ? 1_555 A CYS 88  SG ? ? A CYS 54  A CYS 88   1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf2  disulf ? ? A CYS 70  SG  ? ? ? 1_555 A CYS 144 SG ? ? A CYS 70  A CYS 144  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3  disulf ? ? A CYS 83  SG  ? ? ? 1_555 A CYS 155 SG ? ? A CYS 83  A CYS 155  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4  disulf ? ? A CYS 129 SG  ? ? ? 1_555 A CYS 137 SG ? ? A CYS 129 A CYS 137  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf5  disulf ? ? A CYS 170 SG  ? ? ? 1_555 A CYS 204 SG ? ? A CYS 170 A CYS 204  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf6  disulf ? ? A CYS 186 SG  ? ? ? 1_555 A CYS 249 SG ? ? A CYS 186 A CYS 249  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf7  disulf ? ? A CYS 199 SG  ? ? ? 1_555 A CYS 259 SG ? ? A CYS 199 A CYS 259  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf8  disulf ? ? A CYS 230 SG  ? ? ? 1_555 A CYS 240 SG ? ? A CYS 230 A CYS 240  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf9  disulf ? ? A CYS 274 SG  A ? ? 1_555 A CYS 308 SG A ? A CYS 274 A CYS 308  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf10 disulf ? ? A CYS 290 SG  ? ? ? 1_555 A CYS 350 SG ? ? A CYS 290 A CYS 350  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf11 disulf ? ? A CYS 303 SG  ? ? ? 1_555 A CYS 360 SG ? ? A CYS 303 A CYS 360  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf12 disulf ? ? A CYS 330 SG  ? ? ? 1_555 A CYS 340 SG ? ? A CYS 330 A CYS 340  1_555 ? ? ? ? ? ? ? 2.032 ? 
covale1  covale ? ? A ASN 229 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 229 A NAG 1367 1_555 ? ? ? ? ? ? ? 1.433 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           43 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            43 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    44 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     44 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 2 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 5 ? 
AH ? 4 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 6 ? 
AL ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? parallel      
AG 4 5 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? parallel      
AK 2 3 ? parallel      
AK 3 4 ? anti-parallel 
AK 4 5 ? parallel      
AK 5 6 ? anti-parallel 
AL 1 2 ? parallel      
AL 2 3 ? parallel      
AL 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 45  ? THR A 48  ? VAL A 45  THR A 48  
AA 2 SER A 55  ? VAL A 60  ? SER A 55  VAL A 60  
AB 1 GLU A 67  ? PRO A 68  ? GLU A 67  PRO A 68  
AB 2 SER A 55  ? VAL A 60  ? SER A 55  VAL A 60  
AC 1 ALA A 91  ? LEU A 97  ? ALA A 91  LEU A 97  
AC 2 ARG A 150 ? CYS A 155 ? ARG A 150 CYS A 155 
AC 3 SER A 55  ? VAL A 60  ? SER A 55  VAL A 60  
AC 4 GLU A 67  ? PRO A 68  ? GLU A 67  PRO A 68  
AD 1 ALA A 91  ? LEU A 97  ? ALA A 91  LEU A 97  
AD 2 ARG A 150 ? CYS A 155 ? ARG A 150 CYS A 155 
AD 3 SER A 55  ? VAL A 60  ? SER A 55  VAL A 60  
AD 4 VAL A 45  ? THR A 48  ? VAL A 45  THR A 48  
AE 1 ALA A 126 ? CYS A 129 ? ALA A 126 CYS A 129 
AE 2 CYS A 137 ? VAL A 140 ? CYS A 137 VAL A 140 
AF 1 ARG A 159 ? VAL A 164 ? ARG A 159 VAL A 164 
AF 2 ALA A 171 ? GLU A 178 ? ALA A 171 GLU A 178 
AG 1 ALA A 207 ? GLN A 209 ? ALA A 207 GLN A 209 
AG 2 GLY A 256 ? CYS A 259 ? GLY A 256 CYS A 259 
AG 3 ALA A 171 ? GLU A 178 ? ALA A 171 GLU A 178 
AG 4 TRP A 182 ? VAL A 185 ? TRP A 182 VAL A 185 
AG 5 ILE A 223 ? ARG A 225 ? ILE A 223 ARG A 225 
AH 1 ALA A 207 ? GLN A 209 ? ALA A 207 GLN A 209 
AH 2 GLY A 256 ? CYS A 259 ? GLY A 256 CYS A 259 
AH 3 ALA A 171 ? GLU A 178 ? ALA A 171 GLU A 178 
AH 4 ARG A 159 ? VAL A 164 ? ARG A 159 VAL A 164 
AI 1 GLN A 227 ? VAL A 228 ? GLN A 227 VAL A 228 
AI 2 GLY A 242 ? LEU A 243 ? GLY A 242 LEU A 243 
AJ 1 SER A 264 ? GLY A 269 ? SER A 264 GLY A 269 
AJ 2 GLU A 275 ? PHE A 282 ? GLU A 275 PHE A 282 
AK 1 ALA A 311 ? GLU A 313 ? ALA A 311 GLU A 313 
AK 2 ARG A 357 ? CYS A 360 ? ARG A 357 CYS A 360 
AK 3 GLU A 275 ? PHE A 282 ? GLU A 275 PHE A 282 
AK 4 VAL A 285 ? VAL A 289 ? VAL A 285 VAL A 289 
AK 5 ARG A 325 ? SER A 329 ? ARG A 325 SER A 329 
AK 6 SER A 341 ? PHE A 344 ? SER A 341 PHE A 344 
AL 1 ALA A 311 ? GLU A 313 ? ALA A 311 GLU A 313 
AL 2 ARG A 357 ? CYS A 360 ? ARG A 357 CYS A 360 
AL 3 GLU A 275 ? PHE A 282 ? GLU A 275 PHE A 282 
AL 4 SER A 264 ? GLY A 269 ? SER A 264 GLY A 269 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 48  ? N THR A 48  O THR A 57  ? O THR A 57  
AB 1 2 N GLU A 67  ? N GLU A 67  O VAL A 60  ? O VAL A 60  
AC 1 2 N LEU A 97  ? N LEU A 97  O ARG A 150 ? O ARG A 150 
AC 2 3 N VAL A 153 ? N VAL A 153 O GLY A 56  ? O GLY A 56  
AC 3 4 N VAL A 60  ? N VAL A 60  O GLU A 67  ? O GLU A 67  
AD 1 2 N LEU A 97  ? N LEU A 97  O ARG A 150 ? O ARG A 150 
AD 2 3 N VAL A 153 ? N VAL A 153 O GLY A 56  ? O GLY A 56  
AD 3 4 N GLU A 59  ? N GLU A 59  O ARG A 46  ? O ARG A 46  
AE 1 2 N LEU A 128 ? N LEU A 128 O GLU A 138 ? O GLU A 138 
AF 1 2 N VAL A 164 ? N VAL A 164 O ARG A 173 ? O ARG A 173 
AG 1 2 N VAL A 208 ? N VAL A 208 O VAL A 258 ? O VAL A 258 
AG 2 3 N VAL A 257 ? N VAL A 257 O GLY A 172 ? O GLY A 172 
AG 3 4 N MET A 176 ? N MET A 176 O GLY A 183 ? O GLY A 183 
AG 4 5 O SER A 184 ? O SER A 184 N HIS A 224 ? N HIS A 224 
AH 1 2 N VAL A 208 ? N VAL A 208 O VAL A 258 ? O VAL A 258 
AH 2 3 N VAL A 257 ? N VAL A 257 O GLY A 172 ? O GLY A 172 
AH 3 4 N LEU A 177 ? N LEU A 177 O ALA A 160 ? O ALA A 160 
AI 1 2 O GLN A 227 ? O GLN A 227 N LEU A 243 ? N LEU A 243 
AJ 1 2 N THR A 268 ? N THR A 268 O GLN A 277 ? O GLN A 277 
AK 1 2 N VAL A 312 ? N VAL A 312 O LEU A 359 ? O LEU A 359 
AK 2 3 N VAL A 358 ? N VAL A 358 O GLY A 276 ? O GLY A 276 
AK 3 4 N PHE A 282 ? N PHE A 282 O VAL A 285 ? O VAL A 285 
AK 4 5 O THR A 288 ? O THR A 288 N MET A 326 ? N MET A 326 
AK 5 6 N SER A 329 ? N SER A 329 O SER A 341 ? O SER A 341 
AL 1 2 N VAL A 312 ? N VAL A 312 O LEU A 359 ? O LEU A 359 
AL 2 3 N VAL A 358 ? N VAL A 358 O GLY A 276 ? O GLY A 276 
AL 3 4 N HIS A 281 ? N HIS A 281 O SER A 264 ? O SER A 264 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE EDO A 1373'                           
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 1368'                           
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 1369'                           
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A 1370'                           
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE EDO A 1371'                           
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE EDO A 1372'                           
AC7 Software ? ? ? ? 3 'Binding site for Mono-Saccharide NAG A1367 bound to ASN A 229' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 LEU A 86  ? LEU A 86   . ? 10_554 ? 
2  AC1 2 GLY A 87  ? GLY A 87   . ? 10_554 ? 
3  AC2 4 ARG A 225 ? ARG A 225  . ? 1_555  ? 
4  AC2 4 GLY A 242 ? GLY A 242  . ? 1_555  ? 
5  AC2 4 PRO A 244 ? PRO A 244  . ? 1_555  ? 
6  AC2 4 HOH I .   ? HOH A 2022 . ? 1_555  ? 
7  AC3 4 GLU A 293 ? GLU A 293  . ? 1_555  ? 
8  AC3 4 SER A 297 ? SER A 297  . ? 1_555  ? 
9  AC3 4 GLU A 298 ? GLU A 298  . ? 1_555  ? 
10 AC3 4 CYS A 330 ? CYS A 330  . ? 1_555  ? 
11 AC4 5 CYS A 340 ? CYS A 340  . ? 1_555  ? 
12 AC4 5 SER A 341 ? SER A 341  . ? 1_555  ? 
13 AC4 5 TRP A 342 ? TRP A 342  . ? 1_555  ? 
14 AC4 5 ARG A 343 ? ARG A 343  . ? 1_555  ? 
15 AC4 5 HOH I .   ? HOH A 2038 . ? 1_555  ? 
16 AC5 2 GLN A 227 ? GLN A 227  . ? 1_555  ? 
17 AC5 2 GLY A 242 ? GLY A 242  . ? 1_555  ? 
18 AC6 2 LEU A 163 ? LEU A 163  . ? 1_555  ? 
19 AC6 2 CYS A 170 ? CYS A 170  . ? 1_555  ? 
20 AC7 3 ALA A 85  ? ALA A 85   . ? 10_554 ? 
21 AC7 3 ASN A 229 ? ASN A 229  . ? 1_555  ? 
22 AC7 3 SER A 231 ? SER A 231  . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          5A2E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5A2E 
_atom_sites.fract_transf_matrix[1][1]   0.006193 
_atom_sites.fract_transf_matrix[1][2]   0.003575 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007151 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010655 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 43  ? -45.023 42.205 -10.412 1.00 42.43  ? 43   LEU A N   1 
ATOM   2    C CA  . LEU A 1 43  ? -43.727 42.684 -10.882 1.00 42.19  ? 43   LEU A CA  1 
ATOM   3    C C   . LEU A 1 43  ? -43.676 44.232 -10.817 1.00 45.41  ? 43   LEU A C   1 
ATOM   4    O O   . LEU A 1 43  ? -43.948 44.889 -11.825 1.00 44.82  ? 43   LEU A O   1 
ATOM   5    C CB  . LEU A 1 43  ? -43.466 42.167 -12.317 1.00 42.32  ? 43   LEU A CB  1 
ATOM   6    C CG  . LEU A 1 43  ? -41.988 42.055 -12.706 1.00 47.10  ? 43   LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 43  ? -41.422 40.702 -12.309 1.00 47.29  ? 43   LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 43  ? -41.790 42.263 -14.197 1.00 49.49  ? 43   LEU A CD2 1 
ATOM   9    N N   . PRO A 1 44  ? -43.395 44.862 -9.649  1.00 41.65  ? 44   PRO A N   1 
ATOM   10   C CA  . PRO A 1 44  ? -43.043 44.299 -8.336  1.00 41.31  ? 44   PRO A CA  1 
ATOM   11   C C   . PRO A 1 44  ? -44.216 44.130 -7.353  1.00 44.64  ? 44   PRO A C   1 
ATOM   12   O O   . PRO A 1 44  ? -43.968 43.985 -6.156  1.00 44.17  ? 44   PRO A O   1 
ATOM   13   C CB  . PRO A 1 44  ? -42.032 45.331 -7.825  1.00 43.06  ? 44   PRO A CB  1 
ATOM   14   C CG  . PRO A 1 44  ? -42.617 46.642 -8.293  1.00 47.51  ? 44   PRO A CG  1 
ATOM   15   C CD  . PRO A 1 44  ? -43.348 46.338 -9.596  1.00 43.13  ? 44   PRO A CD  1 
ATOM   16   N N   . VAL A 1 45  ? -45.479 44.143 -7.834  1.00 40.80  ? 45   VAL A N   1 
ATOM   17   C CA  . VAL A 1 45  ? -46.670 43.992 -6.986  1.00 40.34  ? 45   VAL A CA  1 
ATOM   18   C C   . VAL A 1 45  ? -47.410 42.703 -7.367  1.00 43.69  ? 45   VAL A C   1 
ATOM   19   O O   . VAL A 1 45  ? -47.318 42.255 -8.510  1.00 43.23  ? 45   VAL A O   1 
ATOM   20   C CB  . VAL A 1 45  ? -47.599 45.232 -7.113  1.00 44.16  ? 45   VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 45  ? -48.705 45.215 -6.056  1.00 43.89  ? 45   VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 45  ? -46.796 46.525 -7.020  1.00 43.97  ? 45   VAL A CG2 1 
ATOM   23   N N   . ARG A 1 46  ? -48.125 42.105 -6.399  1.00 39.87  ? 46   ARG A N   1 
ATOM   24   C CA  . ARG A 1 46  ? -48.922 40.894 -6.617  1.00 39.52  ? 46   ARG A CA  1 
ATOM   25   C C   . ARG A 1 46  ? -50.091 40.818 -5.630  1.00 42.98  ? 46   ARG A C   1 
ATOM   26   O O   . ARG A 1 46  ? -50.158 41.609 -4.687  1.00 42.36  ? 46   ARG A O   1 
ATOM   27   C CB  . ARG A 1 46  ? -48.047 39.626 -6.537  1.00 39.93  ? 46   ARG A CB  1 
ATOM   28   C CG  . ARG A 1 46  ? -47.612 39.224 -5.129  1.00 50.77  ? 46   ARG A CG  1 
ATOM   29   C CD  . ARG A 1 46  ? -46.676 38.032 -5.157  1.00 60.89  ? 46   ARG A CD  1 
ATOM   30   N NE  . ARG A 1 46  ? -46.317 37.579 -3.812  1.00 68.74  ? 46   ARG A NE  1 
ATOM   31   C CZ  . ARG A 1 46  ? -45.518 36.548 -3.545  1.00 83.04  ? 46   ARG A CZ  1 
ATOM   32   N NH1 . ARG A 1 46  ? -44.975 35.841 -4.532  1.00 70.69  ? 46   ARG A NH1 1 
ATOM   33   N NH2 . ARG A 1 46  ? -45.253 36.215 -2.287  1.00 69.99  ? 46   ARG A NH2 1 
ATOM   34   N N   . LEU A 1 47  ? -51.000 39.856 -5.850  1.00 39.48  ? 47   LEU A N   1 
ATOM   35   C CA  . LEU A 1 47  ? -52.174 39.632 -5.006  1.00 39.22  ? 47   LEU A CA  1 
ATOM   36   C C   . LEU A 1 47  ? -52.219 38.159 -4.592  1.00 43.08  ? 47   LEU A C   1 
ATOM   37   O O   . LEU A 1 47  ? -52.343 37.293 -5.458  1.00 42.75  ? 47   LEU A O   1 
ATOM   38   C CB  . LEU A 1 47  ? -53.450 40.011 -5.772  1.00 39.25  ? 47   LEU A CB  1 
ATOM   39   C CG  . LEU A 1 47  ? -53.578 41.485 -6.173  1.00 43.89  ? 47   LEU A CG  1 
ATOM   40   C CD1 . LEU A 1 47  ? -54.656 41.683 -7.208  1.00 44.00  ? 47   LEU A CD1 1 
ATOM   41   C CD2 . LEU A 1 47  ? -53.891 42.353 -4.979  1.00 46.35  ? 47   LEU A CD2 1 
ATOM   42   N N   . THR A 1 48  ? -52.093 37.876 -3.276  1.00 39.52  ? 48   THR A N   1 
ATOM   43   C CA  . THR A 1 48  ? -52.091 36.511 -2.732  1.00 39.33  ? 48   THR A CA  1 
ATOM   44   C C   . THR A 1 48  ? -53.189 36.302 -1.695  1.00 42.96  ? 48   THR A C   1 
ATOM   45   O O   . THR A 1 48  ? -53.695 37.266 -1.122  1.00 42.33  ? 48   THR A O   1 
ATOM   46   C CB  . THR A 1 48  ? -50.732 36.198 -2.100  1.00 47.72  ? 48   THR A CB  1 
ATOM   47   O OG1 . THR A 1 48  ? -50.445 37.177 -1.101  1.00 46.96  ? 48   THR A OG1 1 
ATOM   48   C CG2 . THR A 1 48  ? -49.611 36.148 -3.126  1.00 46.57  ? 48   THR A CG2 1 
ATOM   49   N N   . ASN A 1 49  ? -53.526 35.021 -1.441  1.00 39.65  ? 49   ASN A N   1 
ATOM   50   C CA  . ASN A 1 49  ? -54.548 34.593 -0.479  1.00 39.56  ? 49   ASN A CA  1 
ATOM   51   C C   . ASN A 1 49  ? -55.904 35.260 -0.758  1.00 43.00  ? 49   ASN A C   1 
ATOM   52   O O   . ASN A 1 49  ? -56.495 35.880 0.128   1.00 42.65  ? 49   ASN A O   1 
ATOM   53   C CB  . ASN A 1 49  ? -54.081 34.837 0.970   1.00 41.23  ? 49   ASN A CB  1 
ATOM   54   C CG  . ASN A 1 49  ? -52.749 34.205 1.306   1.00 66.65  ? 49   ASN A CG  1 
ATOM   55   O OD1 . ASN A 1 49  ? -51.781 34.892 1.651   1.00 62.03  ? 49   ASN A OD1 1 
ATOM   56   N ND2 . ASN A 1 49  ? -52.670 32.883 1.237   1.00 58.48  ? 49   ASN A ND2 1 
ATOM   57   N N   . GLY A 1 50  ? -56.360 35.131 -2.001  1.00 39.04  ? 50   GLY A N   1 
ATOM   58   C CA  . GLY A 1 50  ? -57.623 35.698 -2.462  1.00 38.60  ? 50   GLY A CA  1 
ATOM   59   C C   . GLY A 1 50  ? -58.412 34.761 -3.352  1.00 41.71  ? 50   GLY A C   1 
ATOM   60   O O   . GLY A 1 50  ? -58.081 33.579 -3.475  1.00 41.34  ? 50   GLY A O   1 
ATOM   61   N N   . SER A 1 51  ? -59.469 35.293 -3.974  1.00 37.60  ? 51   SER A N   1 
ATOM   62   C CA  . SER A 1 51  ? -60.357 34.529 -4.853  1.00 37.12  ? 51   SER A CA  1 
ATOM   63   C C   . SER A 1 51  ? -59.687 34.136 -6.177  1.00 40.37  ? 51   SER A C   1 
ATOM   64   O O   . SER A 1 51  ? -59.936 33.041 -6.680  1.00 39.76  ? 51   SER A O   1 
ATOM   65   C CB  . SER A 1 51  ? -61.627 35.327 -5.134  1.00 40.49  ? 51   SER A CB  1 
ATOM   66   O OG  . SER A 1 51  ? -62.551 34.582 -5.907  1.00 48.84  ? 51   SER A OG  1 
ATOM   67   N N   . SER A 1 52  ? -58.864 35.034 -6.745  1.00 36.64  ? 52   SER A N   1 
ATOM   68   C CA  . SER A 1 52  ? -58.170 34.802 -8.015  1.00 36.22  ? 52   SER A CA  1 
ATOM   69   C C   . SER A 1 52  ? -56.830 35.550 -8.038  1.00 39.44  ? 52   SER A C   1 
ATOM   70   O O   . SER A 1 52  ? -56.443 36.140 -7.030  1.00 38.95  ? 52   SER A O   1 
ATOM   71   C CB  . SER A 1 52  ? -59.051 35.276 -9.170  1.00 39.71  ? 52   SER A CB  1 
ATOM   72   O OG  . SER A 1 52  ? -59.184 36.688 -9.194  1.00 48.24  ? 52   SER A OG  1 
ATOM   73   N N   . SER A 1 53  ? -56.130 35.540 -9.188  1.00 35.61  ? 53   SER A N   1 
ATOM   74   C CA  . SER A 1 53  ? -54.876 36.281 -9.351  1.00 35.23  ? 53   SER A CA  1 
ATOM   75   C C   . SER A 1 53  ? -55.123 37.804 -9.387  1.00 38.44  ? 53   SER A C   1 
ATOM   76   O O   . SER A 1 53  ? -54.184 38.567 -9.164  1.00 37.93  ? 53   SER A O   1 
ATOM   77   C CB  . SER A 1 53  ? -54.150 35.837 -10.617 1.00 38.81  ? 53   SER A CB  1 
ATOM   78   O OG  . SER A 1 53  ? -54.989 35.937 -11.756 1.00 47.52  ? 53   SER A OG  1 
ATOM   79   N N   . CYS A 1 54  ? -56.382 38.238 -9.645  1.00 34.58  ? 54   CYS A N   1 
ATOM   80   C CA  . CYS A 1 54  ? -56.789 39.647 -9.673  1.00 34.17  ? 54   CYS A CA  1 
ATOM   81   C C   . CYS A 1 54  ? -57.535 40.063 -8.381  1.00 38.00  ? 54   CYS A C   1 
ATOM   82   O O   . CYS A 1 54  ? -58.352 40.984 -8.421  1.00 37.42  ? 54   CYS A O   1 
ATOM   83   C CB  . CYS A 1 54  ? -57.629 39.921 -10.919 1.00 34.35  ? 54   CYS A CB  1 
ATOM   84   S SG  . CYS A 1 54  ? -56.686 39.899 -12.465 1.00 38.17  ? 54   CYS A SG  1 
ATOM   85   N N   . SER A 1 55  ? -57.226 39.422 -7.233  1.00 34.79  ? 55   SER A N   1 
ATOM   86   C CA  . SER A 1 55  ? -57.858 39.749 -5.949  1.00 34.63  ? 55   SER A CA  1 
ATOM   87   C C   . SER A 1 55  ? -57.089 39.146 -4.769  1.00 38.86  ? 55   SER A C   1 
ATOM   88   O O   . SER A 1 55  ? -56.388 38.149 -4.935  1.00 38.35  ? 55   SER A O   1 
ATOM   89   C CB  . SER A 1 55  ? -59.304 39.261 -5.931  1.00 37.96  ? 55   SER A CB  1 
ATOM   90   O OG  . SER A 1 55  ? -59.875 39.294 -4.633  1.00 46.68  ? 55   SER A OG  1 
ATOM   91   N N   . GLY A 1 56  ? -57.245 39.758 -3.597  1.00 35.89  ? 56   GLY A N   1 
ATOM   92   C CA  . GLY A 1 56  ? -56.609 39.311 -2.361  1.00 36.01  ? 56   GLY A CA  1 
ATOM   93   C C   . GLY A 1 56  ? -55.781 40.377 -1.675  1.00 40.45  ? 56   GLY A C   1 
ATOM   94   O O   . GLY A 1 56  ? -55.911 41.566 -1.973  1.00 39.85  ? 56   GLY A O   1 
ATOM   95   N N   . THR A 1 57  ? -54.925 39.944 -0.735  1.00 37.71  ? 57   THR A N   1 
ATOM   96   C CA  . THR A 1 57  ? -54.056 40.836 0.038   1.00 37.80  ? 57   THR A CA  1 
ATOM   97   C C   . THR A 1 57  ? -52.916 41.355 -0.845  1.00 42.29  ? 57   THR A C   1 
ATOM   98   O O   . THR A 1 57  ? -52.281 40.565 -1.541  1.00 41.89  ? 57   THR A O   1 
ATOM   99   C CB  . THR A 1 57  ? -53.516 40.100 1.275   1.00 45.59  ? 57   THR A CB  1 
ATOM   100  O OG1 . THR A 1 57  ? -54.602 39.462 1.950   1.00 45.18  ? 57   THR A OG1 1 
ATOM   101  C CG2 . THR A 1 57  ? -52.787 41.027 2.238   1.00 43.91  ? 57   THR A CG2 1 
ATOM   102  N N   . VAL A 1 58  ? -52.642 42.671 -0.792  1.00 39.35  ? 58   VAL A N   1 
ATOM   103  C CA  . VAL A 1 58  ? -51.590 43.296 -1.601  1.00 39.43  ? 58   VAL A CA  1 
ATOM   104  C C   . VAL A 1 58  ? -50.216 43.020 -0.981  1.00 44.17  ? 58   VAL A C   1 
ATOM   105  O O   . VAL A 1 58  ? -50.063 43.108 0.237   1.00 43.71  ? 58   VAL A O   1 
ATOM   106  C CB  . VAL A 1 58  ? -51.833 44.821 -1.788  1.00 43.26  ? 58   VAL A CB  1 
ATOM   107  C CG1 . VAL A 1 58  ? -50.726 45.458 -2.631  1.00 43.03  ? 58   VAL A CG1 1 
ATOM   108  C CG2 . VAL A 1 58  ? -53.198 45.091 -2.419  1.00 43.09  ? 58   VAL A CG2 1 
ATOM   109  N N   . GLU A 1 59  ? -49.222 42.698 -1.831  1.00 41.52  ? 59   GLU A N   1 
ATOM   110  C CA  . GLU A 1 59  ? -47.839 42.432 -1.420  1.00 41.76  ? 59   GLU A CA  1 
ATOM   111  C C   . GLU A 1 59  ? -46.883 43.168 -2.355  1.00 46.56  ? 59   GLU A C   1 
ATOM   112  O O   . GLU A 1 59  ? -47.130 43.204 -3.558  1.00 46.08  ? 59   GLU A O   1 
ATOM   113  C CB  . GLU A 1 59  ? -47.534 40.926 -1.468  1.00 43.16  ? 59   GLU A CB  1 
ATOM   114  C CG  . GLU A 1 59  ? -48.340 40.088 -0.492  1.00 53.49  ? 59   GLU A CG  1 
ATOM   115  C CD  . GLU A 1 59  ? -47.786 38.696 -0.262  1.00 72.30  ? 59   GLU A CD  1 
ATOM   116  O OE1 . GLU A 1 59  ? -47.262 38.093 -1.227  1.00 65.41  ? 59   GLU A OE1 1 
ATOM   117  O OE2 . GLU A 1 59  ? -47.901 38.194 0.879   1.00 65.42  ? 59   GLU A OE2 1 
ATOM   118  N N   . VAL A 1 60  ? -45.782 43.720 -1.811  1.00 43.99  ? 60   VAL A N   1 
ATOM   119  C CA  . VAL A 1 60  ? -44.774 44.452 -2.591  1.00 44.27  ? 60   VAL A CA  1 
ATOM   120  C C   . VAL A 1 60  ? -43.433 43.721 -2.522  1.00 49.29  ? 60   VAL A C   1 
ATOM   121  O O   . VAL A 1 60  ? -43.066 43.212 -1.463  1.00 48.84  ? 60   VAL A O   1 
ATOM   122  C CB  . VAL A 1 60  ? -44.650 45.946 -2.185  1.00 48.17  ? 60   VAL A CB  1 
ATOM   123  C CG1 . VAL A 1 60  ? -45.920 46.708 -2.543  1.00 47.96  ? 60   VAL A CG1 1 
ATOM   124  C CG2 . VAL A 1 60  ? -44.313 46.122 -0.704  1.00 48.00  ? 60   VAL A CG2 1 
ATOM   125  N N   . ARG A 1 61  ? -42.713 43.657 -3.655  1.00 46.79  ? 61   ARG A N   1 
ATOM   126  C CA  . ARG A 1 61  ? -41.433 42.956 -3.736  1.00 47.06  ? 61   ARG A CA  1 
ATOM   127  C C   . ARG A 1 61  ? -40.291 43.816 -3.212  1.00 51.92  ? 61   ARG A C   1 
ATOM   128  O O   . ARG A 1 61  ? -40.220 45.003 -3.529  1.00 51.42  ? 61   ARG A O   1 
ATOM   129  C CB  . ARG A 1 61  ? -41.131 42.552 -5.187  1.00 47.59  ? 61   ARG A CB  1 
ATOM   130  C CG  . ARG A 1 61  ? -40.074 41.449 -5.322  1.00 58.40  ? 61   ARG A CG  1 
ATOM   131  C CD  . ARG A 1 61  ? -38.797 41.923 -5.997  1.00 68.69  ? 61   ARG A CD  1 
ATOM   132  N NE  . ARG A 1 61  ? -39.035 42.446 -7.345  1.00 77.02  ? 61   ARG A NE  1 
ATOM   133  C CZ  . ARG A 1 61  ? -39.234 41.713 -8.441  1.00 91.15  ? 61   ARG A CZ  1 
ATOM   134  N NH1 . ARG A 1 61  ? -39.234 40.383 -8.375  1.00 78.41  ? 61   ARG A NH1 1 
ATOM   135  N NH2 . ARG A 1 61  ? -39.441 42.303 -9.612  1.00 78.11  ? 61   ARG A NH2 1 
ATOM   136  N N   . LEU A 1 62  ? -39.384 43.200 -2.440  1.00 49.36  ? 62   LEU A N   1 
ATOM   137  C CA  . LEU A 1 62  ? -38.192 43.845 -1.888  1.00 49.59  ? 62   LEU A CA  1 
ATOM   138  C C   . LEU A 1 62  ? -36.984 42.969 -2.225  1.00 54.48  ? 62   LEU A C   1 
ATOM   139  O O   . LEU A 1 62  ? -37.156 41.869 -2.755  1.00 54.16  ? 62   LEU A O   1 
ATOM   140  C CB  . LEU A 1 62  ? -38.315 44.000 -0.364  1.00 49.63  ? 62   LEU A CB  1 
ATOM   141  C CG  . LEU A 1 62  ? -39.575 44.702 0.149   1.00 54.29  ? 62   LEU A CG  1 
ATOM   142  C CD1 . LEU A 1 62  ? -39.714 44.532 1.647   1.00 54.42  ? 62   LEU A CD1 1 
ATOM   143  C CD2 . LEU A 1 62  ? -39.563 46.177 -0.204  1.00 56.75  ? 62   LEU A CD2 1 
ATOM   144  N N   . GLU A 1 63  ? -35.769 43.453 -1.929  1.00 51.63  ? 63   GLU A N   1 
ATOM   145  C CA  . GLU A 1 63  ? -34.546 42.682 -2.195  1.00 51.70  ? 63   GLU A CA  1 
ATOM   146  C C   . GLU A 1 63  ? -34.456 41.401 -1.344  1.00 55.89  ? 63   GLU A C   1 
ATOM   147  O O   . GLU A 1 63  ? -33.872 40.419 -1.802  1.00 55.47  ? 63   GLU A O   1 
ATOM   148  C CB  . GLU A 1 63  ? -33.274 43.544 -2.038  1.00 53.12  ? 63   GLU A CB  1 
ATOM   149  C CG  . GLU A 1 63  ? -33.088 44.202 -0.677  1.00 63.88  ? 63   GLU A CG  1 
ATOM   150  C CD  . GLU A 1 63  ? -33.170 45.717 -0.695  1.00 84.22  ? 63   GLU A CD  1 
ATOM   151  O OE1 . GLU A 1 63  ? -34.202 46.251 -1.160  1.00 78.25  ? 63   GLU A OE1 1 
ATOM   152  O OE2 . GLU A 1 63  ? -32.196 46.371 -0.256  1.00 78.42  ? 63   GLU A OE2 1 
ATOM   153  N N   . ALA A 1 64  ? -35.060 41.397 -0.136  1.00 52.71  ? 64   ALA A N   1 
ATOM   154  C CA  . ALA A 1 64  ? -35.054 40.230 0.751   1.00 52.68  ? 64   ALA A CA  1 
ATOM   155  C C   . ALA A 1 64  ? -36.201 39.268 0.420   1.00 56.63  ? 64   ALA A C   1 
ATOM   156  O O   . ALA A 1 64  ? -35.941 38.130 0.028   1.00 56.12  ? 64   ALA A O   1 
ATOM   157  C CB  . ALA A 1 64  ? -35.142 40.672 2.207   1.00 53.44  ? 64   ALA A CB  1 
ATOM   158  N N   . SER A 1 65  ? -37.461 39.720 0.573   1.00 53.29  ? 65   SER A N   1 
ATOM   159  C CA  . SER A 1 65  ? -38.644 38.889 0.306   1.00 53.13  ? 65   SER A CA  1 
ATOM   160  C C   . SER A 1 65  ? -39.915 39.739 0.137   1.00 56.76  ? 65   SER A C   1 
ATOM   161  O O   . SER A 1 65  ? -39.892 40.943 0.391   1.00 56.27  ? 65   SER A O   1 
ATOM   162  C CB  . SER A 1 65  ? -38.852 37.886 1.440   1.00 56.74  ? 65   SER A CB  1 
ATOM   163  O OG  . SER A 1 65  ? -39.941 37.014 1.184   1.00 65.51  ? 65   SER A OG  1 
ATOM   164  N N   . TRP A 1 66  ? -41.024 39.098 -0.276  1.00 53.12  ? 66   TRP A N   1 
ATOM   165  C CA  . TRP A 1 66  ? -42.312 39.776 -0.458  1.00 52.79  ? 66   TRP A CA  1 
ATOM   166  C C   . TRP A 1 66  ? -42.945 40.047 0.907   1.00 56.22  ? 66   TRP A C   1 
ATOM   167  O O   . TRP A 1 66  ? -43.105 39.112 1.691   1.00 55.77  ? 66   TRP A O   1 
ATOM   168  C CB  . TRP A 1 66  ? -43.277 38.919 -1.296  1.00 51.53  ? 66   TRP A CB  1 
ATOM   169  C CG  . TRP A 1 66  ? -42.872 38.741 -2.728  1.00 52.46  ? 66   TRP A CG  1 
ATOM   170  C CD1 . TRP A 1 66  ? -42.012 37.809 -3.228  1.00 55.37  ? 66   TRP A CD1 1 
ATOM   171  C CD2 . TRP A 1 66  ? -43.406 39.442 -3.858  1.00 52.27  ? 66   TRP A CD2 1 
ATOM   172  N NE1 . TRP A 1 66  ? -41.941 37.916 -4.597  1.00 54.81  ? 66   TRP A NE1 1 
ATOM   173  C CE2 . TRP A 1 66  ? -42.788 38.911 -5.011  1.00 56.20  ? 66   TRP A CE2 1 
ATOM   174  C CE3 . TRP A 1 66  ? -44.328 40.489 -4.008  1.00 53.49  ? 66   TRP A CE3 1 
ATOM   175  C CZ2 . TRP A 1 66  ? -43.065 39.390 -6.295  1.00 55.51  ? 66   TRP A CZ2 1 
ATOM   176  C CZ3 . TRP A 1 66  ? -44.596 40.967 -5.280  1.00 54.93  ? 66   TRP A CZ3 1 
ATOM   177  C CH2 . TRP A 1 66  ? -43.984 40.407 -6.407  1.00 55.58  ? 66   TRP A CH2 1 
ATOM   178  N N   . GLU A 1 67  ? -43.309 41.315 1.184   1.00 52.48  ? 67   GLU A N   1 
ATOM   179  C CA  . GLU A 1 67  ? -43.931 41.724 2.448   1.00 52.19  ? 67   GLU A CA  1 
ATOM   180  C C   . GLU A 1 67  ? -45.331 42.300 2.183   1.00 55.64  ? 67   GLU A C   1 
ATOM   181  O O   . GLU A 1 67  ? -45.513 42.956 1.157   1.00 55.11  ? 67   GLU A O   1 
ATOM   182  C CB  . GLU A 1 67  ? -43.058 42.777 3.152   1.00 53.58  ? 67   GLU A CB  1 
ATOM   183  C CG  . GLU A 1 67  ? -41.857 42.191 3.875   1.00 63.74  ? 67   GLU A CG  1 
ATOM   184  C CD  . GLU A 1 67  ? -42.185 41.495 5.182   1.00 82.15  ? 67   GLU A CD  1 
ATOM   185  O OE1 . GLU A 1 67  ? -42.715 42.165 6.097   1.00 74.32  ? 67   GLU A OE1 1 
ATOM   186  O OE2 . GLU A 1 67  ? -41.903 40.280 5.294   1.00 75.48  ? 67   GLU A OE2 1 
ATOM   187  N N   . PRO A 1 68  ? -46.328 42.106 3.081   1.00 52.07  ? 68   PRO A N   1 
ATOM   188  C CA  . PRO A 1 68  ? -47.662 42.677 2.819   1.00 51.86  ? 68   PRO A CA  1 
ATOM   189  C C   . PRO A 1 68  ? -47.700 44.201 2.893   1.00 55.66  ? 68   PRO A C   1 
ATOM   190  O O   . PRO A 1 68  ? -46.950 44.799 3.664   1.00 55.18  ? 68   PRO A O   1 
ATOM   191  C CB  . PRO A 1 68  ? -48.556 42.040 3.897   1.00 53.62  ? 68   PRO A CB  1 
ATOM   192  C CG  . PRO A 1 68  ? -47.739 40.985 4.542   1.00 58.09  ? 68   PRO A CG  1 
ATOM   193  C CD  . PRO A 1 68  ? -46.313 41.365 4.356   1.00 53.67  ? 68   PRO A CD  1 
ATOM   194  N N   . ALA A 1 69  ? -48.583 44.824 2.096   1.00 52.28  ? 69   ALA A N   1 
ATOM   195  C CA  . ALA A 1 69  ? -48.734 46.279 2.080   1.00 52.13  ? 69   ALA A CA  1 
ATOM   196  C C   . ALA A 1 69  ? -49.472 46.746 3.329   1.00 56.22  ? 69   ALA A C   1 
ATOM   197  O O   . ALA A 1 69  ? -50.221 45.976 3.933   1.00 55.78  ? 69   ALA A O   1 
ATOM   198  C CB  . ALA A 1 69  ? -49.487 46.720 0.836   1.00 52.87  ? 69   ALA A CB  1 
ATOM   199  N N   . CYS A 1 70  ? -49.257 48.007 3.711   1.00 53.01  ? 70   CYS A N   1 
ATOM   200  C CA  . CYS A 1 70  ? -49.863 48.590 4.906   1.00 52.94  ? 70   CYS A CA  1 
ATOM   201  C C   . CYS A 1 70  ? -51.343 48.902 4.688   1.00 55.28  ? 70   CYS A C   1 
ATOM   202  O O   . CYS A 1 70  ? -51.692 49.482 3.661   1.00 54.73  ? 70   CYS A O   1 
ATOM   203  C CB  . CYS A 1 70  ? -49.097 49.841 5.325   1.00 53.71  ? 70   CYS A CB  1 
ATOM   204  S SG  . CYS A 1 70  ? -49.712 50.615 6.841   1.00 57.92  ? 70   CYS A SG  1 
ATOM   205  N N   . GLY A 1 71  ? -52.182 48.549 5.669   1.00 50.84  ? 71   GLY A N   1 
ATOM   206  C CA  . GLY A 1 71  ? -53.615 48.839 5.645   1.00 50.13  ? 71   GLY A CA  1 
ATOM   207  C C   . GLY A 1 71  ? -53.862 50.331 5.572   1.00 52.51  ? 71   GLY A C   1 
ATOM   208  O O   . GLY A 1 71  ? -54.693 50.779 4.780   1.00 52.11  ? 71   GLY A O   1 
ATOM   209  N N   A ALA A 1 72  ? -53.121 51.114 6.380   0.50 48.43  ? 72   ALA A N   1 
ATOM   210  N N   B ALA A 1 72  ? -53.121 51.114 6.380   0.50 48.43  ? 72   ALA A N   1 
ATOM   211  C CA  A ALA A 1 72  ? -53.203 52.576 6.353   0.50 47.92  ? 72   ALA A CA  1 
ATOM   212  C CA  B ALA A 1 72  ? -53.203 52.576 6.352   0.50 47.92  ? 72   ALA A CA  1 
ATOM   213  C C   A ALA A 1 72  ? -52.447 53.073 5.117   0.50 50.88  ? 72   ALA A C   1 
ATOM   214  C C   B ALA A 1 72  ? -52.447 53.073 5.117   0.50 50.88  ? 72   ALA A C   1 
ATOM   215  O O   A ALA A 1 72  ? -51.592 52.354 4.597   0.50 50.44  ? 72   ALA A O   1 
ATOM   216  O O   B ALA A 1 72  ? -51.592 52.354 4.597   0.50 50.44  ? 72   ALA A O   1 
ATOM   217  C CB  A ALA A 1 72  ? -52.591 53.166 7.615   0.50 48.67  ? 72   ALA A CB  1 
ATOM   218  C CB  B ALA A 1 72  ? -52.591 53.166 7.614   0.50 48.67  ? 72   ALA A CB  1 
ATOM   219  N N   . LEU A 1 73  ? -52.774 54.287 4.640   1.00 46.73  ? 73   LEU A N   1 
ATOM   220  C CA  . LEU A 1 73  ? -52.171 54.889 3.430   1.00 45.81  ? 73   LEU A CA  1 
ATOM   221  C C   . LEU A 1 73  ? -52.600 54.120 2.153   1.00 47.74  ? 73   LEU A C   1 
ATOM   222  O O   . LEU A 1 73  ? -51.892 54.173 1.145   1.00 47.30  ? 73   LEU A O   1 
ATOM   223  C CB  . LEU A 1 73  ? -50.623 54.995 3.488   1.00 45.87  ? 73   LEU A CB  1 
ATOM   224  C CG  . LEU A 1 73  ? -49.983 55.483 4.791   1.00 50.59  ? 73   LEU A CG  1 
ATOM   225  C CD1 . LEU A 1 73  ? -48.545 55.009 4.899   1.00 50.76  ? 73   LEU A CD1 1 
ATOM   226  C CD2 . LEU A 1 73  ? -50.038 56.985 4.889   1.00 53.12  ? 73   LEU A CD2 1 
ATOM   227  N N   . TRP A 1 74  ? -53.761 53.422 2.196   1.00 42.73  ? 74   TRP A N   1 
ATOM   228  C CA  . TRP A 1 74  ? -54.285 52.637 1.080   1.00 41.79  ? 74   TRP A CA  1 
ATOM   229  C C   . TRP A 1 74  ? -55.594 53.265 0.611   1.00 43.97  ? 74   TRP A C   1 
ATOM   230  O O   . TRP A 1 74  ? -56.679 52.854 1.026   1.00 43.57  ? 74   TRP A O   1 
ATOM   231  C CB  . TRP A 1 74  ? -54.478 51.165 1.497   1.00 40.49  ? 74   TRP A CB  1 
ATOM   232  C CG  . TRP A 1 74  ? -54.968 50.273 0.395   1.00 41.39  ? 74   TRP A CG  1 
ATOM   233  C CD1 . TRP A 1 74  ? -56.183 49.661 0.316   1.00 44.29  ? 74   TRP A CD1 1 
ATOM   234  C CD2 . TRP A 1 74  ? -54.280 49.960 -0.821  1.00 41.19  ? 74   TRP A CD2 1 
ATOM   235  N NE1 . TRP A 1 74  ? -56.281 48.953 -0.859  1.00 43.72  ? 74   TRP A NE1 1 
ATOM   236  C CE2 . TRP A 1 74  ? -55.126 49.123 -1.578  1.00 45.06  ? 74   TRP A CE2 1 
ATOM   237  C CE3 . TRP A 1 74  ? -53.019 50.292 -1.339  1.00 42.42  ? 74   TRP A CE3 1 
ATOM   238  C CZ2 . TRP A 1 74  ? -54.753 48.616 -2.825  1.00 44.31  ? 74   TRP A CZ2 1 
ATOM   239  C CZ3 . TRP A 1 74  ? -52.651 49.786 -2.573  1.00 43.86  ? 74   TRP A CZ3 1 
ATOM   240  C CH2 . TRP A 1 74  ? -53.513 48.959 -3.302  1.00 44.47  ? 74   TRP A CH2 1 
ATOM   241  N N   . ASP A 1 75  ? -55.475 54.294 -0.234  1.00 39.20  ? 75   ASP A N   1 
ATOM   242  C CA  . ASP A 1 75  ? -56.624 54.999 -0.803  1.00 38.38  ? 75   ASP A CA  1 
ATOM   243  C C   . ASP A 1 75  ? -57.016 54.340 -2.130  1.00 40.56  ? 75   ASP A C   1 
ATOM   244  O O   . ASP A 1 75  ? -56.327 53.428 -2.593  1.00 39.98  ? 75   ASP A O   1 
ATOM   245  C CB  . ASP A 1 75  ? -56.328 56.508 -0.973  1.00 40.24  ? 75   ASP A CB  1 
ATOM   246  C CG  . ASP A 1 75  ? -55.195 56.864 -1.919  1.00 50.40  ? 75   ASP A CG  1 
ATOM   247  O OD1 . ASP A 1 75  ? -54.272 56.036 -2.079  1.00 51.01  ? 75   ASP A OD1 1 
ATOM   248  O OD2 . ASP A 1 75  ? -55.205 57.992 -2.455  1.00 56.09  ? 75   ASP A OD2 1 
ATOM   249  N N   . SER A 1 76  ? -58.126 54.789 -2.731  1.00 35.90  ? 76   SER A N   1 
ATOM   250  C CA  . SER A 1 76  ? -58.615 54.237 -3.997  1.00 35.08  ? 76   SER A CA  1 
ATOM   251  C C   . SER A 1 76  ? -57.723 54.568 -5.212  1.00 37.30  ? 76   SER A C   1 
ATOM   252  O O   . SER A 1 76  ? -57.867 53.914 -6.246  1.00 36.88  ? 76   SER A O   1 
ATOM   253  C CB  . SER A 1 76  ? -60.050 54.682 -4.250  1.00 38.68  ? 76   SER A CB  1 
ATOM   254  O OG  . SER A 1 76  ? -60.152 56.095 -4.276  1.00 47.32  ? 76   SER A OG  1 
ATOM   255  N N   . ARG A 1 77  ? -56.815 55.566 -5.103  1.00 32.50  ? 77   ARG A N   1 
ATOM   256  C CA  . ARG A 1 77  ? -55.883 55.907 -6.186  1.00 31.67  ? 77   ARG A CA  1 
ATOM   257  C C   . ARG A 1 77  ? -54.865 54.778 -6.358  1.00 33.91  ? 77   ARG A C   1 
ATOM   258  O O   . ARG A 1 77  ? -54.602 54.355 -7.484  1.00 33.40  ? 77   ARG A O   1 
ATOM   259  C CB  . ARG A 1 77  ? -55.133 57.217 -5.892  1.00 32.16  ? 77   ARG A CB  1 
ATOM   260  C CG  . ARG A 1 77  ? -56.019 58.456 -5.850  1.00 43.81  ? 77   ARG A CG  1 
ATOM   261  C CD  . ARG A 1 77  ? -55.202 59.737 -5.798  1.00 54.03  ? 77   ARG A CD  1 
ATOM   262  N NE  . ARG A 1 77  ? -54.476 59.884 -4.534  1.00 62.75  ? 77   ARG A NE  1 
ATOM   263  C CZ  . ARG A 1 77  ? -53.666 60.898 -4.232  1.00 76.33  ? 77   ARG A CZ  1 
ATOM   264  N NH1 . ARG A 1 77  ? -53.460 61.880 -5.107  1.00 62.58  ? 77   ARG A NH1 1 
ATOM   265  N NH2 . ARG A 1 77  ? -53.054 60.938 -3.055  1.00 63.41  ? 77   ARG A NH2 1 
ATOM   266  N N   . ALA A 1 78  ? -54.297 54.293 -5.236  1.00 29.32  ? 78   ALA A N   1 
ATOM   267  C CA  . ALA A 1 78  ? -53.328 53.193 -5.239  1.00 28.61  ? 78   ALA A CA  1 
ATOM   268  C C   . ALA A 1 78  ? -53.976 51.878 -5.683  1.00 31.24  ? 78   ALA A C   1 
ATOM   269  O O   . ALA A 1 78  ? -53.312 51.064 -6.320  1.00 30.75  ? 78   ALA A O   1 
ATOM   270  C CB  . ALA A 1 78  ? -52.717 53.026 -3.857  1.00 29.33  ? 78   ALA A CB  1 
ATOM   271  N N   . ALA A 1 79  ? -55.268 51.675 -5.355  1.00 26.94  ? 79   ALA A N   1 
ATOM   272  C CA  . ALA A 1 79  ? -56.012 50.476 -5.753  1.00 26.34  ? 79   ALA A CA  1 
ATOM   273  C C   . ALA A 1 79  ? -56.151 50.391 -7.277  1.00 29.20  ? 79   ALA A C   1 
ATOM   274  O O   . ALA A 1 79  ? -55.971 49.313 -7.842  1.00 28.59  ? 79   ALA A O   1 
ATOM   275  C CB  . ALA A 1 79  ? -57.389 50.474 -5.105  1.00 27.08  ? 79   ALA A CB  1 
ATOM   276  N N   . GLU A 1 80  ? -56.458 51.525 -7.937  1.00 25.34  ? 80   GLU A N   1 
ATOM   277  C CA  . GLU A 1 80  ? -56.591 51.596 -9.397  1.00 24.98  ? 80   GLU A CA  1 
ATOM   278  C C   . GLU A 1 80  ? -55.242 51.325 -10.066 1.00 28.75  ? 80   GLU A C   1 
ATOM   279  O O   . GLU A 1 80  ? -55.176 50.527 -11.000 1.00 28.16  ? 80   GLU A O   1 
ATOM   280  C CB  . GLU A 1 80  ? -57.109 52.985 -9.821  1.00 26.29  ? 80   GLU A CB  1 
ATOM   281  C CG  . GLU A 1 80  ? -57.386 53.143 -11.312 1.00 36.30  ? 80   GLU A CG  1 
ATOM   282  C CD  . GLU A 1 80  ? -58.564 52.368 -11.871 1.00 54.95  ? 80   GLU A CD  1 
ATOM   283  O OE1 . GLU A 1 80  ? -59.405 51.888 -11.076 1.00 48.61  ? 80   GLU A OE1 1 
ATOM   284  O OE2 . GLU A 1 80  ? -58.655 52.256 -13.115 1.00 47.78  ? 80   GLU A OE2 1 
ATOM   285  N N   . ALA A 1 81  ? -54.181 52.006 -9.598  1.00 25.48  ? 81   ALA A N   1 
ATOM   286  C CA  . ALA A 1 81  ? -52.823 51.866 -10.137 1.00 25.45  ? 81   ALA A CA  1 
ATOM   287  C C   . ALA A 1 81  ? -52.306 50.424 -10.074 1.00 29.51  ? 81   ALA A C   1 
ATOM   288  O O   . ALA A 1 81  ? -51.687 49.962 -11.033 1.00 29.03  ? 81   ALA A O   1 
ATOM   289  C CB  . ALA A 1 81  ? -51.872 52.788 -9.391  1.00 26.23  ? 81   ALA A CB  1 
ATOM   290  N N   . VAL A 1 82  ? -52.572 49.714 -8.961  1.00 26.21  ? 82   VAL A N   1 
ATOM   291  C CA  . VAL A 1 82  ? -52.149 48.320 -8.786  1.00 26.00  ? 82   VAL A CA  1 
ATOM   292  C C   . VAL A 1 82  ? -52.989 47.382 -9.670  1.00 29.81  ? 82   VAL A C   1 
ATOM   293  O O   . VAL A 1 82  ? -52.414 46.519 -10.329 1.00 29.33  ? 82   VAL A O   1 
ATOM   294  C CB  . VAL A 1 82  ? -52.154 47.901 -7.290  1.00 29.92  ? 82   VAL A CB  1 
ATOM   295  C CG1 . VAL A 1 82  ? -51.984 46.390 -7.127  1.00 29.74  ? 82   VAL A CG1 1 
ATOM   296  C CG2 . VAL A 1 82  ? -51.059 48.640 -6.523  1.00 29.75  ? 82   VAL A CG2 1 
ATOM   297  N N   . CYS A 1 83  ? -54.330 47.549 -9.694  1.00 26.42  ? 83   CYS A N   1 
ATOM   298  C CA  . CYS A 1 83  ? -55.208 46.711 -10.527 1.00 26.25  ? 83   CYS A CA  1 
ATOM   299  C C   . CYS A 1 83  ? -54.888 46.873 -12.020 1.00 29.41  ? 83   CYS A C   1 
ATOM   300  O O   . CYS A 1 83  ? -54.838 45.876 -12.739 1.00 29.00  ? 83   CYS A O   1 
ATOM   301  C CB  . CYS A 1 83  ? -56.684 46.994 -10.245 1.00 26.79  ? 83   CYS A CB  1 
ATOM   302  S SG  . CYS A 1 83  ? -57.293 46.315 -8.678  1.00 30.84  ? 83   CYS A SG  1 
ATOM   303  N N   . ARG A 1 84  ? -54.658 48.118 -12.478 1.00 25.55  ? 84   ARG A N   1 
ATOM   304  C CA  . ARG A 1 84  ? -54.333 48.403 -13.882 1.00 25.16  ? 84   ARG A CA  1 
ATOM   305  C C   . ARG A 1 84  ? -52.939 47.896 -14.275 1.00 29.19  ? 84   ARG A C   1 
ATOM   306  O O   . ARG A 1 84  ? -52.772 47.424 -15.400 1.00 28.61  ? 84   ARG A O   1 
ATOM   307  C CB  . ARG A 1 84  ? -54.447 49.910 -14.184 1.00 24.57  ? 84   ARG A CB  1 
ATOM   308  C CG  . ARG A 1 84  ? -55.874 50.449 -14.136 1.00 31.32  ? 84   ARG A CG  1 
ATOM   309  C CD  . ARG A 1 84  ? -56.639 50.186 -15.421 1.00 36.42  ? 84   ARG A CD  1 
ATOM   310  N NE  . ARG A 1 84  ? -58.075 50.406 -15.247 1.00 41.13  ? 84   ARG A NE  1 
ATOM   311  C CZ  . ARG A 1 84  ? -59.011 50.110 -16.147 1.00 52.83  ? 84   ARG A CZ  1 
ATOM   312  N NH1 . ARG A 1 84  ? -58.675 49.571 -17.317 1.00 39.55  ? 84   ARG A NH1 1 
ATOM   313  N NH2 . ARG A 1 84  ? -60.291 50.340 -15.882 1.00 38.13  ? 84   ARG A NH2 1 
ATOM   314  N N   . ALA A 1 85  ? -51.948 47.986 -13.364 1.00 26.09  ? 85   ALA A N   1 
ATOM   315  C CA  . ALA A 1 85  ? -50.581 47.511 -13.628 1.00 26.05  ? 85   ALA A CA  1 
ATOM   316  C C   . ALA A 1 85  ? -50.532 45.989 -13.773 1.00 30.42  ? 85   ALA A C   1 
ATOM   317  O O   . ALA A 1 85  ? -49.838 45.484 -14.656 1.00 29.99  ? 85   ALA A O   1 
ATOM   318  C CB  . ALA A 1 85  ? -49.645 47.950 -12.516 1.00 26.75  ? 85   ALA A CB  1 
ATOM   319  N N   . LEU A 1 86  ? -51.277 45.263 -12.920 1.00 27.37  ? 86   LEU A N   1 
ATOM   320  C CA  . LEU A 1 86  ? -51.352 43.799 -12.973 1.00 27.44  ? 86   LEU A CA  1 
ATOM   321  C C   . LEU A 1 86  ? -52.085 43.297 -14.229 1.00 32.32  ? 86   LEU A C   1 
ATOM   322  O O   . LEU A 1 86  ? -51.873 42.157 -14.638 1.00 31.83  ? 86   LEU A O   1 
ATOM   323  C CB  . LEU A 1 86  ? -52.065 43.248 -11.725 1.00 27.43  ? 86   LEU A CB  1 
ATOM   324  C CG  . LEU A 1 86  ? -51.344 43.448 -10.391 1.00 31.95  ? 86   LEU A CG  1 
ATOM   325  C CD1 . LEU A 1 86  ? -52.313 43.351 -9.228  1.00 31.94  ? 86   LEU A CD1 1 
ATOM   326  C CD2 . LEU A 1 86  ? -50.232 42.443 -10.212 1.00 34.52  ? 86   LEU A CD2 1 
ATOM   327  N N   . GLY A 1 87  ? -52.940 44.138 -14.810 1.00 29.90  ? 87   GLY A N   1 
ATOM   328  C CA  . GLY A 1 87  ? -53.724 43.805 -15.992 1.00 30.25  ? 87   GLY A CA  1 
ATOM   329  C C   . GLY A 1 87  ? -55.045 43.187 -15.595 1.00 35.47  ? 87   GLY A C   1 
ATOM   330  O O   . GLY A 1 87  ? -55.439 42.156 -16.143 1.00 35.09  ? 87   GLY A O   1 
ATOM   331  N N   . CYS A 1 88  ? -55.729 43.821 -14.623 1.00 33.16  ? 88   CYS A N   1 
ATOM   332  C CA  . CYS A 1 88  ? -57.005 43.363 -14.078 1.00 33.53  ? 88   CYS A CA  1 
ATOM   333  C C   . CYS A 1 88  ? -58.102 44.437 -14.187 1.00 38.01  ? 88   CYS A C   1 
ATOM   334  O O   . CYS A 1 88  ? -59.109 44.345 -13.484 1.00 37.62  ? 88   CYS A O   1 
ATOM   335  C CB  . CYS A 1 88  ? -56.814 42.926 -12.628 1.00 34.06  ? 88   CYS A CB  1 
ATOM   336  S SG  . CYS A 1 88  ? -55.589 41.612 -12.399 1.00 38.12  ? 88   CYS A SG  1 
ATOM   337  N N   . GLY A 1 89  ? -57.916 45.427 -15.058 1.00 35.07  ? 89   GLY A N   1 
ATOM   338  C CA  . GLY A 1 89  ? -58.876 46.511 -15.214 1.00 35.21  ? 89   GLY A CA  1 
ATOM   339  C C   . GLY A 1 89  ? -58.855 47.461 -14.033 1.00 39.88  ? 89   GLY A C   1 
ATOM   340  O O   . GLY A 1 89  ? -57.814 47.636 -13.394 1.00 39.41  ? 89   GLY A O   1 
ATOM   341  N N   . GLY A 1 90  ? -60.001 48.070 -13.746 1.00 37.23  ? 90   GLY A N   1 
ATOM   342  C CA  . GLY A 1 90  ? -60.139 49.017 -12.645 1.00 37.46  ? 90   GLY A CA  1 
ATOM   343  C C   . GLY A 1 90  ? -60.331 48.365 -11.292 1.00 42.23  ? 90   GLY A C   1 
ATOM   344  O O   . GLY A 1 90  ? -60.435 47.141 -11.194 1.00 41.63  ? 90   GLY A O   1 
ATOM   345  N N   . ALA A 1 91  ? -60.378 49.195 -10.237 1.00 39.77  ? 91   ALA A N   1 
ATOM   346  C CA  . ALA A 1 91  ? -60.574 48.749 -8.857  1.00 40.06  ? 91   ALA A CA  1 
ATOM   347  C C   . ALA A 1 91  ? -62.044 48.905 -8.479  1.00 45.35  ? 91   ALA A C   1 
ATOM   348  O O   . ALA A 1 91  ? -62.569 50.015 -8.551  1.00 44.82  ? 91   ALA A O   1 
ATOM   349  C CB  . ALA A 1 91  ? -59.710 49.571 -7.918  1.00 40.78  ? 91   ALA A CB  1 
ATOM   350  N N   . GLU A 1 92  ? -62.707 47.803 -8.084  1.00 43.26  ? 92   GLU A N   1 
ATOM   351  C CA  . GLU A 1 92  ? -64.122 47.828 -7.703  1.00 43.74  ? 92   GLU A CA  1 
ATOM   352  C C   . GLU A 1 92  ? -64.291 48.264 -6.251  1.00 49.25  ? 92   GLU A C   1 
ATOM   353  O O   . GLU A 1 92  ? -65.154 49.093 -5.967  1.00 48.73  ? 92   GLU A O   1 
ATOM   354  C CB  . GLU A 1 92  ? -64.780 46.454 -7.917  1.00 45.12  ? 92   GLU A CB  1 
ATOM   355  C CG  . GLU A 1 92  ? -64.775 45.976 -9.359  1.00 55.80  ? 92   GLU A CG  1 
ATOM   356  C CD  . GLU A 1 92  ? -65.652 46.783 -10.295 1.00 76.11  ? 92   GLU A CD  1 
ATOM   357  O OE1 . GLU A 1 92  ? -66.884 46.817 -10.072 1.00 71.79  ? 92   GLU A OE1 1 
ATOM   358  O OE2 . GLU A 1 92  ? -65.110 47.378 -11.254 1.00 68.98  ? 92   GLU A OE2 1 
ATOM   359  N N   . ALA A 1 93  ? -63.485 47.699 -5.332  1.00 47.30  ? 93   ALA A N   1 
ATOM   360  C CA  . ALA A 1 93  ? -63.566 48.038 -3.910  1.00 47.91  ? 93   ALA A CA  1 
ATOM   361  C C   . ALA A 1 93  ? -62.253 47.769 -3.170  1.00 53.62  ? 93   ALA A C   1 
ATOM   362  O O   . ALA A 1 93  ? -61.598 46.758 -3.427  1.00 53.02  ? 93   ALA A O   1 
ATOM   363  C CB  . ALA A 1 93  ? -64.693 47.255 -3.258  1.00 48.64  ? 93   ALA A CB  1 
ATOM   364  N N   . ALA A 1 94  ? -61.887 48.675 -2.241  1.00 51.78  ? 94   ALA A N   1 
ATOM   365  C CA  . ALA A 1 94  ? -60.680 48.579 -1.418  1.00 52.27  ? 94   ALA A CA  1 
ATOM   366  C C   . ALA A 1 94  ? -61.093 48.346 0.034   1.00 57.68  ? 94   ALA A C   1 
ATOM   367  O O   . ALA A 1 94  ? -61.992 49.031 0.525   1.00 57.19  ? 94   ALA A O   1 
ATOM   368  C CB  . ALA A 1 94  ? -59.879 49.867 -1.523  1.00 53.03  ? 94   ALA A CB  1 
ATOM   369  N N   . SER A 1 95  ? -60.444 47.384 0.715   1.00 55.53  ? 95   SER A N   1 
ATOM   370  C CA  . SER A 1 95  ? -60.738 47.041 2.110   1.00 55.96  ? 95   SER A CA  1 
ATOM   371  C C   . SER A 1 95  ? -59.455 46.936 2.935   1.00 61.02  ? 95   SER A C   1 
ATOM   372  O O   . SER A 1 95  ? -58.358 46.910 2.375   1.00 60.48  ? 95   SER A O   1 
ATOM   373  C CB  . SER A 1 95  ? -61.500 45.722 2.178   1.00 59.77  ? 95   SER A CB  1 
ATOM   374  O OG  . SER A 1 95  ? -62.665 45.752 1.370   1.00 69.26  ? 95   SER A OG  1 
ATOM   375  N N   . GLN A 1 96  ? -59.605 46.883 4.270   1.00 58.65  ? 96   GLN A N   1 
ATOM   376  C CA  . GLN A 1 96  ? -58.488 46.777 5.213   1.00 58.94  ? 96   GLN A CA  1 
ATOM   377  C C   . GLN A 1 96  ? -58.774 45.656 6.225   1.00 63.88  ? 96   GLN A C   1 
ATOM   378  O O   . GLN A 1 96  ? -59.625 45.825 7.100   1.00 63.43  ? 96   GLN A O   1 
ATOM   379  C CB  . GLN A 1 96  ? -58.257 48.117 5.934   1.00 60.31  ? 96   GLN A CB  1 
ATOM   380  C CG  . GLN A 1 96  ? -58.007 49.297 4.991   1.00 76.69  ? 96   GLN A CG  1 
ATOM   381  C CD  . GLN A 1 96  ? -57.784 50.605 5.719   1.00 96.41  ? 96   GLN A CD  1 
ATOM   382  O OE1 . GLN A 1 96  ? -57.440 50.645 6.906   1.00 91.83  ? 96   GLN A OE1 1 
ATOM   383  N NE2 . GLN A 1 96  ? -57.949 51.717 5.012   1.00 88.85  ? 96   GLN A NE2 1 
ATOM   384  N N   . LEU A 1 97  ? -58.078 44.508 6.089   1.00 61.35  ? 97   LEU A N   1 
ATOM   385  C CA  . LEU A 1 97  ? -58.256 43.337 6.957   1.00 61.64  ? 97   LEU A CA  1 
ATOM   386  C C   . LEU A 1 97  ? -57.231 43.328 8.098   1.00 66.64  ? 97   LEU A C   1 
ATOM   387  O O   . LEU A 1 97  ? -56.086 43.731 7.895   1.00 66.23  ? 97   LEU A O   1 
ATOM   388  C CB  . LEU A 1 97  ? -58.117 42.052 6.115   1.00 61.71  ? 97   LEU A CB  1 
ATOM   389  C CG  . LEU A 1 97  ? -58.387 40.713 6.817   1.00 66.44  ? 97   LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 97  ? -59.845 40.588 7.237   1.00 66.62  ? 97   LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 97  ? -58.017 39.551 5.914   1.00 68.84  ? 97   LEU A CD2 1 
ATOM   392  N N   . ALA A 1 98  ? -57.645 42.839 9.286   1.00 64.05  ? 98   ALA A N   1 
ATOM   393  C CA  . ALA A 1 98  ? -56.794 42.731 10.475  1.00 64.24  ? 98   ALA A CA  1 
ATOM   394  C C   . ALA A 1 98  ? -56.409 41.260 10.705  1.00 68.90  ? 98   ALA A C   1 
ATOM   395  O O   . ALA A 1 98  ? -57.298 40.407 10.707  1.00 68.41  ? 98   ALA A O   1 
ATOM   396  C CB  . ALA A 1 98  ? -57.535 43.264 11.691  1.00 64.98  ? 98   ALA A CB  1 
ATOM   397  N N   . PRO A 1 99  ? -55.112 40.931 10.908  1.00 66.11  ? 99   PRO A N   1 
ATOM   398  C CA  . PRO A 1 99  ? -54.743 39.520 11.131  1.00 66.10  ? 99   PRO A CA  1 
ATOM   399  C C   . PRO A 1 99  ? -55.070 39.028 12.547  1.00 70.28  ? 99   PRO A C   1 
ATOM   400  O O   . PRO A 1 99  ? -55.200 39.846 13.460  1.00 69.81  ? 99   PRO A O   1 
ATOM   401  C CB  . PRO A 1 99  ? -53.237 39.508 10.861  1.00 67.84  ? 99   PRO A CB  1 
ATOM   402  C CG  . PRO A 1 99  ? -52.784 40.868 11.238  1.00 72.23  ? 99   PRO A CG  1 
ATOM   403  C CD  . PRO A 1 99  ? -53.924 41.809 10.942  1.00 67.72  ? 99   PRO A CD  1 
ATOM   404  N N   . PRO A 1 100 ? -55.187 37.699 12.763  1.00 67.08  ? 100  PRO A N   1 
ATOM   405  C CA  . PRO A 1 100 ? -55.493 37.201 14.116  1.00 70.63  ? 100  PRO A CA  1 
ATOM   406  C C   . PRO A 1 100 ? -54.275 37.214 15.037  1.00 100.78 ? 100  PRO A C   1 
ATOM   407  O O   . PRO A 1 100 ? -53.240 36.640 14.707  1.00 62.08  ? 100  PRO A O   1 
ATOM   408  C CB  . PRO A 1 100 ? -56.001 35.780 13.858  1.00 71.82  ? 100  PRO A CB  1 
ATOM   409  C CG  . PRO A 1 100 ? -55.302 35.353 12.622  1.00 75.04  ? 100  PRO A CG  1 
ATOM   410  C CD  . PRO A 1 100 ? -55.054 36.589 11.796  1.00 69.74  ? 100  PRO A CD  1 
ATOM   411  N N   . ALA A 1 122 ? -38.925 46.997 13.090  1.00 53.87  ? 122  ALA A N   1 
ATOM   412  C CA  . ALA A 1 122 ? -38.573 46.915 11.675  1.00 53.66  ? 122  ALA A CA  1 
ATOM   413  C C   . ALA A 1 122 ? -39.574 47.689 10.814  1.00 57.30  ? 122  ALA A C   1 
ATOM   414  O O   . ALA A 1 122 ? -39.178 48.601 10.088  1.00 56.88  ? 122  ALA A O   1 
ATOM   415  C CB  . ALA A 1 122 ? -38.517 45.459 11.236  1.00 54.40  ? 122  ALA A CB  1 
ATOM   416  N N   . GLY A 1 123 ? -40.850 47.319 10.909  1.00 53.54  ? 123  GLY A N   1 
ATOM   417  C CA  . GLY A 1 123 ? -41.932 47.957 10.167  1.00 53.09  ? 123  GLY A CA  1 
ATOM   418  C C   . GLY A 1 123 ? -42.184 47.356 8.797   1.00 56.12  ? 123  GLY A C   1 
ATOM   419  O O   . GLY A 1 123 ? -41.282 46.764 8.198   1.00 55.63  ? 123  GLY A O   1 
ATOM   420  N N   . ALA A 1 124 ? -43.421 47.526 8.290   1.00 52.01  ? 124  ALA A N   1 
ATOM   421  C CA  . ALA A 1 124 ? -43.858 47.011 6.986   1.00 51.45  ? 124  ALA A CA  1 
ATOM   422  C C   . ALA A 1 124 ? -43.873 48.126 5.923   1.00 54.24  ? 124  ALA A C   1 
ATOM   423  O O   . ALA A 1 124 ? -44.032 49.296 6.274   1.00 53.78  ? 124  ALA A O   1 
ATOM   424  C CB  . ALA A 1 124 ? -45.249 46.405 7.115   1.00 52.20  ? 124  ALA A CB  1 
ATOM   425  N N   . PRO A 1 125 ? -43.743 47.788 4.619   1.00 49.96  ? 125  PRO A N   1 
ATOM   426  C CA  . PRO A 1 125 ? -43.758 48.838 3.584   1.00 49.39  ? 125  PRO A CA  1 
ATOM   427  C C   . PRO A 1 125 ? -45.156 49.372 3.263   1.00 52.06  ? 125  PRO A C   1 
ATOM   428  O O   . PRO A 1 125 ? -46.154 48.816 3.720   1.00 51.55  ? 125  PRO A O   1 
ATOM   429  C CB  . PRO A 1 125 ? -43.137 48.137 2.374   1.00 51.19  ? 125  PRO A CB  1 
ATOM   430  C CG  . PRO A 1 125 ? -43.512 46.720 2.541   1.00 55.76  ? 125  PRO A CG  1 
ATOM   431  C CD  . PRO A 1 125 ? -43.545 46.452 4.021   1.00 51.41  ? 125  PRO A CD  1 
ATOM   432  N N   . ALA A 1 126 ? -45.216 50.455 2.465   1.00 47.72  ? 126  ALA A N   1 
ATOM   433  C CA  . ALA A 1 126 ? -46.471 51.093 2.050   1.00 47.07  ? 126  ALA A CA  1 
ATOM   434  C C   . ALA A 1 126 ? -46.388 51.608 0.609   1.00 49.61  ? 126  ALA A C   1 
ATOM   435  O O   . ALA A 1 126 ? -45.291 51.802 0.083   1.00 49.05  ? 126  ALA A O   1 
ATOM   436  C CB  . ALA A 1 126 ? -46.805 52.240 2.990   1.00 47.81  ? 126  ALA A CB  1 
ATOM   437  N N   . LEU A 1 127 ? -47.558 51.830 -0.020  1.00 45.23  ? 127  LEU A N   1 
ATOM   438  C CA  . LEU A 1 127 ? -47.667 52.317 -1.400  1.00 44.56  ? 127  LEU A CA  1 
ATOM   439  C C   . LEU A 1 127 ? -48.248 53.734 -1.428  1.00 47.43  ? 127  LEU A C   1 
ATOM   440  O O   . LEU A 1 127 ? -49.438 53.913 -1.165  1.00 46.98  ? 127  LEU A O   1 
ATOM   441  C CB  . LEU A 1 127 ? -48.545 51.365 -2.232  1.00 44.55  ? 127  LEU A CB  1 
ATOM   442  C CG  . LEU A 1 127 ? -47.831 50.122 -2.760  1.00 49.18  ? 127  LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 127 ? -48.809 48.990 -3.011  1.00 49.33  ? 127  LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 127 ? -47.064 50.431 -4.034  1.00 51.52  ? 127  LEU A CD2 1 
ATOM   445  N N   . LEU A 1 128 ? -47.404 54.732 -1.748  1.00 43.22  ? 128  LEU A N   1 
ATOM   446  C CA  . LEU A 1 128 ? -47.793 56.142 -1.833  1.00 42.71  ? 128  LEU A CA  1 
ATOM   447  C C   . LEU A 1 128 ? -47.931 56.526 -3.300  1.00 45.89  ? 128  LEU A C   1 
ATOM   448  O O   . LEU A 1 128 ? -46.998 56.295 -4.066  1.00 45.32  ? 128  LEU A O   1 
ATOM   449  C CB  . LEU A 1 128 ? -46.718 57.024 -1.189  1.00 42.73  ? 128  LEU A CB  1 
ATOM   450  C CG  . LEU A 1 128 ? -46.368 56.717 0.260   1.00 47.36  ? 128  LEU A CG  1 
ATOM   451  C CD1 . LEU A 1 128 ? -45.101 57.435 0.656   1.00 47.53  ? 128  LEU A CD1 1 
ATOM   452  C CD2 . LEU A 1 128 ? -47.511 57.085 1.191   1.00 49.54  ? 128  LEU A CD2 1 
ATOM   453  N N   . CYS A 1 129 ? -49.084 57.105 -3.696  1.00 42.13  ? 129  CYS A N   1 
ATOM   454  C CA  . CYS A 1 129 ? -49.339 57.511 -5.083  1.00 41.79  ? 129  CYS A CA  1 
ATOM   455  C C   . CYS A 1 129 ? -49.904 58.931 -5.138  1.00 45.12  ? 129  CYS A C   1 
ATOM   456  O O   . CYS A 1 129 ? -50.877 59.227 -4.446  1.00 44.62  ? 129  CYS A O   1 
ATOM   457  C CB  . CYS A 1 129 ? -50.278 56.521 -5.771  1.00 42.11  ? 129  CYS A CB  1 
ATOM   458  S SG  . CYS A 1 129 ? -49.773 54.784 -5.635  1.00 46.01  ? 129  CYS A SG  1 
ATOM   459  N N   . SER A 1 130 ? -49.307 59.799 -5.980  1.00 41.38  ? 130  SER A N   1 
ATOM   460  C CA  . SER A 1 130 ? -49.777 61.175 -6.172  1.00 41.07  ? 130  SER A CA  1 
ATOM   461  C C   . SER A 1 130 ? -50.954 61.242 -7.169  1.00 44.27  ? 130  SER A C   1 
ATOM   462  O O   . SER A 1 130 ? -51.630 62.269 -7.234  1.00 43.87  ? 130  SER A O   1 
ATOM   463  C CB  . SER A 1 130 ? -48.637 62.075 -6.641  1.00 44.71  ? 130  SER A CB  1 
ATOM   464  O OG  . SER A 1 130 ? -48.029 61.584 -7.823  1.00 53.18  ? 130  SER A OG  1 
ATOM   465  N N   . GLY A 1 131 ? -51.169 60.167 -7.935  1.00 40.22  ? 131  GLY A N   1 
ATOM   466  C CA  . GLY A 1 131 ? -52.267 60.054 -8.891  1.00 39.75  ? 131  GLY A CA  1 
ATOM   467  C C   . GLY A 1 131 ? -52.760 58.626 -9.034  1.00 42.87  ? 131  GLY A C   1 
ATOM   468  O O   . GLY A 1 131 ? -52.292 57.737 -8.318  1.00 42.47  ? 131  GLY A O   1 
ATOM   469  N N   . ALA A 1 132 ? -53.693 58.386 -9.974  1.00 38.80  ? 132  ALA A N   1 
ATOM   470  C CA  . ALA A 1 132 ? -54.271 57.057 -10.215 1.00 38.37  ? 132  ALA A CA  1 
ATOM   471  C C   . ALA A 1 132 ? -53.548 56.313 -11.356 1.00 41.89  ? 132  ALA A C   1 
ATOM   472  O O   . ALA A 1 132 ? -54.195 55.797 -12.270 1.00 41.39  ? 132  ALA A O   1 
ATOM   473  C CB  . ALA A 1 132 ? -55.757 57.192 -10.523 1.00 39.08  ? 132  ALA A CB  1 
ATOM   474  N N   . GLU A 1 133 ? -52.204 56.249 -11.289 1.00 38.29  ? 133  GLU A N   1 
ATOM   475  C CA  . GLU A 1 133 ? -51.359 55.580 -12.287 1.00 38.00  ? 133  GLU A CA  1 
ATOM   476  C C   . GLU A 1 133 ? -50.167 54.922 -11.597 1.00 42.03  ? 133  GLU A C   1 
ATOM   477  O O   . GLU A 1 133 ? -49.715 55.416 -10.565 1.00 41.60  ? 133  GLU A O   1 
ATOM   478  C CB  . GLU A 1 133 ? -50.838 56.591 -13.322 1.00 39.30  ? 133  GLU A CB  1 
ATOM   479  C CG  . GLU A 1 133 ? -51.915 57.220 -14.185 1.00 49.21  ? 133  GLU A CG  1 
ATOM   480  C CD  . GLU A 1 133 ? -51.365 58.076 -15.307 1.00 67.44  ? 133  GLU A CD  1 
ATOM   481  O OE1 . GLU A 1 133 ? -50.860 57.502 -16.298 1.00 60.48  ? 133  GLU A OE1 1 
ATOM   482  O OE2 . GLU A 1 133 ? -51.429 59.321 -15.191 1.00 60.32  ? 133  GLU A OE2 1 
ATOM   483  N N   . TRP A 1 134 ? -49.639 53.832 -12.178 1.00 38.80  ? 134  TRP A N   1 
ATOM   484  C CA  . TRP A 1 134 ? -48.486 53.124 -11.612 1.00 38.69  ? 134  TRP A CA  1 
ATOM   485  C C   . TRP A 1 134 ? -47.188 53.933 -11.731 1.00 42.59  ? 134  TRP A C   1 
ATOM   486  O O   . TRP A 1 134 ? -46.348 53.848 -10.834 1.00 42.08  ? 134  TRP A O   1 
ATOM   487  C CB  . TRP A 1 134 ? -48.328 51.729 -12.238 1.00 37.49  ? 134  TRP A CB  1 
ATOM   488  C CG  . TRP A 1 134 ? -47.160 50.965 -11.692 1.00 38.51  ? 134  TRP A CG  1 
ATOM   489  C CD1 . TRP A 1 134 ? -45.991 50.689 -12.339 1.00 41.45  ? 134  TRP A CD1 1 
ATOM   490  C CD2 . TRP A 1 134 ? -46.961 50.582 -10.327 1.00 38.36  ? 134  TRP A CD2 1 
ATOM   491  N NE1 . TRP A 1 134 ? -45.108 50.079 -11.480 1.00 40.94  ? 134  TRP A NE1 1 
ATOM   492  C CE2 . TRP A 1 134 ? -45.677 50.003 -10.236 1.00 42.34  ? 134  TRP A CE2 1 
ATOM   493  C CE3 . TRP A 1 134 ? -47.762 50.631 -9.176  1.00 39.61  ? 134  TRP A CE3 1 
ATOM   494  C CZ2 . TRP A 1 134 ? -45.179 49.475 -9.042  1.00 41.67  ? 134  TRP A CZ2 1 
ATOM   495  C CZ3 . TRP A 1 134 ? -47.265 50.111 -7.994  1.00 41.11  ? 134  TRP A CZ3 1 
ATOM   496  C CH2 . TRP A 1 134 ? -45.982 49.556 -7.931  1.00 41.76  ? 134  TRP A CH2 1 
ATOM   497  N N   . ARG A 1 135 ? -47.028 54.732 -12.804 1.00 39.28  ? 135  ARG A N   1 
ATOM   498  C CA  . ARG A 1 135 ? -45.839 55.580 -12.977 1.00 39.16  ? 135  ARG A CA  1 
ATOM   499  C C   . ARG A 1 135 ? -45.703 56.621 -11.847 1.00 43.32  ? 135  ARG A C   1 
ATOM   500  O O   . ARG A 1 135 ? -44.583 56.980 -11.484 1.00 42.89  ? 135  ARG A O   1 
ATOM   501  C CB  . ARG A 1 135 ? -45.845 56.272 -14.358 1.00 39.30  ? 135  ARG A CB  1 
ATOM   502  C CG  . ARG A 1 135 ? -46.895 57.372 -14.531 1.00 48.91  ? 135  ARG A CG  1 
ATOM   503  C CD  . ARG A 1 135 ? -46.975 57.845 -15.970 1.00 57.57  ? 135  ARG A CD  1 
ATOM   504  N NE  . ARG A 1 135 ? -47.891 58.978 -16.128 1.00 65.16  ? 135  ARG A NE  1 
ATOM   505  C CZ  . ARG A 1 135 ? -47.617 60.248 -15.826 1.00 79.22  ? 135  ARG A CZ  1 
ATOM   506  N NH1 . ARG A 1 135 ? -46.429 60.583 -15.327 1.00 66.66  ? 135  ARG A NH1 1 
ATOM   507  N NH2 . ARG A 1 135 ? -48.531 61.193 -16.014 1.00 65.98  ? 135  ARG A NH2 1 
ATOM   508  N N   . LEU A 1 136 ? -46.841 57.080 -11.288 1.00 40.13  ? 136  LEU A N   1 
ATOM   509  C CA  . LEU A 1 136 ? -46.880 58.064 -10.202 1.00 40.06  ? 136  LEU A CA  1 
ATOM   510  C C   . LEU A 1 136 ? -46.775 57.433 -8.795  1.00 44.48  ? 136  LEU A C   1 
ATOM   511  O O   . LEU A 1 136 ? -46.700 58.179 -7.819  1.00 43.96  ? 136  LEU A O   1 
ATOM   512  C CB  . LEU A 1 136 ? -48.174 58.891 -10.304 1.00 40.06  ? 136  LEU A CB  1 
ATOM   513  C CG  . LEU A 1 136 ? -48.419 59.607 -11.638 1.00 44.71  ? 136  LEU A CG  1 
ATOM   514  C CD1 . LEU A 1 136 ? -49.803 60.212 -11.680 1.00 44.89  ? 136  LEU A CD1 1 
ATOM   515  C CD2 . LEU A 1 136 ? -47.377 60.681 -11.891 1.00 47.07  ? 136  LEU A CD2 1 
ATOM   516  N N   . CYS A 1 137 ? -46.763 56.084 -8.682  1.00 41.67  ? 137  CYS A N   1 
ATOM   517  C CA  . CYS A 1 137 ? -46.658 55.386 -7.394  1.00 41.80  ? 137  CYS A CA  1 
ATOM   518  C C   . CYS A 1 137 ? -45.201 55.176 -6.983  1.00 46.39  ? 137  CYS A C   1 
ATOM   519  O O   . CYS A 1 137 ? -44.323 55.073 -7.840  1.00 45.89  ? 137  CYS A O   1 
ATOM   520  C CB  . CYS A 1 137 ? -47.420 54.063 -7.422  1.00 42.10  ? 137  CYS A CB  1 
ATOM   521  S SG  . CYS A 1 137 ? -49.220 54.244 -7.516  1.00 45.99  ? 137  CYS A SG  1 
ATOM   522  N N   . GLU A 1 138 ? -44.958 55.099 -5.663  1.00 43.66  ? 138  GLU A N   1 
ATOM   523  C CA  . GLU A 1 138 ? -43.627 54.887 -5.086  1.00 43.86  ? 138  GLU A CA  1 
ATOM   524  C C   . GLU A 1 138 ? -43.735 53.981 -3.857  1.00 48.37  ? 138  GLU A C   1 
ATOM   525  O O   . GLU A 1 138 ? -44.672 54.129 -3.072  1.00 47.90  ? 138  GLU A O   1 
ATOM   526  C CB  . GLU A 1 138 ? -42.994 56.234 -4.691  1.00 45.30  ? 138  GLU A CB  1 
ATOM   527  C CG  . GLU A 1 138 ? -41.485 56.175 -4.495  1.00 56.44  ? 138  GLU A CG  1 
ATOM   528  C CD  . GLU A 1 138 ? -40.879 57.367 -3.778  1.00 77.08  ? 138  GLU A CD  1 
ATOM   529  O OE1 . GLU A 1 138 ? -41.487 58.462 -3.809  1.00 70.95  ? 138  GLU A OE1 1 
ATOM   530  O OE2 . GLU A 1 138 ? -39.793 57.202 -3.177  1.00 70.85  ? 138  GLU A OE2 1 
ATOM   531  N N   . VAL A 1 139 ? -42.770 53.060 -3.687  1.00 45.60  ? 139  VAL A N   1 
ATOM   532  C CA  . VAL A 1 139 ? -42.728 52.130 -2.555  1.00 45.78  ? 139  VAL A CA  1 
ATOM   533  C C   . VAL A 1 139 ? -41.766 52.681 -1.499  1.00 50.53  ? 139  VAL A C   1 
ATOM   534  O O   . VAL A 1 139 ? -40.669 53.121 -1.846  1.00 50.02  ? 139  VAL A O   1 
ATOM   535  C CB  . VAL A 1 139 ? -42.293 50.709 -3.004  1.00 49.68  ? 139  VAL A CB  1 
ATOM   536  C CG1 . VAL A 1 139 ? -42.410 49.708 -1.853  1.00 49.49  ? 139  VAL A CG1 1 
ATOM   537  C CG2 . VAL A 1 139 ? -43.104 50.236 -4.209  1.00 49.50  ? 139  VAL A CG2 1 
ATOM   538  N N   . VAL A 1 140 ? -42.165 52.624 -0.214  1.00 47.90  ? 140  VAL A N   1 
ATOM   539  C CA  . VAL A 1 140 ? -41.335 53.069 0.915   1.00 48.17  ? 140  VAL A CA  1 
ATOM   540  C C   . VAL A 1 140 ? -40.966 51.839 1.743   1.00 53.29  ? 140  VAL A C   1 
ATOM   541  O O   . VAL A 1 140 ? -41.790 50.938 1.893   1.00 52.89  ? 140  VAL A O   1 
ATOM   542  C CB  . VAL A 1 140 ? -41.980 54.196 1.765   1.00 52.00  ? 140  VAL A CB  1 
ATOM   543  C CG1 . VAL A 1 140 ? -42.116 55.473 0.947   1.00 51.79  ? 140  VAL A CG1 1 
ATOM   544  C CG2 . VAL A 1 140 ? -43.329 53.787 2.355   1.00 51.79  ? 140  VAL A CG2 1 
ATOM   545  N N   . GLU A 1 141 ? -39.720 51.782 2.242   1.00 50.76  ? 141  GLU A N   1 
ATOM   546  C CA  . GLU A 1 141 ? -39.230 50.625 2.996   1.00 51.01  ? 141  GLU A CA  1 
ATOM   547  C C   . GLU A 1 141 ? -39.913 50.442 4.349   1.00 55.62  ? 141  GLU A C   1 
ATOM   548  O O   . GLU A 1 141 ? -40.440 49.361 4.611   1.00 55.28  ? 141  GLU A O   1 
ATOM   549  C CB  . GLU A 1 141 ? -37.701 50.694 3.183   1.00 52.45  ? 141  GLU A CB  1 
ATOM   550  C CG  . GLU A 1 141 ? -36.909 50.485 1.900   1.00 63.38  ? 141  GLU A CG  1 
ATOM   551  C CD  . GLU A 1 141 ? -36.901 49.078 1.327   1.00 83.62  ? 141  GLU A CD  1 
ATOM   552  O OE1 . GLU A 1 141 ? -37.332 48.134 2.028   1.00 77.05  ? 141  GLU A OE1 1 
ATOM   553  O OE2 . GLU A 1 141 ? -36.445 48.919 0.172   1.00 77.78  ? 141  GLU A OE2 1 
ATOM   554  N N   . HIS A 1 142 ? -39.878 51.471 5.217   1.00 52.64  ? 142  HIS A N   1 
ATOM   555  C CA  . HIS A 1 142 ? -40.460 51.389 6.562   1.00 52.76  ? 142  HIS A CA  1 
ATOM   556  C C   . HIS A 1 142 ? -41.256 52.651 6.914   1.00 56.83  ? 142  HIS A C   1 
ATOM   557  O O   . HIS A 1 142 ? -40.666 53.693 7.203   1.00 56.37  ? 142  HIS A O   1 
ATOM   558  C CB  . HIS A 1 142 ? -39.356 51.139 7.612   1.00 53.66  ? 142  HIS A CB  1 
ATOM   559  C CG  . HIS A 1 142 ? -38.415 50.032 7.250   1.00 57.14  ? 142  HIS A CG  1 
ATOM   560  N ND1 . HIS A 1 142 ? -38.784 48.705 7.359   1.00 58.94  ? 142  HIS A ND1 1 
ATOM   561  C CD2 . HIS A 1 142 ? -37.157 50.095 6.758   1.00 58.91  ? 142  HIS A CD2 1 
ATOM   562  C CE1 . HIS A 1 142 ? -37.741 48.002 6.948   1.00 58.36  ? 142  HIS A CE1 1 
ATOM   563  N NE2 . HIS A 1 142 ? -36.736 48.797 6.576   1.00 58.69  ? 142  HIS A NE2 1 
ATOM   564  N N   . ALA A 1 143 ? -42.597 52.557 6.867   1.00 53.58  ? 143  ALA A N   1 
ATOM   565  C CA  . ALA A 1 143 ? -43.490 53.667 7.221   1.00 53.49  ? 143  ALA A CA  1 
ATOM   566  C C   . ALA A 1 143 ? -44.826 53.180 7.825   1.00 57.34  ? 143  ALA A C   1 
ATOM   567  O O   . ALA A 1 143 ? -45.822 53.900 7.747   1.00 56.82  ? 143  ALA A O   1 
ATOM   568  C CB  . ALA A 1 143 ? -43.750 54.526 5.990   1.00 54.26  ? 143  ALA A CB  1 
ATOM   569  N N   . CYS A 1 144 ? -44.830 51.997 8.474   1.00 54.05  ? 144  CYS A N   1 
ATOM   570  C CA  . CYS A 1 144 ? -46.028 51.399 9.076   1.00 53.96  ? 144  CYS A CA  1 
ATOM   571  C C   . CYS A 1 144 ? -45.628 50.344 10.109  1.00 58.30  ? 144  CYS A C   1 
ATOM   572  O O   . CYS A 1 144 ? -44.542 49.774 10.009  1.00 57.85  ? 144  CYS A O   1 
ATOM   573  C CB  . CYS A 1 144 ? -46.918 50.788 7.995   1.00 54.18  ? 144  CYS A CB  1 
ATOM   574  S SG  . CYS A 1 144 ? -48.224 51.886 7.386   1.00 58.01  ? 144  CYS A SG  1 
ATOM   575  N N   . ARG A 1 145 ? -46.517 50.065 11.078  1.00 55.24  ? 145  ARG A N   1 
ATOM   576  C CA  . ARG A 1 145 ? -46.273 49.027 12.088  1.00 55.23  ? 145  ARG A CA  1 
ATOM   577  C C   . ARG A 1 145 ? -46.323 47.648 11.414  1.00 59.44  ? 145  ARG A C   1 
ATOM   578  O O   . ARG A 1 145 ? -47.142 47.441 10.518  1.00 59.08  ? 145  ARG A O   1 
ATOM   579  C CB  . ARG A 1 145 ? -47.277 49.125 13.258  1.00 55.62  ? 145  ARG A CB  1 
ATOM   580  C CG  . ARG A 1 145 ? -48.737 48.820 12.900  1.00 66.45  ? 145  ARG A CG  1 
ATOM   581  C CD  . ARG A 1 145 ? -49.715 49.642 13.728  1.00 76.40  ? 145  ARG A CD  1 
ATOM   582  N NE  . ARG A 1 145 ? -51.092 49.538 13.237  1.00 84.76  ? 145  ARG A NE  1 
ATOM   583  C CZ  . ARG A 1 145 ? -51.585 50.175 12.174  1.00 98.63  ? 145  ARG A CZ  1 
ATOM   584  N NH1 . ARG A 1 145 ? -50.810 50.976 11.445  1.00 86.17  ? 145  ARG A NH1 1 
ATOM   585  N NH2 . ARG A 1 145 ? -52.854 50.008 11.824  1.00 84.66  ? 145  ARG A NH2 1 
ATOM   586  N N   . SER A 1 146 ? -45.415 46.732 11.803  1.00 56.13  ? 146  SER A N   1 
ATOM   587  C CA  . SER A 1 146 ? -45.325 45.401 11.190  1.00 55.93  ? 146  SER A CA  1 
ATOM   588  C C   . SER A 1 146 ? -46.590 44.562 11.405  1.00 59.50  ? 146  SER A C   1 
ATOM   589  O O   . SER A 1 146 ? -47.303 44.304 10.436  1.00 59.09  ? 146  SER A O   1 
ATOM   590  C CB  . SER A 1 146 ? -44.086 44.657 11.682  1.00 59.62  ? 146  SER A CB  1 
ATOM   591  O OG  . SER A 1 146 ? -43.916 43.426 10.998  1.00 68.38  ? 146  SER A OG  1 
ATOM   592  N N   . ASP A 1 147 ? -46.888 44.166 12.657  1.00 55.82  ? 147  ASP A N   1 
ATOM   593  C CA  . ASP A 1 147 ? -48.080 43.370 12.954  1.00 55.48  ? 147  ASP A CA  1 
ATOM   594  C C   . ASP A 1 147 ? -49.288 44.300 13.132  1.00 58.32  ? 147  ASP A C   1 
ATOM   595  O O   . ASP A 1 147 ? -49.683 44.620 14.254  1.00 57.77  ? 147  ASP A O   1 
ATOM   596  C CB  . ASP A 1 147 ? -47.858 42.471 14.185  1.00 57.48  ? 147  ASP A CB  1 
ATOM   597  C CG  . ASP A 1 147 ? -48.962 41.450 14.378  1.00 68.17  ? 147  ASP A CG  1 
ATOM   598  O OD1 . ASP A 1 147 ? -49.068 40.526 13.542  1.00 68.66  ? 147  ASP A OD1 1 
ATOM   599  O OD2 . ASP A 1 147 ? -49.726 41.581 15.359  1.00 74.34  ? 147  ASP A OD2 1 
ATOM   600  N N   . GLY A 1 148 ? -49.833 44.739 12.001  1.00 54.16  ? 148  GLY A N   1 
ATOM   601  C CA  . GLY A 1 148 ? -50.994 45.620 11.937  1.00 53.55  ? 148  GLY A CA  1 
ATOM   602  C C   . GLY A 1 148 ? -51.951 45.199 10.841  1.00 56.19  ? 148  GLY A C   1 
ATOM   603  O O   . GLY A 1 148 ? -51.778 44.132 10.243  1.00 55.79  ? 148  GLY A O   1 
ATOM   604  N N   . ARG A 1 149 ? -52.972 46.029 10.571  1.00 51.60  ? 149  ARG A N   1 
ATOM   605  C CA  . ARG A 1 149 ? -53.960 45.723 9.528   1.00 50.80  ? 149  ARG A CA  1 
ATOM   606  C C   . ARG A 1 149 ? -53.348 45.838 8.125   1.00 52.74  ? 149  ARG A C   1 
ATOM   607  O O   . ARG A 1 149 ? -52.602 46.779 7.856   1.00 52.19  ? 149  ARG A O   1 
ATOM   608  C CB  . ARG A 1 149 ? -55.257 46.556 9.674   1.00 51.40  ? 149  ARG A CB  1 
ATOM   609  C CG  . ARG A 1 149 ? -55.110 48.079 9.631   1.00 63.10  ? 149  ARG A CG  1 
ATOM   610  C CD  . ARG A 1 149 ? -56.466 48.762 9.626   1.00 74.64  ? 149  ARG A CD  1 
ATOM   611  N NE  . ARG A 1 149 ? -56.361 50.209 9.416   1.00 84.62  ? 149  ARG A NE  1 
ATOM   612  C CZ  . ARG A 1 149 ? -56.079 51.115 10.354  1.00 99.47  ? 149  ARG A CZ  1 
ATOM   613  N NH1 . ARG A 1 149 ? -55.857 50.740 11.611  1.00 87.26  ? 149  ARG A NH1 1 
ATOM   614  N NH2 . ARG A 1 149 ? -56.014 52.404 10.041  1.00 86.30  ? 149  ARG A NH2 1 
ATOM   615  N N   . ARG A 1 150 ? -53.621 44.840 7.260   1.00 47.89  ? 150  ARG A N   1 
ATOM   616  C CA  . ARG A 1 150 ? -53.096 44.763 5.891   1.00 46.96  ? 150  ARG A CA  1 
ATOM   617  C C   . ARG A 1 150 ? -54.082 45.365 4.890   1.00 48.99  ? 150  ARG A C   1 
ATOM   618  O O   . ARG A 1 150 ? -55.233 45.618 5.241   1.00 48.54  ? 150  ARG A O   1 
ATOM   619  C CB  . ARG A 1 150 ? -52.821 43.299 5.511   1.00 47.15  ? 150  ARG A CB  1 
ATOM   620  C CG  . ARG A 1 150 ? -51.841 42.585 6.434   1.00 57.53  ? 150  ARG A CG  1 
ATOM   621  C CD  . ARG A 1 150 ? -51.667 41.134 6.029   1.00 67.48  ? 150  ARG A CD  1 
ATOM   622  N NE  . ARG A 1 150 ? -50.763 40.411 6.925   1.00 76.29  ? 150  ARG A NE  1 
ATOM   623  C CZ  . ARG A 1 150 ? -50.450 39.121 6.811   1.00 90.83  ? 150  ARG A CZ  1 
ATOM   624  N NH1 . ARG A 1 150 ? -50.968 38.386 5.830   1.00 78.78  ? 150  ARG A NH1 1 
ATOM   625  N NH2 . ARG A 1 150 ? -49.616 38.556 7.675   1.00 77.44  ? 150  ARG A NH2 1 
ATOM   626  N N   . ALA A 1 151 ? -53.631 45.567 3.636   1.00 44.09  ? 151  ALA A N   1 
ATOM   627  C CA  . ALA A 1 151 ? -54.454 46.128 2.558   1.00 43.17  ? 151  ALA A CA  1 
ATOM   628  C C   . ALA A 1 151 ? -54.978 45.021 1.645   1.00 45.12  ? 151  ALA A C   1 
ATOM   629  O O   . ALA A 1 151 ? -54.201 44.163 1.229   1.00 44.61  ? 151  ALA A O   1 
ATOM   630  C CB  . ALA A 1 151 ? -53.638 47.114 1.739   1.00 43.90  ? 151  ALA A CB  1 
ATOM   631  N N   . ARG A 1 152 ? -56.285 45.058 1.320   1.00 40.24  ? 152  ARG A N   1 
ATOM   632  C CA  . ARG A 1 152 ? -56.942 44.085 0.441   1.00 39.35  ? 152  ARG A CA  1 
ATOM   633  C C   . ARG A 1 152 ? -57.675 44.826 -0.683  1.00 41.25  ? 152  ARG A C   1 
ATOM   634  O O   . ARG A 1 152 ? -58.081 45.974 -0.493  1.00 40.91  ? 152  ARG A O   1 
ATOM   635  C CB  . ARG A 1 152 ? -57.923 43.216 1.246   1.00 39.91  ? 152  ARG A CB  1 
ATOM   636  C CG  . ARG A 1 152 ? -58.138 41.840 0.637   1.00 51.48  ? 152  ARG A CG  1 
ATOM   637  C CD  . ARG A 1 152 ? -59.132 41.006 1.419   1.00 62.54  ? 152  ARG A CD  1 
ATOM   638  N NE  . ARG A 1 152 ? -59.446 39.751 0.731   1.00 71.33  ? 152  ARG A NE  1 
ATOM   639  C CZ  . ARG A 1 152 ? -60.284 39.621 -0.298  1.00 85.57  ? 152  ARG A CZ  1 
ATOM   640  N NH1 . ARG A 1 152 ? -60.921 40.681 -0.791  1.00 72.12  ? 152  ARG A NH1 1 
ATOM   641  N NH2 . ARG A 1 152 ? -60.489 38.429 -0.847  1.00 73.25  ? 152  ARG A NH2 1 
ATOM   642  N N   . VAL A 1 153 ? -57.825 44.185 -1.856  1.00 36.14  ? 153  VAL A N   1 
ATOM   643  C CA  . VAL A 1 153 ? -58.483 44.806 -3.010  1.00 35.18  ? 153  VAL A CA  1 
ATOM   644  C C   . VAL A 1 153 ? -59.105 43.767 -3.953  1.00 37.05  ? 153  VAL A C   1 
ATOM   645  O O   . VAL A 1 153 ? -58.595 42.655 -4.069  1.00 36.57  ? 153  VAL A O   1 
ATOM   646  C CB  . VAL A 1 153 ? -57.482 45.734 -3.754  1.00 39.08  ? 153  VAL A CB  1 
ATOM   647  C CG1 . VAL A 1 153 ? -56.321 44.945 -4.364  1.00 38.88  ? 153  VAL A CG1 1 
ATOM   648  C CG2 . VAL A 1 153 ? -58.178 46.581 -4.816  1.00 38.85  ? 153  VAL A CG2 1 
ATOM   649  N N   . THR A 1 154 ? -60.200 44.156 -4.631  1.00 32.10  ? 154  THR A N   1 
ATOM   650  C CA  . THR A 1 154 ? -60.916 43.337 -5.611  1.00 31.20  ? 154  THR A CA  1 
ATOM   651  C C   . THR A 1 154 ? -61.003 44.137 -6.912  1.00 33.11  ? 154  THR A C   1 
ATOM   652  O O   . THR A 1 154 ? -61.694 45.155 -6.952  1.00 32.58  ? 154  THR A O   1 
ATOM   653  C CB  . THR A 1 154 ? -62.312 42.975 -5.091  1.00 39.92  ? 154  THR A CB  1 
ATOM   654  O OG1 . THR A 1 154 ? -62.974 44.161 -4.648  1.00 40.98  ? 154  THR A OG1 1 
ATOM   655  C CG2 . THR A 1 154 ? -62.265 41.966 -3.964  1.00 38.47  ? 154  THR A CG2 1 
ATOM   656  N N   . CYS A 1 155 ? -60.285 43.700 -7.960  1.00 28.20  ? 155  CYS A N   1 
ATOM   657  C CA  . CYS A 1 155 ? -60.270 44.393 -9.252  1.00 27.29  ? 155  CYS A CA  1 
ATOM   658  C C   . CYS A 1 155 ? -61.500 44.023 -10.096 1.00 30.54  ? 155  CYS A C   1 
ATOM   659  O O   . CYS A 1 155 ? -62.288 43.165 -9.698  1.00 29.95  ? 155  CYS A O   1 
ATOM   660  C CB  . CYS A 1 155 ? -58.970 44.104 -9.999  1.00 27.26  ? 155  CYS A CB  1 
ATOM   661  S SG  . CYS A 1 155 ? -57.471 44.314 -9.000  1.00 30.91  ? 155  CYS A SG  1 
ATOM   662  N N   . ALA A 1 156 ? -61.665 44.681 -11.258 1.00 26.74  ? 156  ALA A N   1 
ATOM   663  C CA  . ALA A 1 156 ? -62.796 44.442 -12.165 1.00 26.32  ? 156  ALA A CA  1 
ATOM   664  C C   . ALA A 1 156 ? -62.749 43.059 -12.818 1.00 29.45  ? 156  ALA A C   1 
ATOM   665  O O   . ALA A 1 156 ? -63.799 42.440 -12.994 1.00 29.05  ? 156  ALA A O   1 
ATOM   666  C CB  . ALA A 1 156 ? -62.845 45.520 -13.239 1.00 27.09  ? 156  ALA A CB  1 
ATOM   667  N N   . GLU A 1 157 ? -61.542 42.563 -13.152 1.00 25.50  ? 157  GLU A N   1 
ATOM   668  C CA  . GLU A 1 157 ? -61.365 41.238 -13.762 1.00 25.15  ? 157  GLU A CA  1 
ATOM   669  C C   . GLU A 1 157 ? -61.399 40.084 -12.739 1.00 28.68  ? 157  GLU A C   1 
ATOM   670  O O   . GLU A 1 157 ? -61.239 38.931 -13.142 1.00 28.16  ? 157  GLU A O   1 
ATOM   671  C CB  . GLU A 1 157 ? -60.057 41.182 -14.571 1.00 26.47  ? 157  GLU A CB  1 
ATOM   672  C CG  . GLU A 1 157 ? -60.080 42.027 -15.831 1.00 36.03  ? 157  GLU A CG  1 
ATOM   673  C CD  . GLU A 1 157 ? -60.862 41.407 -16.971 1.00 53.82  ? 157  GLU A CD  1 
ATOM   674  O OE1 . GLU A 1 157 ? -60.348 40.447 -17.589 1.00 46.97  ? 157  GLU A OE1 1 
ATOM   675  O OE2 . GLU A 1 157 ? -61.999 41.861 -17.229 1.00 46.47  ? 157  GLU A OE2 1 
ATOM   676  N N   . ASN A 1 158 ? -61.599 40.375 -11.432 1.00 25.09  ? 158  ASN A N   1 
ATOM   677  C CA  . ASN A 1 158 ? -61.675 39.344 -10.396 1.00 24.81  ? 158  ASN A CA  1 
ATOM   678  C C   . ASN A 1 158 ? -62.818 38.373 -10.679 1.00 28.22  ? 158  ASN A C   1 
ATOM   679  O O   . ASN A 1 158 ? -63.930 38.802 -10.994 1.00 27.88  ? 158  ASN A O   1 
ATOM   680  C CB  . ASN A 1 158 ? -61.888 39.970 -9.009  1.00 25.86  ? 158  ASN A CB  1 
ATOM   681  C CG  . ASN A 1 158 ? -62.131 38.955 -7.909  1.00 48.38  ? 158  ASN A CG  1 
ATOM   682  O OD1 . ASN A 1 158 ? -61.479 37.908 -7.843  1.00 42.12  ? 158  ASN A OD1 1 
ATOM   683  N ND2 . ASN A 1 158 ? -63.066 39.239 -7.009  1.00 40.49  ? 158  ASN A ND2 1 
ATOM   684  N N   . ARG A 1 159 ? -62.533 37.071 -10.555 1.00 24.17  ? 159  ARG A N   1 
ATOM   685  C CA  . ARG A 1 159 ? -63.506 36.003 -10.737 1.00 23.58  ? 159  ARG A CA  1 
ATOM   686  C C   . ARG A 1 159 ? -63.532 35.142 -9.481  1.00 26.94  ? 159  ARG A C   1 
ATOM   687  O O   . ARG A 1 159 ? -62.611 35.196 -8.665  1.00 26.47  ? 159  ARG A O   1 
ATOM   688  C CB  . ARG A 1 159 ? -63.164 35.161 -11.972 1.00 23.43  ? 159  ARG A CB  1 
ATOM   689  C CG  . ARG A 1 159 ? -63.355 35.911 -13.292 1.00 32.40  ? 159  ARG A CG  1 
ATOM   690  C CD  . ARG A 1 159 ? -62.096 35.962 -14.147 1.00 40.99  ? 159  ARG A CD  1 
ATOM   691  N NE  . ARG A 1 159 ? -62.140 37.045 -15.134 1.00 46.96  ? 159  ARG A NE  1 
ATOM   692  C CZ  . ARG A 1 159 ? -62.795 37.015 -16.295 1.00 59.46  ? 159  ARG A CZ  1 
ATOM   693  N NH1 . ARG A 1 159 ? -63.498 35.941 -16.647 1.00 45.73  ? 159  ARG A NH1 1 
ATOM   694  N NH2 . ARG A 1 159 ? -62.758 38.061 -17.111 1.00 46.14  ? 159  ARG A NH2 1 
ATOM   695  N N   . ALA A 1 160 ? -64.599 34.366 -9.321  1.00 23.17  ? 160  ALA A N   1 
ATOM   696  C CA  . ALA A 1 160 ? -64.800 33.507 -8.155  1.00 22.72  ? 160  ALA A CA  1 
ATOM   697  C C   . ALA A 1 160 ? -65.625 32.299 -8.553  1.00 25.90  ? 160  ALA A C   1 
ATOM   698  O O   . ALA A 1 160 ? -66.073 32.222 -9.695  1.00 25.48  ? 160  ALA A O   1 
ATOM   699  C CB  . ALA A 1 160 ? -65.507 34.283 -7.056  1.00 23.48  ? 160  ALA A CB  1 
ATOM   700  N N   . LEU A 1 161 ? -65.811 31.348 -7.632  1.00 21.89  ? 161  LEU A N   1 
ATOM   701  C CA  . LEU A 1 161 ? -66.571 30.137 -7.926  1.00 21.47  ? 161  LEU A CA  1 
ATOM   702  C C   . LEU A 1 161 ? -67.319 29.635 -6.691  1.00 24.86  ? 161  LEU A C   1 
ATOM   703  O O   . LEU A 1 161 ? -66.779 29.688 -5.585  1.00 24.40  ? 161  LEU A O   1 
ATOM   704  C CB  . LEU A 1 161 ? -65.614 29.060 -8.453  1.00 21.52  ? 161  LEU A CB  1 
ATOM   705  C CG  . LEU A 1 161 ? -66.242 27.985 -9.336  1.00 26.29  ? 161  LEU A CG  1 
ATOM   706  C CD1 . LEU A 1 161 ? -66.458 28.488 -10.754 1.00 26.46  ? 161  LEU A CD1 1 
ATOM   707  C CD2 . LEU A 1 161 ? -65.370 26.760 -9.399  1.00 28.72  ? 161  LEU A CD2 1 
ATOM   708  N N   . ARG A 1 162 ? -68.566 29.164 -6.881  1.00 21.09  ? 162  ARG A N   1 
ATOM   709  C CA  . ARG A 1 162 ? -69.391 28.638 -5.792  1.00 20.77  ? 162  ARG A CA  1 
ATOM   710  C C   . ARG A 1 162 ? -70.306 27.513 -6.277  1.00 25.13  ? 162  ARG A C   1 
ATOM   711  O O   . ARG A 1 162 ? -70.714 27.500 -7.439  1.00 24.86  ? 162  ARG A O   1 
ATOM   712  C CB  . ARG A 1 162 ? -70.212 29.766 -5.123  1.00 20.12  ? 162  ARG A CB  1 
ATOM   713  C CG  . ARG A 1 162 ? -71.418 30.285 -5.918  1.00 27.60  ? 162  ARG A CG  1 
ATOM   714  C CD  . ARG A 1 162 ? -72.038 31.503 -5.255  1.00 33.53  ? 162  ARG A CD  1 
ATOM   715  N NE  . ARG A 1 162 ? -73.197 32.018 -5.989  1.00 39.50  ? 162  ARG A NE  1 
ATOM   716  C CZ  . ARG A 1 162 ? -73.906 33.089 -5.635  1.00 52.78  ? 162  ARG A CZ  1 
ATOM   717  N NH1 . ARG A 1 162 ? -73.584 33.782 -4.546  1.00 39.33  ? 162  ARG A NH1 1 
ATOM   718  N NH2 . ARG A 1 162 ? -74.944 33.477 -6.367  1.00 40.07  ? 162  ARG A NH2 1 
ATOM   719  N N   . LEU A 1 163 ? -70.627 26.580 -5.371  1.00 21.79  ? 163  LEU A N   1 
ATOM   720  C CA  . LEU A 1 163 ? -71.536 25.462 -5.615  1.00 21.68  ? 163  LEU A CA  1 
ATOM   721  C C   . LEU A 1 163 ? -72.801 25.713 -4.800  1.00 25.78  ? 163  LEU A C   1 
ATOM   722  O O   . LEU A 1 163 ? -72.705 25.913 -3.589  1.00 25.10  ? 163  LEU A O   1 
ATOM   723  C CB  . LEU A 1 163 ? -70.897 24.126 -5.220  1.00 21.72  ? 163  LEU A CB  1 
ATOM   724  C CG  . LEU A 1 163 ? -69.552 23.800 -5.872  1.00 26.40  ? 163  LEU A CG  1 
ATOM   725  C CD1 . LEU A 1 163 ? -69.076 22.432 -5.456  1.00 26.47  ? 163  LEU A CD1 1 
ATOM   726  C CD2 . LEU A 1 163 ? -69.637 23.869 -7.384  1.00 28.99  ? 163  LEU A CD2 1 
ATOM   727  N N   . VAL A 1 164 ? -73.975 25.734 -5.463  1.00 22.83  ? 164  VAL A N   1 
ATOM   728  C CA  . VAL A 1 164 ? -75.265 26.024 -4.825  1.00 22.84  ? 164  VAL A CA  1 
ATOM   729  C C   . VAL A 1 164 ? -76.227 24.836 -4.953  1.00 27.00  ? 164  VAL A C   1 
ATOM   730  O O   . VAL A 1 164 ? -76.244 24.166 -5.985  1.00 26.44  ? 164  VAL A O   1 
ATOM   731  C CB  . VAL A 1 164 ? -75.895 27.306 -5.437  1.00 26.78  ? 164  VAL A CB  1 
ATOM   732  C CG1 . VAL A 1 164 ? -76.952 27.898 -4.508  1.00 26.63  ? 164  VAL A CG1 1 
ATOM   733  C CG2 . VAL A 1 164 ? -74.827 28.349 -5.764  1.00 26.60  ? 164  VAL A CG2 1 
ATOM   734  N N   . ASP A 1 165 ? -77.035 24.596 -3.901  1.00 24.10  ? 165  ASP A N   1 
ATOM   735  C CA  . ASP A 1 165 ? -78.056 23.544 -3.836  1.00 24.22  ? 165  ASP A CA  1 
ATOM   736  C C   . ASP A 1 165 ? -77.503 22.127 -4.056  1.00 28.87  ? 165  ASP A C   1 
ATOM   737  O O   . ASP A 1 165 ? -77.877 21.463 -5.022  1.00 28.57  ? 165  ASP A O   1 
ATOM   738  C CB  . ASP A 1 165 ? -79.210 23.848 -4.818  1.00 26.03  ? 165  ASP A CB  1 
ATOM   739  C CG  . ASP A 1 165 ? -79.845 25.213 -4.629  1.00 35.51  ? 165  ASP A CG  1 
ATOM   740  O OD1 . ASP A 1 165 ? -80.100 25.594 -3.467  1.00 35.68  ? 165  ASP A OD1 1 
ATOM   741  O OD2 . ASP A 1 165 ? -80.117 25.885 -5.646  1.00 41.86  ? 165  ASP A OD2 1 
ATOM   742  N N   . GLY A 1 166 ? -76.641 21.678 -3.145  1.00 25.99  ? 166  GLY A N   1 
ATOM   743  C CA  . GLY A 1 166 ? -76.039 20.348 -3.204  1.00 26.06  ? 166  GLY A CA  1 
ATOM   744  C C   . GLY A 1 166 ? -75.955 19.622 -1.874  1.00 30.58  ? 166  GLY A C   1 
ATOM   745  O O   . GLY A 1 166 ? -75.044 18.815 -1.676  1.00 30.08  ? 166  GLY A O   1 
ATOM   746  N N   . GLY A 1 167 ? -76.917 19.882 -0.985  1.00 27.80  ? 167  GLY A N   1 
ATOM   747  C CA  . GLY A 1 167 ? -77.013 19.252 0.330   1.00 27.88  ? 167  GLY A CA  1 
ATOM   748  C C   . GLY A 1 167 ? -75.769 19.318 1.193   1.00 32.15  ? 167  GLY A C   1 
ATOM   749  O O   . GLY A 1 167 ? -75.445 18.348 1.884   1.00 31.88  ? 167  GLY A O   1 
ATOM   750  N N   . GLY A 1 168 ? -75.084 20.459 1.156   1.00 28.72  ? 168  GLY A N   1 
ATOM   751  C CA  . GLY A 1 168 ? -73.861 20.686 1.918   1.00 28.60  ? 168  GLY A CA  1 
ATOM   752  C C   . GLY A 1 168 ? -72.733 21.232 1.070   1.00 32.54  ? 168  GLY A C   1 
ATOM   753  O O   . GLY A 1 168 ? -72.891 21.436 -0.137  1.00 32.18  ? 168  GLY A O   1 
ATOM   754  N N   . ALA A 1 169 ? -71.577 21.456 1.707   1.00 29.01  ? 169  ALA A N   1 
ATOM   755  C CA  . ALA A 1 169 ? -70.388 21.990 1.039   1.00 28.73  ? 169  ALA A CA  1 
ATOM   756  C C   . ALA A 1 169 ? -69.721 20.968 0.115   1.00 32.13  ? 169  ALA A C   1 
ATOM   757  O O   . ALA A 1 169 ? -69.985 19.774 0.208   1.00 31.78  ? 169  ALA A O   1 
ATOM   758  C CB  . ALA A 1 169 ? -69.392 22.496 2.071   1.00 29.47  ? 169  ALA A CB  1 
ATOM   759  N N   . CYS A 1 170 ? -68.817 21.460 -0.741  1.00 28.17  ? 170  CYS A N   1 
ATOM   760  C CA  . CYS A 1 170 ? -68.070 20.723 -1.760  1.00 27.65  ? 170  CYS A CA  1 
ATOM   761  C C   . CYS A 1 170 ? -68.958 19.957 -2.790  1.00 30.03  ? 170  CYS A C   1 
ATOM   762  O O   . CYS A 1 170 ? -68.485 19.005 -3.408  1.00 29.44  ? 170  CYS A O   1 
ATOM   763  C CB  . CYS A 1 170 ? -67.037 19.810 -1.104  1.00 28.09  ? 170  CYS A CB  1 
ATOM   764  S SG  . CYS A 1 170 ? -65.701 20.702 -0.261  1.00 32.06  ? 170  CYS A SG  1 
ATOM   765  N N   . ALA A 1 171 ? -70.191 20.440 -3.056  1.00 25.64  ? 171  ALA A N   1 
ATOM   766  C CA  . ALA A 1 171 ? -71.090 19.828 -4.048  1.00 25.01  ? 171  ALA A CA  1 
ATOM   767  C C   . ALA A 1 171 ? -72.244 20.769 -4.414  1.00 27.82  ? 171  ALA A C   1 
ATOM   768  O O   . ALA A 1 171 ? -72.685 21.545 -3.566  1.00 27.39  ? 171  ALA A O   1 
ATOM   769  C CB  . ALA A 1 171 ? -71.649 18.516 -3.521  1.00 25.76  ? 171  ALA A CB  1 
ATOM   770  N N   . GLY A 1 172 ? -72.714 20.687 -5.662  1.00 23.56  ? 172  GLY A N   1 
ATOM   771  C CA  . GLY A 1 172 ? -73.823 21.499 -6.158  1.00 23.06  ? 172  GLY A CA  1 
ATOM   772  C C   . GLY A 1 172 ? -73.631 22.052 -7.556  1.00 25.82  ? 172  GLY A C   1 
ATOM   773  O O   . GLY A 1 172 ? -72.731 21.627 -8.284  1.00 25.19  ? 172  GLY A O   1 
ATOM   774  N N   . ARG A 1 173 ? -74.498 23.010 -7.938  1.00 21.69  ? 173  ARG A N   1 
ATOM   775  C CA  . ARG A 1 173 ? -74.476 23.663 -9.253  1.00 21.18  ? 173  ARG A CA  1 
ATOM   776  C C   . ARG A 1 173 ? -73.266 24.582 -9.356  1.00 24.63  ? 173  ARG A C   1 
ATOM   777  O O   . ARG A 1 173 ? -73.138 25.493 -8.544  1.00 24.03  ? 173  ARG A O   1 
ATOM   778  C CB  . ARG A 1 173 ? -75.767 24.481 -9.467  1.00 21.19  ? 173  ARG A CB  1 
ATOM   779  C CG  . ARG A 1 173 ? -75.807 25.287 -10.768 1.00 30.62  ? 173  ARG A CG  1 
ATOM   780  C CD  . ARG A 1 173 ? -77.102 26.056 -10.972 1.00 39.09  ? 173  ARG A CD  1 
ATOM   781  N NE  . ARG A 1 173 ? -77.288 27.156 -10.014 1.00 45.97  ? 173  ARG A NE  1 
ATOM   782  C CZ  . ARG A 1 173 ? -77.963 27.097 -8.863  1.00 60.09  ? 173  ARG A CZ  1 
ATOM   783  N NH1 . ARG A 1 173 ? -78.526 25.960 -8.466  1.00 47.05  ? 173  ARG A NH1 1 
ATOM   784  N NH2 . ARG A 1 173 ? -78.065 28.173 -8.091  1.00 48.20  ? 173  ARG A NH2 1 
ATOM   785  N N   . VAL A 1 174 ? -72.435 24.404 -10.396 1.00 21.12  ? 174  VAL A N   1 
ATOM   786  C CA  . VAL A 1 174 ? -71.236 25.220 -10.592 1.00 20.77  ? 174  VAL A CA  1 
ATOM   787  C C   . VAL A 1 174 ? -71.625 26.628 -11.048 1.00 24.55  ? 174  VAL A C   1 
ATOM   788  O O   . VAL A 1 174 ? -72.067 26.799 -12.183 1.00 24.25  ? 174  VAL A O   1 
ATOM   789  C CB  . VAL A 1 174 ? -70.232 24.563 -11.580 1.00 24.52  ? 174  VAL A CB  1 
ATOM   790  C CG1 . VAL A 1 174 ? -69.025 25.471 -11.824 1.00 24.29  ? 174  VAL A CG1 1 
ATOM   791  C CG2 . VAL A 1 174 ? -69.774 23.198 -11.073 1.00 24.27  ? 174  VAL A CG2 1 
ATOM   792  N N   . GLU A 1 175 ? -71.466 27.623 -10.156 1.00 20.98  ? 175  GLU A N   1 
ATOM   793  C CA  . GLU A 1 175 ? -71.735 29.033 -10.443 1.00 20.74  ? 175  GLU A CA  1 
ATOM   794  C C   . GLU A 1 175 ? -70.408 29.788 -10.413 1.00 24.30  ? 175  GLU A C   1 
ATOM   795  O O   . GLU A 1 175 ? -69.589 29.538 -9.530  1.00 23.69  ? 175  GLU A O   1 
ATOM   796  C CB  . GLU A 1 175 ? -72.710 29.636 -9.419  1.00 22.12  ? 175  GLU A CB  1 
ATOM   797  C CG  . GLU A 1 175 ? -74.156 29.211 -9.615  1.00 31.88  ? 175  GLU A CG  1 
ATOM   798  C CD  . GLU A 1 175 ? -75.188 30.199 -9.107  1.00 48.50  ? 175  GLU A CD  1 
ATOM   799  O OE1 . GLU A 1 175 ? -74.917 30.888 -8.097  1.00 38.22  ? 175  GLU A OE1 1 
ATOM   800  O OE2 . GLU A 1 175 ? -76.287 30.259 -9.704  1.00 41.61  ? 175  GLU A OE2 1 
ATOM   801  N N   . MET A 1 176 ? -70.200 30.702 -11.375 1.00 20.88  ? 176  MET A N   1 
ATOM   802  C CA  . MET A 1 176 ? -68.981 31.502 -11.518 1.00 20.70  ? 176  MET A CA  1 
ATOM   803  C C   . MET A 1 176 ? -69.331 32.992 -11.497 1.00 24.51  ? 176  MET A C   1 
ATOM   804  O O   . MET A 1 176 ? -70.411 33.367 -11.944 1.00 24.00  ? 176  MET A O   1 
ATOM   805  C CB  . MET A 1 176 ? -68.285 31.127 -12.843 1.00 23.06  ? 176  MET A CB  1 
ATOM   806  C CG  . MET A 1 176 ? -67.016 31.912 -13.134 1.00 26.77  ? 176  MET A CG  1 
ATOM   807  S SD  . MET A 1 176 ? -66.068 31.234 -14.516 1.00 31.02  ? 176  MET A SD  1 
ATOM   808  C CE  . MET A 1 176 ? -67.223 31.465 -15.835 1.00 27.76  ? 176  MET A CE  1 
ATOM   809  N N   . LEU A 1 177 ? -68.413 33.833 -10.986 1.00 21.23  ? 177  LEU A N   1 
ATOM   810  C CA  . LEU A 1 177 ? -68.586 35.288 -10.913 1.00 21.19  ? 177  LEU A CA  1 
ATOM   811  C C   . LEU A 1 177 ? -67.768 35.946 -12.027 1.00 25.68  ? 177  LEU A C   1 
ATOM   812  O O   . LEU A 1 177 ? -66.577 35.669 -12.145 1.00 25.17  ? 177  LEU A O   1 
ATOM   813  C CB  . LEU A 1 177 ? -68.117 35.801 -9.536  1.00 21.20  ? 177  LEU A CB  1 
ATOM   814  C CG  . LEU A 1 177 ? -68.228 37.303 -9.255  1.00 25.71  ? 177  LEU A CG  1 
ATOM   815  C CD1 . LEU A 1 177 ? -69.670 37.748 -9.193  1.00 25.84  ? 177  LEU A CD1 1 
ATOM   816  C CD2 . LEU A 1 177 ? -67.544 37.649 -7.952  1.00 28.00  ? 177  LEU A CD2 1 
ATOM   817  N N   . GLU A 1 178 ? -68.406 36.801 -12.845 1.00 22.88  ? 178  GLU A N   1 
ATOM   818  C CA  . GLU A 1 178 ? -67.739 37.524 -13.932 1.00 23.01  ? 178  GLU A CA  1 
ATOM   819  C C   . GLU A 1 178 ? -68.353 38.911 -14.083 1.00 27.75  ? 178  GLU A C   1 
ATOM   820  O O   . GLU A 1 178 ? -69.522 39.023 -14.456 1.00 27.26  ? 178  GLU A O   1 
ATOM   821  C CB  . GLU A 1 178 ? -67.846 36.760 -15.262 1.00 24.40  ? 178  GLU A CB  1 
ATOM   822  C CG  . GLU A 1 178 ? -66.792 35.684 -15.442 1.00 34.60  ? 178  GLU A CG  1 
ATOM   823  C CD  . GLU A 1 178 ? -66.731 35.068 -16.828 1.00 54.95  ? 178  GLU A CD  1 
ATOM   824  O OE1 . GLU A 1 178 ? -67.678 35.275 -17.621 1.00 49.71  ? 178  GLU A OE1 1 
ATOM   825  O OE2 . GLU A 1 178 ? -65.726 34.384 -17.125 1.00 48.59  ? 178  GLU A OE2 1 
ATOM   826  N N   . HIS A 1 179 ? -67.566 39.960 -13.782 1.00 25.06  ? 179  HIS A N   1 
ATOM   827  C CA  . HIS A 1 179 ? -67.979 41.363 -13.881 1.00 25.14  ? 179  HIS A CA  1 
ATOM   828  C C   . HIS A 1 179 ? -69.189 41.684 -12.982 1.00 28.85  ? 179  HIS A C   1 
ATOM   829  O O   . HIS A 1 179 ? -70.134 42.348 -13.413 1.00 28.43  ? 179  HIS A O   1 
ATOM   830  C CB  . HIS A 1 179 ? -68.228 41.751 -15.354 1.00 26.04  ? 179  HIS A CB  1 
ATOM   831  C CG  . HIS A 1 179 ? -67.148 41.281 -16.280 1.00 29.53  ? 179  HIS A CG  1 
ATOM   832  N ND1 . HIS A 1 179 ? -67.397 40.331 -17.254 1.00 31.35  ? 179  HIS A ND1 1 
ATOM   833  C CD2 . HIS A 1 179 ? -65.835 41.604 -16.311 1.00 31.32  ? 179  HIS A CD2 1 
ATOM   834  C CE1 . HIS A 1 179 ? -66.241 40.132 -17.868 1.00 30.76  ? 179  HIS A CE1 1 
ATOM   835  N NE2 . HIS A 1 179 ? -65.272 40.874 -17.331 1.00 31.09  ? 179  HIS A NE2 1 
ATOM   836  N N   . GLY A 1 180 ? -69.128 41.211 -11.738 1.00 25.21  ? 180  GLY A N   1 
ATOM   837  C CA  . GLY A 1 180 ? -70.171 41.423 -10.741 1.00 24.98  ? 180  GLY A CA  1 
ATOM   838  C C   . GLY A 1 180 ? -71.495 40.748 -11.040 1.00 28.57  ? 180  GLY A C   1 
ATOM   839  O O   . GLY A 1 180 ? -72.549 41.306 -10.728 1.00 28.25  ? 180  GLY A O   1 
ATOM   840  N N   . GLU A 1 181 ? -71.457 39.546 -11.646 1.00 24.75  ? 181  GLU A N   1 
ATOM   841  C CA  . GLU A 1 181 ? -72.661 38.784 -11.984 1.00 24.40  ? 181  GLU A CA  1 
ATOM   842  C C   . GLU A 1 181 ? -72.414 37.287 -11.818 1.00 27.28  ? 181  GLU A C   1 
ATOM   843  O O   . GLU A 1 181 ? -71.557 36.738 -12.509 1.00 26.75  ? 181  GLU A O   1 
ATOM   844  C CB  . GLU A 1 181 ? -73.092 39.076 -13.432 1.00 25.88  ? 181  GLU A CB  1 
ATOM   845  C CG  . GLU A 1 181 ? -73.876 40.365 -13.594 1.00 37.55  ? 181  GLU A CG  1 
ATOM   846  C CD  . GLU A 1 181 ? -74.416 40.576 -14.995 1.00 60.74  ? 181  GLU A CD  1 
ATOM   847  O OE1 . GLU A 1 181 ? -73.635 40.426 -15.962 1.00 55.02  ? 181  GLU A OE1 1 
ATOM   848  O OE2 . GLU A 1 181 ? -75.626 40.870 -15.127 1.00 57.67  ? 181  GLU A OE2 1 
ATOM   849  N N   . TRP A 1 182 ? -73.160 36.627 -10.914 1.00 23.19  ? 182  TRP A N   1 
ATOM   850  C CA  . TRP A 1 182 ? -73.026 35.184 -10.699 1.00 22.65  ? 182  TRP A CA  1 
ATOM   851  C C   . TRP A 1 182 ? -73.784 34.443 -11.807 1.00 26.33  ? 182  TRP A C   1 
ATOM   852  O O   . TRP A 1 182 ? -75.006 34.564 -11.884 1.00 25.80  ? 182  TRP A O   1 
ATOM   853  C CB  . TRP A 1 182 ? -73.556 34.766 -9.314  1.00 21.17  ? 182  TRP A CB  1 
ATOM   854  C CG  . TRP A 1 182 ? -72.611 35.068 -8.191  1.00 21.90  ? 182  TRP A CG  1 
ATOM   855  C CD1 . TRP A 1 182 ? -72.707 36.083 -7.286  1.00 24.76  ? 182  TRP A CD1 1 
ATOM   856  C CD2 . TRP A 1 182 ? -71.429 34.335 -7.850  1.00 21.64  ? 182  TRP A CD2 1 
ATOM   857  N NE1 . TRP A 1 182 ? -71.655 36.029 -6.402  1.00 24.10  ? 182  TRP A NE1 1 
ATOM   858  C CE2 . TRP A 1 182 ? -70.858 34.960 -6.721  1.00 25.45  ? 182  TRP A CE2 1 
ATOM   859  C CE3 . TRP A 1 182 ? -70.796 33.204 -8.388  1.00 22.82  ? 182  TRP A CE3 1 
ATOM   860  C CZ2 . TRP A 1 182 ? -69.676 34.502 -6.131  1.00 24.70  ? 182  TRP A CZ2 1 
ATOM   861  C CZ3 . TRP A 1 182 ? -69.623 32.754 -7.804  1.00 24.22  ? 182  TRP A CZ3 1 
ATOM   862  C CH2 . TRP A 1 182 ? -69.084 33.390 -6.680  1.00 24.81  ? 182  TRP A CH2 1 
ATOM   863  N N   . GLY A 1 183 ? -73.054 33.711 -12.651 1.00 22.85  ? 183  GLY A N   1 
ATOM   864  C CA  . GLY A 1 183 ? -73.616 32.956 -13.769 1.00 22.64  ? 183  GLY A CA  1 
ATOM   865  C C   . GLY A 1 183 ? -73.252 31.486 -13.747 1.00 26.31  ? 183  GLY A C   1 
ATOM   866  O O   . GLY A 1 183 ? -72.246 31.103 -13.148 1.00 25.76  ? 183  GLY A O   1 
ATOM   867  N N   . SER A 1 184 ? -74.063 30.656 -14.426 1.00 22.82  ? 184  SER A N   1 
ATOM   868  C CA  . SER A 1 184 ? -73.891 29.198 -14.480 1.00 22.62  ? 184  SER A CA  1 
ATOM   869  C C   . SER A 1 184 ? -73.051 28.729 -15.679 1.00 26.50  ? 184  SER A C   1 
ATOM   870  O O   . SER A 1 184 ? -72.727 29.524 -16.560 1.00 26.01  ? 184  SER A O   1 
ATOM   871  C CB  . SER A 1 184 ? -75.259 28.522 -14.507 1.00 26.10  ? 184  SER A CB  1 
ATOM   872  O OG  . SER A 1 184 ? -76.040 29.009 -15.584 1.00 34.89  ? 184  SER A OG  1 
ATOM   873  N N   . VAL A 1 185 ? -72.696 27.427 -15.688 1.00 23.23  ? 185  VAL A N   1 
ATOM   874  C CA  . VAL A 1 185 ? -71.900 26.771 -16.733 1.00 23.12  ? 185  VAL A CA  1 
ATOM   875  C C   . VAL A 1 185 ? -72.745 25.656 -17.377 1.00 27.17  ? 185  VAL A C   1 
ATOM   876  O O   . VAL A 1 185 ? -73.405 24.910 -16.659 1.00 26.85  ? 185  VAL A O   1 
ATOM   877  C CB  . VAL A 1 185 ? -70.592 26.209 -16.117 1.00 27.00  ? 185  VAL A CB  1 
ATOM   878  C CG1 . VAL A 1 185 ? -69.811 25.367 -17.127 1.00 26.84  ? 185  VAL A CG1 1 
ATOM   879  C CG2 . VAL A 1 185 ? -69.724 27.337 -15.562 1.00 26.77  ? 185  VAL A CG2 1 
ATOM   880  N N   . CYS A 1 186 ? -72.697 25.525 -18.717 1.00 23.72  ? 186  CYS A N   1 
ATOM   881  C CA  . CYS A 1 186 ? -73.471 24.514 -19.452 1.00 23.55  ? 186  CYS A CA  1 
ATOM   882  C C   . CYS A 1 186 ? -72.872 23.108 -19.312 1.00 27.56  ? 186  CYS A C   1 
ATOM   883  O O   . CYS A 1 186 ? -71.657 22.966 -19.171 1.00 27.01  ? 186  CYS A O   1 
ATOM   884  C CB  . CYS A 1 186 ? -73.605 24.909 -20.921 1.00 23.84  ? 186  CYS A CB  1 
ATOM   885  S SG  . CYS A 1 186 ? -74.576 23.750 -21.923 1.00 27.71  ? 186  CYS A SG  1 
ATOM   886  N N   . ASP A 1 187 ? -73.733 22.070 -19.405 1.00 24.39  ? 187  ASP A N   1 
ATOM   887  C CA  . ASP A 1 187 ? -73.317 20.663 -19.313 1.00 24.34  ? 187  ASP A CA  1 
ATOM   888  C C   . ASP A 1 187 ? -72.709 20.111 -20.611 1.00 28.98  ? 187  ASP A C   1 
ATOM   889  O O   . ASP A 1 187 ? -72.175 19.002 -20.592 1.00 28.56  ? 187  ASP A O   1 
ATOM   890  C CB  . ASP A 1 187 ? -74.466 19.755 -18.815 1.00 26.03  ? 187  ASP A CB  1 
ATOM   891  C CG  . ASP A 1 187 ? -75.677 19.590 -19.724 1.00 35.36  ? 187  ASP A CG  1 
ATOM   892  O OD1 . ASP A 1 187 ? -75.540 19.801 -20.949 1.00 35.88  ? 187  ASP A OD1 1 
ATOM   893  O OD2 . ASP A 1 187 ? -76.755 19.223 -19.211 1.00 40.62  ? 187  ASP A OD2 1 
ATOM   894  N N   . ASP A 1 188 ? -72.813 20.851 -21.737 1.00 26.13  ? 188  ASP A N   1 
ATOM   895  C CA  . ASP A 1 188 ? -72.246 20.421 -23.016 1.00 26.18  ? 188  ASP A CA  1 
ATOM   896  C C   . ASP A 1 188 ? -70.716 20.401 -22.890 1.00 30.40  ? 188  ASP A C   1 
ATOM   897  O O   . ASP A 1 188 ? -70.129 21.395 -22.459 1.00 29.98  ? 188  ASP A O   1 
ATOM   898  C CB  . ASP A 1 188 ? -72.695 21.368 -24.146 1.00 28.14  ? 188  ASP A CB  1 
ATOM   899  C CG  . ASP A 1 188 ? -72.307 20.916 -25.539 1.00 39.44  ? 188  ASP A CG  1 
ATOM   900  O OD1 . ASP A 1 188 ? -72.510 19.724 -25.854 1.00 40.25  ? 188  ASP A OD1 1 
ATOM   901  O OD2 . ASP A 1 188 ? -71.840 21.766 -26.329 1.00 45.63  ? 188  ASP A OD2 1 
ATOM   902  N N   . THR A 1 189 ? -70.088 19.245 -23.208 1.00 27.22  ? 189  THR A N   1 
ATOM   903  C CA  . THR A 1 189 ? -68.639 19.002 -23.103 1.00 27.14  ? 189  THR A CA  1 
ATOM   904  C C   . THR A 1 189 ? -68.140 19.057 -21.634 1.00 31.16  ? 189  THR A C   1 
ATOM   905  O O   . THR A 1 189 ? -66.952 19.296 -21.401 1.00 30.84  ? 189  THR A O   1 
ATOM   906  C CB  . THR A 1 189 ? -67.842 19.930 -24.043 1.00 35.37  ? 189  THR A CB  1 
ATOM   907  O OG1 . THR A 1 189 ? -68.492 19.978 -25.311 1.00 35.29  ? 189  THR A OG1 1 
ATOM   908  N N   . TRP A 1 190 ? -69.033 18.780 -20.655 1.00 27.61  ? 190  TRP A N   1 
ATOM   909  C CA  . TRP A 1 190 ? -68.696 18.784 -19.229 1.00 27.32  ? 190  TRP A CA  1 
ATOM   910  C C   . TRP A 1 190 ? -68.295 17.363 -18.827 1.00 31.25  ? 190  TRP A C   1 
ATOM   911  O O   . TRP A 1 190 ? -69.089 16.439 -18.999 1.00 30.79  ? 190  TRP A O   1 
ATOM   912  C CB  . TRP A 1 190 ? -69.894 19.270 -18.396 1.00 25.94  ? 190  TRP A CB  1 
ATOM   913  C CG  . TRP A 1 190 ? -69.587 19.483 -16.945 1.00 26.79  ? 190  TRP A CG  1 
ATOM   914  C CD1 . TRP A 1 190 ? -69.953 18.683 -15.904 1.00 29.68  ? 190  TRP A CD1 1 
ATOM   915  C CD2 . TRP A 1 190 ? -68.855 20.574 -16.376 1.00 26.58  ? 190  TRP A CD2 1 
ATOM   916  N NE1 . TRP A 1 190 ? -69.479 19.199 -14.721 1.00 29.06  ? 190  TRP A NE1 1 
ATOM   917  C CE2 . TRP A 1 190 ? -68.804 20.363 -14.982 1.00 30.42  ? 190  TRP A CE2 1 
ATOM   918  C CE3 . TRP A 1 190 ? -68.239 21.716 -16.909 1.00 27.81  ? 190  TRP A CE3 1 
ATOM   919  C CZ2 . TRP A 1 190 ? -68.159 21.249 -14.116 1.00 29.68  ? 190  TRP A CZ2 1 
ATOM   920  C CZ3 . TRP A 1 190 ? -67.607 22.597 -16.048 1.00 29.23  ? 190  TRP A CZ3 1 
ATOM   921  C CH2 . TRP A 1 190 ? -67.565 22.357 -14.670 1.00 29.85  ? 190  TRP A CH2 1 
ATOM   922  N N   . ASP A 1 191 ? -67.060 17.190 -18.320 1.00 27.92  ? 191  ASP A N   1 
ATOM   923  C CA  . ASP A 1 191 ? -66.518 15.884 -17.932 1.00 27.84  ? 191  ASP A CA  1 
ATOM   924  C C   . ASP A 1 191 ? -65.682 15.983 -16.645 1.00 31.42  ? 191  ASP A C   1 
ATOM   925  O O   . ASP A 1 191 ? -65.603 17.060 -16.053 1.00 30.91  ? 191  ASP A O   1 
ATOM   926  C CB  . ASP A 1 191 ? -65.685 15.309 -19.101 1.00 29.90  ? 191  ASP A CB  1 
ATOM   927  C CG  . ASP A 1 191 ? -64.490 16.148 -19.532 1.00 41.35  ? 191  ASP A CG  1 
ATOM   928  O OD1 . ASP A 1 191 ? -64.477 17.364 -19.237 1.00 42.17  ? 191  ASP A OD1 1 
ATOM   929  O OD2 . ASP A 1 191 ? -63.587 15.597 -20.198 1.00 47.54  ? 191  ASP A OD2 1 
ATOM   930  N N   . LEU A 1 192 ? -65.084 14.857 -16.198 1.00 27.92  ? 192  LEU A N   1 
ATOM   931  C CA  . LEU A 1 192 ? -64.250 14.821 -14.986 1.00 27.67  ? 192  LEU A CA  1 
ATOM   932  C C   . LEU A 1 192 ? -63.012 15.728 -15.059 1.00 31.11  ? 192  LEU A C   1 
ATOM   933  O O   . LEU A 1 192 ? -62.535 16.166 -14.013 1.00 30.57  ? 192  LEU A O   1 
ATOM   934  C CB  . LEU A 1 192 ? -63.822 13.382 -14.646 1.00 27.80  ? 192  LEU A CB  1 
ATOM   935  C CG  . LEU A 1 192 ? -64.914 12.499 -14.043 1.00 32.58  ? 192  LEU A CG  1 
ATOM   936  C CD1 . LEU A 1 192 ? -64.597 11.030 -14.243 1.00 32.87  ? 192  LEU A CD1 1 
ATOM   937  C CD2 . LEU A 1 192 ? -65.105 12.790 -12.560 1.00 34.90  ? 192  LEU A CD2 1 
ATOM   938  N N   . GLU A 1 193 ? -62.500 16.015 -16.274 1.00 27.54  ? 193  GLU A N   1 
ATOM   939  C CA  . GLU A 1 193 ? -61.343 16.901 -16.452 1.00 27.36  ? 193  GLU A CA  1 
ATOM   940  C C   . GLU A 1 193 ? -61.721 18.337 -16.063 1.00 30.67  ? 193  GLU A C   1 
ATOM   941  O O   . GLU A 1 193 ? -60.906 19.039 -15.467 1.00 30.07  ? 193  GLU A O   1 
ATOM   942  C CB  . GLU A 1 193 ? -60.817 16.867 -17.906 1.00 28.87  ? 193  GLU A CB  1 
ATOM   943  C CG  . GLU A 1 193 ? -60.472 15.488 -18.455 1.00 40.29  ? 193  GLU A CG  1 
ATOM   944  C CD  . GLU A 1 193 ? -59.673 14.586 -17.534 1.00 62.78  ? 193  GLU A CD  1 
ATOM   945  O OE1 . GLU A 1 193 ? -58.667 15.062 -16.959 1.00 58.47  ? 193  GLU A OE1 1 
ATOM   946  O OE2 . GLU A 1 193 ? -60.048 13.399 -17.393 1.00 56.82  ? 193  GLU A OE2 1 
ATOM   947  N N   . ASP A 1 194 ? -62.963 18.758 -16.373 1.00 27.08  ? 194  ASP A N   1 
ATOM   948  C CA  . ASP A 1 194 ? -63.468 20.087 -16.016 1.00 26.80  ? 194  ASP A CA  1 
ATOM   949  C C   . ASP A 1 194 ? -63.788 20.147 -14.520 1.00 30.36  ? 194  ASP A C   1 
ATOM   950  O O   . ASP A 1 194 ? -63.509 21.157 -13.879 1.00 29.77  ? 194  ASP A O   1 
ATOM   951  C CB  . ASP A 1 194 ? -64.722 20.439 -16.838 1.00 28.62  ? 194  ASP A CB  1 
ATOM   952  C CG  . ASP A 1 194 ? -64.513 20.477 -18.342 1.00 38.13  ? 194  ASP A CG  1 
ATOM   953  O OD1 . ASP A 1 194 ? -63.368 20.248 -18.791 1.00 38.78  ? 194  ASP A OD1 1 
ATOM   954  O OD2 . ASP A 1 194 ? -65.496 20.722 -19.069 1.00 43.43  ? 194  ASP A OD2 1 
ATOM   955  N N   . ALA A 1 195 ? -64.369 19.066 -13.969 1.00 26.97  ? 195  ALA A N   1 
ATOM   956  C CA  . ALA A 1 195 ? -64.715 18.973 -12.547 1.00 26.83  ? 195  ALA A CA  1 
ATOM   957  C C   . ALA A 1 195 ? -63.483 18.964 -11.637 1.00 30.66  ? 195  ALA A C   1 
ATOM   958  O O   . ALA A 1 195 ? -63.555 19.490 -10.528 1.00 30.01  ? 195  ALA A O   1 
ATOM   959  C CB  . ALA A 1 195 ? -65.539 17.723 -12.292 1.00 27.60  ? 195  ALA A CB  1 
ATOM   960  N N   . HIS A 1 196 ? -62.374 18.336 -12.076 1.00 27.57  ? 196  HIS A N   1 
ATOM   961  C CA  . HIS A 1 196 ? -61.139 18.272 -11.285 1.00 27.57  ? 196  HIS A CA  1 
ATOM   962  C C   . HIS A 1 196 ? -60.554 19.671 -11.041 1.00 30.68  ? 196  HIS A C   1 
ATOM   963  O O   . HIS A 1 196 ? -60.017 19.921 -9.962  1.00 30.08  ? 196  HIS A O   1 
ATOM   964  C CB  . HIS A 1 196 ? -60.103 17.357 -11.961 1.00 28.63  ? 196  HIS A CB  1 
ATOM   965  C CG  . HIS A 1 196 ? -58.894 17.089 -11.119 1.00 32.31  ? 196  HIS A CG  1 
ATOM   966  N ND1 . HIS A 1 196 ? -59.003 16.532 -9.855  1.00 34.22  ? 196  HIS A ND1 1 
ATOM   967  C CD2 . HIS A 1 196 ? -57.586 17.297 -11.393 1.00 34.19  ? 196  HIS A CD2 1 
ATOM   968  C CE1 . HIS A 1 196 ? -57.765 16.432 -9.397  1.00 33.69  ? 196  HIS A CE1 1 
ATOM   969  N NE2 . HIS A 1 196 ? -56.879 16.878 -10.290 1.00 34.02  ? 196  HIS A NE2 1 
ATOM   970  N N   . VAL A 1 197 ? -60.684 20.582 -12.028 1.00 26.82  ? 197  VAL A N   1 
ATOM   971  C CA  . VAL A 1 197 ? -60.217 21.968 -11.908 1.00 26.33  ? 197  VAL A CA  1 
ATOM   972  C C   . VAL A 1 197 ? -61.066 22.707 -10.855 1.00 29.36  ? 197  VAL A C   1 
ATOM   973  O O   . VAL A 1 197 ? -60.525 23.492 -10.076 1.00 28.91  ? 197  VAL A O   1 
ATOM   974  C CB  . VAL A 1 197 ? -60.233 22.697 -13.280 1.00 30.24  ? 197  VAL A CB  1 
ATOM   975  C CG1 . VAL A 1 197 ? -59.980 24.197 -13.120 1.00 30.07  ? 197  VAL A CG1 1 
ATOM   976  C CG2 . VAL A 1 197 ? -59.210 22.082 -14.231 1.00 30.08  ? 197  VAL A CG2 1 
ATOM   977  N N   . VAL A 1 198 ? -62.387 22.441 -10.833 1.00 25.25  ? 198  VAL A N   1 
ATOM   978  C CA  . VAL A 1 198 ? -63.316 23.059 -9.885  1.00 24.74  ? 198  VAL A CA  1 
ATOM   979  C C   . VAL A 1 198 ? -63.016 22.620 -8.446  1.00 28.35  ? 198  VAL A C   1 
ATOM   980  O O   . VAL A 1 198 ? -62.969 23.468 -7.565  1.00 27.90  ? 198  VAL A O   1 
ATOM   981  C CB  . VAL A 1 198 ? -64.796 22.777 -10.276 1.00 28.53  ? 198  VAL A CB  1 
ATOM   982  C CG1 . VAL A 1 198 ? -65.765 23.167 -9.156  1.00 28.32  ? 198  VAL A CG1 1 
ATOM   983  C CG2 . VAL A 1 198 ? -65.159 23.479 -11.582 1.00 28.34  ? 198  VAL A CG2 1 
ATOM   984  N N   . CYS A 1 199 ? -62.822 21.318 -8.204  1.00 24.77  ? 199  CYS A N   1 
ATOM   985  C CA  . CYS A 1 199 ? -62.575 20.812 -6.849  1.00 24.40  ? 199  CYS A CA  1 
ATOM   986  C C   . CYS A 1 199 ? -61.231 21.258 -6.240  1.00 28.54  ? 199  CYS A C   1 
ATOM   987  O O   . CYS A 1 199 ? -61.185 21.467 -5.028  1.00 28.16  ? 199  CYS A O   1 
ATOM   988  C CB  . CYS A 1 199 ? -62.727 19.294 -6.805  1.00 24.48  ? 199  CYS A CB  1 
ATOM   989  S SG  . CYS A 1 199 ? -64.366 18.701 -7.302  1.00 28.20  ? 199  CYS A SG  1 
ATOM   990  N N   . ARG A 1 200 ? -60.155 21.415 -7.048  1.00 25.26  ? 200  ARG A N   1 
ATOM   991  C CA  . ARG A 1 200 ? -58.847 21.818 -6.508  1.00 25.20  ? 200  ARG A CA  1 
ATOM   992  C C   . ARG A 1 200 ? -58.793 23.289 -6.054  1.00 29.16  ? 200  ARG A C   1 
ATOM   993  O O   . ARG A 1 200 ? -58.205 23.572 -5.009  1.00 28.73  ? 200  ARG A O   1 
ATOM   994  C CB  . ARG A 1 200 ? -57.688 21.497 -7.484  1.00 25.83  ? 200  ARG A CB  1 
ATOM   995  C CG  . ARG A 1 200 ? -57.611 22.343 -8.765  1.00 37.91  ? 200  ARG A CG  1 
ATOM   996  C CD  . ARG A 1 200 ? -56.231 22.336 -9.400  1.00 49.25  ? 200  ARG A CD  1 
ATOM   997  N NE  . ARG A 1 200 ? -55.917 21.076 -10.074 1.00 59.02  ? 200  ARG A NE  1 
ATOM   998  C CZ  . ARG A 1 200 ? -54.779 20.828 -10.722 1.00 74.59  ? 200  ARG A CZ  1 
ATOM   999  N NH1 . ARG A 1 200 ? -53.825 21.753 -10.790 1.00 62.19  ? 200  ARG A NH1 1 
ATOM   1000 N NH2 . ARG A 1 200 ? -54.585 19.652 -11.307 1.00 62.19  ? 200  ARG A NH2 1 
ATOM   1001 N N   . GLN A 1 201 ? -59.391 24.216 -6.831  1.00 25.67  ? 201  GLN A N   1 
ATOM   1002 C CA  . GLN A 1 201 ? -59.375 25.651 -6.508  1.00 25.46  ? 201  GLN A CA  1 
ATOM   1003 C C   . GLN A 1 201 ? -60.201 26.002 -5.266  1.00 29.38  ? 201  GLN A C   1 
ATOM   1004 O O   . GLN A 1 201 ? -59.902 26.994 -4.599  1.00 28.96  ? 201  GLN A O   1 
ATOM   1005 C CB  . GLN A 1 201 ? -59.814 26.504 -7.719  1.00 26.76  ? 201  GLN A CB  1 
ATOM   1006 C CG  . GLN A 1 201 ? -61.290 26.415 -8.100  1.00 39.43  ? 201  GLN A CG  1 
ATOM   1007 C CD  . GLN A 1 201 ? -61.590 27.218 -9.337  1.00 56.72  ? 201  GLN A CD  1 
ATOM   1008 O OE1 . GLN A 1 201 ? -61.735 26.677 -10.438 1.00 51.64  ? 201  GLN A OE1 1 
ATOM   1009 N NE2 . GLN A 1 201 ? -61.702 28.527 -9.188  1.00 48.56  ? 201  GLN A NE2 1 
ATOM   1010 N N   . LEU A 1 202 ? -61.228 25.195 -4.960  1.00 25.92  ? 202  LEU A N   1 
ATOM   1011 C CA  . LEU A 1 202 ? -62.100 25.402 -3.803  1.00 25.76  ? 202  LEU A CA  1 
ATOM   1012 C C   . LEU A 1 202 ? -61.532 24.761 -2.531  1.00 29.92  ? 202  LEU A C   1 
ATOM   1013 O O   . LEU A 1 202 ? -61.855 25.212 -1.432  1.00 29.49  ? 202  LEU A O   1 
ATOM   1014 C CB  . LEU A 1 202 ? -63.485 24.812 -4.086  1.00 25.78  ? 202  LEU A CB  1 
ATOM   1015 C CG  . LEU A 1 202 ? -64.208 25.359 -5.317  1.00 30.41  ? 202  LEU A CG  1 
ATOM   1016 C CD1 . LEU A 1 202 ? -65.397 24.481 -5.676  1.00 30.55  ? 202  LEU A CD1 1 
ATOM   1017 C CD2 . LEU A 1 202 ? -64.594 26.817 -5.135  1.00 32.67  ? 202  LEU A CD2 1 
ATOM   1018 N N   . GLY A 1 203 ? -60.724 23.713 -2.689  1.00 26.67  ? 203  GLY A N   1 
ATOM   1019 C CA  . GLY A 1 203 ? -60.129 22.986 -1.576  1.00 26.60  ? 203  GLY A CA  1 
ATOM   1020 C C   . GLY A 1 203 ? -60.999 21.829 -1.133  1.00 30.88  ? 203  GLY A C   1 
ATOM   1021 O O   . GLY A 1 203 ? -61.247 21.661 0.064   1.00 30.54  ? 203  GLY A O   1 
ATOM   1022 N N   . CYS A 1 204 ? -61.471 21.026 -2.106  1.00 27.69  ? 204  CYS A N   1 
ATOM   1023 C CA  . CYS A 1 204 ? -62.310 19.848 -1.875  1.00 27.63  ? 204  CYS A CA  1 
ATOM   1024 C C   . CYS A 1 204 ? -61.654 18.579 -2.461  1.00 31.35  ? 204  CYS A C   1 
ATOM   1025 O O   . CYS A 1 204 ? -62.343 17.586 -2.695  1.00 30.87  ? 204  CYS A O   1 
ATOM   1026 C CB  . CYS A 1 204 ? -63.705 20.070 -2.455  1.00 28.07  ? 204  CYS A CB  1 
ATOM   1027 S SG  . CYS A 1 204 ? -64.581 21.499 -1.764  1.00 32.04  ? 204  CYS A SG  1 
ATOM   1028 N N   . GLY A 1 205 ? -60.336 18.608 -2.660  1.00 27.87  ? 205  GLY A N   1 
ATOM   1029 C CA  . GLY A 1 205 ? -59.592 17.474 -3.193  1.00 27.70  ? 205  GLY A CA  1 
ATOM   1030 C C   . GLY A 1 205 ? -59.842 17.208 -4.665  1.00 31.57  ? 205  GLY A C   1 
ATOM   1031 O O   . GLY A 1 205 ? -59.698 18.114 -5.487  1.00 31.30  ? 205  GLY A O   1 
ATOM   1032 N N   . TRP A 1 206 ? -60.223 15.959 -5.004  1.00 28.02  ? 206  TRP A N   1 
ATOM   1033 C CA  . TRP A 1 206 ? -60.464 15.524 -6.389  1.00 27.81  ? 206  TRP A CA  1 
ATOM   1034 C C   . TRP A 1 206 ? -61.954 15.445 -6.730  1.00 30.89  ? 206  TRP A C   1 
ATOM   1035 O O   . TRP A 1 206 ? -62.800 15.518 -5.838  1.00 30.45  ? 206  TRP A O   1 
ATOM   1036 C CB  . TRP A 1 206 ? -59.767 14.174 -6.670  1.00 26.69  ? 206  TRP A CB  1 
ATOM   1037 C CG  . TRP A 1 206 ? -60.303 13.001 -5.899  1.00 27.73  ? 206  TRP A CG  1 
ATOM   1038 C CD1 . TRP A 1 206 ? -61.314 12.165 -6.272  1.00 30.65  ? 206  TRP A CD1 1 
ATOM   1039 C CD2 . TRP A 1 206 ? -59.794 12.489 -4.663  1.00 27.63  ? 206  TRP A CD2 1 
ATOM   1040 N NE1 . TRP A 1 206 ? -61.499 11.192 -5.318  1.00 30.11  ? 206  TRP A NE1 1 
ATOM   1041 C CE2 . TRP A 1 206 ? -60.579 11.368 -4.318  1.00 31.56  ? 206  TRP A CE2 1 
ATOM   1042 C CE3 . TRP A 1 206 ? -58.778 12.898 -3.786  1.00 28.93  ? 206  TRP A CE3 1 
ATOM   1043 C CZ2 . TRP A 1 206 ? -60.365 10.639 -3.144  1.00 30.92  ? 206  TRP A CZ2 1 
ATOM   1044 C CZ3 . TRP A 1 206 ? -58.567 12.175 -2.624  1.00 30.44  ? 206  TRP A CZ3 1 
ATOM   1045 C CH2 . TRP A 1 206 ? -59.353 11.059 -2.314  1.00 31.09  ? 206  TRP A CH2 1 
ATOM   1046 N N   . ALA A 1 207 ? -62.263 15.283 -8.030  1.00 26.80  ? 207  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 207 ? -63.636 15.196 -8.536  1.00 26.29  ? 207  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 207 ? -64.127 13.753 -8.611  1.00 29.29  ? 207  ALA A C   1 
ATOM   1049 O O   . ALA A 1 207 ? -63.471 12.916 -9.230  1.00 28.92  ? 207  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 207 ? -63.723 15.834 -9.909  1.00 27.02  ? 207  ALA A CB  1 
ATOM   1051 N N   . VAL A 1 208 ? -65.298 13.478 -8.013  1.00 25.02  ? 208  VAL A N   1 
ATOM   1052 C CA  . VAL A 1 208 ? -65.909 12.149 -7.999  1.00 24.41  ? 208  VAL A CA  1 
ATOM   1053 C C   . VAL A 1 208 ? -66.802 11.981 -9.219  1.00 27.44  ? 208  VAL A C   1 
ATOM   1054 O O   . VAL A 1 208 ? -66.708 10.962 -9.903  1.00 27.06  ? 208  VAL A O   1 
ATOM   1055 C CB  . VAL A 1 208 ? -66.719 11.921 -6.697  1.00 28.32  ? 208  VAL A CB  1 
ATOM   1056 C CG1 . VAL A 1 208 ? -67.425 10.565 -6.707  1.00 28.17  ? 208  VAL A CG1 1 
ATOM   1057 C CG2 . VAL A 1 208 ? -65.826 12.052 -5.466  1.00 28.12  ? 208  VAL A CG2 1 
ATOM   1058 N N   . GLN A 1 209 ? -67.714 12.943 -9.448  1.00 23.40  ? 209  GLN A N   1 
ATOM   1059 C CA  . GLN A 1 209 ? -68.684 12.875 -10.539 1.00 22.95  ? 209  GLN A CA  1 
ATOM   1060 C C   . GLN A 1 209 ? -68.937 14.250 -11.164 1.00 26.47  ? 209  GLN A C   1 
ATOM   1061 O O   . GLN A 1 209 ? -69.179 15.214 -10.441 1.00 25.75  ? 209  GLN A O   1 
ATOM   1062 C CB  . GLN A 1 209 ? -69.999 12.302 -9.988  1.00 24.22  ? 209  GLN A CB  1 
ATOM   1063 C CG  . GLN A 1 209 ? -70.957 11.772 -11.047 1.00 36.36  ? 209  GLN A CG  1 
ATOM   1064 C CD  . GLN A 1 209 ? -72.185 11.129 -10.441 1.00 51.16  ? 209  GLN A CD  1 
ATOM   1065 O OE1 . GLN A 1 209 ? -72.389 11.123 -9.221  1.00 44.97  ? 209  GLN A OE1 1 
ATOM   1066 N NE2 . GLN A 1 209 ? -73.053 10.595 -11.286 1.00 43.35  ? 209  GLN A NE2 1 
ATOM   1067 N N   . ALA A 1 210 ? -68.894 14.324 -12.507 1.00 23.19  ? 210  ALA A N   1 
ATOM   1068 C CA  . ALA A 1 210 ? -69.163 15.544 -13.273 1.00 23.06  ? 210  ALA A CA  1 
ATOM   1069 C C   . ALA A 1 210 ? -70.617 15.448 -13.747 1.00 26.76  ? 210  ALA A C   1 
ATOM   1070 O O   . ALA A 1 210 ? -70.898 14.888 -14.808 1.00 26.15  ? 210  ALA A O   1 
ATOM   1071 C CB  . ALA A 1 210 ? -68.210 15.641 -14.456 1.00 23.85  ? 210  ALA A CB  1 
ATOM   1072 N N   . LEU A 1 211 ? -71.543 15.946 -12.918 1.00 23.44  ? 211  LEU A N   1 
ATOM   1073 C CA  . LEU A 1 211 ? -72.982 15.837 -13.163 1.00 23.24  ? 211  LEU A CA  1 
ATOM   1074 C C   . LEU A 1 211 ? -73.533 16.750 -14.264 1.00 26.91  ? 211  LEU A C   1 
ATOM   1075 O O   . LEU A 1 211 ? -73.127 17.909 -14.356 1.00 26.40  ? 211  LEU A O   1 
ATOM   1076 C CB  . LEU A 1 211 ? -73.754 16.112 -11.867 1.00 23.32  ? 211  LEU A CB  1 
ATOM   1077 C CG  . LEU A 1 211 ? -73.541 15.112 -10.736 1.00 28.17  ? 211  LEU A CG  1 
ATOM   1078 C CD1 . LEU A 1 211 ? -74.012 15.696 -9.426  1.00 28.41  ? 211  LEU A CD1 1 
ATOM   1079 C CD2 . LEU A 1 211 ? -74.221 13.781 -11.039 1.00 30.88  ? 211  LEU A CD2 1 
ATOM   1080 N N   . PRO A 1 212 ? -74.541 16.277 -15.037 1.00 23.41  ? 212  PRO A N   1 
ATOM   1081 C CA  . PRO A 1 212 ? -75.161 17.136 -16.055 1.00 23.16  ? 212  PRO A CA  1 
ATOM   1082 C C   . PRO A 1 212 ? -76.303 17.964 -15.446 1.00 26.66  ? 212  PRO A C   1 
ATOM   1083 O O   . PRO A 1 212 ? -76.455 18.003 -14.224 1.00 25.97  ? 212  PRO A O   1 
ATOM   1084 C CB  . PRO A 1 212 ? -75.662 16.114 -17.077 1.00 24.93  ? 212  PRO A CB  1 
ATOM   1085 C CG  . PRO A 1 212 ? -76.080 14.963 -16.244 1.00 29.42  ? 212  PRO A CG  1 
ATOM   1086 C CD  . PRO A 1 212 ? -75.174 14.941 -15.032 1.00 24.99  ? 212  PRO A CD  1 
ATOM   1087 N N   . GLY A 1 213 ? -77.089 18.623 -16.295 1.00 23.20  ? 213  GLY A N   1 
ATOM   1088 C CA  . GLY A 1 213 ? -78.217 19.437 -15.861 1.00 23.03  ? 213  GLY A CA  1 
ATOM   1089 C C   . GLY A 1 213 ? -79.360 18.660 -15.237 1.00 27.05  ? 213  GLY A C   1 
ATOM   1090 O O   . GLY A 1 213 ? -79.506 17.458 -15.471 1.00 26.70  ? 213  GLY A O   1 
ATOM   1091 N N   . LEU A 1 214 ? -80.155 19.358 -14.402 1.00 23.63  ? 214  LEU A N   1 
ATOM   1092 C CA  . LEU A 1 214 ? -81.329 18.848 -13.680 1.00 23.44  ? 214  LEU A CA  1 
ATOM   1093 C C   . LEU A 1 214 ? -81.017 17.856 -12.531 1.00 27.65  ? 214  LEU A C   1 
ATOM   1094 O O   . LEU A 1 214 ? -81.967 17.359 -11.923 1.00 27.16  ? 214  LEU A O   1 
ATOM   1095 C CB  . LEU A 1 214 ? -82.379 18.243 -14.634 1.00 23.45  ? 214  LEU A CB  1 
ATOM   1096 C CG  . LEU A 1 214 ? -82.796 19.111 -15.821 1.00 28.02  ? 214  LEU A CG  1 
ATOM   1097 C CD1 . LEU A 1 214 ? -83.801 18.384 -16.691 1.00 28.21  ? 214  LEU A CD1 1 
ATOM   1098 C CD2 . LEU A 1 214 ? -83.374 20.437 -15.358 1.00 30.04  ? 214  LEU A CD2 1 
ATOM   1099 N N   . HIS A 1 215 ? -79.732 17.616 -12.173 1.00 24.63  ? 215  HIS A N   1 
ATOM   1100 C CA  . HIS A 1 215 ? -79.409 16.756 -11.027 1.00 24.71  ? 215  HIS A CA  1 
ATOM   1101 C C   . HIS A 1 215 ? -79.646 17.606 -9.781  1.00 28.48  ? 215  HIS A C   1 
ATOM   1102 O O   . HIS A 1 215 ? -80.325 17.173 -8.854  1.00 28.04  ? 215  HIS A O   1 
ATOM   1103 C CB  . HIS A 1 215 ? -77.958 16.255 -11.070 1.00 25.64  ? 215  HIS A CB  1 
ATOM   1104 C CG  . HIS A 1 215 ? -77.677 15.189 -10.056 1.00 29.18  ? 215  HIS A CG  1 
ATOM   1105 N ND1 . HIS A 1 215 ? -77.354 15.503 -8.747  1.00 31.01  ? 215  HIS A ND1 1 
ATOM   1106 C CD2 . HIS A 1 215 ? -77.718 13.843 -10.182 1.00 31.03  ? 215  HIS A CD2 1 
ATOM   1107 C CE1 . HIS A 1 215 ? -77.179 14.345 -8.129  1.00 30.47  ? 215  HIS A CE1 1 
ATOM   1108 N NE2 . HIS A 1 215 ? -77.388 13.319 -8.954  1.00 30.82  ? 215  HIS A NE2 1 
ATOM   1109 N N   . PHE A 1 216 ? -79.096 18.830 -9.788  1.00 24.96  ? 216  PHE A N   1 
ATOM   1110 C CA  . PHE A 1 216 ? -79.306 19.834 -8.751  1.00 24.72  ? 216  PHE A CA  1 
ATOM   1111 C C   . PHE A 1 216 ? -80.328 20.822 -9.315  1.00 28.53  ? 216  PHE A C   1 
ATOM   1112 O O   . PHE A 1 216 ? -80.733 20.685 -10.472 1.00 28.07  ? 216  PHE A O   1 
ATOM   1113 C CB  . PHE A 1 216 ? -77.995 20.562 -8.426  1.00 26.48  ? 216  PHE A CB  1 
ATOM   1114 C CG  . PHE A 1 216 ? -76.900 19.657 -7.918  1.00 27.97  ? 216  PHE A CG  1 
ATOM   1115 C CD1 . PHE A 1 216 ? -77.058 18.944 -6.739  1.00 31.04  ? 216  PHE A CD1 1 
ATOM   1116 C CD2 . PHE A 1 216 ? -75.700 19.541 -8.600  1.00 30.06  ? 216  PHE A CD2 1 
ATOM   1117 C CE1 . PHE A 1 216 ? -76.042 18.118 -6.262  1.00 31.91  ? 216  PHE A CE1 1 
ATOM   1118 C CE2 . PHE A 1 216 ? -74.682 18.721 -8.118  1.00 32.89  ? 216  PHE A CE2 1 
ATOM   1119 C CZ  . PHE A 1 216 ? -74.861 18.011 -6.956  1.00 30.97  ? 216  PHE A CZ  1 
ATOM   1120 N N   . THR A 1 217 ? -80.743 21.814 -8.517  1.00 25.08  ? 217  THR A N   1 
ATOM   1121 C CA  . THR A 1 217 ? -81.707 22.822 -8.972  1.00 24.81  ? 217  THR A CA  1 
ATOM   1122 C C   . THR A 1 217 ? -81.057 23.688 -10.061 1.00 28.10  ? 217  THR A C   1 
ATOM   1123 O O   . THR A 1 217 ? -79.908 24.083 -9.888  1.00 27.62  ? 217  THR A O   1 
ATOM   1124 C CB  . THR A 1 217 ? -82.144 23.703 -7.794  1.00 33.96  ? 217  THR A CB  1 
ATOM   1125 O OG1 . THR A 1 217 ? -82.530 22.863 -6.706  1.00 34.21  ? 217  THR A OG1 1 
ATOM   1126 C CG2 . THR A 1 217 ? -83.291 24.647 -8.154  1.00 32.90  ? 217  THR A CG2 1 
ATOM   1127 N N   . PRO A 1 218 ? -81.747 23.997 -11.180 1.00 24.30  ? 218  PRO A N   1 
ATOM   1128 C CA  . PRO A 1 218 ? -81.124 24.847 -12.206 1.00 23.94  ? 218  PRO A CA  1 
ATOM   1129 C C   . PRO A 1 218 ? -80.993 26.297 -11.741 1.00 27.58  ? 218  PRO A C   1 
ATOM   1130 O O   . PRO A 1 218 ? -81.830 26.787 -10.983 1.00 27.21  ? 218  PRO A O   1 
ATOM   1131 C CB  . PRO A 1 218 ? -82.070 24.706 -13.399 1.00 25.65  ? 218  PRO A CB  1 
ATOM   1132 C CG  . PRO A 1 218 ? -83.384 24.426 -12.802 1.00 30.17  ? 218  PRO A CG  1 
ATOM   1133 C CD  . PRO A 1 218 ? -83.120 23.618 -11.563 1.00 25.80  ? 218  PRO A CD  1 
ATOM   1134 N N   . GLY A 1 219 ? -79.936 26.959 -12.190 1.00 23.95  ? 219  GLY A N   1 
ATOM   1135 C CA  . GLY A 1 219 ? -79.644 28.337 -11.822 1.00 23.66  ? 219  GLY A CA  1 
ATOM   1136 C C   . GLY A 1 219 ? -80.478 29.374 -12.543 1.00 27.01  ? 219  GLY A C   1 
ATOM   1137 O O   . GLY A 1 219 ? -81.367 29.040 -13.330 1.00 26.42  ? 219  GLY A O   1 
ATOM   1138 N N   . ARG A 1 220 ? -80.189 30.648 -12.252 1.00 23.42  ? 220  ARG A N   1 
ATOM   1139 C CA  . ARG A 1 220 ? -80.870 31.809 -12.829 1.00 23.09  ? 220  ARG A CA  1 
ATOM   1140 C C   . ARG A 1 220 ? -79.838 32.850 -13.267 1.00 26.43  ? 220  ARG A C   1 
ATOM   1141 O O   . ARG A 1 220 ? -78.652 32.721 -12.955 1.00 26.07  ? 220  ARG A O   1 
ATOM   1142 C CB  . ARG A 1 220 ? -81.820 32.425 -11.788 1.00 23.64  ? 220  ARG A CB  1 
ATOM   1143 C CG  . ARG A 1 220 ? -83.022 31.553 -11.459 1.00 35.29  ? 220  ARG A CG  1 
ATOM   1144 C CD  . ARG A 1 220 ? -83.866 32.168 -10.358 1.00 47.04  ? 220  ARG A CD  1 
ATOM   1145 N NE  . ARG A 1 220 ? -83.250 32.015 -9.036  1.00 55.78  ? 220  ARG A NE  1 
ATOM   1146 C CZ  . ARG A 1 220 ? -83.755 32.495 -7.900  1.00 70.43  ? 220  ARG A CZ  1 
ATOM   1147 N NH1 . ARG A 1 220 ? -84.897 33.178 -7.905  1.00 57.90  ? 220  ARG A NH1 1 
ATOM   1148 N NH2 . ARG A 1 220 ? -83.120 32.300 -6.751  1.00 57.48  ? 220  ARG A NH2 1 
ATOM   1149 N N   . GLY A 1 221 ? -80.302 33.866 -13.985 1.00 22.47  ? 221  GLY A N   1 
ATOM   1150 C CA  . GLY A 1 221 ? -79.449 34.949 -14.456 1.00 22.02  ? 221  GLY A CA  1 
ATOM   1151 C C   . GLY A 1 221 ? -78.646 34.579 -15.689 1.00 25.01  ? 221  GLY A C   1 
ATOM   1152 O O   . GLY A 1 221 ? -79.154 33.866 -16.558 1.00 24.70  ? 221  GLY A O   1 
ATOM   1153 N N   . PRO A 1 222 ? -77.390 35.054 -15.817 1.00 20.76  ? 222  PRO A N   1 
ATOM   1154 C CA  . PRO A 1 222 ? -76.612 34.739 -17.025 1.00 20.31  ? 222  PRO A CA  1 
ATOM   1155 C C   . PRO A 1 222 ? -75.986 33.349 -17.039 1.00 23.18  ? 222  PRO A C   1 
ATOM   1156 O O   . PRO A 1 222 ? -75.918 32.677 -16.013 1.00 22.73  ? 222  PRO A O   1 
ATOM   1157 C CB  . PRO A 1 222 ? -75.538 35.828 -17.034 1.00 22.13  ? 222  PRO A CB  1 
ATOM   1158 C CG  . PRO A 1 222 ? -75.313 36.135 -15.607 1.00 26.60  ? 222  PRO A CG  1 
ATOM   1159 C CD  . PRO A 1 222 ? -76.628 35.929 -14.903 1.00 22.23  ? 222  PRO A CD  1 
ATOM   1160 N N   . ILE A 1 223 ? -75.531 32.932 -18.228 1.00 19.08  ? 223  ILE A N   1 
ATOM   1161 C CA  . ILE A 1 223 ? -74.833 31.669 -18.463 1.00 18.63  ? 223  ILE A CA  1 
ATOM   1162 C C   . ILE A 1 223 ? -73.467 32.096 -18.994 1.00 22.29  ? 223  ILE A C   1 
ATOM   1163 O O   . ILE A 1 223 ? -73.372 32.515 -20.144 1.00 21.91  ? 223  ILE A O   1 
ATOM   1164 C CB  . ILE A 1 223 ? -75.607 30.765 -19.467 1.00 21.68  ? 223  ILE A CB  1 
ATOM   1165 C CG1 . ILE A 1 223 ? -76.988 30.369 -18.891 1.00 22.12  ? 223  ILE A CG1 1 
ATOM   1166 C CG2 . ILE A 1 223 ? -74.783 29.512 -19.820 1.00 22.37  ? 223  ILE A CG2 1 
ATOM   1167 C CD1 . ILE A 1 223 ? -77.959 29.774 -19.897 1.00 29.78  ? 223  ILE A CD1 1 
ATOM   1168 N N   . HIS A 1 224 ? -72.427 32.048 -18.148 1.00 18.65  ? 224  HIS A N   1 
ATOM   1169 C CA  . HIS A 1 224 ? -71.089 32.495 -18.540 1.00 18.34  ? 224  HIS A CA  1 
ATOM   1170 C C   . HIS A 1 224 ? -70.372 31.564 -19.510 1.00 22.31  ? 224  HIS A C   1 
ATOM   1171 O O   . HIS A 1 224 ? -69.473 32.035 -20.205 1.00 21.96  ? 224  HIS A O   1 
ATOM   1172 C CB  . HIS A 1 224 ? -70.200 32.728 -17.309 1.00 19.00  ? 224  HIS A CB  1 
ATOM   1173 C CG  . HIS A 1 224 ? -70.694 33.795 -16.381 1.00 22.30  ? 224  HIS A CG  1 
ATOM   1174 N ND1 . HIS A 1 224 ? -71.481 34.843 -16.826 1.00 24.02  ? 224  HIS A ND1 1 
ATOM   1175 C CD2 . HIS A 1 224 ? -70.456 33.960 -15.062 1.00 23.94  ? 224  HIS A CD2 1 
ATOM   1176 C CE1 . HIS A 1 224 ? -71.720 35.591 -15.761 1.00 23.38  ? 224  HIS A CE1 1 
ATOM   1177 N NE2 . HIS A 1 224 ? -71.125 35.095 -14.677 1.00 23.69  ? 224  HIS A NE2 1 
ATOM   1178 N N   . ARG A 1 225 ? -70.714 30.258 -19.542 1.00 18.90  ? 225  ARG A N   1 
ATOM   1179 C CA  . ARG A 1 225 ? -70.046 29.304 -20.431 1.00 18.84  ? 225  ARG A CA  1 
ATOM   1180 C C   . ARG A 1 225 ? -71.016 28.312 -21.079 1.00 23.54  ? 225  ARG A C   1 
ATOM   1181 O O   . ARG A 1 225 ? -71.699 27.578 -20.366 1.00 23.15  ? 225  ARG A O   1 
ATOM   1182 C CB  . ARG A 1 225 ? -68.975 28.512 -19.659 1.00 18.64  ? 225  ARG A CB  1 
ATOM   1183 C CG  . ARG A 1 225 ? -67.778 29.324 -19.169 1.00 27.04  ? 225  ARG A CG  1 
ATOM   1184 C CD  . ARG A 1 225 ? -66.829 29.715 -20.286 1.00 33.89  ? 225  ARG A CD  1 
ATOM   1185 N NE  . ARG A 1 225 ? -65.630 30.382 -19.769 1.00 40.10  ? 225  ARG A NE  1 
ATOM   1186 C CZ  . ARG A 1 225 ? -65.553 31.662 -19.399 1.00 52.05  ? 225  ARG A CZ  1 
ATOM   1187 N NH1 . ARG A 1 225 ? -66.621 32.453 -19.475 1.00 37.43  ? 225  ARG A NH1 1 
ATOM   1188 N NH2 . ARG A 1 225 ? -64.410 32.158 -18.940 1.00 38.36  ? 225  ARG A NH2 1 
ATOM   1189 N N   . ASP A 1 226 ? -71.043 28.265 -22.429 1.00 20.73  ? 226  ASP A N   1 
ATOM   1190 C CA  . ASP A 1 226 ? -71.843 27.300 -23.195 1.00 20.83  ? 226  ASP A CA  1 
ATOM   1191 C C   . ASP A 1 226 ? -71.022 26.029 -23.487 1.00 25.16  ? 226  ASP A C   1 
ATOM   1192 O O   . ASP A 1 226 ? -71.604 25.004 -23.836 1.00 24.54  ? 226  ASP A O   1 
ATOM   1193 C CB  . ASP A 1 226 ? -72.347 27.908 -24.521 1.00 22.73  ? 226  ASP A CB  1 
ATOM   1194 C CG  . ASP A 1 226 ? -73.481 28.910 -24.388 1.00 33.56  ? 226  ASP A CG  1 
ATOM   1195 O OD1 . ASP A 1 226 ? -74.000 29.081 -23.263 1.00 34.39  ? 226  ASP A OD1 1 
ATOM   1196 O OD2 . ASP A 1 226 ? -73.854 29.520 -25.413 1.00 39.22  ? 226  ASP A OD2 1 
ATOM   1197 N N   . GLN A 1 227 ? -69.681 26.097 -23.365 1.00 22.45  ? 227  GLN A N   1 
ATOM   1198 C CA  . GLN A 1 227 ? -68.790 24.957 -23.594 1.00 22.72  ? 227  GLN A CA  1 
ATOM   1199 C C   . GLN A 1 227 ? -67.478 25.178 -22.821 1.00 27.49  ? 227  GLN A C   1 
ATOM   1200 O O   . GLN A 1 227 ? -66.944 26.285 -22.847 1.00 27.01  ? 227  GLN A O   1 
ATOM   1201 C CB  . GLN A 1 227 ? -68.515 24.780 -25.103 1.00 24.18  ? 227  GLN A CB  1 
ATOM   1202 C CG  . GLN A 1 227 ? -68.089 23.356 -25.481 1.00 41.39  ? 227  GLN A CG  1 
ATOM   1203 C CD  . GLN A 1 227 ? -67.800 23.122 -26.952 1.00 61.62  ? 227  GLN A CD  1 
ATOM   1204 O OE1 . GLN A 1 227 ? -66.799 22.487 -27.307 1.00 57.69  ? 227  GLN A OE1 1 
ATOM   1205 N NE2 . GLN A 1 227 ? -68.645 23.595 -27.857 1.00 53.49  ? 227  GLN A NE2 1 
ATOM   1206 N N   . VAL A 1 228 ? -66.993 24.144 -22.105 1.00 24.94  ? 228  VAL A N   1 
ATOM   1207 C CA  . VAL A 1 228 ? -65.748 24.193 -21.322 1.00 25.15  ? 228  VAL A CA  1 
ATOM   1208 C C   . VAL A 1 228 ? -64.909 22.969 -21.702 1.00 30.03  ? 228  VAL A C   1 
ATOM   1209 O O   . VAL A 1 228 ? -65.464 21.878 -21.845 1.00 29.57  ? 228  VAL A O   1 
ATOM   1210 C CB  . VAL A 1 228 ? -66.022 24.237 -19.794 1.00 29.08  ? 228  VAL A CB  1 
ATOM   1211 C CG1 . VAL A 1 228 ? -64.723 24.413 -19.005 1.00 28.93  ? 228  VAL A CG1 1 
ATOM   1212 C CG2 . VAL A 1 228 ? -67.014 25.345 -19.446 1.00 28.90  ? 228  VAL A CG2 1 
ATOM   1213 N N   . ASN A 1 229 ? -63.583 23.148 -21.869 1.00 27.46  ? 229  ASN A N   1 
ATOM   1214 C CA  . ASN A 1 229 ? -62.683 22.056 -22.251 1.00 27.79  ? 229  ASN A CA  1 
ATOM   1215 C C   . ASN A 1 229 ? -61.331 22.165 -21.528 1.00 32.09  ? 229  ASN A C   1 
ATOM   1216 O O   . ASN A 1 229 ? -60.316 22.500 -22.140 1.00 31.69  ? 229  ASN A O   1 
ATOM   1217 C CB  . ASN A 1 229 ? -62.517 22.028 -23.780 1.00 30.06  ? 229  ASN A CB  1 
ATOM   1218 C CG  . ASN A 1 229 ? -61.816 20.794 -24.309 1.00 62.11  ? 229  ASN A CG  1 
ATOM   1219 O OD1 . ASN A 1 229 ? -62.151 19.661 -23.931 1.00 56.40  ? 229  ASN A OD1 1 
ATOM   1220 N ND2 . ASN A 1 229 ? -60.835 20.998 -25.199 1.00 59.44  ? 229  ASN A ND2 1 
ATOM   1221 N N   . CYS A 1 230 ? -61.322 21.855 -20.220 1.00 28.95  ? 230  CYS A N   1 
ATOM   1222 C CA  . CYS A 1 230 ? -60.105 21.894 -19.406 1.00 28.97  ? 230  CYS A CA  1 
ATOM   1223 C C   . CYS A 1 230 ? -59.217 20.701 -19.728 1.00 33.37  ? 230  CYS A C   1 
ATOM   1224 O O   . CYS A 1 230 ? -59.725 19.598 -19.938 1.00 33.03  ? 230  CYS A O   1 
ATOM   1225 C CB  . CYS A 1 230 ? -60.442 21.911 -17.918 1.00 29.30  ? 230  CYS A CB  1 
ATOM   1226 S SG  . CYS A 1 230 ? -61.412 23.341 -17.378 1.00 33.17  ? 230  CYS A SG  1 
ATOM   1227 N N   . SER A 1 231 ? -57.894 20.907 -19.712 1.00 30.21  ? 231  SER A N   1 
ATOM   1228 C CA  . SER A 1 231 ? -56.926 19.828 -19.907 1.00 30.19  ? 231  SER A CA  1 
ATOM   1229 C C   . SER A 1 231 ? -56.814 18.992 -18.618 1.00 34.35  ? 231  SER A C   1 
ATOM   1230 O O   . SER A 1 231 ? -56.595 17.783 -18.695 1.00 34.02  ? 231  SER A O   1 
ATOM   1231 C CB  . SER A 1 231 ? -55.560 20.382 -20.311 1.00 33.83  ? 231  SER A CB  1 
ATOM   1232 O OG  . SER A 1 231 ? -54.812 20.885 -19.215 1.00 42.82  ? 231  SER A OG  1 
ATOM   1233 N N   . GLY A 1 232 ? -56.972 19.650 -17.463 1.00 30.94  ? 232  GLY A N   1 
ATOM   1234 C CA  . GLY A 1 232 ? -56.902 19.026 -16.145 1.00 30.72  ? 232  GLY A CA  1 
ATOM   1235 C C   . GLY A 1 232 ? -55.945 19.728 -15.199 1.00 34.54  ? 232  GLY A C   1 
ATOM   1236 O O   . GLY A 1 232 ? -56.183 19.751 -13.989 1.00 34.15  ? 232  GLY A O   1 
ATOM   1237 N N   . ALA A 1 233 ? -54.854 20.309 -15.743 1.00 30.96  ? 233  ALA A N   1 
ATOM   1238 C CA  . ALA A 1 233 ? -53.819 20.993 -14.961 1.00 30.64  ? 233  ALA A CA  1 
ATOM   1239 C C   . ALA A 1 233 ? -54.084 22.488 -14.685 1.00 33.86  ? 233  ALA A C   1 
ATOM   1240 O O   . ALA A 1 233 ? -53.251 23.112 -14.024 1.00 33.42  ? 233  ALA A O   1 
ATOM   1241 C CB  . ALA A 1 233 ? -52.473 20.834 -15.657 1.00 31.40  ? 233  ALA A CB  1 
ATOM   1242 N N   . GLU A 1 234 ? -55.210 23.069 -15.166 1.00 29.87  ? 234  GLU A N   1 
ATOM   1243 C CA  . GLU A 1 234 ? -55.493 24.495 -14.936 1.00 29.39  ? 234  GLU A CA  1 
ATOM   1244 C C   . GLU A 1 234 ? -55.747 24.801 -13.460 1.00 32.75  ? 234  GLU A C   1 
ATOM   1245 O O   . GLU A 1 234 ? -56.372 24.002 -12.761 1.00 32.20  ? 234  GLU A O   1 
ATOM   1246 C CB  . GLU A 1 234 ? -56.691 24.990 -15.770 1.00 30.70  ? 234  GLU A CB  1 
ATOM   1247 C CG  . GLU A 1 234 ? -56.393 25.198 -17.246 1.00 40.72  ? 234  GLU A CG  1 
ATOM   1248 C CD  . GLU A 1 234 ? -56.653 24.006 -18.144 1.00 60.41  ? 234  GLU A CD  1 
ATOM   1249 O OE1 . GLU A 1 234 ? -56.558 22.855 -17.659 1.00 54.86  ? 234  GLU A OE1 1 
ATOM   1250 O OE2 . GLU A 1 234 ? -56.931 24.223 -19.345 1.00 53.63  ? 234  GLU A OE2 1 
ATOM   1251 N N   . ALA A 1 235 ? -55.267 25.968 -12.998 1.00 29.07  ? 235  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 235 ? -55.438 26.409 -11.613 1.00 28.79  ? 235  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 235 ? -56.870 26.870 -11.348 1.00 32.26  ? 235  ALA A C   1 
ATOM   1254 O O   . ALA A 1 235 ? -57.371 26.653 -10.248 1.00 31.84  ? 235  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 235 ? -54.468 27.535 -11.294 1.00 29.54  ? 235  ALA A CB  1 
ATOM   1256 N N   . TYR A 1 236 ? -57.516 27.521 -12.340 1.00 28.46  ? 236  TYR A N   1 
ATOM   1257 C CA  . TYR A 1 236 ? -58.895 28.007 -12.231 1.00 28.05  ? 236  TYR A CA  1 
ATOM   1258 C C   . TYR A 1 236 ? -59.727 27.568 -13.435 1.00 31.13  ? 236  TYR A C   1 
ATOM   1259 O O   . TYR A 1 236 ? -59.175 27.240 -14.485 1.00 30.48  ? 236  TYR A O   1 
ATOM   1260 C CB  . TYR A 1 236 ? -58.928 29.538 -12.145 1.00 29.31  ? 236  TYR A CB  1 
ATOM   1261 C CG  . TYR A 1 236 ? -58.007 30.140 -11.106 1.00 31.14  ? 236  TYR A CG  1 
ATOM   1262 C CD1 . TYR A 1 236 ? -58.324 30.091 -9.754  1.00 33.17  ? 236  TYR A CD1 1 
ATOM   1263 C CD2 . TYR A 1 236 ? -56.864 30.837 -11.481 1.00 31.93  ? 236  TYR A CD2 1 
ATOM   1264 C CE1 . TYR A 1 236 ? -57.503 30.681 -8.796  1.00 34.11  ? 236  TYR A CE1 1 
ATOM   1265 C CE2 . TYR A 1 236 ? -56.034 31.430 -10.533 1.00 32.87  ? 236  TYR A CE2 1 
ATOM   1266 C CZ  . TYR A 1 236 ? -56.357 31.351 -9.188  1.00 40.30  ? 236  TYR A CZ  1 
ATOM   1267 O OH  . TYR A 1 236 ? -55.553 31.925 -8.227  1.00 40.90  ? 236  TYR A OH  1 
ATOM   1268 N N   . LEU A 1 237 ? -61.061 27.589 -13.286 1.00 27.45  ? 237  LEU A N   1 
ATOM   1269 C CA  . LEU A 1 237 ? -61.996 27.215 -14.355 1.00 27.14  ? 237  LEU A CA  1 
ATOM   1270 C C   . LEU A 1 237 ? -61.980 28.251 -15.487 1.00 31.11  ? 237  LEU A C   1 
ATOM   1271 O O   . LEU A 1 237 ? -62.106 27.880 -16.652 1.00 30.79  ? 237  LEU A O   1 
ATOM   1272 C CB  . LEU A 1 237 ? -63.420 27.076 -13.786 1.00 27.10  ? 237  LEU A CB  1 
ATOM   1273 C CG  . LEU A 1 237 ? -64.492 26.510 -14.721 1.00 31.62  ? 237  LEU A CG  1 
ATOM   1274 C CD1 . LEU A 1 237 ? -64.200 25.066 -15.090 1.00 31.69  ? 237  LEU A CD1 1 
ATOM   1275 C CD2 . LEU A 1 237 ? -65.859 26.608 -14.083 1.00 33.97  ? 237  LEU A CD2 1 
ATOM   1276 N N   . TRP A 1 238 ? -61.834 29.541 -15.140 1.00 27.62  ? 238  TRP A N   1 
ATOM   1277 C CA  . TRP A 1 238 ? -61.772 30.636 -16.122 1.00 27.43  ? 238  TRP A CA  1 
ATOM   1278 C C   . TRP A 1 238 ? -60.514 30.583 -17.009 1.00 31.39  ? 238  TRP A C   1 
ATOM   1279 O O   . TRP A 1 238 ? -60.554 31.099 -18.125 1.00 30.96  ? 238  TRP A O   1 
ATOM   1280 C CB  . TRP A 1 238 ? -61.937 32.031 -15.470 1.00 26.10  ? 238  TRP A CB  1 
ATOM   1281 C CG  . TRP A 1 238 ? -61.095 32.290 -14.255 1.00 27.00  ? 238  TRP A CG  1 
ATOM   1282 C CD1 . TRP A 1 238 ? -59.827 32.788 -14.222 1.00 29.91  ? 238  TRP A CD1 1 
ATOM   1283 C CD2 . TRP A 1 238 ? -61.511 32.161 -12.890 1.00 26.81  ? 238  TRP A CD2 1 
ATOM   1284 N NE1 . TRP A 1 238 ? -59.404 32.920 -12.920 1.00 29.36  ? 238  TRP A NE1 1 
ATOM   1285 C CE2 . TRP A 1 238 ? -60.423 32.548 -12.081 1.00 30.76  ? 238  TRP A CE2 1 
ATOM   1286 C CE3 . TRP A 1 238 ? -62.681 31.695 -12.270 1.00 28.03  ? 238  TRP A CE3 1 
ATOM   1287 C CZ2 . TRP A 1 238 ? -60.472 32.486 -10.686 1.00 30.12  ? 238  TRP A CZ2 1 
ATOM   1288 C CZ3 . TRP A 1 238 ? -62.735 31.653 -10.890 1.00 29.50  ? 238  TRP A CZ3 1 
ATOM   1289 C CH2 . TRP A 1 238 ? -61.637 32.036 -10.112 1.00 30.17  ? 238  TRP A CH2 1 
ATOM   1290 N N   . ASP A 1 239 ? -59.419 29.941 -16.543 1.00 28.08  ? 239  ASP A N   1 
ATOM   1291 C CA  . ASP A 1 239 ? -58.199 29.785 -17.347 1.00 27.95  ? 239  ASP A CA  1 
ATOM   1292 C C   . ASP A 1 239 ? -58.390 28.765 -18.484 1.00 32.02  ? 239  ASP A C   1 
ATOM   1293 O O   . ASP A 1 239 ? -57.632 28.805 -19.453 1.00 31.60  ? 239  ASP A O   1 
ATOM   1294 C CB  . ASP A 1 239 ? -57.002 29.354 -16.473 1.00 29.77  ? 239  ASP A CB  1 
ATOM   1295 C CG  . ASP A 1 239 ? -56.483 30.407 -15.510 1.00 40.02  ? 239  ASP A CG  1 
ATOM   1296 O OD1 . ASP A 1 239 ? -57.096 31.492 -15.425 1.00 40.59  ? 239  ASP A OD1 1 
ATOM   1297 O OD2 . ASP A 1 239 ? -55.453 30.149 -14.850 1.00 45.90  ? 239  ASP A OD2 1 
ATOM   1298 N N   . CYS A 1 240 ? -59.375 27.844 -18.365 1.00 28.74  ? 240  CYS A N   1 
ATOM   1299 C CA  . CYS A 1 240 ? -59.640 26.825 -19.387 1.00 28.64  ? 240  CYS A CA  1 
ATOM   1300 C C   . CYS A 1 240 ? -60.173 27.450 -20.672 1.00 31.97  ? 240  CYS A C   1 
ATOM   1301 O O   . CYS A 1 240 ? -60.940 28.412 -20.605 1.00 31.60  ? 240  CYS A O   1 
ATOM   1302 C CB  . CYS A 1 240 ? -60.630 25.785 -18.870 1.00 29.13  ? 240  CYS A CB  1 
ATOM   1303 S SG  . CYS A 1 240 ? -60.090 24.885 -17.398 1.00 33.14  ? 240  CYS A SG  1 
ATOM   1304 N N   . PRO A 1 241 ? -59.883 26.848 -21.844 1.00 28.00  ? 241  PRO A N   1 
ATOM   1305 C CA  . PRO A 1 241 ? -60.475 27.357 -23.089 1.00 27.62  ? 241  PRO A CA  1 
ATOM   1306 C C   . PRO A 1 241 ? -61.951 26.955 -23.163 1.00 30.84  ? 241  PRO A C   1 
ATOM   1307 O O   . PRO A 1 241 ? -62.308 25.846 -22.759 1.00 30.35  ? 241  PRO A O   1 
ATOM   1308 C CB  . PRO A 1 241 ? -59.638 26.678 -24.172 1.00 29.38  ? 241  PRO A CB  1 
ATOM   1309 C CG  . PRO A 1 241 ? -59.231 25.390 -23.564 1.00 33.82  ? 241  PRO A CG  1 
ATOM   1310 C CD  . PRO A 1 241 ? -59.036 25.665 -22.097 1.00 29.42  ? 241  PRO A CD  1 
ATOM   1311 N N   . GLY A 1 242 ? -62.793 27.861 -23.645 1.00 26.95  ? 242  GLY A N   1 
ATOM   1312 C CA  . GLY A 1 242 ? -64.228 27.621 -23.753 1.00 26.44  ? 242  GLY A CA  1 
ATOM   1313 C C   . GLY A 1 242 ? -64.936 28.587 -24.678 1.00 29.65  ? 242  GLY A C   1 
ATOM   1314 O O   . GLY A 1 242 ? -64.289 29.292 -25.455 1.00 29.27  ? 242  GLY A O   1 
ATOM   1315 N N   . LEU A 1 243 ? -66.276 28.616 -24.596 1.00 25.67  ? 243  LEU A N   1 
ATOM   1316 C CA  . LEU A 1 243 ? -67.127 29.505 -25.391 1.00 25.23  ? 243  LEU A CA  1 
ATOM   1317 C C   . LEU A 1 243 ? -68.032 30.295 -24.446 1.00 28.66  ? 243  LEU A C   1 
ATOM   1318 O O   . LEU A 1 243 ? -68.547 29.714 -23.495 1.00 28.14  ? 243  LEU A O   1 
ATOM   1319 C CB  . LEU A 1 243 ? -68.004 28.695 -26.356 1.00 25.25  ? 243  LEU A CB  1 
ATOM   1320 C CG  . LEU A 1 243 ? -67.278 27.818 -27.368 1.00 29.89  ? 243  LEU A CG  1 
ATOM   1321 C CD1 . LEU A 1 243 ? -68.267 26.982 -28.156 1.00 30.16  ? 243  LEU A CD1 1 
ATOM   1322 C CD2 . LEU A 1 243 ? -66.445 28.651 -28.316 1.00 31.98  ? 243  LEU A CD2 1 
ATOM   1323 N N   . PRO A 1 244 ? -68.283 31.596 -24.700 1.00 25.11  ? 244  PRO A N   1 
ATOM   1324 C CA  . PRO A 1 244 ? -69.163 32.364 -23.801 1.00 24.92  ? 244  PRO A CA  1 
ATOM   1325 C C   . PRO A 1 244 ? -70.655 32.060 -24.000 1.00 28.88  ? 244  PRO A C   1 
ATOM   1326 O O   . PRO A 1 244 ? -71.013 31.151 -24.750 1.00 28.41  ? 244  PRO A O   1 
ATOM   1327 C CB  . PRO A 1 244 ? -68.814 33.815 -24.151 1.00 26.66  ? 244  PRO A CB  1 
ATOM   1328 C CG  . PRO A 1 244 ? -68.445 33.764 -25.578 1.00 31.10  ? 244  PRO A CG  1 
ATOM   1329 C CD  . PRO A 1 244 ? -67.766 32.442 -25.794 1.00 26.65  ? 244  PRO A CD  1 
ATOM   1330 N N   . GLY A 1 245 ? -71.509 32.808 -23.304 1.00 25.49  ? 245  GLY A N   1 
ATOM   1331 C CA  . GLY A 1 245 ? -72.955 32.669 -23.412 1.00 25.30  ? 245  GLY A CA  1 
ATOM   1332 C C   . GLY A 1 245 ? -73.504 33.232 -24.707 1.00 29.22  ? 245  GLY A C   1 
ATOM   1333 O O   . GLY A 1 245 ? -73.781 34.431 -24.787 1.00 28.92  ? 245  GLY A O   1 
ATOM   1334 N N   . GLN A 1 246 ? -73.671 32.367 -25.728 1.00 25.65  ? 246  GLN A N   1 
ATOM   1335 C CA  . GLN A 1 246 ? -74.196 32.737 -27.048 1.00 25.41  ? 246  GLN A CA  1 
ATOM   1336 C C   . GLN A 1 246 ? -75.645 32.226 -27.278 1.00 28.86  ? 246  GLN A C   1 
ATOM   1337 O O   . GLN A 1 246 ? -76.016 31.973 -28.427 1.00 28.48  ? 246  GLN A O   1 
ATOM   1338 C CB  . GLN A 1 246 ? -73.257 32.194 -28.143 1.00 26.83  ? 246  GLN A CB  1 
ATOM   1339 C CG  . GLN A 1 246 ? -71.811 32.672 -28.015 1.00 42.60  ? 246  GLN A CG  1 
ATOM   1340 C CD  . GLN A 1 246 ? -70.918 32.096 -29.092 1.00 62.31  ? 246  GLN A CD  1 
ATOM   1341 O OE1 . GLN A 1 246 ? -71.005 30.913 -29.441 1.00 57.53  ? 246  GLN A OE1 1 
ATOM   1342 N NE2 . GLN A 1 246 ? -70.001 32.902 -29.612 1.00 54.96  ? 246  GLN A NE2 1 
ATOM   1343 N N   . HIS A 1 247 ? -76.454 32.080 -26.189 1.00 25.10  ? 247  HIS A N   1 
ATOM   1344 C CA  A HIS A 1 247 ? -77.845 31.612 -26.235 0.47 24.74  ? 247  HIS A CA  1 
ATOM   1345 C CA  B HIS A 1 247 ? -77.849 31.626 -26.261 0.53 24.85  ? 247  HIS A CA  1 
ATOM   1346 C C   . HIS A 1 247 ? -78.000 30.199 -26.838 1.00 28.05  ? 247  HIS A C   1 
ATOM   1347 O O   . HIS A 1 247 ? -79.088 29.835 -27.288 1.00 27.57  ? 247  HIS A O   1 
ATOM   1348 C CB  A HIS A 1 247 ? -78.746 32.638 -26.952 0.47 25.50  ? 247  HIS A CB  1 
ATOM   1349 C CB  B HIS A 1 247 ? -78.696 32.646 -27.056 0.53 25.72  ? 247  HIS A CB  1 
ATOM   1350 C CG  A HIS A 1 247 ? -78.661 34.015 -26.368 0.47 28.86  ? 247  HIS A CG  1 
ATOM   1351 C CG  B HIS A 1 247 ? -80.078 32.850 -26.516 0.53 29.17  ? 247  HIS A CG  1 
ATOM   1352 N ND1 A HIS A 1 247 ? -77.786 34.960 -26.873 0.47 30.57  ? 247  HIS A ND1 1 
ATOM   1353 N ND1 B HIS A 1 247 ? -80.307 33.644 -25.409 0.53 30.96  ? 247  HIS A ND1 1 
ATOM   1354 C CD2 A HIS A 1 247 ? -79.334 34.555 -25.327 0.47 30.54  ? 247  HIS A CD2 1 
ATOM   1355 C CD2 B HIS A 1 247 ? -81.264 32.389 -26.973 0.53 30.93  ? 247  HIS A CD2 1 
ATOM   1356 C CE1 A HIS A 1 247 ? -77.960 36.044 -26.134 0.47 29.94  ? 247  HIS A CE1 1 
ATOM   1357 C CE1 B HIS A 1 247 ? -81.615 33.628 -25.213 0.53 30.39  ? 247  HIS A CE1 1 
ATOM   1358 N NE2 A HIS A 1 247 ? -78.883 35.846 -25.192 0.47 30.28  ? 247  HIS A NE2 1 
ATOM   1359 N NE2 B HIS A 1 247 ? -82.233 32.882 -26.131 0.53 30.71  ? 247  HIS A NE2 1 
ATOM   1360 N N   . TYR A 1 248 ? -76.928 29.374 -26.793 1.00 23.91  ? 248  TYR A N   1 
ATOM   1361 C CA  . TYR A 1 248 ? -76.958 27.998 -27.307 1.00 23.38  ? 248  TYR A CA  1 
ATOM   1362 C C   . TYR A 1 248 ? -77.475 27.065 -26.221 1.00 27.10  ? 248  TYR A C   1 
ATOM   1363 O O   . TYR A 1 248 ? -78.316 26.212 -26.500 1.00 26.66  ? 248  TYR A O   1 
ATOM   1364 C CB  . TYR A 1 248 ? -75.563 27.554 -27.770 1.00 24.32  ? 248  TYR A CB  1 
ATOM   1365 C CG  . TYR A 1 248 ? -75.533 26.163 -28.369 1.00 25.54  ? 248  TYR A CG  1 
ATOM   1366 C CD1 . TYR A 1 248 ? -76.240 25.867 -29.528 1.00 27.32  ? 248  TYR A CD1 1 
ATOM   1367 C CD2 . TYR A 1 248 ? -74.783 25.148 -27.787 1.00 26.16  ? 248  TYR A CD2 1 
ATOM   1368 C CE1 . TYR A 1 248 ? -76.203 24.594 -30.094 1.00 27.72  ? 248  TYR A CE1 1 
ATOM   1369 C CE2 . TYR A 1 248 ? -74.738 23.871 -28.342 1.00 26.91  ? 248  TYR A CE2 1 
ATOM   1370 C CZ  . TYR A 1 248 ? -75.451 23.597 -29.498 1.00 33.15  ? 248  TYR A CZ  1 
ATOM   1371 O OH  . TYR A 1 248 ? -75.424 22.346 -30.071 1.00 32.80  ? 248  TYR A OH  1 
ATOM   1372 N N   . CYS A 1 249 ? -76.943 27.211 -24.996 1.00 23.63  ? 249  CYS A N   1 
ATOM   1373 C CA  . CYS A 1 249 ? -77.366 26.445 -23.824 1.00 23.33  ? 249  CYS A CA  1 
ATOM   1374 C C   . CYS A 1 249 ? -78.403 27.267 -23.062 1.00 26.43  ? 249  CYS A C   1 
ATOM   1375 O O   . CYS A 1 249 ? -78.570 28.460 -23.320 1.00 25.91  ? 249  CYS A O   1 
ATOM   1376 C CB  . CYS A 1 249 ? -76.174 26.107 -22.930 1.00 23.74  ? 249  CYS A CB  1 
ATOM   1377 S SG  . CYS A 1 249 ? -75.092 24.809 -23.581 1.00 27.69  ? 249  CYS A SG  1 
ATOM   1378 N N   . GLY A 1 250 ? -79.073 26.613 -22.123 1.00 22.52  ? 250  GLY A N   1 
ATOM   1379 C CA  . GLY A 1 250 ? -80.074 27.226 -21.259 1.00 22.09  ? 250  GLY A CA  1 
ATOM   1380 C C   . GLY A 1 250 ? -79.882 26.791 -19.822 1.00 25.30  ? 250  GLY A C   1 
ATOM   1381 O O   . GLY A 1 250 ? -78.977 26.001 -19.536 1.00 24.78  ? 250  GLY A O   1 
ATOM   1382 N N   . HIS A 1 251 ? -80.731 27.286 -18.902 1.00 21.57  ? 251  HIS A N   1 
ATOM   1383 C CA  . HIS A 1 251 ? -80.619 26.918 -17.486 1.00 21.30  ? 251  HIS A CA  1 
ATOM   1384 C C   . HIS A 1 251 ? -80.986 25.450 -17.210 1.00 24.45  ? 251  HIS A C   1 
ATOM   1385 O O   . HIS A 1 251 ? -80.587 24.921 -16.174 1.00 23.92  ? 251  HIS A O   1 
ATOM   1386 C CB  . HIS A 1 251 ? -81.401 27.874 -16.575 1.00 22.23  ? 251  HIS A CB  1 
ATOM   1387 C CG  . HIS A 1 251 ? -80.763 29.224 -16.455 1.00 25.76  ? 251  HIS A CG  1 
ATOM   1388 N ND1 . HIS A 1 251 ? -79.469 29.372 -15.983 1.00 27.56  ? 251  HIS A ND1 1 
ATOM   1389 C CD2 . HIS A 1 251 ? -81.273 30.448 -16.720 1.00 27.66  ? 251  HIS A CD2 1 
ATOM   1390 C CE1 . HIS A 1 251 ? -79.225 30.672 -16.001 1.00 27.03  ? 251  HIS A CE1 1 
ATOM   1391 N NE2 . HIS A 1 251 ? -80.284 31.359 -16.433 1.00 27.42  ? 251  HIS A NE2 1 
ATOM   1392 N N   . LYS A 1 252 ? -81.694 24.781 -18.148 1.00 20.55  ? 252  LYS A N   1 
ATOM   1393 C CA  . LYS A 1 252 ? -82.012 23.350 -18.065 1.00 20.07  ? 252  LYS A CA  1 
ATOM   1394 C C   . LYS A 1 252 ? -80.707 22.528 -18.043 1.00 23.66  ? 252  LYS A C   1 
ATOM   1395 O O   . LYS A 1 252 ? -80.653 21.493 -17.383 1.00 23.20  ? 252  LYS A O   1 
ATOM   1396 C CB  . LYS A 1 252 ? -82.862 22.931 -19.286 1.00 22.42  ? 252  LYS A CB  1 
ATOM   1397 C CG  . LYS A 1 252 ? -83.370 21.489 -19.268 1.00 36.52  ? 252  LYS A CG  1 
ATOM   1398 C CD  . LYS A 1 252 ? -83.988 21.104 -20.601 1.00 45.82  ? 252  LYS A CD  1 
ATOM   1399 C CE  . LYS A 1 252 ? -84.505 19.686 -20.605 1.00 57.23  ? 252  LYS A CE  1 
ATOM   1400 N NZ  . LYS A 1 252 ? -85.114 19.319 -21.911 1.00 66.54  ? 252  LYS A NZ  1 
ATOM   1401 N N   . GLU A 1 253 ? -79.662 23.009 -18.752 1.00 20.03  ? 253  GLU A N   1 
ATOM   1402 C CA  . GLU A 1 253 ? -78.361 22.350 -18.880 1.00 19.70  ? 253  GLU A CA  1 
ATOM   1403 C C   . GLU A 1 253 ? -77.283 22.855 -17.886 1.00 23.35  ? 253  GLU A C   1 
ATOM   1404 O O   . GLU A 1 253 ? -76.099 22.668 -18.162 1.00 22.83  ? 253  GLU A O   1 
ATOM   1405 C CB  . GLU A 1 253 ? -77.854 22.543 -20.324 1.00 21.07  ? 253  GLU A CB  1 
ATOM   1406 C CG  . GLU A 1 253 ? -78.811 22.046 -21.390 1.00 31.43  ? 253  GLU A CG  1 
ATOM   1407 C CD  . GLU A 1 253 ? -78.242 22.146 -22.790 1.00 51.50  ? 253  GLU A CD  1 
ATOM   1408 O OE1 . GLU A 1 253 ? -77.246 21.443 -23.077 1.00 45.06  ? 253  GLU A OE1 1 
ATOM   1409 O OE2 . GLU A 1 253 ? -78.772 22.949 -23.591 1.00 46.02  ? 253  GLU A OE2 1 
ATOM   1410 N N   . ASP A 1 254 ? -77.661 23.451 -16.734 1.00 19.88  ? 254  ASP A N   1 
ATOM   1411 C CA  . ASP A 1 254 ? -76.666 23.957 -15.773 1.00 19.65  ? 254  ASP A CA  1 
ATOM   1412 C C   . ASP A 1 254 ? -75.865 22.834 -15.101 1.00 23.28  ? 254  ASP A C   1 
ATOM   1413 O O   . ASP A 1 254 ? -76.409 22.089 -14.289 1.00 22.75  ? 254  ASP A O   1 
ATOM   1414 C CB  . ASP A 1 254 ? -77.315 24.865 -14.712 1.00 21.52  ? 254  ASP A CB  1 
ATOM   1415 C CG  . ASP A 1 254 ? -77.739 26.226 -15.231 1.00 31.17  ? 254  ASP A CG  1 
ATOM   1416 O OD1 . ASP A 1 254 ? -77.202 26.662 -16.273 1.00 31.53  ? 254  ASP A OD1 1 
ATOM   1417 O OD2 . ASP A 1 254 ? -78.586 26.870 -14.580 1.00 36.94  ? 254  ASP A OD2 1 
ATOM   1418 N N   . ALA A 1 255 ? -74.562 22.742 -15.434 1.00 19.95  ? 255  ALA A N   1 
ATOM   1419 C CA  . ALA A 1 255 ? -73.647 21.714 -14.925 1.00 19.82  ? 255  ALA A CA  1 
ATOM   1420 C C   . ALA A 1 255 ? -73.445 21.765 -13.414 1.00 23.79  ? 255  ALA A C   1 
ATOM   1421 O O   . ALA A 1 255 ? -73.553 22.829 -12.805 1.00 23.37  ? 255  ALA A O   1 
ATOM   1422 C CB  . ALA A 1 255 ? -72.294 21.834 -15.612 1.00 20.55  ? 255  ALA A CB  1 
ATOM   1423 N N   . GLY A 1 256 ? -73.123 20.605 -12.847 1.00 20.46  ? 256  GLY A N   1 
ATOM   1424 C CA  . GLY A 1 256 ? -72.867 20.424 -11.424 1.00 20.25  ? 256  GLY A CA  1 
ATOM   1425 C C   . GLY A 1 256 ? -71.619 19.602 -11.177 1.00 24.14  ? 256  GLY A C   1 
ATOM   1426 O O   . GLY A 1 256 ? -70.954 19.176 -12.125 1.00 23.46  ? 256  GLY A O   1 
ATOM   1427 N N   . VAL A 1 257 ? -71.281 19.389 -9.897  1.00 21.11  ? 257  VAL A N   1 
ATOM   1428 C CA  . VAL A 1 257 ? -70.092 18.625 -9.518  1.00 21.14  ? 257  VAL A CA  1 
ATOM   1429 C C   . VAL A 1 257 ? -70.225 18.030 -8.110  1.00 25.48  ? 257  VAL A C   1 
ATOM   1430 O O   . VAL A 1 257 ? -70.955 18.570 -7.281  1.00 25.05  ? 257  VAL A O   1 
ATOM   1431 C CB  . VAL A 1 257 ? -68.826 19.521 -9.646  1.00 25.09  ? 257  VAL A CB  1 
ATOM   1432 C CG1 . VAL A 1 257 ? -68.877 20.713 -8.691  1.00 24.89  ? 257  VAL A CG1 1 
ATOM   1433 C CG2 . VAL A 1 257 ? -67.548 18.719 -9.431  1.00 24.96  ? 257  VAL A CG2 1 
ATOM   1434 N N   . VAL A 1 258 ? -69.529 16.905 -7.864  1.00 22.46  ? 258  VAL A N   1 
ATOM   1435 C CA  . VAL A 1 258 ? -69.460 16.235 -6.563  1.00 22.46  ? 258  VAL A CA  1 
ATOM   1436 C C   . VAL A 1 258 ? -67.972 15.998 -6.305  1.00 26.62  ? 258  VAL A C   1 
ATOM   1437 O O   . VAL A 1 258 ? -67.343 15.253 -7.054  1.00 26.15  ? 258  VAL A O   1 
ATOM   1438 C CB  . VAL A 1 258 ? -70.254 14.905 -6.518  1.00 26.38  ? 258  VAL A CB  1 
ATOM   1439 C CG1 . VAL A 1 258 ? -70.406 14.414 -5.080  1.00 26.13  ? 258  VAL A CG1 1 
ATOM   1440 C CG2 . VAL A 1 258 ? -71.619 15.055 -7.178  1.00 26.23  ? 258  VAL A CG2 1 
ATOM   1441 N N   . CYS A 1 259 ? -67.400 16.674 -5.296  1.00 23.47  ? 259  CYS A N   1 
ATOM   1442 C CA  . CYS A 1 259 ? -65.979 16.550 -4.968  1.00 23.42  ? 259  CYS A CA  1 
ATOM   1443 C C   . CYS A 1 259 ? -65.759 15.485 -3.892  1.00 26.46  ? 259  CYS A C   1 
ATOM   1444 O O   . CYS A 1 259 ? -66.717 15.005 -3.285  1.00 25.96  ? 259  CYS A O   1 
ATOM   1445 C CB  . CYS A 1 259 ? -65.406 17.899 -4.546  1.00 24.04  ? 259  CYS A CB  1 
ATOM   1446 S SG  . CYS A 1 259 ? -65.613 19.215 -5.777  1.00 28.13  ? 259  CYS A SG  1 
ATOM   1447 N N   . SER A 1 260 ? -64.490 15.108 -3.679  1.00 22.50  ? 260  SER A N   1 
ATOM   1448 C CA  . SER A 1 260 ? -64.095 14.075 -2.713  1.00 22.10  ? 260  SER A CA  1 
ATOM   1449 C C   . SER A 1 260 ? -64.444 14.409 -1.254  1.00 25.53  ? 260  SER A C   1 
ATOM   1450 O O   . SER A 1 260 ? -64.854 13.515 -0.514  1.00 25.09  ? 260  SER A O   1 
ATOM   1451 C CB  . SER A 1 260 ? -62.602 13.771 -2.833  1.00 25.58  ? 260  SER A CB  1 
ATOM   1452 O OG  . SER A 1 260 ? -61.786 14.789 -2.274  1.00 34.00  ? 260  SER A OG  1 
ATOM   1453 N N   . GLU A 1 261 ? -64.298 15.682 -0.845  1.00 21.76  ? 261  GLU A N   1 
ATOM   1454 C CA  . GLU A 1 261 ? -64.565 16.104 0.535   1.00 21.34  ? 261  GLU A CA  1 
ATOM   1455 C C   . GLU A 1 261 ? -66.058 16.286 0.890   1.00 24.85  ? 261  GLU A C   1 
ATOM   1456 O O   . GLU A 1 261 ? -66.353 16.556 2.055   1.00 24.49  ? 261  GLU A O   1 
ATOM   1457 C CB  . GLU A 1 261 ? -63.779 17.387 0.868   1.00 22.67  ? 261  GLU A CB  1 
ATOM   1458 C CG  . GLU A 1 261 ? -62.268 17.211 0.823   1.00 32.52  ? 261  GLU A CG  1 
ATOM   1459 C CD  . GLU A 1 261 ? -61.698 16.279 1.874   1.00 49.35  ? 261  GLU A CD  1 
ATOM   1460 O OE1 . GLU A 1 261 ? -61.966 16.501 3.077   1.00 39.74  ? 261  GLU A OE1 1 
ATOM   1461 O OE2 . GLU A 1 261 ? -60.983 15.324 1.494   1.00 42.20  ? 261  GLU A OE2 1 
ATOM   1462 N N   . HIS A 1 262 ? -66.994 16.128 -0.073  1.00 21.12  ? 262  HIS A N   1 
ATOM   1463 C CA  . HIS A 1 262 ? -68.432 16.259 0.210   1.00 20.78  ? 262  HIS A CA  1 
ATOM   1464 C C   . HIS A 1 262 ? -68.927 15.082 1.060   1.00 24.51  ? 262  HIS A C   1 
ATOM   1465 O O   . HIS A 1 262 ? -68.422 13.971 0.910   1.00 24.14  ? 262  HIS A O   1 
ATOM   1466 C CB  . HIS A 1 262 ? -69.242 16.338 -1.100  1.00 21.43  ? 262  HIS A CB  1 
ATOM   1467 C CG  . HIS A 1 262 ? -70.727 16.398 -0.902  1.00 24.71  ? 262  HIS A CG  1 
ATOM   1468 N ND1 . HIS A 1 262 ? -71.323 17.457 -0.248  1.00 26.43  ? 262  HIS A ND1 1 
ATOM   1469 C CD2 . HIS A 1 262 ? -71.687 15.523 -1.276  1.00 26.41  ? 262  HIS A CD2 1 
ATOM   1470 C CE1 . HIS A 1 262 ? -72.620 17.199 -0.239  1.00 25.83  ? 262  HIS A CE1 1 
ATOM   1471 N NE2 . HIS A 1 262 ? -72.888 16.047 -0.854  1.00 26.16  ? 262  HIS A NE2 1 
ATOM   1472 N N   . GLN A 1 263 ? -69.913 15.335 1.944   1.00 20.85  ? 263  GLN A N   1 
ATOM   1473 C CA  . GLN A 1 263 ? -70.507 14.320 2.814   1.00 20.53  ? 263  GLN A CA  1 
ATOM   1474 C C   . GLN A 1 263 ? -72.032 14.313 2.682   1.00 24.22  ? 263  GLN A C   1 
ATOM   1475 O O   . GLN A 1 263 ? -72.675 15.313 3.000   1.00 23.77  ? 263  GLN A O   1 
ATOM   1476 C CB  . GLN A 1 263 ? -70.123 14.573 4.274   1.00 21.83  ? 263  GLN A CB  1 
ATOM   1477 C CG  . GLN A 1 263 ? -68.661 14.310 4.574   1.00 35.57  ? 263  GLN A CG  1 
ATOM   1478 C CD  . GLN A 1 263 ? -68.385 14.460 6.049   1.00 52.93  ? 263  GLN A CD  1 
ATOM   1479 O OE1 . GLN A 1 263 ? -68.885 13.688 6.873   1.00 47.48  ? 263  GLN A OE1 1 
ATOM   1480 N NE2 . GLN A 1 263 ? -67.598 15.456 6.429   1.00 45.92  ? 263  GLN A NE2 1 
ATOM   1481 N N   . SER A 1 264 ? -72.600 13.183 2.218   1.00 20.67  ? 264  SER A N   1 
ATOM   1482 C CA  . SER A 1 264 ? -74.044 12.972 2.070   1.00 20.39  ? 264  SER A CA  1 
ATOM   1483 C C   . SER A 1 264 ? -74.405 11.731 2.888   1.00 23.37  ? 264  SER A C   1 
ATOM   1484 O O   . SER A 1 264 ? -73.633 10.774 2.882   1.00 22.79  ? 264  SER A O   1 
ATOM   1485 C CB  . SER A 1 264 ? -74.405 12.757 0.602   1.00 24.36  ? 264  SER A CB  1 
ATOM   1486 O OG  . SER A 1 264 ? -75.808 12.651 0.425   1.00 34.27  ? 264  SER A OG  1 
ATOM   1487 N N   . TRP A 1 265 ? -75.558 11.743 3.589   1.00 19.41  ? 265  TRP A N   1 
ATOM   1488 C CA  . TRP A 1 265 ? -75.979 10.630 4.451   1.00 18.95  ? 265  TRP A CA  1 
ATOM   1489 C C   . TRP A 1 265 ? -77.299 9.990  4.033   1.00 22.79  ? 265  TRP A C   1 
ATOM   1490 O O   . TRP A 1 265 ? -78.108 10.603 3.338   1.00 22.39  ? 265  TRP A O   1 
ATOM   1491 C CB  . TRP A 1 265 ? -76.096 11.102 5.911   1.00 17.51  ? 265  TRP A CB  1 
ATOM   1492 C CG  . TRP A 1 265 ? -74.835 11.694 6.458   1.00 18.33  ? 265  TRP A CG  1 
ATOM   1493 C CD1 . TRP A 1 265 ? -73.849 11.045 7.139   1.00 21.20  ? 265  TRP A CD1 1 
ATOM   1494 C CD2 . TRP A 1 265 ? -74.413 13.055 6.338   1.00 18.14  ? 265  TRP A CD2 1 
ATOM   1495 N NE1 . TRP A 1 265 ? -72.838 11.921 7.455   1.00 20.61  ? 265  TRP A NE1 1 
ATOM   1496 C CE2 . TRP A 1 265 ? -73.156 13.162 6.968   1.00 22.02  ? 265  TRP A CE2 1 
ATOM   1497 C CE3 . TRP A 1 265 ? -74.972 14.196 5.745   1.00 19.37  ? 265  TRP A CE3 1 
ATOM   1498 C CZ2 . TRP A 1 265 ? -72.458 14.371 7.039   1.00 21.32  ? 265  TRP A CZ2 1 
ATOM   1499 C CZ3 . TRP A 1 265 ? -74.275 15.388 5.806   1.00 20.79  ? 265  TRP A CZ3 1 
ATOM   1500 C CH2 . TRP A 1 265 ? -73.036 15.470 6.451   1.00 21.43  ? 265  TRP A CH2 1 
ATOM   1501 N N   . ARG A 1 266 ? -77.510 8.748  4.492   1.00 19.32  ? 266  ARG A N   1 
ATOM   1502 C CA  . ARG A 1 266 ? -78.732 7.974  4.254   1.00 19.11  ? 266  ARG A CA  1 
ATOM   1503 C C   . ARG A 1 266 ? -78.834 6.831  5.271   1.00 23.29  ? 266  ARG A C   1 
ATOM   1504 O O   . ARG A 1 266 ? -77.854 6.537  5.958   1.00 22.69  ? 266  ARG A O   1 
ATOM   1505 C CB  . ARG A 1 266 ? -78.782 7.425  2.814   1.00 18.74  ? 266  ARG A CB  1 
ATOM   1506 C CG  . ARG A 1 266 ? -77.750 6.348  2.496   1.00 26.98  ? 266  ARG A CG  1 
ATOM   1507 C CD  . ARG A 1 266 ? -77.872 5.873  1.063   1.00 35.60  ? 266  ARG A CD  1 
ATOM   1508 N NE  . ARG A 1 266 ? -76.936 4.786  0.766   1.00 43.53  ? 266  ARG A NE  1 
ATOM   1509 C CZ  . ARG A 1 266 ? -76.819 4.183  -0.416  1.00 57.65  ? 266  ARG A CZ  1 
ATOM   1510 N NH1 . ARG A 1 266 ? -77.580 4.555  -1.442  1.00 45.66  ? 266  ARG A NH1 1 
ATOM   1511 N NH2 . ARG A 1 266 ? -75.938 3.204  -0.583  1.00 44.02  ? 266  ARG A NH2 1 
ATOM   1512 N N   . LEU A 1 267 ? -80.010 6.184  5.354   1.00 20.23  ? 267  LEU A N   1 
ATOM   1513 C CA  . LEU A 1 267 ? -80.239 5.061  6.266   1.00 20.15  ? 267  LEU A CA  1 
ATOM   1514 C C   . LEU A 1 267 ? -80.838 3.879  5.509   1.00 24.60  ? 267  LEU A C   1 
ATOM   1515 O O   . LEU A 1 267 ? -82.027 3.888  5.192   1.00 24.14  ? 267  LEU A O   1 
ATOM   1516 C CB  . LEU A 1 267 ? -81.146 5.478  7.429   1.00 20.14  ? 267  LEU A CB  1 
ATOM   1517 C CG  . LEU A 1 267 ? -80.532 6.455  8.424   1.00 24.82  ? 267  LEU A CG  1 
ATOM   1518 C CD1 . LEU A 1 267 ? -81.600 7.203  9.180   1.00 24.92  ? 267  LEU A CD1 1 
ATOM   1519 C CD2 . LEU A 1 267 ? -79.628 5.744  9.392   1.00 27.66  ? 267  LEU A CD2 1 
ATOM   1520 N N   . THR A 1 268 ? -80.003 2.867  5.214   1.00 21.76  ? 268  THR A N   1 
ATOM   1521 C CA  . THR A 1 268 ? -80.392 1.667  4.471   1.00 21.92  ? 268  THR A CA  1 
ATOM   1522 C C   . THR A 1 268 ? -80.528 0.455  5.394   1.00 26.27  ? 268  THR A C   1 
ATOM   1523 O O   . THR A 1 268 ? -79.812 0.362  6.390   1.00 25.85  ? 268  THR A O   1 
ATOM   1524 C CB  . THR A 1 268 ? -79.342 1.377  3.397   1.00 30.36  ? 268  THR A CB  1 
ATOM   1525 O OG1 . THR A 1 268 ? -78.067 1.232  4.026   1.00 28.62  ? 268  THR A OG1 1 
ATOM   1526 C CG2 . THR A 1 268 ? -79.277 2.468  2.339   1.00 29.68  ? 268  THR A CG2 1 
ATOM   1527 N N   . GLY A 1 269 ? -81.416 -0.470 5.029   1.00 23.16  ? 269  GLY A N   1 
ATOM   1528 C CA  . GLY A 1 269 ? -81.656 -1.701 5.776   1.00 23.18  ? 269  GLY A CA  1 
ATOM   1529 C C   . GLY A 1 269 ? -82.984 -1.754 6.505   1.00 27.41  ? 269  GLY A C   1 
ATOM   1530 O O   . GLY A 1 269 ? -83.598 -2.821 6.587   1.00 27.06  ? 269  GLY A O   1 
ATOM   1531 N N   . GLY A 1 270 ? -83.428 -0.615 7.035   1.00 24.11  ? 270  GLY A N   1 
ATOM   1532 C CA  . GLY A 1 270 ? -84.675 -0.526 7.785   1.00 23.97  ? 270  GLY A CA  1 
ATOM   1533 C C   . GLY A 1 270 ? -85.931 -0.532 6.939   1.00 27.77  ? 270  GLY A C   1 
ATOM   1534 O O   . GLY A 1 270 ? -85.893 -0.827 5.742   1.00 27.12  ? 270  GLY A O   1 
ATOM   1535 N N   . ALA A 1 271 ? -87.062 -0.199 7.576   1.00 24.59  ? 271  ALA A N   1 
ATOM   1536 C CA  . ALA A 1 271 ? -88.375 -0.174 6.929   1.00 24.49  ? 271  ALA A CA  1 
ATOM   1537 C C   . ALA A 1 271 ? -88.529 0.979  5.935   1.00 28.23  ? 271  ALA A C   1 
ATOM   1538 O O   . ALA A 1 271 ? -89.150 0.789  4.889   1.00 27.94  ? 271  ALA A O   1 
ATOM   1539 C CB  . ALA A 1 271 ? -89.472 -0.095 7.981   1.00 25.24  ? 271  ALA A CB  1 
ATOM   1540 N N   . ASP A 1 272 ? -87.992 2.169  6.266   1.00 24.47  ? 272  ASP A N   1 
ATOM   1541 C CA  . ASP A 1 272 ? -88.086 3.350  5.403   1.00 24.13  ? 272  ASP A CA  1 
ATOM   1542 C C   . ASP A 1 272 ? -86.810 4.218  5.476   1.00 27.30  ? 272  ASP A C   1 
ATOM   1543 O O   . ASP A 1 272 ? -85.827 3.814  6.098   1.00 26.76  ? 272  ASP A O   1 
ATOM   1544 C CB  . ASP A 1 272 ? -89.357 4.148  5.755   1.00 26.10  ? 272  ASP A CB  1 
ATOM   1545 C CG  . ASP A 1 272 ? -89.314 4.859  7.091   1.00 36.77  ? 272  ASP A CG  1 
ATOM   1546 O OD1 . ASP A 1 272 ? -88.737 4.295  8.046   1.00 42.79  ? 272  ASP A OD1 1 
ATOM   1547 O OD2 . ASP A 1 272 ? -89.858 5.979  7.182   1.00 37.43  ? 272  ASP A OD2 1 
ATOM   1548 N N   . ARG A 1 273 ? -86.824 5.390  4.811   1.00 23.43  ? 273  ARG A N   1 
ATOM   1549 C CA  . ARG A 1 273 ? -85.682 6.313  4.731   1.00 22.97  ? 273  ARG A CA  1 
ATOM   1550 C C   . ARG A 1 273 ? -85.078 6.801  6.063   1.00 26.14  ? 273  ARG A C   1 
ATOM   1551 O O   . ARG A 1 273 ? -83.915 7.203  6.038   1.00 25.44  ? 273  ARG A O   1 
ATOM   1552 C CB  . ARG A 1 273 ? -86.035 7.545  3.876   1.00 23.07  ? 273  ARG A CB  1 
ATOM   1553 C CG  . ARG A 1 273 ? -87.071 8.491  4.494   1.00 32.09  ? 273  ARG A CG  1 
ATOM   1554 C CD  . ARG A 1 273 ? -87.267 9.717  3.631   1.00 39.97  ? 273  ARG A CD  1 
ATOM   1555 N NE  . ARG A 1 273 ? -86.074 10.567 3.597   1.00 46.12  ? 273  ARG A NE  1 
ATOM   1556 C CZ  . ARG A 1 273 ? -85.704 11.423 4.550   1.00 58.23  ? 273  ARG A CZ  1 
ATOM   1557 N NH1 . ARG A 1 273 ? -86.437 11.566 5.652   1.00 44.24  ? 273  ARG A NH1 1 
ATOM   1558 N NH2 . ARG A 1 273 ? -84.597 12.142 4.410   1.00 44.25  ? 273  ARG A NH2 1 
ATOM   1559 N N   . CYS A 1 274 ? -85.847 6.810  7.187   1.00 22.58  ? 274  CYS A N   1 
ATOM   1560 C CA  A CYS A 1 274 ? -85.367 7.272  8.497   0.50 22.36  ? 274  CYS A CA  1 
ATOM   1561 C CA  B CYS A 1 274 ? -85.345 7.269  8.487   0.50 22.32  ? 274  CYS A CA  1 
ATOM   1562 C C   . CYS A 1 274 ? -85.193 6.095  9.478   1.00 26.04  ? 274  CYS A C   1 
ATOM   1563 O O   . CYS A 1 274 ? -85.596 6.182  10.641  1.00 25.40  ? 274  CYS A O   1 
ATOM   1564 C CB  A CYS A 1 274 ? -86.300 8.345  9.058   0.50 22.62  ? 274  CYS A CB  1 
ATOM   1565 C CB  B CYS A 1 274 ? -86.234 8.383  9.038   0.50 22.56  ? 274  CYS A CB  1 
ATOM   1566 S SG  A CYS A 1 274 ? -86.208 9.934  8.196   0.50 26.48  ? 274  CYS A SG  1 
ATOM   1567 S SG  B CYS A 1 274 ? -87.997 7.978  9.076   0.50 26.39  ? 274  CYS A SG  1 
ATOM   1568 N N   . GLU A 1 275 ? -84.564 4.997  9.017   1.00 22.62  ? 275  GLU A N   1 
ATOM   1569 C CA  . GLU A 1 275 ? -84.312 3.803  9.836   1.00 22.35  ? 275  GLU A CA  1 
ATOM   1570 C C   . GLU A 1 275 ? -83.301 2.886  9.132   1.00 25.54  ? 275  GLU A C   1 
ATOM   1571 O O   . GLU A 1 275 ? -83.444 2.652  7.931   1.00 25.24  ? 275  GLU A O   1 
ATOM   1572 C CB  . GLU A 1 275 ? -85.615 3.017  10.082  1.00 23.85  ? 275  GLU A CB  1 
ATOM   1573 C CG  . GLU A 1 275 ? -85.513 2.033  11.237  1.00 35.65  ? 275  GLU A CG  1 
ATOM   1574 C CD  . GLU A 1 275 ? -86.674 1.067  11.373  1.00 59.20  ? 275  GLU A CD  1 
ATOM   1575 O OE1 . GLU A 1 275 ? -87.749 1.327  10.783  1.00 55.50  ? 275  GLU A OE1 1 
ATOM   1576 O OE2 . GLU A 1 275 ? -86.504 0.039  12.067  1.00 54.48  ? 275  GLU A OE2 1 
ATOM   1577 N N   . GLY A 1 276 ? -82.308 2.384  9.873   1.00 21.43  ? 276  GLY A N   1 
ATOM   1578 C CA  . GLY A 1 276 ? -81.304 1.466  9.338   1.00 21.09  ? 276  GLY A CA  1 
ATOM   1579 C C   . GLY A 1 276 ? -79.860 1.797  9.659   1.00 24.39  ? 276  GLY A C   1 
ATOM   1580 O O   . GLY A 1 276 ? -79.573 2.514  10.620  1.00 23.84  ? 276  GLY A O   1 
ATOM   1581 N N   . GLN A 1 277 ? -78.938 1.252  8.842   1.00 20.63  ? 277  GLN A N   1 
ATOM   1582 C CA  . GLN A 1 277 ? -77.493 1.440  8.996   1.00 20.31  ? 277  GLN A CA  1 
ATOM   1583 C C   . GLN A 1 277 ? -77.086 2.846  8.578   1.00 24.03  ? 277  GLN A C   1 
ATOM   1584 O O   . GLN A 1 277 ? -77.481 3.298  7.508   1.00 23.45  ? 277  GLN A O   1 
ATOM   1585 C CB  . GLN A 1 277 ? -76.726 0.403  8.154   1.00 21.56  ? 277  GLN A CB  1 
ATOM   1586 C CG  . GLN A 1 277 ? -75.242 0.320  8.478   1.00 34.98  ? 277  GLN A CG  1 
ATOM   1587 C CD  . GLN A 1 277 ? -74.588 -0.838 7.771   1.00 53.73  ? 277  GLN A CD  1 
ATOM   1588 O OE1 . GLN A 1 277 ? -74.280 -1.871 8.372   1.00 49.64  ? 277  GLN A OE1 1 
ATOM   1589 N NE2 . GLN A 1 277 ? -74.376 -0.700 6.472   1.00 45.80  ? 277  GLN A NE2 1 
ATOM   1590 N N   . VAL A 1 278 ? -76.248 3.509  9.390   1.00 20.70  ? 278  VAL A N   1 
ATOM   1591 C CA  . VAL A 1 278 ? -75.796 4.873  9.112   1.00 20.53  ? 278  VAL A CA  1 
ATOM   1592 C C   . VAL A 1 278 ? -74.703 4.816  8.046   1.00 24.41  ? 278  VAL A C   1 
ATOM   1593 O O   . VAL A 1 278 ? -73.596 4.363  8.334   1.00 23.97  ? 278  VAL A O   1 
ATOM   1594 C CB  . VAL A 1 278 ? -75.301 5.610  10.387  1.00 24.42  ? 278  VAL A CB  1 
ATOM   1595 C CG1 . VAL A 1 278 ? -74.966 7.068  10.080  1.00 24.24  ? 278  VAL A CG1 1 
ATOM   1596 C CG2 . VAL A 1 278 ? -76.336 5.546  11.506  1.00 24.26  ? 278  VAL A CG2 1 
ATOM   1597 N N   . GLU A 1 279 ? -75.017 5.270  6.821   1.00 20.98  ? 279  GLU A N   1 
ATOM   1598 C CA  . GLU A 1 279 ? -74.067 5.298  5.710   1.00 20.80  ? 279  GLU A CA  1 
ATOM   1599 C C   . GLU A 1 279 ? -73.675 6.742  5.398   1.00 24.64  ? 279  GLU A C   1 
ATOM   1600 O O   . GLU A 1 279 ? -74.494 7.642  5.577   1.00 24.22  ? 279  GLU A O   1 
ATOM   1601 C CB  . GLU A 1 279 ? -74.671 4.632  4.468   1.00 22.14  ? 279  GLU A CB  1 
ATOM   1602 C CG  . GLU A 1 279 ? -74.899 3.140  4.638   1.00 31.96  ? 279  GLU A CG  1 
ATOM   1603 C CD  . GLU A 1 279 ? -75.231 2.379  3.368   1.00 50.32  ? 279  GLU A CD  1 
ATOM   1604 O OE1 . GLU A 1 279 ? -75.474 3.024  2.322   1.00 44.38  ? 279  GLU A OE1 1 
ATOM   1605 O OE2 . GLU A 1 279 ? -75.281 1.130  3.430   1.00 43.28  ? 279  GLU A OE2 1 
ATOM   1606 N N   . VAL A 1 280 ? -72.425 6.961  4.945   1.00 21.15  ? 280  VAL A N   1 
ATOM   1607 C CA  . VAL A 1 280 ? -71.919 8.294  4.593   1.00 20.98  ? 280  VAL A CA  1 
ATOM   1608 C C   . VAL A 1 280 ? -71.079 8.224  3.307   1.00 25.10  ? 280  VAL A C   1 
ATOM   1609 O O   . VAL A 1 280 ? -70.200 7.369  3.198   1.00 24.83  ? 280  VAL A O   1 
ATOM   1610 C CB  . VAL A 1 280 ? -71.160 8.972  5.769   1.00 24.81  ? 280  VAL A CB  1 
ATOM   1611 C CG1 . VAL A 1 280 ? -69.917 8.185  6.185   1.00 24.58  ? 280  VAL A CG1 1 
ATOM   1612 C CG2 . VAL A 1 280 ? -70.796 10.416 5.431   1.00 24.60  ? 280  VAL A CG2 1 
ATOM   1613 N N   . HIS A 1 281 ? -71.364 9.114  2.335   1.00 21.57  ? 281  HIS A N   1 
ATOM   1614 C CA  . HIS A 1 281 ? -70.654 9.163  1.056   1.00 21.34  ? 281  HIS A CA  1 
ATOM   1615 C C   . HIS A 1 281 ? -69.516 10.185 1.136   1.00 25.15  ? 281  HIS A C   1 
ATOM   1616 O O   . HIS A 1 281 ? -69.727 11.366 0.863   1.00 24.85  ? 281  HIS A O   1 
ATOM   1617 C CB  . HIS A 1 281 ? -71.631 9.502  -0.085  1.00 22.12  ? 281  HIS A CB  1 
ATOM   1618 C CG  . HIS A 1 281 ? -71.012 9.482  -1.447  1.00 25.46  ? 281  HIS A CG  1 
ATOM   1619 N ND1 . HIS A 1 281 ? -70.874 8.304  -2.158  1.00 27.18  ? 281  HIS A ND1 1 
ATOM   1620 C CD2 . HIS A 1 281 ? -70.533 10.503 -2.193  1.00 27.17  ? 281  HIS A CD2 1 
ATOM   1621 C CE1 . HIS A 1 281 ? -70.306 8.641  -3.305  1.00 26.59  ? 281  HIS A CE1 1 
ATOM   1622 N NE2 . HIS A 1 281 ? -70.091 9.955  -3.373  1.00 26.94  ? 281  HIS A NE2 1 
ATOM   1623 N N   . PHE A 1 282 ? -68.318 9.723  1.528   1.00 21.44  ? 282  PHE A N   1 
ATOM   1624 C CA  . PHE A 1 282 ? -67.114 10.549 1.663   1.00 21.11  ? 282  PHE A CA  1 
ATOM   1625 C C   . PHE A 1 282 ? -66.003 9.936  0.802   1.00 24.84  ? 282  PHE A C   1 
ATOM   1626 O O   . PHE A 1 282 ? -65.890 8.712  0.739   1.00 24.39  ? 282  PHE A O   1 
ATOM   1627 C CB  . PHE A 1 282 ? -66.701 10.620 3.143   1.00 22.89  ? 282  PHE A CB  1 
ATOM   1628 C CG  . PHE A 1 282 ? -65.568 11.562 3.473   1.00 24.46  ? 282  PHE A CG  1 
ATOM   1629 C CD1 . PHE A 1 282 ? -65.691 12.925 3.250   1.00 27.57  ? 282  PHE A CD1 1 
ATOM   1630 C CD2 . PHE A 1 282 ? -64.432 11.106 4.127   1.00 26.71  ? 282  PHE A CD2 1 
ATOM   1631 C CE1 . PHE A 1 282 ? -64.661 13.800 3.593   1.00 28.52  ? 282  PHE A CE1 1 
ATOM   1632 C CE2 . PHE A 1 282 ? -63.397 11.980 4.455   1.00 29.60  ? 282  PHE A CE2 1 
ATOM   1633 C CZ  . PHE A 1 282 ? -63.521 13.322 4.193   1.00 27.69  ? 282  PHE A CZ  1 
ATOM   1634 N N   . ARG A 1 283 ? -65.212 10.786 0.116   1.00 21.34  ? 283  ARG A N   1 
ATOM   1635 C CA  . ARG A 1 283 ? -64.126 10.374 -0.788  1.00 21.06  ? 283  ARG A CA  1 
ATOM   1636 C C   . ARG A 1 283 ? -64.652 9.547  -1.979  1.00 24.89  ? 283  ARG A C   1 
ATOM   1637 O O   . ARG A 1 283 ? -63.974 8.638  -2.459  1.00 24.44  ? 283  ARG A O   1 
ATOM   1638 C CB  . ARG A 1 283 ? -62.999 9.635  -0.034  1.00 21.10  ? 283  ARG A CB  1 
ATOM   1639 C CG  . ARG A 1 283 ? -62.448 10.390 1.173   1.00 30.64  ? 283  ARG A CG  1 
ATOM   1640 C CD  . ARG A 1 283 ? -61.498 11.509 0.789   1.00 39.23  ? 283  ARG A CD  1 
ATOM   1641 N NE  . ARG A 1 283 ? -61.050 12.273 1.957   1.00 46.57  ? 283  ARG A NE  1 
ATOM   1642 C CZ  . ARG A 1 283 ? -60.105 11.892 2.817   1.00 59.63  ? 283  ARG A CZ  1 
ATOM   1643 N NH1 . ARG A 1 283 ? -59.477 10.729 2.663   1.00 46.37  ? 283  ARG A NH1 1 
ATOM   1644 N NH2 . ARG A 1 283 ? -59.783 12.671 3.844   1.00 45.62  ? 283  ARG A NH2 1 
ATOM   1645 N N   . GLY A 1 284 ? -65.847 9.898  -2.449  1.00 21.49  ? 284  GLY A N   1 
ATOM   1646 C CA  . GLY A 1 284 ? -66.504 9.246  -3.575  1.00 21.32  ? 284  GLY A CA  1 
ATOM   1647 C C   . GLY A 1 284 ? -66.895 7.793  -3.389  1.00 25.13  ? 284  GLY A C   1 
ATOM   1648 O O   . GLY A 1 284 ? -67.067 7.084  -4.382  1.00 24.56  ? 284  GLY A O   1 
ATOM   1649 N N   . VAL A 1 285 ? -67.059 7.338  -2.133  1.00 21.86  ? 285  VAL A N   1 
ATOM   1650 C CA  . VAL A 1 285 ? -67.442 5.956  -1.819  1.00 21.72  ? 285  VAL A CA  1 
ATOM   1651 C C   . VAL A 1 285 ? -68.308 5.926  -0.564  1.00 26.03  ? 285  VAL A C   1 
ATOM   1652 O O   . VAL A 1 285 ? -68.088 6.725  0.346   1.00 25.62  ? 285  VAL A O   1 
ATOM   1653 C CB  . VAL A 1 285 ? -66.216 5.015  -1.647  1.00 25.52  ? 285  VAL A CB  1 
ATOM   1654 C CG1 . VAL A 1 285 ? -65.559 4.698  -2.985  1.00 25.33  ? 285  VAL A CG1 1 
ATOM   1655 C CG2 . VAL A 1 285 ? -65.196 5.585  -0.660  1.00 25.32  ? 285  VAL A CG2 1 
ATOM   1656 N N   . TRP A 1 286 ? -69.270 4.990  -0.500  1.00 22.97  ? 286  TRP A N   1 
ATOM   1657 C CA  . TRP A 1 286 ? -70.128 4.841  0.678   1.00 22.99  ? 286  TRP A CA  1 
ATOM   1658 C C   . TRP A 1 286 ? -69.324 4.200  1.810   1.00 28.02  ? 286  TRP A C   1 
ATOM   1659 O O   . TRP A 1 286 ? -68.519 3.304  1.557   1.00 27.37  ? 286  TRP A O   1 
ATOM   1660 C CB  . TRP A 1 286 ? -71.385 4.019  0.362   1.00 21.58  ? 286  TRP A CB  1 
ATOM   1661 C CG  . TRP A 1 286 ? -72.412 4.791  -0.408  1.00 22.43  ? 286  TRP A CG  1 
ATOM   1662 C CD1 . TRP A 1 286 ? -72.710 4.672  -1.733  1.00 25.29  ? 286  TRP A CD1 1 
ATOM   1663 C CD2 . TRP A 1 286 ? -73.233 5.850  0.095   1.00 22.21  ? 286  TRP A CD2 1 
ATOM   1664 N NE1 . TRP A 1 286 ? -73.695 5.568  -2.078  1.00 24.68  ? 286  TRP A NE1 1 
ATOM   1665 C CE2 . TRP A 1 286 ? -74.032 6.307  -0.974  1.00 26.03  ? 286  TRP A CE2 1 
ATOM   1666 C CE3 . TRP A 1 286 ? -73.381 6.451  1.354   1.00 23.38  ? 286  TRP A CE3 1 
ATOM   1667 C CZ2 . TRP A 1 286 ? -74.968 7.334  -0.821  1.00 25.27  ? 286  TRP A CZ2 1 
ATOM   1668 C CZ3 . TRP A 1 286 ? -74.309 7.467  1.504   1.00 24.78  ? 286  TRP A CZ3 1 
ATOM   1669 C CH2 . TRP A 1 286 ? -75.088 7.901  0.425   1.00 25.38  ? 286  TRP A CH2 1 
ATOM   1670 N N   . ASN A 1 287 ? -69.505 4.704  3.042   1.00 25.74  ? 287  ASN A N   1 
ATOM   1671 C CA  . ASN A 1 287 ? -68.779 4.246  4.229   1.00 26.01  ? 287  ASN A CA  1 
ATOM   1672 C C   . ASN A 1 287 ? -69.719 4.060  5.409   1.00 30.94  ? 287  ASN A C   1 
ATOM   1673 O O   . ASN A 1 287 ? -70.786 4.665  5.447   1.00 30.31  ? 287  ASN A O   1 
ATOM   1674 C CB  . ASN A 1 287 ? -67.721 5.278  4.613   1.00 26.81  ? 287  ASN A CB  1 
ATOM   1675 C CG  . ASN A 1 287 ? -66.720 5.567  3.521   1.00 49.16  ? 287  ASN A CG  1 
ATOM   1676 O OD1 . ASN A 1 287 ? -66.103 4.662  2.961   1.00 44.56  ? 287  ASN A OD1 1 
ATOM   1677 N ND2 . ASN A 1 287 ? -66.525 6.833  3.197   1.00 40.43  ? 287  ASN A ND2 1 
ATOM   1678 N N   . THR A 1 288 ? -69.299 3.245  6.386   1.00 28.73  ? 288  THR A N   1 
ATOM   1679 C CA  . THR A 1 288 ? -70.055 2.971  7.614   1.00 29.12  ? 288  THR A CA  1 
ATOM   1680 C C   . THR A 1 288 ? -69.613 3.930  8.727   1.00 34.29  ? 288  THR A C   1 
ATOM   1681 O O   . THR A 1 288 ? -68.585 4.595  8.590   1.00 33.72  ? 288  THR A O   1 
ATOM   1682 C CB  . THR A 1 288 ? -69.823 1.513  8.053   1.00 37.14  ? 288  THR A CB  1 
ATOM   1683 O OG1 . THR A 1 288 ? -68.433 1.212  7.923   1.00 36.96  ? 288  THR A OG1 1 
ATOM   1684 C CG2 . THR A 1 288 ? -70.625 0.517  7.233   1.00 35.43  ? 288  THR A CG2 1 
ATOM   1685 N N   . VAL A 1 289 ? -70.388 3.994  9.827   1.00 32.14  ? 289  VAL A N   1 
ATOM   1686 C CA  . VAL A 1 289 ? -70.080 4.831  10.994  1.00 32.65  ? 289  VAL A CA  1 
ATOM   1687 C C   . VAL A 1 289 ? -69.741 3.916  12.177  1.00 38.51  ? 289  VAL A C   1 
ATOM   1688 O O   . VAL A 1 289 ? -70.397 2.894  12.369  1.00 38.06  ? 289  VAL A O   1 
ATOM   1689 C CB  . VAL A 1 289 ? -71.235 5.811  11.320  1.00 36.48  ? 289  VAL A CB  1 
ATOM   1690 C CG1 . VAL A 1 289 ? -70.961 6.587  12.610  1.00 36.26  ? 289  VAL A CG1 1 
ATOM   1691 C CG2 . VAL A 1 289 ? -71.468 6.769  10.156  1.00 36.29  ? 289  VAL A CG2 1 
ATOM   1692 N N   . CYS A 1 290 ? -68.721 4.289  12.969  1.00 36.81  ? 290  CYS A N   1 
ATOM   1693 C CA  . CYS A 1 290 ? -68.265 3.500  14.118  1.00 37.53  ? 290  CYS A CA  1 
ATOM   1694 C C   . CYS A 1 290 ? -69.241 3.614  15.285  1.00 40.36  ? 290  CYS A C   1 
ATOM   1695 O O   . CYS A 1 290 ? -69.565 4.729  15.689  1.00 39.77  ? 290  CYS A O   1 
ATOM   1696 C CB  . CYS A 1 290 ? -66.861 3.931  14.532  1.00 38.73  ? 290  CYS A CB  1 
ATOM   1697 S SG  . CYS A 1 290 ? -65.639 3.844  13.198  1.00 43.24  ? 290  CYS A SG  1 
ATOM   1698 N N   . ASP A 1 291 ? -69.673 2.467  15.855  1.00 36.40  ? 291  ASP A N   1 
ATOM   1699 C CA  . ASP A 1 291 ? -70.607 2.451  16.987  1.00 35.94  ? 291  ASP A CA  1 
ATOM   1700 C C   . ASP A 1 291 ? -69.940 2.718  18.352  1.00 39.24  ? 291  ASP A C   1 
ATOM   1701 O O   . ASP A 1 291 ? -70.654 2.797  19.352  1.00 38.77  ? 291  ASP A O   1 
ATOM   1702 C CB  . ASP A 1 291 ? -71.424 1.142  17.017  1.00 37.74  ? 291  ASP A CB  1 
ATOM   1703 C CG  . ASP A 1 291 ? -70.735 -0.035 17.678  1.00 47.78  ? 291  ASP A CG  1 
ATOM   1704 O OD1 . ASP A 1 291 ? -69.556 -0.290 17.355  1.00 48.39  ? 291  ASP A OD1 1 
ATOM   1705 O OD2 . ASP A 1 291 ? -71.389 -0.725 18.488  1.00 53.65  ? 291  ASP A OD2 1 
ATOM   1706 N N   . SER A 1 292 ? -68.593 2.842  18.404  1.00 35.42  ? 292  SER A N   1 
ATOM   1707 C CA  . SER A 1 292 ? -67.865 3.121  19.646  1.00 35.02  ? 292  SER A CA  1 
ATOM   1708 C C   . SER A 1 292 ? -68.249 4.495  20.197  1.00 38.24  ? 292  SER A C   1 
ATOM   1709 O O   . SER A 1 292 ? -68.625 4.597  21.364  1.00 37.89  ? 292  SER A O   1 
ATOM   1710 C CB  . SER A 1 292 ? -66.358 3.060  19.409  1.00 38.62  ? 292  SER A CB  1 
ATOM   1711 O OG  . SER A 1 292 ? -65.964 3.918  18.351  1.00 47.30  ? 292  SER A OG  1 
ATOM   1712 N N   . GLU A 1 293 ? -68.184 5.535  19.344  1.00 34.16  ? 293  GLU A N   1 
ATOM   1713 C CA  . GLU A 1 293 ? -68.552 6.907  19.703  1.00 33.68  ? 293  GLU A CA  1 
ATOM   1714 C C   . GLU A 1 293 ? -69.852 7.279  18.965  1.00 36.39  ? 293  GLU A C   1 
ATOM   1715 O O   . GLU A 1 293 ? -69.880 8.211  18.160  1.00 35.98  ? 293  GLU A O   1 
ATOM   1716 C CB  . GLU A 1 293 ? -67.393 7.875  19.377  1.00 35.11  ? 293  GLU A CB  1 
ATOM   1717 C CG  . GLU A 1 293 ? -67.511 9.254  20.018  1.00 46.00  ? 293  GLU A CG  1 
ATOM   1718 C CD  . GLU A 1 293 ? -67.381 9.305  21.529  1.00 66.39  ? 293  GLU A CD  1 
ATOM   1719 O OE1 . GLU A 1 293 ? -66.565 8.538  22.089  1.00 60.16  ? 293  GLU A OE1 1 
ATOM   1720 O OE2 . GLU A 1 293 ? -68.082 10.134 22.152  1.00 60.07  ? 293  GLU A OE2 1 
ATOM   1721 N N   . TRP A 1 294 ? -70.926 6.514  19.241  1.00 31.97  ? 294  TRP A N   1 
ATOM   1722 C CA  . TRP A 1 294 ? -72.258 6.721  18.665  1.00 31.31  ? 294  TRP A CA  1 
ATOM   1723 C C   . TRP A 1 294 ? -73.285 6.713  19.803  1.00 34.78  ? 294  TRP A C   1 
ATOM   1724 O O   . TRP A 1 294 ? -73.895 5.685  20.100  1.00 34.34  ? 294  TRP A O   1 
ATOM   1725 C CB  . TRP A 1 294 ? -72.572 5.650  17.607  1.00 29.84  ? 294  TRP A CB  1 
ATOM   1726 C CG  . TRP A 1 294 ? -73.863 5.885  16.886  1.00 30.64  ? 294  TRP A CG  1 
ATOM   1727 C CD1 . TRP A 1 294 ? -75.052 5.258  17.110  1.00 33.52  ? 294  TRP A CD1 1 
ATOM   1728 C CD2 . TRP A 1 294 ? -74.112 6.872  15.880  1.00 30.44  ? 294  TRP A CD2 1 
ATOM   1729 N NE1 . TRP A 1 294 ? -76.027 5.787  16.297  1.00 32.91  ? 294  TRP A NE1 1 
ATOM   1730 C CE2 . TRP A 1 294 ? -75.475 6.776  15.525  1.00 34.29  ? 294  TRP A CE2 1 
ATOM   1731 C CE3 . TRP A 1 294 ? -73.310 7.819  15.225  1.00 31.64  ? 294  TRP A CE3 1 
ATOM   1732 C CZ2 . TRP A 1 294 ? -76.057 7.607  14.565  1.00 33.56  ? 294  TRP A CZ2 1 
ATOM   1733 C CZ3 . TRP A 1 294 ? -73.881 8.615  14.246  1.00 33.07  ? 294  TRP A CZ3 1 
ATOM   1734 C CH2 . TRP A 1 294 ? -75.239 8.509  13.929  1.00 33.69  ? 294  TRP A CH2 1 
ATOM   1735 N N   . TYR A 1 295 ? -73.435 7.871  20.456  1.00 31.11  ? 295  TYR A N   1 
ATOM   1736 C CA  . TYR A 1 295 ? -74.329 8.084  21.597  1.00 30.83  ? 295  TYR A CA  1 
ATOM   1737 C C   . TYR A 1 295 ? -75.497 8.994  21.166  1.00 34.03  ? 295  TYR A C   1 
ATOM   1738 O O   . TYR A 1 295 ? -75.484 9.460  20.025  1.00 33.55  ? 295  TYR A O   1 
ATOM   1739 C CB  . TYR A 1 295 ? -73.499 8.684  22.751  1.00 32.12  ? 295  TYR A CB  1 
ATOM   1740 C CG  . TYR A 1 295 ? -72.387 7.762  23.203  1.00 34.07  ? 295  TYR A CG  1 
ATOM   1741 C CD1 . TYR A 1 295 ? -72.668 6.510  23.736  1.00 36.08  ? 295  TYR A CD1 1 
ATOM   1742 C CD2 . TYR A 1 295 ? -71.053 8.134  23.083  1.00 34.95  ? 295  TYR A CD2 1 
ATOM   1743 C CE1 . TYR A 1 295 ? -71.650 5.648  24.138  1.00 37.00  ? 295  TYR A CE1 1 
ATOM   1744 C CE2 . TYR A 1 295 ? -70.025 7.284  23.487  1.00 35.92  ? 295  TYR A CE2 1 
ATOM   1745 C CZ  . TYR A 1 295 ? -70.328 6.039  24.016  1.00 43.65  ? 295  TYR A CZ  1 
ATOM   1746 O OH  . TYR A 1 295 ? -69.338 5.175  24.427  1.00 45.01  ? 295  TYR A OH  1 
ATOM   1747 N N   . PRO A 1 296 ? -76.530 9.242  22.013  1.00 30.11  ? 296  PRO A N   1 
ATOM   1748 C CA  . PRO A 1 296 ? -77.663 10.083 21.573  1.00 29.78  ? 296  PRO A CA  1 
ATOM   1749 C C   . PRO A 1 296 ? -77.300 11.440 20.966  1.00 33.05  ? 296  PRO A C   1 
ATOM   1750 O O   . PRO A 1 296 ? -78.027 11.921 20.100  1.00 32.42  ? 296  PRO A O   1 
ATOM   1751 C CB  . PRO A 1 296 ? -78.498 10.236 22.845  1.00 31.56  ? 296  PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 296 ? -78.209 9.007  23.619  1.00 36.01  ? 296  PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 296 ? -76.749 8.754  23.389  1.00 31.57  ? 296  PRO A CD  1 
ATOM   1754 N N   . SER A 1 297 ? -76.182 12.043 21.407  1.00 29.47  ? 297  SER A N   1 
ATOM   1755 C CA  . SER A 1 297 ? -75.684 13.316 20.882  1.00 29.25  ? 297  SER A CA  1 
ATOM   1756 C C   . SER A 1 297 ? -75.429 13.238 19.365  1.00 32.83  ? 297  SER A C   1 
ATOM   1757 O O   . SER A 1 297 ? -75.816 14.153 18.640  1.00 32.49  ? 297  SER A O   1 
ATOM   1758 C CB  . SER A 1 297 ? -74.403 13.712 21.610  1.00 32.89  ? 297  SER A CB  1 
ATOM   1759 O OG  . SER A 1 297 ? -73.841 14.906 21.096  1.00 42.06  ? 297  SER A OG  1 
ATOM   1760 N N   . GLU A 1 298 ? -74.811 12.140 18.889  1.00 28.93  ? 298  GLU A N   1 
ATOM   1761 C CA  . GLU A 1 298 ? -74.542 11.940 17.458  1.00 28.42  ? 298  GLU A CA  1 
ATOM   1762 C C   . GLU A 1 298 ? -75.835 11.599 16.708  1.00 31.66  ? 298  GLU A C   1 
ATOM   1763 O O   . GLU A 1 298 ? -76.048 12.098 15.604  1.00 31.26  ? 298  GLU A O   1 
ATOM   1764 C CB  . GLU A 1 298 ? -73.509 10.818 17.225  1.00 29.80  ? 298  GLU A CB  1 
ATOM   1765 C CG  . GLU A 1 298 ? -72.065 11.204 17.496  1.00 39.89  ? 298  GLU A CG  1 
ATOM   1766 C CD  . GLU A 1 298 ? -71.685 11.293 18.959  1.00 59.95  ? 298  GLU A CD  1 
ATOM   1767 O OE1 . GLU A 1 298 ? -71.831 10.278 19.678  1.00 53.79  ? 298  GLU A OE1 1 
ATOM   1768 O OE2 . GLU A 1 298 ? -71.247 12.383 19.390  1.00 54.48  ? 298  GLU A OE2 1 
ATOM   1769 N N   . ALA A 1 299 ? -76.678 10.730 17.295  1.00 27.87  ? 299  ALA A N   1 
ATOM   1770 C CA  . ALA A 1 299 ? -77.949 10.308 16.695  1.00 27.60  ? 299  ALA A CA  1 
ATOM   1771 C C   . ALA A 1 299 ? -78.965 11.450 16.564  1.00 31.21  ? 299  ALA A C   1 
ATOM   1772 O O   . ALA A 1 299 ? -79.747 11.449 15.614  1.00 30.58  ? 299  ALA A O   1 
ATOM   1773 C CB  . ALA A 1 299 ? -78.555 9.172  17.505  1.00 28.35  ? 299  ALA A CB  1 
ATOM   1774 N N   . LYS A 1 300 ? -78.969 12.406 17.517  1.00 27.88  ? 300  LYS A N   1 
ATOM   1775 C CA  . LYS A 1 300 ? -79.874 13.564 17.492  1.00 27.69  ? 300  LYS A CA  1 
ATOM   1776 C C   . LYS A 1 300 ? -79.569 14.457 16.282  1.00 31.49  ? 300  LYS A C   1 
ATOM   1777 O O   . LYS A 1 300 ? -80.496 14.961 15.650  1.00 30.69  ? 300  LYS A O   1 
ATOM   1778 C CB  . LYS A 1 300 ? -79.743 14.378 18.796  1.00 30.24  ? 300  LYS A CB  1 
ATOM   1779 C CG  . LYS A 1 300 ? -80.756 15.510 18.957  1.00 44.30  ? 300  LYS A CG  1 
ATOM   1780 C CD  . LYS A 1 300 ? -80.417 16.388 20.153  1.00 53.51  ? 300  LYS A CD  1 
ATOM   1781 C CE  . LYS A 1 300 ? -81.356 17.560 20.287  1.00 64.09  ? 300  LYS A CE  1 
ATOM   1782 N NZ  . LYS A 1 300 ? -80.922 18.496 21.357  1.00 72.72  ? 300  LYS A NZ  1 
ATOM   1783 N N   . VAL A 1 301 ? -78.275 14.638 15.962  1.00 28.49  ? 301  VAL A N   1 
ATOM   1784 C CA  . VAL A 1 301 ? -77.829 15.456 14.829  1.00 28.56  ? 301  VAL A CA  1 
ATOM   1785 C C   . VAL A 1 301 ? -78.190 14.774 13.498  1.00 33.06  ? 301  VAL A C   1 
ATOM   1786 O O   . VAL A 1 301 ? -78.590 15.462 12.559  1.00 32.64  ? 301  VAL A O   1 
ATOM   1787 C CB  . VAL A 1 301 ? -76.306 15.769 14.924  1.00 32.48  ? 301  VAL A CB  1 
ATOM   1788 C CG1 . VAL A 1 301 ? -75.793 16.453 13.656  1.00 32.27  ? 301  VAL A CG1 1 
ATOM   1789 C CG2 . VAL A 1 301 ? -75.997 16.626 16.150  1.00 32.36  ? 301  VAL A CG2 1 
ATOM   1790 N N   . LEU A 1 302 ? -78.054 13.436 13.420  1.00 30.12  ? 302  LEU A N   1 
ATOM   1791 C CA  . LEU A 1 302 ? -78.345 12.682 12.197  1.00 30.20  ? 302  LEU A CA  1 
ATOM   1792 C C   . LEU A 1 302 ? -79.835 12.703 11.838  1.00 34.74  ? 302  LEU A C   1 
ATOM   1793 O O   . LEU A 1 302 ? -80.169 13.112 10.727  1.00 34.29  ? 302  LEU A O   1 
ATOM   1794 C CB  . LEU A 1 302 ? -77.831 11.233 12.331  1.00 30.26  ? 302  LEU A CB  1 
ATOM   1795 C CG  . LEU A 1 302 ? -77.853 10.316 11.083  1.00 35.00  ? 302  LEU A CG  1 
ATOM   1796 C CD1 . LEU A 1 302 ? -79.191 9.617  10.908  1.00 35.30  ? 302  LEU A CD1 1 
ATOM   1797 C CD2 . LEU A 1 302 ? -77.470 11.058 9.808   1.00 37.25  ? 302  LEU A CD2 1 
ATOM   1798 N N   . CYS A 1 303 ? -80.725 12.270 12.754  1.00 31.93  ? 303  CYS A N   1 
ATOM   1799 C CA  . CYS A 1 303 ? -82.174 12.258 12.492  1.00 32.08  ? 303  CYS A CA  1 
ATOM   1800 C C   . CYS A 1 303 ? -82.724 13.667 12.200  1.00 36.29  ? 303  CYS A C   1 
ATOM   1801 O O   . CYS A 1 303 ? -83.663 13.796 11.414  1.00 35.80  ? 303  CYS A O   1 
ATOM   1802 C CB  . CYS A 1 303 ? -82.941 11.592 13.633  1.00 32.50  ? 303  CYS A CB  1 
ATOM   1803 S SG  . CYS A 1 303 ? -82.585 9.827  13.850  1.00 36.44  ? 303  CYS A SG  1 
ATOM   1804 N N   . GLN A 1 304 ? -82.134 14.712 12.816  1.00 33.24  ? 304  GLN A N   1 
ATOM   1805 C CA  . GLN A 1 304 ? -82.543 16.106 12.604  1.00 33.18  ? 304  GLN A CA  1 
ATOM   1806 C C   . GLN A 1 304 ? -82.133 16.603 11.209  1.00 36.83  ? 304  GLN A C   1 
ATOM   1807 O O   . GLN A 1 304 ? -82.932 17.272 10.555  1.00 36.21  ? 304  GLN A O   1 
ATOM   1808 C CB  . GLN A 1 304 ? -81.948 17.013 13.701  1.00 34.61  ? 304  GLN A CB  1 
ATOM   1809 C CG  . GLN A 1 304 ? -82.317 18.496 13.580  1.00 51.64  ? 304  GLN A CG  1 
ATOM   1810 C CD  . GLN A 1 304 ? -81.224 19.325 12.936  1.00 72.05  ? 304  GLN A CD  1 
ATOM   1811 O OE1 . GLN A 1 304 ? -80.109 19.432 13.459  1.00 67.81  ? 304  GLN A OE1 1 
ATOM   1812 N NE2 . GLN A 1 304 ? -81.510 19.944 11.795  1.00 64.32  ? 304  GLN A NE2 1 
ATOM   1813 N N   . SER A 1 305 ? -80.898 16.288 10.761  1.00 33.42  ? 305  SER A N   1 
ATOM   1814 C CA  . SER A 1 305 ? -80.405 16.712 9.442   1.00 33.27  ? 305  SER A CA  1 
ATOM   1815 C C   . SER A 1 305 ? -81.204 16.071 8.300   1.00 37.26  ? 305  SER A C   1 
ATOM   1816 O O   . SER A 1 305 ? -81.525 16.754 7.327   1.00 36.94  ? 305  SER A O   1 
ATOM   1817 C CB  . SER A 1 305 ? -78.915 16.408 9.281   1.00 36.68  ? 305  SER A CB  1 
ATOM   1818 O OG  . SER A 1 305 ? -78.651 15.036 9.034   1.00 44.56  ? 305  SER A OG  1 
ATOM   1819 N N   . LEU A 1 306 ? -81.534 14.774 8.427   1.00 33.83  ? 306  LEU A N   1 
ATOM   1820 C CA  . LEU A 1 306 ? -82.326 14.063 7.420   1.00 33.67  ? 306  LEU A CA  1 
ATOM   1821 C C   . LEU A 1 306 ? -83.798 14.501 7.443   1.00 37.90  ? 306  LEU A C   1 
ATOM   1822 O O   . LEU A 1 306 ? -84.471 14.373 6.424   1.00 37.56  ? 306  LEU A O   1 
ATOM   1823 C CB  . LEU A 1 306 ? -82.229 12.541 7.611   1.00 33.70  ? 306  LEU A CB  1 
ATOM   1824 C CG  . LEU A 1 306 ? -80.839 11.919 7.454   1.00 38.35  ? 306  LEU A CG  1 
ATOM   1825 C CD1 . LEU A 1 306 ? -80.879 10.436 7.749   1.00 38.48  ? 306  LEU A CD1 1 
ATOM   1826 C CD2 . LEU A 1 306 ? -80.279 12.141 6.059   1.00 40.78  ? 306  LEU A CD2 1 
ATOM   1827 N N   . GLY A 1 307 ? -84.278 14.994 8.587   1.00 34.67  ? 307  GLY A N   1 
ATOM   1828 C CA  . GLY A 1 307 ? -85.642 15.489 8.738   1.00 34.59  ? 307  GLY A CA  1 
ATOM   1829 C C   . GLY A 1 307 ? -86.636 14.421 9.135   1.00 38.62  ? 307  GLY A C   1 
ATOM   1830 O O   . GLY A 1 307 ? -87.660 14.255 8.465   1.00 38.12  ? 307  GLY A O   1 
ATOM   1831 N N   . CYS A 1 308 ? -86.328 13.689 10.234  1.00 35.40  ? 308  CYS A N   1 
ATOM   1832 C CA  A CYS A 1 308 ? -87.205 12.637 10.757  0.50 35.25  ? 308  CYS A CA  1 
ATOM   1833 C CA  B CYS A 1 308 ? -87.159 12.602 10.770  0.50 35.24  ? 308  CYS A CA  1 
ATOM   1834 C C   . CYS A 1 308 ? -87.369 12.765 12.289  1.00 38.89  ? 308  CYS A C   1 
ATOM   1835 O O   . CYS A 1 308 ? -87.645 11.780 12.981  1.00 38.34  ? 308  CYS A O   1 
ATOM   1836 C CB  A CYS A 1 308 ? -86.716 11.249 10.336  0.50 35.61  ? 308  CYS A CB  1 
ATOM   1837 C CB  B CYS A 1 308 ? -86.534 11.245 10.448  0.50 35.59  ? 308  CYS A CB  1 
ATOM   1838 S SG  A CYS A 1 308 ? -85.188 11.249 9.360   0.50 39.53  ? 308  CYS A SG  1 
ATOM   1839 S SG  B CYS A 1 308 ? -85.777 11.132 8.805   0.50 39.50  ? 308  CYS A SG  1 
ATOM   1840 N N   . GLY A 1 309 ? -87.256 13.995 12.798  1.00 35.37  ? 309  GLY A N   1 
ATOM   1841 C CA  . GLY A 1 309 ? -87.415 14.281 14.220  1.00 35.09  ? 309  GLY A CA  1 
ATOM   1842 C C   . GLY A 1 309 ? -86.231 13.851 15.064  1.00 38.62  ? 309  GLY A C   1 
ATOM   1843 O O   . GLY A 1 309 ? -85.103 13.786 14.569  1.00 38.12  ? 309  GLY A O   1 
ATOM   1844 N N   . THR A 1 310 ? -86.482 13.580 16.356  1.00 34.97  ? 310  THR A N   1 
ATOM   1845 C CA  . THR A 1 310 ? -85.441 13.156 17.302  1.00 34.63  ? 310  THR A CA  1 
ATOM   1846 C C   . THR A 1 310 ? -85.114 11.665 17.169  1.00 37.38  ? 310  THR A C   1 
ATOM   1847 O O   . THR A 1 310 ? -85.848 10.924 16.512  1.00 36.78  ? 310  THR A O   1 
ATOM   1848 C CB  . THR A 1 310 ? -85.818 13.540 18.753  1.00 44.60  ? 310  THR A CB  1 
ATOM   1849 O OG1 . THR A 1 310 ? -84.653 13.428 19.574  1.00 45.21  ? 310  THR A OG1 1 
ATOM   1850 C CG2 . THR A 1 310 ? -86.956 12.683 19.344  1.00 43.42  ? 310  THR A CG2 1 
ATOM   1851 N N   . ALA A 1 311 ? -84.023 11.231 17.821  1.00 33.26  ? 311  ALA A N   1 
ATOM   1852 C CA  . ALA A 1 311 ? -83.589 9.832  17.819  1.00 32.77  ? 311  ALA A CA  1 
ATOM   1853 C C   . ALA A 1 311 ? -84.321 9.063  18.920  1.00 35.89  ? 311  ALA A C   1 
ATOM   1854 O O   . ALA A 1 311 ? -84.521 9.603  20.009  1.00 35.51  ? 311  ALA A O   1 
ATOM   1855 C CB  . ALA A 1 311 ? -82.088 9.751  18.041  1.00 33.53  ? 311  ALA A CB  1 
ATOM   1856 N N   . VAL A 1 312 ? -84.718 7.808  18.637  1.00 31.79  ? 312  VAL A N   1 
ATOM   1857 C CA  . VAL A 1 312 ? -85.449 6.952  19.577  1.00 31.25  ? 312  VAL A CA  1 
ATOM   1858 C C   . VAL A 1 312 ? -84.551 5.839  20.124  1.00 34.47  ? 312  VAL A C   1 
ATOM   1859 O O   . VAL A 1 312 ? -84.418 5.717  21.341  1.00 34.13  ? 312  VAL A O   1 
ATOM   1860 C CB  . VAL A 1 312 ? -86.726 6.377  18.908  1.00 35.11  ? 312  VAL A CB  1 
ATOM   1861 C CG1 . VAL A 1 312 ? -87.423 5.363  19.814  1.00 34.96  ? 312  VAL A CG1 1 
ATOM   1862 C CG2 . VAL A 1 312 ? -87.683 7.500  18.511  1.00 34.89  ? 312  VAL A CG2 1 
ATOM   1863 N N   . GLU A 1 313 ? -83.970 5.015  19.234  1.00 30.44  ? 313  GLU A N   1 
ATOM   1864 C CA  . GLU A 1 313 ? -83.128 3.876  19.615  1.00 29.97  ? 313  GLU A CA  1 
ATOM   1865 C C   . GLU A 1 313 ? -81.893 3.764  18.712  1.00 32.68  ? 313  GLU A C   1 
ATOM   1866 O O   . GLU A 1 313 ? -81.925 4.221  17.571  1.00 32.12  ? 313  GLU A O   1 
ATOM   1867 C CB  . GLU A 1 313 ? -83.964 2.584  19.513  1.00 31.42  ? 313  GLU A CB  1 
ATOM   1868 C CG  . GLU A 1 313 ? -83.470 1.425  20.365  1.00 43.19  ? 313  GLU A CG  1 
ATOM   1869 C CD  . GLU A 1 313 ? -84.099 0.085  20.029  1.00 66.24  ? 313  GLU A CD  1 
ATOM   1870 O OE1 . GLU A 1 313 ? -85.238 0.069  19.507  1.00 61.79  ? 313  GLU A OE1 1 
ATOM   1871 O OE2 . GLU A 1 313 ? -83.448 -0.953 20.286  1.00 60.80  ? 313  GLU A OE2 1 
ATOM   1872 N N   . ARG A 1 314 ? -80.812 3.155  19.237  1.00 28.56  ? 314  ARG A N   1 
ATOM   1873 C CA  . ARG A 1 314 ? -79.558 2.893  18.525  1.00 28.01  ? 314  ARG A CA  1 
ATOM   1874 C C   . ARG A 1 314 ? -79.322 1.363  18.575  1.00 31.39  ? 314  ARG A C   1 
ATOM   1875 O O   . ARG A 1 314 ? -78.661 0.878  19.496  1.00 31.04  ? 314  ARG A O   1 
ATOM   1876 C CB  . ARG A 1 314 ? -78.391 3.654  19.190  1.00 27.96  ? 314  ARG A CB  1 
ATOM   1877 C CG  . ARG A 1 314 ? -78.670 5.141  19.415  1.00 37.34  ? 314  ARG A CG  1 
ATOM   1878 C CD  . ARG A 1 314 ? -77.443 5.937  19.850  1.00 45.09  ? 314  ARG A CD  1 
ATOM   1879 N NE  . ARG A 1 314 ? -76.543 5.184  20.731  1.00 51.71  ? 314  ARG A NE  1 
ATOM   1880 C CZ  . ARG A 1 314 ? -76.730 4.966  22.033  1.00 64.03  ? 314  ARG A CZ  1 
ATOM   1881 N NH1 . ARG A 1 314 ? -77.810 5.439  22.650  1.00 49.20  ? 314  ARG A NH1 1 
ATOM   1882 N NH2 . ARG A 1 314 ? -75.841 4.266  22.729  1.00 51.04  ? 314  ARG A NH2 1 
ATOM   1883 N N   . PRO A 1 315 ? -79.894 0.572  17.637  1.00 27.45  ? 315  PRO A N   1 
ATOM   1884 C CA  . PRO A 1 315 ? -79.729 -0.895 17.711  1.00 27.16  ? 315  PRO A CA  1 
ATOM   1885 C C   . PRO A 1 315 ? -78.307 -1.413 17.494  1.00 30.69  ? 315  PRO A C   1 
ATOM   1886 O O   . PRO A 1 315 ? -77.427 -0.662 17.073  1.00 30.21  ? 315  PRO A O   1 
ATOM   1887 C CB  . PRO A 1 315 ? -80.686 -1.424 16.631  1.00 28.95  ? 315  PRO A CB  1 
ATOM   1888 C CG  . PRO A 1 315 ? -81.541 -0.273 16.241  1.00 33.38  ? 315  PRO A CG  1 
ATOM   1889 C CD  . PRO A 1 315 ? -80.743 0.954  16.494  1.00 28.92  ? 315  PRO A CD  1 
ATOM   1890 N N   . LYS A 1 316 ? -78.091 -2.714 17.779  1.00 27.07  ? 316  LYS A N   1 
ATOM   1891 C CA  . LYS A 1 316 ? -76.781 -3.349 17.610  1.00 26.75  ? 316  LYS A CA  1 
ATOM   1892 C C   . LYS A 1 316 ? -76.445 -3.435 16.123  1.00 30.18  ? 316  LYS A C   1 
ATOM   1893 O O   . LYS A 1 316 ? -77.279 -3.860 15.322  1.00 29.67  ? 316  LYS A O   1 
ATOM   1894 C CB  . LYS A 1 316 ? -76.743 -4.753 18.238  1.00 29.29  ? 316  LYS A CB  1 
ATOM   1895 C CG  . LYS A 1 316 ? -75.325 -5.305 18.392  1.00 44.52  ? 316  LYS A CG  1 
ATOM   1896 C CD  . LYS A 1 316 ? -75.315 -6.761 18.838  1.00 55.61  ? 316  LYS A CD  1 
ATOM   1897 C CE  . LYS A 1 316 ? -73.932 -7.375 18.798  1.00 67.22  ? 316  LYS A CE  1 
ATOM   1898 N NZ  . LYS A 1 316 ? -73.019 -6.795 19.821  1.00 76.80  ? 316  LYS A NZ  1 
ATOM   1899 N N   . GLY A 1 317 ? -75.231 -3.027 15.780  1.00 26.41  ? 317  GLY A N   1 
ATOM   1900 C CA  . GLY A 1 317 ? -74.760 -3.009 14.405  1.00 25.98  ? 317  GLY A CA  1 
ATOM   1901 C C   . GLY A 1 317 ? -74.256 -4.332 13.878  1.00 29.14  ? 317  GLY A C   1 
ATOM   1902 O O   . GLY A 1 317 ? -74.032 -5.277 14.637  1.00 28.63  ? 317  GLY A O   1 
ATOM   1903 N N   . LEU A 1 318 ? -74.076 -4.384 12.554  1.00 25.24  ? 318  LEU A N   1 
ATOM   1904 C CA  . LEU A 1 318 ? -73.538 -5.533 11.832  1.00 24.79  ? 318  LEU A CA  1 
ATOM   1905 C C   . LEU A 1 318 ? -72.062 -5.216 11.567  1.00 28.10  ? 318  LEU A C   1 
ATOM   1906 O O   . LEU A 1 318 ? -71.663 -4.064 11.746  1.00 27.50  ? 318  LEU A O   1 
ATOM   1907 C CB  . LEU A 1 318 ? -74.284 -5.715 10.497  1.00 24.80  ? 318  LEU A CB  1 
ATOM   1908 C CG  . LEU A 1 318 ? -75.809 -5.691 10.557  1.00 29.52  ? 318  LEU A CG  1 
ATOM   1909 C CD1 . LEU A 1 318 ? -76.397 -5.849 9.173   1.00 29.71  ? 318  LEU A CD1 1 
ATOM   1910 C CD2 . LEU A 1 318 ? -76.341 -6.775 11.475  1.00 32.29  ? 318  LEU A CD2 1 
ATOM   1911 N N   . PRO A 1 319 ? -71.227 -6.172 11.115  1.00 24.54  ? 319  PRO A N   1 
ATOM   1912 C CA  . PRO A 1 319 ? -69.821 -5.828 10.833  1.00 24.33  ? 319  PRO A CA  1 
ATOM   1913 C C   . PRO A 1 319 ? -69.680 -4.807 9.698   1.00 28.07  ? 319  PRO A C   1 
ATOM   1914 O O   . PRO A 1 319 ? -70.577 -4.686 8.860   1.00 27.59  ? 319  PRO A O   1 
ATOM   1915 C CB  . PRO A 1 319 ? -69.179 -7.178 10.477  1.00 26.10  ? 319  PRO A CB  1 
ATOM   1916 C CG  . PRO A 1 319 ? -70.149 -8.217 10.921  1.00 30.57  ? 319  PRO A CG  1 
ATOM   1917 C CD  . PRO A 1 319 ? -71.499 -7.593 10.833  1.00 26.10  ? 319  PRO A CD  1 
ATOM   1918 N N   . HIS A 1 320 ? -68.565 -4.060 9.686   1.00 24.39  ? 320  HIS A N   1 
ATOM   1919 C CA  . HIS A 1 320 ? -68.314 -3.039 8.664   1.00 24.11  ? 320  HIS A CA  1 
ATOM   1920 C C   . HIS A 1 320 ? -68.163 -3.710 7.293   1.00 27.66  ? 320  HIS A C   1 
ATOM   1921 O O   . HIS A 1 320 ? -67.205 -4.454 7.085   1.00 27.04  ? 320  HIS A O   1 
ATOM   1922 C CB  . HIS A 1 320 ? -67.066 -2.215 9.015   1.00 24.92  ? 320  HIS A CB  1 
ATOM   1923 C CG  . HIS A 1 320 ? -67.224 -1.380 10.250  1.00 28.25  ? 320  HIS A CG  1 
ATOM   1924 N ND1 . HIS A 1 320 ? -67.995 -0.233 10.250  1.00 29.94  ? 320  HIS A ND1 1 
ATOM   1925 C CD2 . HIS A 1 320 ? -66.702 -1.553 11.485  1.00 29.95  ? 320  HIS A CD2 1 
ATOM   1926 C CE1 . HIS A 1 320 ? -67.915 0.257  11.476  1.00 29.33  ? 320  HIS A CE1 1 
ATOM   1927 N NE2 . HIS A 1 320 ? -67.136 -0.496 12.250  1.00 29.68  ? 320  HIS A NE2 1 
ATOM   1928 N N   . SER A 1 321 ? -69.139 -3.482 6.383   1.00 24.22  ? 321  SER A N   1 
ATOM   1929 C CA  . SER A 1 321 ? -69.193 -4.110 5.058   1.00 23.98  ? 321  SER A CA  1 
ATOM   1930 C C   . SER A 1 321 ? -69.161 -3.122 3.869   1.00 27.91  ? 321  SER A C   1 
ATOM   1931 O O   . SER A 1 321 ? -69.636 -3.478 2.790   1.00 27.43  ? 321  SER A O   1 
ATOM   1932 C CB  . SER A 1 321 ? -70.442 -4.984 4.973   1.00 27.43  ? 321  SER A CB  1 
ATOM   1933 O OG  . SER A 1 321 ? -71.621 -4.198 5.032   1.00 35.59  ? 321  SER A OG  1 
ATOM   1934 N N   . LEU A 1 322 ? -68.574 -1.919 4.040   1.00 24.63  ? 322  LEU A N   1 
ATOM   1935 C CA  . LEU A 1 322 ? -68.467 -0.915 2.968   1.00 24.50  ? 322  LEU A CA  1 
ATOM   1936 C C   . LEU A 1 322 ? -66.989 -0.510 2.768   1.00 29.07  ? 322  LEU A C   1 
ATOM   1937 O O   . LEU A 1 322 ? -66.108 -1.163 3.330   1.00 28.76  ? 322  LEU A O   1 
ATOM   1938 C CB  . LEU A 1 322 ? -69.364 0.301  3.282   1.00 24.46  ? 322  LEU A CB  1 
ATOM   1939 C CG  . LEU A 1 322 ? -70.865 0.020  3.425   1.00 28.93  ? 322  LEU A CG  1 
ATOM   1940 C CD1 . LEU A 1 322 ? -71.617 1.277  3.812   1.00 29.16  ? 322  LEU A CD1 1 
ATOM   1941 C CD2 . LEU A 1 322 ? -71.458 -0.509 2.130   1.00 30.72  ? 322  LEU A CD2 1 
ATOM   1942 N N   . SER A 1 323 ? -66.712 0.512  1.929   1.00 26.04  ? 323  SER A N   1 
ATOM   1943 C CA  . SER A 1 323 ? -65.345 0.951  1.610   1.00 26.06  ? 323  SER A CA  1 
ATOM   1944 C C   . SER A 1 323 ? -64.499 1.402  2.805   1.00 30.41  ? 323  SER A C   1 
ATOM   1945 O O   . SER A 1 323 ? -63.334 1.014  2.889   1.00 29.92  ? 323  SER A O   1 
ATOM   1946 C CB  . SER A 1 323 ? -65.369 2.056  0.556   1.00 29.50  ? 323  SER A CB  1 
ATOM   1947 O OG  . SER A 1 323 ? -64.065 2.338  0.074   1.00 37.77  ? 323  SER A OG  1 
ATOM   1948 N N   . GLY A 1 324 ? -65.069 2.218  3.688   1.00 27.50  ? 324  GLY A N   1 
ATOM   1949 C CA  . GLY A 1 324 ? -64.354 2.744  4.848   1.00 27.57  ? 324  GLY A CA  1 
ATOM   1950 C C   . GLY A 1 324 ? -65.185 2.886  6.105   1.00 31.92  ? 324  GLY A C   1 
ATOM   1951 O O   . GLY A 1 324 ? -66.347 2.475  6.143   1.00 31.29  ? 324  GLY A O   1 
ATOM   1952 N N   . ARG A 1 325 ? -64.565 3.464  7.149   1.00 29.18  ? 325  ARG A N   1 
ATOM   1953 C CA  . ARG A 1 325 ? -65.174 3.690  8.462   1.00 29.32  ? 325  ARG A CA  1 
ATOM   1954 C C   . ARG A 1 325 ? -65.056 5.169  8.835   1.00 33.93  ? 325  ARG A C   1 
ATOM   1955 O O   . ARG A 1 325 ? -64.017 5.779  8.580   1.00 33.25  ? 325  ARG A O   1 
ATOM   1956 C CB  . ARG A 1 325 ? -64.481 2.829  9.527   1.00 29.71  ? 325  ARG A CB  1 
ATOM   1957 C CG  . ARG A 1 325 ? -64.352 1.361  9.148   1.00 40.81  ? 325  ARG A CG  1 
ATOM   1958 C CD  . ARG A 1 325 ? -63.962 0.519  10.344  1.00 52.45  ? 325  ARG A CD  1 
ATOM   1959 N NE  . ARG A 1 325 ? -63.702 -0.873 9.976   1.00 62.36  ? 325  ARG A NE  1 
ATOM   1960 C CZ  . ARG A 1 325 ? -63.367 -1.836 10.833  1.00 78.35  ? 325  ARG A CZ  1 
ATOM   1961 N NH1 . ARG A 1 325 ? -63.251 -1.571 12.132  1.00 66.95  ? 325  ARG A NH1 1 
ATOM   1962 N NH2 . ARG A 1 325 ? -63.152 -3.072 10.400  1.00 65.77  ? 325  ARG A NH2 1 
ATOM   1963 N N   . MET A 1 326 ? -66.114 5.738  9.447   1.00 31.43  ? 326  MET A N   1 
ATOM   1964 C CA  . MET A 1 326 ? -66.168 7.149  9.842   1.00 31.75  ? 326  MET A CA  1 
ATOM   1965 C C   . MET A 1 326 ? -66.399 7.282  11.352  1.00 36.43  ? 326  MET A C   1 
ATOM   1966 O O   . MET A 1 326 ? -67.196 6.538  11.920  1.00 35.92  ? 326  MET A O   1 
ATOM   1967 C CB  . MET A 1 326 ? -67.306 7.847  9.078   1.00 34.18  ? 326  MET A CB  1 
ATOM   1968 C CG  . MET A 1 326 ? -67.191 9.357  9.041   1.00 37.92  ? 326  MET A CG  1 
ATOM   1969 S SD  . MET A 1 326 ? -66.052 9.947  7.772   1.00 42.22  ? 326  MET A SD  1 
ATOM   1970 C CE  . MET A 1 326 ? -65.672 11.523 8.408   1.00 38.90  ? 326  MET A CE  1 
ATOM   1971 N N   . TYR A 1 327 ? -65.717 8.252  11.986  1.00 33.74  ? 327  TYR A N   1 
ATOM   1972 C CA  . TYR A 1 327 ? -65.821 8.543  13.419  1.00 33.82  ? 327  TYR A CA  1 
ATOM   1973 C C   . TYR A 1 327 ? -66.482 9.915  13.595  1.00 37.99  ? 327  TYR A C   1 
ATOM   1974 O O   . TYR A 1 327 ? -66.255 10.801 12.774  1.00 37.44  ? 327  TYR A O   1 
ATOM   1975 C CB  . TYR A 1 327 ? -64.415 8.536  14.046  1.00 35.10  ? 327  TYR A CB  1 
ATOM   1976 C CG  . TYR A 1 327 ? -64.398 8.650  15.555  1.00 36.92  ? 327  TYR A CG  1 
ATOM   1977 C CD1 . TYR A 1 327 ? -64.463 7.518  16.358  1.00 38.93  ? 327  TYR A CD1 1 
ATOM   1978 C CD2 . TYR A 1 327 ? -64.239 9.882  16.178  1.00 37.63  ? 327  TYR A CD2 1 
ATOM   1979 C CE1 . TYR A 1 327 ? -64.413 7.612  17.747  1.00 39.81  ? 327  TYR A CE1 1 
ATOM   1980 C CE2 . TYR A 1 327 ? -64.191 9.990  17.566  1.00 38.51  ? 327  TYR A CE2 1 
ATOM   1981 C CZ  . TYR A 1 327 ? -64.278 8.851  18.350  1.00 46.09  ? 327  TYR A CZ  1 
ATOM   1982 O OH  . TYR A 1 327 ? -64.228 8.926  19.724  1.00 47.17  ? 327  TYR A OH  1 
ATOM   1983 N N   . TYR A 1 328 ? -67.308 10.083 14.647  1.00 35.08  ? 328  TYR A N   1 
ATOM   1984 C CA  . TYR A 1 328 ? -68.005 11.345 14.930  1.00 35.17  ? 328  TYR A CA  1 
ATOM   1985 C C   . TYR A 1 328 ? -68.053 11.645 16.430  1.00 40.05  ? 328  TYR A C   1 
ATOM   1986 O O   . TYR A 1 328 ? -68.134 10.723 17.242  1.00 39.65  ? 328  TYR A O   1 
ATOM   1987 C CB  . TYR A 1 328 ? -69.439 11.308 14.371  1.00 36.27  ? 328  TYR A CB  1 
ATOM   1988 C CG  . TYR A 1 328 ? -69.517 11.460 12.868  1.00 37.91  ? 328  TYR A CG  1 
ATOM   1989 C CD1 . TYR A 1 328 ? -69.140 12.644 12.248  1.00 39.90  ? 328  TYR A CD1 1 
ATOM   1990 C CD2 . TYR A 1 328 ? -70.050 10.452 12.073  1.00 38.61  ? 328  TYR A CD2 1 
ATOM   1991 C CE1 . TYR A 1 328 ? -69.210 12.792 10.865  1.00 40.54  ? 328  TYR A CE1 1 
ATOM   1992 C CE2 . TYR A 1 328 ? -70.153 10.598 10.691  1.00 39.45  ? 328  TYR A CE2 1 
ATOM   1993 C CZ  . TYR A 1 328 ? -69.741 11.774 10.090  1.00 46.51  ? 328  TYR A CZ  1 
ATOM   1994 O OH  . TYR A 1 328 ? -69.844 11.902 8.724   1.00 47.18  ? 328  TYR A OH  1 
ATOM   1995 N N   . SER A 1 329 ? -68.021 12.942 16.786  1.00 37.37  ? 329  SER A N   1 
ATOM   1996 C CA  . SER A 1 329 ? -68.078 13.407 18.174  1.00 37.54  ? 329  SER A CA  1 
ATOM   1997 C C   . SER A 1 329 ? -68.772 14.777 18.232  1.00 42.17  ? 329  SER A C   1 
ATOM   1998 O O   . SER A 1 329 ? -68.111 15.816 18.195  1.00 41.76  ? 329  SER A O   1 
ATOM   1999 C CB  . SER A 1 329 ? -66.675 13.470 18.772  1.00 41.22  ? 329  SER A CB  1 
ATOM   2000 O OG  . SER A 1 329 ? -66.700 13.906 20.121  1.00 50.44  ? 329  SER A OG  1 
ATOM   2001 N N   . CYS A 1 330 ? -70.116 14.762 18.293  1.00 39.34  ? 330  CYS A N   1 
ATOM   2002 C CA  . CYS A 1 330 ? -70.956 15.965 18.330  1.00 39.48  ? 330  CYS A CA  1 
ATOM   2003 C C   . CYS A 1 330 ? -71.291 16.359 19.767  1.00 43.58  ? 330  CYS A C   1 
ATOM   2004 O O   . CYS A 1 330 ? -71.215 15.528 20.674  1.00 43.13  ? 330  CYS A O   1 
ATOM   2005 C CB  . CYS A 1 330 ? -72.237 15.743 17.525  1.00 39.93  ? 330  CYS A CB  1 
ATOM   2006 S SG  . CYS A 1 330 ? -71.975 15.110 15.847  1.00 43.89  ? 330  CYS A SG  1 
ATOM   2007 N N   . ASN A 1 331 ? -71.704 17.626 19.958  1.00 40.26  ? 331  ASN A N   1 
ATOM   2008 C CA  . ASN A 1 331 ? -72.153 18.161 21.249  1.00 40.08  ? 331  ASN A CA  1 
ATOM   2009 C C   . ASN A 1 331 ? -73.684 18.036 21.408  1.00 43.92  ? 331  ASN A C   1 
ATOM   2010 O O   . ASN A 1 331 ? -74.171 18.053 22.538  1.00 43.54  ? 331  ASN A O   1 
ATOM   2011 C CB  . ASN A 1 331 ? -71.671 19.614 21.468  1.00 40.96  ? 331  ASN A CB  1 
ATOM   2012 C CG  . ASN A 1 331 ? -72.249 20.681 20.551  1.00 63.72  ? 331  ASN A CG  1 
ATOM   2013 O OD1 . ASN A 1 331 ? -73.455 20.737 20.285  1.00 57.91  ? 331  ASN A OD1 1 
ATOM   2014 N ND2 . ASN A 1 331 ? -71.418 21.630 20.132  1.00 55.51  ? 331  ASN A ND2 1 
ATOM   2015 N N   . GLY A 1 332 ? -74.410 17.908 20.288  1.00 40.37  ? 332  GLY A N   1 
ATOM   2016 C CA  . GLY A 1 332 ? -75.861 17.754 20.269  1.00 40.16  ? 332  GLY A CA  1 
ATOM   2017 C C   . GLY A 1 332 ? -76.604 18.829 19.498  1.00 43.93  ? 332  GLY A C   1 
ATOM   2018 O O   . GLY A 1 332 ? -77.659 18.547 18.922  1.00 43.38  ? 332  GLY A O   1 
ATOM   2019 N N   . GLU A 1 333 ? -76.071 20.068 19.482  1.00 40.54  ? 333  GLU A N   1 
ATOM   2020 C CA  . GLU A 1 333 ? -76.707 21.215 18.822  1.00 40.38  ? 333  GLU A CA  1 
ATOM   2021 C C   . GLU A 1 333 ? -76.269 21.460 17.359  1.00 43.86  ? 333  GLU A C   1 
ATOM   2022 O O   . GLU A 1 333 ? -76.682 22.470 16.788  1.00 43.50  ? 333  GLU A O   1 
ATOM   2023 C CB  . GLU A 1 333 ? -76.471 22.491 19.660  1.00 41.83  ? 333  GLU A CB  1 
ATOM   2024 C CG  . GLU A 1 333 ? -76.893 22.380 21.120  1.00 52.89  ? 333  GLU A CG  1 
ATOM   2025 C CD  . GLU A 1 333 ? -78.350 22.027 21.359  1.00 73.93  ? 333  GLU A CD  1 
ATOM   2026 O OE1 . GLU A 1 333 ? -79.214 22.489 20.579  1.00 67.15  ? 333  GLU A OE1 1 
ATOM   2027 O OE2 . GLU A 1 333 ? -78.629 21.301 22.340  1.00 68.46  ? 333  GLU A OE2 1 
ATOM   2028 N N   . GLU A 1 334 ? -75.478 20.553 16.738  1.00 39.98  ? 334  GLU A N   1 
ATOM   2029 C CA  . GLU A 1 334 ? -75.047 20.740 15.343  1.00 39.54  ? 334  GLU A CA  1 
ATOM   2030 C C   . GLU A 1 334 ? -76.200 20.542 14.357  1.00 43.10  ? 334  GLU A C   1 
ATOM   2031 O O   . GLU A 1 334 ? -77.114 19.761 14.617  1.00 42.64  ? 334  GLU A O   1 
ATOM   2032 C CB  . GLU A 1 334 ? -73.890 19.793 14.961  1.00 40.83  ? 334  GLU A CB  1 
ATOM   2033 C CG  . GLU A 1 334 ? -72.535 20.194 15.518  1.00 50.45  ? 334  GLU A CG  1 
ATOM   2034 C CD  . GLU A 1 334 ? -72.217 19.684 16.908  1.00 67.25  ? 334  GLU A CD  1 
ATOM   2035 O OE1 . GLU A 1 334 ? -73.162 19.370 17.667  1.00 59.29  ? 334  GLU A OE1 1 
ATOM   2036 O OE2 . GLU A 1 334 ? -71.013 19.600 17.243  1.00 59.67  ? 334  GLU A OE2 1 
ATOM   2037 N N   . LEU A 1 335 ? -76.136 21.243 13.217  1.00 39.54  ? 335  LEU A N   1 
ATOM   2038 C CA  . LEU A 1 335 ? -77.141 21.149 12.156  1.00 39.33  ? 335  LEU A CA  1 
ATOM   2039 C C   . LEU A 1 335 ? -76.909 19.905 11.287  1.00 42.89  ? 335  LEU A C   1 
ATOM   2040 O O   . LEU A 1 335 ? -77.865 19.379 10.717  1.00 42.38  ? 335  LEU A O   1 
ATOM   2041 C CB  . LEU A 1 335 ? -77.113 22.410 11.276  1.00 39.40  ? 335  LEU A CB  1 
ATOM   2042 C CG  . LEU A 1 335 ? -77.411 23.732 11.986  1.00 44.13  ? 335  LEU A CG  1 
ATOM   2043 C CD1 . LEU A 1 335 ? -77.033 24.912 11.112  1.00 44.33  ? 335  LEU A CD1 1 
ATOM   2044 C CD2 . LEU A 1 335 ? -78.875 23.823 12.396  1.00 46.45  ? 335  LEU A CD2 1 
ATOM   2045 N N   . THR A 1 336 ? -75.646 19.451 11.170  1.00 39.29  ? 336  THR A N   1 
ATOM   2046 C CA  . THR A 1 336 ? -75.281 18.275 10.376  1.00 39.01  ? 336  THR A CA  1 
ATOM   2047 C C   . THR A 1 336 ? -74.023 17.601 10.949  1.00 42.40  ? 336  THR A C   1 
ATOM   2048 O O   . THR A 1 336 ? -73.264 18.241 11.678  1.00 41.87  ? 336  THR A O   1 
ATOM   2049 C CB  . THR A 1 336 ? -75.134 18.681 8.903   1.00 47.99  ? 336  THR A CB  1 
ATOM   2050 O OG1 . THR A 1 336 ? -74.793 17.538 8.125   1.00 48.33  ? 336  THR A OG1 1 
ATOM   2051 C CG2 . THR A 1 336 ? -74.104 19.791 8.687   1.00 46.79  ? 336  THR A CG2 1 
ATOM   2052 N N   . LEU A 1 337 ? -73.811 16.309 10.628  1.00 38.74  ? 337  LEU A N   1 
ATOM   2053 C CA  . LEU A 1 337 ? -72.661 15.547 11.135  1.00 38.46  ? 337  LEU A CA  1 
ATOM   2054 C C   . LEU A 1 337 ? -71.300 16.062 10.645  1.00 42.29  ? 337  LEU A C   1 
ATOM   2055 O O   . LEU A 1 337 ? -70.305 15.834 11.333  1.00 41.84  ? 337  LEU A O   1 
ATOM   2056 C CB  . LEU A 1 337 ? -72.788 14.049 10.810  1.00 38.49  ? 337  LEU A CB  1 
ATOM   2057 C CG  . LEU A 1 337 ? -73.872 13.255 11.534  1.00 43.16  ? 337  LEU A CG  1 
ATOM   2058 C CD1 . LEU A 1 337 ? -73.979 11.861 10.950  1.00 43.34  ? 337  LEU A CD1 1 
ATOM   2059 C CD2 . LEU A 1 337 ? -73.590 13.154 13.030  1.00 45.58  ? 337  LEU A CD2 1 
ATOM   2060 N N   . SER A 1 338 ? -71.241 16.744 9.483   1.00 38.90  ? 338  SER A N   1 
ATOM   2061 C CA  . SER A 1 338 ? -69.982 17.297 8.967   1.00 38.74  ? 338  SER A CA  1 
ATOM   2062 C C   . SER A 1 338 ? -69.451 18.448 9.844   1.00 42.80  ? 338  SER A C   1 
ATOM   2063 O O   . SER A 1 338 ? -68.241 18.665 9.883   1.00 42.31  ? 338  SER A O   1 
ATOM   2064 C CB  . SER A 1 338 ? -70.145 17.770 7.525   1.00 42.22  ? 338  SER A CB  1 
ATOM   2065 O OG  . SER A 1 338 ? -71.262 18.632 7.380   1.00 51.08  ? 338  SER A OG  1 
ATOM   2066 N N   . ASN A 1 339 ? -70.345 19.160 10.562  1.00 39.65  ? 339  ASN A N   1 
ATOM   2067 C CA  . ASN A 1 339 ? -69.958 20.259 11.456  1.00 39.57  ? 339  ASN A CA  1 
ATOM   2068 C C   . ASN A 1 339 ? -69.295 19.754 12.752  1.00 43.49  ? 339  ASN A C   1 
ATOM   2069 O O   . ASN A 1 339 ? -68.615 20.533 13.419  1.00 43.18  ? 339  ASN A O   1 
ATOM   2070 C CB  . ASN A 1 339 ? -71.170 21.138 11.794  1.00 40.35  ? 339  ASN A CB  1 
ATOM   2071 C CG  . ASN A 1 339 ? -71.800 21.819 10.601  1.00 62.19  ? 339  ASN A CG  1 
ATOM   2072 O OD1 . ASN A 1 339 ? -71.236 21.871 9.501   1.00 55.58  ? 339  ASN A OD1 1 
ATOM   2073 N ND2 . ASN A 1 339 ? -72.991 22.366 10.793  1.00 54.59  ? 339  ASN A ND2 1 
ATOM   2074 N N   . CYS A 1 340 ? -69.487 18.466 13.110  1.00 39.93  ? 340  CYS A N   1 
ATOM   2075 C CA  . CYS A 1 340 ? -68.891 17.860 14.308  1.00 39.76  ? 340  CYS A CA  1 
ATOM   2076 C C   . CYS A 1 340 ? -67.401 17.573 14.097  1.00 43.76  ? 340  CYS A C   1 
ATOM   2077 O O   . CYS A 1 340 ? -66.868 17.809 13.013  1.00 43.38  ? 340  CYS A O   1 
ATOM   2078 C CB  . CYS A 1 340 ? -69.633 16.577 14.675  1.00 40.04  ? 340  CYS A CB  1 
ATOM   2079 S SG  . CYS A 1 340 ? -71.431 16.751 14.780  1.00 43.92  ? 340  CYS A SG  1 
ATOM   2080 N N   . SER A 1 341 ? -66.736 17.039 15.137  1.00 40.39  ? 341  SER A N   1 
ATOM   2081 C CA  . SER A 1 341 ? -65.334 16.635 15.053  1.00 40.27  ? 341  SER A CA  1 
ATOM   2082 C C   . SER A 1 341 ? -65.310 15.208 14.495  1.00 43.99  ? 341  SER A C   1 
ATOM   2083 O O   . SER A 1 341 ? -65.967 14.333 15.059  1.00 43.61  ? 341  SER A O   1 
ATOM   2084 C CB  . SER A 1 341 ? -64.667 16.697 16.424  1.00 43.98  ? 341  SER A CB  1 
ATOM   2085 O OG  . SER A 1 341 ? -63.287 16.381 16.332  1.00 53.22  ? 341  SER A OG  1 
ATOM   2086 N N   . TRP A 1 342 ? -64.592 14.982 13.376  1.00 40.33  ? 342  TRP A N   1 
ATOM   2087 C CA  . TRP A 1 342 ? -64.528 13.674 12.715  1.00 40.08  ? 342  TRP A CA  1 
ATOM   2088 C C   . TRP A 1 342 ? -63.133 13.289 12.232  1.00 44.12  ? 342  TRP A C   1 
ATOM   2089 O O   . TRP A 1 342 ? -62.309 14.154 11.944  1.00 43.59  ? 342  TRP A O   1 
ATOM   2090 C CB  . TRP A 1 342 ? -65.518 13.608 11.536  1.00 38.74  ? 342  TRP A CB  1 
ATOM   2091 C CG  . TRP A 1 342 ? -65.428 14.737 10.548  1.00 39.62  ? 342  TRP A CG  1 
ATOM   2092 C CD1 . TRP A 1 342 ? -66.246 15.826 10.484  1.00 42.51  ? 342  TRP A CD1 1 
ATOM   2093 C CD2 . TRP A 1 342 ? -64.563 14.818 9.405   1.00 39.41  ? 342  TRP A CD2 1 
ATOM   2094 N NE1 . TRP A 1 342 ? -65.902 16.615 9.412   1.00 41.90  ? 342  TRP A NE1 1 
ATOM   2095 C CE2 . TRP A 1 342 ? -64.866 16.024 8.736   1.00 43.28  ? 342  TRP A CE2 1 
ATOM   2096 C CE3 . TRP A 1 342 ? -63.514 14.023 8.916   1.00 40.62  ? 342  TRP A CE3 1 
ATOM   2097 C CZ2 . TRP A 1 342 ? -64.183 16.435 7.588   1.00 42.56  ? 342  TRP A CZ2 1 
ATOM   2098 C CZ3 . TRP A 1 342 ? -62.838 14.433 7.779   1.00 42.05  ? 342  TRP A CZ3 1 
ATOM   2099 C CH2 . TRP A 1 342 ? -63.171 15.627 7.130   1.00 42.69  ? 342  TRP A CH2 1 
ATOM   2100 N N   . ARG A 1 343 ? -62.897 11.966 12.124  1.00 40.99  ? 343  ARG A N   1 
ATOM   2101 C CA  . ARG A 1 343 ? -61.642 11.367 11.654  1.00 41.00  ? 343  ARG A CA  1 
ATOM   2102 C C   . ARG A 1 343 ? -62.008 10.194 10.732  1.00 45.12  ? 343  ARG A C   1 
ATOM   2103 O O   . ARG A 1 343 ? -62.743 9.303  11.160  1.00 44.67  ? 343  ARG A O   1 
ATOM   2104 C CB  . ARG A 1 343 ? -60.779 10.857 12.835  1.00 41.52  ? 343  ARG A CB  1 
ATOM   2105 C CG  . ARG A 1 343 ? -60.650 11.804 14.033  1.00 52.85  ? 343  ARG A CG  1 
ATOM   2106 C CD  . ARG A 1 343 ? -59.814 13.042 13.740  1.00 64.53  ? 343  ARG A CD  1 
ATOM   2107 N NE  . ARG A 1 343 ? -60.143 14.155 14.637  1.00 74.06  ? 343  ARG A NE  1 
ATOM   2108 C CZ  . ARG A 1 343 ? -59.610 15.374 14.571  1.00 88.68  ? 343  ARG A CZ  1 
ATOM   2109 N NH1 . ARG A 1 343 ? -58.707 15.666 13.639  1.00 76.51  ? 343  ARG A NH1 1 
ATOM   2110 N NH2 . ARG A 1 343 ? -59.976 16.313 15.435  1.00 75.33  ? 343  ARG A NH2 1 
ATOM   2111 N N   . PHE A 1 344 ? -61.524 10.201 9.475   1.00 41.93  ? 344  PHE A N   1 
ATOM   2112 C CA  . PHE A 1 344 ? -61.829 9.151  8.497   1.00 41.87  ? 344  PHE A CA  1 
ATOM   2113 C C   . PHE A 1 344 ? -60.723 8.091  8.451   1.00 46.50  ? 344  PHE A C   1 
ATOM   2114 O O   . PHE A 1 344 ? -59.553 8.438  8.288   1.00 46.06  ? 344  PHE A O   1 
ATOM   2115 C CB  . PHE A 1 344 ? -62.035 9.768  7.103   1.00 43.55  ? 344  PHE A CB  1 
ATOM   2116 C CG  . PHE A 1 344 ? -62.304 8.763  6.006   1.00 44.99  ? 344  PHE A CG  1 
ATOM   2117 C CD1 . PHE A 1 344 ? -63.397 7.913  6.074   1.00 47.96  ? 344  PHE A CD1 1 
ATOM   2118 C CD2 . PHE A 1 344 ? -61.476 8.682  4.896   1.00 47.17  ? 344  PHE A CD2 1 
ATOM   2119 C CE1 . PHE A 1 344 ? -63.646 6.987  5.063   1.00 48.86  ? 344  PHE A CE1 1 
ATOM   2120 C CE2 . PHE A 1 344 ? -61.727 7.754  3.886   1.00 49.97  ? 344  PHE A CE2 1 
ATOM   2121 C CZ  . PHE A 1 344 ? -62.812 6.915  3.974   1.00 47.99  ? 344  PHE A CZ  1 
ATOM   2122 N N   . ASN A 1 345 ? -61.107 6.800  8.568   1.00 43.65  ? 345  ASN A N   1 
ATOM   2123 C CA  . ASN A 1 345 ? -60.202 5.644  8.539   1.00 43.76  ? 345  ASN A CA  1 
ATOM   2124 C C   . ASN A 1 345 ? -59.067 5.742  9.567   1.00 48.48  ? 345  ASN A C   1 
ATOM   2125 O O   . ASN A 1 345 ? -57.894 5.852  9.203   1.00 48.06  ? 345  ASN A O   1 
ATOM   2126 C CB  . ASN A 1 345 ? -59.662 5.395  7.119   1.00 44.42  ? 345  ASN A CB  1 
ATOM   2127 C CG  . ASN A 1 345 ? -60.709 4.963  6.118   1.00 65.84  ? 345  ASN A CG  1 
ATOM   2128 O OD1 . ASN A 1 345 ? -61.873 4.709  6.451   1.00 59.65  ? 345  ASN A OD1 1 
ATOM   2129 N ND2 . ASN A 1 345 ? -60.306 4.833  4.863   1.00 57.48  ? 345  ASN A ND2 1 
ATOM   2130 N N   . ASN A 1 346 ? -59.439 5.708  10.858  1.00 45.62  ? 346  ASN A N   1 
ATOM   2131 C CA  . ASN A 1 346 ? -58.504 5.754  11.986  1.00 45.63  ? 346  ASN A CA  1 
ATOM   2132 C C   . ASN A 1 346 ? -58.534 4.385  12.665  1.00 49.49  ? 346  ASN A C   1 
ATOM   2133 O O   . ASN A 1 346 ? -59.540 4.029  13.281  1.00 49.05  ? 346  ASN A O   1 
ATOM   2134 C CB  . ASN A 1 346 ? -58.888 6.871  12.974  1.00 47.10  ? 346  ASN A CB  1 
ATOM   2135 C CG  . ASN A 1 346 ? -58.091 8.144  12.800  1.00 71.82  ? 346  ASN A CG  1 
ATOM   2136 O OD1 . ASN A 1 346 ? -57.442 8.625  13.735  1.00 66.62  ? 346  ASN A OD1 1 
ATOM   2137 N ND2 . ASN A 1 346 ? -58.123 8.726  11.607  1.00 63.65  ? 346  ASN A ND2 1 
ATOM   2138 N N   . SER A 1 347 ? -57.449 3.604  12.520  1.00 46.02  ? 347  SER A N   1 
ATOM   2139 C CA  . SER A 1 347 ? -57.349 2.259  13.097  1.00 45.80  ? 347  SER A CA  1 
ATOM   2140 C C   . SER A 1 347 ? -57.331 2.258  14.633  1.00 49.18  ? 347  SER A C   1 
ATOM   2141 O O   . SER A 1 347 ? -57.749 1.270  15.234  1.00 48.73  ? 347  SER A O   1 
ATOM   2142 C CB  . SER A 1 347 ? -56.113 1.540  12.565  1.00 49.52  ? 347  SER A CB  1 
ATOM   2143 O OG  . SER A 1 347 ? -56.162 1.424  11.152  1.00 58.44  ? 347  SER A OG  1 
ATOM   2144 N N   . ASN A 1 348 ? -56.862 3.351  15.264  1.00 45.33  ? 348  ASN A N   1 
ATOM   2145 C CA  . ASN A 1 348 ? -56.813 3.454  16.727  1.00 44.94  ? 348  ASN A CA  1 
ATOM   2146 C C   . ASN A 1 348 ? -58.217 3.650  17.313  1.00 47.94  ? 348  ASN A C   1 
ATOM   2147 O O   . ASN A 1 348 ? -58.552 3.018  18.315  1.00 47.50  ? 348  ASN A O   1 
ATOM   2148 C CB  . ASN A 1 348 ? -55.896 4.604  17.163  1.00 46.14  ? 348  ASN A CB  1 
ATOM   2149 C CG  . ASN A 1 348 ? -54.458 4.425  16.738  1.00 70.08  ? 348  ASN A CG  1 
ATOM   2150 O OD1 . ASN A 1 348 ? -53.946 5.150  15.879  1.00 64.48  ? 348  ASN A OD1 1 
ATOM   2151 N ND2 . ASN A 1 348 ? -53.778 3.444  17.317  1.00 62.11  ? 348  ASN A ND2 1 
ATOM   2152 N N   . LEU A 1 349 ? -59.033 4.513  16.684  1.00 43.78  ? 349  LEU A N   1 
ATOM   2153 C CA  . LEU A 1 349 ? -60.400 4.795  17.134  1.00 43.21  ? 349  LEU A CA  1 
ATOM   2154 C C   . LEU A 1 349 ? -61.390 3.695  16.731  1.00 45.75  ? 349  LEU A C   1 
ATOM   2155 O O   . LEU A 1 349 ? -62.291 3.390  17.512  1.00 45.39  ? 349  LEU A O   1 
ATOM   2156 C CB  . LEU A 1 349 ? -60.886 6.143  16.573  1.00 43.34  ? 349  LEU A CB  1 
ATOM   2157 C CG  . LEU A 1 349 ? -60.083 7.383  16.980  1.00 48.19  ? 349  LEU A CG  1 
ATOM   2158 C CD1 . LEU A 1 349 ? -60.449 8.573  16.110  1.00 48.38  ? 349  LEU A CD1 1 
ATOM   2159 C CD2 . LEU A 1 349 ? -60.294 7.723  18.450  1.00 50.68  ? 349  LEU A CD2 1 
ATOM   2160 N N   . CYS A 1 350 ? -61.247 3.127  15.512  1.00 41.09  ? 350  CYS A N   1 
ATOM   2161 C CA  . CYS A 1 350 ? -62.147 2.093  14.986  1.00 40.26  ? 350  CYS A CA  1 
ATOM   2162 C C   . CYS A 1 350 ? -61.386 0.812  14.625  1.00 44.39  ? 350  CYS A C   1 
ATOM   2163 O O   . CYS A 1 350 ? -60.581 0.819  13.695  1.00 44.06  ? 350  CYS A O   1 
ATOM   2164 C CB  . CYS A 1 350 ? -62.915 2.632  13.783  1.00 40.03  ? 350  CYS A CB  1 
ATOM   2165 S SG  . CYS A 1 350 ? -63.854 4.145  14.121  1.00 43.51  ? 350  CYS A SG  1 
ATOM   2166 N N   . SER A 1 351 ? -61.657 -0.286 15.354  1.00 40.96  ? 351  SER A N   1 
ATOM   2167 C CA  . SER A 1 351 ? -61.032 -1.595 15.119  1.00 40.74  ? 351  SER A CA  1 
ATOM   2168 C C   . SER A 1 351 ? -62.004 -2.729 15.472  1.00 44.24  ? 351  SER A C   1 
ATOM   2169 O O   . SER A 1 351 ? -62.378 -3.505 14.591  1.00 43.90  ? 351  SER A O   1 
ATOM   2170 C CB  . SER A 1 351 ? -59.741 -1.725 15.923  1.00 44.44  ? 351  SER A CB  1 
ATOM   2171 O OG  . SER A 1 351 ? -59.143 -3.001 15.757  1.00 53.82  ? 351  SER A OG  1 
ATOM   2172 N N   . GLN A 1 352 ? -62.430 -2.803 16.748  1.00 40.28  ? 352  GLN A N   1 
ATOM   2173 C CA  . GLN A 1 352 ? -63.384 -3.805 17.232  1.00 39.82  ? 352  GLN A CA  1 
ATOM   2174 C C   . GLN A 1 352 ? -64.840 -3.293 17.148  1.00 42.55  ? 352  GLN A C   1 
ATOM   2175 O O   . GLN A 1 352 ? -65.750 -4.000 17.585  1.00 42.08  ? 352  GLN A O   1 
ATOM   2176 C CB  . GLN A 1 352 ? -63.051 -4.196 18.687  1.00 41.29  ? 352  GLN A CB  1 
ATOM   2177 C CG  . GLN A 1 352 ? -61.649 -4.771 18.889  1.00 58.60  ? 352  GLN A CG  1 
ATOM   2178 C CD  . GLN A 1 352 ? -61.497 -6.143 18.279  1.00 79.28  ? 352  GLN A CD  1 
ATOM   2179 O OE1 . GLN A 1 352 ? -61.785 -7.163 18.915  1.00 75.07  ? 352  GLN A OE1 1 
ATOM   2180 N NE2 . GLN A 1 352 ? -61.049 -6.208 17.031  1.00 71.64  ? 352  GLN A NE2 1 
ATOM   2181 N N   . SER A 1 353 ? -65.067 -2.083 16.586  1.00 38.23  ? 353  SER A N   1 
ATOM   2182 C CA  . SER A 1 353 ? -66.405 -1.501 16.459  1.00 37.65  ? 353  SER A CA  1 
ATOM   2183 C C   . SER A 1 353 ? -67.222 -2.165 15.347  1.00 40.35  ? 353  SER A C   1 
ATOM   2184 O O   . SER A 1 353 ? -66.680 -2.904 14.524  1.00 39.84  ? 353  SER A O   1 
ATOM   2185 C CB  . SER A 1 353 ? -66.303 -0.001 16.191  1.00 41.29  ? 353  SER A CB  1 
ATOM   2186 O OG  . SER A 1 353 ? -65.550 0.258  15.018  1.00 50.41  ? 353  SER A OG  1 
ATOM   2187 N N   . LEU A 1 354 ? -68.529 -1.869 15.326  1.00 36.09  ? 354  LEU A N   1 
ATOM   2188 C CA  . LEU A 1 354 ? -69.498 -2.375 14.352  1.00 35.49  ? 354  LEU A CA  1 
ATOM   2189 C C   . LEU A 1 354 ? -70.148 -1.197 13.617  1.00 38.18  ? 354  LEU A C   1 
ATOM   2190 O O   . LEU A 1 354 ? -69.999 -0.048 14.039  1.00 37.69  ? 354  LEU A O   1 
ATOM   2191 C CB  . LEU A 1 354 ? -70.578 -3.199 15.071  1.00 35.57  ? 354  LEU A CB  1 
ATOM   2192 C CG  . LEU A 1 354 ? -70.073 -4.350 15.944  1.00 40.38  ? 354  LEU A CG  1 
ATOM   2193 C CD1 . LEU A 1 354 ? -71.216 -5.019 16.679  1.00 40.61  ? 354  LEU A CD1 1 
ATOM   2194 C CD2 . LEU A 1 354 ? -69.328 -5.383 15.119  1.00 42.92  ? 354  LEU A CD2 1 
ATOM   2195 N N   . ALA A 1 355 ? -70.865 -1.482 12.519  1.00 33.88  ? 355  ALA A N   1 
ATOM   2196 C CA  . ALA A 1 355 ? -71.531 -0.449 11.717  1.00 33.30  ? 355  ALA A CA  1 
ATOM   2197 C C   . ALA A 1 355 ? -72.740 0.125  12.467  1.00 36.02  ? 355  ALA A C   1 
ATOM   2198 O O   . ALA A 1 355 ? -73.770 -0.539 12.570  1.00 35.50  ? 355  ALA A O   1 
ATOM   2199 C CB  . ALA A 1 355 ? -71.964 -1.023 10.375  1.00 34.08  ? 355  ALA A CB  1 
ATOM   2200 N N   . ALA A 1 356 ? -72.604 1.360  12.990  1.00 31.75  ? 356  ALA A N   1 
ATOM   2201 C CA  . ALA A 1 356 ? -73.642 2.042  13.776  1.00 31.18  ? 356  ALA A CA  1 
ATOM   2202 C C   . ALA A 1 356 ? -75.003 2.126  13.085  1.00 34.18  ? 356  ALA A C   1 
ATOM   2203 O O   . ALA A 1 356 ? -75.072 2.263  11.864  1.00 33.59  ? 356  ALA A O   1 
ATOM   2204 C CB  . ALA A 1 356 ? -73.179 3.439  14.151  1.00 31.91  ? 356  ALA A CB  1 
ATOM   2205 N N   . ARG A 1 357 ? -76.079 2.052  13.888  1.00 30.31  ? 357  ARG A N   1 
ATOM   2206 C CA  . ARG A 1 357 ? -77.468 2.110  13.431  1.00 29.91  ? 357  ARG A CA  1 
ATOM   2207 C C   . ARG A 1 357 ? -78.245 3.156  14.217  1.00 33.44  ? 357  ARG A C   1 
ATOM   2208 O O   . ARG A 1 357 ? -77.763 3.647  15.238  1.00 32.89  ? 357  ARG A O   1 
ATOM   2209 C CB  . ARG A 1 357 ? -78.149 0.751  13.632  1.00 29.94  ? 357  ARG A CB  1 
ATOM   2210 C CG  . ARG A 1 357 ? -77.543 -0.374 12.807  1.00 38.42  ? 357  ARG A CG  1 
ATOM   2211 C CD  . ARG A 1 357 ? -78.568 -1.426 12.410  1.00 45.65  ? 357  ARG A CD  1 
ATOM   2212 N NE  . ARG A 1 357 ? -78.329 -1.932 11.055  1.00 53.19  ? 357  ARG A NE  1 
ATOM   2213 C CZ  . ARG A 1 357 ? -79.263 -2.373 10.210  1.00 68.08  ? 357  ARG A CZ  1 
ATOM   2214 N NH1 . ARG A 1 357 ? -80.548 -2.378 10.562  1.00 57.49  ? 357  ARG A NH1 1 
ATOM   2215 N NH2 . ARG A 1 357 ? -78.922 -2.808 9.003   1.00 54.34  ? 357  ARG A NH2 1 
ATOM   2216 N N   . VAL A 1 358 ? -79.465 3.474  13.754  1.00 30.01  ? 358  VAL A N   1 
ATOM   2217 C CA  . VAL A 1 358 ? -80.334 4.446  14.416  1.00 29.89  ? 358  VAL A CA  1 
ATOM   2218 C C   . VAL A 1 358 ? -81.794 4.306  13.958  1.00 34.03  ? 358  VAL A C   1 
ATOM   2219 O O   . VAL A 1 358 ? -82.054 3.987  12.798  1.00 33.58  ? 358  VAL A O   1 
ATOM   2220 C CB  . VAL A 1 358 ? -79.806 5.891  14.220  1.00 33.77  ? 358  VAL A CB  1 
ATOM   2221 C CG1 . VAL A 1 358 ? -79.759 6.270  12.744  1.00 33.61  ? 358  VAL A CG1 1 
ATOM   2222 C CG2 . VAL A 1 358 ? -80.625 6.901  15.018  1.00 33.55  ? 358  VAL A CG2 1 
ATOM   2223 N N   . LEU A 1 359 ? -82.732 4.563  14.883  1.00 30.93  ? 359  LEU A N   1 
ATOM   2224 C CA  . LEU A 1 359 ? -84.176 4.535  14.656  1.00 30.94  ? 359  LEU A CA  1 
ATOM   2225 C C   . LEU A 1 359 ? -84.704 5.914  15.054  1.00 35.19  ? 359  LEU A C   1 
ATOM   2226 O O   . LEU A 1 359 ? -84.582 6.285  16.220  1.00 34.66  ? 359  LEU A O   1 
ATOM   2227 C CB  . LEU A 1 359 ? -84.810 3.427  15.522  1.00 31.04  ? 359  LEU A CB  1 
ATOM   2228 C CG  . LEU A 1 359 ? -86.335 3.439  15.721  1.00 35.74  ? 359  LEU A CG  1 
ATOM   2229 C CD1 . LEU A 1 359 ? -87.070 3.271  14.414  1.00 35.86  ? 359  LEU A CD1 1 
ATOM   2230 C CD2 . LEU A 1 359 ? -86.755 2.335  16.666  1.00 38.31  ? 359  LEU A CD2 1 
ATOM   2231 N N   . CYS A 1 360 ? -85.250 6.682  14.094  1.00 32.29  ? 360  CYS A N   1 
ATOM   2232 C CA  . CYS A 1 360 ? -85.776 8.029  14.352  1.00 32.41  ? 360  CYS A CA  1 
ATOM   2233 C C   . CYS A 1 360 ? -87.285 7.974  14.664  1.00 37.14  ? 360  CYS A C   1 
ATOM   2234 O O   . CYS A 1 360 ? -87.892 6.905  14.591  1.00 36.71  ? 360  CYS A O   1 
ATOM   2235 C CB  . CYS A 1 360 ? -85.482 8.957  13.177  1.00 32.65  ? 360  CYS A CB  1 
ATOM   2236 S SG  . CYS A 1 360 ? -83.788 8.845  12.530  1.00 36.46  ? 360  CYS A SG  1 
ATOM   2237 N N   . SER A 1 361 ? -87.881 9.127  15.011  1.00 34.42  ? 361  SER A N   1 
ATOM   2238 C CA  . SER A 1 361 ? -89.296 9.223  15.394  1.00 34.62  ? 361  SER A CA  1 
ATOM   2239 C C   . SER A 1 361 ? -90.300 9.067  14.249  1.00 39.53  ? 361  SER A C   1 
ATOM   2240 O O   . SER A 1 361 ? -91.319 8.401  14.431  1.00 39.16  ? 361  SER A O   1 
ATOM   2241 C CB  . SER A 1 361 ? -89.563 10.547 16.104  1.00 38.25  ? 361  SER A CB  1 
ATOM   2242 O OG  . SER A 1 361 ? -88.810 10.647 17.301  1.00 47.71  ? 361  SER A OG  1 
ATOM   2243 N N   . ALA A 1 362 ? -90.040 9.697  13.090  1.00 36.78  ? 362  ALA A N   1 
ATOM   2244 C CA  . ALA A 1 362 ? -90.970 9.677  11.950  1.00 36.82  ? 362  ALA A CA  1 
ATOM   2245 C C   . ALA A 1 362 ? -91.084 8.339  11.192  1.00 41.28  ? 362  ALA A C   1 
ATOM   2246 O O   . ALA A 1 362 ? -91.942 8.238  10.316  1.00 40.92  ? 362  ALA A O   1 
ATOM   2247 C CB  . ALA A 1 362 ? -90.612 10.785 10.973  1.00 37.55  ? 362  ALA A CB  1 
ATOM   2248 N N   . SER A 1 363 ? -90.245 7.332  11.498  1.00 38.37  ? 363  SER A N   1 
ATOM   2249 C CA  . SER A 1 363 ? -90.293 6.034  10.811  1.00 38.52  ? 363  SER A CA  1 
ATOM   2250 C C   . SER A 1 363 ? -91.566 5.237  11.090  1.00 43.13  ? 363  SER A C   1 
ATOM   2251 O O   . SER A 1 363 ? -92.192 5.415  12.136  1.00 42.62  ? 363  SER A O   1 
ATOM   2252 C CB  . SER A 1 363 ? -89.089 5.181  11.201  1.00 42.12  ? 363  SER A CB  1 
ATOM   2253 O OG  . SER A 1 363 ? -89.091 4.899  12.590  1.00 51.39  ? 363  SER A OG  1 
ATOM   2254 N N   . ARG A 1 364 ? -91.927 4.334  10.157  1.00 40.42  ? 364  ARG A N   1 
ATOM   2255 C CA  . ARG A 1 364 ? -93.088 3.452  10.316  1.00 40.53  ? 364  ARG A CA  1 
ATOM   2256 C C   . ARG A 1 364 ? -92.815 2.384  11.393  1.00 44.91  ? 364  ARG A C   1 
ATOM   2257 O O   . ARG A 1 364 ? -93.757 1.894  12.015  1.00 44.55  ? 364  ARG A O   1 
ATOM   2258 C CB  . ARG A 1 364 ? -93.512 2.807  8.973   1.00 41.12  ? 364  ARG A CB  1 
ATOM   2259 C CG  . ARG A 1 364 ? -92.569 1.731  8.414   1.00 52.68  ? 364  ARG A CG  1 
ATOM   2260 C CD  . ARG A 1 364 ? -93.153 1.016  7.201   1.00 64.10  ? 364  ARG A CD  1 
ATOM   2261 N NE  . ARG A 1 364 ? -92.854 1.693  5.936   1.00 73.66  ? 364  ARG A NE  1 
ATOM   2262 C CZ  . ARG A 1 364 ? -93.144 1.211  4.727   1.00 87.81  ? 364  ARG A CZ  1 
ATOM   2263 N NH1 . ARG A 1 364 ? -93.748 0.032  4.597   1.00 75.15  ? 364  ARG A NH1 1 
ATOM   2264 N NH2 . ARG A 1 364 ? -92.831 1.903  3.637   1.00 74.03  ? 364  ARG A NH2 1 
ATOM   2265 N N   . GLY A 1 365 ? -91.536 2.044  11.598  1.00 41.81  ? 365  GLY A N   1 
ATOM   2266 C CA  . GLY A 1 365 ? -91.103 1.086  12.610  1.00 41.78  ? 365  GLY A CA  1 
ATOM   2267 C C   . GLY A 1 365 ? -91.384 1.520  14.039  1.00 45.89  ? 365  GLY A C   1 
ATOM   2268 O O   . GLY A 1 365 ? -91.500 0.668  14.923  1.00 45.64  ? 365  GLY A O   1 
ATOM   2269 N N   . HIS A 1 366 ? -91.481 2.848  14.281  1.00 42.27  ? 366  HIS A N   1 
ATOM   2270 C CA  . HIS A 1 366 ? -91.794 3.431  15.588  1.00 68.74  ? 366  HIS A CA  1 
ATOM   2271 C C   . HIS A 1 366 ? -93.110 4.213  15.489  1.00 92.55  ? 366  HIS A C   1 
ATOM   2272 O O   . HIS A 1 366 ? -94.047 3.779  14.821  1.00 51.92  ? 366  HIS A O   1 
ATOM   2273 C CB  . HIS A 1 366 ? -90.649 4.351  16.048  1.00 69.46  ? 366  HIS A CB  1 
ATOM   2274 C CG  . HIS A 1 366 ? -91.020 5.270  17.171  1.00 72.82  ? 366  HIS A CG  1 
ATOM   2275 N ND1 . HIS A 1 366 ? -91.386 6.581  16.936  1.00 74.55  ? 366  HIS A ND1 1 
ATOM   2276 C CD2 . HIS A 1 366 ? -91.102 5.027  18.499  1.00 74.52  ? 366  HIS A CD2 1 
ATOM   2277 C CE1 . HIS A 1 366 ? -91.656 7.103  18.121  1.00 73.94  ? 366  HIS A CE1 1 
ATOM   2278 N NE2 . HIS A 1 366 ? -91.499 6.203  19.094  1.00 74.27  ? 366  HIS A NE2 1 
HETATM 2279 C C1  . NAG B 2 .   ? -60.078 19.932 -25.786 1.00 60.00  ? 1367 NAG A C1  1 
HETATM 2280 C C2  . NAG B 2 .   ? -59.748 20.227 -27.249 1.00 60.82  ? 1367 NAG A C2  1 
HETATM 2281 C C3  . NAG B 2 .   ? -58.828 19.137 -27.798 1.00 60.91  ? 1367 NAG A C3  1 
HETATM 2282 C C4  . NAG B 2 .   ? -57.593 18.990 -26.917 1.00 61.07  ? 1367 NAG A C4  1 
HETATM 2283 C C5  . NAG B 2 .   ? -58.015 18.725 -25.475 1.00 61.20  ? 1367 NAG A C5  1 
HETATM 2284 C C6  . NAG B 2 .   ? -56.851 18.675 -24.512 1.00 61.55  ? 1367 NAG A C6  1 
HETATM 2285 C C7  . NAG B 2 .   ? -61.177 21.173 -29.027 1.00 61.72  ? 1367 NAG A C7  1 
HETATM 2286 C C8  . NAG B 2 .   ? -62.519 21.104 -29.691 1.00 61.74  ? 1367 NAG A C8  1 
HETATM 2287 N N2  . NAG B 2 .   ? -60.974 20.298 -28.029 1.00 61.35  ? 1367 NAG A N2  1 
HETATM 2288 O O3  . NAG B 2 .   ? -58.436 19.472 -29.124 1.00 60.77  ? 1367 NAG A O3  1 
HETATM 2289 O O4  . NAG B 2 .   ? -56.794 17.910 -27.385 1.00 61.09  ? 1367 NAG A O4  1 
HETATM 2290 O O5  . NAG B 2 .   ? -58.879 19.781 -25.023 1.00 60.68  ? 1367 NAG A O5  1 
HETATM 2291 O O6  . NAG B 2 .   ? -57.282 18.326 -23.203 1.00 61.56  ? 1367 NAG A O6  1 
HETATM 2292 O O7  . NAG B 2 .   ? -60.317 21.973 -29.383 1.00 61.82  ? 1367 NAG A O7  1 
HETATM 2293 C C1  . EDO C 3 .   ? -63.640 32.243 -24.264 1.00 44.78  ? 1368 EDO A C1  1 
HETATM 2294 O O1  . EDO C 3 .   ? -62.676 31.207 -24.360 1.00 44.98  ? 1368 EDO A O1  1 
HETATM 2295 C C2  . EDO C 3 .   ? -64.531 32.007 -23.022 1.00 44.23  ? 1368 EDO A C2  1 
HETATM 2296 O O2  . EDO C 3 .   ? -65.457 33.072 -22.899 1.00 43.87  ? 1368 EDO A O2  1 
HETATM 2297 C C1  . EDO D 3 .   ? -69.048 13.661 23.183  1.00 46.18  ? 1369 EDO A C1  1 
HETATM 2298 O O1  . EDO D 3 .   ? -69.385 15.046 23.167  1.00 46.08  ? 1369 EDO A O1  1 
HETATM 2299 C C2  . EDO D 3 .   ? -70.318 12.772 23.184  1.00 46.38  ? 1369 EDO A C2  1 
HETATM 2300 O O2  . EDO D 3 .   ? -71.071 13.047 22.018  1.00 46.53  ? 1369 EDO A O2  1 
HETATM 2301 C C1  . EDO E 3 .   ? -62.486 17.399 10.960  1.00 27.87  ? 1370 EDO A C1  1 
HETATM 2302 O O1  . EDO E 3 .   ? -61.393 17.345 11.867  1.00 28.26  ? 1370 EDO A O1  1 
HETATM 2303 C C2  . EDO E 3 .   ? -63.367 18.636 11.222  1.00 27.67  ? 1370 EDO A C2  1 
HETATM 2304 O O2  . EDO E 3 .   ? -63.803 18.643 12.570  1.00 27.80  ? 1370 EDO A O2  1 
HETATM 2305 C C1  . EDO F 3 .   ? -62.480 24.811 -26.364 1.00 26.43  ? 1371 EDO A C1  1 
HETATM 2306 O O1  . EDO F 3 .   ? -61.534 25.196 -27.348 1.00 26.70  ? 1371 EDO A O1  1 
HETATM 2307 C C2  . EDO F 3 .   ? -63.877 25.379 -26.731 1.00 26.49  ? 1371 EDO A C2  1 
HETATM 2308 O O2  . EDO F 3 .   ? -64.881 24.756 -25.936 1.00 26.84  ? 1371 EDO A O2  1 
HETATM 2309 C C1  . EDO G 3 .   ? -69.293 25.966 -1.907  1.00 23.46  ? 1372 EDO A C1  1 
HETATM 2310 O O1  . EDO G 3 .   ? -68.489 27.008 -2.466  1.00 23.47  ? 1372 EDO A O1  1 
HETATM 2311 C C2  . EDO G 3 .   ? -68.627 24.571 -2.070  1.00 23.25  ? 1372 EDO A C2  1 
HETATM 2312 O O2  . EDO G 3 .   ? -67.842 24.236 -0.923  1.00 23.13  ? 1372 EDO A O2  1 
HETATM 2313 C C1  . EDO H 3 .   ? -60.546 26.555 -32.794 1.00 43.61  ? 1373 EDO A C1  1 
HETATM 2314 O O1  . EDO H 3 .   ? -59.789 25.480 -33.321 1.00 43.57  ? 1373 EDO A O1  1 
HETATM 2315 C C2  . EDO H 3 .   ? -60.001 26.941 -31.402 1.00 43.79  ? 1373 EDO A C2  1 
HETATM 2316 O O2  . EDO H 3 .   ? -60.804 27.973 -30.855 1.00 43.81  ? 1373 EDO A O2  1 
HETATM 2317 O O   . HOH I 4 .   ? -46.525 45.786 -11.918 1.00 3.00   ? 2001 HOH A O   1 
HETATM 2318 O O   . HOH I 4 .   ? -50.991 36.036 -7.482  1.00 13.95  ? 2002 HOH A O   1 
HETATM 2319 O O   . HOH I 4 .   ? -62.494 30.376 -6.094  1.00 3.00   ? 2003 HOH A O   1 
HETATM 2320 O O   . HOH I 4 .   ? -58.052 36.005 -12.954 1.00 7.53   ? 2004 HOH A O   1 
HETATM 2321 O O   . HOH I 4 .   ? -62.997 48.375 -15.617 1.00 3.00   ? 2005 HOH A O   1 
HETATM 2322 O O   . HOH I 4 .   ? -65.398 49.128 -13.336 1.00 40.06  ? 2006 HOH A O   1 
HETATM 2323 O O   . HOH I 4 .   ? -67.129 44.646 -13.181 1.00 6.34   ? 2007 HOH A O   1 
HETATM 2324 O O   . HOH I 4 .   ? -61.534 44.020 -0.969  1.00 3.00   ? 2008 HOH A O   1 
HETATM 2325 O O   . HOH I 4 .   ? -43.595 53.088 -10.112 1.00 25.63  ? 2009 HOH A O   1 
HETATM 2326 O O   . HOH I 4 .   ? -64.403 39.606 -13.962 1.00 17.32  ? 2010 HOH A O   1 
HETATM 2327 O O   . HOH I 4 .   ? -67.130 31.610 -2.677  1.00 10.97  ? 2011 HOH A O   1 
HETATM 2328 O O   . HOH I 4 .   ? -73.628 23.584 -1.650  1.00 3.00   ? 2012 HOH A O   1 
HETATM 2329 O O   . HOH I 4 .   ? -69.242 18.386 3.064   1.00 3.00   ? 2013 HOH A O   1 
HETATM 2330 O O   . HOH I 4 .   ? -64.283 18.745 -21.633 1.00 11.11  ? 2014 HOH A O   1 
HETATM 2331 O O   . HOH I 4 .   ? -71.666 15.525 -17.701 1.00 5.46   ? 2015 HOH A O   1 
HETATM 2332 O O   . HOH I 4 .   ? -66.881 12.372 -17.295 1.00 9.40   ? 2016 HOH A O   1 
HETATM 2333 O O   . HOH I 4 .   ? -60.261 14.162 -10.707 1.00 3.00   ? 2017 HOH A O   1 
HETATM 2334 O O   . HOH I 4 .   ? -58.032 20.368 -2.975  1.00 3.35   ? 2018 HOH A O   1 
HETATM 2335 O O   . HOH I 4 .   ? -68.434 11.509 -14.196 1.00 6.27   ? 2019 HOH A O   1 
HETATM 2336 O O   . HOH I 4 .   ? -72.288 28.629 -27.769 1.00 8.13   ? 2020 HOH A O   1 
HETATM 2337 O O   . HOH I 4 .   ? -60.800 18.221 -22.036 1.00 14.84  ? 2021 HOH A O   1 
HETATM 2338 O O   . HOH I 4 .   ? -62.655 30.862 -27.076 1.00 24.99  ? 2022 HOH A O   1 
HETATM 2339 O O   . HOH I 4 .   ? -76.475 29.965 -30.760 1.00 3.00   ? 2023 HOH A O   1 
HETATM 2340 O O   . HOH I 4 .   ? -78.064 33.284 -31.028 1.00 9.23   ? 2024 HOH A O   1 
HETATM 2341 O O   . HOH I 4 .   ? -85.060 34.582 -26.218 1.00 3.00   ? 2025 HOH A O   1 
HETATM 2342 O O   . HOH I 4 .   ? -76.295 26.509 -19.117 1.00 7.08   ? 2026 HOH A O   1 
HETATM 2343 O O   . HOH I 4 .   ? -78.041 13.849 3.126   1.00 12.08  ? 2027 HOH A O   1 
HETATM 2344 O O   . HOH I 4 .   ? -83.887 1.889  5.338   1.00 18.92  ? 2028 HOH A O   1 
HETATM 2345 O O   . HOH I 4 .   ? -83.190 0.367  2.730   1.00 11.58  ? 2029 HOH A O   1 
HETATM 2346 O O   . HOH I 4 .   ? -75.300 -2.130 10.925  1.00 11.71  ? 2030 HOH A O   1 
HETATM 2347 O O   . HOH I 4 .   ? -72.823 2.411  10.059  1.00 3.00   ? 2031 HOH A O   1 
HETATM 2348 O O   . HOH I 4 .   ? -68.089 7.451  -6.881  1.00 5.36   ? 2032 HOH A O   1 
HETATM 2349 O O   . HOH I 4 .   ? -74.794 4.689  -5.159  1.00 3.00   ? 2033 HOH A O   1 
HETATM 2350 O O   . HOH I 4 .   ? -67.140 -0.169 5.958   1.00 13.06  ? 2034 HOH A O   1 
HETATM 2351 O O   . HOH I 4 .   ? -80.764 7.396  21.073  1.00 3.00   ? 2035 HOH A O   1 
HETATM 2352 O O   . HOH I 4 .   ? -64.419 -2.293 6.454   1.00 3.76   ? 2036 HOH A O   1 
HETATM 2353 O O   . HOH I 4 .   ? -73.893 23.874 13.081  1.00 7.95   ? 2037 HOH A O   1 
HETATM 2354 O O   . HOH I 4 .   ? -62.121 18.677 15.000  1.00 33.73  ? 2038 HOH A O   1 
HETATM 2355 O O   . HOH I 4 .   ? -60.506 1.802  10.635  1.00 3.00   ? 2039 HOH A O   1 
HETATM 2356 O O   . HOH I 4 .   ? -65.941 -5.065 12.202  1.00 16.40  ? 2040 HOH A O   1 
HETATM 2357 O O   . HOH I 4 .   ? -82.971 -0.928 11.658  1.00 16.40  ? 2041 HOH A O   1 
HETATM 2358 O O   . HOH I 4 .   ? -93.645 -0.974 15.250  1.00 13.67  ? 2042 HOH A O   1 
HETATM 2359 O O   . HOH I 4 .   ? -94.992 4.405  18.760  1.00 16.64  ? 2043 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   TRP 2   2   ?   ?   ?   A . n 
A 1 3   LEU 3   3   ?   ?   ?   A . n 
A 1 4   PHE 4   4   ?   ?   ?   A . n 
A 1 5   PHE 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   ILE 7   7   ?   ?   ?   A . n 
A 1 8   THR 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  ?   ?   ?   A . n 
A 1 11  LEU 11  11  ?   ?   ?   A . n 
A 1 12  THR 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  ALA 14  14  ?   ?   ?   A . n 
A 1 15  LEU 15  15  ?   ?   ?   A . n 
A 1 16  SER 16  16  ?   ?   ?   A . n 
A 1 17  GLY 17  17  ?   ?   ?   A . n 
A 1 18  HIS 18  18  ?   ?   ?   A . n 
A 1 19  PRO 19  19  ?   ?   ?   A . n 
A 1 20  SER 20  20  ?   ?   ?   A . n 
A 1 21  PRO 21  21  ?   ?   ?   A . n 
A 1 22  ALA 22  22  ?   ?   ?   A . n 
A 1 23  PRO 23  23  ?   ?   ?   A . n 
A 1 24  PRO 24  24  ?   ?   ?   A . n 
A 1 25  ASP 25  25  ?   ?   ?   A . n 
A 1 26  GLN 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  ASN 28  28  ?   ?   ?   A . n 
A 1 29  THR 29  29  ?   ?   ?   A . n 
A 1 30  SER 30  30  ?   ?   ?   A . n 
A 1 31  SER 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  GLU 33  33  ?   ?   ?   A . n 
A 1 34  SER 34  34  ?   ?   ?   A . n 
A 1 35  GLU 35  35  ?   ?   ?   A . n 
A 1 36  LEU 36  36  ?   ?   ?   A . n 
A 1 37  TRP 37  37  ?   ?   ?   A . n 
A 1 38  GLU 38  38  ?   ?   ?   A . n 
A 1 39  PRO 39  39  ?   ?   ?   A . n 
A 1 40  GLY 40  40  ?   ?   ?   A . n 
A 1 41  GLU 41  41  ?   ?   ?   A . n 
A 1 42  ARG 42  42  ?   ?   ?   A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  CYS 54  54  54  CYS CYS A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  TRP 66  66  66  TRP TRP A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  CYS 70  70  70  CYS CYS A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  TRP 74  74  74  TRP TRP A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  CYS 83  83  83  CYS CYS A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  CYS 88  88  88  CYS CYS A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 THR 101 101 ?   ?   ?   A . n 
A 1 102 PRO 102 102 ?   ?   ?   A . n 
A 1 103 GLU 103 103 ?   ?   ?   A . n 
A 1 104 LEU 104 104 ?   ?   ?   A . n 
A 1 105 PRO 105 105 ?   ?   ?   A . n 
A 1 106 PRO 106 106 ?   ?   ?   A . n 
A 1 107 PRO 107 107 ?   ?   ?   A . n 
A 1 108 PRO 108 108 ?   ?   ?   A . n 
A 1 109 ALA 109 109 ?   ?   ?   A . n 
A 1 110 ALA 110 110 ?   ?   ?   A . n 
A 1 111 GLY 111 111 ?   ?   ?   A . n 
A 1 112 ASN 112 112 ?   ?   ?   A . n 
A 1 113 THR 113 113 ?   ?   ?   A . n 
A 1 114 SER 114 114 ?   ?   ?   A . n 
A 1 115 VAL 115 115 ?   ?   ?   A . n 
A 1 116 ALA 116 116 ?   ?   ?   A . n 
A 1 117 ALA 117 117 ?   ?   ?   A . n 
A 1 118 ASN 118 118 ?   ?   ?   A . n 
A 1 119 ALA 119 119 ?   ?   ?   A . n 
A 1 120 THR 120 120 ?   ?   ?   A . n 
A 1 121 LEU 121 121 ?   ?   ?   A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 CYS 129 129 129 CYS CYS A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 TRP 134 134 134 TRP TRP A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 CYS 137 137 137 CYS CYS A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 HIS 142 142 142 HIS HIS A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 CYS 144 144 144 CYS CYS A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 ARG 150 150 150 ARG ARG A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 CYS 155 155 155 CYS CYS A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 ASN 158 158 158 ASN ASN A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 CYS 170 170 170 CYS CYS A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 ARG 173 173 173 ARG ARG A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 MET 176 176 176 MET MET A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 HIS 179 179 179 HIS HIS A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 CYS 186 186 186 CYS CYS A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 ASP 188 188 188 ASP ASP A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 TRP 190 190 190 TRP TRP A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 HIS 196 196 196 HIS HIS A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 CYS 199 199 199 CYS CYS A . n 
A 1 200 ARG 200 200 200 ARG ARG A . n 
A 1 201 GLN 201 201 201 GLN GLN A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 TRP 206 206 206 TRP TRP A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 GLN 209 209 209 GLN GLN A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 HIS 215 215 215 HIS HIS A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 PRO 218 218 218 PRO PRO A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 PRO 222 222 222 PRO PRO A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 HIS 224 224 224 HIS HIS A . n 
A 1 225 ARG 225 225 225 ARG ARG A . n 
A 1 226 ASP 226 226 226 ASP ASP A . n 
A 1 227 GLN 227 227 227 GLN GLN A . n 
A 1 228 VAL 228 228 228 VAL VAL A . n 
A 1 229 ASN 229 229 229 ASN ASN A . n 
A 1 230 CYS 230 230 230 CYS CYS A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 ALA 233 233 233 ALA ALA A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 TYR 236 236 236 TYR TYR A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 TRP 238 238 238 TRP TRP A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 CYS 240 240 240 CYS CYS A . n 
A 1 241 PRO 241 241 241 PRO PRO A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 GLN 246 246 246 GLN GLN A . n 
A 1 247 HIS 247 247 247 HIS HIS A . n 
A 1 248 TYR 248 248 248 TYR TYR A . n 
A 1 249 CYS 249 249 249 CYS CYS A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 HIS 251 251 251 HIS HIS A . n 
A 1 252 LYS 252 252 252 LYS LYS A . n 
A 1 253 GLU 253 253 253 GLU GLU A . n 
A 1 254 ASP 254 254 254 ASP ASP A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 VAL 258 258 258 VAL VAL A . n 
A 1 259 CYS 259 259 259 CYS CYS A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 HIS 262 262 262 HIS HIS A . n 
A 1 263 GLN 263 263 263 GLN GLN A . n 
A 1 264 SER 264 264 264 SER SER A . n 
A 1 265 TRP 265 265 265 TRP TRP A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 ASP 272 272 272 ASP ASP A . n 
A 1 273 ARG 273 273 273 ARG ARG A . n 
A 1 274 CYS 274 274 274 CYS CYS A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 GLY 276 276 276 GLY GLY A . n 
A 1 277 GLN 277 277 277 GLN GLN A . n 
A 1 278 VAL 278 278 278 VAL VAL A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 HIS 281 281 281 HIS HIS A . n 
A 1 282 PHE 282 282 282 PHE PHE A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 VAL 285 285 285 VAL VAL A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 ASN 287 287 287 ASN ASN A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 CYS 290 290 290 CYS CYS A . n 
A 1 291 ASP 291 291 291 ASP ASP A . n 
A 1 292 SER 292 292 292 SER SER A . n 
A 1 293 GLU 293 293 293 GLU GLU A . n 
A 1 294 TRP 294 294 294 TRP TRP A . n 
A 1 295 TYR 295 295 295 TYR TYR A . n 
A 1 296 PRO 296 296 296 PRO PRO A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 LYS 300 300 300 LYS LYS A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 CYS 303 303 303 CYS CYS A . n 
A 1 304 GLN 304 304 304 GLN GLN A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 GLY 307 307 307 GLY GLY A . n 
A 1 308 CYS 308 308 308 CYS CYS A . n 
A 1 309 GLY 309 309 309 GLY GLY A . n 
A 1 310 THR 310 310 310 THR THR A . n 
A 1 311 ALA 311 311 311 ALA ALA A . n 
A 1 312 VAL 312 312 312 VAL VAL A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ARG 314 314 314 ARG ARG A . n 
A 1 315 PRO 315 315 315 PRO PRO A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 PRO 319 319 319 PRO PRO A . n 
A 1 320 HIS 320 320 320 HIS HIS A . n 
A 1 321 SER 321 321 321 SER SER A . n 
A 1 322 LEU 322 322 322 LEU LEU A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 GLY 324 324 324 GLY GLY A . n 
A 1 325 ARG 325 325 325 ARG ARG A . n 
A 1 326 MET 326 326 326 MET MET A . n 
A 1 327 TYR 327 327 327 TYR TYR A . n 
A 1 328 TYR 328 328 328 TYR TYR A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 CYS 330 330 330 CYS CYS A . n 
A 1 331 ASN 331 331 331 ASN ASN A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 LEU 335 335 335 LEU LEU A . n 
A 1 336 THR 336 336 336 THR THR A . n 
A 1 337 LEU 337 337 337 LEU LEU A . n 
A 1 338 SER 338 338 338 SER SER A . n 
A 1 339 ASN 339 339 339 ASN ASN A . n 
A 1 340 CYS 340 340 340 CYS CYS A . n 
A 1 341 SER 341 341 341 SER SER A . n 
A 1 342 TRP 342 342 342 TRP TRP A . n 
A 1 343 ARG 343 343 343 ARG ARG A . n 
A 1 344 PHE 344 344 344 PHE PHE A . n 
A 1 345 ASN 345 345 345 ASN ASN A . n 
A 1 346 ASN 346 346 346 ASN ASN A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 CYS 350 350 350 CYS CYS A . n 
A 1 351 SER 351 351 351 SER SER A . n 
A 1 352 GLN 352 352 352 GLN GLN A . n 
A 1 353 SER 353 353 353 SER SER A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 ALA 356 356 356 ALA ALA A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 VAL 358 358 358 VAL VAL A . n 
A 1 359 LEU 359 359 359 LEU LEU A . n 
A 1 360 CYS 360 360 360 CYS CYS A . n 
A 1 361 SER 361 361 361 SER SER A . n 
A 1 362 ALA 362 362 362 ALA ALA A . n 
A 1 363 SER 363 363 363 SER SER A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 GLY 365 365 365 GLY GLY A . n 
A 1 366 HIS 366 366 366 HIS HIS A . n 
A 1 367 HIS 367 367 ?   ?   ?   A . n 
A 1 368 HIS 368 368 ?   ?   ?   A . n 
A 1 369 HIS 369 369 ?   ?   ?   A . n 
A 1 370 HIS 370 370 ?   ?   ?   A . n 
A 1 371 HIS 371 371 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1  1367 1367 NAG NAG A . 
C 3 EDO 1  1368 1368 EDO EDO A . 
D 3 EDO 1  1369 1369 EDO EDO A . 
E 3 EDO 1  1370 1370 EDO EDO A . 
F 3 EDO 1  1371 1371 EDO EDO A . 
G 3 EDO 1  1372 1372 EDO EDO A . 
H 3 EDO 1  1373 1373 EDO EDO A . 
I 4 HOH 1  2001 2001 HOH HOH A . 
I 4 HOH 2  2002 2002 HOH HOH A . 
I 4 HOH 3  2003 2003 HOH HOH A . 
I 4 HOH 4  2004 2004 HOH HOH A . 
I 4 HOH 5  2005 2005 HOH HOH A . 
I 4 HOH 6  2006 2006 HOH HOH A . 
I 4 HOH 7  2007 2007 HOH HOH A . 
I 4 HOH 8  2008 2008 HOH HOH A . 
I 4 HOH 9  2009 2009 HOH HOH A . 
I 4 HOH 10 2010 2010 HOH HOH A . 
I 4 HOH 11 2011 2011 HOH HOH A . 
I 4 HOH 12 2012 2012 HOH HOH A . 
I 4 HOH 13 2013 2013 HOH HOH A . 
I 4 HOH 14 2014 2014 HOH HOH A . 
I 4 HOH 15 2015 2015 HOH HOH A . 
I 4 HOH 16 2016 2016 HOH HOH A . 
I 4 HOH 17 2017 2017 HOH HOH A . 
I 4 HOH 18 2018 2018 HOH HOH A . 
I 4 HOH 19 2019 2019 HOH HOH A . 
I 4 HOH 20 2020 2020 HOH HOH A . 
I 4 HOH 21 2021 2021 HOH HOH A . 
I 4 HOH 22 2022 2022 HOH HOH A . 
I 4 HOH 23 2023 2023 HOH HOH A . 
I 4 HOH 24 2024 2024 HOH HOH A . 
I 4 HOH 25 2025 2025 HOH HOH A . 
I 4 HOH 26 2026 2026 HOH HOH A . 
I 4 HOH 27 2027 2027 HOH HOH A . 
I 4 HOH 28 2028 2028 HOH HOH A . 
I 4 HOH 29 2029 2029 HOH HOH A . 
I 4 HOH 30 2030 2030 HOH HOH A . 
I 4 HOH 31 2031 2031 HOH HOH A . 
I 4 HOH 32 2032 2032 HOH HOH A . 
I 4 HOH 33 2033 2033 HOH HOH A . 
I 4 HOH 34 2034 2034 HOH HOH A . 
I 4 HOH 35 2035 2035 HOH HOH A . 
I 4 HOH 36 2036 2036 HOH HOH A . 
I 4 HOH 37 2037 2037 HOH HOH A . 
I 4 HOH 38 2038 2038 HOH HOH A . 
I 4 HOH 39 2039 2039 HOH HOH A . 
I 4 HOH 40 2040 2040 HOH HOH A . 
I 4 HOH 41 2041 2041 HOH HOH A . 
I 4 HOH 42 2042 2042 HOH HOH A . 
I 4 HOH 43 2043 2043 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    ASN 
_pdbx_struct_mod_residue.label_seq_id     229 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     ASN 
_pdbx_struct_mod_residue.auth_seq_id      229 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   ASN 
_pdbx_struct_mod_residue.details          'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-07-22 
2 'Structure model' 1 1 2015-08-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER  refinement       2.11.4 ? 1 
XDS     'data reduction' .      ? 2 
Aimless 'data scaling'   .      ? 3 
PHASER  phasing          .      ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 132 ? ? -95.40  50.38  
2 1 ALA A 143 ? ? -148.73 27.71  
3 1 CYS A 274 ? ? -109.18 46.01  
4 1 GLU A 293 ? ? -110.13 60.33  
5 1 SER A 351 ? ? -147.92 -61.37 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     THR 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      189 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     CG2 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    THR 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     189 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A TRP 2   ? A TRP 2   
3  1 Y 1 A LEU 3   ? A LEU 3   
4  1 Y 1 A PHE 4   ? A PHE 4   
5  1 Y 1 A PHE 5   ? A PHE 5   
6  1 Y 1 A GLY 6   ? A GLY 6   
7  1 Y 1 A ILE 7   ? A ILE 7   
8  1 Y 1 A THR 8   ? A THR 8   
9  1 Y 1 A GLY 9   ? A GLY 9   
10 1 Y 1 A LEU 10  ? A LEU 10  
11 1 Y 1 A LEU 11  ? A LEU 11  
12 1 Y 1 A THR 12  ? A THR 12  
13 1 Y 1 A ALA 13  ? A ALA 13  
14 1 Y 1 A ALA 14  ? A ALA 14  
15 1 Y 1 A LEU 15  ? A LEU 15  
16 1 Y 1 A SER 16  ? A SER 16  
17 1 Y 1 A GLY 17  ? A GLY 17  
18 1 Y 1 A HIS 18  ? A HIS 18  
19 1 Y 1 A PRO 19  ? A PRO 19  
20 1 Y 1 A SER 20  ? A SER 20  
21 1 Y 1 A PRO 21  ? A PRO 21  
22 1 Y 1 A ALA 22  ? A ALA 22  
23 1 Y 1 A PRO 23  ? A PRO 23  
24 1 Y 1 A PRO 24  ? A PRO 24  
25 1 Y 1 A ASP 25  ? A ASP 25  
26 1 Y 1 A GLN 26  ? A GLN 26  
27 1 Y 1 A LEU 27  ? A LEU 27  
28 1 Y 1 A ASN 28  ? A ASN 28  
29 1 Y 1 A THR 29  ? A THR 29  
30 1 Y 1 A SER 30  ? A SER 30  
31 1 Y 1 A SER 31  ? A SER 31  
32 1 Y 1 A ALA 32  ? A ALA 32  
33 1 Y 1 A GLU 33  ? A GLU 33  
34 1 Y 1 A SER 34  ? A SER 34  
35 1 Y 1 A GLU 35  ? A GLU 35  
36 1 Y 1 A LEU 36  ? A LEU 36  
37 1 Y 1 A TRP 37  ? A TRP 37  
38 1 Y 1 A GLU 38  ? A GLU 38  
39 1 Y 1 A PRO 39  ? A PRO 39  
40 1 Y 1 A GLY 40  ? A GLY 40  
41 1 Y 1 A GLU 41  ? A GLU 41  
42 1 Y 1 A ARG 42  ? A ARG 42  
43 1 Y 1 A THR 101 ? A THR 101 
44 1 Y 1 A PRO 102 ? A PRO 102 
45 1 Y 1 A GLU 103 ? A GLU 103 
46 1 Y 1 A LEU 104 ? A LEU 104 
47 1 Y 1 A PRO 105 ? A PRO 105 
48 1 Y 1 A PRO 106 ? A PRO 106 
49 1 Y 1 A PRO 107 ? A PRO 107 
50 1 Y 1 A PRO 108 ? A PRO 108 
51 1 Y 1 A ALA 109 ? A ALA 109 
52 1 Y 1 A ALA 110 ? A ALA 110 
53 1 Y 1 A GLY 111 ? A GLY 111 
54 1 Y 1 A ASN 112 ? A ASN 112 
55 1 Y 1 A THR 113 ? A THR 113 
56 1 Y 1 A SER 114 ? A SER 114 
57 1 Y 1 A VAL 115 ? A VAL 115 
58 1 Y 1 A ALA 116 ? A ALA 116 
59 1 Y 1 A ALA 117 ? A ALA 117 
60 1 Y 1 A ASN 118 ? A ASN 118 
61 1 Y 1 A ALA 119 ? A ALA 119 
62 1 Y 1 A THR 120 ? A THR 120 
63 1 Y 1 A LEU 121 ? A LEU 121 
64 1 Y 1 A HIS 367 ? A HIS 367 
65 1 Y 1 A HIS 368 ? A HIS 368 
66 1 Y 1 A HIS 369 ? A HIS 369 
67 1 Y 1 A HIS 370 ? A HIS 370 
68 1 Y 1 A HIS 371 ? A HIS 371 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE NAG 
3 1,2-ETHANEDIOL         EDO 
4 water                  HOH 
#