data_5A31
# 
_entry.id   5A31 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5A31         
PDBE  EBI-63715    
WWPDB D_1290063715 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.db_id          EMD-2925 
_pdbx_database_related.content_type   'associated EM volume' 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5A31 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-05-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chang, L.'        1 
'Zhang, Z.'        2 
'Yang, J.'         3 
'Mclaughlin, S.H.' 4 
'Barford, D.'      5 
# 
_citation.id                        primary 
_citation.title                     'Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            522 
_citation.page_first                450 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26083744 
_citation.pdbx_database_id_DOI      10.1038/NATURE14471 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chang, L.'        1 ? 
primary 'Zhang, Z.'        2 ? 
primary 'Yang, J.'         3 ? 
primary 'Mclaughlin, S.H.' 4 ? 
primary 'Barford, D.'      5 ? 
# 
_cell.entry_id           5A31 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5A31 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 1'                                                  159616.484 1 ? ? ? ? 
2  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 11'                                                 9866.702   1 ? ? ? ? 
3  polymer     man 'CELL DIVISION CYCLE PROTEIN 23 HOMOLOG'                                                68905.008  2 ? ? ? ? 
4  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 15'                                                 14302.727  1 ? ? ? ? 
5  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 16'                                                 11677.995  1 ? ? ? ? 
6  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 3'                                                  92005.125  2 ? ? ? ? 
7  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT CDC26'                                              9793.999   2 ? ? ? ? 
8  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 4'                                                  92205.195  1 ? ? ? ? 
9  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 6'                                                  71631.508  1 ? ? ? ? 
10 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 6'                                                  71806.672  1 ? ? ? ? 
11 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 10'                                                 21282.143  1 ? ? ? ? 
12 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 13'                                                 8528.309   1 ? ? ? ? 
13 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 2'                                                  79116.469  1 ? ? ? ? 
14 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 5'                                                  85087.547  1 ? ? ? ? 
15 polymer     man 'FUSION PROTEIN - UBIQUITIN-CONJUGATING ENZYME E2 C, UBIQUITIN-CONJUGATING ENZYME E2 S' 17793.396  1 
'2.3.2.23, 2.3.2.24, 2.3.2.23' ? ? ? 
16 polymer     man 'THE ANAPHASE-PROMOTING COMPLEX CHAIN R'                                                42944.512  1 ? ? ? ? 
17 polymer     man 'THE ANAPHASE-PROMOTING COMPLEX CHAIN T'                                                1876.293   1 ? ? ? ? 
18 polymer     man 'THE ANAPHASE-PROMOTING COMPLEX CHAIN U'                                                2060.531   1 ? ? ? ? 
19 polymer     man 'THE ANAPHASE-PROMOTING COMPLEX CHAIN V'                                                1421.707   1 ? ? ? ? 
20 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 7'                                                  66832.164  2 ? ? ? ? 
21 non-polymer syn 'ZINC ION'                                                                              65.409     3 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'APC1, CYCLOSOME SUBUNIT 1, MITOTIC CHECKPOINT REGULATOR, TESTIS-SPECIFIC GENE 24 PROTEIN' 
2  'APC11, CYCLOSOME SUBUNIT 11, HEPATOCELLULAR CARCINOMA-ASSOC IATED RING FINGER PROTEIN' 
3  'ANAPHASE-PROMOTING COMPLEX SUBUNIT 8, APC8, CYCLOSOME SUBUNIT 8, THE ANAPHASE-PROMOTING COMPLEX' 
4  APC15 
5  'APC16, CYCLOSOME SUBUNIT 16' 
6  'CELL DIVISION CYCLE PROTEIN 27 HOMOLOG, APC3, CDC27 HOMOLOG, CDC27HS, H-NUC' 
7  'ANAPHASE-PROMOTING COMPLEX SUBUNIT 12, APC12, CELL DIVISION CYCLE PROTEIN 26 HOMOLOG' 
8  'APC4, CYCLOSOME SUBUNIT 4' 
9  'CELL DIVISION CYCLE PROTEIN 16 HOMOLOG, APC6, CDC16 HOMOLOG, CDC16HS, CYCLOSOME SUBUNIT 6' 
10 'CELL DIVISION CYCLE PROTEIN 16 HOMOLOG, APC6, CDC16 HOMOLOG, CDC16HS, CYCLOSOME SUBUNIT 6' 
11 'APC10, CYCLOSOME SUBUNIT 10' 
12 'APC13, CYCLOSOME SUBUNIT 13' 
13 'APC2, CYCLOSOME SUBUNIT 2' 
14 'APC5, CYCLOSOME SUBUNIT 5' 
15 
;(E3-INDEPENDENT) E2 UBIQUITIN-CONJUGATING ENZYME C, E2 UBIQUITIN-CONJUGATING ENZYME C, UBCH10, UBIQUITIN CARRIER PROTEIN C, UBIQUITIN-PROTEIN LIGASE C, UBIQUITIN CARRIER PROTEIN S, E2 UBIQUITIN-CONJUGATING ENZYME S, UBIQUITIN-CONJUGATING ENZYME E2-24 KDA, E2-EPF, UBIQUITIN-CONJUGATING ENZYME E2-EPF5, UBIQUITIN-PROTEIN LIGASE S
;
20 'APC7, CYCLOSOME SUBUNIT 7, THE ANAPHASE-PROMOTING COMPLEX' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASE(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)KESWQLRKAVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISE
VEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSPLPTMFSMLHPLDEITPLVCKAQYVVDHAMKIVF
LNTDPSIVMTYDAVQNVHSVWTLRRVKAEEE(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)GGF
(UNK)(UNK)(UNK)(UNK)PIVPELCIDHLWAAAQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESTALIFGSVTN
IPAKDAAPVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPATYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTC
LQAIKFILPKEIAVQMLVKWYNVHSAPGGASYHSEWNLFVTCLMNMMGYTHIPAIFFVLHLVYEELKLNTLMGEGICSLV
ELLVQLARDLKLGPYVDHYYRDYPTLASEPPSIYQWVSSCLKGEGAPPYPYLPGICERSRLVVLSIALYILSSLAERLVV
WMTNVGFILRDLETLPFGIALPIRDAIYHCREQPASDWPEAVCLLIGRQDLSAADDGMNDMNHEVMSLIWSEDLRVQDVR
RLLQSAHPVRVNVVQYPELSEHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTV
DLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLT
KGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIG
RPPGPEMEYATDRESYSLAAGLALGMVCLGHGSNLIGMSALNVPEQLYQYMVGGHSPSYQIKEGDTLNVDVTCPGATLAL
AMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENLNLETLSQAHVYII
AGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMK
TGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVD
TNTPCYALLEVLYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLTQHLKSILSKDGVLYVKLRAGQLSY
KEDASEARAFKSAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSE
TSELWQIKLVLEFFSSRSHQFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSPLESQLSMLACFAVYHSVPAP
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
;MIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASEXXXXXXXXXXXKESWQLRKAVSEIGEDVDYDEELYVAGNMVIW
SKGSKSQALAVYKAFTVDSPVQQALWCDFIISEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSP
LPTMFSMLHPLDEITPLVCKAQYVVDHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKAEEEXXXXXXXXXGGFXXXX
PIVPELCIDHLWAAAQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESTALIFGSVTNIPAKDAAPVEKIDTMLVLEG
SGNLVLYTGVVRVGKVFIPATYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKW
YNVHSAPGGASYHSEWNLFVTCLMNMMGYTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYY
RDYPTLASEPPSIYQWVSSCLKGEGAPPYPYLPGICERSRLVVLSIALYILSSLAERLVVWMTNVGFILRDLETLPFGIA
LPIRDAIYHCREQPASDWPEAVCLLIGRQDLSAADDGMNDMNHEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELS
EHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFH
NGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLG
TMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRPPGPEMEYATDRESYSLAA
GLALGMVCLGHGSNLIGMSALNVPEQLYQYMVGGHSPSYQIKEGDTLNVDVTCPGATLALAMIYLKTNNRSIADWLRAPD
TMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAF
NCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLL
FLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVLYKGTQWYE
QTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLTQHLKSILSKDGVLYVKLRAGQLSYKEDASEARAFKSAFTSDPAL
LSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQ
FMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSPLESQLSMLACFAVYHSVPAPXXXXXXXXXXXXXXXXXXXXXXXX
X
;
A   ? 
2  'polypeptide(L)' no no 
;MKVKIKCWNGVALWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEW
KFKE
;
;MKVKIKCWNGVALWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEW
KFKE
;
B   ? 
3  'polypeptide(L)' no no 
;MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEED
AQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSK
LHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLA
HNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYR
AWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQG
ETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
;
;MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEED
AQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSK
LHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLA
HNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYR
AWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQG
ETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
;
C,P ? 
4  'polypeptide(L)' no no 
;MSTLYPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDS
EDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
;
;MSTLYPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDS
EDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
;
D   ? 
5  'polypeptide(L)' no no 
;MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARME
KLAGLVEELEADEWRFKPIEQLLGFTPSSG
;
;MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARME
KLAGLVEELEADEWRFKPIEQLLGFTPSSG
;
E   ? 
6  'polypeptide(L)' no no 
;MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCV
DLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGE
KPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKS
VARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKF
PPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLSLCSYN
CKESINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYG
LGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGT
DESQESSMTDADDTQLHAAESDEF
;
;MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCV
DLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGE
KPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKS
VARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKF
PPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLSLCSYN
CKESINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYG
LGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGT
DESQESSMTDADDTQLHAAESDEF
;
F,H ? 
7  'polypeptide(L)' no no 
;MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF
GSLEF
;
;MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF
GSLEF
;
G,W ? 
8  'polypeptide(L)' no no 
;MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLL
AFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEEN
SDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTL
LMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKA
NELLQVIDSSMKNFKAFFRWLYVAMLRMTDDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDT
RSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLD
AQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVE
KLDPELDS
;
;MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLL
AFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEEN
SDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTL
LMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKA
NELLQVIDSSMKNFKAFFRWLYVAMLRMTDDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDT
RSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLD
AQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVE
KLDPELDS
;
I   ? 
9  'polypeptide(L)' no no 
;MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCH
YAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLD
VYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVNGLEKNLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHAR
RYLSKATTLEKTYGPAWIAYGHSFAVASEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE
DPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIAMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
;
;MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCH
YAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLD
VYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVNGLEKNLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHAR
RYLSKATTLEKTYGPAWIAYGHSFAVASEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE
DPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIAMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
;
J   ? 
10 'polypeptide(L)' no no 
;MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCH
YAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLD
VYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLEKNLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHKSCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHAR
RYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE
DPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
;
;MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCH
YAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLD
VYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLEKNLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHKSCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHAR
RYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE
DPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
;
K   ? 
11 'polypeptide(L)' no no 
;MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIY
ADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYT
PVEESSIGKFPRCTTIDFMMYRSIR
;
;MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIY
ADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYT
PVEESSIGKFPRCTTIDFMMYRSIR
;
L   ? 
12 'polypeptide(L)' no no MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN 
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN M   ? 
13 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
WFVEVLQNDLQANISPEFW(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)PY
(UNK)(UNK)(UNK)L(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)GLREEVHTMLRGVLFFAAPRTFQEMIQRLYGCFLRVYMQSKRKG(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)ELDSRYARRRYYRL(UNK)(UNK)(UNK)(UNK)(UNK)WCRQALEQFHQLSQVL
HRLSLLARVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFTLRRWRCHVQRFFYRIYASLRIE
ELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVIDPSMVILEVACE
PIRRYLRTREDTVRQIVAGL(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)SADIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLK
DMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLG
LVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQ
DRDNMVLIKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLP
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWFVEVLQNDLQANISPEFWXXXXXXXXXXXXXXXXXXXXXXXXXXXPY
XXXLXXXXXXXXXXXXXXXXXXGLREEVHTMLRGVLFFAAPRTFQEMIQRLYGCFLRVYMQSKRKGXXXXXXELDSRYAR
RRYYRLXXXXXWCRQALEQFHQLSQVLHRLSLLARVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWL
GKVFTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCD
IITLYISAIKALRVIDPSMVILEVACEPIRRYLRTREDTVRQIVAGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSA
DIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDE
KRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAV
TPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQDRDNMVLIKEEELLLFW
TYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLP
;
N   ? 
14 'polypeptide(L)' no no 
;MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLSEMSRTGEGAVSLVERRRLNQQLLPLLQGPDITVSKLLK
LIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQ
YFQSDENKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQA
ELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMD
ALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQA
LSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
;
;MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLSEMSRTGEGAVSLVERRRLNQQLLPLLQGPDITVSKLLK
LIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQ
YFQSDENKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQA
ELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMD
ALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQA
LSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
;
O   ? 
15 'polypeptide(L)' no no 
;GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
TQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQ(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
;GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
TQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQXXXXXXXXXXXXXXX
XX
;
Q   ? 
16 'polypeptide(L)' no no 
;SKHGDRFIPSRAGANWSVNFHRINENGLAYSALLKNELLGAGIEKVQKGLFTYSLSPYSLSPVSNKSQKLLRSRQIAKVP
YRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCDTENEYTSLSWIGAGSHLAVGQANGLVEIYDV
MKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHV
YEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHG
YSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDVSVLNLFTRIR
;
;SKHGDRFIPSRAGANWSVNFHRINENGLAYSALLKNELLGAGIEKVQKGLFTYSLSPYSLSPVSNKSQKLLRSRQIAKVP
YRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCDTENEYTSLSWIGAGSHLAVGQANGLVEIYDV
MKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHV
YEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHG
YSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDVSVLNLFTRIR
;
R   ? 
17 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)QL(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)
;
XXXXXQLXXXXXXXXXXXXXX T   ? 
18 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
XXXXXXXXXXXXXXXXXXXXXXXX U   ? 
19 'polypeptide(L)' no no AAFRIALKSVQKS AAFRIALKSVQKS V   ? 
20 'polypeptide(L)' no no 
;MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTLSNNNPELFSPPQKYQLL
VYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKLAECYTVLKQDKDAIAILD
GIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWI
KAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGR
LEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAI
RLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLNKALTQEPDYIKAVV
KKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTD
ATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
;
;MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTLSNNNPELFSPPQKYQLL
VYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKLAECYTVLKQDKDAIAILD
GIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWI
KAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGR
LEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAI
RLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLNKALTQEPDYIKAVV
KKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTD
ATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
;
X,Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    ILE n 
1  3    ALA n 
1  4    ALA n 
1  5    ARG n 
1  6    ASP n 
1  7    LEU n 
1  8    GLN n 
1  9    GLU n 
1  10   PHE n 
1  11   VAL n 
1  12   PRO n 
1  13   PHE n 
1  14   GLY n 
1  15   ARG n 
1  16   ASP n 
1  17   HIS n 
1  18   CYS n 
1  19   LYS n 
1  20   HIS n 
1  21   HIS n 
1  22   PRO n 
1  23   ASN n 
1  24   ALA n 
1  25   LEU n 
1  26   ASN n 
1  27   LEU n 
1  28   GLN n 
1  29   LEU n 
1  30   ARG n 
1  31   GLN n 
1  32   LEU n 
1  33   GLN n 
1  34   PRO n 
1  35   ALA n 
1  36   SER n 
1  37   GLU n 
1  38   UNK n 
1  39   UNK n 
1  40   UNK n 
1  41   UNK n 
1  42   UNK n 
1  43   UNK n 
1  44   UNK n 
1  45   UNK n 
1  46   UNK n 
1  47   UNK n 
1  48   UNK n 
1  49   LYS n 
1  50   GLU n 
1  51   SER n 
1  52   TRP n 
1  53   GLN n 
1  54   LEU n 
1  55   ARG n 
1  56   LYS n 
1  57   ALA n 
1  58   VAL n 
1  59   SER n 
1  60   GLU n 
1  61   ILE n 
1  62   GLY n 
1  63   GLU n 
1  64   ASP n 
1  65   VAL n 
1  66   ASP n 
1  67   TYR n 
1  68   ASP n 
1  69   GLU n 
1  70   GLU n 
1  71   LEU n 
1  72   TYR n 
1  73   VAL n 
1  74   ALA n 
1  75   GLY n 
1  76   ASN n 
1  77   MET n 
1  78   VAL n 
1  79   ILE n 
1  80   TRP n 
1  81   SER n 
1  82   LYS n 
1  83   GLY n 
1  84   SER n 
1  85   LYS n 
1  86   SER n 
1  87   GLN n 
1  88   ALA n 
1  89   LEU n 
1  90   ALA n 
1  91   VAL n 
1  92   TYR n 
1  93   LYS n 
1  94   ALA n 
1  95   PHE n 
1  96   THR n 
1  97   VAL n 
1  98   ASP n 
1  99   SER n 
1  100  PRO n 
1  101  VAL n 
1  102  GLN n 
1  103  GLN n 
1  104  ALA n 
1  105  LEU n 
1  106  TRP n 
1  107  CYS n 
1  108  ASP n 
1  109  PHE n 
1  110  ILE n 
1  111  ILE n 
1  112  SER n 
1  113  GLU n 
1  114  VAL n 
1  115  GLU n 
1  116  LYS n 
1  117  CYS n 
1  118  ILE n 
1  119  CYS n 
1  120  ILE n 
1  121  LEU n 
1  122  GLN n 
1  123  SER n 
1  124  SER n 
1  125  CYS n 
1  126  ILE n 
1  127  ASN n 
1  128  MET n 
1  129  HIS n 
1  130  SER n 
1  131  ILE n 
1  132  GLU n 
1  133  GLY n 
1  134  LYS n 
1  135  ASP n 
1  136  TYR n 
1  137  ILE n 
1  138  ALA n 
1  139  SER n 
1  140  LEU n 
1  141  PRO n 
1  142  PHE n 
1  143  GLN n 
1  144  VAL n 
1  145  ALA n 
1  146  ASN n 
1  147  VAL n 
1  148  TRP n 
1  149  PRO n 
1  150  THR n 
1  151  LYS n 
1  152  TYR n 
1  153  GLY n 
1  154  LEU n 
1  155  LEU n 
1  156  PHE n 
1  157  GLU n 
1  158  ARG n 
1  159  SER n 
1  160  PRO n 
1  161  LEU n 
1  162  PRO n 
1  163  THR n 
1  164  MET n 
1  165  PHE n 
1  166  SER n 
1  167  MET n 
1  168  LEU n 
1  169  HIS n 
1  170  PRO n 
1  171  LEU n 
1  172  ASP n 
1  173  GLU n 
1  174  ILE n 
1  175  THR n 
1  176  PRO n 
1  177  LEU n 
1  178  VAL n 
1  179  CYS n 
1  180  LYS n 
1  181  ALA n 
1  182  GLN n 
1  183  TYR n 
1  184  VAL n 
1  185  VAL n 
1  186  ASP n 
1  187  HIS n 
1  188  ALA n 
1  189  MET n 
1  190  LYS n 
1  191  ILE n 
1  192  VAL n 
1  193  PHE n 
1  194  LEU n 
1  195  ASN n 
1  196  THR n 
1  197  ASP n 
1  198  PRO n 
1  199  SER n 
1  200  ILE n 
1  201  VAL n 
1  202  MET n 
1  203  THR n 
1  204  TYR n 
1  205  ASP n 
1  206  ALA n 
1  207  VAL n 
1  208  GLN n 
1  209  ASN n 
1  210  VAL n 
1  211  HIS n 
1  212  SER n 
1  213  VAL n 
1  214  TRP n 
1  215  THR n 
1  216  LEU n 
1  217  ARG n 
1  218  ARG n 
1  219  VAL n 
1  220  LYS n 
1  221  ALA n 
1  222  GLU n 
1  223  GLU n 
1  224  GLU n 
1  225  UNK n 
1  226  UNK n 
1  227  UNK n 
1  228  UNK n 
1  229  UNK n 
1  230  UNK n 
1  231  UNK n 
1  232  UNK n 
1  233  UNK n 
1  234  GLY n 
1  235  GLY n 
1  236  PHE n 
1  237  UNK n 
1  238  UNK n 
1  239  UNK n 
1  240  UNK n 
1  241  PRO n 
1  242  ILE n 
1  243  VAL n 
1  244  PRO n 
1  245  GLU n 
1  246  LEU n 
1  247  CYS n 
1  248  ILE n 
1  249  ASP n 
1  250  HIS n 
1  251  LEU n 
1  252  TRP n 
1  253  ALA n 
1  254  ALA n 
1  255  ALA n 
1  256  GLN n 
1  257  ALA n 
1  258  SER n 
1  259  LYS n 
1  260  VAL n 
1  261  PHE n 
1  262  ILE n 
1  263  THR n 
1  264  SER n 
1  265  ASP n 
1  266  LEU n 
1  267  CYS n 
1  268  GLY n 
1  269  GLN n 
1  270  LYS n 
1  271  PHE n 
1  272  LEU n 
1  273  CYS n 
1  274  PHE n 
1  275  LEU n 
1  276  VAL n 
1  277  GLU n 
1  278  SER n 
1  279  GLN n 
1  280  LEU n 
1  281  GLN n 
1  282  LEU n 
1  283  ARG n 
1  284  CYS n 
1  285  VAL n 
1  286  LYS n 
1  287  PHE n 
1  288  GLN n 
1  289  GLU n 
1  290  SER n 
1  291  THR n 
1  292  ALA n 
1  293  LEU n 
1  294  ILE n 
1  295  PHE n 
1  296  GLY n 
1  297  SER n 
1  298  VAL n 
1  299  THR n 
1  300  ASN n 
1  301  ILE n 
1  302  PRO n 
1  303  ALA n 
1  304  LYS n 
1  305  ASP n 
1  306  ALA n 
1  307  ALA n 
1  308  PRO n 
1  309  VAL n 
1  310  GLU n 
1  311  LYS n 
1  312  ILE n 
1  313  ASP n 
1  314  THR n 
1  315  MET n 
1  316  LEU n 
1  317  VAL n 
1  318  LEU n 
1  319  GLU n 
1  320  GLY n 
1  321  SER n 
1  322  GLY n 
1  323  ASN n 
1  324  LEU n 
1  325  VAL n 
1  326  LEU n 
1  327  TYR n 
1  328  THR n 
1  329  GLY n 
1  330  VAL n 
1  331  VAL n 
1  332  ARG n 
1  333  VAL n 
1  334  GLY n 
1  335  LYS n 
1  336  VAL n 
1  337  PHE n 
1  338  ILE n 
1  339  PRO n 
1  340  ALA n 
1  341  THR n 
1  342  TYR n 
1  343  ILE n 
1  344  HIS n 
1  345  SER n 
1  346  ILE n 
1  347  ARG n 
1  348  ASP n 
1  349  PRO n 
1  350  VAL n 
1  351  HIS n 
1  352  ASN n 
1  353  ARG n 
1  354  VAL n 
1  355  THR n 
1  356  LEU n 
1  357  GLU n 
1  358  LEU n 
1  359  SER n 
1  360  ASN n 
1  361  GLY n 
1  362  SER n 
1  363  MET n 
1  364  VAL n 
1  365  ARG n 
1  366  ILE n 
1  367  THR n 
1  368  ILE n 
1  369  PRO n 
1  370  GLU n 
1  371  ILE n 
1  372  ALA n 
1  373  THR n 
1  374  SER n 
1  375  GLU n 
1  376  LEU n 
1  377  VAL n 
1  378  GLN n 
1  379  THR n 
1  380  CYS n 
1  381  LEU n 
1  382  GLN n 
1  383  ALA n 
1  384  ILE n 
1  385  LYS n 
1  386  PHE n 
1  387  ILE n 
1  388  LEU n 
1  389  PRO n 
1  390  LYS n 
1  391  GLU n 
1  392  ILE n 
1  393  ALA n 
1  394  VAL n 
1  395  GLN n 
1  396  MET n 
1  397  LEU n 
1  398  VAL n 
1  399  LYS n 
1  400  TRP n 
1  401  TYR n 
1  402  ASN n 
1  403  VAL n 
1  404  HIS n 
1  405  SER n 
1  406  ALA n 
1  407  PRO n 
1  408  GLY n 
1  409  GLY n 
1  410  ALA n 
1  411  SER n 
1  412  TYR n 
1  413  HIS n 
1  414  SER n 
1  415  GLU n 
1  416  TRP n 
1  417  ASN n 
1  418  LEU n 
1  419  PHE n 
1  420  VAL n 
1  421  THR n 
1  422  CYS n 
1  423  LEU n 
1  424  MET n 
1  425  ASN n 
1  426  MET n 
1  427  MET n 
1  428  GLY n 
1  429  TYR n 
1  430  THR n 
1  431  HIS n 
1  432  ILE n 
1  433  PRO n 
1  434  ALA n 
1  435  ILE n 
1  436  PHE n 
1  437  PHE n 
1  438  VAL n 
1  439  LEU n 
1  440  HIS n 
1  441  LEU n 
1  442  VAL n 
1  443  TYR n 
1  444  GLU n 
1  445  GLU n 
1  446  LEU n 
1  447  LYS n 
1  448  LEU n 
1  449  ASN n 
1  450  THR n 
1  451  LEU n 
1  452  MET n 
1  453  GLY n 
1  454  GLU n 
1  455  GLY n 
1  456  ILE n 
1  457  CYS n 
1  458  SER n 
1  459  LEU n 
1  460  VAL n 
1  461  GLU n 
1  462  LEU n 
1  463  LEU n 
1  464  VAL n 
1  465  GLN n 
1  466  LEU n 
1  467  ALA n 
1  468  ARG n 
1  469  ASP n 
1  470  LEU n 
1  471  LYS n 
1  472  LEU n 
1  473  GLY n 
1  474  PRO n 
1  475  TYR n 
1  476  VAL n 
1  477  ASP n 
1  478  HIS n 
1  479  TYR n 
1  480  TYR n 
1  481  ARG n 
1  482  ASP n 
1  483  TYR n 
1  484  PRO n 
1  485  THR n 
1  486  LEU n 
1  487  ALA n 
1  488  SER n 
1  489  GLU n 
1  490  PRO n 
1  491  PRO n 
1  492  SER n 
1  493  ILE n 
1  494  TYR n 
1  495  GLN n 
1  496  TRP n 
1  497  VAL n 
1  498  SER n 
1  499  SER n 
1  500  CYS n 
1  501  LEU n 
1  502  LYS n 
1  503  GLY n 
1  504  GLU n 
1  505  GLY n 
1  506  ALA n 
1  507  PRO n 
1  508  PRO n 
1  509  TYR n 
1  510  PRO n 
1  511  TYR n 
1  512  LEU n 
1  513  PRO n 
1  514  GLY n 
1  515  ILE n 
1  516  CYS n 
1  517  GLU n 
1  518  ARG n 
1  519  SER n 
1  520  ARG n 
1  521  LEU n 
1  522  VAL n 
1  523  VAL n 
1  524  LEU n 
1  525  SER n 
1  526  ILE n 
1  527  ALA n 
1  528  LEU n 
1  529  TYR n 
1  530  ILE n 
1  531  LEU n 
1  532  SER n 
1  533  SER n 
1  534  LEU n 
1  535  ALA n 
1  536  GLU n 
1  537  ARG n 
1  538  LEU n 
1  539  VAL n 
1  540  VAL n 
1  541  TRP n 
1  542  MET n 
1  543  THR n 
1  544  ASN n 
1  545  VAL n 
1  546  GLY n 
1  547  PHE n 
1  548  ILE n 
1  549  LEU n 
1  550  ARG n 
1  551  ASP n 
1  552  LEU n 
1  553  GLU n 
1  554  THR n 
1  555  LEU n 
1  556  PRO n 
1  557  PHE n 
1  558  GLY n 
1  559  ILE n 
1  560  ALA n 
1  561  LEU n 
1  562  PRO n 
1  563  ILE n 
1  564  ARG n 
1  565  ASP n 
1  566  ALA n 
1  567  ILE n 
1  568  TYR n 
1  569  HIS n 
1  570  CYS n 
1  571  ARG n 
1  572  GLU n 
1  573  GLN n 
1  574  PRO n 
1  575  ALA n 
1  576  SER n 
1  577  ASP n 
1  578  TRP n 
1  579  PRO n 
1  580  GLU n 
1  581  ALA n 
1  582  VAL n 
1  583  CYS n 
1  584  LEU n 
1  585  LEU n 
1  586  ILE n 
1  587  GLY n 
1  588  ARG n 
1  589  GLN n 
1  590  ASP n 
1  591  LEU n 
1  592  SER n 
1  593  ALA n 
1  594  ALA n 
1  595  ASP n 
1  596  ASP n 
1  597  GLY n 
1  598  MET n 
1  599  ASN n 
1  600  ASP n 
1  601  MET n 
1  602  ASN n 
1  603  HIS n 
1  604  GLU n 
1  605  VAL n 
1  606  MET n 
1  607  SER n 
1  608  LEU n 
1  609  ILE n 
1  610  TRP n 
1  611  SER n 
1  612  GLU n 
1  613  ASP n 
1  614  LEU n 
1  615  ARG n 
1  616  VAL n 
1  617  GLN n 
1  618  ASP n 
1  619  VAL n 
1  620  ARG n 
1  621  ARG n 
1  622  LEU n 
1  623  LEU n 
1  624  GLN n 
1  625  SER n 
1  626  ALA n 
1  627  HIS n 
1  628  PRO n 
1  629  VAL n 
1  630  ARG n 
1  631  VAL n 
1  632  ASN n 
1  633  VAL n 
1  634  VAL n 
1  635  GLN n 
1  636  TYR n 
1  637  PRO n 
1  638  GLU n 
1  639  LEU n 
1  640  SER n 
1  641  GLU n 
1  642  HIS n 
1  643  GLU n 
1  644  PHE n 
1  645  ILE n 
1  646  GLU n 
1  647  GLU n 
1  648  LYS n 
1  649  GLU n 
1  650  ASN n 
1  651  ARG n 
1  652  LEU n 
1  653  LEU n 
1  654  GLN n 
1  655  LEU n 
1  656  CYS n 
1  657  GLN n 
1  658  ARG n 
1  659  THR n 
1  660  MET n 
1  661  ALA n 
1  662  LEU n 
1  663  PRO n 
1  664  VAL n 
1  665  GLY n 
1  666  ARG n 
1  667  GLY n 
1  668  MET n 
1  669  PHE n 
1  670  THR n 
1  671  LEU n 
1  672  PHE n 
1  673  SER n 
1  674  TYR n 
1  675  HIS n 
1  676  PRO n 
1  677  VAL n 
1  678  PRO n 
1  679  THR n 
1  680  GLU n 
1  681  PRO n 
1  682  LEU n 
1  683  PRO n 
1  684  ILE n 
1  685  PRO n 
1  686  LYS n 
1  687  LEU n 
1  688  ASN n 
1  689  LEU n 
1  690  THR n 
1  691  GLY n 
1  692  ARG n 
1  693  ALA n 
1  694  PRO n 
1  695  PRO n 
1  696  ARG n 
1  697  ASN n 
1  698  THR n 
1  699  THR n 
1  700  VAL n 
1  701  ASP n 
1  702  LEU n 
1  703  ASN n 
1  704  SER n 
1  705  GLY n 
1  706  ASN n 
1  707  ILE n 
1  708  ASP n 
1  709  VAL n 
1  710  PRO n 
1  711  PRO n 
1  712  ASN n 
1  713  MET n 
1  714  THR n 
1  715  SER n 
1  716  TRP n 
1  717  ALA n 
1  718  SER n 
1  719  PHE n 
1  720  HIS n 
1  721  ASN n 
1  722  GLY n 
1  723  VAL n 
1  724  ALA n 
1  725  ALA n 
1  726  GLY n 
1  727  LEU n 
1  728  LYS n 
1  729  ILE n 
1  730  ALA n 
1  731  PRO n 
1  732  ALA n 
1  733  SER n 
1  734  GLN n 
1  735  ILE n 
1  736  ASP n 
1  737  SER n 
1  738  ALA n 
1  739  TRP n 
1  740  ILE n 
1  741  VAL n 
1  742  TYR n 
1  743  ASN n 
1  744  LYS n 
1  745  PRO n 
1  746  LYS n 
1  747  HIS n 
1  748  ALA n 
1  749  GLU n 
1  750  LEU n 
1  751  ALA n 
1  752  ASN n 
1  753  GLU n 
1  754  TYR n 
1  755  ALA n 
1  756  GLY n 
1  757  PHE n 
1  758  LEU n 
1  759  MET n 
1  760  ALA n 
1  761  LEU n 
1  762  GLY n 
1  763  LEU n 
1  764  ASN n 
1  765  GLY n 
1  766  HIS n 
1  767  LEU n 
1  768  THR n 
1  769  LYS n 
1  770  LEU n 
1  771  ALA n 
1  772  THR n 
1  773  LEU n 
1  774  ASN n 
1  775  ILE n 
1  776  HIS n 
1  777  ASP n 
1  778  TYR n 
1  779  LEU n 
1  780  THR n 
1  781  LYS n 
1  782  GLY n 
1  783  HIS n 
1  784  GLU n 
1  785  MET n 
1  786  THR n 
1  787  SER n 
1  788  ILE n 
1  789  GLY n 
1  790  LEU n 
1  791  LEU n 
1  792  LEU n 
1  793  GLY n 
1  794  VAL n 
1  795  SER n 
1  796  ALA n 
1  797  ALA n 
1  798  LYS n 
1  799  LEU n 
1  800  GLY n 
1  801  THR n 
1  802  MET n 
1  803  ASP n 
1  804  MET n 
1  805  SER n 
1  806  ILE n 
1  807  THR n 
1  808  ARG n 
1  809  LEU n 
1  810  LEU n 
1  811  SER n 
1  812  ILE n 
1  813  HIS n 
1  814  ILE n 
1  815  PRO n 
1  816  ALA n 
1  817  LEU n 
1  818  LEU n 
1  819  PRO n 
1  820  PRO n 
1  821  THR n 
1  822  SER n 
1  823  THR n 
1  824  GLU n 
1  825  LEU n 
1  826  ASP n 
1  827  VAL n 
1  828  PRO n 
1  829  HIS n 
1  830  ASN n 
1  831  VAL n 
1  832  GLN n 
1  833  VAL n 
1  834  ALA n 
1  835  ALA n 
1  836  VAL n 
1  837  VAL n 
1  838  GLY n 
1  839  ILE n 
1  840  GLY n 
1  841  LEU n 
1  842  VAL n 
1  843  TYR n 
1  844  GLN n 
1  845  GLY n 
1  846  THR n 
1  847  ALA n 
1  848  HIS n 
1  849  ARG n 
1  850  HIS n 
1  851  THR n 
1  852  ALA n 
1  853  GLU n 
1  854  VAL n 
1  855  LEU n 
1  856  LEU n 
1  857  ALA n 
1  858  GLU n 
1  859  ILE n 
1  860  GLY n 
1  861  ARG n 
1  862  PRO n 
1  863  PRO n 
1  864  GLY n 
1  865  PRO n 
1  866  GLU n 
1  867  MET n 
1  868  GLU n 
1  869  TYR n 
1  870  ALA n 
1  871  THR n 
1  872  ASP n 
1  873  ARG n 
1  874  GLU n 
1  875  SER n 
1  876  TYR n 
1  877  SER n 
1  878  LEU n 
1  879  ALA n 
1  880  ALA n 
1  881  GLY n 
1  882  LEU n 
1  883  ALA n 
1  884  LEU n 
1  885  GLY n 
1  886  MET n 
1  887  VAL n 
1  888  CYS n 
1  889  LEU n 
1  890  GLY n 
1  891  HIS n 
1  892  GLY n 
1  893  SER n 
1  894  ASN n 
1  895  LEU n 
1  896  ILE n 
1  897  GLY n 
1  898  MET n 
1  899  SER n 
1  900  ALA n 
1  901  LEU n 
1  902  ASN n 
1  903  VAL n 
1  904  PRO n 
1  905  GLU n 
1  906  GLN n 
1  907  LEU n 
1  908  TYR n 
1  909  GLN n 
1  910  TYR n 
1  911  MET n 
1  912  VAL n 
1  913  GLY n 
1  914  GLY n 
1  915  HIS n 
1  916  SER n 
1  917  PRO n 
1  918  SER n 
1  919  TYR n 
1  920  GLN n 
1  921  ILE n 
1  922  LYS n 
1  923  GLU n 
1  924  GLY n 
1  925  ASP n 
1  926  THR n 
1  927  LEU n 
1  928  ASN n 
1  929  VAL n 
1  930  ASP n 
1  931  VAL n 
1  932  THR n 
1  933  CYS n 
1  934  PRO n 
1  935  GLY n 
1  936  ALA n 
1  937  THR n 
1  938  LEU n 
1  939  ALA n 
1  940  LEU n 
1  941  ALA n 
1  942  MET n 
1  943  ILE n 
1  944  TYR n 
1  945  LEU n 
1  946  LYS n 
1  947  THR n 
1  948  ASN n 
1  949  ASN n 
1  950  ARG n 
1  951  SER n 
1  952  ILE n 
1  953  ALA n 
1  954  ASP n 
1  955  TRP n 
1  956  LEU n 
1  957  ARG n 
1  958  ALA n 
1  959  PRO n 
1  960  ASP n 
1  961  THR n 
1  962  MET n 
1  963  TYR n 
1  964  LEU n 
1  965  LEU n 
1  966  ASP n 
1  967  PHE n 
1  968  VAL n 
1  969  LYS n 
1  970  PRO n 
1  971  GLU n 
1  972  PHE n 
1  973  LEU n 
1  974  LEU n 
1  975  LEU n 
1  976  ARG n 
1  977  THR n 
1  978  LEU n 
1  979  ALA n 
1  980  ARG n 
1  981  CYS n 
1  982  LEU n 
1  983  ILE n 
1  984  LEU n 
1  985  TRP n 
1  986  ASP n 
1  987  ASP n 
1  988  ILE n 
1  989  LEU n 
1  990  PRO n 
1  991  ASN n 
1  992  SER n 
1  993  LYS n 
1  994  TRP n 
1  995  VAL n 
1  996  ASP n 
1  997  SER n 
1  998  ASN n 
1  999  VAL n 
1  1000 PRO n 
1  1001 GLN n 
1  1002 ILE n 
1  1003 ILE n 
1  1004 ARG n 
1  1005 GLU n 
1  1006 ASN n 
1  1007 LEU n 
1  1008 ASN n 
1  1009 LEU n 
1  1010 GLU n 
1  1011 THR n 
1  1012 LEU n 
1  1013 SER n 
1  1014 GLN n 
1  1015 ALA n 
1  1016 HIS n 
1  1017 VAL n 
1  1018 TYR n 
1  1019 ILE n 
1  1020 ILE n 
1  1021 ALA n 
1  1022 GLY n 
1  1023 ALA n 
1  1024 CYS n 
1  1025 LEU n 
1  1026 SER n 
1  1027 LEU n 
1  1028 GLY n 
1  1029 PHE n 
1  1030 ARG n 
1  1031 PHE n 
1  1032 ALA n 
1  1033 GLY n 
1  1034 SER n 
1  1035 GLU n 
1  1036 ASN n 
1  1037 LEU n 
1  1038 SER n 
1  1039 ALA n 
1  1040 PHE n 
1  1041 ASN n 
1  1042 CYS n 
1  1043 LEU n 
1  1044 HIS n 
1  1045 LYS n 
1  1046 PHE n 
1  1047 ALA n 
1  1048 LYS n 
1  1049 ASP n 
1  1050 PHE n 
1  1051 MET n 
1  1052 THR n 
1  1053 TYR n 
1  1054 LEU n 
1  1055 SER n 
1  1056 ALA n 
1  1057 PRO n 
1  1058 ASN n 
1  1059 ALA n 
1  1060 SER n 
1  1061 VAL n 
1  1062 THR n 
1  1063 GLY n 
1  1064 PRO n 
1  1065 HIS n 
1  1066 ASN n 
1  1067 LEU n 
1  1068 GLU n 
1  1069 THR n 
1  1070 CYS n 
1  1071 LEU n 
1  1072 SER n 
1  1073 VAL n 
1  1074 VAL n 
1  1075 LEU n 
1  1076 LEU n 
1  1077 SER n 
1  1078 LEU n 
1  1079 ALA n 
1  1080 MET n 
1  1081 VAL n 
1  1082 MET n 
1  1083 ALA n 
1  1084 GLY n 
1  1085 SER n 
1  1086 GLY n 
1  1087 ASN n 
1  1088 LEU n 
1  1089 LYS n 
1  1090 VAL n 
1  1091 LEU n 
1  1092 GLN n 
1  1093 LEU n 
1  1094 CYS n 
1  1095 ARG n 
1  1096 PHE n 
1  1097 LEU n 
1  1098 HIS n 
1  1099 MET n 
1  1100 LYS n 
1  1101 THR n 
1  1102 GLY n 
1  1103 GLY n 
1  1104 GLU n 
1  1105 MET n 
1  1106 ASN n 
1  1107 TYR n 
1  1108 GLY n 
1  1109 PHE n 
1  1110 HIS n 
1  1111 LEU n 
1  1112 ALA n 
1  1113 HIS n 
1  1114 HIS n 
1  1115 MET n 
1  1116 ALA n 
1  1117 LEU n 
1  1118 GLY n 
1  1119 LEU n 
1  1120 LEU n 
1  1121 PHE n 
1  1122 LEU n 
1  1123 GLY n 
1  1124 GLY n 
1  1125 GLY n 
1  1126 ARG n 
1  1127 TYR n 
1  1128 SER n 
1  1129 LEU n 
1  1130 SER n 
1  1131 THR n 
1  1132 SER n 
1  1133 ASN n 
1  1134 SER n 
1  1135 SER n 
1  1136 ILE n 
1  1137 ALA n 
1  1138 ALA n 
1  1139 LEU n 
1  1140 LEU n 
1  1141 CYS n 
1  1142 ALA n 
1  1143 LEU n 
1  1144 TYR n 
1  1145 PRO n 
1  1146 HIS n 
1  1147 PHE n 
1  1148 PRO n 
1  1149 ALA n 
1  1150 HIS n 
1  1151 SER n 
1  1152 THR n 
1  1153 ASP n 
1  1154 ASN n 
1  1155 ARG n 
1  1156 TYR n 
1  1157 HIS n 
1  1158 LEU n 
1  1159 GLN n 
1  1160 ALA n 
1  1161 LEU n 
1  1162 ARG n 
1  1163 HIS n 
1  1164 LEU n 
1  1165 TYR n 
1  1166 VAL n 
1  1167 LEU n 
1  1168 ALA n 
1  1169 ALA n 
1  1170 GLU n 
1  1171 PRO n 
1  1172 ARG n 
1  1173 LEU n 
1  1174 LEU n 
1  1175 VAL n 
1  1176 PRO n 
1  1177 VAL n 
1  1178 ASP n 
1  1179 VAL n 
1  1180 ASP n 
1  1181 THR n 
1  1182 ASN n 
1  1183 THR n 
1  1184 PRO n 
1  1185 CYS n 
1  1186 TYR n 
1  1187 ALA n 
1  1188 LEU n 
1  1189 LEU n 
1  1190 GLU n 
1  1191 VAL n 
1  1192 LEU n 
1  1193 TYR n 
1  1194 LYS n 
1  1195 GLY n 
1  1196 THR n 
1  1197 GLN n 
1  1198 TRP n 
1  1199 TYR n 
1  1200 GLU n 
1  1201 GLN n 
1  1202 THR n 
1  1203 LYS n 
1  1204 GLU n 
1  1205 GLU n 
1  1206 LEU n 
1  1207 MET n 
1  1208 ALA n 
1  1209 PRO n 
1  1210 THR n 
1  1211 LEU n 
1  1212 LEU n 
1  1213 PRO n 
1  1214 GLU n 
1  1215 LEU n 
1  1216 HIS n 
1  1217 LEU n 
1  1218 LEU n 
1  1219 LYS n 
1  1220 GLN n 
1  1221 ILE n 
1  1222 LYS n 
1  1223 VAL n 
1  1224 LYS n 
1  1225 GLY n 
1  1226 PRO n 
1  1227 ARG n 
1  1228 TYR n 
1  1229 TRP n 
1  1230 GLU n 
1  1231 LEU n 
1  1232 LEU n 
1  1233 ILE n 
1  1234 ASP n 
1  1235 LEU n 
1  1236 THR n 
1  1237 GLN n 
1  1238 HIS n 
1  1239 LEU n 
1  1240 LYS n 
1  1241 SER n 
1  1242 ILE n 
1  1243 LEU n 
1  1244 SER n 
1  1245 LYS n 
1  1246 ASP n 
1  1247 GLY n 
1  1248 VAL n 
1  1249 LEU n 
1  1250 TYR n 
1  1251 VAL n 
1  1252 LYS n 
1  1253 LEU n 
1  1254 ARG n 
1  1255 ALA n 
1  1256 GLY n 
1  1257 GLN n 
1  1258 LEU n 
1  1259 SER n 
1  1260 TYR n 
1  1261 LYS n 
1  1262 GLU n 
1  1263 ASP n 
1  1264 ALA n 
1  1265 SER n 
1  1266 GLU n 
1  1267 ALA n 
1  1268 ARG n 
1  1269 ALA n 
1  1270 PHE n 
1  1271 LYS n 
1  1272 SER n 
1  1273 ALA n 
1  1274 PHE n 
1  1275 THR n 
1  1276 SER n 
1  1277 ASP n 
1  1278 PRO n 
1  1279 ALA n 
1  1280 LEU n 
1  1281 LEU n 
1  1282 SER n 
1  1283 PHE n 
1  1284 ALA n 
1  1285 GLU n 
1  1286 TYR n 
1  1287 PHE n 
1  1288 CYS n 
1  1289 LYS n 
1  1290 PRO n 
1  1291 THR n 
1  1292 VAL n 
1  1293 ASN n 
1  1294 MET n 
1  1295 GLY n 
1  1296 GLN n 
1  1297 LYS n 
1  1298 GLN n 
1  1299 GLU n 
1  1300 ILE n 
1  1301 LEU n 
1  1302 ASP n 
1  1303 LEU n 
1  1304 PHE n 
1  1305 SER n 
1  1306 SER n 
1  1307 VAL n 
1  1308 LEU n 
1  1309 TYR n 
1  1310 GLU n 
1  1311 CYS n 
1  1312 VAL n 
1  1313 THR n 
1  1314 GLN n 
1  1315 GLU n 
1  1316 THR n 
1  1317 PRO n 
1  1318 GLU n 
1  1319 MET n 
1  1320 LEU n 
1  1321 PRO n 
1  1322 ALA n 
1  1323 TYR n 
1  1324 ILE n 
1  1325 ALA n 
1  1326 MET n 
1  1327 ASP n 
1  1328 GLN n 
1  1329 ALA n 
1  1330 ILE n 
1  1331 ARG n 
1  1332 ARG n 
1  1333 LEU n 
1  1334 GLY n 
1  1335 ARG n 
1  1336 ARG n 
1  1337 GLU n 
1  1338 MET n 
1  1339 SER n 
1  1340 GLU n 
1  1341 THR n 
1  1342 SER n 
1  1343 GLU n 
1  1344 LEU n 
1  1345 TRP n 
1  1346 GLN n 
1  1347 ILE n 
1  1348 LYS n 
1  1349 LEU n 
1  1350 VAL n 
1  1351 LEU n 
1  1352 GLU n 
1  1353 PHE n 
1  1354 PHE n 
1  1355 SER n 
1  1356 SER n 
1  1357 ARG n 
1  1358 SER n 
1  1359 HIS n 
1  1360 GLN n 
1  1361 PHE n 
1  1362 MET n 
1  1363 ASN n 
1  1364 SER n 
1  1365 GLU n 
1  1366 PHE n 
1  1367 LEU n 
1  1368 PRO n 
1  1369 VAL n 
1  1370 VAL n 
1  1371 LYS n 
1  1372 CYS n 
1  1373 THR n 
1  1374 ILE n 
1  1375 ASP n 
1  1376 ASN n 
1  1377 THR n 
1  1378 LEU n 
1  1379 ASP n 
1  1380 GLN n 
1  1381 TRP n 
1  1382 LEU n 
1  1383 GLN n 
1  1384 VAL n 
1  1385 GLY n 
1  1386 GLY n 
1  1387 ASP n 
1  1388 MET n 
1  1389 CYS n 
1  1390 VAL n 
1  1391 HIS n 
1  1392 ALA n 
1  1393 TYR n 
1  1394 LEU n 
1  1395 SER n 
1  1396 PRO n 
1  1397 LEU n 
1  1398 GLU n 
1  1399 SER n 
1  1400 GLN n 
1  1401 LEU n 
1  1402 SER n 
1  1403 MET n 
1  1404 LEU n 
1  1405 ALA n 
1  1406 CYS n 
1  1407 PHE n 
1  1408 ALA n 
1  1409 VAL n 
1  1410 TYR n 
1  1411 HIS n 
1  1412 SER n 
1  1413 VAL n 
1  1414 PRO n 
1  1415 ALA n 
1  1416 PRO n 
1  1417 UNK n 
1  1418 UNK n 
1  1419 UNK n 
1  1420 UNK n 
1  1421 UNK n 
1  1422 UNK n 
1  1423 UNK n 
1  1424 UNK n 
1  1425 UNK n 
1  1426 UNK n 
1  1427 UNK n 
1  1428 UNK n 
1  1429 UNK n 
1  1430 UNK n 
1  1431 UNK n 
1  1432 UNK n 
1  1433 UNK n 
1  1434 UNK n 
1  1435 UNK n 
1  1436 UNK n 
1  1437 UNK n 
1  1438 UNK n 
1  1439 UNK n 
1  1440 UNK n 
1  1441 UNK n 
2  1    MET n 
2  2    LYS n 
2  3    VAL n 
2  4    LYS n 
2  5    ILE n 
2  6    LYS n 
2  7    CYS n 
2  8    TRP n 
2  9    ASN n 
2  10   GLY n 
2  11   VAL n 
2  12   ALA n 
2  13   LEU n 
2  14   TRP n 
2  15   LEU n 
2  16   TRP n 
2  17   VAL n 
2  18   ALA n 
2  19   ASN n 
2  20   ASP n 
2  21   GLU n 
2  22   ASN n 
2  23   CYS n 
2  24   GLY n 
2  25   ILE n 
2  26   CYS n 
2  27   ARG n 
2  28   MET n 
2  29   ALA n 
2  30   PHE n 
2  31   ASN n 
2  32   GLY n 
2  33   CYS n 
2  34   CYS n 
2  35   PRO n 
2  36   ASP n 
2  37   CYS n 
2  38   LYS n 
2  39   VAL n 
2  40   PRO n 
2  41   GLY n 
2  42   ASP n 
2  43   ASP n 
2  44   CYS n 
2  45   PRO n 
2  46   LEU n 
2  47   VAL n 
2  48   TRP n 
2  49   GLY n 
2  50   GLN n 
2  51   CYS n 
2  52   SER n 
2  53   HIS n 
2  54   CYS n 
2  55   PHE n 
2  56   HIS n 
2  57   MET n 
2  58   HIS n 
2  59   CYS n 
2  60   ILE n 
2  61   LEU n 
2  62   LYS n 
2  63   TRP n 
2  64   LEU n 
2  65   HIS n 
2  66   ALA n 
2  67   GLN n 
2  68   GLN n 
2  69   VAL n 
2  70   GLN n 
2  71   GLN n 
2  72   HIS n 
2  73   CYS n 
2  74   PRO n 
2  75   MET n 
2  76   CYS n 
2  77   ARG n 
2  78   GLN n 
2  79   GLU n 
2  80   TRP n 
2  81   LYS n 
2  82   PHE n 
2  83   LYS n 
2  84   GLU n 
3  1    MET n 
3  2    ALA n 
3  3    ALA n 
3  4    SER n 
3  5    THR n 
3  6    SER n 
3  7    MET n 
3  8    VAL n 
3  9    PRO n 
3  10   VAL n 
3  11   ALA n 
3  12   VAL n 
3  13   THR n 
3  14   ALA n 
3  15   ALA n 
3  16   VAL n 
3  17   ALA n 
3  18   PRO n 
3  19   VAL n 
3  20   LEU n 
3  21   SER n 
3  22   ILE n 
3  23   ASN n 
3  24   SER n 
3  25   ASP n 
3  26   PHE n 
3  27   SER n 
3  28   ASP n 
3  29   LEU n 
3  30   ARG n 
3  31   GLU n 
3  32   ILE n 
3  33   LYS n 
3  34   LYS n 
3  35   GLN n 
3  36   LEU n 
3  37   LEU n 
3  38   LEU n 
3  39   ILE n 
3  40   ALA n 
3  41   GLY n 
3  42   LEU n 
3  43   THR n 
3  44   ARG n 
3  45   GLU n 
3  46   ARG n 
3  47   GLY n 
3  48   LEU n 
3  49   LEU n 
3  50   HIS n 
3  51   SER n 
3  52   SER n 
3  53   LYS n 
3  54   TRP n 
3  55   SER n 
3  56   ALA n 
3  57   GLU n 
3  58   LEU n 
3  59   ALA n 
3  60   PHE n 
3  61   SER n 
3  62   LEU n 
3  63   PRO n 
3  64   ALA n 
3  65   LEU n 
3  66   PRO n 
3  67   LEU n 
3  68   ALA n 
3  69   GLU n 
3  70   LEU n 
3  71   GLN n 
3  72   PRO n 
3  73   PRO n 
3  74   PRO n 
3  75   PRO n 
3  76   ILE n 
3  77   THR n 
3  78   GLU n 
3  79   GLU n 
3  80   ASP n 
3  81   ALA n 
3  82   GLN n 
3  83   ASP n 
3  84   MET n 
3  85   ASP n 
3  86   ALA n 
3  87   TYR n 
3  88   THR n 
3  89   LEU n 
3  90   ALA n 
3  91   LYS n 
3  92   ALA n 
3  93   TYR n 
3  94   PHE n 
3  95   ASP n 
3  96   VAL n 
3  97   LYS n 
3  98   GLU n 
3  99   TYR n 
3  100  ASP n 
3  101  ARG n 
3  102  ALA n 
3  103  ALA n 
3  104  HIS n 
3  105  PHE n 
3  106  LEU n 
3  107  HIS n 
3  108  GLY n 
3  109  CYS n 
3  110  ASN n 
3  111  SER n 
3  112  LYS n 
3  113  LYS n 
3  114  ALA n 
3  115  TYR n 
3  116  PHE n 
3  117  LEU n 
3  118  TYR n 
3  119  MET n 
3  120  TYR n 
3  121  SER n 
3  122  ARG n 
3  123  TYR n 
3  124  LEU n 
3  125  SER n 
3  126  GLY n 
3  127  GLU n 
3  128  LYS n 
3  129  LYS n 
3  130  LYS n 
3  131  ASP n 
3  132  ASP n 
3  133  GLU n 
3  134  THR n 
3  135  VAL n 
3  136  ASP n 
3  137  SER n 
3  138  LEU n 
3  139  GLY n 
3  140  PRO n 
3  141  LEU n 
3  142  GLU n 
3  143  LYS n 
3  144  GLY n 
3  145  GLN n 
3  146  VAL n 
3  147  LYS n 
3  148  ASN n 
3  149  GLU n 
3  150  ALA n 
3  151  LEU n 
3  152  ARG n 
3  153  GLU n 
3  154  LEU n 
3  155  ARG n 
3  156  VAL n 
3  157  GLU n 
3  158  LEU n 
3  159  SER n 
3  160  LYS n 
3  161  LEU n 
3  162  HIS n 
3  163  GLN n 
3  164  ALA n 
3  165  ARG n 
3  166  GLU n 
3  167  LEU n 
3  168  ASP n 
3  169  GLY n 
3  170  PHE n 
3  171  GLY n 
3  172  LEU n 
3  173  TYR n 
3  174  LEU n 
3  175  TYR n 
3  176  GLY n 
3  177  VAL n 
3  178  VAL n 
3  179  LEU n 
3  180  ARG n 
3  181  LYS n 
3  182  LEU n 
3  183  ASP n 
3  184  LEU n 
3  185  VAL n 
3  186  LYS n 
3  187  GLU n 
3  188  ALA n 
3  189  ILE n 
3  190  ASP n 
3  191  VAL n 
3  192  PHE n 
3  193  VAL n 
3  194  GLU n 
3  195  ALA n 
3  196  THR n 
3  197  HIS n 
3  198  VAL n 
3  199  LEU n 
3  200  PRO n 
3  201  LEU n 
3  202  HIS n 
3  203  TRP n 
3  204  GLY n 
3  205  ALA n 
3  206  TRP n 
3  207  LEU n 
3  208  GLU n 
3  209  LEU n 
3  210  CYS n 
3  211  ASN n 
3  212  LEU n 
3  213  ILE n 
3  214  THR n 
3  215  ASP n 
3  216  LYS n 
3  217  GLU n 
3  218  MET n 
3  219  LEU n 
3  220  LYS n 
3  221  PHE n 
3  222  LEU n 
3  223  SER n 
3  224  LEU n 
3  225  PRO n 
3  226  ASP n 
3  227  THR n 
3  228  TRP n 
3  229  MET n 
3  230  LYS n 
3  231  GLU n 
3  232  PHE n 
3  233  PHE n 
3  234  LEU n 
3  235  ALA n 
3  236  HIS n 
3  237  ILE n 
3  238  TYR n 
3  239  THR n 
3  240  GLU n 
3  241  LEU n 
3  242  GLN n 
3  243  LEU n 
3  244  ILE n 
3  245  GLU n 
3  246  GLU n 
3  247  ALA n 
3  248  LEU n 
3  249  GLN n 
3  250  LYS n 
3  251  TYR n 
3  252  GLN n 
3  253  ASN n 
3  254  LEU n 
3  255  ILE n 
3  256  ASP n 
3  257  VAL n 
3  258  GLY n 
3  259  PHE n 
3  260  SER n 
3  261  LYS n 
3  262  SER n 
3  263  SER n 
3  264  TYR n 
3  265  ILE n 
3  266  VAL n 
3  267  SER n 
3  268  GLN n 
3  269  ILE n 
3  270  ALA n 
3  271  VAL n 
3  272  ALA n 
3  273  TYR n 
3  274  HIS n 
3  275  ASN n 
3  276  ILE n 
3  277  ARG n 
3  278  ASP n 
3  279  ILE n 
3  280  ASP n 
3  281  LYS n 
3  282  ALA n 
3  283  LEU n 
3  284  SER n 
3  285  ILE n 
3  286  PHE n 
3  287  ASN n 
3  288  GLU n 
3  289  LEU n 
3  290  ARG n 
3  291  LYS n 
3  292  GLN n 
3  293  ASP n 
3  294  PRO n 
3  295  TYR n 
3  296  ARG n 
3  297  ILE n 
3  298  GLU n 
3  299  ASN n 
3  300  MET n 
3  301  ASP n 
3  302  THR n 
3  303  PHE n 
3  304  SER n 
3  305  ASN n 
3  306  LEU n 
3  307  LEU n 
3  308  TYR n 
3  309  VAL n 
3  310  ARG n 
3  311  SER n 
3  312  MET n 
3  313  LYS n 
3  314  SER n 
3  315  GLU n 
3  316  LEU n 
3  317  SER n 
3  318  TYR n 
3  319  LEU n 
3  320  ALA n 
3  321  HIS n 
3  322  ASN n 
3  323  LEU n 
3  324  CYS n 
3  325  GLU n 
3  326  ILE n 
3  327  ASP n 
3  328  LYS n 
3  329  TYR n 
3  330  ARG n 
3  331  VAL n 
3  332  GLU n 
3  333  THR n 
3  334  CYS n 
3  335  CYS n 
3  336  VAL n 
3  337  ILE n 
3  338  GLY n 
3  339  ASN n 
3  340  TYR n 
3  341  TYR n 
3  342  SER n 
3  343  LEU n 
3  344  ARG n 
3  345  SER n 
3  346  GLN n 
3  347  HIS n 
3  348  GLU n 
3  349  LYS n 
3  350  ALA n 
3  351  ALA n 
3  352  LEU n 
3  353  TYR n 
3  354  PHE n 
3  355  GLN n 
3  356  ARG n 
3  357  ALA n 
3  358  LEU n 
3  359  LYS n 
3  360  LEU n 
3  361  ASN n 
3  362  PRO n 
3  363  ARG n 
3  364  TYR n 
3  365  LEU n 
3  366  GLY n 
3  367  ALA n 
3  368  TRP n 
3  369  THR n 
3  370  LEU n 
3  371  MET n 
3  372  GLY n 
3  373  HIS n 
3  374  GLU n 
3  375  TYR n 
3  376  MET n 
3  377  GLU n 
3  378  MET n 
3  379  LYS n 
3  380  ASN n 
3  381  THR n 
3  382  SER n 
3  383  ALA n 
3  384  ALA n 
3  385  ILE n 
3  386  GLN n 
3  387  ALA n 
3  388  TYR n 
3  389  ARG n 
3  390  HIS n 
3  391  ALA n 
3  392  ILE n 
3  393  GLU n 
3  394  VAL n 
3  395  ASN n 
3  396  LYS n 
3  397  ARG n 
3  398  ASP n 
3  399  TYR n 
3  400  ARG n 
3  401  ALA n 
3  402  TRP n 
3  403  TYR n 
3  404  GLY n 
3  405  LEU n 
3  406  GLY n 
3  407  GLN n 
3  408  THR n 
3  409  TYR n 
3  410  GLU n 
3  411  ILE n 
3  412  LEU n 
3  413  LYS n 
3  414  MET n 
3  415  PRO n 
3  416  PHE n 
3  417  TYR n 
3  418  CYS n 
3  419  LEU n 
3  420  TYR n 
3  421  TYR n 
3  422  TYR n 
3  423  ARG n 
3  424  ARG n 
3  425  ALA n 
3  426  HIS n 
3  427  GLN n 
3  428  LEU n 
3  429  ARG n 
3  430  PRO n 
3  431  ASN n 
3  432  ASP n 
3  433  SER n 
3  434  ARG n 
3  435  MET n 
3  436  LEU n 
3  437  VAL n 
3  438  ALA n 
3  439  LEU n 
3  440  GLY n 
3  441  GLU n 
3  442  CYS n 
3  443  TYR n 
3  444  GLU n 
3  445  LYS n 
3  446  LEU n 
3  447  ASN n 
3  448  GLN n 
3  449  LEU n 
3  450  VAL n 
3  451  GLU n 
3  452  ALA n 
3  453  LYS n 
3  454  LYS n 
3  455  CYS n 
3  456  TYR n 
3  457  TRP n 
3  458  ARG n 
3  459  ALA n 
3  460  TYR n 
3  461  ALA n 
3  462  VAL n 
3  463  GLY n 
3  464  ASP n 
3  465  VAL n 
3  466  GLU n 
3  467  LYS n 
3  468  MET n 
3  469  ALA n 
3  470  LEU n 
3  471  VAL n 
3  472  LYS n 
3  473  LEU n 
3  474  ALA n 
3  475  LYS n 
3  476  LEU n 
3  477  HIS n 
3  478  GLU n 
3  479  GLN n 
3  480  LEU n 
3  481  THR n 
3  482  GLU n 
3  483  SER n 
3  484  GLU n 
3  485  GLN n 
3  486  ALA n 
3  487  ALA n 
3  488  GLN n 
3  489  CYS n 
3  490  TYR n 
3  491  ILE n 
3  492  LYS n 
3  493  TYR n 
3  494  ILE n 
3  495  GLN n 
3  496  ASP n 
3  497  ILE n 
3  498  TYR n 
3  499  SER n 
3  500  CYS n 
3  501  GLY n 
3  502  GLU n 
3  503  ILE n 
3  504  VAL n 
3  505  GLU n 
3  506  HIS n 
3  507  LEU n 
3  508  GLU n 
3  509  GLU n 
3  510  SER n 
3  511  THR n 
3  512  ALA n 
3  513  PHE n 
3  514  ARG n 
3  515  TYR n 
3  516  LEU n 
3  517  ALA n 
3  518  GLN n 
3  519  TYR n 
3  520  TYR n 
3  521  PHE n 
3  522  LYS n 
3  523  CYS n 
3  524  LYS n 
3  525  LEU n 
3  526  TRP n 
3  527  ASP n 
3  528  GLU n 
3  529  ALA n 
3  530  SER n 
3  531  THR n 
3  532  CYS n 
3  533  ALA n 
3  534  GLN n 
3  535  LYS n 
3  536  CYS n 
3  537  CYS n 
3  538  ALA n 
3  539  PHE n 
3  540  ASN n 
3  541  ASP n 
3  542  THR n 
3  543  ARG n 
3  544  GLU n 
3  545  GLU n 
3  546  GLY n 
3  547  LYS n 
3  548  ALA n 
3  549  LEU n 
3  550  LEU n 
3  551  ARG n 
3  552  GLN n 
3  553  ILE n 
3  554  LEU n 
3  555  GLN n 
3  556  LEU n 
3  557  ARG n 
3  558  ASN n 
3  559  GLN n 
3  560  GLY n 
3  561  GLU n 
3  562  THR n 
3  563  PRO n 
3  564  THR n 
3  565  THR n 
3  566  GLU n 
3  567  VAL n 
3  568  PRO n 
3  569  ALA n 
3  570  PRO n 
3  571  PHE n 
3  572  PHE n 
3  573  LEU n 
3  574  PRO n 
3  575  ALA n 
3  576  SER n 
3  577  LEU n 
3  578  SER n 
3  579  ALA n 
3  580  ASN n 
3  581  ASN n 
3  582  THR n 
3  583  PRO n 
3  584  THR n 
3  585  ARG n 
3  586  ARG n 
3  587  VAL n 
3  588  SER n 
3  589  PRO n 
3  590  LEU n 
3  591  ASN n 
3  592  LEU n 
3  593  SER n 
3  594  SER n 
3  595  VAL n 
3  596  THR n 
3  597  PRO n 
4  1    MET n 
4  2    SER n 
4  3    THR n 
4  4    LEU n 
4  5    TYR n 
4  6    PRO n 
4  7    SER n 
4  8    LEU n 
4  9    PHE n 
4  10   PRO n 
4  11   ARG n 
4  12   VAL n 
4  13   THR n 
4  14   GLU n 
4  15   THR n 
4  16   LEU n 
4  17   TRP n 
4  18   PHE n 
4  19   ASN n 
4  20   LEU n 
4  21   ASP n 
4  22   ARG n 
4  23   PRO n 
4  24   CYS n 
4  25   VAL n 
4  26   GLU n 
4  27   GLU n 
4  28   THR n 
4  29   GLU n 
4  30   LEU n 
4  31   GLN n 
4  32   GLN n 
4  33   GLN n 
4  34   GLU n 
4  35   GLN n 
4  36   GLN n 
4  37   HIS n 
4  38   GLN n 
4  39   ALA n 
4  40   TRP n 
4  41   LEU n 
4  42   GLN n 
4  43   SER n 
4  44   ILE n 
4  45   ALA n 
4  46   GLU n 
4  47   LYS n 
4  48   ASP n 
4  49   ASN n 
4  50   ASN n 
4  51   LEU n 
4  52   VAL n 
4  53   PRO n 
4  54   ILE n 
4  55   GLY n 
4  56   LYS n 
4  57   PRO n 
4  58   ALA n 
4  59   SER n 
4  60   GLU n 
4  61   HIS n 
4  62   TYR n 
4  63   ASP n 
4  64   ASP n 
4  65   GLU n 
4  66   GLU n 
4  67   GLU n 
4  68   GLU n 
4  69   ASP n 
4  70   ASP n 
4  71   GLU n 
4  72   ASP n 
4  73   ASP n 
4  74   GLU n 
4  75   ASP n 
4  76   SER n 
4  77   GLU n 
4  78   GLU n 
4  79   ASP n 
4  80   SER n 
4  81   GLU n 
4  82   ASP n 
4  83   ASP n 
4  84   GLU n 
4  85   ASP n 
4  86   MET n 
4  87   GLN n 
4  88   ASP n 
4  89   MET n 
4  90   ASP n 
4  91   GLU n 
4  92   MET n 
4  93   ASN n 
4  94   ASP n 
4  95   TYR n 
4  96   ASN n 
4  97   GLU n 
4  98   SER n 
4  99   PRO n 
4  100  ASP n 
4  101  ASP n 
4  102  GLY n 
4  103  GLU n 
4  104  VAL n 
4  105  ASN n 
4  106  GLU n 
4  107  VAL n 
4  108  ASP n 
4  109  MET n 
4  110  GLU n 
4  111  GLY n 
4  112  ASN n 
4  113  GLU n 
4  114  GLN n 
4  115  ASP n 
4  116  GLN n 
4  117  ASP n 
4  118  GLN n 
4  119  TRP n 
4  120  MET n 
4  121  ILE n 
5  1    MET n 
5  2    ALA n 
5  3    ALA n 
5  4    SER n 
5  5    SER n 
5  6    SER n 
5  7    SER n 
5  8    SER n 
5  9    SER n 
5  10   ALA n 
5  11   GLY n 
5  12   GLY n 
5  13   VAL n 
5  14   SER n 
5  15   GLY n 
5  16   SER n 
5  17   SER n 
5  18   VAL n 
5  19   THR n 
5  20   GLY n 
5  21   SER n 
5  22   GLY n 
5  23   PHE n 
5  24   SER n 
5  25   VAL n 
5  26   SER n 
5  27   ASP n 
5  28   LEU n 
5  29   ALA n 
5  30   PRO n 
5  31   PRO n 
5  32   ARG n 
5  33   LYS n 
5  34   ALA n 
5  35   LEU n 
5  36   PHE n 
5  37   THR n 
5  38   TYR n 
5  39   PRO n 
5  40   LYS n 
5  41   GLY n 
5  42   ALA n 
5  43   GLY n 
5  44   GLU n 
5  45   MET n 
5  46   LEU n 
5  47   GLU n 
5  48   ASP n 
5  49   GLY n 
5  50   SER n 
5  51   GLU n 
5  52   ARG n 
5  53   PHE n 
5  54   LEU n 
5  55   CYS n 
5  56   GLU n 
5  57   SER n 
5  58   VAL n 
5  59   PHE n 
5  60   SER n 
5  61   TYR n 
5  62   GLN n 
5  63   VAL n 
5  64   ALA n 
5  65   SER n 
5  66   THR n 
5  67   LEU n 
5  68   LYS n 
5  69   GLN n 
5  70   VAL n 
5  71   LYS n 
5  72   HIS n 
5  73   ASP n 
5  74   GLN n 
5  75   GLN n 
5  76   VAL n 
5  77   ALA n 
5  78   ARG n 
5  79   MET n 
5  80   GLU n 
5  81   LYS n 
5  82   LEU n 
5  83   ALA n 
5  84   GLY n 
5  85   LEU n 
5  86   VAL n 
5  87   GLU n 
5  88   GLU n 
5  89   LEU n 
5  90   GLU n 
5  91   ALA n 
5  92   ASP n 
5  93   GLU n 
5  94   TRP n 
5  95   ARG n 
5  96   PHE n 
5  97   LYS n 
5  98   PRO n 
5  99   ILE n 
5  100  GLU n 
5  101  GLN n 
5  102  LEU n 
5  103  LEU n 
5  104  GLY n 
5  105  PHE n 
5  106  THR n 
5  107  PRO n 
5  108  SER n 
5  109  SER n 
5  110  GLY n 
6  1    MET n 
6  2    THR n 
6  3    VAL n 
6  4    LEU n 
6  5    GLN n 
6  6    GLU n 
6  7    PRO n 
6  8    VAL n 
6  9    GLN n 
6  10   ALA n 
6  11   ALA n 
6  12   ILE n 
6  13   TRP n 
6  14   GLN n 
6  15   ALA n 
6  16   LEU n 
6  17   ASN n 
6  18   HIS n 
6  19   TYR n 
6  20   ALA n 
6  21   TYR n 
6  22   ARG n 
6  23   ASP n 
6  24   ALA n 
6  25   VAL n 
6  26   PHE n 
6  27   LEU n 
6  28   ALA n 
6  29   GLU n 
6  30   ARG n 
6  31   LEU n 
6  32   TYR n 
6  33   ALA n 
6  34   GLU n 
6  35   VAL n 
6  36   HIS n 
6  37   SER n 
6  38   GLU n 
6  39   GLU n 
6  40   ALA n 
6  41   LEU n 
6  42   PHE n 
6  43   LEU n 
6  44   LEU n 
6  45   ALA n 
6  46   THR n 
6  47   CYS n 
6  48   TYR n 
6  49   TYR n 
6  50   ARG n 
6  51   SER n 
6  52   GLY n 
6  53   LYS n 
6  54   ALA n 
6  55   TYR n 
6  56   LYS n 
6  57   ALA n 
6  58   TYR n 
6  59   ARG n 
6  60   LEU n 
6  61   LEU n 
6  62   LYS n 
6  63   GLY n 
6  64   HIS n 
6  65   SER n 
6  66   CYS n 
6  67   THR n 
6  68   THR n 
6  69   PRO n 
6  70   GLN n 
6  71   CYS n 
6  72   LYS n 
6  73   TYR n 
6  74   LEU n 
6  75   LEU n 
6  76   ALA n 
6  77   LYS n 
6  78   CYS n 
6  79   CYS n 
6  80   VAL n 
6  81   ASP n 
6  82   LEU n 
6  83   SER n 
6  84   LYS n 
6  85   LEU n 
6  86   ALA n 
6  87   GLU n 
6  88   GLY n 
6  89   GLU n 
6  90   GLN n 
6  91   ILE n 
6  92   LEU n 
6  93   SER n 
6  94   GLY n 
6  95   GLY n 
6  96   VAL n 
6  97   PHE n 
6  98   ASN n 
6  99   LYS n 
6  100  GLN n 
6  101  LYS n 
6  102  SER n 
6  103  HIS n 
6  104  ASP n 
6  105  ASP n 
6  106  ILE n 
6  107  VAL n 
6  108  THR n 
6  109  GLU n 
6  110  PHE n 
6  111  GLY n 
6  112  ASP n 
6  113  SER n 
6  114  ALA n 
6  115  CYS n 
6  116  PHE n 
6  117  THR n 
6  118  LEU n 
6  119  SER n 
6  120  LEU n 
6  121  LEU n 
6  122  GLY n 
6  123  HIS n 
6  124  VAL n 
6  125  TYR n 
6  126  CYS n 
6  127  LYS n 
6  128  THR n 
6  129  ASP n 
6  130  ARG n 
6  131  LEU n 
6  132  ALA n 
6  133  LYS n 
6  134  GLY n 
6  135  SER n 
6  136  GLU n 
6  137  CYS n 
6  138  TYR n 
6  139  GLN n 
6  140  LYS n 
6  141  SER n 
6  142  LEU n 
6  143  SER n 
6  144  LEU n 
6  145  ASN n 
6  146  PRO n 
6  147  PHE n 
6  148  LEU n 
6  149  TRP n 
6  150  SER n 
6  151  PRO n 
6  152  PHE n 
6  153  GLU n 
6  154  SER n 
6  155  LEU n 
6  156  CYS n 
6  157  GLU n 
6  158  ILE n 
6  159  GLY n 
6  160  GLU n 
6  161  LYS n 
6  162  PRO n 
6  163  ASP n 
6  164  PRO n 
6  165  ASP n 
6  166  GLN n 
6  167  THR n 
6  168  PHE n 
6  169  LYS n 
6  170  PHE n 
6  171  THR n 
6  172  SER n 
6  173  LEU n 
6  174  GLN n 
6  175  ASN n 
6  176  PHE n 
6  177  SER n 
6  178  ASN n 
6  179  CYS n 
6  180  LEU n 
6  181  PRO n 
6  182  ASN n 
6  183  SER n 
6  184  CYS n 
6  185  THR n 
6  186  THR n 
6  187  GLN n 
6  188  VAL n 
6  189  PRO n 
6  190  ASN n 
6  191  HIS n 
6  192  SER n 
6  193  LEU n 
6  194  SER n 
6  195  HIS n 
6  196  ARG n 
6  197  GLN n 
6  198  PRO n 
6  199  GLU n 
6  200  THR n 
6  201  VAL n 
6  202  LEU n 
6  203  THR n 
6  204  GLU n 
6  205  THR n 
6  206  PRO n 
6  207  GLN n 
6  208  ASP n 
6  209  THR n 
6  210  ILE n 
6  211  GLU n 
6  212  LEU n 
6  213  ASN n 
6  214  ARG n 
6  215  LEU n 
6  216  ASN n 
6  217  LEU n 
6  218  GLU n 
6  219  SER n 
6  220  SER n 
6  221  ASN n 
6  222  SER n 
6  223  LYS n 
6  224  TYR n 
6  225  SER n 
6  226  LEU n 
6  227  ASN n 
6  228  THR n 
6  229  ASP n 
6  230  SER n 
6  231  SER n 
6  232  VAL n 
6  233  SER n 
6  234  TYR n 
6  235  ILE n 
6  236  ASP n 
6  237  SER n 
6  238  ALA n 
6  239  VAL n 
6  240  ILE n 
6  241  SER n 
6  242  PRO n 
6  243  ASP n 
6  244  THR n 
6  245  VAL n 
6  246  PRO n 
6  247  LEU n 
6  248  GLY n 
6  249  THR n 
6  250  GLY n 
6  251  THR n 
6  252  SER n 
6  253  ILE n 
6  254  LEU n 
6  255  SER n 
6  256  LYS n 
6  257  GLN n 
6  258  VAL n 
6  259  GLN n 
6  260  ASN n 
6  261  LYS n 
6  262  PRO n 
6  263  LYS n 
6  264  THR n 
6  265  GLY n 
6  266  ARG n 
6  267  SER n 
6  268  LEU n 
6  269  LEU n 
6  270  GLY n 
6  271  GLY n 
6  272  PRO n 
6  273  ALA n 
6  274  ALA n 
6  275  LEU n 
6  276  SER n 
6  277  PRO n 
6  278  LEU n 
6  279  THR n 
6  280  PRO n 
6  281  SER n 
6  282  PHE n 
6  283  GLY n 
6  284  ILE n 
6  285  LEU n 
6  286  PRO n 
6  287  LEU n 
6  288  GLU n 
6  289  THR n 
6  290  PRO n 
6  291  SER n 
6  292  PRO n 
6  293  GLY n 
6  294  ASP n 
6  295  GLY n 
6  296  SER n 
6  297  TYR n 
6  298  LEU n 
6  299  GLN n 
6  300  ASN n 
6  301  TYR n 
6  302  THR n 
6  303  ASN n 
6  304  THR n 
6  305  PRO n 
6  306  PRO n 
6  307  VAL n 
6  308  ILE n 
6  309  ASP n 
6  310  VAL n 
6  311  PRO n 
6  312  SER n 
6  313  THR n 
6  314  GLY n 
6  315  ALA n 
6  316  PRO n 
6  317  SER n 
6  318  LYS n 
6  319  LYS n 
6  320  SER n 
6  321  VAL n 
6  322  ALA n 
6  323  ARG n 
6  324  ILE n 
6  325  GLY n 
6  326  GLN n 
6  327  THR n 
6  328  GLY n 
6  329  THR n 
6  330  LYS n 
6  331  SER n 
6  332  VAL n 
6  333  PHE n 
6  334  SER n 
6  335  GLN n 
6  336  SER n 
6  337  GLY n 
6  338  ASN n 
6  339  SER n 
6  340  ARG n 
6  341  GLU n 
6  342  VAL n 
6  343  THR n 
6  344  PRO n 
6  345  ILE n 
6  346  LEU n 
6  347  ALA n 
6  348  GLN n 
6  349  THR n 
6  350  GLN n 
6  351  SER n 
6  352  SER n 
6  353  GLY n 
6  354  PRO n 
6  355  GLN n 
6  356  THR n 
6  357  SER n 
6  358  THR n 
6  359  THR n 
6  360  PRO n 
6  361  GLN n 
6  362  VAL n 
6  363  LEU n 
6  364  SER n 
6  365  PRO n 
6  366  THR n 
6  367  ILE n 
6  368  THR n 
6  369  SER n 
6  370  PRO n 
6  371  PRO n 
6  372  ASN n 
6  373  ALA n 
6  374  LEU n 
6  375  PRO n 
6  376  ARG n 
6  377  ARG n 
6  378  SER n 
6  379  SER n 
6  380  ARG n 
6  381  LEU n 
6  382  PHE n 
6  383  THR n 
6  384  SER n 
6  385  ASP n 
6  386  SER n 
6  387  SER n 
6  388  THR n 
6  389  THR n 
6  390  LYS n 
6  391  GLU n 
6  392  ASN n 
6  393  SER n 
6  394  LYS n 
6  395  LYS n 
6  396  LEU n 
6  397  LYS n 
6  398  MET n 
6  399  LYS n 
6  400  PHE n 
6  401  PRO n 
6  402  PRO n 
6  403  LYS n 
6  404  ILE n 
6  405  PRO n 
6  406  ASN n 
6  407  ARG n 
6  408  LYS n 
6  409  THR n 
6  410  LYS n 
6  411  SER n 
6  412  LYS n 
6  413  THR n 
6  414  ASN n 
6  415  LYS n 
6  416  GLY n 
6  417  GLY n 
6  418  ILE n 
6  419  THR n 
6  420  GLN n 
6  421  PRO n 
6  422  ASN n 
6  423  ILE n 
6  424  ASN n 
6  425  ASP n 
6  426  SER n 
6  427  LEU n 
6  428  GLU n 
6  429  ILE n 
6  430  THR n 
6  431  LYS n 
6  432  LEU n 
6  433  ASP n 
6  434  SER n 
6  435  SER n 
6  436  ILE n 
6  437  ILE n 
6  438  SER n 
6  439  GLU n 
6  440  GLY n 
6  441  LYS n 
6  442  ILE n 
6  443  SER n 
6  444  THR n 
6  445  ILE n 
6  446  THR n 
6  447  PRO n 
6  448  GLN n 
6  449  ILE n 
6  450  GLN n 
6  451  ALA n 
6  452  PHE n 
6  453  ASN n 
6  454  LEU n 
6  455  GLN n 
6  456  LYS n 
6  457  ALA n 
6  458  ALA n 
6  459  ALA n 
6  460  GLU n 
6  461  GLY n 
6  462  LEU n 
6  463  MET n 
6  464  SER n 
6  465  LEU n 
6  466  LEU n 
6  467  ARG n 
6  468  GLU n 
6  469  MET n 
6  470  GLY n 
6  471  LYS n 
6  472  GLY n 
6  473  TYR n 
6  474  LEU n 
6  475  SER n 
6  476  LEU n 
6  477  CYS n 
6  478  SER n 
6  479  TYR n 
6  480  ASN n 
6  481  CYS n 
6  482  LYS n 
6  483  GLU n 
6  484  SER n 
6  485  ILE n 
6  486  ASN n 
6  487  ILE n 
6  488  LEU n 
6  489  SER n 
6  490  HIS n 
6  491  LEU n 
6  492  PRO n 
6  493  SER n 
6  494  HIS n 
6  495  HIS n 
6  496  TYR n 
6  497  ASN n 
6  498  THR n 
6  499  GLY n 
6  500  TRP n 
6  501  VAL n 
6  502  LEU n 
6  503  CYS n 
6  504  GLN n 
6  505  ILE n 
6  506  GLY n 
6  507  ARG n 
6  508  ALA n 
6  509  TYR n 
6  510  PHE n 
6  511  GLU n 
6  512  LEU n 
6  513  SER n 
6  514  GLU n 
6  515  TYR n 
6  516  MET n 
6  517  GLN n 
6  518  ALA n 
6  519  GLU n 
6  520  ARG n 
6  521  ILE n 
6  522  PHE n 
6  523  SER n 
6  524  GLU n 
6  525  VAL n 
6  526  ARG n 
6  527  ARG n 
6  528  ILE n 
6  529  GLU n 
6  530  ASN n 
6  531  TYR n 
6  532  ARG n 
6  533  VAL n 
6  534  GLU n 
6  535  GLY n 
6  536  MET n 
6  537  GLU n 
6  538  ILE n 
6  539  TYR n 
6  540  SER n 
6  541  THR n 
6  542  THR n 
6  543  LEU n 
6  544  TRP n 
6  545  HIS n 
6  546  LEU n 
6  547  GLN n 
6  548  LYS n 
6  549  ASP n 
6  550  VAL n 
6  551  ALA n 
6  552  LEU n 
6  553  SER n 
6  554  VAL n 
6  555  LEU n 
6  556  SER n 
6  557  LYS n 
6  558  ASP n 
6  559  LEU n 
6  560  THR n 
6  561  ASP n 
6  562  MET n 
6  563  ASP n 
6  564  LYS n 
6  565  ASN n 
6  566  SER n 
6  567  PRO n 
6  568  GLU n 
6  569  ALA n 
6  570  TRP n 
6  571  CYS n 
6  572  ALA n 
6  573  ALA n 
6  574  GLY n 
6  575  ASN n 
6  576  CYS n 
6  577  PHE n 
6  578  SER n 
6  579  LEU n 
6  580  GLN n 
6  581  ARG n 
6  582  GLU n 
6  583  HIS n 
6  584  ASP n 
6  585  ILE n 
6  586  ALA n 
6  587  ILE n 
6  588  LYS n 
6  589  PHE n 
6  590  PHE n 
6  591  GLN n 
6  592  ARG n 
6  593  ALA n 
6  594  ILE n 
6  595  GLN n 
6  596  VAL n 
6  597  ASP n 
6  598  PRO n 
6  599  ASN n 
6  600  TYR n 
6  601  ALA n 
6  602  TYR n 
6  603  ALA n 
6  604  TYR n 
6  605  THR n 
6  606  LEU n 
6  607  LEU n 
6  608  GLY n 
6  609  HIS n 
6  610  GLU n 
6  611  PHE n 
6  612  VAL n 
6  613  LEU n 
6  614  THR n 
6  615  GLU n 
6  616  GLU n 
6  617  LEU n 
6  618  ASP n 
6  619  LYS n 
6  620  ALA n 
6  621  LEU n 
6  622  ALA n 
6  623  CYS n 
6  624  PHE n 
6  625  ARG n 
6  626  ASN n 
6  627  ALA n 
6  628  ILE n 
6  629  ARG n 
6  630  VAL n 
6  631  ASN n 
6  632  PRO n 
6  633  ARG n 
6  634  HIS n 
6  635  TYR n 
6  636  ASN n 
6  637  ALA n 
6  638  TRP n 
6  639  TYR n 
6  640  GLY n 
6  641  LEU n 
6  642  GLY n 
6  643  MET n 
6  644  ILE n 
6  645  TYR n 
6  646  TYR n 
6  647  LYS n 
6  648  GLN n 
6  649  GLU n 
6  650  LYS n 
6  651  PHE n 
6  652  SER n 
6  653  LEU n 
6  654  ALA n 
6  655  GLU n 
6  656  MET n 
6  657  HIS n 
6  658  PHE n 
6  659  GLN n 
6  660  LYS n 
6  661  ALA n 
6  662  LEU n 
6  663  ASP n 
6  664  ILE n 
6  665  ASN n 
6  666  PRO n 
6  667  GLN n 
6  668  SER n 
6  669  SER n 
6  670  VAL n 
6  671  LEU n 
6  672  LEU n 
6  673  CYS n 
6  674  HIS n 
6  675  ILE n 
6  676  GLY n 
6  677  VAL n 
6  678  VAL n 
6  679  GLN n 
6  680  HIS n 
6  681  ALA n 
6  682  LEU n 
6  683  LYS n 
6  684  LYS n 
6  685  SER n 
6  686  GLU n 
6  687  LYS n 
6  688  ALA n 
6  689  LEU n 
6  690  ASP n 
6  691  THR n 
6  692  LEU n 
6  693  ASN n 
6  694  LYS n 
6  695  ALA n 
6  696  ILE n 
6  697  VAL n 
6  698  ILE n 
6  699  ASP n 
6  700  PRO n 
6  701  LYS n 
6  702  ASN n 
6  703  PRO n 
6  704  LEU n 
6  705  CYS n 
6  706  LYS n 
6  707  PHE n 
6  708  HIS n 
6  709  ARG n 
6  710  ALA n 
6  711  SER n 
6  712  VAL n 
6  713  LEU n 
6  714  PHE n 
6  715  ALA n 
6  716  ASN n 
6  717  GLU n 
6  718  LYS n 
6  719  TYR n 
6  720  LYS n 
6  721  SER n 
6  722  ALA n 
6  723  LEU n 
6  724  GLN n 
6  725  GLU n 
6  726  LEU n 
6  727  GLU n 
6  728  GLU n 
6  729  LEU n 
6  730  LYS n 
6  731  GLN n 
6  732  ILE n 
6  733  VAL n 
6  734  PRO n 
6  735  LYS n 
6  736  GLU n 
6  737  SER n 
6  738  LEU n 
6  739  VAL n 
6  740  TYR n 
6  741  PHE n 
6  742  LEU n 
6  743  ILE n 
6  744  GLY n 
6  745  LYS n 
6  746  VAL n 
6  747  TYR n 
6  748  LYS n 
6  749  LYS n 
6  750  LEU n 
6  751  GLY n 
6  752  GLN n 
6  753  THR n 
6  754  HIS n 
6  755  LEU n 
6  756  ALA n 
6  757  LEU n 
6  758  MET n 
6  759  ASN n 
6  760  PHE n 
6  761  SER n 
6  762  TRP n 
6  763  ALA n 
6  764  MET n 
6  765  ASP n 
6  766  LEU n 
6  767  ASP n 
6  768  PRO n 
6  769  LYS n 
6  770  GLY n 
6  771  ALA n 
6  772  ASN n 
6  773  ASN n 
6  774  GLN n 
6  775  ILE n 
6  776  LYS n 
6  777  GLU n 
6  778  ALA n 
6  779  ILE n 
6  780  ASP n 
6  781  LYS n 
6  782  ARG n 
6  783  TYR n 
6  784  LEU n 
6  785  PRO n 
6  786  ASP n 
6  787  ASP n 
6  788  GLU n 
6  789  GLU n 
6  790  PRO n 
6  791  ILE n 
6  792  THR n 
6  793  GLN n 
6  794  GLU n 
6  795  GLU n 
6  796  GLN n 
6  797  ILE n 
6  798  MET n 
6  799  GLY n 
6  800  THR n 
6  801  ASP n 
6  802  GLU n 
6  803  SER n 
6  804  GLN n 
6  805  GLU n 
6  806  SER n 
6  807  SER n 
6  808  MET n 
6  809  THR n 
6  810  ASP n 
6  811  ALA n 
6  812  ASP n 
6  813  ASP n 
6  814  THR n 
6  815  GLN n 
6  816  LEU n 
6  817  HIS n 
6  818  ALA n 
6  819  ALA n 
6  820  GLU n 
6  821  SER n 
6  822  ASP n 
6  823  GLU n 
6  824  PHE n 
7  1    MET n 
7  2    LEU n 
7  3    ARG n 
7  4    ARG n 
7  5    LYS n 
7  6    PRO n 
7  7    THR n 
7  8    ARG n 
7  9    LEU n 
7  10   GLU n 
7  11   LEU n 
7  12   LYS n 
7  13   LEU n 
7  14   ASP n 
7  15   ASP n 
7  16   ILE n 
7  17   GLU n 
7  18   GLU n 
7  19   PHE n 
7  20   GLU n 
7  21   ASN n 
7  22   ILE n 
7  23   ARG n 
7  24   LYS n 
7  25   ASP n 
7  26   LEU n 
7  27   GLU n 
7  28   THR n 
7  29   ARG n 
7  30   LYS n 
7  31   LYS n 
7  32   GLN n 
7  33   LYS n 
7  34   GLU n 
7  35   ASP n 
7  36   VAL n 
7  37   GLU n 
7  38   VAL n 
7  39   VAL n 
7  40   GLY n 
7  41   GLY n 
7  42   SER n 
7  43   ASP n 
7  44   GLY n 
7  45   GLU n 
7  46   GLY n 
7  47   ALA n 
7  48   ILE n 
7  49   GLY n 
7  50   LEU n 
7  51   SER n 
7  52   SER n 
7  53   ASP n 
7  54   PRO n 
7  55   LYS n 
7  56   SER n 
7  57   ARG n 
7  58   GLU n 
7  59   GLN n 
7  60   MET n 
7  61   ILE n 
7  62   ASN n 
7  63   ASP n 
7  64   ARG n 
7  65   ILE n 
7  66   GLY n 
7  67   TYR n 
7  68   LYS n 
7  69   PRO n 
7  70   GLN n 
7  71   PRO n 
7  72   LYS n 
7  73   PRO n 
7  74   ASN n 
7  75   ASN n 
7  76   ARG n 
7  77   SER n 
7  78   SER n 
7  79   GLN n 
7  80   PHE n 
7  81   GLY n 
7  82   SER n 
7  83   LEU n 
7  84   GLU n 
7  85   PHE n 
8  1    MET n 
8  2    LEU n 
8  3    ARG n 
8  4    PHE n 
8  5    PRO n 
8  6    THR n 
8  7    CYS n 
8  8    PHE n 
8  9    PRO n 
8  10   SER n 
8  11   PHE n 
8  12   ARG n 
8  13   VAL n 
8  14   VAL n 
8  15   GLY n 
8  16   GLU n 
8  17   LYS n 
8  18   GLN n 
8  19   LEU n 
8  20   PRO n 
8  21   GLN n 
8  22   GLU n 
8  23   ILE n 
8  24   ILE n 
8  25   PHE n 
8  26   LEU n 
8  27   VAL n 
8  28   TRP n 
8  29   SER n 
8  30   PRO n 
8  31   LYS n 
8  32   ARG n 
8  33   ASP n 
8  34   LEU n 
8  35   ILE n 
8  36   ALA n 
8  37   LEU n 
8  38   ALA n 
8  39   ASN n 
8  40   THR n 
8  41   ALA n 
8  42   GLY n 
8  43   GLU n 
8  44   VAL n 
8  45   LEU n 
8  46   LEU n 
8  47   HIS n 
8  48   ARG n 
8  49   LEU n 
8  50   ALA n 
8  51   SER n 
8  52   PHE n 
8  53   HIS n 
8  54   ARG n 
8  55   VAL n 
8  56   TRP n 
8  57   SER n 
8  58   PHE n 
8  59   PRO n 
8  60   PRO n 
8  61   ASN n 
8  62   GLU n 
8  63   ASN n 
8  64   THR n 
8  65   GLY n 
8  66   LYS n 
8  67   GLU n 
8  68   VAL n 
8  69   THR n 
8  70   CYS n 
8  71   LEU n 
8  72   ALA n 
8  73   TRP n 
8  74   ARG n 
8  75   PRO n 
8  76   ASP n 
8  77   GLY n 
8  78   LYS n 
8  79   LEU n 
8  80   LEU n 
8  81   ALA n 
8  82   PHE n 
8  83   ALA n 
8  84   LEU n 
8  85   ALA n 
8  86   ASP n 
8  87   THR n 
8  88   LYS n 
8  89   LYS n 
8  90   ILE n 
8  91   VAL n 
8  92   LEU n 
8  93   CYS n 
8  94   ASP n 
8  95   VAL n 
8  96   GLU n 
8  97   LYS n 
8  98   PRO n 
8  99   GLU n 
8  100  SER n 
8  101  LEU n 
8  102  HIS n 
8  103  SER n 
8  104  PHE n 
8  105  SER n 
8  106  VAL n 
8  107  GLU n 
8  108  ALA n 
8  109  PRO n 
8  110  VAL n 
8  111  SER n 
8  112  CYS n 
8  113  MET n 
8  114  HIS n 
8  115  TRP n 
8  116  MET n 
8  117  GLU n 
8  118  VAL n 
8  119  THR n 
8  120  VAL n 
8  121  GLU n 
8  122  SER n 
8  123  SER n 
8  124  VAL n 
8  125  LEU n 
8  126  THR n 
8  127  SER n 
8  128  PHE n 
8  129  TYR n 
8  130  ASN n 
8  131  ALA n 
8  132  GLU n 
8  133  ASP n 
8  134  GLU n 
8  135  SER n 
8  136  ASN n 
8  137  LEU n 
8  138  LEU n 
8  139  LEU n 
8  140  PRO n 
8  141  LYS n 
8  142  LEU n 
8  143  PRO n 
8  144  THR n 
8  145  LEU n 
8  146  PRO n 
8  147  LYS n 
8  148  ASN n 
8  149  TYR n 
8  150  SER n 
8  151  ASN n 
8  152  THR n 
8  153  SER n 
8  154  LYS n 
8  155  ILE n 
8  156  PHE n 
8  157  SER n 
8  158  GLU n 
8  159  GLU n 
8  160  ASN n 
8  161  SER n 
8  162  ASP n 
8  163  GLU n 
8  164  ILE n 
8  165  ILE n 
8  166  LYS n 
8  167  LEU n 
8  168  LEU n 
8  169  GLY n 
8  170  ASP n 
8  171  VAL n 
8  172  ARG n 
8  173  LEU n 
8  174  ASN n 
8  175  ILE n 
8  176  LEU n 
8  177  VAL n 
8  178  LEU n 
8  179  GLY n 
8  180  GLY n 
8  181  SER n 
8  182  SER n 
8  183  GLY n 
8  184  PHE n 
8  185  ILE n 
8  186  GLU n 
8  187  LEU n 
8  188  TYR n 
8  189  ALA n 
8  190  TYR n 
8  191  GLY n 
8  192  MET n 
8  193  PHE n 
8  194  LYS n 
8  195  ILE n 
8  196  ALA n 
8  197  ARG n 
8  198  VAL n 
8  199  THR n 
8  200  GLY n 
8  201  ILE n 
8  202  ALA n 
8  203  GLY n 
8  204  THR n 
8  205  CYS n 
8  206  LEU n 
8  207  ALA n 
8  208  LEU n 
8  209  CYS n 
8  210  LEU n 
8  211  SER n 
8  212  SER n 
8  213  ASP n 
8  214  LEU n 
8  215  LYS n 
8  216  SER n 
8  217  LEU n 
8  218  SER n 
8  219  VAL n 
8  220  VAL n 
8  221  THR n 
8  222  GLU n 
8  223  VAL n 
8  224  SER n 
8  225  THR n 
8  226  ASN n 
8  227  GLY n 
8  228  ALA n 
8  229  SER n 
8  230  GLU n 
8  231  VAL n 
8  232  SER n 
8  233  TYR n 
8  234  PHE n 
8  235  GLN n 
8  236  LEU n 
8  237  GLU n 
8  238  THR n 
8  239  ASN n 
8  240  LEU n 
8  241  LEU n 
8  242  TYR n 
8  243  SER n 
8  244  PHE n 
8  245  LEU n 
8  246  PRO n 
8  247  GLU n 
8  248  VAL n 
8  249  THR n 
8  250  ARG n 
8  251  MET n 
8  252  ALA n 
8  253  ARG n 
8  254  LYS n 
8  255  PHE n 
8  256  THR n 
8  257  HIS n 
8  258  ILE n 
8  259  SER n 
8  260  ALA n 
8  261  LEU n 
8  262  LEU n 
8  263  GLN n 
8  264  TYR n 
8  265  ILE n 
8  266  ASN n 
8  267  LEU n 
8  268  SER n 
8  269  LEU n 
8  270  THR n 
8  271  CYS n 
8  272  MET n 
8  273  CYS n 
8  274  GLU n 
8  275  ALA n 
8  276  TRP n 
8  277  GLU n 
8  278  GLU n 
8  279  ILE n 
8  280  LEU n 
8  281  MET n 
8  282  GLN n 
8  283  MET n 
8  284  ASP n 
8  285  SER n 
8  286  ARG n 
8  287  LEU n 
8  288  THR n 
8  289  LYS n 
8  290  PHE n 
8  291  VAL n 
8  292  GLN n 
8  293  GLU n 
8  294  LYS n 
8  295  ASN n 
8  296  THR n 
8  297  THR n 
8  298  THR n 
8  299  SER n 
8  300  VAL n 
8  301  GLN n 
8  302  ASP n 
8  303  GLU n 
8  304  PHE n 
8  305  MET n 
8  306  HIS n 
8  307  LEU n 
8  308  LEU n 
8  309  LEU n 
8  310  TRP n 
8  311  GLY n 
8  312  LYS n 
8  313  ALA n 
8  314  SER n 
8  315  ALA n 
8  316  GLU n 
8  317  LEU n 
8  318  GLN n 
8  319  THR n 
8  320  LEU n 
8  321  LEU n 
8  322  MET n 
8  323  ASN n 
8  324  GLN n 
8  325  LEU n 
8  326  THR n 
8  327  VAL n 
8  328  LYS n 
8  329  GLY n 
8  330  LEU n 
8  331  LYS n 
8  332  LYS n 
8  333  LEU n 
8  334  GLY n 
8  335  GLN n 
8  336  SER n 
8  337  ILE n 
8  338  GLU n 
8  339  SER n 
8  340  SER n 
8  341  TYR n 
8  342  SER n 
8  343  SER n 
8  344  ILE n 
8  345  GLN n 
8  346  LYS n 
8  347  LEU n 
8  348  VAL n 
8  349  ILE n 
8  350  SER n 
8  351  HIS n 
8  352  LEU n 
8  353  GLN n 
8  354  SER n 
8  355  GLY n 
8  356  SER n 
8  357  GLU n 
8  358  SER n 
8  359  LEU n 
8  360  LEU n 
8  361  TYR n 
8  362  HIS n 
8  363  LEU n 
8  364  SER n 
8  365  GLU n 
8  366  LEU n 
8  367  LYS n 
8  368  GLY n 
8  369  MET n 
8  370  ALA n 
8  371  SER n 
8  372  TRP n 
8  373  LYS n 
8  374  GLN n 
8  375  LYS n 
8  376  TYR n 
8  377  GLU n 
8  378  PRO n 
8  379  LEU n 
8  380  GLY n 
8  381  LEU n 
8  382  ASP n 
8  383  ALA n 
8  384  ALA n 
8  385  GLY n 
8  386  ILE n 
8  387  GLU n 
8  388  GLU n 
8  389  ALA n 
8  390  ILE n 
8  391  THR n 
8  392  ALA n 
8  393  VAL n 
8  394  GLY n 
8  395  SER n 
8  396  PHE n 
8  397  ILE n 
8  398  LEU n 
8  399  LYS n 
8  400  ALA n 
8  401  ASN n 
8  402  GLU n 
8  403  LEU n 
8  404  LEU n 
8  405  GLN n 
8  406  VAL n 
8  407  ILE n 
8  408  ASP n 
8  409  SER n 
8  410  SER n 
8  411  MET n 
8  412  LYS n 
8  413  ASN n 
8  414  PHE n 
8  415  LYS n 
8  416  ALA n 
8  417  PHE n 
8  418  PHE n 
8  419  ARG n 
8  420  TRP n 
8  421  LEU n 
8  422  TYR n 
8  423  VAL n 
8  424  ALA n 
8  425  MET n 
8  426  LEU n 
8  427  ARG n 
8  428  MET n 
8  429  THR n 
8  430  ASP n 
8  431  ASP n 
8  432  HIS n 
8  433  VAL n 
8  434  LEU n 
8  435  PRO n 
8  436  GLU n 
8  437  LEU n 
8  438  ASN n 
8  439  LYS n 
8  440  MET n 
8  441  THR n 
8  442  GLN n 
8  443  LYS n 
8  444  ASP n 
8  445  ILE n 
8  446  THR n 
8  447  PHE n 
8  448  VAL n 
8  449  ALA n 
8  450  GLU n 
8  451  PHE n 
8  452  LEU n 
8  453  THR n 
8  454  GLU n 
8  455  HIS n 
8  456  PHE n 
8  457  ASN n 
8  458  GLU n 
8  459  ALA n 
8  460  PRO n 
8  461  ASP n 
8  462  LEU n 
8  463  TYR n 
8  464  ASN n 
8  465  ARG n 
8  466  LYS n 
8  467  GLY n 
8  468  LYS n 
8  469  TYR n 
8  470  PHE n 
8  471  ASN n 
8  472  VAL n 
8  473  GLU n 
8  474  ARG n 
8  475  VAL n 
8  476  GLY n 
8  477  GLN n 
8  478  TYR n 
8  479  LEU n 
8  480  LYS n 
8  481  ASP n 
8  482  GLU n 
8  483  ASP n 
8  484  ASP n 
8  485  ASP n 
8  486  LEU n 
8  487  VAL n 
8  488  SER n 
8  489  PRO n 
8  490  PRO n 
8  491  ASN n 
8  492  THR n 
8  493  GLU n 
8  494  GLY n 
8  495  ASN n 
8  496  GLN n 
8  497  TRP n 
8  498  TYR n 
8  499  ASP n 
8  500  PHE n 
8  501  LEU n 
8  502  GLN n 
8  503  ASN n 
8  504  SER n 
8  505  SER n 
8  506  HIS n 
8  507  LEU n 
8  508  LYS n 
8  509  GLU n 
8  510  SER n 
8  511  PRO n 
8  512  LEU n 
8  513  LEU n 
8  514  PHE n 
8  515  PRO n 
8  516  TYR n 
8  517  TYR n 
8  518  PRO n 
8  519  ARG n 
8  520  LYS n 
8  521  SER n 
8  522  LEU n 
8  523  HIS n 
8  524  PHE n 
8  525  VAL n 
8  526  LYS n 
8  527  ARG n 
8  528  ARG n 
8  529  MET n 
8  530  GLU n 
8  531  ASN n 
8  532  ILE n 
8  533  ILE n 
8  534  ASP n 
8  535  GLN n 
8  536  CYS n 
8  537  LEU n 
8  538  GLN n 
8  539  LYS n 
8  540  PRO n 
8  541  ALA n 
8  542  ASP n 
8  543  VAL n 
8  544  ILE n 
8  545  GLY n 
8  546  LYS n 
8  547  SER n 
8  548  MET n 
8  549  ASN n 
8  550  GLN n 
8  551  ALA n 
8  552  ILE n 
8  553  CYS n 
8  554  ILE n 
8  555  PRO n 
8  556  LEU n 
8  557  TYR n 
8  558  ARG n 
8  559  ASP n 
8  560  THR n 
8  561  ARG n 
8  562  SER n 
8  563  GLU n 
8  564  ASP n 
8  565  SER n 
8  566  THR n 
8  567  ARG n 
8  568  ARG n 
8  569  LEU n 
8  570  PHE n 
8  571  LYS n 
8  572  PHE n 
8  573  PRO n 
8  574  PHE n 
8  575  LEU n 
8  576  TRP n 
8  577  ASN n 
8  578  ASN n 
8  579  LYS n 
8  580  THR n 
8  581  SER n 
8  582  ASN n 
8  583  LEU n 
8  584  HIS n 
8  585  TYR n 
8  586  LEU n 
8  587  LEU n 
8  588  PHE n 
8  589  THR n 
8  590  ILE n 
8  591  LEU n 
8  592  GLU n 
8  593  ASP n 
8  594  SER n 
8  595  LEU n 
8  596  TYR n 
8  597  LYS n 
8  598  MET n 
8  599  CYS n 
8  600  ILE n 
8  601  LEU n 
8  602  ARG n 
8  603  ARG n 
8  604  HIS n 
8  605  THR n 
8  606  ASP n 
8  607  ILE n 
8  608  SER n 
8  609  GLN n 
8  610  SER n 
8  611  VAL n 
8  612  SER n 
8  613  ASN n 
8  614  GLY n 
8  615  LEU n 
8  616  ILE n 
8  617  ALA n 
8  618  ILE n 
8  619  LYS n 
8  620  PHE n 
8  621  GLY n 
8  622  SER n 
8  623  PHE n 
8  624  THR n 
8  625  TYR n 
8  626  ALA n 
8  627  THR n 
8  628  THR n 
8  629  GLU n 
8  630  LYS n 
8  631  VAL n 
8  632  ARG n 
8  633  ARG n 
8  634  SER n 
8  635  ILE n 
8  636  TYR n 
8  637  SER n 
8  638  CYS n 
8  639  LEU n 
8  640  ASP n 
8  641  ALA n 
8  642  GLN n 
8  643  PHE n 
8  644  TYR n 
8  645  ASP n 
8  646  ASP n 
8  647  GLU n 
8  648  THR n 
8  649  VAL n 
8  650  THR n 
8  651  VAL n 
8  652  VAL n 
8  653  LEU n 
8  654  LYS n 
8  655  ASP n 
8  656  THR n 
8  657  VAL n 
8  658  GLY n 
8  659  ARG n 
8  660  GLU n 
8  661  GLY n 
8  662  ARG n 
8  663  ASP n 
8  664  ARG n 
8  665  LEU n 
8  666  LEU n 
8  667  VAL n 
8  668  GLN n 
8  669  LEU n 
8  670  PRO n 
8  671  LEU n 
8  672  SER n 
8  673  LEU n 
8  674  VAL n 
8  675  TYR n 
8  676  ASN n 
8  677  SER n 
8  678  GLU n 
8  679  ASP n 
8  680  SER n 
8  681  ALA n 
8  682  GLU n 
8  683  TYR n 
8  684  GLN n 
8  685  PHE n 
8  686  THR n 
8  687  GLY n 
8  688  THR n 
8  689  TYR n 
8  690  SER n 
8  691  THR n 
8  692  ARG n 
8  693  LEU n 
8  694  ASP n 
8  695  GLU n 
8  696  GLN n 
8  697  CYS n 
8  698  SER n 
8  699  ALA n 
8  700  ILE n 
8  701  PRO n 
8  702  THR n 
8  703  ARG n 
8  704  THR n 
8  705  MET n 
8  706  HIS n 
8  707  PHE n 
8  708  GLU n 
8  709  LYS n 
8  710  HIS n 
8  711  TRP n 
8  712  ARG n 
8  713  LEU n 
8  714  LEU n 
8  715  GLU n 
8  716  SER n 
8  717  MET n 
8  718  LYS n 
8  719  ALA n 
8  720  GLN n 
8  721  TYR n 
8  722  VAL n 
8  723  ALA n 
8  724  GLY n 
8  725  ASN n 
8  726  GLY n 
8  727  PHE n 
8  728  ARG n 
8  729  LYS n 
8  730  VAL n 
8  731  SER n 
8  732  CYS n 
8  733  VAL n 
8  734  LEU n 
8  735  SER n 
8  736  SER n 
8  737  ASN n 
8  738  LEU n 
8  739  ARG n 
8  740  HIS n 
8  741  VAL n 
8  742  ARG n 
8  743  VAL n 
8  744  PHE n 
8  745  GLU n 
8  746  MET n 
8  747  ASP n 
8  748  ILE n 
8  749  ASP n 
8  750  ASP n 
8  751  GLU n 
8  752  TRP n 
8  753  GLU n 
8  754  LEU n 
8  755  ASP n 
8  756  GLU n 
8  757  SER n 
8  758  SER n 
8  759  ASP n 
8  760  GLU n 
8  761  GLU n 
8  762  GLU n 
8  763  GLU n 
8  764  ALA n 
8  765  SER n 
8  766  ASN n 
8  767  LYS n 
8  768  PRO n 
8  769  VAL n 
8  770  LYS n 
8  771  ILE n 
8  772  LYS n 
8  773  GLU n 
8  774  GLU n 
8  775  VAL n 
8  776  LEU n 
8  777  SER n 
8  778  GLU n 
8  779  SER n 
8  780  GLU n 
8  781  ALA n 
8  782  GLU n 
8  783  ASN n 
8  784  GLN n 
8  785  GLN n 
8  786  ALA n 
8  787  GLY n 
8  788  ALA n 
8  789  ALA n 
8  790  ALA n 
8  791  LEU n 
8  792  ALA n 
8  793  PRO n 
8  794  GLU n 
8  795  ILE n 
8  796  VAL n 
8  797  ILE n 
8  798  LYS n 
8  799  VAL n 
8  800  GLU n 
8  801  LYS n 
8  802  LEU n 
8  803  ASP n 
8  804  PRO n 
8  805  GLU n 
8  806  LEU n 
8  807  ASP n 
8  808  SER n 
9  1    MET n 
9  2    ASN n 
9  3    LEU n 
9  4    GLU n 
9  5    ARG n 
9  6    LEU n 
9  7    ARG n 
9  8    LYS n 
9  9    ARG n 
9  10   VAL n 
9  11   ARG n 
9  12   GLN n 
9  13   TYR n 
9  14   LEU n 
9  15   ASP n 
9  16   GLN n 
9  17   GLN n 
9  18   GLN n 
9  19   TYR n 
9  20   GLN n 
9  21   SER n 
9  22   ALA n 
9  23   LEU n 
9  24   PHE n 
9  25   TRP n 
9  26   ALA n 
9  27   ASP n 
9  28   LYS n 
9  29   VAL n 
9  30   ALA n 
9  31   SER n 
9  32   LEU n 
9  33   SER n 
9  34   ARG n 
9  35   GLU n 
9  36   GLU n 
9  37   PRO n 
9  38   GLN n 
9  39   ASP n 
9  40   ILE n 
9  41   TYR n 
9  42   TRP n 
9  43   LEU n 
9  44   ALA n 
9  45   GLN n 
9  46   CYS n 
9  47   LEU n 
9  48   TYR n 
9  49   LEU n 
9  50   THR n 
9  51   ALA n 
9  52   GLN n 
9  53   TYR n 
9  54   HIS n 
9  55   ARG n 
9  56   ALA n 
9  57   ALA n 
9  58   HIS n 
9  59   ALA n 
9  60   LEU n 
9  61   ARG n 
9  62   SER n 
9  63   ARG n 
9  64   LYS n 
9  65   LEU n 
9  66   ASP n 
9  67   LYS n 
9  68   LEU n 
9  69   TYR n 
9  70   GLU n 
9  71   ALA n 
9  72   CYS n 
9  73   ARG n 
9  74   TYR n 
9  75   LEU n 
9  76   ALA n 
9  77   ALA n 
9  78   ARG n 
9  79   CYS n 
9  80   HIS n 
9  81   TYR n 
9  82   ALA n 
9  83   ALA n 
9  84   LYS n 
9  85   GLU n 
9  86   HIS n 
9  87   GLN n 
9  88   GLN n 
9  89   ALA n 
9  90   LEU n 
9  91   ASP n 
9  92   VAL n 
9  93   LEU n 
9  94   ASP n 
9  95   MET n 
9  96   GLU n 
9  97   GLU n 
9  98   PRO n 
9  99   ILE n 
9  100  ASN n 
9  101  LYS n 
9  102  ARG n 
9  103  LEU n 
9  104  PHE n 
9  105  GLU n 
9  106  LYS n 
9  107  TYR n 
9  108  LEU n 
9  109  LYS n 
9  110  ASP n 
9  111  GLU n 
9  112  SER n 
9  113  GLY n 
9  114  PHE n 
9  115  LYS n 
9  116  ASP n 
9  117  PRO n 
9  118  SER n 
9  119  SER n 
9  120  ASP n 
9  121  TRP n 
9  122  GLU n 
9  123  MET n 
9  124  SER n 
9  125  GLN n 
9  126  SER n 
9  127  SER n 
9  128  ILE n 
9  129  LYS n 
9  130  SER n 
9  131  SER n 
9  132  ILE n 
9  133  CYS n 
9  134  LEU n 
9  135  LEU n 
9  136  ARG n 
9  137  GLY n 
9  138  LYS n 
9  139  ILE n 
9  140  TYR n 
9  141  ASP n 
9  142  ALA n 
9  143  LEU n 
9  144  ASP n 
9  145  ASN n 
9  146  ARG n 
9  147  THR n 
9  148  LEU n 
9  149  ALA n 
9  150  THR n 
9  151  TYR n 
9  152  SER n 
9  153  TYR n 
9  154  LYS n 
9  155  GLU n 
9  156  ALA n 
9  157  LEU n 
9  158  LYS n 
9  159  LEU n 
9  160  ASP n 
9  161  VAL n 
9  162  TYR n 
9  163  CYS n 
9  164  PHE n 
9  165  GLU n 
9  166  ALA n 
9  167  PHE n 
9  168  ASP n 
9  169  LEU n 
9  170  LEU n 
9  171  THR n 
9  172  SER n 
9  173  HIS n 
9  174  HIS n 
9  175  MET n 
9  176  LEU n 
9  177  THR n 
9  178  ALA n 
9  179  GLN n 
9  180  GLU n 
9  181  GLU n 
9  182  LYS n 
9  183  GLU n 
9  184  LEU n 
9  185  LEU n 
9  186  GLU n 
9  187  SER n 
9  188  LEU n 
9  189  PRO n 
9  190  LEU n 
9  191  SER n 
9  192  LYS n 
9  193  LEU n 
9  194  CYS n 
9  195  ASN n 
9  196  GLU n 
9  197  GLU n 
9  198  GLN n 
9  199  GLU n 
9  200  LEU n 
9  201  LEU n 
9  202  ARG n 
9  203  PHE n 
9  204  LEU n 
9  205  PHE n 
9  206  GLU n 
9  207  ASN n 
9  208  LYS n 
9  209  LEU n 
9  210  LYS n 
9  211  LYS n 
9  212  TYR n 
9  213  ASN n 
9  214  LYS n 
9  215  PRO n 
9  216  SER n 
9  217  GLU n 
9  218  THR n 
9  219  VAL n 
9  220  ILE n 
9  221  PRO n 
9  222  GLU n 
9  223  SER n 
9  224  VAL n 
9  225  ASN n 
9  226  GLY n 
9  227  LEU n 
9  228  GLU n 
9  229  LYS n 
9  230  ASN n 
9  231  LEU n 
9  232  ASP n 
9  233  VAL n 
9  234  VAL n 
9  235  VAL n 
9  236  SER n 
9  237  LEU n 
9  238  ALA n 
9  239  GLU n 
9  240  ARG n 
9  241  HIS n 
9  242  TYR n 
9  243  TYR n 
9  244  ASN n 
9  245  CYS n 
9  246  ASP n 
9  247  PHE n 
9  248  LYS n 
9  249  MET n 
9  250  CYS n 
9  251  TYR n 
9  252  LYS n 
9  253  LEU n 
9  254  THR n 
9  255  SER n 
9  256  VAL n 
9  257  VAL n 
9  258  MET n 
9  259  GLU n 
9  260  LYS n 
9  261  ASP n 
9  262  PRO n 
9  263  PHE n 
9  264  HIS n 
9  265  ALA n 
9  266  SER n 
9  267  CYS n 
9  268  LEU n 
9  269  PRO n 
9  270  VAL n 
9  271  HIS n 
9  272  ILE n 
9  273  GLY n 
9  274  THR n 
9  275  LEU n 
9  276  VAL n 
9  277  GLU n 
9  278  LEU n 
9  279  ASN n 
9  280  LYS n 
9  281  ALA n 
9  282  ASN n 
9  283  GLU n 
9  284  LEU n 
9  285  PHE n 
9  286  TYR n 
9  287  LEU n 
9  288  SER n 
9  289  HIS n 
9  290  LYS n 
9  291  LEU n 
9  292  VAL n 
9  293  ASP n 
9  294  LEU n 
9  295  TYR n 
9  296  PRO n 
9  297  SER n 
9  298  ASN n 
9  299  PRO n 
9  300  VAL n 
9  301  SER n 
9  302  TRP n 
9  303  PHE n 
9  304  ALA n 
9  305  VAL n 
9  306  GLY n 
9  307  CYS n 
9  308  TYR n 
9  309  TYR n 
9  310  LEU n 
9  311  MET n 
9  312  VAL n 
9  313  GLY n 
9  314  HIS n 
9  315  LYS n 
9  316  ASN n 
9  317  GLU n 
9  318  HIS n 
9  319  ALA n 
9  320  ARG n 
9  321  ARG n 
9  322  TYR n 
9  323  LEU n 
9  324  SER n 
9  325  LYS n 
9  326  ALA n 
9  327  THR n 
9  328  THR n 
9  329  LEU n 
9  330  GLU n 
9  331  LYS n 
9  332  THR n 
9  333  TYR n 
9  334  GLY n 
9  335  PRO n 
9  336  ALA n 
9  337  TRP n 
9  338  ILE n 
9  339  ALA n 
9  340  TYR n 
9  341  GLY n 
9  342  HIS n 
9  343  SER n 
9  344  PHE n 
9  345  ALA n 
9  346  VAL n 
9  347  ALA n 
9  348  SER n 
9  349  GLU n 
9  350  HIS n 
9  351  ASP n 
9  352  GLN n 
9  353  ALA n 
9  354  MET n 
9  355  ALA n 
9  356  ALA n 
9  357  TYR n 
9  358  PHE n 
9  359  THR n 
9  360  ALA n 
9  361  ALA n 
9  362  GLN n 
9  363  LEU n 
9  364  MET n 
9  365  LYS n 
9  366  GLY n 
9  367  CYS n 
9  368  HIS n 
9  369  LEU n 
9  370  PRO n 
9  371  MET n 
9  372  LEU n 
9  373  TYR n 
9  374  ILE n 
9  375  GLY n 
9  376  LEU n 
9  377  GLU n 
9  378  TYR n 
9  379  GLY n 
9  380  LEU n 
9  381  THR n 
9  382  ASN n 
9  383  ASN n 
9  384  SER n 
9  385  LYS n 
9  386  LEU n 
9  387  ALA n 
9  388  GLU n 
9  389  ARG n 
9  390  PHE n 
9  391  PHE n 
9  392  SER n 
9  393  GLN n 
9  394  ALA n 
9  395  LEU n 
9  396  SER n 
9  397  ILE n 
9  398  ALA n 
9  399  PRO n 
9  400  GLU n 
9  401  ASP n 
9  402  PRO n 
9  403  PHE n 
9  404  VAL n 
9  405  MET n 
9  406  HIS n 
9  407  GLU n 
9  408  VAL n 
9  409  GLY n 
9  410  VAL n 
9  411  VAL n 
9  412  ALA n 
9  413  PHE n 
9  414  GLN n 
9  415  ASN n 
9  416  GLY n 
9  417  GLU n 
9  418  TRP n 
9  419  LYS n 
9  420  THR n 
9  421  ALA n 
9  422  GLU n 
9  423  LYS n 
9  424  TRP n 
9  425  PHE n 
9  426  LEU n 
9  427  ASP n 
9  428  ALA n 
9  429  LEU n 
9  430  GLU n 
9  431  LYS n 
9  432  ILE n 
9  433  LYS n 
9  434  ALA n 
9  435  ILE n 
9  436  GLY n 
9  437  ASN n 
9  438  GLU n 
9  439  VAL n 
9  440  THR n 
9  441  VAL n 
9  442  ASP n 
9  443  LYS n 
9  444  TRP n 
9  445  GLU n 
9  446  PRO n 
9  447  LEU n 
9  448  LEU n 
9  449  ASN n 
9  450  ASN n 
9  451  LEU n 
9  452  GLY n 
9  453  HIS n 
9  454  VAL n 
9  455  CYS n 
9  456  ARG n 
9  457  LYS n 
9  458  LEU n 
9  459  LYS n 
9  460  LYS n 
9  461  TYR n 
9  462  ALA n 
9  463  GLU n 
9  464  ALA n 
9  465  LEU n 
9  466  ASP n 
9  467  TYR n 
9  468  HIS n 
9  469  ARG n 
9  470  GLN n 
9  471  ALA n 
9  472  LEU n 
9  473  VAL n 
9  474  LEU n 
9  475  ILE n 
9  476  PRO n 
9  477  GLN n 
9  478  ASN n 
9  479  ALA n 
9  480  SER n 
9  481  THR n 
9  482  TYR n 
9  483  SER n 
9  484  ALA n 
9  485  ILE n 
9  486  GLY n 
9  487  TYR n 
9  488  ILE n 
9  489  HIS n 
9  490  SER n 
9  491  LEU n 
9  492  MET n 
9  493  GLY n 
9  494  ASN n 
9  495  PHE n 
9  496  GLU n 
9  497  ASN n 
9  498  ALA n 
9  499  VAL n 
9  500  ASP n 
9  501  TYR n 
9  502  PHE n 
9  503  HIS n 
9  504  THR n 
9  505  ALA n 
9  506  LEU n 
9  507  GLY n 
9  508  LEU n 
9  509  ARG n 
9  510  ARG n 
9  511  ASP n 
9  512  ASP n 
9  513  THR n 
9  514  PHE n 
9  515  SER n 
9  516  VAL n 
9  517  THR n 
9  518  MET n 
9  519  LEU n 
9  520  GLY n 
9  521  HIS n 
9  522  CYS n 
9  523  ILE n 
9  524  ALA n 
9  525  MET n 
9  526  TYR n 
9  527  ILE n 
9  528  GLY n 
9  529  ASP n 
9  530  SER n 
9  531  GLU n 
9  532  ALA n 
9  533  TYR n 
9  534  ILE n 
9  535  GLY n 
9  536  ALA n 
9  537  ASP n 
9  538  ILE n 
9  539  LYS n 
9  540  ASP n 
9  541  LYS n 
9  542  LEU n 
9  543  LYS n 
9  544  CYS n 
9  545  TYR n 
9  546  ASP n 
9  547  PHE n 
9  548  ASP n 
9  549  VAL n 
9  550  HIS n 
9  551  THR n 
9  552  MET n 
9  553  LYS n 
9  554  THR n 
9  555  LEU n 
9  556  LYS n 
9  557  ASN n 
9  558  ILE n 
9  559  ILE n 
9  560  SER n 
9  561  PRO n 
9  562  PRO n 
9  563  TRP n 
9  564  ASP n 
9  565  PHE n 
9  566  ARG n 
9  567  GLU n 
9  568  PHE n 
9  569  GLU n 
9  570  VAL n 
9  571  GLU n 
9  572  LYS n 
9  573  GLN n 
9  574  THR n 
9  575  ALA n 
9  576  GLU n 
9  577  GLU n 
9  578  THR n 
9  579  GLY n 
9  580  LEU n 
9  581  THR n 
9  582  PRO n 
9  583  LEU n 
9  584  GLU n 
9  585  THR n 
9  586  SER n 
9  587  ARG n 
9  588  LYS n 
9  589  THR n 
9  590  PRO n 
9  591  ASP n 
9  592  SER n 
9  593  ARG n 
9  594  PRO n 
9  595  SER n 
9  596  LEU n 
9  597  GLU n 
9  598  GLU n 
9  599  THR n 
9  600  PHE n 
9  601  GLU n 
9  602  ILE n 
9  603  GLU n 
9  604  MET n 
9  605  ASN n 
9  606  GLU n 
9  607  SER n 
9  608  ASP n 
9  609  MET n 
9  610  MET n 
9  611  LEU n 
9  612  GLU n 
9  613  THR n 
9  614  SER n 
9  615  MET n 
9  616  SER n 
9  617  ASP n 
9  618  HIS n 
9  619  SER n 
9  620  THR n 
10 1    MET n 
10 2    ASN n 
10 3    LEU n 
10 4    GLU n 
10 5    ARG n 
10 6    LEU n 
10 7    ARG n 
10 8    LYS n 
10 9    ARG n 
10 10   VAL n 
10 11   ARG n 
10 12   GLN n 
10 13   TYR n 
10 14   LEU n 
10 15   ASP n 
10 16   GLN n 
10 17   GLN n 
10 18   GLN n 
10 19   TYR n 
10 20   GLN n 
10 21   SER n 
10 22   ALA n 
10 23   LEU n 
10 24   PHE n 
10 25   TRP n 
10 26   ALA n 
10 27   ASP n 
10 28   LYS n 
10 29   VAL n 
10 30   ALA n 
10 31   SER n 
10 32   LEU n 
10 33   SER n 
10 34   ARG n 
10 35   GLU n 
10 36   GLU n 
10 37   PRO n 
10 38   GLN n 
10 39   ASP n 
10 40   ILE n 
10 41   TYR n 
10 42   TRP n 
10 43   LEU n 
10 44   ALA n 
10 45   GLN n 
10 46   CYS n 
10 47   LEU n 
10 48   TYR n 
10 49   LEU n 
10 50   THR n 
10 51   ALA n 
10 52   GLN n 
10 53   TYR n 
10 54   HIS n 
10 55   ARG n 
10 56   ALA n 
10 57   ALA n 
10 58   HIS n 
10 59   ALA n 
10 60   LEU n 
10 61   ARG n 
10 62   SER n 
10 63   ARG n 
10 64   LYS n 
10 65   LEU n 
10 66   ASP n 
10 67   LYS n 
10 68   LEU n 
10 69   TYR n 
10 70   GLU n 
10 71   ALA n 
10 72   CYS n 
10 73   ARG n 
10 74   TYR n 
10 75   LEU n 
10 76   ALA n 
10 77   ALA n 
10 78   ARG n 
10 79   CYS n 
10 80   HIS n 
10 81   TYR n 
10 82   ALA n 
10 83   ALA n 
10 84   LYS n 
10 85   GLU n 
10 86   HIS n 
10 87   GLN n 
10 88   GLN n 
10 89   ALA n 
10 90   LEU n 
10 91   ASP n 
10 92   VAL n 
10 93   LEU n 
10 94   ASP n 
10 95   MET n 
10 96   GLU n 
10 97   GLU n 
10 98   PRO n 
10 99   ILE n 
10 100  ASN n 
10 101  LYS n 
10 102  ARG n 
10 103  LEU n 
10 104  PHE n 
10 105  GLU n 
10 106  LYS n 
10 107  TYR n 
10 108  LEU n 
10 109  LYS n 
10 110  ASP n 
10 111  GLU n 
10 112  SER n 
10 113  GLY n 
10 114  PHE n 
10 115  LYS n 
10 116  ASP n 
10 117  PRO n 
10 118  SER n 
10 119  SER n 
10 120  ASP n 
10 121  TRP n 
10 122  GLU n 
10 123  MET n 
10 124  SER n 
10 125  GLN n 
10 126  SER n 
10 127  SER n 
10 128  ILE n 
10 129  LYS n 
10 130  SER n 
10 131  SER n 
10 132  ILE n 
10 133  CYS n 
10 134  LEU n 
10 135  LEU n 
10 136  ARG n 
10 137  GLY n 
10 138  LYS n 
10 139  ILE n 
10 140  TYR n 
10 141  ASP n 
10 142  ALA n 
10 143  LEU n 
10 144  ASP n 
10 145  ASN n 
10 146  ARG n 
10 147  THR n 
10 148  LEU n 
10 149  ALA n 
10 150  THR n 
10 151  TYR n 
10 152  SER n 
10 153  TYR n 
10 154  LYS n 
10 155  GLU n 
10 156  ALA n 
10 157  LEU n 
10 158  LYS n 
10 159  LEU n 
10 160  ASP n 
10 161  VAL n 
10 162  TYR n 
10 163  CYS n 
10 164  PHE n 
10 165  GLU n 
10 166  ALA n 
10 167  PHE n 
10 168  ASP n 
10 169  LEU n 
10 170  LEU n 
10 171  THR n 
10 172  SER n 
10 173  HIS n 
10 174  HIS n 
10 175  MET n 
10 176  LEU n 
10 177  THR n 
10 178  ALA n 
10 179  GLN n 
10 180  GLU n 
10 181  GLU n 
10 182  LYS n 
10 183  GLU n 
10 184  LEU n 
10 185  LEU n 
10 186  GLU n 
10 187  SER n 
10 188  LEU n 
10 189  PRO n 
10 190  LEU n 
10 191  SER n 
10 192  LYS n 
10 193  LEU n 
10 194  CYS n 
10 195  ASN n 
10 196  GLU n 
10 197  GLU n 
10 198  GLN n 
10 199  GLU n 
10 200  LEU n 
10 201  LEU n 
10 202  ARG n 
10 203  PHE n 
10 204  LEU n 
10 205  PHE n 
10 206  GLU n 
10 207  ASN n 
10 208  LYS n 
10 209  LEU n 
10 210  LYS n 
10 211  LYS n 
10 212  TYR n 
10 213  ASN n 
10 214  LYS n 
10 215  PRO n 
10 216  SER n 
10 217  GLU n 
10 218  THR n 
10 219  VAL n 
10 220  ILE n 
10 221  PRO n 
10 222  GLU n 
10 223  SER n 
10 224  VAL n 
10 225  ASP n 
10 226  GLY n 
10 227  LEU n 
10 228  GLU n 
10 229  LYS n 
10 230  ASN n 
10 231  LEU n 
10 232  ASP n 
10 233  VAL n 
10 234  VAL n 
10 235  VAL n 
10 236  SER n 
10 237  LEU n 
10 238  ALA n 
10 239  GLU n 
10 240  ARG n 
10 241  HIS n 
10 242  TYR n 
10 243  TYR n 
10 244  ASN n 
10 245  CYS n 
10 246  ASP n 
10 247  PHE n 
10 248  LYS n 
10 249  MET n 
10 250  CYS n 
10 251  TYR n 
10 252  LYS n 
10 253  LEU n 
10 254  THR n 
10 255  SER n 
10 256  VAL n 
10 257  VAL n 
10 258  MET n 
10 259  GLU n 
10 260  LYS n 
10 261  ASP n 
10 262  PRO n 
10 263  PHE n 
10 264  HIS n 
10 265  LYS n 
10 266  SER n 
10 267  CYS n 
10 268  LEU n 
10 269  PRO n 
10 270  VAL n 
10 271  HIS n 
10 272  ILE n 
10 273  GLY n 
10 274  THR n 
10 275  LEU n 
10 276  VAL n 
10 277  GLU n 
10 278  LEU n 
10 279  ASN n 
10 280  LYS n 
10 281  ALA n 
10 282  ASN n 
10 283  GLU n 
10 284  LEU n 
10 285  PHE n 
10 286  TYR n 
10 287  LEU n 
10 288  SER n 
10 289  HIS n 
10 290  LYS n 
10 291  LEU n 
10 292  VAL n 
10 293  ASP n 
10 294  LEU n 
10 295  TYR n 
10 296  PRO n 
10 297  SER n 
10 298  ASN n 
10 299  PRO n 
10 300  VAL n 
10 301  SER n 
10 302  TRP n 
10 303  PHE n 
10 304  ALA n 
10 305  VAL n 
10 306  GLY n 
10 307  CYS n 
10 308  TYR n 
10 309  TYR n 
10 310  LEU n 
10 311  MET n 
10 312  VAL n 
10 313  GLY n 
10 314  HIS n 
10 315  LYS n 
10 316  ASN n 
10 317  GLU n 
10 318  HIS n 
10 319  ALA n 
10 320  ARG n 
10 321  ARG n 
10 322  TYR n 
10 323  LEU n 
10 324  SER n 
10 325  LYS n 
10 326  ALA n 
10 327  THR n 
10 328  THR n 
10 329  LEU n 
10 330  GLU n 
10 331  LYS n 
10 332  THR n 
10 333  TYR n 
10 334  GLY n 
10 335  PRO n 
10 336  ALA n 
10 337  TRP n 
10 338  ILE n 
10 339  ALA n 
10 340  TYR n 
10 341  GLY n 
10 342  HIS n 
10 343  SER n 
10 344  PHE n 
10 345  ALA n 
10 346  VAL n 
10 347  GLU n 
10 348  SER n 
10 349  GLU n 
10 350  HIS n 
10 351  ASP n 
10 352  GLN n 
10 353  ALA n 
10 354  MET n 
10 355  ALA n 
10 356  ALA n 
10 357  TYR n 
10 358  PHE n 
10 359  THR n 
10 360  ALA n 
10 361  ALA n 
10 362  GLN n 
10 363  LEU n 
10 364  MET n 
10 365  LYS n 
10 366  GLY n 
10 367  CYS n 
10 368  HIS n 
10 369  LEU n 
10 370  PRO n 
10 371  MET n 
10 372  LEU n 
10 373  TYR n 
10 374  ILE n 
10 375  GLY n 
10 376  LEU n 
10 377  GLU n 
10 378  TYR n 
10 379  GLY n 
10 380  LEU n 
10 381  THR n 
10 382  ASN n 
10 383  ASN n 
10 384  SER n 
10 385  LYS n 
10 386  LEU n 
10 387  ALA n 
10 388  GLU n 
10 389  ARG n 
10 390  PHE n 
10 391  PHE n 
10 392  SER n 
10 393  GLN n 
10 394  ALA n 
10 395  LEU n 
10 396  SER n 
10 397  ILE n 
10 398  ALA n 
10 399  PRO n 
10 400  GLU n 
10 401  ASP n 
10 402  PRO n 
10 403  PHE n 
10 404  VAL n 
10 405  MET n 
10 406  HIS n 
10 407  GLU n 
10 408  VAL n 
10 409  GLY n 
10 410  VAL n 
10 411  VAL n 
10 412  ALA n 
10 413  PHE n 
10 414  GLN n 
10 415  ASN n 
10 416  GLY n 
10 417  GLU n 
10 418  TRP n 
10 419  LYS n 
10 420  THR n 
10 421  ALA n 
10 422  GLU n 
10 423  LYS n 
10 424  TRP n 
10 425  PHE n 
10 426  LEU n 
10 427  ASP n 
10 428  ALA n 
10 429  LEU n 
10 430  GLU n 
10 431  LYS n 
10 432  ILE n 
10 433  LYS n 
10 434  ALA n 
10 435  ILE n 
10 436  GLY n 
10 437  ASN n 
10 438  GLU n 
10 439  VAL n 
10 440  THR n 
10 441  VAL n 
10 442  ASP n 
10 443  LYS n 
10 444  TRP n 
10 445  GLU n 
10 446  PRO n 
10 447  LEU n 
10 448  LEU n 
10 449  ASN n 
10 450  ASN n 
10 451  LEU n 
10 452  GLY n 
10 453  HIS n 
10 454  VAL n 
10 455  CYS n 
10 456  ARG n 
10 457  LYS n 
10 458  LEU n 
10 459  LYS n 
10 460  LYS n 
10 461  TYR n 
10 462  ALA n 
10 463  GLU n 
10 464  ALA n 
10 465  LEU n 
10 466  ASP n 
10 467  TYR n 
10 468  HIS n 
10 469  ARG n 
10 470  GLN n 
10 471  ALA n 
10 472  LEU n 
10 473  VAL n 
10 474  LEU n 
10 475  ILE n 
10 476  PRO n 
10 477  GLN n 
10 478  ASN n 
10 479  ALA n 
10 480  SER n 
10 481  THR n 
10 482  TYR n 
10 483  SER n 
10 484  ALA n 
10 485  ILE n 
10 486  GLY n 
10 487  TYR n 
10 488  ILE n 
10 489  HIS n 
10 490  SER n 
10 491  LEU n 
10 492  MET n 
10 493  GLY n 
10 494  ASN n 
10 495  PHE n 
10 496  GLU n 
10 497  ASN n 
10 498  ALA n 
10 499  VAL n 
10 500  ASP n 
10 501  TYR n 
10 502  PHE n 
10 503  HIS n 
10 504  THR n 
10 505  ALA n 
10 506  LEU n 
10 507  GLY n 
10 508  LEU n 
10 509  ARG n 
10 510  ARG n 
10 511  ASP n 
10 512  ASP n 
10 513  THR n 
10 514  PHE n 
10 515  SER n 
10 516  VAL n 
10 517  THR n 
10 518  MET n 
10 519  LEU n 
10 520  GLY n 
10 521  HIS n 
10 522  CYS n 
10 523  ILE n 
10 524  GLU n 
10 525  MET n 
10 526  TYR n 
10 527  ILE n 
10 528  GLY n 
10 529  ASP n 
10 530  SER n 
10 531  GLU n 
10 532  ALA n 
10 533  TYR n 
10 534  ILE n 
10 535  GLY n 
10 536  ALA n 
10 537  ASP n 
10 538  ILE n 
10 539  LYS n 
10 540  ASP n 
10 541  LYS n 
10 542  LEU n 
10 543  LYS n 
10 544  CYS n 
10 545  TYR n 
10 546  ASP n 
10 547  PHE n 
10 548  ASP n 
10 549  VAL n 
10 550  HIS n 
10 551  THR n 
10 552  MET n 
10 553  LYS n 
10 554  THR n 
10 555  LEU n 
10 556  LYS n 
10 557  ASN n 
10 558  ILE n 
10 559  ILE n 
10 560  SER n 
10 561  PRO n 
10 562  PRO n 
10 563  TRP n 
10 564  ASP n 
10 565  PHE n 
10 566  ARG n 
10 567  GLU n 
10 568  PHE n 
10 569  GLU n 
10 570  VAL n 
10 571  GLU n 
10 572  LYS n 
10 573  GLN n 
10 574  THR n 
10 575  ALA n 
10 576  GLU n 
10 577  GLU n 
10 578  THR n 
10 579  GLY n 
10 580  LEU n 
10 581  THR n 
10 582  PRO n 
10 583  LEU n 
10 584  GLU n 
10 585  THR n 
10 586  SER n 
10 587  ARG n 
10 588  LYS n 
10 589  THR n 
10 590  PRO n 
10 591  ASP n 
10 592  SER n 
10 593  ARG n 
10 594  PRO n 
10 595  SER n 
10 596  LEU n 
10 597  GLU n 
10 598  GLU n 
10 599  THR n 
10 600  PHE n 
10 601  GLU n 
10 602  ILE n 
10 603  GLU n 
10 604  MET n 
10 605  ASN n 
10 606  GLU n 
10 607  SER n 
10 608  ASP n 
10 609  MET n 
10 610  MET n 
10 611  LEU n 
10 612  GLU n 
10 613  THR n 
10 614  SER n 
10 615  MET n 
10 616  SER n 
10 617  ASP n 
10 618  HIS n 
10 619  SER n 
10 620  THR n 
11 1    MET n 
11 2    THR n 
11 3    THR n 
11 4    PRO n 
11 5    ASN n 
11 6    LYS n 
11 7    THR n 
11 8    PRO n 
11 9    PRO n 
11 10   GLY n 
11 11   ALA n 
11 12   ASP n 
11 13   PRO n 
11 14   LYS n 
11 15   GLN n 
11 16   LEU n 
11 17   GLU n 
11 18   ARG n 
11 19   THR n 
11 20   GLY n 
11 21   THR n 
11 22   VAL n 
11 23   ARG n 
11 24   GLU n 
11 25   ILE n 
11 26   GLY n 
11 27   SER n 
11 28   GLN n 
11 29   ALA n 
11 30   VAL n 
11 31   TRP n 
11 32   SER n 
11 33   LEU n 
11 34   SER n 
11 35   SER n 
11 36   CYS n 
11 37   LYS n 
11 38   PRO n 
11 39   GLY n 
11 40   PHE n 
11 41   GLY n 
11 42   VAL n 
11 43   ASP n 
11 44   GLN n 
11 45   LEU n 
11 46   ARG n 
11 47   ASP n 
11 48   ASP n 
11 49   ASN n 
11 50   LEU n 
11 51   GLU n 
11 52   THR n 
11 53   TYR n 
11 54   TRP n 
11 55   GLN n 
11 56   SER n 
11 57   ASP n 
11 58   GLY n 
11 59   SER n 
11 60   GLN n 
11 61   PRO n 
11 62   HIS n 
11 63   LEU n 
11 64   VAL n 
11 65   ASN n 
11 66   ILE n 
11 67   GLN n 
11 68   PHE n 
11 69   ARG n 
11 70   ARG n 
11 71   LYS n 
11 72   THR n 
11 73   THR n 
11 74   VAL n 
11 75   LYS n 
11 76   THR n 
11 77   LEU n 
11 78   CYS n 
11 79   ILE n 
11 80   TYR n 
11 81   ALA n 
11 82   ASP n 
11 83   TYR n 
11 84   LYS n 
11 85   SER n 
11 86   ASP n 
11 87   GLU n 
11 88   SER n 
11 89   TYR n 
11 90   THR n 
11 91   PRO n 
11 92   SER n 
11 93   LYS n 
11 94   ILE n 
11 95   SER n 
11 96   VAL n 
11 97   ARG n 
11 98   VAL n 
11 99   GLY n 
11 100  ASN n 
11 101  ASN n 
11 102  PHE n 
11 103  HIS n 
11 104  ASN n 
11 105  LEU n 
11 106  GLN n 
11 107  GLU n 
11 108  ILE n 
11 109  ARG n 
11 110  GLN n 
11 111  LEU n 
11 112  GLU n 
11 113  LEU n 
11 114  VAL n 
11 115  GLU n 
11 116  PRO n 
11 117  SER n 
11 118  GLY n 
11 119  TRP n 
11 120  ILE n 
11 121  HIS n 
11 122  VAL n 
11 123  PRO n 
11 124  LEU n 
11 125  THR n 
11 126  ASP n 
11 127  ASN n 
11 128  HIS n 
11 129  LYS n 
11 130  LYS n 
11 131  PRO n 
11 132  THR n 
11 133  ARG n 
11 134  THR n 
11 135  PHE n 
11 136  MET n 
11 137  ILE n 
11 138  GLN n 
11 139  ILE n 
11 140  ALA n 
11 141  VAL n 
11 142  LEU n 
11 143  ALA n 
11 144  ASN n 
11 145  HIS n 
11 146  GLN n 
11 147  ASN n 
11 148  GLY n 
11 149  ARG n 
11 150  ASP n 
11 151  THR n 
11 152  HIS n 
11 153  MET n 
11 154  ARG n 
11 155  GLN n 
11 156  ILE n 
11 157  LYS n 
11 158  ILE n 
11 159  TYR n 
11 160  THR n 
11 161  PRO n 
11 162  VAL n 
11 163  GLU n 
11 164  GLU n 
11 165  SER n 
11 166  SER n 
11 167  ILE n 
11 168  GLY n 
11 169  LYS n 
11 170  PHE n 
11 171  PRO n 
11 172  ARG n 
11 173  CYS n 
11 174  THR n 
11 175  THR n 
11 176  ILE n 
11 177  ASP n 
11 178  PHE n 
11 179  MET n 
11 180  MET n 
11 181  TYR n 
11 182  ARG n 
11 183  SER n 
11 184  ILE n 
11 185  ARG n 
12 1    MET n 
12 2    ASP n 
12 3    SER n 
12 4    GLU n 
12 5    VAL n 
12 6    GLN n 
12 7    ARG n 
12 8    ASP n 
12 9    GLY n 
12 10   ARG n 
12 11   ILE n 
12 12   LEU n 
12 13   ASP n 
12 14   LEU n 
12 15   ILE n 
12 16   ASP n 
12 17   ASP n 
12 18   ALA n 
12 19   TRP n 
12 20   ARG n 
12 21   GLU n 
12 22   ASP n 
12 23   LYS n 
12 24   LEU n 
12 25   PRO n 
12 26   TYR n 
12 27   GLU n 
12 28   ASP n 
12 29   VAL n 
12 30   ALA n 
12 31   ILE n 
12 32   PRO n 
12 33   LEU n 
12 34   ASN n 
12 35   GLU n 
12 36   LEU n 
12 37   PRO n 
12 38   GLU n 
12 39   PRO n 
12 40   GLU n 
12 41   GLN n 
12 42   ASP n 
12 43   ASN n 
12 44   GLY n 
12 45   GLY n 
12 46   THR n 
12 47   THR n 
12 48   GLU n 
12 49   SER n 
12 50   VAL n 
12 51   LYS n 
12 52   GLU n 
12 53   GLN n 
12 54   GLU n 
12 55   MET n 
12 56   LYS n 
12 57   TRP n 
12 58   THR n 
12 59   ASP n 
12 60   LEU n 
12 61   ALA n 
12 62   LEU n 
12 63   GLN n 
12 64   TYR n 
12 65   LEU n 
12 66   HIS n 
12 67   GLU n 
12 68   ASN n 
12 69   VAL n 
12 70   PRO n 
12 71   PRO n 
12 72   ILE n 
12 73   GLY n 
12 74   ASN n 
13 1    UNK n 
13 2    UNK n 
13 3    UNK n 
13 4    UNK n 
13 5    UNK n 
13 6    UNK n 
13 7    UNK n 
13 8    UNK n 
13 9    UNK n 
13 10   UNK n 
13 11   UNK n 
13 12   UNK n 
13 13   UNK n 
13 14   UNK n 
13 15   UNK n 
13 16   UNK n 
13 17   UNK n 
13 18   UNK n 
13 19   UNK n 
13 20   UNK n 
13 21   UNK n 
13 22   UNK n 
13 23   UNK n 
13 24   UNK n 
13 25   UNK n 
13 26   UNK n 
13 27   UNK n 
13 28   UNK n 
13 29   UNK n 
13 30   UNK n 
13 31   UNK n 
13 32   UNK n 
13 33   TRP n 
13 34   PHE n 
13 35   VAL n 
13 36   GLU n 
13 37   VAL n 
13 38   LEU n 
13 39   GLN n 
13 40   ASN n 
13 41   ASP n 
13 42   LEU n 
13 43   GLN n 
13 44   ALA n 
13 45   ASN n 
13 46   ILE n 
13 47   SER n 
13 48   PRO n 
13 49   GLU n 
13 50   PHE n 
13 51   TRP n 
13 52   UNK n 
13 53   UNK n 
13 54   UNK n 
13 55   UNK n 
13 56   UNK n 
13 57   UNK n 
13 58   UNK n 
13 59   UNK n 
13 60   UNK n 
13 61   UNK n 
13 62   UNK n 
13 63   UNK n 
13 64   UNK n 
13 65   UNK n 
13 66   UNK n 
13 67   UNK n 
13 68   UNK n 
13 69   UNK n 
13 70   UNK n 
13 71   UNK n 
13 72   UNK n 
13 73   UNK n 
13 74   UNK n 
13 75   UNK n 
13 76   UNK n 
13 77   UNK n 
13 78   UNK n 
13 79   PRO n 
13 80   TYR n 
13 81   UNK n 
13 82   UNK n 
13 83   UNK n 
13 84   LEU n 
13 85   UNK n 
13 86   UNK n 
13 87   UNK n 
13 88   UNK n 
13 89   UNK n 
13 90   UNK n 
13 91   UNK n 
13 92   UNK n 
13 93   UNK n 
13 94   UNK n 
13 95   UNK n 
13 96   UNK n 
13 97   UNK n 
13 98   UNK n 
13 99   UNK n 
13 100  UNK n 
13 101  UNK n 
13 102  UNK n 
13 103  GLY n 
13 104  LEU n 
13 105  ARG n 
13 106  GLU n 
13 107  GLU n 
13 108  VAL n 
13 109  HIS n 
13 110  THR n 
13 111  MET n 
13 112  LEU n 
13 113  ARG n 
13 114  GLY n 
13 115  VAL n 
13 116  LEU n 
13 117  PHE n 
13 118  PHE n 
13 119  ALA n 
13 120  ALA n 
13 121  PRO n 
13 122  ARG n 
13 123  THR n 
13 124  PHE n 
13 125  GLN n 
13 126  GLU n 
13 127  MET n 
13 128  ILE n 
13 129  GLN n 
13 130  ARG n 
13 131  LEU n 
13 132  TYR n 
13 133  GLY n 
13 134  CYS n 
13 135  PHE n 
13 136  LEU n 
13 137  ARG n 
13 138  VAL n 
13 139  TYR n 
13 140  MET n 
13 141  GLN n 
13 142  SER n 
13 143  LYS n 
13 144  ARG n 
13 145  LYS n 
13 146  GLY n 
13 147  UNK n 
13 148  UNK n 
13 149  UNK n 
13 150  UNK n 
13 151  UNK n 
13 152  UNK n 
13 153  GLU n 
13 154  LEU n 
13 155  ASP n 
13 156  SER n 
13 157  ARG n 
13 158  TYR n 
13 159  ALA n 
13 160  ARG n 
13 161  ARG n 
13 162  ARG n 
13 163  TYR n 
13 164  TYR n 
13 165  ARG n 
13 166  LEU n 
13 167  UNK n 
13 168  UNK n 
13 169  UNK n 
13 170  UNK n 
13 171  UNK n 
13 172  TRP n 
13 173  CYS n 
13 174  ARG n 
13 175  GLN n 
13 176  ALA n 
13 177  LEU n 
13 178  GLU n 
13 179  GLN n 
13 180  PHE n 
13 181  HIS n 
13 182  GLN n 
13 183  LEU n 
13 184  SER n 
13 185  GLN n 
13 186  VAL n 
13 187  LEU n 
13 188  HIS n 
13 189  ARG n 
13 190  LEU n 
13 191  SER n 
13 192  LEU n 
13 193  LEU n 
13 194  ALA n 
13 195  ARG n 
13 196  VAL n 
13 197  SER n 
13 198  ALA n 
13 199  GLU n 
13 200  ALA n 
13 201  VAL n 
13 202  THR n 
13 203  THR n 
13 204  THR n 
13 205  LEU n 
13 206  HIS n 
13 207  GLN n 
13 208  VAL n 
13 209  THR n 
13 210  ARG n 
13 211  GLU n 
13 212  ARG n 
13 213  MET n 
13 214  GLU n 
13 215  ASP n 
13 216  ARG n 
13 217  CYS n 
13 218  ARG n 
13 219  GLY n 
13 220  GLU n 
13 221  TYR n 
13 222  GLU n 
13 223  ARG n 
13 224  SER n 
13 225  PHE n 
13 226  LEU n 
13 227  ARG n 
13 228  GLU n 
13 229  PHE n 
13 230  HIS n 
13 231  LYS n 
13 232  TRP n 
13 233  ILE n 
13 234  GLU n 
13 235  ARG n 
13 236  VAL n 
13 237  VAL n 
13 238  GLY n 
13 239  TRP n 
13 240  LEU n 
13 241  GLY n 
13 242  LYS n 
13 243  VAL n 
13 244  PHE n 
13 245  THR n 
13 246  LEU n 
13 247  ARG n 
13 248  ARG n 
13 249  TRP n 
13 250  ARG n 
13 251  CYS n 
13 252  HIS n 
13 253  VAL n 
13 254  GLN n 
13 255  ARG n 
13 256  PHE n 
13 257  PHE n 
13 258  TYR n 
13 259  ARG n 
13 260  ILE n 
13 261  TYR n 
13 262  ALA n 
13 263  SER n 
13 264  LEU n 
13 265  ARG n 
13 266  ILE n 
13 267  GLU n 
13 268  GLU n 
13 269  LEU n 
13 270  PHE n 
13 271  SER n 
13 272  ILE n 
13 273  VAL n 
13 274  ARG n 
13 275  ASP n 
13 276  PHE n 
13 277  PRO n 
13 278  ASP n 
13 279  SER n 
13 280  ARG n 
13 281  PRO n 
13 282  ALA n 
13 283  ILE n 
13 284  GLU n 
13 285  ASP n 
13 286  LEU n 
13 287  LYS n 
13 288  TYR n 
13 289  CYS n 
13 290  LEU n 
13 291  GLU n 
13 292  ARG n 
13 293  THR n 
13 294  ASP n 
13 295  GLN n 
13 296  ARG n 
13 297  GLN n 
13 298  GLN n 
13 299  LEU n 
13 300  LEU n 
13 301  VAL n 
13 302  SER n 
13 303  LEU n 
13 304  LYS n 
13 305  ALA n 
13 306  ALA n 
13 307  LEU n 
13 308  GLU n 
13 309  THR n 
13 310  ARG n 
13 311  LEU n 
13 312  LEU n 
13 313  HIS n 
13 314  PRO n 
13 315  GLY n 
13 316  VAL n 
13 317  ASN n 
13 318  THR n 
13 319  CYS n 
13 320  ASP n 
13 321  ILE n 
13 322  ILE n 
13 323  THR n 
13 324  LEU n 
13 325  TYR n 
13 326  ILE n 
13 327  SER n 
13 328  ALA n 
13 329  ILE n 
13 330  LYS n 
13 331  ALA n 
13 332  LEU n 
13 333  ARG n 
13 334  VAL n 
13 335  ILE n 
13 336  ASP n 
13 337  PRO n 
13 338  SER n 
13 339  MET n 
13 340  VAL n 
13 341  ILE n 
13 342  LEU n 
13 343  GLU n 
13 344  VAL n 
13 345  ALA n 
13 346  CYS n 
13 347  GLU n 
13 348  PRO n 
13 349  ILE n 
13 350  ARG n 
13 351  ARG n 
13 352  TYR n 
13 353  LEU n 
13 354  ARG n 
13 355  THR n 
13 356  ARG n 
13 357  GLU n 
13 358  ASP n 
13 359  THR n 
13 360  VAL n 
13 361  ARG n 
13 362  GLN n 
13 363  ILE n 
13 364  VAL n 
13 365  ALA n 
13 366  GLY n 
13 367  LEU n 
13 368  UNK n 
13 369  UNK n 
13 370  UNK n 
13 371  UNK n 
13 372  UNK n 
13 373  UNK n 
13 374  UNK n 
13 375  UNK n 
13 376  UNK n 
13 377  UNK n 
13 378  UNK n 
13 379  UNK n 
13 380  UNK n 
13 381  UNK n 
13 382  UNK n 
13 383  UNK n 
13 384  UNK n 
13 385  UNK n 
13 386  UNK n 
13 387  UNK n 
13 388  UNK n 
13 389  UNK n 
13 390  UNK n 
13 391  UNK n 
13 392  UNK n 
13 393  UNK n 
13 394  UNK n 
13 395  UNK n 
13 396  UNK n 
13 397  UNK n 
13 398  UNK n 
13 399  SER n 
13 400  ALA n 
13 401  ASP n 
13 402  ILE n 
13 403  ILE n 
13 404  SER n 
13 405  LEU n 
13 406  LEU n 
13 407  VAL n 
13 408  SER n 
13 409  ILE n 
13 410  TYR n 
13 411  GLY n 
13 412  SER n 
13 413  LYS n 
13 414  ASP n 
13 415  LEU n 
13 416  PHE n 
13 417  ILE n 
13 418  ASN n 
13 419  GLU n 
13 420  TYR n 
13 421  ARG n 
13 422  SER n 
13 423  LEU n 
13 424  LEU n 
13 425  ALA n 
13 426  ASP n 
13 427  ARG n 
13 428  LEU n 
13 429  LEU n 
13 430  HIS n 
13 431  GLN n 
13 432  PHE n 
13 433  SER n 
13 434  PHE n 
13 435  SER n 
13 436  PRO n 
13 437  GLU n 
13 438  ARG n 
13 439  GLU n 
13 440  ILE n 
13 441  ARG n 
13 442  ASN n 
13 443  VAL n 
13 444  GLU n 
13 445  LEU n 
13 446  LEU n 
13 447  LYS n 
13 448  LEU n 
13 449  ARG n 
13 450  PHE n 
13 451  GLY n 
13 452  GLU n 
13 453  ALA n 
13 454  PRO n 
13 455  MET n 
13 456  HIS n 
13 457  PHE n 
13 458  CYS n 
13 459  GLU n 
13 460  VAL n 
13 461  MET n 
13 462  LEU n 
13 463  LYS n 
13 464  ASP n 
13 465  MET n 
13 466  ALA n 
13 467  ASP n 
13 468  SER n 
13 469  ARG n 
13 470  ARG n 
13 471  ILE n 
13 472  ASN n 
13 473  ALA n 
13 474  ASN n 
13 475  ILE n 
13 476  ARG n 
13 477  GLU n 
13 478  GLU n 
13 479  ASP n 
13 480  GLU n 
13 481  LYS n 
13 482  ARG n 
13 483  PRO n 
13 484  ALA n 
13 485  GLU n 
13 486  GLU n 
13 487  GLN n 
13 488  PRO n 
13 489  PRO n 
13 490  PHE n 
13 491  GLY n 
13 492  VAL n 
13 493  TYR n 
13 494  ALA n 
13 495  VAL n 
13 496  ILE n 
13 497  LEU n 
13 498  SER n 
13 499  SER n 
13 500  GLU n 
13 501  PHE n 
13 502  TRP n 
13 503  PRO n 
13 504  PRO n 
13 505  PHE n 
13 506  LYS n 
13 507  ASP n 
13 508  GLU n 
13 509  LYS n 
13 510  LEU n 
13 511  GLU n 
13 512  VAL n 
13 513  PRO n 
13 514  GLU n 
13 515  ASP n 
13 516  ILE n 
13 517  ARG n 
13 518  ALA n 
13 519  ALA n 
13 520  LEU n 
13 521  GLU n 
13 522  ALA n 
13 523  TYR n 
13 524  CYS n 
13 525  LYS n 
13 526  LYS n 
13 527  TYR n 
13 528  GLU n 
13 529  GLN n 
13 530  LEU n 
13 531  LYS n 
13 532  ALA n 
13 533  MET n 
13 534  ARG n 
13 535  THR n 
13 536  LEU n 
13 537  SER n 
13 538  TRP n 
13 539  LYS n 
13 540  HIS n 
13 541  THR n 
13 542  LEU n 
13 543  GLY n 
13 544  LEU n 
13 545  VAL n 
13 546  THR n 
13 547  MET n 
13 548  ASP n 
13 549  VAL n 
13 550  GLU n 
13 551  LEU n 
13 552  ALA n 
13 553  ASP n 
13 554  ARG n 
13 555  THR n 
13 556  LEU n 
13 557  SER n 
13 558  VAL n 
13 559  ALA n 
13 560  VAL n 
13 561  THR n 
13 562  PRO n 
13 563  VAL n 
13 564  GLN n 
13 565  ALA n 
13 566  VAL n 
13 567  ILE n 
13 568  LEU n 
13 569  LEU n 
13 570  TYR n 
13 571  PHE n 
13 572  GLN n 
13 573  ASP n 
13 574  GLN n 
13 575  ALA n 
13 576  SER n 
13 577  TRP n 
13 578  THR n 
13 579  LEU n 
13 580  GLU n 
13 581  GLU n 
13 582  LEU n 
13 583  SER n 
13 584  LYS n 
13 585  ALA n 
13 586  VAL n 
13 587  LYS n 
13 588  MET n 
13 589  PRO n 
13 590  VAL n 
13 591  ALA n 
13 592  LEU n 
13 593  LEU n 
13 594  ARG n 
13 595  ARG n 
13 596  ARG n 
13 597  MET n 
13 598  SER n 
13 599  VAL n 
13 600  TRP n 
13 601  LEU n 
13 602  GLN n 
13 603  GLN n 
13 604  GLY n 
13 605  VAL n 
13 606  LEU n 
13 607  ARG n 
13 608  GLU n 
13 609  GLU n 
13 610  PRO n 
13 611  PRO n 
13 612  GLY n 
13 613  THR n 
13 614  PHE n 
13 615  SER n 
13 616  VAL n 
13 617  ILE n 
13 618  GLU n 
13 619  GLU n 
13 620  GLU n 
13 621  ARG n 
13 622  PRO n 
13 623  GLN n 
13 624  ASP n 
13 625  ARG n 
13 626  ASP n 
13 627  ASN n 
13 628  MET n 
13 629  VAL n 
13 630  LEU n 
13 631  ILE n 
13 632  LYS n 
13 633  GLU n 
13 634  GLU n 
13 635  GLU n 
13 636  LEU n 
13 637  LEU n 
13 638  LEU n 
13 639  PHE n 
13 640  TRP n 
13 641  THR n 
13 642  TYR n 
13 643  ILE n 
13 644  GLN n 
13 645  ALA n 
13 646  MET n 
13 647  LEU n 
13 648  THR n 
13 649  ASN n 
13 650  LEU n 
13 651  GLU n 
13 652  SER n 
13 653  LEU n 
13 654  SER n 
13 655  LEU n 
13 656  ASP n 
13 657  ARG n 
13 658  ILE n 
13 659  TYR n 
13 660  ASN n 
13 661  MET n 
13 662  LEU n 
13 663  ARG n 
13 664  MET n 
13 665  PHE n 
13 666  VAL n 
13 667  VAL n 
13 668  THR n 
13 669  GLY n 
13 670  PRO n 
13 671  ALA n 
13 672  LEU n 
13 673  ALA n 
13 674  GLU n 
13 675  ILE n 
13 676  ASP n 
13 677  LEU n 
13 678  GLN n 
13 679  GLU n 
13 680  LEU n 
13 681  GLN n 
13 682  GLY n 
13 683  TYR n 
13 684  LEU n 
13 685  GLN n 
13 686  LYS n 
13 687  LYS n 
13 688  VAL n 
13 689  ARG n 
13 690  ASP n 
13 691  GLN n 
13 692  GLN n 
13 693  LEU n 
13 694  VAL n 
13 695  TYR n 
13 696  SER n 
13 697  ALA n 
13 698  GLY n 
13 699  VAL n 
13 700  TYR n 
13 701  ARG n 
13 702  LEU n 
13 703  PRO n 
14 1    MET n 
14 2    ALA n 
14 3    SER n 
14 4    VAL n 
14 5    HIS n 
14 6    GLU n 
14 7    SER n 
14 8    LEU n 
14 9    TYR n 
14 10   PHE n 
14 11   ASN n 
14 12   PRO n 
14 13   MET n 
14 14   MET n 
14 15   THR n 
14 16   ASN n 
14 17   GLY n 
14 18   VAL n 
14 19   VAL n 
14 20   HIS n 
14 21   ALA n 
14 22   ASN n 
14 23   VAL n 
14 24   PHE n 
14 25   GLY n 
14 26   ILE n 
14 27   LYS n 
14 28   ASP n 
14 29   TRP n 
14 30   VAL n 
14 31   THR n 
14 32   PRO n 
14 33   TYR n 
14 34   LYS n 
14 35   ILE n 
14 36   ALA n 
14 37   VAL n 
14 38   LEU n 
14 39   VAL n 
14 40   LEU n 
14 41   LEU n 
14 42   SER n 
14 43   GLU n 
14 44   MET n 
14 45   SER n 
14 46   ARG n 
14 47   THR n 
14 48   GLY n 
14 49   GLU n 
14 50   GLY n 
14 51   ALA n 
14 52   VAL n 
14 53   SER n 
14 54   LEU n 
14 55   VAL n 
14 56   GLU n 
14 57   ARG n 
14 58   ARG n 
14 59   ARG n 
14 60   LEU n 
14 61   ASN n 
14 62   GLN n 
14 63   GLN n 
14 64   LEU n 
14 65   LEU n 
14 66   PRO n 
14 67   LEU n 
14 68   LEU n 
14 69   GLN n 
14 70   GLY n 
14 71   PRO n 
14 72   ASP n 
14 73   ILE n 
14 74   THR n 
14 75   VAL n 
14 76   SER n 
14 77   LYS n 
14 78   LEU n 
14 79   LEU n 
14 80   LYS n 
14 81   LEU n 
14 82   ILE n 
14 83   GLU n 
14 84   GLU n 
14 85   SER n 
14 86   CYS n 
14 87   PRO n 
14 88   GLN n 
14 89   LEU n 
14 90   ALA n 
14 91   ASN n 
14 92   SER n 
14 93   VAL n 
14 94   GLN n 
14 95   ILE n 
14 96   ARG n 
14 97   ILE n 
14 98   LYS n 
14 99   LEU n 
14 100  MET n 
14 101  ALA n 
14 102  GLU n 
14 103  GLY n 
14 104  GLU n 
14 105  LEU n 
14 106  LYS n 
14 107  ASP n 
14 108  MET n 
14 109  GLU n 
14 110  GLN n 
14 111  PHE n 
14 112  PHE n 
14 113  ASP n 
14 114  ASP n 
14 115  LEU n 
14 116  SER n 
14 117  ASP n 
14 118  SER n 
14 119  PHE n 
14 120  SER n 
14 121  GLY n 
14 122  THR n 
14 123  GLU n 
14 124  PRO n 
14 125  GLU n 
14 126  VAL n 
14 127  HIS n 
14 128  LYS n 
14 129  THR n 
14 130  SER n 
14 131  VAL n 
14 132  VAL n 
14 133  GLY n 
14 134  LEU n 
14 135  PHE n 
14 136  LEU n 
14 137  ARG n 
14 138  HIS n 
14 139  MET n 
14 140  ILE n 
14 141  LEU n 
14 142  ALA n 
14 143  TYR n 
14 144  SER n 
14 145  LYS n 
14 146  LEU n 
14 147  SER n 
14 148  PHE n 
14 149  SER n 
14 150  GLN n 
14 151  VAL n 
14 152  PHE n 
14 153  LYS n 
14 154  LEU n 
14 155  TYR n 
14 156  THR n 
14 157  ALA n 
14 158  LEU n 
14 159  GLN n 
14 160  GLN n 
14 161  TYR n 
14 162  PHE n 
14 163  GLN n 
14 164  SER n 
14 165  ASP n 
14 166  GLU n 
14 167  ASN n 
14 168  LYS n 
14 169  THR n 
14 170  VAL n 
14 171  GLU n 
14 172  ASP n 
14 173  ALA n 
14 174  ASP n 
14 175  MET n 
14 176  GLU n 
14 177  LEU n 
14 178  THR n 
14 179  SER n 
14 180  ARG n 
14 181  ASP n 
14 182  GLU n 
14 183  GLY n 
14 184  GLU n 
14 185  ARG n 
14 186  LYS n 
14 187  MET n 
14 188  GLU n 
14 189  LYS n 
14 190  GLU n 
14 191  GLU n 
14 192  LEU n 
14 193  ASP n 
14 194  VAL n 
14 195  SER n 
14 196  VAL n 
14 197  ARG n 
14 198  GLU n 
14 199  GLU n 
14 200  GLU n 
14 201  VAL n 
14 202  SER n 
14 203  CYS n 
14 204  SER n 
14 205  GLY n 
14 206  PRO n 
14 207  LEU n 
14 208  SER n 
14 209  GLN n 
14 210  LYS n 
14 211  GLN n 
14 212  ALA n 
14 213  GLU n 
14 214  PHE n 
14 215  PHE n 
14 216  LEU n 
14 217  SER n 
14 218  GLN n 
14 219  GLN n 
14 220  ALA n 
14 221  SER n 
14 222  LEU n 
14 223  LEU n 
14 224  LYS n 
14 225  ASN n 
14 226  ASP n 
14 227  GLU n 
14 228  THR n 
14 229  LYS n 
14 230  ALA n 
14 231  LEU n 
14 232  THR n 
14 233  PRO n 
14 234  ALA n 
14 235  SER n 
14 236  LEU n 
14 237  GLN n 
14 238  LYS n 
14 239  GLU n 
14 240  LEU n 
14 241  ASN n 
14 242  ASN n 
14 243  LEU n 
14 244  LEU n 
14 245  LYS n 
14 246  PHE n 
14 247  ASN n 
14 248  PRO n 
14 249  ASP n 
14 250  PHE n 
14 251  ALA n 
14 252  GLU n 
14 253  ALA n 
14 254  HIS n 
14 255  TYR n 
14 256  LEU n 
14 257  SER n 
14 258  TYR n 
14 259  LEU n 
14 260  ASN n 
14 261  ASN n 
14 262  LEU n 
14 263  ARG n 
14 264  VAL n 
14 265  GLN n 
14 266  ASP n 
14 267  VAL n 
14 268  PHE n 
14 269  SER n 
14 270  SER n 
14 271  THR n 
14 272  HIS n 
14 273  SER n 
14 274  LEU n 
14 275  LEU n 
14 276  HIS n 
14 277  TYR n 
14 278  PHE n 
14 279  ASP n 
14 280  ARG n 
14 281  LEU n 
14 282  ILE n 
14 283  LEU n 
14 284  THR n 
14 285  GLY n 
14 286  ALA n 
14 287  GLU n 
14 288  SER n 
14 289  LYS n 
14 290  SER n 
14 291  ASN n 
14 292  GLY n 
14 293  GLU n 
14 294  GLU n 
14 295  GLY n 
14 296  TYR n 
14 297  GLY n 
14 298  ARG n 
14 299  SER n 
14 300  LEU n 
14 301  ARG n 
14 302  TYR n 
14 303  ALA n 
14 304  ALA n 
14 305  LEU n 
14 306  ASN n 
14 307  LEU n 
14 308  ALA n 
14 309  ALA n 
14 310  LEU n 
14 311  HIS n 
14 312  CYS n 
14 313  ARG n 
14 314  PHE n 
14 315  GLY n 
14 316  HIS n 
14 317  TYR n 
14 318  GLN n 
14 319  GLN n 
14 320  ALA n 
14 321  GLU n 
14 322  LEU n 
14 323  ALA n 
14 324  LEU n 
14 325  GLN n 
14 326  GLU n 
14 327  ALA n 
14 328  ILE n 
14 329  ARG n 
14 330  ILE n 
14 331  ALA n 
14 332  GLN n 
14 333  GLU n 
14 334  SER n 
14 335  ASN n 
14 336  ASP n 
14 337  HIS n 
14 338  VAL n 
14 339  CYS n 
14 340  LEU n 
14 341  GLN n 
14 342  HIS n 
14 343  CYS n 
14 344  LEU n 
14 345  SER n 
14 346  TRP n 
14 347  LEU n 
14 348  TYR n 
14 349  VAL n 
14 350  LEU n 
14 351  GLY n 
14 352  GLN n 
14 353  LYS n 
14 354  ARG n 
14 355  SER n 
14 356  ASP n 
14 357  SER n 
14 358  TYR n 
14 359  VAL n 
14 360  LEU n 
14 361  LEU n 
14 362  GLU n 
14 363  HIS n 
14 364  SER n 
14 365  VAL n 
14 366  LYS n 
14 367  LYS n 
14 368  ALA n 
14 369  VAL n 
14 370  HIS n 
14 371  PHE n 
14 372  GLY n 
14 373  LEU n 
14 374  PRO n 
14 375  TYR n 
14 376  LEU n 
14 377  ALA n 
14 378  SER n 
14 379  LEU n 
14 380  GLY n 
14 381  ILE n 
14 382  GLN n 
14 383  SER n 
14 384  LEU n 
14 385  VAL n 
14 386  GLN n 
14 387  GLN n 
14 388  ARG n 
14 389  ALA n 
14 390  PHE n 
14 391  ALA n 
14 392  GLY n 
14 393  LYS n 
14 394  THR n 
14 395  ALA n 
14 396  ASN n 
14 397  LYS n 
14 398  LEU n 
14 399  MET n 
14 400  ASP n 
14 401  ALA n 
14 402  LEU n 
14 403  LYS n 
14 404  ASP n 
14 405  SER n 
14 406  ASP n 
14 407  LEU n 
14 408  LEU n 
14 409  HIS n 
14 410  TRP n 
14 411  LYS n 
14 412  HIS n 
14 413  SER n 
14 414  LEU n 
14 415  SER n 
14 416  GLU n 
14 417  LEU n 
14 418  ILE n 
14 419  ASP n 
14 420  ILE n 
14 421  SER n 
14 422  ILE n 
14 423  ALA n 
14 424  GLN n 
14 425  LYS n 
14 426  THR n 
14 427  ALA n 
14 428  ILE n 
14 429  TRP n 
14 430  ARG n 
14 431  LEU n 
14 432  TYR n 
14 433  GLY n 
14 434  ARG n 
14 435  SER n 
14 436  THR n 
14 437  MET n 
14 438  ALA n 
14 439  LEU n 
14 440  GLN n 
14 441  GLN n 
14 442  ALA n 
14 443  GLN n 
14 444  MET n 
14 445  LEU n 
14 446  LEU n 
14 447  SER n 
14 448  MET n 
14 449  ASN n 
14 450  SER n 
14 451  LEU n 
14 452  GLU n 
14 453  ALA n 
14 454  VAL n 
14 455  ASN n 
14 456  ALA n 
14 457  GLY n 
14 458  VAL n 
14 459  GLN n 
14 460  GLN n 
14 461  ASN n 
14 462  ASN n 
14 463  THR n 
14 464  GLU n 
14 465  SER n 
14 466  PHE n 
14 467  ALA n 
14 468  VAL n 
14 469  ALA n 
14 470  LEU n 
14 471  CYS n 
14 472  HIS n 
14 473  LEU n 
14 474  ALA n 
14 475  GLU n 
14 476  LEU n 
14 477  HIS n 
14 478  ALA n 
14 479  GLU n 
14 480  GLN n 
14 481  GLY n 
14 482  CYS n 
14 483  PHE n 
14 484  ALA n 
14 485  ALA n 
14 486  ALA n 
14 487  SER n 
14 488  GLU n 
14 489  VAL n 
14 490  LEU n 
14 491  LYS n 
14 492  HIS n 
14 493  LEU n 
14 494  LYS n 
14 495  GLU n 
14 496  ARG n 
14 497  PHE n 
14 498  PRO n 
14 499  PRO n 
14 500  ASN n 
14 501  SER n 
14 502  GLN n 
14 503  HIS n 
14 504  ALA n 
14 505  GLN n 
14 506  LEU n 
14 507  TRP n 
14 508  MET n 
14 509  LEU n 
14 510  CYS n 
14 511  ASP n 
14 512  GLN n 
14 513  LYS n 
14 514  ILE n 
14 515  GLN n 
14 516  PHE n 
14 517  ASP n 
14 518  ARG n 
14 519  ALA n 
14 520  MET n 
14 521  ASN n 
14 522  ASP n 
14 523  GLY n 
14 524  LYS n 
14 525  TYR n 
14 526  HIS n 
14 527  LEU n 
14 528  ALA n 
14 529  ASP n 
14 530  SER n 
14 531  LEU n 
14 532  VAL n 
14 533  THR n 
14 534  GLY n 
14 535  ILE n 
14 536  THR n 
14 537  ALA n 
14 538  LEU n 
14 539  ASN n 
14 540  SER n 
14 541  ILE n 
14 542  GLU n 
14 543  GLY n 
14 544  VAL n 
14 545  TYR n 
14 546  ARG n 
14 547  LYS n 
14 548  ALA n 
14 549  VAL n 
14 550  VAL n 
14 551  LEU n 
14 552  GLN n 
14 553  ALA n 
14 554  GLN n 
14 555  ASN n 
14 556  GLN n 
14 557  MET n 
14 558  SER n 
14 559  GLU n 
14 560  ALA n 
14 561  HIS n 
14 562  LYS n 
14 563  LEU n 
14 564  LEU n 
14 565  GLN n 
14 566  LYS n 
14 567  LEU n 
14 568  LEU n 
14 569  VAL n 
14 570  HIS n 
14 571  CYS n 
14 572  GLN n 
14 573  LYS n 
14 574  LEU n 
14 575  LYS n 
14 576  ASN n 
14 577  THR n 
14 578  GLU n 
14 579  MET n 
14 580  VAL n 
14 581  ILE n 
14 582  SER n 
14 583  VAL n 
14 584  LEU n 
14 585  LEU n 
14 586  SER n 
14 587  VAL n 
14 588  ALA n 
14 589  GLU n 
14 590  LEU n 
14 591  TYR n 
14 592  TRP n 
14 593  ARG n 
14 594  SER n 
14 595  SER n 
14 596  SER n 
14 597  PRO n 
14 598  THR n 
14 599  ILE n 
14 600  ALA n 
14 601  LEU n 
14 602  PRO n 
14 603  MET n 
14 604  LEU n 
14 605  LEU n 
14 606  GLN n 
14 607  ALA n 
14 608  LEU n 
14 609  ALA n 
14 610  LEU n 
14 611  SER n 
14 612  LYS n 
14 613  GLU n 
14 614  TYR n 
14 615  ARG n 
14 616  LEU n 
14 617  GLN n 
14 618  TYR n 
14 619  LEU n 
14 620  ALA n 
14 621  SER n 
14 622  GLU n 
14 623  THR n 
14 624  VAL n 
14 625  LEU n 
14 626  ASN n 
14 627  LEU n 
14 628  ALA n 
14 629  PHE n 
14 630  ALA n 
14 631  GLN n 
14 632  LEU n 
14 633  ILE n 
14 634  LEU n 
14 635  GLY n 
14 636  ILE n 
14 637  PRO n 
14 638  GLU n 
14 639  GLN n 
14 640  ALA n 
14 641  LEU n 
14 642  SER n 
14 643  LEU n 
14 644  LEU n 
14 645  HIS n 
14 646  MET n 
14 647  ALA n 
14 648  ILE n 
14 649  GLU n 
14 650  PRO n 
14 651  ILE n 
14 652  LEU n 
14 653  ALA n 
14 654  ASP n 
14 655  GLY n 
14 656  ALA n 
14 657  ILE n 
14 658  LEU n 
14 659  ASP n 
14 660  LYS n 
14 661  GLY n 
14 662  ARG n 
14 663  ALA n 
14 664  MET n 
14 665  PHE n 
14 666  LEU n 
14 667  VAL n 
14 668  ALA n 
14 669  LYS n 
14 670  CYS n 
14 671  GLN n 
14 672  VAL n 
14 673  ALA n 
14 674  SER n 
14 675  ALA n 
14 676  ALA n 
14 677  SER n 
14 678  TYR n 
14 679  ASP n 
14 680  GLN n 
14 681  PRO n 
14 682  LYS n 
14 683  LYS n 
14 684  ALA n 
14 685  GLU n 
14 686  ALA n 
14 687  LEU n 
14 688  GLU n 
14 689  ALA n 
14 690  ALA n 
14 691  ILE n 
14 692  GLU n 
14 693  ASN n 
14 694  LEU n 
14 695  ASN n 
14 696  GLU n 
14 697  ALA n 
14 698  LYS n 
14 699  ASN n 
14 700  TYR n 
14 701  PHE n 
14 702  ALA n 
14 703  LYS n 
14 704  VAL n 
14 705  ASP n 
14 706  CYS n 
14 707  LYS n 
14 708  GLU n 
14 709  ARG n 
14 710  ILE n 
14 711  ARG n 
14 712  ASP n 
14 713  VAL n 
14 714  VAL n 
14 715  TYR n 
14 716  PHE n 
14 717  GLN n 
14 718  ALA n 
14 719  ARG n 
14 720  LEU n 
14 721  TYR n 
14 722  HIS n 
14 723  THR n 
14 724  LEU n 
14 725  GLY n 
14 726  LYS n 
14 727  THR n 
14 728  GLN n 
14 729  GLU n 
14 730  ARG n 
14 731  ASN n 
14 732  ARG n 
14 733  CYS n 
14 734  ALA n 
14 735  MET n 
14 736  LEU n 
14 737  PHE n 
14 738  ARG n 
14 739  GLN n 
14 740  LEU n 
14 741  HIS n 
14 742  GLN n 
14 743  GLU n 
14 744  LEU n 
14 745  PRO n 
14 746  SER n 
14 747  HIS n 
14 748  GLY n 
14 749  VAL n 
14 750  PRO n 
14 751  LEU n 
14 752  ILE n 
14 753  ASN n 
14 754  HIS n 
14 755  LEU n 
15 1    GLY n 
15 2    PRO n 
15 3    VAL n 
15 4    GLY n 
15 5    LYS n 
15 6    ARG n 
15 7    LEU n 
15 8    GLN n 
15 9    GLN n 
15 10   GLU n 
15 11   LEU n 
15 12   MET n 
15 13   THR n 
15 14   LEU n 
15 15   MET n 
15 16   MET n 
15 17   SER n 
15 18   GLY n 
15 19   ASP n 
15 20   LYS n 
15 21   GLY n 
15 22   ILE n 
15 23   SER n 
15 24   ALA n 
15 25   PHE n 
15 26   PRO n 
15 27   GLU n 
15 28   SER n 
15 29   ASP n 
15 30   ASN n 
15 31   LEU n 
15 32   PHE n 
15 33   LYS n 
15 34   TRP n 
15 35   VAL n 
15 36   GLY n 
15 37   THR n 
15 38   ILE n 
15 39   HIS n 
15 40   GLY n 
15 41   ALA n 
15 42   ALA n 
15 43   GLY n 
15 44   THR n 
15 45   VAL n 
15 46   TYR n 
15 47   GLU n 
15 48   ASP n 
15 49   LEU n 
15 50   ARG n 
15 51   TYR n 
15 52   LYS n 
15 53   LEU n 
15 54   SER n 
15 55   LEU n 
15 56   GLU n 
15 57   PHE n 
15 58   PRO n 
15 59   SER n 
15 60   GLY n 
15 61   TYR n 
15 62   PRO n 
15 63   TYR n 
15 64   ASN n 
15 65   ALA n 
15 66   PRO n 
15 67   THR n 
15 68   VAL n 
15 69   LYS n 
15 70   PHE n 
15 71   LEU n 
15 72   THR n 
15 73   PRO n 
15 74   CYS n 
15 75   TYR n 
15 76   HIS n 
15 77   PRO n 
15 78   ASN n 
15 79   VAL n 
15 80   ASP n 
15 81   THR n 
15 82   GLN n 
15 83   GLY n 
15 84   ASN n 
15 85   ILE n 
15 86   CYS n 
15 87   LEU n 
15 88   ASP n 
15 89   ILE n 
15 90   LEU n 
15 91   LYS n 
15 92   GLU n 
15 93   LYS n 
15 94   TRP n 
15 95   SER n 
15 96   ALA n 
15 97   LEU n 
15 98   TYR n 
15 99   ASP n 
15 100  VAL n 
15 101  ARG n 
15 102  THR n 
15 103  ILE n 
15 104  LEU n 
15 105  LEU n 
15 106  SER n 
15 107  ILE n 
15 108  GLN n 
15 109  SER n 
15 110  LEU n 
15 111  LEU n 
15 112  GLY n 
15 113  GLU n 
15 114  PRO n 
15 115  ASN n 
15 116  ILE n 
15 117  ASP n 
15 118  SER n 
15 119  PRO n 
15 120  LEU n 
15 121  ASN n 
15 122  THR n 
15 123  HIS n 
15 124  ALA n 
15 125  ALA n 
15 126  GLU n 
15 127  LEU n 
15 128  TRP n 
15 129  LYS n 
15 130  ASN n 
15 131  PRO n 
15 132  THR n 
15 133  ALA n 
15 134  PHE n 
15 135  LYS n 
15 136  LYS n 
15 137  TYR n 
15 138  LEU n 
15 139  GLN n 
15 140  GLU n 
15 141  THR n 
15 142  TYR n 
15 143  SER n 
15 144  LYS n 
15 145  GLN n 
15 146  UNK n 
15 147  UNK n 
15 148  UNK n 
15 149  UNK n 
15 150  UNK n 
15 151  UNK n 
15 152  UNK n 
15 153  UNK n 
15 154  UNK n 
15 155  UNK n 
15 156  UNK n 
15 157  UNK n 
15 158  UNK n 
15 159  UNK n 
15 160  UNK n 
15 161  UNK n 
15 162  UNK n 
16 1    SER n 
16 2    LYS n 
16 3    HIS n 
16 4    GLY n 
16 5    ASP n 
16 6    ARG n 
16 7    PHE n 
16 8    ILE n 
16 9    PRO n 
16 10   SER n 
16 11   ARG n 
16 12   ALA n 
16 13   GLY n 
16 14   ALA n 
16 15   ASN n 
16 16   TRP n 
16 17   SER n 
16 18   VAL n 
16 19   ASN n 
16 20   PHE n 
16 21   HIS n 
16 22   ARG n 
16 23   ILE n 
16 24   ASN n 
16 25   GLU n 
16 26   ASN n 
16 27   GLY n 
16 28   LEU n 
16 29   ALA n 
16 30   TYR n 
16 31   SER n 
16 32   ALA n 
16 33   LEU n 
16 34   LEU n 
16 35   LYS n 
16 36   ASN n 
16 37   GLU n 
16 38   LEU n 
16 39   LEU n 
16 40   GLY n 
16 41   ALA n 
16 42   GLY n 
16 43   ILE n 
16 44   GLU n 
16 45   LYS n 
16 46   VAL n 
16 47   GLN n 
16 48   LYS n 
16 49   GLY n 
16 50   LEU n 
16 51   PHE n 
16 52   THR n 
16 53   TYR n 
16 54   SER n 
16 55   LEU n 
16 56   SER n 
16 57   PRO n 
16 58   TYR n 
16 59   SER n 
16 60   LEU n 
16 61   SER n 
16 62   PRO n 
16 63   VAL n 
16 64   SER n 
16 65   ASN n 
16 66   LYS n 
16 67   SER n 
16 68   GLN n 
16 69   LYS n 
16 70   LEU n 
16 71   LEU n 
16 72   ARG n 
16 73   SER n 
16 74   ARG n 
16 75   GLN n 
16 76   ILE n 
16 77   ALA n 
16 78   LYS n 
16 79   VAL n 
16 80   PRO n 
16 81   TYR n 
16 82   ARG n 
16 83   VAL n 
16 84   LEU n 
16 85   ASP n 
16 86   ALA n 
16 87   PRO n 
16 88   SER n 
16 89   LEU n 
16 90   ALA n 
16 91   ASP n 
16 92   ASP n 
16 93   PHE n 
16 94   TYR n 
16 95   TYR n 
16 96   SER n 
16 97   LEU n 
16 98   ILE n 
16 99   ASP n 
16 100  TRP n 
16 101  SER n 
16 102  SER n 
16 103  THR n 
16 104  ASP n 
16 105  VAL n 
16 106  LEU n 
16 107  ALA n 
16 108  VAL n 
16 109  ALA n 
16 110  LEU n 
16 111  GLY n 
16 112  LYS n 
16 113  SER n 
16 114  ILE n 
16 115  PHE n 
16 116  LEU n 
16 117  THR n 
16 118  ASP n 
16 119  ASN n 
16 120  ASN n 
16 121  THR n 
16 122  GLY n 
16 123  ASP n 
16 124  VAL n 
16 125  VAL n 
16 126  HIS n 
16 127  LEU n 
16 128  CYS n 
16 129  ASP n 
16 130  THR n 
16 131  GLU n 
16 132  ASN n 
16 133  GLU n 
16 134  TYR n 
16 135  THR n 
16 136  SER n 
16 137  LEU n 
16 138  SER n 
16 139  TRP n 
16 140  ILE n 
16 141  GLY n 
16 142  ALA n 
16 143  GLY n 
16 144  SER n 
16 145  HIS n 
16 146  LEU n 
16 147  ALA n 
16 148  VAL n 
16 149  GLY n 
16 150  GLN n 
16 151  ALA n 
16 152  ASN n 
16 153  GLY n 
16 154  LEU n 
16 155  VAL n 
16 156  GLU n 
16 157  ILE n 
16 158  TYR n 
16 159  ASP n 
16 160  VAL n 
16 161  MET n 
16 162  LYS n 
16 163  ARG n 
16 164  LYS n 
16 165  CYS n 
16 166  ILE n 
16 167  ARG n 
16 168  THR n 
16 169  LEU n 
16 170  SER n 
16 171  GLY n 
16 172  HIS n 
16 173  ILE n 
16 174  ASP n 
16 175  ARG n 
16 176  VAL n 
16 177  ALA n 
16 178  CYS n 
16 179  LEU n 
16 180  SER n 
16 181  TRP n 
16 182  ASN n 
16 183  ASN n 
16 184  HIS n 
16 185  VAL n 
16 186  LEU n 
16 187  THR n 
16 188  SER n 
16 189  GLY n 
16 190  SER n 
16 191  ARG n 
16 192  ASP n 
16 193  HIS n 
16 194  ARG n 
16 195  ILE n 
16 196  LEU n 
16 197  HIS n 
16 198  ARG n 
16 199  ASP n 
16 200  VAL n 
16 201  ARG n 
16 202  MET n 
16 203  PRO n 
16 204  ASP n 
16 205  PRO n 
16 206  PHE n 
16 207  PHE n 
16 208  GLU n 
16 209  THR n 
16 210  ILE n 
16 211  GLU n 
16 212  SER n 
16 213  HIS n 
16 214  THR n 
16 215  GLN n 
16 216  GLU n 
16 217  VAL n 
16 218  CYS n 
16 219  GLY n 
16 220  LEU n 
16 221  LYS n 
16 222  TRP n 
16 223  ASN n 
16 224  VAL n 
16 225  ALA n 
16 226  ASP n 
16 227  ASN n 
16 228  LYS n 
16 229  LEU n 
16 230  ALA n 
16 231  SER n 
16 232  GLY n 
16 233  GLY n 
16 234  ASN n 
16 235  ASP n 
16 236  ASN n 
16 237  VAL n 
16 238  VAL n 
16 239  HIS n 
16 240  VAL n 
16 241  TYR n 
16 242  GLU n 
16 243  GLY n 
16 244  THR n 
16 245  SER n 
16 246  LYS n 
16 247  SER n 
16 248  PRO n 
16 249  ILE n 
16 250  LEU n 
16 251  THR n 
16 252  PHE n 
16 253  ASP n 
16 254  GLU n 
16 255  HIS n 
16 256  LYS n 
16 257  ALA n 
16 258  ALA n 
16 259  VAL n 
16 260  LYS n 
16 261  ALA n 
16 262  MET n 
16 263  ALA n 
16 264  TRP n 
16 265  SER n 
16 266  PRO n 
16 267  HIS n 
16 268  LYS n 
16 269  ARG n 
16 270  GLY n 
16 271  VAL n 
16 272  LEU n 
16 273  ALA n 
16 274  THR n 
16 275  GLY n 
16 276  GLY n 
16 277  GLY n 
16 278  THR n 
16 279  ALA n 
16 280  ASP n 
16 281  ARG n 
16 282  ARG n 
16 283  LEU n 
16 284  LYS n 
16 285  ILE n 
16 286  TRP n 
16 287  ASN n 
16 288  VAL n 
16 289  ASN n 
16 290  THR n 
16 291  SER n 
16 292  ILE n 
16 293  LYS n 
16 294  MET n 
16 295  SER n 
16 296  ASP n 
16 297  ILE n 
16 298  ASP n 
16 299  SER n 
16 300  GLY n 
16 301  SER n 
16 302  GLN n 
16 303  ILE n 
16 304  CYS n 
16 305  ASN n 
16 306  MET n 
16 307  VAL n 
16 308  TRP n 
16 309  SER n 
16 310  LYS n 
16 311  ASN n 
16 312  THR n 
16 313  ASN n 
16 314  GLU n 
16 315  LEU n 
16 316  VAL n 
16 317  THR n 
16 318  SER n 
16 319  HIS n 
16 320  GLY n 
16 321  TYR n 
16 322  SER n 
16 323  LYS n 
16 324  TYR n 
16 325  ASN n 
16 326  LEU n 
16 327  THR n 
16 328  LEU n 
16 329  TRP n 
16 330  ASP n 
16 331  CYS n 
16 332  ASN n 
16 333  SER n 
16 334  MET n 
16 335  ASP n 
16 336  PRO n 
16 337  ILE n 
16 338  ALA n 
16 339  ILE n 
16 340  LEU n 
16 341  LYS n 
16 342  GLY n 
16 343  HIS n 
16 344  SER n 
16 345  PHE n 
16 346  ARG n 
16 347  VAL n 
16 348  LEU n 
16 349  HIS n 
16 350  LEU n 
16 351  THR n 
16 352  LEU n 
16 353  SER n 
16 354  ASN n 
16 355  ASP n 
16 356  GLY n 
16 357  THR n 
16 358  THR n 
16 359  VAL n 
16 360  VAL n 
16 361  SER n 
16 362  GLY n 
16 363  ALA n 
16 364  GLY n 
16 365  ASP n 
16 366  GLU n 
16 367  THR n 
16 368  LEU n 
16 369  ARG n 
16 370  TYR n 
16 371  TRP n 
16 372  LYS n 
16 373  LEU n 
16 374  PHE n 
16 375  ASP n 
16 376  VAL n 
16 377  SER n 
16 378  VAL n 
16 379  LEU n 
16 380  ASN n 
16 381  LEU n 
16 382  PHE n 
16 383  THR n 
16 384  ARG n 
16 385  ILE n 
16 386  ARG n 
17 1    UNK n 
17 2    UNK n 
17 3    UNK n 
17 4    UNK n 
17 5    UNK n 
17 6    GLN n 
17 7    LEU n 
17 8    UNK n 
17 9    UNK n 
17 10   UNK n 
17 11   UNK n 
17 12   UNK n 
17 13   UNK n 
17 14   UNK n 
17 15   UNK n 
17 16   UNK n 
17 17   UNK n 
17 18   UNK n 
17 19   UNK n 
17 20   UNK n 
17 21   UNK n 
18 1    UNK n 
18 2    UNK n 
18 3    UNK n 
18 4    UNK n 
18 5    UNK n 
18 6    UNK n 
18 7    UNK n 
18 8    UNK n 
18 9    UNK n 
18 10   UNK n 
18 11   UNK n 
18 12   UNK n 
18 13   UNK n 
18 14   UNK n 
18 15   UNK n 
18 16   UNK n 
18 17   UNK n 
18 18   UNK n 
18 19   UNK n 
18 20   UNK n 
18 21   UNK n 
18 22   UNK n 
18 23   UNK n 
18 24   UNK n 
19 1    ALA n 
19 2    ALA n 
19 3    PHE n 
19 4    ARG n 
19 5    ILE n 
19 6    ALA n 
19 7    LEU n 
19 8    LYS n 
19 9    SER n 
19 10   VAL n 
19 11   GLN n 
19 12   LYS n 
19 13   SER n 
20 1    MET n 
20 2    ASP n 
20 3    PRO n 
20 4    GLY n 
20 5    ASP n 
20 6    ALA n 
20 7    ALA n 
20 8    ILE n 
20 9    LEU n 
20 10   GLU n 
20 11   SER n 
20 12   SER n 
20 13   LEU n 
20 14   ARG n 
20 15   ILE n 
20 16   LEU n 
20 17   TYR n 
20 18   ARG n 
20 19   LEU n 
20 20   PHE n 
20 21   GLU n 
20 22   SER n 
20 23   VAL n 
20 24   LEU n 
20 25   PRO n 
20 26   PRO n 
20 27   LEU n 
20 28   PRO n 
20 29   ALA n 
20 30   ALA n 
20 31   LEU n 
20 32   GLN n 
20 33   SER n 
20 34   ARG n 
20 35   MET n 
20 36   ASN n 
20 37   VAL n 
20 38   ILE n 
20 39   ASP n 
20 40   HIS n 
20 41   VAL n 
20 42   ARG n 
20 43   ASP n 
20 44   MET n 
20 45   ALA n 
20 46   ALA n 
20 47   ALA n 
20 48   GLY n 
20 49   LEU n 
20 50   HIS n 
20 51   SER n 
20 52   ASN n 
20 53   VAL n 
20 54   ARG n 
20 55   LEU n 
20 56   LEU n 
20 57   SER n 
20 58   SER n 
20 59   LEU n 
20 60   LEU n 
20 61   LEU n 
20 62   THR n 
20 63   LEU n 
20 64   SER n 
20 65   ASN n 
20 66   ASN n 
20 67   ASN n 
20 68   PRO n 
20 69   GLU n 
20 70   LEU n 
20 71   PHE n 
20 72   SER n 
20 73   PRO n 
20 74   PRO n 
20 75   GLN n 
20 76   LYS n 
20 77   TYR n 
20 78   GLN n 
20 79   LEU n 
20 80   LEU n 
20 81   VAL n 
20 82   TYR n 
20 83   HIS n 
20 84   ALA n 
20 85   ASP n 
20 86   SER n 
20 87   LEU n 
20 88   PHE n 
20 89   HIS n 
20 90   ASP n 
20 91   LYS n 
20 92   GLU n 
20 93   TYR n 
20 94   ARG n 
20 95   ASN n 
20 96   ALA n 
20 97   VAL n 
20 98   SER n 
20 99   LYS n 
20 100  TYR n 
20 101  THR n 
20 102  MET n 
20 103  ALA n 
20 104  LEU n 
20 105  GLN n 
20 106  GLN n 
20 107  LYS n 
20 108  LYS n 
20 109  ALA n 
20 110  LEU n 
20 111  SER n 
20 112  LYS n 
20 113  THR n 
20 114  SER n 
20 115  LYS n 
20 116  VAL n 
20 117  ARG n 
20 118  PRO n 
20 119  SER n 
20 120  THR n 
20 121  GLY n 
20 122  ASN n 
20 123  SER n 
20 124  ALA n 
20 125  SER n 
20 126  THR n 
20 127  PRO n 
20 128  GLN n 
20 129  SER n 
20 130  GLN n 
20 131  CYS n 
20 132  LEU n 
20 133  PRO n 
20 134  SER n 
20 135  GLU n 
20 136  ILE n 
20 137  GLU n 
20 138  VAL n 
20 139  LYS n 
20 140  TYR n 
20 141  LYS n 
20 142  LEU n 
20 143  ALA n 
20 144  GLU n 
20 145  CYS n 
20 146  TYR n 
20 147  THR n 
20 148  VAL n 
20 149  LEU n 
20 150  LYS n 
20 151  GLN n 
20 152  ASP n 
20 153  LYS n 
20 154  ASP n 
20 155  ALA n 
20 156  ILE n 
20 157  ALA n 
20 158  ILE n 
20 159  LEU n 
20 160  ASP n 
20 161  GLY n 
20 162  ILE n 
20 163  PRO n 
20 164  SER n 
20 165  ARG n 
20 166  GLN n 
20 167  ARG n 
20 168  THR n 
20 169  PRO n 
20 170  LYS n 
20 171  ILE n 
20 172  ASN n 
20 173  MET n 
20 174  MET n 
20 175  LEU n 
20 176  ALA n 
20 177  ASN n 
20 178  LEU n 
20 179  TYR n 
20 180  LYS n 
20 181  LYS n 
20 182  ALA n 
20 183  GLY n 
20 184  GLN n 
20 185  GLU n 
20 186  ARG n 
20 187  PRO n 
20 188  SER n 
20 189  VAL n 
20 190  THR n 
20 191  SER n 
20 192  TYR n 
20 193  LYS n 
20 194  GLU n 
20 195  VAL n 
20 196  LEU n 
20 197  ARG n 
20 198  GLN n 
20 199  CYS n 
20 200  PRO n 
20 201  LEU n 
20 202  ALA n 
20 203  LEU n 
20 204  ASP n 
20 205  ALA n 
20 206  ILE n 
20 207  LEU n 
20 208  GLY n 
20 209  LEU n 
20 210  LEU n 
20 211  SER n 
20 212  LEU n 
20 213  SER n 
20 214  VAL n 
20 215  LYS n 
20 216  GLY n 
20 217  ALA n 
20 218  GLU n 
20 219  VAL n 
20 220  ALA n 
20 221  SER n 
20 222  MET n 
20 223  THR n 
20 224  MET n 
20 225  ASN n 
20 226  VAL n 
20 227  ILE n 
20 228  GLN n 
20 229  THR n 
20 230  VAL n 
20 231  PRO n 
20 232  ASN n 
20 233  LEU n 
20 234  ASP n 
20 235  TRP n 
20 236  LEU n 
20 237  SER n 
20 238  VAL n 
20 239  TRP n 
20 240  ILE n 
20 241  LYS n 
20 242  ALA n 
20 243  TYR n 
20 244  ALA n 
20 245  PHE n 
20 246  VAL n 
20 247  HIS n 
20 248  THR n 
20 249  GLY n 
20 250  ASP n 
20 251  ASN n 
20 252  SER n 
20 253  ARG n 
20 254  ALA n 
20 255  ILE n 
20 256  SER n 
20 257  THR n 
20 258  ILE n 
20 259  CYS n 
20 260  SER n 
20 261  LEU n 
20 262  GLU n 
20 263  LYS n 
20 264  LYS n 
20 265  SER n 
20 266  LEU n 
20 267  LEU n 
20 268  ARG n 
20 269  ASP n 
20 270  ASN n 
20 271  VAL n 
20 272  ASP n 
20 273  LEU n 
20 274  LEU n 
20 275  GLY n 
20 276  SER n 
20 277  LEU n 
20 278  ALA n 
20 279  ASP n 
20 280  LEU n 
20 281  TYR n 
20 282  PHE n 
20 283  ARG n 
20 284  ALA n 
20 285  GLY n 
20 286  ASP n 
20 287  ASN n 
20 288  LYS n 
20 289  ASN n 
20 290  SER n 
20 291  VAL n 
20 292  LEU n 
20 293  LYS n 
20 294  PHE n 
20 295  GLU n 
20 296  GLN n 
20 297  ALA n 
20 298  GLN n 
20 299  MET n 
20 300  LEU n 
20 301  ASP n 
20 302  PRO n 
20 303  TYR n 
20 304  LEU n 
20 305  ILE n 
20 306  LYS n 
20 307  GLY n 
20 308  MET n 
20 309  ASP n 
20 310  VAL n 
20 311  TYR n 
20 312  GLY n 
20 313  TYR n 
20 314  LEU n 
20 315  LEU n 
20 316  ALA n 
20 317  ARG n 
20 318  GLU n 
20 319  GLY n 
20 320  ARG n 
20 321  LEU n 
20 322  GLU n 
20 323  ASP n 
20 324  VAL n 
20 325  GLU n 
20 326  ASN n 
20 327  LEU n 
20 328  GLY n 
20 329  CYS n 
20 330  ARG n 
20 331  LEU n 
20 332  PHE n 
20 333  ASN n 
20 334  ILE n 
20 335  SER n 
20 336  ASP n 
20 337  GLN n 
20 338  HIS n 
20 339  ALA n 
20 340  GLU n 
20 341  PRO n 
20 342  TRP n 
20 343  VAL n 
20 344  VAL n 
20 345  SER n 
20 346  GLY n 
20 347  CYS n 
20 348  HIS n 
20 349  SER n 
20 350  PHE n 
20 351  TYR n 
20 352  SER n 
20 353  LYS n 
20 354  ARG n 
20 355  TYR n 
20 356  SER n 
20 357  ARG n 
20 358  ALA n 
20 359  LEU n 
20 360  TYR n 
20 361  LEU n 
20 362  GLY n 
20 363  ALA n 
20 364  LYS n 
20 365  ALA n 
20 366  ILE n 
20 367  GLN n 
20 368  LEU n 
20 369  ASN n 
20 370  SER n 
20 371  ASN n 
20 372  SER n 
20 373  VAL n 
20 374  GLN n 
20 375  ALA n 
20 376  LEU n 
20 377  LEU n 
20 378  LEU n 
20 379  LYS n 
20 380  GLY n 
20 381  ALA n 
20 382  ALA n 
20 383  LEU n 
20 384  ARG n 
20 385  ASN n 
20 386  MET n 
20 387  GLY n 
20 388  ARG n 
20 389  VAL n 
20 390  GLN n 
20 391  GLU n 
20 392  ALA n 
20 393  ILE n 
20 394  ILE n 
20 395  HIS n 
20 396  PHE n 
20 397  ARG n 
20 398  GLU n 
20 399  ALA n 
20 400  ILE n 
20 401  ARG n 
20 402  LEU n 
20 403  ALA n 
20 404  PRO n 
20 405  CYS n 
20 406  ARG n 
20 407  LEU n 
20 408  ASP n 
20 409  CYS n 
20 410  TYR n 
20 411  GLU n 
20 412  GLY n 
20 413  LEU n 
20 414  ILE n 
20 415  GLU n 
20 416  CYS n 
20 417  TYR n 
20 418  LEU n 
20 419  ALA n 
20 420  SER n 
20 421  ASN n 
20 422  SER n 
20 423  ILE n 
20 424  ARG n 
20 425  GLU n 
20 426  ALA n 
20 427  MET n 
20 428  VAL n 
20 429  MET n 
20 430  ALA n 
20 431  ASN n 
20 432  ASN n 
20 433  VAL n 
20 434  TYR n 
20 435  LYS n 
20 436  THR n 
20 437  LEU n 
20 438  GLY n 
20 439  ALA n 
20 440  ASN n 
20 441  ALA n 
20 442  GLN n 
20 443  THR n 
20 444  LEU n 
20 445  THR n 
20 446  LEU n 
20 447  LEU n 
20 448  ALA n 
20 449  THR n 
20 450  VAL n 
20 451  CYS n 
20 452  LEU n 
20 453  GLU n 
20 454  ASP n 
20 455  PRO n 
20 456  VAL n 
20 457  THR n 
20 458  GLN n 
20 459  GLU n 
20 460  LYS n 
20 461  ALA n 
20 462  LYS n 
20 463  THR n 
20 464  LEU n 
20 465  LEU n 
20 466  ASN n 
20 467  LYS n 
20 468  ALA n 
20 469  LEU n 
20 470  THR n 
20 471  GLN n 
20 472  GLU n 
20 473  PRO n 
20 474  ASP n 
20 475  TYR n 
20 476  ILE n 
20 477  LYS n 
20 478  ALA n 
20 479  VAL n 
20 480  VAL n 
20 481  LYS n 
20 482  LYS n 
20 483  ALA n 
20 484  GLU n 
20 485  LEU n 
20 486  LEU n 
20 487  SER n 
20 488  ARG n 
20 489  GLU n 
20 490  GLN n 
20 491  LYS n 
20 492  TYR n 
20 493  GLU n 
20 494  ASP n 
20 495  GLY n 
20 496  ILE n 
20 497  ALA n 
20 498  LEU n 
20 499  LEU n 
20 500  ARG n 
20 501  ASN n 
20 502  ALA n 
20 503  LEU n 
20 504  ALA n 
20 505  ASN n 
20 506  GLN n 
20 507  SER n 
20 508  ASP n 
20 509  CYS n 
20 510  VAL n 
20 511  LEU n 
20 512  HIS n 
20 513  ARG n 
20 514  ILE n 
20 515  LEU n 
20 516  GLY n 
20 517  ASP n 
20 518  PHE n 
20 519  LEU n 
20 520  VAL n 
20 521  ALA n 
20 522  VAL n 
20 523  ASN n 
20 524  GLU n 
20 525  TYR n 
20 526  GLN n 
20 527  GLU n 
20 528  ALA n 
20 529  MET n 
20 530  ASP n 
20 531  GLN n 
20 532  TYR n 
20 533  SER n 
20 534  ILE n 
20 535  ALA n 
20 536  LEU n 
20 537  SER n 
20 538  LEU n 
20 539  ASP n 
20 540  PRO n 
20 541  ASN n 
20 542  ASP n 
20 543  GLN n 
20 544  LYS n 
20 545  SER n 
20 546  LEU n 
20 547  GLU n 
20 548  GLY n 
20 549  MET n 
20 550  GLN n 
20 551  LYS n 
20 552  MET n 
20 553  GLU n 
20 554  LYS n 
20 555  GLU n 
20 556  GLU n 
20 557  SER n 
20 558  PRO n 
20 559  THR n 
20 560  ASP n 
20 561  ALA n 
20 562  THR n 
20 563  GLN n 
20 564  GLU n 
20 565  GLU n 
20 566  ASP n 
20 567  VAL n 
20 568  ASP n 
20 569  ASP n 
20 570  MET n 
20 571  GLU n 
20 572  GLY n 
20 573  SER n 
20 574  GLY n 
20 575  GLU n 
20 576  GLU n 
20 577  GLY n 
20 578  ASP n 
20 579  LEU n 
20 580  GLU n 
20 581  GLY n 
20 582  SER n 
20 583  ASP n 
20 584  SER n 
20 585  GLU n 
20 586  ALA n 
20 587  ALA n 
20 588  GLN n 
20 589  TRP n 
20 590  ALA n 
20 591  ASP n 
20 592  GLN n 
20 593  GLU n 
20 594  GLN n 
20 595  TRP n 
20 596  PHE n 
20 597  GLY n 
20 598  MET n 
20 599  GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1  1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'CABBAGE LOOPER' 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  PDB 5A31        1  ? ? 5A31   ? 
2  UNP APC11_HUMAN 2  ? ? Q9NYG5 ? 
3  UNP CDC23_HUMAN 3  ? ? Q9UJX2 ? 
4  UNP APC15_HUMAN 4  ? ? P60006 ? 
5  UNP APC16_HUMAN 5  ? ? Q96DE5 ? 
6  UNP CDC27_HUMAN 6  ? ? P30260 ? 
7  UNP CDC26_HUMAN 7  ? ? Q8NHZ8 ? 
8  UNP APC4_HUMAN  8  ? ? Q9UJX5 ? 
9  UNP CDC16_HUMAN 9  ? ? Q13042 ? 
10 UNP CDC16_HUMAN 10 ? ? Q13042 ? 
11 UNP APC10_HUMAN 11 ? ? Q9UM13 ? 
12 UNP APC13_BOVIN 12 ? ? Q2NKV2 ? 
13 PDB 5A31        13 ? ? 5A31   ? 
14 UNP APC5_HUMAN  14 ? ? Q9UJX4 ? 
15 PDB 5A31        15 ? ? 5A31   ? 
16 PDB 5A31        16 ? ? 5A31   ? 
17 PDB 5A31        17 ? ? 5A31   ? 
18 PDB 5A31        18 ? ? 5A31   ? 
19 PDB 5A31        19 ? ? 5A31   ? 
20 UNP APC7_HUMAN  20 ? ? Q9UJX3 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5A31 A 1 ? 1441 ? 5A31   11  ? 1934 ? 11  1934 
2  2  5A31 B 1 ? 84   ? Q9NYG5 1   ? 84   ? 1   84   
3  3  5A31 C 1 ? 597  ? Q9UJX2 1   ? 597  ? 1   597  
4  4  5A31 D 6 ? 121  ? P60006 6   ? 121  ? 6   121  
5  5  5A31 E 1 ? 110  ? Q96DE5 1   ? 110  ? 1   110  
6  6  5A31 F 1 ? 824  ? P30260 1   ? 824  ? 1   824  
7  7  5A31 G 1 ? 85   ? Q8NHZ8 1   ? 85   ? 1   85   
8  6  5A31 H 1 ? 824  ? P30260 1   ? 824  ? 1   824  
9  8  5A31 I 1 ? 808  ? Q9UJX5 1   ? 808  ? 1   808  
10 9  5A31 J 1 ? 620  ? Q13042 1   ? 620  ? 1   620  
11 10 5A31 K 1 ? 620  ? Q13042 1   ? 620  ? 1   620  
12 11 5A31 L 1 ? 185  ? Q9UM13 1   ? 185  ? 1   184  
13 12 5A31 M 1 ? 74   ? Q2NKV2 1   ? 74   ? 1   74   
14 13 5A31 N 1 ? 703  ? 5A31   15  ? 818  ? 15  818  
15 14 5A31 O 1 ? 755  ? Q9UJX4 1   ? 755  ? 1   755  
16 3  5A31 P 1 ? 597  ? Q9UJX2 1   ? 597  ? 1   597  
17 15 5A31 Q 1 ? 162  ? 5A31   29  ? 288  ? 29  288  
18 16 5A31 R 1 ? 386  ? 5A31   42  ? 493  ? 42  493  
19 17 5A31 T 1 ? 21   ? 5A31   1   ? 21   ? 1   21   
20 18 5A31 U 1 ? 24   ? 5A31   5   ? 28   ? 5   28   
21 19 5A31 V 1 ? 13   ? 5A31   319 ? 331  ? 319 331  
22 7  5A31 W 1 ? 85   ? Q8NHZ8 1   ? 85   ? 1   85   
23 20 5A31 X 1 ? 599  ? Q9UJX3 1   ? 599  ? 1   599  
24 20 5A31 Y 1 ? 599  ? Q9UJX3 1   ? 599  ? 1   599  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2  5A31 LEU B 13  ? UNP Q9NYG5 THR 13  conflict         13  1  
3  5A31 LEU C 161 ? UNP Q9UJX2 LYS 161 conflict         161 2  
4  5A31 MET D 1   ? UNP P60006 ?   ?   'expression tag' 1   3  
4  5A31 SER D 2   ? UNP P60006 ?   ?   'expression tag' 2   4  
4  5A31 THR D 3   ? UNP P60006 ?   ?   'expression tag' 3   5  
4  5A31 LEU D 4   ? UNP P60006 ?   ?   'expression tag' 4   6  
4  5A31 TYR D 5   ? UNP P60006 ?   ?   'expression tag' 5   7  
6  5A31 SER F 475 ? UNP P30260 ALA 475 conflict         475 8  
6  5A31 SER F 484 ? UNP P30260 ALA 484 conflict         484 9  
8  5A31 SER H 475 ? UNP P30260 ALA 475 conflict         475 10 
8  5A31 SER H 484 ? UNP P30260 ALA 484 conflict         484 11 
9  5A31 ASP I 430 ? UNP Q9UJX5 GLU 430 conflict         430 12 
10 5A31 ASN J 225 ? UNP Q13042 ASP 225 conflict         225 13 
10 5A31 GLU J 228 ? UNP Q13042 GLN 228 conflict         228 14 
10 5A31 LYS J 229 ? UNP Q13042 GLU 229 conflict         229 15 
10 5A31 ALA J 347 ? UNP Q13042 GLU 347 conflict         347 16 
10 5A31 ALA J 524 ? UNP Q13042 GLU 524 conflict         524 17 
11 5A31 GLU K 228 ? UNP Q13042 GLN 228 conflict         228 18 
11 5A31 LYS K 229 ? UNP Q13042 GLU 229 conflict         229 19 
11 5A31 LYS K 265 ? UNP Q13042 ALA 265 conflict         265 20 
15 5A31 SER O 42  ? UNP Q9UJX4 ASN 42  conflict         42  21 
15 5A31 VAL O 55  ? UNP Q9UJX4 MET 55  conflict         55  22 
15 5A31 GLN O 63  ? UNP Q9UJX4 LEU 63  conflict         63  23 
15 5A31 VAL O 75  ? UNP Q9UJX4 LEU 75  conflict         75  24 
15 5A31 LEU O 79  ? UNP Q9UJX4 TYR 79  conflict         79  25 
15 5A31 SER O 164 ? UNP Q9UJX4 ASN 164 conflict         164 26 
15 5A31 ASP O 165 ? UNP Q9UJX4 GLY 165 conflict         165 27 
15 5A31 ASN O 167 ? UNP Q9UJX4 LYS 167 conflict         167 28 
16 5A31 LEU P 161 ? UNP Q9UJX2 LYS 161 conflict         161 29 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking' . UNKNOWN         ? 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          5A31 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 5A31 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            4.30 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        67667 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               67670 
_refine_hist.d_res_high                       4.30 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  5A31 
_struct.title                     'Structure of the human APC-Cdh1-Hsl1-UbcH10 complex.' 
_struct.pdbx_descriptor           
;ANAPHASE-PROMOTING COMPLEX SUBUNIT 1, ANAPHASE-PROMOTING COMPLEX SUBUNIT 11, CELL DIVISION CYCLE PROTEIN 23 HOMOLOG, ANAPHASE-PROMOTING COMPLEX SUBUNIT 15, ANAPHASE-PROMOTING COMPLEX SUBUNIT 16, ANAPHASE-PROMOTING COMPLEX SUBUNIT 3, ANAPHASE-PROMOTING COMPLEX SUBUNIT CDC26, ANAPHASE-PROMOTING COMPLEX SUBUNIT 4, ANAPHASE-PROMOTING COMPLEX SUBUNIT 6, ANAPHASE-PROMOTING COMPLEX SUBUNIT 10, ANAPHASE-PROMOTING COMPLEX SUBUNIT 13, ANAPHASE-PROMOTING COMPLEX SUBUNIT 2, ANAPHASE-PROMOTING COMPLEX SUBUNIT 5, FUSION PROTEIN - UBIQUITIN-CONJUGATING ENZYME E2 C, UBIQUITIN-CONJUGATING ENZYME E2 S (E.C.2.3.2.23, 2.3.2.24, 2.3.2.23), THE ANAPHASE-PROMOTING COMPLEX CHAIN R, THE ANAPHASE-PROMOTING COMPLEX CHAIN T, THE ANAPHASE-PROMOTING COMPLEX CHAIN U, THE ANAPHASE-PROMOTING COMPLEX CHAIN V, ANAPHASE-PROMOTING COMPLEX SUBUNIT 7
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5A31 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            'UBIQUITINATION, CELL CYCLE, APC/C' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 6  ? 
I  N N 8  ? 
J  N N 9  ? 
K  N N 10 ? 
L  N N 11 ? 
M  N N 12 ? 
N  N N 13 ? 
O  N N 14 ? 
P  N N 3  ? 
Q  N N 15 ? 
R  N N 16 ? 
S  N N 17 ? 
T  N N 18 ? 
U  N N 19 ? 
V  N N 7  ? 
W  N N 20 ? 
X  N N 20 ? 
Y  N N 21 ? 
Z  N N 21 ? 
AA N N 21 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   PRO A 12   ? HIS A 21   ? PRO A 22   HIS A 31   1 ? 10 
HELX_P HELX_P2   2   UNK A 230  ? UNK A 240  ? UNK A 285  UNK A 295  1 ? 11 
HELX_P HELX_P3   3   SER A 374  ? LEU A 388  ? SER A 615  LEU A 629  1 ? 15 
HELX_P HELX_P4   4   LYS A 390  ? ALA A 406  ? LYS A 631  ALA A 647  1 ? 17 
HELX_P HELX_P5   5   SER A 414  ? MET A 426  ? SER A 655  MET A 667  1 ? 13 
HELX_P HELX_P6   6   HIS A 431  ? THR A 450  ? HIS A 758  THR A 777  1 ? 20 
HELX_P HELX_P7   7   GLU A 454  ? LYS A 471  ? GLU A 781  LYS A 798  1 ? 18 
HELX_P HELX_P8   8   GLY A 473  ? TYR A 483  ? GLY A 800  TYR A 810  1 ? 11 
HELX_P HELX_P9   9   SER A 492  ? GLY A 503  ? SER A 843  GLY A 854  1 ? 12 
HELX_P HELX_P10  10  CYS A 516  ? LEU A 531  ? CYS A 867  LEU A 882  1 ? 16 
HELX_P HELX_P11  11  SER A 532  ? VAL A 545  ? SER A 924  VAL A 937  1 ? 14 
HELX_P HELX_P12  12  ARG A 550  ? THR A 554  ? ARG A 942  THR A 946  5 ? 5  
HELX_P HELX_P13  13  PRO A 556  ? GLN A 573  ? PRO A 948  GLN A 965  1 ? 18 
HELX_P HELX_P14  14  PRO A 579  ? ILE A 586  ? PRO A 971  ILE A 978  1 ? 8  
HELX_P HELX_P15  15  ARG A 588  ? SER A 592  ? ARG A 980  SER A 984  5 ? 5  
HELX_P HELX_P16  16  ASN A 602  ? TRP A 610  ? ASN A 1020 TRP A 1028 1 ? 9  
HELX_P HELX_P17  17  LEU A 614  ? LEU A 623  ? LEU A 1032 LEU A 1041 1 ? 10 
HELX_P HELX_P18  18  SER A 640  ? THR A 670  ? SER A 1058 THR A 1088 1 ? 31 
HELX_P HELX_P19  19  THR A 714  ? LYS A 728  ? THR A 1132 LYS A 1146 1 ? 15 
HELX_P HELX_P20  20  ASP A 736  ? ASN A 743  ? ASP A 1154 ASN A 1161 1 ? 8  
HELX_P HELX_P21  21  LEU A 750  ? GLY A 765  ? LEU A 1168 GLY A 1183 1 ? 16 
HELX_P HELX_P22  22  HIS A 766  ? LEU A 770  ? HIS A 1184 LEU A 1188 5 ? 5  
HELX_P HELX_P23  23  ALA A 771  ? GLY A 782  ? ALA A 1189 GLY A 1200 1 ? 12 
HELX_P HELX_P24  24  HIS A 783  ? LEU A 799  ? HIS A 1201 LEU A 1217 1 ? 17 
HELX_P HELX_P25  25  ASP A 803  ? ILE A 814  ? ASP A 1221 ILE A 1232 1 ? 12 
HELX_P HELX_P26  26  PRO A 828  ? TYR A 843  ? PRO A 1246 TYR A 1261 1 ? 16 
HELX_P HELX_P27  27  HIS A 848  ? GLY A 860  ? HIS A 1266 GLY A 1278 1 ? 13 
HELX_P HELX_P28  28  ASP A 872  ? LEU A 889  ? ASP A 1290 LEU A 1307 1 ? 18 
HELX_P HELX_P29  29  ASN A 902  ? GLY A 913  ? ASN A 1320 GLY A 1331 1 ? 12 
HELX_P HELX_P30  30  ASN A 928  ? TYR A 944  ? ASN A 1359 TYR A 1375 1 ? 17 
HELX_P HELX_P31  31  ASN A 949  ? LEU A 956  ? ASN A 1380 LEU A 1387 1 ? 8  
HELX_P HELX_P32  32  THR A 961  ? VAL A 968  ? THR A 1392 VAL A 1399 1 ? 8  
HELX_P HELX_P33  33  LYS A 969  ? LEU A 984  ? LYS A 1400 LEU A 1415 1 ? 16 
HELX_P HELX_P34  34  ASN A 991  ? VAL A 999  ? ASN A 1422 VAL A 1430 1 ? 9  
HELX_P HELX_P35  35  PRO A 1000 ? ASN A 1006 ? PRO A 1431 ASN A 1437 1 ? 7  
HELX_P HELX_P36  36  ASN A 1008 ? PHE A 1031 ? ASN A 1453 PHE A 1476 1 ? 24 
HELX_P HELX_P37  37  ASN A 1036 ? SER A 1055 ? ASN A 1481 SER A 1500 1 ? 20 
HELX_P HELX_P38  38  ASN A 1058 ? GLY A 1063 ? ASN A 1503 GLY A 1508 1 ? 6  
HELX_P HELX_P39  39  GLY A 1063 ? MET A 1082 ? GLY A 1508 MET A 1527 1 ? 20 
HELX_P HELX_P40  40  ASN A 1087 ? THR A 1101 ? ASN A 1532 THR A 1546 1 ? 15 
HELX_P HELX_P41  41  ASN A 1106 ? PHE A 1121 ? ASN A 1551 PHE A 1566 1 ? 16 
HELX_P HELX_P42  42  ASN A 1133 ? LEU A 1143 ? ASN A 1578 LEU A 1588 1 ? 11 
HELX_P HELX_P43  43  LEU A 1158 ? HIS A 1163 ? LEU A 1603 HIS A 1608 5 ? 6  
HELX_P HELX_P44  44  LEU A 1164 ? ALA A 1168 ? LEU A 1609 ALA A 1613 1 ? 5  
HELX_P HELX_P45  45  THR A 1236 ? LYS A 1245 ? THR A 1684 LYS A 1693 1 ? 10 
HELX_P HELX_P46  46  ASP A 1277 ? CYS A 1288 ? ASP A 1744 CYS A 1755 1 ? 12 
HELX_P HELX_P47  47  LYS A 1297 ? GLN A 1314 ? LYS A 1764 GLN A 1781 1 ? 18 
HELX_P HELX_P48  48  GLU A 1318 ? ARG A 1336 ? GLU A 1785 ARG A 1803 1 ? 19 
HELX_P HELX_P49  49  THR A 1341 ? SER A 1355 ? THR A 1808 SER A 1822 1 ? 15 
HELX_P HELX_P50  50  PHE A 1366 ? GLY A 1385 ? PHE A 1844 GLY A 1863 1 ? 20 
HELX_P HELX_P51  51  GLY A 1386 ? SER A 1395 ? GLY A 1864 SER A 1873 1 ? 10 
HELX_P HELX_P52  52  LEU A 1397 ? SER A 1412 ? LEU A 1878 SER A 1893 1 ? 16 
HELX_P HELX_P53  53  UNK A 1417 ? UNK A 1427 ? UNK A 1910 UNK A 1920 1 ? 11 
HELX_P HELX_P54  54  UNK A 1431 ? UNK A 1441 ? UNK A 1924 UNK A 1934 1 ? 11 
HELX_P HELX_P55  55  MET B 57   ? GLN B 68   ? MET B 57   GLN B 68   1 ? 12 
HELX_P HELX_P56  56  ASP C 28   ? GLY C 47   ? ASP C 28   GLY C 47   1 ? 20 
HELX_P HELX_P57  57  LEU C 48   ? LEU C 62   ? LEU C 48   LEU C 62   1 ? 15 
HELX_P HELX_P58  58  THR C 77   ? LYS C 97   ? THR C 77   LYS C 97   1 ? 21 
HELX_P HELX_P59  59  GLU C 98   ? HIS C 107  ? GLU C 98   HIS C 107  1 ? 10 
HELX_P HELX_P60  60  SER C 111  ? SER C 137  ? SER C 111  SER C 137  1 ? 27 
HELX_P HELX_P61  61  ALA C 150  ? ARG C 165  ? ALA C 150  ARG C 165  1 ? 16 
HELX_P HELX_P62  62  GLY C 169  ? LEU C 182  ? GLY C 169  LEU C 182  1 ? 14 
HELX_P HELX_P63  63  LEU C 184  ? LEU C 199  ? LEU C 184  LEU C 199  1 ? 16 
HELX_P HELX_P64  64  HIS C 202  ? ILE C 213  ? HIS C 202  ILE C 213  1 ? 12 
HELX_P HELX_P65  65  ASP C 215  ? LEU C 222  ? ASP C 215  LEU C 222  1 ? 8  
HELX_P HELX_P66  66  TRP C 228  ? GLN C 242  ? TRP C 228  GLN C 242  1 ? 15 
HELX_P HELX_P67  67  LEU C 243  ? VAL C 257  ? LEU C 243  VAL C 257  1 ? 15 
HELX_P HELX_P68  68  SER C 262  ? ARG C 277  ? SER C 262  ARG C 277  1 ? 16 
HELX_P HELX_P69  69  ASP C 278  ? ASP C 293  ? ASP C 278  ASP C 293  1 ? 16 
HELX_P HELX_P70  70  ASN C 299  ? ARG C 310  ? ASN C 299  ARG C 310  1 ? 12 
HELX_P HELX_P71  71  MET C 312  ? ASP C 327  ? MET C 312  ASP C 327  1 ? 16 
HELX_P HELX_P72  72  ARG C 330  ? SER C 345  ? ARG C 330  SER C 345  1 ? 16 
HELX_P HELX_P73  73  GLN C 346  ? ASN C 361  ? GLN C 346  ASN C 361  1 ? 16 
HELX_P HELX_P74  74  LEU C 365  ? MET C 378  ? LEU C 365  MET C 378  1 ? 14 
HELX_P HELX_P75  75  ASN C 380  ? ASN C 395  ? ASN C 380  ASN C 395  1 ? 16 
HELX_P HELX_P76  76  ASP C 398  ? LEU C 412  ? ASP C 398  LEU C 412  1 ? 15 
HELX_P HELX_P77  77  MET C 414  ? ARG C 429  ? MET C 414  ARG C 429  1 ? 16 
HELX_P HELX_P78  78  ASP C 432  ? ASN C 447  ? ASP C 432  ASN C 447  1 ? 16 
HELX_P HELX_P79  79  GLN C 448  ? GLY C 463  ? GLN C 448  GLY C 463  1 ? 16 
HELX_P HELX_P80  80  MET C 468  ? LEU C 480  ? MET C 468  LEU C 480  1 ? 13 
HELX_P HELX_P81  81  SER C 483  ? CYS C 500  ? SER C 483  CYS C 500  1 ? 18 
HELX_P HELX_P82  82  GLU C 509  ? CYS C 523  ? GLU C 509  CYS C 523  1 ? 15 
HELX_P HELX_P83  83  LEU C 525  ? ASN C 540  ? LEU C 525  ASN C 540  1 ? 16 
HELX_P HELX_P84  84  ARG C 543  ? ARG C 557  ? ARG C 543  ARG C 557  1 ? 15 
HELX_P HELX_P85  85  VAL D 25   ? GLU D 46   ? VAL D 25   GLU D 46   1 ? 22 
HELX_P HELX_P86  86  ARG E 52   ? ASP E 92   ? ARG E 52   ASP E 92   1 ? 41 
HELX_P HELX_P87  87  PRO E 98   ? LEU E 103  ? PRO E 98   LEU E 103  1 ? 6  
HELX_P HELX_P88  88  GLU F 6    ? HIS F 18   ? GLU F 6    HIS F 18   1 ? 13 
HELX_P HELX_P89  89  ALA F 20   ? HIS F 36   ? ALA F 20   HIS F 36   1 ? 17 
HELX_P HELX_P90  90  SER F 37   ? SER F 51   ? SER F 37   SER F 51   1 ? 15 
HELX_P HELX_P91  91  LYS F 53   ? HIS F 64   ? LYS F 53   HIS F 64   1 ? 12 
HELX_P HELX_P92  92  THR F 68   ? LEU F 82   ? THR F 68   LEU F 82   1 ? 15 
HELX_P HELX_P93  93  LYS F 84   ? GLY F 94   ? LYS F 84   GLY F 94   1 ? 11 
HELX_P HELX_P94  94  HIS F 103  ? GLY F 111  ? HIS F 103  GLY F 111  1 ? 9  
HELX_P HELX_P95  95  SER F 113  ? ASP F 129  ? SER F 113  ASP F 129  1 ? 17 
HELX_P HELX_P96  96  ARG F 130  ? ASN F 145  ? ARG F 130  ASN F 145  1 ? 16 
HELX_P HELX_P97  97  LEU F 148  ? ILE F 158  ? LEU F 148  ILE F 158  1 ? 11 
HELX_P HELX_P98  98  ALA F 451  ? TYR F 479  ? ALA F 451  TYR F 479  1 ? 29 
HELX_P HELX_P99  99  ASN F 480  ? HIS F 490  ? ASN F 480  HIS F 490  1 ? 11 
HELX_P HELX_P100 100 THR F 498  ? LEU F 512  ? THR F 498  LEU F 512  1 ? 15 
HELX_P HELX_P101 101 GLU F 514  ? GLU F 529  ? GLU F 514  GLU F 529  1 ? 16 
HELX_P HELX_P102 102 GLY F 535  ? GLN F 547  ? GLY F 535  GLN F 547  1 ? 13 
HELX_P HELX_P103 103 LYS F 548  ? ASP F 563  ? LYS F 548  ASP F 563  1 ? 16 
HELX_P HELX_P104 104 SER F 566  ? GLN F 580  ? SER F 566  GLN F 580  1 ? 15 
HELX_P HELX_P105 105 GLU F 582  ? ASP F 597  ? GLU F 582  ASP F 597  1 ? 16 
HELX_P HELX_P106 106 TYR F 600  ? GLU F 615  ? TYR F 600  GLU F 615  1 ? 16 
HELX_P HELX_P107 107 GLU F 616  ? ASN F 631  ? GLU F 616  ASN F 631  1 ? 16 
HELX_P HELX_P108 108 HIS F 634  ? GLN F 648  ? HIS F 634  GLN F 648  1 ? 15 
HELX_P HELX_P109 109 LYS F 650  ? ASN F 665  ? LYS F 650  ASN F 665  1 ? 16 
HELX_P HELX_P110 110 SER F 668  ? LYS F 683  ? SER F 668  LYS F 683  1 ? 16 
HELX_P HELX_P111 111 LYS F 684  ? ASP F 699  ? LYS F 684  ASP F 699  1 ? 16 
HELX_P HELX_P112 112 ASN F 702  ? ASN F 716  ? ASN F 702  ASN F 716  1 ? 15 
HELX_P HELX_P113 113 LYS F 718  ? VAL F 733  ? LYS F 718  VAL F 733  1 ? 16 
HELX_P HELX_P114 114 GLU F 736  ? GLY F 751  ? GLU F 736  GLY F 751  1 ? 16 
HELX_P HELX_P115 115 GLN F 752  ? ASP F 767  ? GLN F 752  ASP F 767  1 ? 16 
HELX_P HELX_P116 116 LYS F 769  ? ARG F 782  ? LYS F 769  ARG F 782  1 ? 14 
HELX_P HELX_P117 117 LYS G 12   ? ASP G 25   ? LYS G 12   ASP G 25   1 ? 14 
HELX_P HELX_P118 118 GLU H 6    ? HIS H 18   ? GLU H 6    HIS H 18   1 ? 13 
HELX_P HELX_P119 119 ALA H 20   ? HIS H 36   ? ALA H 20   HIS H 36   1 ? 17 
HELX_P HELX_P120 120 SER H 37   ? SER H 51   ? SER H 37   SER H 51   1 ? 15 
HELX_P HELX_P121 121 LYS H 53   ? HIS H 64   ? LYS H 53   HIS H 64   1 ? 12 
HELX_P HELX_P122 122 THR H 68   ? LEU H 82   ? THR H 68   LEU H 82   1 ? 15 
HELX_P HELX_P123 123 LYS H 84   ? GLY H 94   ? LYS H 84   GLY H 94   1 ? 11 
HELX_P HELX_P124 124 HIS H 103  ? GLY H 111  ? HIS H 103  GLY H 111  1 ? 9  
HELX_P HELX_P125 125 SER H 113  ? ASP H 129  ? SER H 113  ASP H 129  1 ? 17 
HELX_P HELX_P126 126 ARG H 130  ? ASN H 145  ? ARG H 130  ASN H 145  1 ? 16 
HELX_P HELX_P127 127 LEU H 148  ? ILE H 158  ? LEU H 148  ILE H 158  1 ? 11 
HELX_P HELX_P128 128 ASP H 163  ? LYS H 169  ? ASP H 163  LYS H 169  1 ? 7  
HELX_P HELX_P129 129 ALA H 451  ? TYR H 479  ? ALA H 451  TYR H 479  1 ? 29 
HELX_P HELX_P130 130 ASN H 480  ? HIS H 490  ? ASN H 480  HIS H 490  1 ? 11 
HELX_P HELX_P131 131 THR H 498  ? LEU H 512  ? THR H 498  LEU H 512  1 ? 15 
HELX_P HELX_P132 132 GLU H 514  ? GLU H 529  ? GLU H 514  GLU H 529  1 ? 16 
HELX_P HELX_P133 133 GLY H 535  ? GLN H 547  ? GLY H 535  GLN H 547  1 ? 13 
HELX_P HELX_P134 134 LYS H 548  ? ASP H 563  ? LYS H 548  ASP H 563  1 ? 16 
HELX_P HELX_P135 135 SER H 566  ? GLN H 580  ? SER H 566  GLN H 580  1 ? 15 
HELX_P HELX_P136 136 GLU H 582  ? ASP H 597  ? GLU H 582  ASP H 597  1 ? 16 
HELX_P HELX_P137 137 TYR H 600  ? GLU H 615  ? TYR H 600  GLU H 615  1 ? 16 
HELX_P HELX_P138 138 GLU H 616  ? ASN H 631  ? GLU H 616  ASN H 631  1 ? 16 
HELX_P HELX_P139 139 HIS H 634  ? GLN H 648  ? HIS H 634  GLN H 648  1 ? 15 
HELX_P HELX_P140 140 LYS H 650  ? ASN H 665  ? LYS H 650  ASN H 665  1 ? 16 
HELX_P HELX_P141 141 SER H 668  ? LYS H 683  ? SER H 668  LYS H 683  1 ? 16 
HELX_P HELX_P142 142 LYS H 684  ? ASP H 699  ? LYS H 684  ASP H 699  1 ? 16 
HELX_P HELX_P143 143 ASN H 702  ? ASN H 716  ? ASN H 702  ASN H 716  1 ? 15 
HELX_P HELX_P144 144 LYS H 718  ? VAL H 733  ? LYS H 718  VAL H 733  1 ? 16 
HELX_P HELX_P145 145 GLU H 736  ? GLY H 751  ? GLU H 736  GLY H 751  1 ? 16 
HELX_P HELX_P146 146 GLN H 752  ? ASP H 767  ? GLN H 752  ASP H 767  1 ? 16 
HELX_P HELX_P147 147 LEU I 49   ? PHE I 52   ? LEU I 49   PHE I 52   5 ? 4  
HELX_P HELX_P148 148 GLU I 132  ? LEU I 137  ? GLU I 132  LEU I 137  1 ? 6  
HELX_P HELX_P149 149 GLU I 163  ? ASP I 170  ? GLU I 163  ASP I 170  1 ? 8  
HELX_P HELX_P150 150 TYR I 190  ? MET I 192  ? TYR I 190  MET I 192  5 ? 3  
HELX_P HELX_P151 151 THR I 238  ? PHE I 244  ? THR I 238  PHE I 244  1 ? 7  
HELX_P HELX_P152 152 PHE I 244  ? LYS I 294  ? PHE I 244  LYS I 294  1 ? 51 
HELX_P HELX_P153 153 SER I 299  ? TRP I 310  ? SER I 299  TRP I 310  1 ? 12 
HELX_P HELX_P154 154 ALA I 315  ? LEU I 325  ? ALA I 315  LEU I 325  1 ? 11 
HELX_P HELX_P155 155 THR I 326  ? HIS I 351  ? THR I 326  HIS I 351  1 ? 26 
HELX_P HELX_P156 156 HIS I 351  ? TRP I 372  ? HIS I 351  TRP I 372  1 ? 22 
HELX_P HELX_P157 157 TRP I 372  ? GLU I 377  ? TRP I 372  GLU I 377  1 ? 6  
HELX_P HELX_P158 158 ASP I 382  ? THR I 429  ? ASP I 382  THR I 429  1 ? 48 
HELX_P HELX_P159 159 THR I 441  ? PHE I 456  ? THR I 441  PHE I 456  1 ? 16 
HELX_P HELX_P160 160 ARG I 474  ? ASP I 481  ? ARG I 474  ASP I 481  1 ? 8  
HELX_P HELX_P161 161 ASN I 495  ? ASN I 503  ? ASN I 495  ASN I 503  1 ? 9  
HELX_P HELX_P162 162 SER I 505  ? SER I 510  ? SER I 505  SER I 510  1 ? 6  
HELX_P HELX_P163 163 SER I 521  ? MET I 548  ? SER I 521  MET I 548  1 ? 28 
HELX_P HELX_P164 164 SER I 672  ? VAL I 674  ? SER I 672  VAL I 674  5 ? 3  
HELX_P HELX_P165 165 ASP I 679  ? TYR I 683  ? ASP I 679  TYR I 683  5 ? 5  
HELX_P HELX_P166 166 ASN J 2    ? GLN J 17   ? ASN J 2    GLN J 17   1 ? 16 
HELX_P HELX_P167 167 GLN J 18   ? ARG J 34   ? GLN J 18   ARG J 34   1 ? 17 
HELX_P HELX_P168 168 GLU J 36   ? THR J 50   ? GLU J 36   THR J 50   1 ? 15 
HELX_P HELX_P169 169 GLN J 52   ? ARG J 63   ? GLN J 52   ARG J 63   1 ? 12 
HELX_P HELX_P170 170 LYS J 64   ? GLU J 70   ? LYS J 64   GLU J 70   1 ? 7  
HELX_P HELX_P171 171 GLU J 70   ? LYS J 84   ? GLU J 70   LYS J 84   1 ? 15 
HELX_P HELX_P172 172 GLN J 87   ? ASP J 94   ? GLN J 87   ASP J 94   1 ? 8  
HELX_P HELX_P173 173 SER J 124  ? ASP J 144  ? SER J 124  ASP J 144  1 ? 21 
HELX_P HELX_P174 174 ASN J 145  ? VAL J 161  ? ASN J 145  VAL J 161  1 ? 17 
HELX_P HELX_P175 175 CYS J 163  ? HIS J 173  ? CYS J 163  HIS J 173  1 ? 11 
HELX_P HELX_P176 176 THR J 177  ? LEU J 188  ? THR J 177  LEU J 188  1 ? 12 
HELX_P HELX_P177 177 CYS J 194  ? LEU J 209  ? CYS J 194  LEU J 209  1 ? 16 
HELX_P HELX_P178 178 ASN J 230  ? CYS J 245  ? ASN J 230  CYS J 245  1 ? 16 
HELX_P HELX_P179 179 ASP J 246  ? ASP J 261  ? ASP J 246  ASP J 261  1 ? 16 
HELX_P HELX_P180 180 SER J 266  ? LEU J 278  ? SER J 266  LEU J 278  1 ? 13 
HELX_P HELX_P181 181 LYS J 280  ? TYR J 295  ? LYS J 280  TYR J 295  1 ? 16 
HELX_P HELX_P182 182 ASN J 298  ? GLY J 313  ? ASN J 298  GLY J 313  1 ? 16 
HELX_P HELX_P183 183 LYS J 315  ? GLU J 330  ? LYS J 315  GLU J 330  1 ? 16 
HELX_P HELX_P184 184 TYR J 333  ? SER J 348  ? TYR J 333  SER J 348  1 ? 16 
HELX_P HELX_P185 185 GLU J 349  ? MET J 364  ? GLU J 349  MET J 364  1 ? 16 
HELX_P HELX_P186 186 HIS J 368  ? THR J 381  ? HIS J 368  THR J 381  1 ? 14 
HELX_P HELX_P187 187 ASN J 383  ? ILE J 397  ? ASN J 383  ILE J 397  1 ? 15 
HELX_P HELX_P188 188 ASP J 401  ? GLY J 416  ? ASP J 401  GLY J 416  1 ? 16 
HELX_P HELX_P189 189 TRP J 418  ? ALA J 434  ? TRP J 418  ALA J 434  1 ? 17 
HELX_P HELX_P190 190 TRP J 444  ? LEU J 458  ? TRP J 444  LEU J 458  1 ? 15 
HELX_P HELX_P191 191 LYS J 460  ? ILE J 475  ? LYS J 460  ILE J 475  1 ? 16 
HELX_P HELX_P192 192 ASN J 478  ? MET J 492  ? ASN J 478  MET J 492  1 ? 15 
HELX_P HELX_P193 193 ASN J 494  ? ARG J 509  ? ASN J 494  ARG J 509  1 ? 16 
HELX_P HELX_P194 194 ASP J 512  ? ASP J 529  ? ASP J 512  ASP J 529  1 ? 18 
HELX_P HELX_P195 195 ASN K 2    ? GLN K 17   ? ASN K 2    GLN K 17   1 ? 16 
HELX_P HELX_P196 196 GLN K 18   ? ARG K 34   ? GLN K 18   ARG K 34   1 ? 17 
HELX_P HELX_P197 197 GLU K 36   ? THR K 50   ? GLU K 36   THR K 50   1 ? 15 
HELX_P HELX_P198 198 GLN K 52   ? SER K 62   ? GLN K 52   SER K 62   1 ? 11 
HELX_P HELX_P199 199 LYS K 64   ? TYR K 69   ? LYS K 64   TYR K 69   1 ? 6  
HELX_P HELX_P200 200 TYR K 69   ? ALA K 83   ? TYR K 69   ALA K 83   1 ? 15 
HELX_P HELX_P201 201 GLN K 87   ? LEU K 93   ? GLN K 87   LEU K 93   1 ? 7  
HELX_P HELX_P202 202 ILE K 128  ? ASP K 144  ? ILE K 128  ASP K 144  1 ? 17 
HELX_P HELX_P203 203 ASN K 145  ? VAL K 161  ? ASN K 145  VAL K 161  1 ? 17 
HELX_P HELX_P204 204 CYS K 163  ? SER K 172  ? CYS K 163  SER K 172  1 ? 10 
HELX_P HELX_P205 205 HIS K 173  ? MET K 175  ? HIS K 173  MET K 175  5 ? 3  
HELX_P HELX_P206 206 ALA K 178  ? LEU K 188  ? ALA K 178  LEU K 188  1 ? 11 
HELX_P HELX_P207 207 CYS K 194  ? LYS K 211  ? CYS K 194  LYS K 211  1 ? 18 
HELX_P HELX_P208 208 THR K 218  ? ASP K 225  ? THR K 218  ASP K 225  1 ? 8  
HELX_P HELX_P209 209 GLY K 226  ? LYS K 229  ? GLY K 226  LYS K 229  5 ? 4  
HELX_P HELX_P210 210 ASN K 230  ? CYS K 245  ? ASN K 230  CYS K 245  1 ? 16 
HELX_P HELX_P211 211 ASP K 246  ? ASP K 261  ? ASP K 246  ASP K 261  1 ? 16 
HELX_P HELX_P212 212 SER K 266  ? LEU K 278  ? SER K 266  LEU K 278  1 ? 13 
HELX_P HELX_P213 213 LYS K 280  ? TYR K 295  ? LYS K 280  TYR K 295  1 ? 16 
HELX_P HELX_P214 214 ASN K 298  ? GLY K 313  ? ASN K 298  GLY K 313  1 ? 16 
HELX_P HELX_P215 215 LYS K 315  ? GLU K 330  ? LYS K 315  GLU K 330  1 ? 16 
HELX_P HELX_P216 216 GLY K 334  ? SER K 348  ? GLY K 334  SER K 348  1 ? 15 
HELX_P HELX_P217 217 GLU K 349  ? MET K 364  ? GLU K 349  MET K 364  1 ? 16 
HELX_P HELX_P218 218 HIS K 368  ? THR K 381  ? HIS K 368  THR K 381  1 ? 14 
HELX_P HELX_P219 219 ASN K 383  ? ALA K 398  ? ASN K 383  ALA K 398  1 ? 16 
HELX_P HELX_P220 220 ASP K 401  ? GLY K 416  ? ASP K 401  GLY K 416  1 ? 16 
HELX_P HELX_P221 221 GLU K 417  ? ILE K 435  ? GLU K 417  ILE K 435  1 ? 19 
HELX_P HELX_P222 222 THR K 440  ? LEU K 458  ? THR K 440  LEU K 458  1 ? 19 
HELX_P HELX_P223 223 LYS K 460  ? ILE K 475  ? LYS K 460  ILE K 475  1 ? 16 
HELX_P HELX_P224 224 ASN K 478  ? MET K 492  ? ASN K 478  MET K 492  1 ? 15 
HELX_P HELX_P225 225 ASN K 494  ? ARG K 509  ? ASN K 494  ARG K 509  1 ? 16 
HELX_P HELX_P226 226 ASP K 512  ? ILE K 527  ? ASP K 512  ILE K 527  1 ? 16 
HELX_P HELX_P227 227 ASP L 12   ? GLY L 20   ? ASP L 12   GLY L 20   1 ? 9  
HELX_P HELX_P228 228 GLY L 41   ? ARG L 46   ? GLY L 41   ARG L 46   1 ? 6  
HELX_P HELX_P229 229 HIS L 145  ? GLY L 148  ? HIS L 145  GLY L 148  5 ? 4  
HELX_P HELX_P230 230 THR L 175  ? SER L 183  ? THR L 174  SER L 182  1 ? 9  
HELX_P HELX_P231 231 ASP M 8    ? ASP M 16   ? ASP M 8    ASP M 16   1 ? 9  
HELX_P HELX_P232 232 SER M 49   ? LYS M 56   ? SER M 49   LYS M 56   1 ? 8  
HELX_P HELX_P233 233 UNK N 1    ? UNK N 15   ? UNK N 15   UNK N 29   1 ? 15 
HELX_P HELX_P234 234 UNK N 16   ? UNK N 26   ? UNK N 53   UNK N 63   1 ? 11 
HELX_P HELX_P235 235 LEU N 38   ? UNK N 57   ? LEU N 79   UNK N 98   1 ? 20 
HELX_P HELX_P236 236 UNK N 62   ? UNK N 78   ? UNK N 107  UNK N 123  1 ? 17 
HELX_P HELX_P237 237 UNK N 81   ? UNK N 94   ? UNK N 126  UNK N 139  1 ? 14 
HELX_P HELX_P238 238 LEU N 104  ? PHE N 117  ? LEU N 149  PHE N 162  1 ? 14 
HELX_P HELX_P239 239 PRO N 121  ? GLY N 146  ? PRO N 166  GLY N 191  1 ? 26 
HELX_P HELX_P240 240 LEU N 154  ? LEU N 166  ? LEU N 203  LEU N 215  1 ? 13 
HELX_P HELX_P241 241 ARG N 174  ? LEU N 190  ? ARG N 234  LEU N 250  1 ? 17 
HELX_P HELX_P242 242 LEU N 192  ? ARG N 218  ? LEU N 252  ARG N 278  1 ? 27 
HELX_P HELX_P243 243 ARG N 227  ? PHE N 244  ? ARG N 287  PHE N 304  1 ? 18 
HELX_P HELX_P244 244 TRP N 249  ? ARG N 274  ? TRP N 324  ARG N 349  1 ? 26 
HELX_P HELX_P245 245 SER N 279  ? ARG N 292  ? SER N 354  ARG N 367  1 ? 14 
HELX_P HELX_P246 246 GLN N 295  ? LEU N 311  ? GLN N 370  LEU N 386  1 ? 17 
HELX_P HELX_P247 247 ASP N 320  ? VAL N 334  ? ASP N 395  VAL N 409  1 ? 15 
HELX_P HELX_P248 248 MET N 339  ? CYS N 346  ? MET N 414  CYS N 421  1 ? 8  
HELX_P HELX_P249 249 CYS N 346  ? GLU N 357  ? CYS N 421  GLU N 432  1 ? 12 
HELX_P HELX_P250 250 ASP N 358  ? LEU N 367  ? ASP N 433  LEU N 442  1 ? 10 
HELX_P HELX_P251 251 UNK N 369  ? UNK N 376  ? UNK N 451  UNK N 458  1 ? 8  
HELX_P HELX_P252 252 ALA N 400  ? GLY N 411  ? ALA N 499  GLY N 510  1 ? 12 
HELX_P HELX_P253 253 LYS N 413  ? GLN N 431  ? LYS N 512  GLN N 530  1 ? 19 
HELX_P HELX_P254 254 GLU N 437  ? PHE N 450  ? GLU N 536  PHE N 549  1 ? 14 
HELX_P HELX_P255 255 MET N 455  ? LYS N 481  ? MET N 554  LYS N 580  1 ? 27 
HELX_P HELX_P256 256 ARG N 482  ? GLU N 485  ? ARG N 581  GLU N 584  5 ? 4  
HELX_P HELX_P257 257 PRO N 513  ? LEU N 530  ? PRO N 612  LEU N 629  1 ? 18 
HELX_P HELX_P258 258 LYS N 539  ? GLY N 543  ? LYS N 638  GLY N 642  5 ? 5  
HELX_P HELX_P259 259 THR N 561  ? ASP N 573  ? THR N 660  ASP N 672  1 ? 13 
HELX_P HELX_P260 260 THR N 578  ? LYS N 587  ? THR N 677  LYS N 686  1 ? 10 
HELX_P HELX_P261 261 PRO N 589  ? GLY N 604  ? PRO N 688  GLY N 703  1 ? 16 
HELX_P HELX_P262 262 LYS N 632  ? GLU N 651  ? LYS N 747  GLU N 766  1 ? 20 
HELX_P HELX_P263 263 SER N 654  ? VAL N 666  ? SER N 769  VAL N 781  1 ? 13 
HELX_P HELX_P264 264 ASP N 676  ? ASP N 690  ? ASP N 791  ASP N 805  1 ? 15 
HELX_P HELX_P265 265 THR O 31   ? SER O 45   ? THR O 31   SER O 45   1 ? 15 
HELX_P HELX_P266 266 SER O 53   ? GLY O 70   ? SER O 53   GLY O 70   1 ? 18 
HELX_P HELX_P267 267 THR O 74   ? CYS O 86   ? THR O 74   CYS O 86   1 ? 13 
HELX_P HELX_P268 268 GLN O 88   ? GLY O 103  ? GLN O 88   GLY O 103  1 ? 16 
HELX_P HELX_P269 269 GLU O 104  ? GLY O 121  ? GLU O 104  GLY O 121  1 ? 18 
HELX_P HELX_P270 270 THR O 129  ? LEU O 146  ? THR O 129  LEU O 146  1 ? 18 
HELX_P HELX_P271 271 SER O 147  ? THR O 169  ? SER O 147  THR O 169  1 ? 23 
HELX_P HELX_P272 272 SER O 208  ? ASP O 226  ? SER O 208  ASP O 226  1 ? 19 
HELX_P HELX_P273 273 THR O 232  ? ASN O 247  ? THR O 232  ASN O 247  1 ? 16 
HELX_P HELX_P274 274 ALA O 251  ? GLN O 265  ? ALA O 251  GLN O 265  1 ? 15 
HELX_P HELX_P275 275 ASP O 266  ? LEU O 281  ? ASP O 266  LEU O 281  1 ? 16 
HELX_P HELX_P276 276 GLY O 297  ? PHE O 314  ? GLY O 297  PHE O 314  1 ? 18 
HELX_P HELX_P277 277 HIS O 316  ? ASN O 335  ? HIS O 316  ASN O 335  1 ? 20 
HELX_P HELX_P278 278 ASP O 336  ? GLY O 351  ? ASP O 336  GLY O 351  1 ? 16 
HELX_P HELX_P279 279 SER O 357  ? HIS O 370  ? SER O 357  HIS O 370  1 ? 14 
HELX_P HELX_P280 280 LEU O 373  ? GLY O 392  ? LEU O 373  GLY O 392  1 ? 20 
HELX_P HELX_P281 281 THR O 394  ? SER O 413  ? THR O 394  SER O 413  1 ? 20 
HELX_P HELX_P282 282 LEU O 414  ? TYR O 432  ? LEU O 414  TYR O 432  1 ? 19 
HELX_P HELX_P283 283 ARG O 434  ? MET O 448  ? ARG O 434  MET O 448  1 ? 15 
HELX_P HELX_P284 284 ASN O 462  ? GLN O 480  ? ASN O 462  GLN O 480  1 ? 19 
HELX_P HELX_P285 285 CYS O 482  ? PHE O 497  ? CYS O 482  PHE O 497  1 ? 16 
HELX_P HELX_P286 286 HIS O 503  ? GLY O 523  ? HIS O 503  GLY O 523  1 ? 21 
HELX_P HELX_P287 287 LYS O 524  ? SER O 540  ? LYS O 524  SER O 540  1 ? 17 
HELX_P HELX_P288 288 SER O 540  ? ASN O 555  ? SER O 540  ASN O 555  1 ? 16 
HELX_P HELX_P289 289 GLN O 556  ? LYS O 575  ? GLN O 556  LYS O 575  1 ? 20 
HELX_P HELX_P290 290 ASN O 576  ? SER O 594  ? ASN O 576  SER O 594  1 ? 19 
HELX_P HELX_P291 291 SER O 596  ? THR O 598  ? SER O 596  THR O 598  5 ? 3  
HELX_P HELX_P292 292 ILE O 599  ? TYR O 614  ? ILE O 599  TYR O 614  1 ? 16 
HELX_P HELX_P293 293 LEU O 616  ? LEU O 634  ? LEU O 616  LEU O 634  1 ? 19 
HELX_P HELX_P294 294 ILE O 636  ? ASP O 654  ? ILE O 636  ASP O 654  1 ? 19 
HELX_P HELX_P295 295 ILE O 657  ? TYR O 678  ? ILE O 657  TYR O 678  1 ? 22 
HELX_P HELX_P296 296 LYS O 682  ? ASP O 705  ? LYS O 682  ASP O 705  1 ? 24 
HELX_P HELX_P297 297 LYS O 707  ? GLY O 725  ? LYS O 707  GLY O 725  1 ? 19 
HELX_P HELX_P298 298 LYS O 726  ? HIS O 741  ? LYS O 726  HIS O 741  1 ? 16 
HELX_P HELX_P299 299 ASP P 28   ? GLY P 47   ? ASP P 28   GLY P 47   1 ? 20 
HELX_P HELX_P300 300 LEU P 48   ? LEU P 62   ? LEU P 48   LEU P 62   1 ? 15 
HELX_P HELX_P301 301 THR P 77   ? LYS P 97   ? THR P 77   LYS P 97   1 ? 21 
HELX_P HELX_P302 302 GLU P 98   ? HIS P 107  ? GLU P 98   HIS P 107  1 ? 10 
HELX_P HELX_P303 303 SER P 111  ? THR P 134  ? SER P 111  THR P 134  1 ? 24 
HELX_P HELX_P304 304 ASN P 148  ? ARG P 165  ? ASN P 148  ARG P 165  1 ? 18 
HELX_P HELX_P305 305 GLY P 169  ? LEU P 182  ? GLY P 169  LEU P 182  1 ? 14 
HELX_P HELX_P306 306 LEU P 184  ? LEU P 199  ? LEU P 184  LEU P 199  1 ? 16 
HELX_P HELX_P307 307 HIS P 202  ? ILE P 213  ? HIS P 202  ILE P 213  1 ? 12 
HELX_P HELX_P308 308 ASP P 215  ? LEU P 222  ? ASP P 215  LEU P 222  1 ? 8  
HELX_P HELX_P309 309 TRP P 228  ? LEU P 241  ? TRP P 228  LEU P 241  1 ? 14 
HELX_P HELX_P310 310 LEU P 243  ? VAL P 257  ? LEU P 243  VAL P 257  1 ? 15 
HELX_P HELX_P311 311 SER P 262  ? ILE P 276  ? SER P 262  ILE P 276  1 ? 15 
HELX_P HELX_P312 312 ASP P 278  ? ASP P 293  ? ASP P 278  ASP P 293  1 ? 16 
HELX_P HELX_P313 313 ASN P 299  ? ARG P 310  ? ASN P 299  ARG P 310  1 ? 12 
HELX_P HELX_P314 314 MET P 312  ? ASP P 327  ? MET P 312  ASP P 327  1 ? 16 
HELX_P HELX_P315 315 ARG P 330  ? SER P 345  ? ARG P 330  SER P 345  1 ? 16 
HELX_P HELX_P316 316 GLN P 346  ? ASN P 361  ? GLN P 346  ASN P 361  1 ? 16 
HELX_P HELX_P317 317 TYR P 364  ? MET P 378  ? TYR P 364  MET P 378  1 ? 15 
HELX_P HELX_P318 318 ASN P 380  ? ASN P 395  ? ASN P 380  ASN P 395  1 ? 16 
HELX_P HELX_P319 319 ASP P 398  ? LEU P 412  ? ASP P 398  LEU P 412  1 ? 15 
HELX_P HELX_P320 320 PRO P 415  ? ARG P 429  ? PRO P 415  ARG P 429  1 ? 15 
HELX_P HELX_P321 321 ASP P 432  ? ASN P 447  ? ASP P 432  ASN P 447  1 ? 16 
HELX_P HELX_P322 322 GLN P 448  ? GLY P 463  ? GLN P 448  GLY P 463  1 ? 16 
HELX_P HELX_P323 323 MET P 468  ? LEU P 480  ? MET P 468  LEU P 480  1 ? 13 
HELX_P HELX_P324 324 GLU P 482  ? CYS P 500  ? GLU P 482  CYS P 500  1 ? 19 
HELX_P HELX_P325 325 THR P 511  ? CYS P 523  ? THR P 511  CYS P 523  1 ? 13 
HELX_P HELX_P326 326 LEU P 525  ? ALA P 538  ? LEU P 525  ALA P 538  1 ? 14 
HELX_P HELX_P327 327 GLY Q 1    ? GLY Q 18   ? GLY Q 29   GLY Q 46   1 ? 18 
HELX_P HELX_P328 328 LEU Q 87   ? LYS Q 91   ? LEU Q 115  LYS Q 119  5 ? 5  
HELX_P HELX_P329 329 ASP Q 99   ? GLU Q 113  ? ASP Q 127  GLU Q 141  1 ? 15 
HELX_P HELX_P330 330 ASN Q 121  ? TRP Q 128  ? ASN Q 149  TRP Q 156  1 ? 8  
HELX_P HELX_P331 331 ASN Q 130  ? GLN Q 145  ? ASN Q 158  GLN Q 173  1 ? 16 
HELX_P HELX_P332 332 UNK Q 149  ? UNK Q 161  ? UNK Q 275  UNK Q 287  1 ? 13 
HELX_P HELX_P333 333 ASN R 15   ? ARG R 22   ? ASN R 56   ARG R 63   1 ? 8  
HELX_P HELX_P334 334 GLY R 27   ? LEU R 39   ? GLY R 88   LEU R 100  1 ? 13 
HELX_P HELX_P335 335 SER R 64   ? SER R 73   ? SER R 154  SER R 163  1 ? 10 
HELX_P HELX_P336 336 UNK T 1    ? UNK T 17   ? UNK U 5    UNK U 21   1 ? 17 
HELX_P HELX_P337 337 LYS V 12   ? ASP V 25   ? LYS W 12   ASP W 25   1 ? 14 
HELX_P HELX_P338 338 ASN W 36   ? GLY W 48   ? ASN X 36   GLY X 48   1 ? 13 
HELX_P HELX_P339 339 LEU W 49   ? ASN W 67   ? LEU X 49   ASN X 67   1 ? 19 
HELX_P HELX_P340 340 SER W 72   ? ASP W 90   ? SER X 72   ASP X 90   1 ? 19 
HELX_P HELX_P341 341 GLU W 92   ? LEU W 110  ? GLU X 92   LEU X 110  1 ? 19 
HELX_P HELX_P342 342 SER W 134  ? LYS W 150  ? SER X 134  LYS X 150  1 ? 17 
HELX_P HELX_P343 343 GLN W 151  ? GLY W 161  ? GLN X 151  GLY X 161  1 ? 11 
HELX_P HELX_P344 344 THR W 168  ? GLY W 183  ? THR X 168  GLY X 183  1 ? 16 
HELX_P HELX_P345 345 GLN W 184  ? CYS W 199  ? GLN X 184  CYS X 199  1 ? 16 
HELX_P HELX_P346 346 ALA W 202  ? SER W 213  ? ALA X 202  SER X 213  1 ? 12 
HELX_P HELX_P347 347 VAL W 214  ? THR W 229  ? VAL X 214  THR X 229  1 ? 16 
HELX_P HELX_P348 348 TRP W 235  ? GLY W 249  ? TRP X 235  GLY X 249  1 ? 15 
HELX_P HELX_P349 349 ASP W 250  ? LYS W 264  ? ASP X 250  LYS X 264  1 ? 15 
HELX_P HELX_P350 350 ASN W 270  ? GLY W 285  ? ASN X 270  GLY X 285  1 ? 16 
HELX_P HELX_P351 351 ASP W 286  ? ASP W 301  ? ASP X 286  ASP X 301  1 ? 16 
HELX_P HELX_P352 352 LEU W 304  ? GLY W 319  ? LEU X 304  GLY X 319  1 ? 16 
HELX_P HELX_P353 353 ARG W 320  ? SER W 335  ? ARG X 320  SER X 335  1 ? 16 
HELX_P HELX_P354 354 HIS W 338  ? LYS W 353  ? HIS X 338  LYS X 353  1 ? 16 
HELX_P HELX_P355 355 ARG W 354  ? ASN W 369  ? ARG X 354  ASN X 369  1 ? 16 
HELX_P HELX_P356 356 VAL W 373  ? GLY W 387  ? VAL X 373  GLY X 387  1 ? 15 
HELX_P HELX_P357 357 ARG W 388  ? ALA W 403  ? ARG X 388  ALA X 403  1 ? 16 
HELX_P HELX_P358 358 ARG W 406  ? ASN W 421  ? ARG X 406  ASN X 421  1 ? 16 
HELX_P HELX_P359 359 SER W 422  ? GLY W 438  ? SER X 422  GLY X 438  1 ? 17 
HELX_P HELX_P360 360 ALA W 441  ? ASP W 454  ? ALA X 441  ASP X 454  1 ? 14 
HELX_P HELX_P361 361 THR W 457  ? GLU W 472  ? THR X 457  GLU X 472  1 ? 16 
HELX_P HELX_P362 362 TYR W 475  ? GLN W 490  ? TYR X 475  GLN X 490  1 ? 16 
HELX_P HELX_P363 363 LYS W 491  ? GLN W 506  ? LYS X 491  GLN X 506  1 ? 16 
HELX_P HELX_P364 364 CYS W 509  ? ASN W 523  ? CYS X 509  ASN X 523  1 ? 15 
HELX_P HELX_P365 365 GLU W 524  ? ASP W 539  ? GLU X 524  ASP X 539  1 ? 16 
HELX_P HELX_P366 366 ASN X 36   ? GLY X 48   ? ASN Y 36   GLY Y 48   1 ? 13 
HELX_P HELX_P367 367 LEU X 49   ? ASN X 67   ? LEU Y 49   ASN Y 67   1 ? 19 
HELX_P HELX_P368 368 SER X 72   ? ASP X 90   ? SER Y 72   ASP Y 90   1 ? 19 
HELX_P HELX_P369 369 GLU X 92   ? LEU X 110  ? GLU Y 92   LEU Y 110  1 ? 19 
HELX_P HELX_P370 370 SER X 134  ? LYS X 150  ? SER Y 134  LYS Y 150  1 ? 17 
HELX_P HELX_P371 371 GLN X 151  ? ILE X 162  ? GLN Y 151  ILE Y 162  1 ? 12 
HELX_P HELX_P372 372 THR X 168  ? GLY X 183  ? THR Y 168  GLY Y 183  1 ? 16 
HELX_P HELX_P373 373 GLN X 184  ? CYS X 199  ? GLN Y 184  CYS Y 199  1 ? 16 
HELX_P HELX_P374 374 ALA X 202  ? SER X 213  ? ALA Y 202  SER Y 213  1 ? 12 
HELX_P HELX_P375 375 VAL X 214  ? THR X 229  ? VAL Y 214  THR Y 229  1 ? 16 
HELX_P HELX_P376 376 TRP X 235  ? GLY X 249  ? TRP Y 235  GLY Y 249  1 ? 15 
HELX_P HELX_P377 377 ASP X 250  ? LYS X 264  ? ASP Y 250  LYS Y 264  1 ? 15 
HELX_P HELX_P378 378 ASN X 270  ? GLY X 285  ? ASN Y 270  GLY Y 285  1 ? 16 
HELX_P HELX_P379 379 ASP X 286  ? ASP X 301  ? ASP Y 286  ASP Y 301  1 ? 16 
HELX_P HELX_P380 380 LEU X 304  ? GLY X 319  ? LEU Y 304  GLY Y 319  1 ? 16 
HELX_P HELX_P381 381 ARG X 320  ? SER X 335  ? ARG Y 320  SER Y 335  1 ? 16 
HELX_P HELX_P382 382 HIS X 338  ? LYS X 353  ? HIS Y 338  LYS Y 353  1 ? 16 
HELX_P HELX_P383 383 ARG X 354  ? ASN X 369  ? ARG Y 354  ASN Y 369  1 ? 16 
HELX_P HELX_P384 384 SER X 372  ? GLY X 387  ? SER Y 372  GLY Y 387  1 ? 16 
HELX_P HELX_P385 385 ARG X 388  ? ALA X 403  ? ARG Y 388  ALA Y 403  1 ? 16 
HELX_P HELX_P386 386 ARG X 406  ? ASN X 421  ? ARG Y 406  ASN Y 421  1 ? 16 
HELX_P HELX_P387 387 SER X 422  ? GLY X 438  ? SER Y 422  GLY Y 438  1 ? 17 
HELX_P HELX_P388 388 ALA X 441  ? ASP X 454  ? ALA Y 441  ASP Y 454  1 ? 14 
HELX_P HELX_P389 389 THR X 457  ? GLU X 472  ? THR Y 457  GLU Y 472  1 ? 16 
HELX_P HELX_P390 390 TYR X 475  ? GLN X 490  ? TYR Y 475  GLN Y 490  1 ? 16 
HELX_P HELX_P391 391 LYS X 491  ? GLN X 506  ? LYS Y 491  GLN Y 506  1 ? 16 
HELX_P HELX_P392 392 CYS X 509  ? ASN X 523  ? CYS Y 509  ASN Y 523  1 ? 15 
HELX_P HELX_P393 393 GLU X 524  ? ASP X 539  ? GLU Y 524  ASP Y 539  1 ? 16 
HELX_P HELX_P394 394 ASP X 542  ? MET X 552  ? ASP Y 542  MET Y 552  1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 682  A . ? LEU 1100 A PRO 683  A ? PRO 1101 A 1 5.78   
2  PRO 694  A . ? PRO 1112 A PRO 695  A ? PRO 1113 A 1 6.24   
3  GLY 1225 A . ? GLY 1670 A PRO 1226 A ? PRO 1671 A 1 -7.41  
4  SER 1272 A . ? SER 1739 A ALA 1273 A ? ALA 1740 A 1 18.68  
5  TRP 14   B . ? TRP 14   B LEU 15   B ? LEU 15   B 1 -0.44  
6  GLN 68   B . ? GLN 68   B VAL 69   B ? VAL 69   B 1 -9.48  
7  VAL 96   C . ? VAL 96   C LYS 97   C ? LYS 97   C 1 20.18  
8  ASN 361  C . ? ASN 361  C PRO 362  C ? PRO 362  C 1 -15.35 
9  ASN 145  F . ? ASN 145  F PRO 146  F ? PRO 146  F 1 -22.10 
10 ASN 145  H . ? ASN 145  H PRO 146  H ? PRO 146  H 1 -17.68 
11 PRO 489  I . ? PRO 489  I PRO 490  I ? PRO 490  I 1 18.32  
12 PHE 572  I . ? PHE 572  I PRO 573  I ? PRO 573  I 1 0.57   
13 GLN 60   L . ? GLN 60   L PRO 61   L ? PRO 61   L 1 5.27   
14 THR 125  L . ? THR 125  L ASP 126  L ? ASP 126  L 1 -9.42  
15 PRO 171  L . ? PRO 170  L ARG 172  L ? ARG 171  L 1 -2.87  
16 TYR 80   N . ? TYR 125  N UNK 81   N ? UNK 126  N 1 3.71   
17 ALA 120  N . ? ALA 165  N PRO 121  N ? PRO 166  N 1 -25.27 
18 UNK 148  N . ? UNK 197  N UNK 149  N ? UNK 198  N 1 -3.65  
19 SER 224  N . ? SER 284  N PHE 225  N ? PHE 285  N 1 12.68  
20 ASP 275  N . ? ASP 350  N PHE 276  N ? PHE 351  N 1 -26.13 
21 THR 293  N . ? THR 368  N ASP 294  N ? ASP 369  N 1 2.77   
22 UNK 379  N . ? UNK 478  N UNK 380  N ? UNK 479  N 1 -4.25  
23 UNK 384  N . ? UNK 483  N UNK 385  N ? UNK 484  N 1 28.30  
24 UNK 394  N . ? UNK 493  N UNK 395  N ? UNK 494  N 1 -27.06 
25 SER 433  N . ? SER 532  N PHE 434  N ? PHE 533  N 1 -11.65 
26 GLY 451  N . ? GLY 550  N GLU 452  N ? GLU 551  N 1 -16.13 
27 PRO 610  N . ? PRO 709  N PRO 611  N ? PRO 710  N 1 -8.12  
28 GLU 123  O . ? GLU 123  O PRO 124  O ? PRO 124  O 1 -6.19  
29 ASP 356  O . ? ASP 356  O SER 357  O ? SER 357  O 1 7.93   
30 VAL 96   P . ? VAL 96   P LYS 97   P ? LYS 97   P 1 21.49  
31 ASN 361  P . ? ASN 361  P PRO 362  P ? PRO 362  P 1 -17.86 
32 TYR 61   Q . ? TYR 89   Q PRO 62   Q ? PRO 90   Q 1 -5.44  
33 LEU 50   R . ? LEU 127  R PHE 51   R ? PHE 128  R 1 24.85  
34 TYR 321  R . ? TYR 416  R SER 322  R ? SER 417  R 1 -4.60  
35 SER 377  R . ? SER 484  R VAL 378  R ? VAL 485  R 1 -20.67 
36 LEU 7    S . ? LEU 7    T UNK 8    S ? UNK 8    T 1 -4.28  
37 UNK 11   S . ? UNK 11   T UNK 12   S ? UNK 12   T 1 5.49   
38 PHE 3    U . ? PHE 321  V ARG 4    U ? ARG 322  V 1 -1.53  
39 CYS 199  X . ? CYS 199  Y PRO 200  X ? PRO 200  Y 1 -21.32 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 4 ? 
AF ? 4 ? 
AG ? 4 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 4 ? 
BA ? 3 ? 
BB ? 2 ? 
IA ? 4 ? 
IB ? 4 ? 
IC ? 4 ? 
ID ? 4 ? 
IE ? 2 ? 
IF ? 5 ? 
IG ? 5 ? 
IH ? 2 ? 
II ? 4 ? 
IJ ? 3 ? 
LA ? 4 ? 
LB ? 5 ? 
NA ? 2 ? 
QA ? 4 ? 
RA ? 4 ? 
RB ? 4 ? 
RC ? 4 ? 
RD ? 4 ? 
RE ? 4 ? 
RF ? 4 ? 
RG ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? parallel      
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
IA 1 2 ? anti-parallel 
IA 2 3 ? anti-parallel 
IA 3 4 ? anti-parallel 
IB 1 2 ? anti-parallel 
IB 2 3 ? anti-parallel 
IB 3 4 ? anti-parallel 
IC 1 2 ? anti-parallel 
IC 2 3 ? anti-parallel 
IC 3 4 ? anti-parallel 
ID 1 2 ? anti-parallel 
ID 2 3 ? anti-parallel 
ID 3 4 ? anti-parallel 
IE 1 2 ? anti-parallel 
IF 1 2 ? anti-parallel 
IF 2 3 ? anti-parallel 
IF 3 4 ? anti-parallel 
IF 4 5 ? anti-parallel 
IG 1 2 ? anti-parallel 
IG 2 3 ? anti-parallel 
IG 3 4 ? anti-parallel 
IG 4 5 ? parallel      
IH 1 2 ? anti-parallel 
II 1 2 ? anti-parallel 
II 2 3 ? anti-parallel 
II 3 4 ? anti-parallel 
IJ 1 2 ? anti-parallel 
IJ 2 3 ? anti-parallel 
LA 1 2 ? anti-parallel 
LA 2 3 ? anti-parallel 
LA 3 4 ? anti-parallel 
LB 1 2 ? anti-parallel 
LB 2 3 ? anti-parallel 
LB 3 4 ? anti-parallel 
LB 4 5 ? anti-parallel 
NA 1 2 ? anti-parallel 
QA 1 2 ? anti-parallel 
QA 2 3 ? anti-parallel 
QA 3 4 ? anti-parallel 
RA 1 2 ? anti-parallel 
RA 2 3 ? anti-parallel 
RA 3 4 ? anti-parallel 
RB 1 2 ? anti-parallel 
RB 2 3 ? anti-parallel 
RB 3 4 ? anti-parallel 
RC 1 2 ? anti-parallel 
RC 2 3 ? anti-parallel 
RC 3 4 ? anti-parallel 
RD 1 2 ? anti-parallel 
RD 2 3 ? anti-parallel 
RD 3 4 ? anti-parallel 
RE 1 2 ? anti-parallel 
RE 2 3 ? anti-parallel 
RE 3 4 ? anti-parallel 
RF 1 2 ? anti-parallel 
RF 2 3 ? anti-parallel 
RF 3 4 ? anti-parallel 
RG 1 2 ? anti-parallel 
RG 2 3 ? anti-parallel 
RG 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 7    ? GLU A 9    ? LEU A 17   GLU A 19   
AA 2 MET A 363  ? THR A 367  ? MET A 604  THR A 608  
AA 3 ARG A 353  ? LEU A 358  ? ARG A 594  LEU A 599  
AA 4 ILE A 343  ? VAL A 350  ? ILE A 584  VAL A 591  
AB 1 SER A 51   ? LYS A 56   ? SER A 73   LYS A 78   
AB 2 ASP A 68   ? VAL A 73   ? ASP A 90   VAL A 95   
AB 3 MET A 77   ? SER A 81   ? MET A 99   SER A 103  
AB 4 LYS A 93   ? THR A 96   ? LYS A 115  THR A 118  
AC 1 LEU A 105  ? ILE A 110  ? LEU A 127  ILE A 132  
AC 2 VAL A 114  ? LEU A 121  ? VAL A 147  LEU A 154  
AC 3 ILE A 126  ? SER A 130  ? ILE A 159  SER A 163  
AC 4 ASP A 135  ? ILE A 137  ? ASP A 168  ILE A 170  
AD 1 VAL A 144  ? VAL A 147  ? VAL A 177  VAL A 180  
AD 2 LEU A 154  ? ARG A 158  ? LEU A 187  ARG A 191  
AD 3 MET A 164  ? MET A 167  ? MET A 210  MET A 213  
AD 4 THR A 175  ? PRO A 176  ? THR A 221  PRO A 222  
AE 1 LYS A 190  ? ASN A 195  ? LYS A 245  ASN A 250  
AE 2 ILE A 200  ? ASP A 205  ? ILE A 255  ASP A 260  
AE 3 VAL A 210  ? TRP A 214  ? VAL A 265  TRP A 269  
AE 4 HIS A 250  ? TRP A 252  ? HIS A 411  TRP A 413  
AF 1 VAL A 260  ? SER A 264  ? VAL A 430  SER A 434  
AF 2 LYS A 270  ? VAL A 276  ? LYS A 440  VAL A 446  
AF 3 GLN A 281  ? GLU A 289  ? GLN A 451  GLU A 459  
AF 4 LEU A 293  ? ILE A 301  ? LEU A 466  ILE A 474  
AG 1 ASP A 305  ? VAL A 309  ? ASP A 478  VAL A 482  
AG 2 THR A 314  ? GLU A 319  ? THR A 487  GLU A 492  
AG 3 ASN A 323  ? TYR A 327  ? ASN A 496  TYR A 500  
AG 4 ARG A 332  ? LYS A 335  ? ARG A 505  LYS A 508  
AH 1 THR A 690  ? ALA A 693  ? THR A 1108 ALA A 1111 
AH 2 THR A 698  ? ASP A 701  ? THR A 1116 ASP A 1119 
AI 1 TYR A 1127 ? LEU A 1129 ? TYR A 1572 LEU A 1574 
AI 2 ALA A 1169 ? PRO A 1171 ? ALA A 1614 PRO A 1616 
AJ 1 VAL A 1175 ? VAL A 1177 ? VAL A 1620 VAL A 1622 
AJ 2 VAL A 1248 ? TYR A 1250 ? VAL A 1696 TYR A 1698 
AK 1 GLN A 1201 ? MET A 1207 ? GLN A 1646 MET A 1652 
AK 2 LEU A 1188 ? LYS A 1194 ? LEU A 1633 LYS A 1639 
AK 3 LEU A 1218 ? VAL A 1223 ? LEU A 1663 VAL A 1668 
AK 4 GLU A 1230 ? ILE A 1233 ? GLU A 1675 ILE A 1678 
BA 1 VAL B 3    ? ASN B 9    ? VAL B 3    ASN B 9    
BA 2 LEU N 544  ? VAL N 549  ? LEU N 643  VAL N 648  
BA 3 LEU N 556  ? SER N 557  ? LEU N 655  SER N 656  
BB 1 LEU B 46   ? TRP B 48   ? LEU B 46   TRP B 48   
BB 2 CYS B 54   ? HIS B 56   ? CYS B 54   HIS B 56   
IA 1 ILE I 23   ? TRP I 28   ? ILE I 23   TRP I 28   
IA 2 ILE I 35   ? ASN I 39   ? ILE I 35   ASN I 39   
IA 3 VAL I 44   ? HIS I 47   ? VAL I 44   HIS I 47   
IA 4 ARG I 54   ? PHE I 58   ? ARG I 54   PHE I 58   
IB 1 VAL I 68   ? TRP I 73   ? VAL I 68   TRP I 73   
IB 2 LEU I 79   ? LEU I 84   ? LEU I 79   LEU I 84   
IB 3 ILE I 90   ? ASP I 94   ? ILE I 90   ASP I 94   
IB 4 SER I 100  ? PHE I 104  ? SER I 100  PHE I 104  
IC 1 CYS I 112  ? GLU I 117  ? CYS I 112  GLU I 117  
IC 2 ASN I 174  ? GLY I 179  ? ASN I 174  GLY I 179  
IC 3 PHE I 184  ? ALA I 189  ? PHE I 184  ALA I 189  
IC 4 PHE I 193  ? THR I 199  ? PHE I 193  THR I 199  
ID 1 THR I 204  ? LEU I 210  ? THR I 204  LEU I 210  
ID 2 SER I 216  ? GLU I 222  ? SER I 216  GLU I 222  
ID 3 TYR I 233  ? GLU I 237  ? TYR I 233  GLU I 237  
ID 4 ALA I 551  ? ILE I 554  ? ALA I 551  ILE I 554  
IE 1 SER I 229  ? GLU I 230  ? SER I 229  GLU I 230  
IE 2 ARG I 558  ? ASP I 559  ? ARG I 558  ASP I 559  
IF 1 PHE I 574  ? ASN I 578  ? PHE I 574  ASN I 578  
IF 2 LEU I 583  ? LEU I 591  ? LEU I 583  LEU I 591  
IF 3 TYR I 596  ? HIS I 604  ? TYR I 596  HIS I 604  
IF 4 LEU I 615  ? THR I 624  ? LEU I 615  THR I 624  
IF 5 VAL I 631  ? ARG I 632  ? VAL I 631  ARG I 632  
IG 1 PHE I 574  ? ASN I 578  ? PHE I 574  ASN I 578  
IG 2 LEU I 583  ? LEU I 591  ? LEU I 583  LEU I 591  
IG 3 TYR I 596  ? HIS I 604  ? TYR I 596  HIS I 604  
IG 4 LEU I 615  ? THR I 624  ? LEU I 615  THR I 624  
IG 5 THR I 702  ? PHE I 707  ? THR I 702  PHE I 707  
IH 1 VAL I 631  ? ARG I 632  ? VAL I 631  ARG I 632  
IH 2 LEU I 615  ? THR I 624  ? LEU I 615  THR I 624  
II 1 TYR I 636  ? ASP I 645  ? TYR I 636  ASP I 645  
II 2 THR I 648  ? ASP I 655  ? THR I 648  ASP I 655  
II 3 ARG I 664  ? PRO I 670  ? ARG I 664  PRO I 670  
II 4 TRP I 711  ? LEU I 713  ? TRP I 711  LEU I 713  
IJ 1 ALA I 719  ? GLY I 724  ? ALA I 719  GLY I 724  
IJ 2 VAL I 730  ? SER I 735  ? VAL I 730  SER I 735  
IJ 3 VAL I 741  ? GLU I 745  ? VAL I 741  GLU I 745  
LA 1 VAL L 22   ? GLU L 24   ? VAL L 22   GLU L 24   
LA 2 GLN L 155  ? PRO L 161  ? GLN L 155  PRO L 161  
LA 3 THR L 76   ? TYR L 80   ? THR L 76   TYR L 80   
LA 4 TRP L 119  ? PRO L 123  ? TRP L 119  PRO L 123  
LB 1 VAL L 30   ? LEU L 33   ? VAL L 30   LEU L 33   
LB 2 HIS L 62   ? VAL L 74   ? HIS L 62   VAL L 74   
LB 3 THR L 132  ? VAL L 141  ? THR L 132  VAL L 141  
LB 4 LYS L 93   ? GLY L 99   ? LYS L 93   GLY L 99   
LB 5 GLN L 106  ? GLU L 112  ? GLN L 106  GLU L 112  
NA 1 VAL N 694  ? SER N 696  ? VAL N 809  SER N 811  
NA 2 VAL N 699  ? ARG N 701  ? VAL N 814  ARG N 816  
QA 1 ILE Q 22   ? PRO Q 26   ? ILE Q 50   PRO Q 54   
QA 2 LYS Q 33   ? HIS Q 39   ? LYS Q 61   HIS Q 67   
QA 3 ARG Q 50   ? GLU Q 56   ? ARG Q 78   GLU Q 84   
QA 4 THR Q 67   ? PHE Q 70   ? THR Q 95   PHE Q 98   
RA 1 ARG R 82   ? ASP R 85   ? ARG R 177  ASP R 180  
RA 2 THR R 367  ? LYS R 372  ? THR R 462  LYS R 467  
RA 3 THR R 358  ? ALA R 363  ? THR R 453  ALA R 458  
RA 4 VAL R 347  ? LEU R 352  ? VAL R 442  LEU R 447  
RB 1 ILE R 98   ? TRP R 100  ? ILE R 193  TRP R 195  
RB 2 VAL R 105  ? LEU R 110  ? VAL R 200  LEU R 205  
RB 3 SER R 113  ? ASP R 118  ? SER R 208  ASP R 213  
RB 4 VAL R 124  ? ASP R 129  ? VAL R 219  ASP R 224  
RC 1 TYR R 134  ? TRP R 139  ? TYR R 229  TRP R 234  
RC 2 HIS R 145  ? GLN R 150  ? HIS R 240  GLN R 245  
RC 3 VAL R 155  ? ASP R 159  ? VAL R 250  ASP R 254  
RC 4 LYS R 164  ? LEU R 169  ? LYS R 259  LEU R 264  
RD 1 VAL R 176  ? ASN R 182  ? VAL R 271  ASN R 277  
RD 2 VAL R 185  ? SER R 190  ? VAL R 280  SER R 285  
RD 3 ILE R 195  ? ASP R 199  ? ILE R 290  ASP R 294  
RD 4 GLU R 208  ? ILE R 210  ? GLU R 303  ILE R 305  
RE 1 VAL R 217  ? TRP R 222  ? VAL R 312  TRP R 317  
RE 2 LYS R 228  ? GLY R 233  ? LYS R 323  GLY R 328  
RE 3 VAL R 238  ? GLU R 242  ? VAL R 333  GLU R 337  
RE 4 LEU R 250  ? PHE R 252  ? LEU R 345  PHE R 347  
RF 1 VAL R 259  ? TRP R 264  ? VAL R 354  TRP R 359  
RF 2 VAL R 271  ? GLY R 276  ? VAL R 366  GLY R 371  
RF 3 ARG R 282  ? ASN R 287  ? ARG R 377  ASN R 382  
RF 4 ILE R 292  ? ASP R 298  ? ILE R 387  ASP R 393  
RG 1 ILE R 303  ? TRP R 308  ? ILE R 398  TRP R 403  
RG 2 LEU R 315  ? HIS R 319  ? LEU R 410  HIS R 414  
RG 3 LEU R 326  ? TRP R 329  ? LEU R 421  TRP R 424  
RG 4 PRO R 336  ? LEU R 340  ? PRO R 431  LEU R 435  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLN A 8    ? N GLN A 18   O ARG A 365  ? O ARG A 606  
AA 2 3 N ILE A 366  ? N ILE A 607  O VAL A 354  ? O VAL A 595  
AA 3 4 O GLU A 357  ? O GLU A 598  N HIS A 344  ? N HIS A 585  
AB 1 2 N ARG A 55   ? N ARG A 77   O GLU A 69   ? O GLU A 91   
AB 2 3 N TYR A 72   ? N TYR A 94   O ILE A 79   ? O ILE A 101  
AB 3 4 N TRP A 80   ? N TRP A 102  O LYS A 93   ? O LYS A 115  
AC 1 2 N PHE A 109  ? N PHE A 131  O GLU A 115  ? O GLU A 148  
AC 2 3 N ILE A 120  ? N ILE A 153  O ASN A 127  ? O ASN A 160  
AC 3 4 N MET A 128  ? N MET A 161  O TYR A 136  ? O TYR A 169  
AD 1 2 N ALA A 145  ? N ALA A 178  O GLU A 157  ? O GLU A 190  
AD 2 3 N PHE A 156  ? N PHE A 189  O PHE A 165  ? O PHE A 211  
AD 3 4 N SER A 166  ? N SER A 212  O THR A 175  ? O THR A 221  
AE 1 2 N ASN A 195  ? N ASN A 250  O ILE A 200  ? O ILE A 255  
AE 2 3 N ASP A 205  ? N ASP A 260  O VAL A 210  ? O VAL A 265  
AE 3 4 O VAL A 213  ? O VAL A 268  N LEU A 251  ? N LEU A 412  
AF 1 2 N THR A 263  ? N THR A 433  O PHE A 271  ? O PHE A 441  
AF 2 3 N VAL A 276  ? N VAL A 446  O GLN A 281  ? O GLN A 451  
AF 3 4 N GLN A 288  ? N GLN A 458  O ILE A 294  ? O ILE A 467  
AG 1 2 N VAL A 309  ? N VAL A 482  O THR A 314  ? O THR A 487  
AG 2 3 N GLU A 319  ? N GLU A 492  O ASN A 323  ? O ASN A 496  
AG 3 4 O LEU A 326  ? O LEU A 499  N VAL A 333  ? N VAL A 506  
AH 1 2 N ALA A 693  ? N ALA A 1111 O THR A 698  ? O THR A 1116 
AI 1 2 N SER A 1128 ? N SER A 1573 O GLU A 1170 ? O GLU A 1615 
AJ 1 2 N VAL A 1177 ? N VAL A 1622 O LEU A 1249 ? O LEU A 1697 
AK 1 2 N LEU A 1206 ? N LEU A 1651 O LEU A 1189 ? O LEU A 1634 
AK 2 3 O LEU A 1192 ? O LEU A 1637 N LYS A 1219 ? N LYS A 1664 
AK 3 4 N VAL A 1223 ? N VAL A 1668 O GLU A 1230 ? O GLU A 1675 
BA 1 2 N ASN B 9    ? N ASN B 9    O LEU N 544  ? O LEU N 643  
BA 2 3 N VAL N 549  ? N VAL N 648  O LEU N 556  ? O LEU N 655  
BB 1 2 N VAL B 47   ? N VAL B 47   O PHE B 55   ? O PHE B 55   
IA 1 2 N VAL I 27   ? N VAL I 27   O ALA I 36   ? O ALA I 36   
IA 2 3 N LEU I 37   ? N LEU I 37   O LEU I 45   ? O LEU I 45   
IA 3 4 O LEU I 46   ? O LEU I 46   N VAL I 55   ? N VAL I 55   
IB 1 2 N ALA I 72   ? N ALA I 72   O ALA I 81   ? O ALA I 81   
IB 2 3 N PHE I 82   ? N PHE I 82   O VAL I 91   ? O VAL I 91   
IB 3 4 N LEU I 92   ? N LEU I 92   O HIS I 102  ? O HIS I 102  
IC 1 2 N MET I 116  ? N MET I 116  O ILE I 175  ? O ILE I 175  
IC 2 3 N LEU I 178  ? N LEU I 178  O GLU I 186  ? O GLU I 186  
IC 3 4 N ALA I 189  ? N ALA I 189  O PHE I 193  ? O PHE I 193  
ID 1 2 N CYS I 209  ? N CYS I 209  O SER I 218  ? O SER I 218  
ID 2 3 N VAL I 219  ? N VAL I 219  O PHE I 234  ? O PHE I 234  
ID 3 4 N GLN I 235  ? N GLN I 235  O ILE I 552  ? O ILE I 552  
IE 1 2 N SER I 229  ? N SER I 229  O ASP I 559  ? O ASP I 559  
IF 1 2 N ASN I 578  ? N ASN I 578  O LEU I 583  ? O LEU I 583  
IF 2 3 N ILE I 590  ? N ILE I 590  O LYS I 597  ? O LYS I 597  
IF 3 4 N ILE I 600  ? N ILE I 600  O ILE I 616  ? O ILE I 616  
IF 4 5 N PHE I 623  ? N PHE I 623  O ARG I 632  ? O ARG I 632  
IG 1 2 N ASN I 578  ? N ASN I 578  O LEU I 583  ? O LEU I 583  
IG 2 3 N ILE I 590  ? N ILE I 590  O LYS I 597  ? O LYS I 597  
IG 3 4 N ILE I 600  ? N ILE I 600  O ILE I 616  ? O ILE I 616  
IG 4 5 N LYS I 619  ? N LYS I 619  O ARG I 703  ? O ARG I 703  
IH 1 2 N ARG I 632  ? N ARG I 632  O PHE I 623  ? O PHE I 623  
II 1 2 N TYR I 644  ? N TYR I 644  O THR I 648  ? O THR I 648  
II 2 3 N LEU I 653  ? N LEU I 653  O LEU I 665  ? O LEU I 665  
II 3 4 N LEU I 666  ? N LEU I 666  O ARG I 712  ? O ARG I 712  
IJ 1 2 N ALA I 723  ? N ALA I 723  O CYS I 732  ? O CYS I 732  
IJ 2 3 N VAL I 733  ? N VAL I 733  O ARG I 742  ? O ARG I 742  
LA 1 2 N ARG L 23   ? N ARG L 23   O THR L 160  ? O THR L 160  
LA 2 3 N TYR L 159  ? N TYR L 159  O THR L 76   ? O THR L 76   
LA 3 4 N ILE L 79   ? N ILE L 79   O ILE L 120  ? O ILE L 120  
LB 1 2 N SER L 32   ? N SER L 32   O ASN L 65   ? O ASN L 65   
LB 2 3 N VAL L 74   ? N VAL L 74   O THR L 132  ? O THR L 132  
LB 3 4 N ALA L 140  ? N ALA L 140  O SER L 95   ? O SER L 95   
LB 4 5 N VAL L 98   ? N VAL L 98   O GLN L 106  ? O GLN L 106  
NA 1 2 N SER N 696  ? N SER N 811  O VAL N 699  ? O VAL N 814  
QA 1 2 N PHE Q 25   ? N PHE Q 53   O VAL Q 35   ? O VAL Q 63   
QA 2 3 N ILE Q 38   ? N ILE Q 66   O TYR Q 51   ? O TYR Q 79   
QA 3 4 N GLU Q 56   ? N GLU Q 84   O THR Q 67   ? O THR Q 95   
RA 1 2 N LEU R 84   ? N LEU R 179  O LEU R 368  ? O LEU R 463  
RA 2 3 N TRP R 371  ? N TRP R 466  O VAL R 359  ? O VAL R 454  
RA 3 4 N GLY R 362  ? N GLY R 457  O HIS R 349  ? O HIS R 444  
RB 1 2 N ASP R 99   ? N ASP R 194  O ALA R 107  ? O ALA R 202  
RB 2 3 N LEU R 110  ? N LEU R 205  O SER R 113  ? O SER R 208  
RB 3 4 N LEU R 116  ? N LEU R 211  O VAL R 125  ? O VAL R 220  
RC 1 2 N SER R 138  ? N SER R 233  O ALA R 147  ? O ALA R 242  
RC 2 3 N VAL R 148  ? N VAL R 243  O GLU R 156  ? O GLU R 251  
RC 3 4 N ASP R 159  ? N ASP R 254  O LYS R 164  ? O LYS R 259  
RD 1 2 N ASN R 182  ? N ASN R 277  O VAL R 185  ? O VAL R 280  
RD 2 3 N SER R 188  ? N SER R 283  O LEU R 196  ? O LEU R 291  
RD 3 4 N HIS R 197  ? N HIS R 292  O GLU R 208  ? O GLU R 303  
RE 1 2 N LYS R 221  ? N LYS R 316  O ALA R 230  ? O ALA R 325  
RE 2 3 N SER R 231  ? N SER R 326  O HIS R 239  ? O HIS R 334  
RE 3 4 N VAL R 240  ? N VAL R 335  O LEU R 250  ? O LEU R 345  
RF 1 2 N ALA R 263  ? N ALA R 358  O ALA R 273  ? O ALA R 368  
RF 2 3 N GLY R 276  ? N GLY R 371  O ARG R 282  ? O ARG R 377  
RF 3 4 N ASN R 287  ? N ASN R 382  O ILE R 292  ? O ILE R 387  
RG 1 2 N VAL R 307  ? N VAL R 402  O VAL R 316  ? O VAL R 411  
RG 2 3 N THR R 317  ? N THR R 412  O THR R 327  ? O THR R 422  
RG 3 4 O LEU R 328  ? O LEU R 423  N ILE R 337  ? N ILE R 432  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 101' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 102' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 103' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS B 23 ? CYS B 23 . ? 1_555 ? 
2  AC1 4 CYS B 26 ? CYS B 26 . ? 1_555 ? 
3  AC1 4 HIS B 56 ? HIS B 56 . ? 1_555 ? 
4  AC1 4 CYS B 59 ? CYS B 59 . ? 1_555 ? 
5  AC2 4 CYS B 51 ? CYS B 51 . ? 1_555 ? 
6  AC2 4 HIS B 53 ? HIS B 53 . ? 1_555 ? 
7  AC2 4 CYS B 73 ? CYS B 73 . ? 1_555 ? 
8  AC2 4 CYS B 76 ? CYS B 76 . ? 1_555 ? 
9  AC3 4 CYS B 34 ? CYS B 34 . ? 1_555 ? 
10 AC3 4 CYS B 37 ? CYS B 37 . ? 1_555 ? 
11 AC3 4 CYS B 44 ? CYS B 44 . ? 1_555 ? 
12 AC3 4 HIS B 58 ? HIS B 58 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5A31 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5A31 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A  1  1    ? 259.186 230.027 151.288 1.00   165.89 ? 11   MET A N   1 
ATOM   2     C  CA  . MET A  1  1    ? 257.715 230.179 151.635 1.00   208.15 ? 11   MET A CA  1 
ATOM   3     C  C   . MET A  1  1    ? 256.851 228.834 151.669 1.00   217.29 ? 11   MET A C   1 
ATOM   4     O  O   . MET A  1  1    ? 257.415 227.731 151.527 1.00   206.51 ? 11   MET A O   1 
ATOM   5     C  CB  . MET A  1  1    ? 257.092 231.263 150.728 1.00   230.65 ? 11   MET A CB  1 
ATOM   6     C  CG  . MET A  1  1    ? 257.982 232.488 150.419 1.00   249.66 ? 11   MET A CG  1 
ATOM   7     S  SD  . MET A  1  1    ? 258.781 233.326 151.822 1.00   271.53 ? 11   MET A SD  1 
ATOM   8     C  CE  . MET A  1  1    ? 259.172 234.992 151.215 1.00   176.04 ? 11   MET A CE  1 
ATOM   9     N  N   . ILE A  1  2    ? 255.503 228.938 151.780 1.00   191.65 ? 12   ILE A N   1 
ATOM   10    C  CA  . ILE A  1  2    ? 254.591 227.979 152.558 1.00   168.68 ? 12   ILE A CA  1 
ATOM   11    C  C   . ILE A  1  2    ? 254.585 226.509 152.162 1.00   167.86 ? 12   ILE A C   1 
ATOM   12    O  O   . ILE A  1  2    ? 254.642 226.214 150.979 1.00   206.37 ? 12   ILE A O   1 
ATOM   13    C  CB  . ILE A  1  2    ? 253.081 228.385 152.520 1.00   151.78 ? 12   ILE A CB  1 
ATOM   14    C  CG1 . ILE A  1  2    ? 252.876 229.847 152.948 1.00   182.41 ? 12   ILE A CG1 1 
ATOM   15    C  CG2 . ILE A  1  2    ? 252.216 227.486 153.422 1.00   129.87 ? 12   ILE A CG2 1 
ATOM   16    C  CD1 . ILE A  1  2    ? 251.509 230.410 152.616 1.00   199.65 ? 12   ILE A CD1 1 
ATOM   17    N  N   . ALA A  1  3    ? 254.447 225.603 153.144 1.00   152.08 ? 13   ALA A N   1 
ATOM   18    C  CA  . ALA A  1  3    ? 254.465 224.151 152.891 1.00   174.67 ? 13   ALA A CA  1 
ATOM   19    C  C   . ALA A  1  3    ? 253.313 223.349 153.506 1.00   180.25 ? 13   ALA A C   1 
ATOM   20    O  O   . ALA A  1  3    ? 253.271 223.137 154.725 1.00   177.78 ? 13   ALA A O   1 
ATOM   21    C  CB  . ALA A  1  3    ? 255.791 223.557 153.343 1.00   196.38 ? 13   ALA A CB  1 
ATOM   22    N  N   . ALA A  1  4    ? 252.416 222.870 152.637 1.00   187.65 ? 14   ALA A N   1 
ATOM   23    C  CA  . ALA A  1  4    ? 251.321 221.953 152.993 1.00   180.81 ? 14   ALA A CA  1 
ATOM   24    C  C   . ALA A  1  4    ? 251.880 220.629 153.515 1.00   173.43 ? 14   ALA A C   1 
ATOM   25    O  O   . ALA A  1  4    ? 252.869 220.116 152.987 1.00   174.45 ? 14   ALA A O   1 
ATOM   26    C  CB  . ALA A  1  4    ? 250.416 221.719 151.793 1.00   194.10 ? 14   ALA A CB  1 
ATOM   27    N  N   . ARG A  1  5    ? 251.222 220.080 154.536 1.00   165.01 ? 15   ARG A N   1 
ATOM   28    C  CA  . ARG A  1  5    ? 251.912 219.269 155.530 1.00   188.43 ? 15   ARG A CA  1 
ATOM   29    C  C   . ARG A  1  5    ? 252.083 217.822 155.149 1.00   197.57 ? 15   ARG A C   1 
ATOM   30    O  O   . ARG A  1  5    ? 253.057 217.196 155.567 1.00   221.39 ? 15   ARG A O   1 
ATOM   31    C  CB  . ARG A  1  5    ? 251.249 219.382 156.906 1.00   201.36 ? 15   ARG A CB  1 
ATOM   32    C  CG  . ARG A  1  5    ? 251.436 220.751 157.567 1.00   222.48 ? 15   ARG A CG  1 
ATOM   33    C  CD  . ARG A  1  5    ? 251.618 220.662 159.076 1.00   228.63 ? 15   ARG A CD  1 
ATOM   34    N  NE  . ARG A  1  5    ? 250.580 219.835 159.692 1.00   232.09 ? 15   ARG A NE  1 
ATOM   35    C  CZ  . ARG A  1  5    ? 249.317 220.210 159.894 1.00   221.35 ? 15   ARG A CZ  1 
ATOM   36    N  NH1 . ARG A  1  5    ? 248.894 221.417 159.538 1.00   198.26 ? 15   ARG A NH1 1 
ATOM   37    N  NH2 . ARG A  1  5    ? 248.460 219.358 160.459 1.00   231.97 ? 15   ARG A NH2 1 
ATOM   38    N  N   . ASP A  1  6    ? 251.157 217.283 154.370 1.00   197.85 ? 16   ASP A N   1 
ATOM   39    C  CA  . ASP A  1  6    ? 251.306 215.900 153.903 1.00   214.64 ? 16   ASP A CA  1 
ATOM   40    C  C   . ASP A  1  6    ? 250.820 215.693 152.491 1.00   225.30 ? 16   ASP A C   1 
ATOM   41    O  O   . ASP A  1  6    ? 250.084 216.505 151.925 1.00   241.48 ? 16   ASP A O   1 
ATOM   42    C  CB  . ASP A  1  6    ? 250.583 214.920 154.829 1.00   196.25 ? 16   ASP A CB  1 
ATOM   43    C  CG  . ASP A  1  6    ? 249.146 215.308 155.081 1.00   192.77 ? 16   ASP A CG  1 
ATOM   44    O  OD1 . ASP A  1  6    ? 248.538 215.997 154.239 1.00   190.10 ? 16   ASP A OD1 1 
ATOM   45    O  OD2 . ASP A  1  6    ? 248.619 214.929 156.141 1.00   228.96 ? 16   ASP A OD2 1 
ATOM   46    N  N   . LEU A  1  7    ? 251.256 214.573 151.938 1.00   213.40 ? 17   LEU A N   1 
ATOM   47    C  CA  . LEU A  1  7    ? 250.720 214.070 150.695 1.00   208.47 ? 17   LEU A CA  1 
ATOM   48    C  C   . LEU A  1  7    ? 250.055 212.755 151.010 1.00   179.77 ? 17   LEU A C   1 
ATOM   49    O  O   . LEU A  1  7    ? 250.531 211.988 151.828 1.00   193.99 ? 17   LEU A O   1 
ATOM   50    C  CB  . LEU A  1  7    ? 251.826 213.887 149.658 1.00   216.35 ? 17   LEU A CB  1 
ATOM   51    C  CG  . LEU A  1  7    ? 252.581 215.175 149.309 1.00   238.60 ? 17   LEU A CG  1 
ATOM   52    C  CD1 . LEU A  1  7    ? 253.737 214.912 148.337 1.00   256.45 ? 17   LEU A CD1 1 
ATOM   53    C  CD2 . LEU A  1  7    ? 251.614 216.225 148.758 1.00   237.41 ? 17   LEU A CD2 1 
ATOM   54    N  N   . GLN A  1  8    ? 248.913 212.523 150.393 1.00   165.30 ? 18   GLN A N   1 
ATOM   55    C  CA  . GLN A  1  8    ? 248.341 211.199 150.333 1.00   174.34 ? 18   GLN A CA  1 
ATOM   56    C  C   . GLN A  1  8    ? 247.910 211.043 148.902 1.00   192.84 ? 18   GLN A C   1 
ATOM   57    O  O   . GLN A  1  8    ? 247.235 211.919 148.370 1.00   211.01 ? 18   GLN A O   1 
ATOM   58    C  CB  . GLN A  1  8    ? 247.143 211.088 151.256 1.00   181.40 ? 18   GLN A CB  1 
ATOM   59    C  CG  . GLN A  1  8    ? 247.520 210.868 152.711 1.00   202.79 ? 18   GLN A CG  1 
ATOM   60    C  CD  . GLN A  1  8    ? 246.542 211.500 153.695 1.00   247.34 ? 18   GLN A CD  1 
ATOM   61    O  OE1 . GLN A  1  8    ? 245.540 212.126 153.310 1.00   262.88 ? 18   GLN A OE1 1 
ATOM   62    N  NE2 . GLN A  1  8    ? 246.833 211.340 154.984 1.00   263.01 ? 18   GLN A NE2 1 
ATOM   63    N  N   . GLU A  1  9    ? 248.332 209.960 148.256 1.00   203.18 ? 19   GLU A N   1 
ATOM   64    C  CA  . GLU A  1  9    ? 247.822 209.629 146.922 1.00   189.79 ? 19   GLU A CA  1 
ATOM   65    C  C   . GLU A  1  9    ? 246.402 209.141 147.105 1.00   167.67 ? 19   GLU A C   1 
ATOM   66    O  O   . GLU A  1  9    ? 246.170 208.197 147.832 1.00   194.48 ? 19   GLU A O   1 
ATOM   67    C  CB  . GLU A  1  9    ? 248.710 208.592 146.242 1.00   229.17 ? 19   GLU A CB  1 
ATOM   68    C  CG  . GLU A  1  9    ? 250.018 209.212 145.738 1.00   282.20 ? 19   GLU A CG  1 
ATOM   69    C  CD  . GLU A  1  9    ? 251.273 208.385 145.998 1.00   327.78 ? 19   GLU A CD  1 
ATOM   70    O  OE1 . GLU A  1  9    ? 251.170 207.174 146.303 1.00   380.82 ? 19   GLU A OE1 1 
ATOM   71    O  OE2 . GLU A  1  9    ? 252.378 208.963 145.893 1.00   326.52 ? 19   GLU A OE2 1 
ATOM   72    N  N   . PHE A  1  10   ? 245.457 209.834 146.483 1.00   178.10 ? 20   PHE A N   1 
ATOM   73    C  CA  . PHE A  1  10   ? 244.024 209.739 146.800 1.00   154.60 ? 20   PHE A CA  1 
ATOM   74    C  C   . PHE A  1  10   ? 243.367 209.261 145.565 1.00   150.01 ? 20   PHE A C   1 
ATOM   75    O  O   . PHE A  1  10   ? 243.281 210.017 144.595 1.00   167.54 ? 20   PHE A O   1 
ATOM   76    C  CB  . PHE A  1  10   ? 243.478 211.126 147.127 1.00   146.96 ? 20   PHE A CB  1 
ATOM   77    C  CG  . PHE A  1  10   ? 241.983 211.250 147.075 1.00   143.23 ? 20   PHE A CG  1 
ATOM   78    C  CD1 . PHE A  1  10   ? 241.180 210.498 147.914 1.00   170.24 ? 20   PHE A CD1 1 
ATOM   79    C  CD2 . PHE A  1  10   ? 241.378 212.169 146.222 1.00   160.97 ? 20   PHE A CD2 1 
ATOM   80    C  CE1 . PHE A  1  10   ? 239.795 210.647 147.885 1.00   181.07 ? 20   PHE A CE1 1 
ATOM   81    C  CE2 . PHE A  1  10   ? 239.997 212.324 146.191 1.00   169.07 ? 20   PHE A CE2 1 
ATOM   82    C  CZ  . PHE A  1  10   ? 239.202 211.557 147.018 1.00   161.20 ? 20   PHE A CZ  1 
ATOM   83    N  N   . VAL A  1  11   ? 242.937 208.011 145.576 1.00   154.29 ? 21   VAL A N   1 
ATOM   84    C  CA  . VAL A  1  11   ? 242.035 207.520 144.544 1.00   176.63 ? 21   VAL A CA  1 
ATOM   85    C  C   . VAL A  1  11   ? 240.682 207.340 145.231 1.00   179.48 ? 21   VAL A C   1 
ATOM   86    O  O   . VAL A  1  11   ? 240.632 206.750 146.315 1.00   213.87 ? 21   VAL A O   1 
ATOM   87    C  CB  . VAL A  1  11   ? 242.552 206.251 143.822 1.00   187.00 ? 21   VAL A CB  1 
ATOM   88    C  CG1 . VAL A  1  11   ? 243.064 205.197 144.805 1.00   205.38 ? 21   VAL A CG1 1 
ATOM   89    C  CG2 . VAL A  1  11   ? 241.478 205.689 142.881 1.00   187.42 ? 21   VAL A CG2 1 
ATOM   90    N  N   . PRO A  1  12   ? 239.596 207.905 144.649 1.00   168.78 ? 22   PRO A N   1 
ATOM   91    C  CA  . PRO A  1  12   ? 238.317 207.741 145.300 1.00   182.85 ? 22   PRO A CA  1 
ATOM   92    C  C   . PRO A  1  12   ? 237.974 206.265 145.323 1.00   181.79 ? 22   PRO A C   1 
ATOM   93    O  O   . PRO A  1  12   ? 238.167 205.569 144.311 1.00   176.46 ? 22   PRO A O   1 
ATOM   94    C  CB  . PRO A  1  12   ? 237.369 208.571 144.429 1.00   191.90 ? 22   PRO A CB  1 
ATOM   95    C  CG  . PRO A  1  12   ? 238.070 208.725 143.137 1.00   175.43 ? 22   PRO A CG  1 
ATOM   96    C  CD  . PRO A  1  12   ? 239.491 208.834 143.514 1.00   177.09 ? 22   PRO A CD  1 
ATOM   97    N  N   . PHE A  1  13   ? 237.531 205.810 146.495 1.00   152.13 ? 23   PHE A N   1 
ATOM   98    C  CA  . PHE A  1  13   ? 237.471 204.397 146.809 1.00   147.03 ? 23   PHE A CA  1 
ATOM   99    C  C   . PHE A  1  13   ? 236.512 203.702 145.914 1.00   160.46 ? 23   PHE A C   1 
ATOM   100   O  O   . PHE A  1  13   ? 236.754 202.578 145.482 1.00   194.99 ? 23   PHE A O   1 
ATOM   101   C  CB  . PHE A  1  13   ? 236.982 204.217 148.212 1.00   146.66 ? 23   PHE A CB  1 
ATOM   102   C  CG  . PHE A  1  13   ? 237.194 202.847 148.763 1.00   163.90 ? 23   PHE A CG  1 
ATOM   103   C  CD1 . PHE A  1  13   ? 238.475 202.271 148.762 1.00   180.64 ? 23   PHE A CD1 1 
ATOM   104   C  CD2 . PHE A  1  13   ? 236.134 202.149 149.343 1.00   159.66 ? 23   PHE A CD2 1 
ATOM   105   C  CE1 . PHE A  1  13   ? 238.687 201.020 149.297 1.00   215.85 ? 23   PHE A CE1 1 
ATOM   106   C  CE2 . PHE A  1  13   ? 236.346 200.894 149.882 1.00   197.24 ? 23   PHE A CE2 1 
ATOM   107   C  CZ  . PHE A  1  13   ? 237.619 200.329 149.855 1.00   236.34 ? 23   PHE A CZ  1 
ATOM   108   N  N   . GLY A  1  14   ? 235.414 204.396 145.652 1.00   151.09 ? 24   GLY A N   1 
ATOM   109   C  CA  . GLY A  1  14   ? 234.432 203.962 144.692 1.00   166.47 ? 24   GLY A CA  1 
ATOM   110   C  C   . GLY A  1  14   ? 234.975 203.363 143.403 1.00   158.36 ? 24   GLY A C   1 
ATOM   111   O  O   . GLY A  1  14   ? 234.478 202.334 142.980 1.00   221.94 ? 24   GLY A O   1 
ATOM   112   N  N   . ARG A  1  15   ? 235.996 203.971 142.799 1.00   153.56 ? 25   ARG A N   1 
ATOM   113   C  CA  . ARG A  1  15   ? 236.535 203.501 141.514 1.00   173.22 ? 25   ARG A CA  1 
ATOM   114   C  C   . ARG A  1  15   ? 237.028 202.074 141.588 1.00   180.30 ? 25   ARG A C   1 
ATOM   115   O  O   . ARG A  1  15   ? 236.626 201.208 140.796 1.00   226.67 ? 25   ARG A O   1 
ATOM   116   C  CB  . ARG A  1  15   ? 237.700 204.386 141.053 1.00   188.90 ? 25   ARG A CB  1 
ATOM   117   C  CG  . ARG A  1  15   ? 238.293 203.941 139.722 1.00   192.31 ? 25   ARG A CG  1 
ATOM   118   C  CD  . ARG A  1  15   ? 238.755 205.098 138.860 1.00   190.70 ? 25   ARG A CD  1 
ATOM   119   N  NE  . ARG A  1  15   ? 239.988 205.668 139.382 1.00   183.96 ? 25   ARG A NE  1 
ATOM   120   C  CZ  . ARG A  1  15   ? 240.196 206.954 139.665 1.00   213.60 ? 25   ARG A CZ  1 
ATOM   121   N  NH1 . ARG A  1  15   ? 239.267 207.899 139.474 1.00   190.85 ? 25   ARG A NH1 1 
ATOM   122   N  NH2 . ARG A  1  15   ? 241.384 207.308 140.133 1.00   257.64 ? 25   ARG A NH2 1 
ATOM   123   N  N   . ASP A  1  16   ? 237.908 201.850 142.548 1.00   166.82 ? 26   ASP A N   1 
ATOM   124   C  CA  . ASP A  1  16   ? 238.405 200.533 142.855 1.00   202.65 ? 26   ASP A CA  1 
ATOM   125   C  C   . ASP A  1  16   ? 237.246 199.540 143.047 1.00   198.92 ? 26   ASP A C   1 
ATOM   126   O  O   . ASP A  1  16   ? 237.167 198.488 142.400 1.00   228.94 ? 26   ASP A O   1 
ATOM   127   C  CB  . ASP A  1  16   ? 239.278 200.658 144.121 1.00   231.80 ? 26   ASP A CB  1 
ATOM   128   C  CG  . ASP A  1  16   ? 239.560 199.334 144.788 1.00   284.45 ? 26   ASP A CG  1 
ATOM   129   O  OD1 . ASP A  1  16   ? 240.245 198.497 144.165 1.00   338.34 ? 26   ASP A OD1 1 
ATOM   130   O  OD2 . ASP A  1  16   ? 239.108 199.144 145.945 1.00   291.11 ? 26   ASP A OD2 1 
ATOM   131   N  N   . HIS A  1  17   ? 236.339 199.927 143.919 1.00   172.68 ? 27   HIS A N   1 
ATOM   132   C  CA  . HIS A  1  17   ? 235.338 199.034 144.463 1.00   164.34 ? 27   HIS A CA  1 
ATOM   133   C  C   . HIS A  1  17   ? 234.181 198.746 143.468 1.00   156.73 ? 27   HIS A C   1 
ATOM   134   O  O   . HIS A  1  17   ? 233.603 197.659 143.483 1.00   175.19 ? 27   HIS A O   1 
ATOM   135   C  CB  . HIS A  1  17   ? 234.883 199.663 145.784 1.00   166.10 ? 27   HIS A CB  1 
ATOM   136   C  CG  . HIS A  1  17   ? 233.775 198.947 146.451 1.00   158.33 ? 27   HIS A CG  1 
ATOM   137   N  ND1 . HIS A  1  17   ? 232.455 199.171 146.128 1.00   137.96 ? 27   HIS A ND1 1 
ATOM   138   C  CD2 . HIS A  1  17   ? 233.781 198.023 147.434 1.00   156.91 ? 27   HIS A CD2 1 
ATOM   139   C  CE1 . HIS A  1  17   ? 231.689 198.405 146.877 1.00   146.70 ? 27   HIS A CE1 1 
ATOM   140   N  NE2 . HIS A  1  17   ? 232.469 197.694 147.675 1.00   173.29 ? 27   HIS A NE2 1 
ATOM   141   N  N   . CYS A  1  18   ? 233.866 199.730 142.622 1.00   151.84 ? 28   CYS A N   1 
ATOM   142   C  CA  . CYS A  1  18   ? 232.898 199.622 141.517 1.00   157.63 ? 28   CYS A CA  1 
ATOM   143   C  C   . CYS A  1  18   ? 233.285 198.623 140.477 1.00   176.49 ? 28   CYS A C   1 
ATOM   144   O  O   . CYS A  1  18   ? 232.419 197.977 139.883 1.00   201.07 ? 28   CYS A O   1 
ATOM   145   C  CB  . CYS A  1  18   ? 232.801 200.932 140.721 1.00   182.27 ? 28   CYS A CB  1 
ATOM   146   S  SG  . CYS A  1  18   ? 231.653 202.156 141.363 1.00   252.99 ? 28   CYS A SG  1 
ATOM   147   N  N   . LYS A  1  19   ? 234.571 198.564 140.183 1.00   179.49 ? 29   LYS A N   1 
ATOM   148   C  CA  . LYS A  1  19   ? 235.057 197.667 139.162 1.00   184.54 ? 29   LYS A CA  1 
ATOM   149   C  C   . LYS A  1  19   ? 234.595 196.227 139.431 1.00   173.28 ? 29   LYS A C   1 
ATOM   150   O  O   . LYS A  1  19   ? 234.054 195.581 138.539 1.00   190.18 ? 29   LYS A O   1 
ATOM   151   C  CB  . LYS A  1  19   ? 236.576 197.814 139.020 1.00   192.57 ? 29   LYS A CB  1 
ATOM   152   C  CG  . LYS A  1  19   ? 237.343 196.610 138.514 1.00   205.18 ? 29   LYS A CG  1 
ATOM   153   C  CD  . LYS A  1  19   ? 238.750 197.022 138.082 1.00   215.26 ? 29   LYS A CD  1 
ATOM   154   C  CE  . LYS A  1  19   ? 239.850 196.226 138.775 1.00   220.50 ? 29   LYS A CE  1 
ATOM   155   N  NZ  . LYS A  1  19   ? 240.216 196.811 140.097 1.00   222.73 ? 29   LYS A NZ  1 
ATOM   156   N  N   . HIS A  1  20   ? 234.754 195.753 140.660 1.00   155.33 ? 30   HIS A N   1 
ATOM   157   C  CA  . HIS A  1  20   ? 234.371 194.385 140.997 1.00   184.52 ? 30   HIS A CA  1 
ATOM   158   C  C   . HIS A  1  20   ? 232.976 194.179 141.571 1.00   184.18 ? 30   HIS A C   1 
ATOM   159   O  O   . HIS A  1  20   ? 232.592 193.050 141.865 1.00   200.14 ? 30   HIS A O   1 
ATOM   160   C  CB  . HIS A  1  20   ? 235.431 193.759 141.892 1.00   214.87 ? 30   HIS A CB  1 
ATOM   161   C  CG  . HIS A  1  20   ? 236.574 193.208 141.118 1.00   247.29 ? 30   HIS A CG  1 
ATOM   162   N  ND1 . HIS A  1  20   ? 237.862 193.676 141.257 1.00   260.31 ? 30   HIS A ND1 1 
ATOM   163   C  CD2 . HIS A  1  20   ? 236.610 192.269 140.144 1.00   256.08 ? 30   HIS A CD2 1 
ATOM   164   C  CE1 . HIS A  1  20   ? 238.651 193.017 140.427 1.00   284.30 ? 30   HIS A CE1 1 
ATOM   165   N  NE2 . HIS A  1  20   ? 237.916 192.160 139.739 1.00   281.77 ? 30   HIS A NE2 1 
ATOM   166   N  N   . HIS A  1  21   ? 232.206 195.248 141.699 1.00   173.63 ? 31   HIS A N   1 
ATOM   167   C  CA  . HIS A  1  21   ? 230.812 195.155 142.142 1.00   134.43 ? 31   HIS A CA  1 
ATOM   168   C  C   . HIS A  1  21   ? 229.972 194.245 141.328 1.00   134.74 ? 31   HIS A C   1 
ATOM   169   O  O   . HIS A  1  21   ? 230.297 194.033 140.162 1.00   167.07 ? 31   HIS A O   1 
ATOM   170   C  CB  . HIS A  1  21   ? 230.132 196.461 141.932 1.00   123.02 ? 31   HIS A CB  1 
ATOM   171   C  CG  . HIS A  1  21   ? 229.288 196.844 143.063 1.00   125.24 ? 31   HIS A CG  1 
ATOM   172   N  ND1 . HIS A  1  21   ? 227.948 197.084 142.932 1.00   148.38 ? 31   HIS A ND1 1 
ATOM   173   C  CD2 . HIS A  1  21   ? 229.591 197.019 144.366 1.00   140.29 ? 31   HIS A CD2 1 
ATOM   174   C  CE1 . HIS A  1  21   ? 227.460 197.423 144.111 1.00   166.03 ? 31   HIS A CE1 1 
ATOM   175   N  NE2 . HIS A  1  21   ? 228.431 197.362 145.004 1.00   151.19 ? 31   HIS A NE2 1 
ATOM   176   N  N   . PRO A  1  22   ? 228.834 193.782 141.889 1.00   146.77 ? 32   PRO A N   1 
ATOM   177   C  CA  . PRO A  1  22   ? 227.850 193.047 141.088 1.00   162.43 ? 32   PRO A CA  1 
ATOM   178   C  C   . PRO A  1  22   ? 227.390 193.856 139.910 1.00   186.55 ? 32   PRO A C   1 
ATOM   179   O  O   . PRO A  1  22   ? 227.545 193.386 138.785 1.00   243.08 ? 32   PRO A O   1 
ATOM   180   C  CB  . PRO A  1  22   ? 226.695 192.780 142.055 1.00   148.00 ? 32   PRO A CB  1 
ATOM   181   C  CG  . PRO A  1  22   ? 227.016 193.541 143.268 1.00   167.41 ? 32   PRO A CG  1 
ATOM   182   C  CD  . PRO A  1  22   ? 228.503 193.654 143.306 1.00   155.72 ? 32   PRO A CD  1 
ATOM   183   N  N   . ASN A  1  23   ? 226.843 195.047 140.143 1.00   160.58 ? 33   ASN A N   1 
ATOM   184   C  CA  . ASN A  1  23   ? 226.713 196.029 139.074 1.00   168.55 ? 33   ASN A CA  1 
ATOM   185   C  C   . ASN A  1  23   ? 225.521 195.781 138.216 1.00   158.50 ? 33   ASN A C   1 
ATOM   186   O  O   . ASN A  1  23   ? 225.071 196.713 137.595 1.00   201.80 ? 33   ASN A O   1 
ATOM   187   C  CB  . ASN A  1  23   ? 227.991 196.127 138.164 1.00   198.07 ? 33   ASN A CB  1 
ATOM   188   C  CG  . ASN A  1  23   ? 227.775 196.937 136.872 1.00   202.57 ? 33   ASN A CG  1 
ATOM   189   O  OD1 . ASN A  1  23   ? 227.460 198.123 136.909 1.00   185.06 ? 33   ASN A OD1 1 
ATOM   190   N  ND2 . ASN A  1  23   ? 227.966 196.286 135.725 1.00   219.79 ? 33   ASN A ND2 1 
ATOM   191   N  N   . ALA A  1  24   ? 225.002 194.563 138.128 1.00   163.10 ? 34   ALA A N   1 
ATOM   192   C  CA  . ALA A  1  24   ? 223.843 194.314 137.264 1.00   185.27 ? 34   ALA A CA  1 
ATOM   193   C  C   . ALA A  1  24   ? 222.758 193.573 138.045 1.00   210.35 ? 34   ALA A C   1 
ATOM   194   O  O   . ALA A  1  24   ? 223.047 192.648 138.793 1.00   272.48 ? 34   ALA A O   1 
ATOM   195   C  CB  . ALA A  1  24   ? 224.265 193.550 136.010 1.00   169.78 ? 34   ALA A CB  1 
ATOM   196   N  N   . LEU A  1  25   ? 221.508 193.998 137.900 1.00   196.50 ? 35   LEU A N   1 
ATOM   197   C  CA  . LEU A  1  25   ? 220.397 193.363 138.618 1.00   203.32 ? 35   LEU A CA  1 
ATOM   198   C  C   . LEU A  1  25   ? 219.433 192.974 137.535 1.00   214.64 ? 35   LEU A C   1 
ATOM   199   O  O   . LEU A  1  25   ? 218.889 193.849 136.858 1.00   263.29 ? 35   LEU A O   1 
ATOM   200   C  CB  . LEU A  1  25   ? 219.726 194.316 139.621 1.00   214.44 ? 35   LEU A CB  1 
ATOM   201   C  CG  . LEU A  1  25   ? 220.411 195.658 139.929 1.00   221.05 ? 35   LEU A CG  1 
ATOM   202   C  CD1 . LEU A  1  25   ? 219.467 196.592 140.684 1.00   204.26 ? 35   LEU A CD1 1 
ATOM   203   C  CD2 . LEU A  1  25   ? 221.717 195.446 140.691 1.00   241.35 ? 35   LEU A CD2 1 
ATOM   204   N  N   . ASN A  1  26   ? 219.262 191.677 137.319 1.00   210.32 ? 36   ASN A N   1 
ATOM   205   C  CA  . ASN A  1  26   ? 218.295 191.210 136.337 1.00   228.84 ? 36   ASN A CA  1 
ATOM   206   C  C   . ASN A  1  26   ? 216.983 190.946 137.062 1.00   217.80 ? 36   ASN A C   1 
ATOM   207   O  O   . ASN A  1  26   ? 216.637 189.818 137.383 1.00   255.43 ? 36   ASN A O   1 
ATOM   208   C  CB  . ASN A  1  26   ? 218.826 190.044 135.446 1.00   266.75 ? 36   ASN A CB  1 
ATOM   209   C  CG  . ASN A  1  26   ? 218.824 188.661 136.125 1.00   307.90 ? 36   ASN A CG  1 
ATOM   210   O  OD1 . ASN A  1  26   ? 218.677 187.637 135.440 1.00   311.83 ? 36   ASN A OD1 1 
ATOM   211   N  ND2 . ASN A  1  26   ? 219.012 188.616 137.448 1.00   320.04 ? 36   ASN A ND2 1 
ATOM   212   N  N   . LEU A  1  27   ? 216.262 192.022 137.342 1.00   199.46 ? 37   LEU A N   1 
ATOM   213   C  CA  . LEU A  1  27   ? 214.944 191.907 137.958 1.00   183.49 ? 37   LEU A CA  1 
ATOM   214   C  C   . LEU A  1  27   ? 213.980 191.271 136.972 1.00   158.46 ? 37   LEU A C   1 
ATOM   215   O  O   . LEU A  1  27   ? 213.072 190.540 137.364 1.00   146.43 ? 37   LEU A O   1 
ATOM   216   C  CB  . LEU A  1  27   ? 214.431 193.280 138.426 1.00   193.27 ? 37   LEU A CB  1 
ATOM   217   C  CG  . LEU A  1  27   ? 213.746 193.259 139.796 1.00   196.41 ? 37   LEU A CG  1 
ATOM   218   C  CD1 . LEU A  1  27   ? 213.497 194.678 140.300 1.00   212.87 ? 37   LEU A CD1 1 
ATOM   219   C  CD2 . LEU A  1  27   ? 212.464 192.444 139.754 1.00   186.40 ? 37   LEU A CD2 1 
ATOM   220   N  N   . GLN A  1  28   ? 214.206 191.536 135.690 1.00   144.74 ? 38   GLN A N   1 
ATOM   221   C  CA  . GLN A  1  28   ? 213.344 191.056 134.631 1.00   150.10 ? 38   GLN A CA  1 
ATOM   222   C  C   . GLN A  1  28   ? 214.009 189.906 133.855 1.00   140.42 ? 38   GLN A C   1 
ATOM   223   O  O   . GLN A  1  28   ? 214.524 190.058 132.734 1.00   156.71 ? 38   GLN A O   1 
ATOM   224   C  CB  . GLN A  1  28   ? 213.043 192.242 133.747 1.00   159.50 ? 38   GLN A CB  1 
ATOM   225   C  CG  . GLN A  1  28   ? 211.939 192.034 132.756 1.00   147.50 ? 38   GLN A CG  1 
ATOM   226   C  CD  . GLN A  1  28   ? 212.112 193.008 131.651 1.00   162.55 ? 38   GLN A CD  1 
ATOM   227   O  OE1 . GLN A  1  28   ? 212.673 192.671 130.603 1.00   195.84 ? 38   GLN A OE1 1 
ATOM   228   N  NE2 . GLN A  1  28   ? 211.724 194.257 131.903 1.00   169.07 ? 38   GLN A NE2 1 
ATOM   229   N  N   . LEU A  1  29   ? 213.980 188.731 134.452 1.00   120.74 ? 39   LEU A N   1 
ATOM   230   C  CA  . LEU A  1  29   ? 214.814 187.663 133.937 1.00   120.06 ? 39   LEU A CA  1 
ATOM   231   C  C   . LEU A  1  29   ? 214.172 186.990 132.770 1.00   149.54 ? 39   LEU A C   1 
ATOM   232   O  O   . LEU A  1  29   ? 214.872 186.745 131.796 1.00   225.68 ? 39   LEU A O   1 
ATOM   233   C  CB  . LEU A  1  29   ? 215.180 186.608 134.959 1.00   118.23 ? 39   LEU A CB  1 
ATOM   234   C  CG  . LEU A  1  29   ? 214.266 186.434 136.152 1.00   124.31 ? 39   LEU A CG  1 
ATOM   235   C  CD1 . LEU A  1  29   ? 214.133 184.988 136.550 1.00   147.50 ? 39   LEU A CD1 1 
ATOM   236   C  CD2 . LEU A  1  29   ? 214.807 187.276 137.295 1.00   138.70 ? 39   LEU A CD2 1 
ATOM   237   N  N   . ARG A  1  30   ? 212.874 186.671 132.850 1.00   144.93 ? 40   ARG A N   1 
ATOM   238   C  CA  . ARG A  1  30   ? 212.180 185.920 131.769 1.00   141.06 ? 40   ARG A CA  1 
ATOM   239   C  C   . ARG A  1  30   ? 212.041 186.690 130.413 1.00   164.30 ? 40   ARG A C   1 
ATOM   240   O  O   . ARG A  1  30   ? 211.416 187.767 130.386 1.00   189.69 ? 40   ARG A O   1 
ATOM   241   C  CB  . ARG A  1  30   ? 210.789 185.510 132.251 1.00   129.25 ? 40   ARG A CB  1 
ATOM   242   C  CG  . ARG A  1  30   ? 210.779 184.509 133.383 1.00   133.45 ? 40   ARG A CG  1 
ATOM   243   C  CD  . ARG A  1  30   ? 209.372 184.305 133.953 1.00   131.68 ? 40   ARG A CD  1 
ATOM   244   N  NE  . ARG A  1  30   ? 209.354 183.147 134.853 1.00   131.66 ? 40   ARG A NE  1 
ATOM   245   C  CZ  . ARG A  1  30   ? 209.203 181.873 134.475 1.00   165.22 ? 40   ARG A CZ  1 
ATOM   246   N  NH1 . ARG A  1  30   ? 208.968 181.558 133.191 1.00   187.97 ? 40   ARG A NH1 1 
ATOM   247   N  NH2 . ARG A  1  30   ? 209.231 180.893 135.390 1.00   155.21 ? 40   ARG A NH2 1 
ATOM   248   N  N   . GLN A  1  31   ? 212.594 186.142 129.306 1.00   164.27 ? 41   GLN A N   1 
ATOM   249   C  CA  . GLN A  1  31   ? 212.458 186.750 127.957 1.00   168.43 ? 41   GLN A CA  1 
ATOM   250   C  C   . GLN A  1  31   ? 211.419 186.010 127.171 1.00   174.00 ? 41   GLN A C   1 
ATOM   251   O  O   . GLN A  1  31   ? 211.273 184.796 127.262 1.00   210.46 ? 41   GLN A O   1 
ATOM   252   C  CB  . GLN A  1  31   ? 213.738 186.718 127.115 1.00   178.65 ? 41   GLN A CB  1 
ATOM   253   C  CG  . GLN A  1  31   ? 214.653 187.912 127.294 1.00   213.50 ? 41   GLN A CG  1 
ATOM   254   C  CD  . GLN A  1  31   ? 215.739 187.646 128.319 1.00   266.11 ? 41   GLN A CD  1 
ATOM   255   O  OE1 . GLN A  1  31   ? 216.403 186.608 128.270 1.00   286.93 ? 41   GLN A OE1 1 
ATOM   256   N  NE2 . GLN A  1  31   ? 215.932 188.583 129.253 1.00   284.75 ? 41   GLN A NE2 1 
ATOM   257   N  N   . LEU A  1  32   ? 210.740 186.757 126.335 1.00   154.81 ? 42   LEU A N   1 
ATOM   258   C  CA  . LEU A  1  32   ? 209.649 186.220 125.574 1.00   153.34 ? 42   LEU A CA  1 
ATOM   259   C  C   . LEU A  1  32   ? 210.144 186.009 124.167 1.00   179.96 ? 42   LEU A C   1 
ATOM   260   O  O   . LEU A  1  32   ? 210.993 186.779 123.712 1.00   231.78 ? 42   LEU A O   1 
ATOM   261   C  CB  . LEU A  1  32   ? 208.591 187.271 125.553 1.00   152.36 ? 42   LEU A CB  1 
ATOM   262   C  CG  . LEU A  1  32   ? 208.200 187.746 126.947 1.00   144.87 ? 42   LEU A CG  1 
ATOM   263   C  CD1 . LEU A  1  32   ? 207.767 189.218 126.909 1.00   157.17 ? 42   LEU A CD1 1 
ATOM   264   C  CD2 . LEU A  1  32   ? 207.127 186.799 127.489 1.00   150.27 ? 42   LEU A CD2 1 
ATOM   265   N  N   . GLN A  1  33   ? 209.630 185.013 123.446 1.00   168.15 ? 43   GLN A N   1 
ATOM   266   C  CA  . GLN A  1  33   ? 209.880 185.003 122.000 1.00   160.05 ? 43   GLN A CA  1 
ATOM   267   C  C   . GLN A  1  33   ? 209.180 186.211 121.451 1.00   165.14 ? 43   GLN A C   1 
ATOM   268   O  O   . GLN A  1  33   ? 208.015 186.447 121.807 1.00   194.94 ? 43   GLN A O   1 
ATOM   269   C  CB  . GLN A  1  33   ? 209.292 183.818 121.295 1.00   150.88 ? 43   GLN A CB  1 
ATOM   270   C  CG  . GLN A  1  33   ? 209.989 182.527 121.565 1.00   153.47 ? 43   GLN A CG  1 
ATOM   271   C  CD  . GLN A  1  33   ? 208.970 181.452 121.839 1.00   185.12 ? 43   GLN A CD  1 
ATOM   272   O  OE1 . GLN A  1  33   ? 208.249 181.005 120.942 1.00   210.80 ? 43   GLN A OE1 1 
ATOM   273   N  NE2 . GLN A  1  33   ? 208.861 181.067 123.099 1.00   221.36 ? 43   GLN A NE2 1 
ATOM   274   N  N   . PRO A  1  34   ? 209.857 186.964 120.570 1.00   153.33 ? 44   PRO A N   1 
ATOM   275   C  CA  . PRO A  1  34   ? 209.301 188.233 120.144 1.00   158.62 ? 44   PRO A CA  1 
ATOM   276   C  C   . PRO A  1  34   ? 207.968 188.014 119.428 1.00   182.60 ? 44   PRO A C   1 
ATOM   277   O  O   . PRO A  1  34   ? 207.747 186.970 118.784 1.00   171.92 ? 44   PRO A O   1 
ATOM   278   C  CB  . PRO A  1  34   ? 210.363 188.781 119.214 1.00   157.36 ? 44   PRO A CB  1 
ATOM   279   C  CG  . PRO A  1  34   ? 210.964 187.556 118.611 1.00   165.07 ? 44   PRO A CG  1 
ATOM   280   C  CD  . PRO A  1  34   ? 210.908 186.487 119.657 1.00   159.77 ? 44   PRO A CD  1 
ATOM   281   N  N   . ALA A  1  35   ? 207.085 188.989 119.589 1.00   181.05 ? 45   ALA A N   1 
ATOM   282   C  CA  . ALA A  1  35   ? 205.700 188.872 119.161 1.00   177.87 ? 45   ALA A CA  1 
ATOM   283   C  C   . ALA A  1  35   ? 205.554 188.659 117.662 1.00   189.78 ? 45   ALA A C   1 
ATOM   284   O  O   . ALA A  1  35   ? 206.331 189.209 116.889 1.00   232.98 ? 45   ALA A O   1 
ATOM   285   C  CB  . ALA A  1  35   ? 204.964 190.142 119.534 1.00   182.71 ? 45   ALA A CB  1 
ATOM   286   N  N   . SER A  1  36   ? 204.533 187.915 117.240 1.00   185.87 ? 46   SER A N   1 
ATOM   287   C  CA  . SER A  1  36   ? 204.157 187.901 115.818 1.00   214.12 ? 46   SER A CA  1 
ATOM   288   C  C   . SER A  1  36   ? 203.533 189.238 115.433 1.00   243.74 ? 46   SER A C   1 
ATOM   289   O  O   . SER A  1  36   ? 203.040 189.956 116.299 1.00   326.07 ? 46   SER A O   1 
ATOM   290   C  CB  . SER A  1  36   ? 203.188 186.763 115.498 1.00   230.60 ? 46   SER A CB  1 
ATOM   291   O  OG  . SER A  1  36   ? 203.903 185.593 115.148 1.00   257.89 ? 46   SER A OG  1 
ATOM   292   N  N   . GLU A  1  37   ? 203.603 189.581 114.144 1.00   240.19 ? 47   GLU A N   1 
ATOM   293   C  CA  . GLU A  1  37   ? 202.956 190.786 113.540 1.00   255.76 ? 47   GLU A CA  1 
ATOM   294   C  C   . GLU A  1  37   ? 201.703 191.413 114.237 1.00   266.41 ? 47   GLU A C   1 
ATOM   295   O  O   . GLU A  1  37   ? 201.671 192.621 114.613 1.00   216.01 ? 47   GLU A O   1 
ATOM   296   C  CB  . GLU A  1  37   ? 202.614 190.515 112.049 1.00   254.24 ? 47   GLU A CB  1 
ATOM   297   C  CG  . GLU A  1  37   ? 202.570 189.058 111.540 1.00   276.68 ? 47   GLU A CG  1 
ATOM   298   C  CD  . GLU A  1  37   ? 201.620 188.100 112.280 1.00   289.59 ? 47   GLU A CD  1 
ATOM   299   O  OE1 . GLU A  1  37   ? 200.908 188.495 113.230 1.00   258.02 ? 47   GLU A OE1 1 
ATOM   300   O  OE2 . GLU A  1  37   ? 201.583 186.908 111.902 1.00   293.20 ? 47   GLU A OE2 1 
ATOM   301   N  N   . UNK A  1  38   ? 200.702 190.555 114.419 1.00   260.69 ? 48   UNK A N   1 
ATOM   302   C  CA  . UNK A  1  38   ? 199.376 190.944 114.853 1.00   246.83 ? 48   UNK A CA  1 
ATOM   303   C  C   . UNK A  1  38   ? 199.464 191.373 116.306 1.00   270.83 ? 48   UNK A C   1 
ATOM   304   O  O   . UNK A  1  38   ? 200.150 190.727 117.095 1.00   345.55 ? 48   UNK A O   1 
ATOM   305   C  CB  . UNK A  1  38   ? 198.414 189.770 114.689 1.00   204.00 ? 48   UNK A CB  1 
ATOM   306   N  N   . UNK A  1  39   ? 198.786 192.455 116.659 1.00   262.21 ? 49   UNK A N   1 
ATOM   307   C  CA  . UNK A  1  39   ? 198.768 192.935 118.032 1.00   273.83 ? 49   UNK A CA  1 
ATOM   308   C  C   . UNK A  1  39   ? 197.656 192.240 118.871 1.00   294.37 ? 49   UNK A C   1 
ATOM   309   O  O   . UNK A  1  39   ? 196.779 192.899 119.435 1.00   313.61 ? 49   UNK A O   1 
ATOM   310   C  CB  . UNK A  1  39   ? 198.627 194.452 118.045 1.00   260.19 ? 49   UNK A CB  1 
ATOM   311   N  N   . UNK A  1  40   ? 197.716 190.905 118.968 1.00   294.05 ? 50   UNK A N   1 
ATOM   312   C  CA  . UNK A  1  40   ? 196.802 190.115 119.817 1.00   269.60 ? 50   UNK A CA  1 
ATOM   313   C  C   . UNK A  1  40   ? 196.957 190.482 121.303 1.00   298.04 ? 50   UNK A C   1 
ATOM   314   O  O   . UNK A  1  40   ? 196.008 190.947 121.938 1.00   305.85 ? 50   UNK A O   1 
ATOM   315   C  CB  . UNK A  1  40   ? 197.039 188.613 119.622 1.00   219.80 ? 50   UNK A CB  1 
ATOM   316   N  N   . UNK A  1  41   ? 198.167 190.292 121.830 1.00   325.40 ? 51   UNK A N   1 
ATOM   317   C  CA  . UNK A  1  41   ? 198.489 190.530 123.243 1.00   316.05 ? 51   UNK A CA  1 
ATOM   318   C  C   . UNK A  1  41   ? 199.329 191.795 123.412 1.00   293.91 ? 51   UNK A C   1 
ATOM   319   O  O   . UNK A  1  41   ? 200.433 191.900 122.856 1.00   242.49 ? 51   UNK A O   1 
ATOM   320   C  CB  . UNK A  1  41   ? 199.237 189.342 123.809 1.00   342.62 ? 51   UNK A CB  1 
ATOM   321   N  N   . UNK A  1  42   ? 198.809 192.717 124.218 1.00   290.61 ? 52   UNK A N   1 
ATOM   322   C  CA  . UNK A  1  42   ? 199.409 194.027 124.447 1.00   321.72 ? 52   UNK A CA  1 
ATOM   323   C  C   . UNK A  1  42   ? 200.375 194.037 125.653 1.00   356.65 ? 52   UNK A C   1 
ATOM   324   O  O   . UNK A  1  42   ? 200.027 193.544 126.734 1.00   372.30 ? 52   UNK A O   1 
ATOM   325   C  CB  . UNK A  1  42   ? 198.301 195.051 124.667 1.00   291.81 ? 52   UNK A CB  1 
ATOM   326   N  N   . UNK A  1  43   ? 201.567 194.617 125.468 1.00   366.49 ? 53   UNK A N   1 
ATOM   327   C  CA  . UNK A  1  43   ? 202.549 194.815 126.551 1.00   327.59 ? 53   UNK A CA  1 
ATOM   328   C  C   . UNK A  1  43   ? 203.493 196.001 126.249 1.00   310.82 ? 53   UNK A C   1 
ATOM   329   O  O   . UNK A  1  43   ? 203.876 196.203 125.095 1.00   292.73 ? 53   UNK A O   1 
ATOM   330   N  N   . UNK A  1  44   ? 203.858 196.775 127.277 1.00   288.54 ? 54   UNK A N   1 
ATOM   331   C  CA  . UNK A  1  44   ? 204.903 197.814 127.148 1.00   277.21 ? 54   UNK A CA  1 
ATOM   332   C  C   . UNK A  1  44   ? 206.274 197.189 126.766 1.00   294.73 ? 54   UNK A C   1 
ATOM   333   O  O   . UNK A  1  44   ? 206.977 197.713 125.896 1.00   284.75 ? 54   UNK A O   1 
ATOM   334   C  CB  . UNK A  1  44   ? 205.003 198.651 128.430 1.00   230.72 ? 54   UNK A CB  1 
ATOM   335   N  N   . UNK A  1  45   ? 206.616 196.079 127.434 1.00   295.08 ? 55   UNK A N   1 
ATOM   336   C  CA  . UNK A  1  45   ? 207.767 195.181 127.153 1.00   240.98 ? 55   UNK A CA  1 
ATOM   337   C  C   . UNK A  1  45   ? 209.080 195.852 126.738 1.00   255.15 ? 55   UNK A C   1 
ATOM   338   O  O   . UNK A  1  45   ? 209.641 195.568 125.676 1.00   288.74 ? 55   UNK A O   1 
ATOM   339   C  CB  . UNK A  1  45   ? 207.363 194.105 126.159 1.00   235.97 ? 55   UNK A CB  1 
ATOM   340   N  N   . UNK A  1  46   ? 209.567 196.733 127.608 1.00   261.81 ? 56   UNK A N   1 
ATOM   341   C  CA  . UNK A  1  46   ? 210.808 197.491 127.376 1.00   252.08 ? 56   UNK A CA  1 
ATOM   342   C  C   . UNK A  1  46   ? 212.000 196.623 126.963 1.00   260.12 ? 56   UNK A C   1 
ATOM   343   O  O   . UNK A  1  46   ? 212.854 197.085 126.211 1.00   259.32 ? 56   UNK A O   1 
ATOM   344   C  CB  . UNK A  1  46   ? 211.172 198.309 128.613 1.00   238.22 ? 56   UNK A CB  1 
ATOM   345   N  N   . UNK A  1  47   ? 212.056 195.390 127.468 1.00   282.54 ? 57   UNK A N   1 
ATOM   346   C  CA  . UNK A  1  47   ? 213.107 194.404 127.143 1.00   297.36 ? 57   UNK A CA  1 
ATOM   347   C  C   . UNK A  1  47   ? 214.521 194.841 127.616 1.00   301.94 ? 57   UNK A C   1 
ATOM   348   O  O   . UNK A  1  47   ? 214.712 195.072 128.814 1.00   275.89 ? 57   UNK A O   1 
ATOM   349   C  CB  . UNK A  1  47   ? 213.059 194.014 125.661 1.00   295.45 ? 57   UNK A CB  1 
ATOM   350   N  N   . UNK A  1  48   ? 215.512 194.931 126.719 1.00   315.67 ? 58   UNK A N   1 
ATOM   351   C  CA  . UNK A  1  48   ? 216.870 195.337 127.098 1.00   301.96 ? 58   UNK A CA  1 
ATOM   352   C  C   . UNK A  1  48   ? 217.140 196.782 126.664 1.00   292.04 ? 58   UNK A C   1 
ATOM   353   O  O   . UNK A  1  48   ? 217.409 197.067 125.491 1.00   239.82 ? 58   UNK A O   1 
ATOM   354   C  CB  . UNK A  1  48   ? 217.901 194.387 126.500 1.00   290.83 ? 58   UNK A CB  1 
ATOM   355   N  N   . LYS A  1  49   ? 231.842 207.705 132.476 1.00   197.52 ? 71   LYS A N   1 
ATOM   356   C  CA  . LYS A  1  49   ? 231.818 209.169 132.682 1.00   217.38 ? 71   LYS A CA  1 
ATOM   357   C  C   . LYS A  1  49   ? 231.835 209.537 134.173 1.00   223.93 ? 71   LYS A C   1 
ATOM   358   O  O   . LYS A  1  49   ? 231.262 210.560 134.546 1.00   246.35 ? 71   LYS A O   1 
ATOM   359   C  CB  . LYS A  1  49   ? 230.581 209.816 132.010 1.00   175.14 ? 71   LYS A CB  1 
ATOM   360   N  N   . GLU A  1  50   ? 232.530 208.747 135.000 1.00   212.51 ? 72   GLU A N   1 
ATOM   361   C  CA  . GLU A  1  50   ? 232.312 208.720 136.481 1.00   180.15 ? 72   GLU A CA  1 
ATOM   362   C  C   . GLU A  1  50   ? 232.895 209.870 137.317 1.00   154.61 ? 72   GLU A C   1 
ATOM   363   O  O   . GLU A  1  50   ? 233.902 210.471 136.961 1.00   162.03 ? 72   GLU A O   1 
ATOM   364   C  CB  . GLU A  1  50   ? 232.823 207.405 137.059 1.00   188.51 ? 72   GLU A CB  1 
ATOM   365   C  CG  . GLU A  1  50   ? 234.211 207.432 137.677 1.00   195.64 ? 72   GLU A CG  1 
ATOM   366   C  CD  . GLU A  1  50   ? 235.360 207.806 136.751 1.00   228.39 ? 72   GLU A CD  1 
ATOM   367   O  OE1 . GLU A  1  50   ? 235.124 208.138 135.562 1.00   263.43 ? 72   GLU A OE1 1 
ATOM   368   O  OE2 . GLU A  1  50   ? 236.518 207.756 137.238 1.00   217.15 ? 72   GLU A OE2 1 
ATOM   369   N  N   . SER A  1  51   ? 232.276 210.109 138.470 1.00   147.72 ? 73   SER A N   1 
ATOM   370   C  CA  . SER A  1  51   ? 232.497 211.331 139.254 1.00   153.89 ? 73   SER A CA  1 
ATOM   371   C  C   . SER A  1  51   ? 232.221 211.100 140.728 1.00   140.68 ? 73   SER A C   1 
ATOM   372   O  O   . SER A  1  51   ? 231.711 210.049 141.126 1.00   129.54 ? 73   SER A O   1 
ATOM   373   C  CB  . SER A  1  51   ? 231.585 212.458 138.766 1.00   174.75 ? 73   SER A CB  1 
ATOM   374   O  OG  . SER A  1  51   ? 230.234 212.222 139.168 1.00   211.11 ? 73   SER A OG  1 
ATOM   375   N  N   . TRP A  1  52   ? 232.571 212.096 141.530 1.00   134.57 ? 74   TRP A N   1 
ATOM   376   C  CA  . TRP A  1  52   ? 232.462 211.979 142.972 1.00   129.75 ? 74   TRP A CA  1 
ATOM   377   C  C   . TRP A  1  52   ? 232.577 213.333 143.633 1.00   136.40 ? 74   TRP A C   1 
ATOM   378   O  O   . TRP A  1  52   ? 233.196 214.276 143.084 1.00   138.80 ? 74   TRP A O   1 
ATOM   379   C  CB  . TRP A  1  52   ? 233.573 211.095 143.517 1.00   121.84 ? 74   TRP A CB  1 
ATOM   380   C  CG  . TRP A  1  52   ? 234.953 211.698 143.274 1.00   129.23 ? 74   TRP A CG  1 
ATOM   381   C  CD1 . TRP A  1  52   ? 235.650 212.498 144.114 1.00   136.39 ? 74   TRP A CD1 1 
ATOM   382   C  CD2 . TRP A  1  52   ? 235.754 211.565 142.109 1.00   116.08 ? 74   TRP A CD2 1 
ATOM   383   N  NE1 . TRP A  1  52   ? 236.838 212.858 143.555 1.00   125.60 ? 74   TRP A NE1 1 
ATOM   384   C  CE2 . TRP A  1  52   ? 236.922 212.287 142.325 1.00   125.31 ? 74   TRP A CE2 1 
ATOM   385   C  CE3 . TRP A  1  52   ? 235.594 210.894 140.896 1.00   154.33 ? 74   TRP A CE3 1 
ATOM   386   C  CZ2 . TRP A  1  52   ? 237.927 212.364 141.389 1.00   178.28 ? 74   TRP A CZ2 1 
ATOM   387   C  CZ3 . TRP A  1  52   ? 236.602 210.967 139.949 1.00   177.78 ? 74   TRP A CZ3 1 
ATOM   388   C  CH2 . TRP A  1  52   ? 237.755 211.695 140.203 1.00   190.90 ? 74   TRP A CH2 1 
ATOM   389   N  N   . GLN A  1  53   ? 232.009 213.396 144.832 1.00   127.82 ? 75   GLN A N   1 
ATOM   390   C  CA  . GLN A  1  53   ? 232.074 214.580 145.662 1.00   136.45 ? 75   GLN A CA  1 
ATOM   391   C  C   . GLN A  1  53   ? 232.324 214.193 147.070 1.00   128.89 ? 75   GLN A C   1 
ATOM   392   O  O   . GLN A  1  53   ? 232.157 213.048 147.444 1.00   138.70 ? 75   GLN A O   1 
ATOM   393   C  CB  . GLN A  1  53   ? 230.797 215.393 145.593 1.00   140.83 ? 75   GLN A CB  1 
ATOM   394   C  CG  . GLN A  1  53   ? 229.536 214.586 145.618 1.00   149.02 ? 75   GLN A CG  1 
ATOM   395   C  CD  . GLN A  1  53   ? 228.354 215.488 145.397 1.00   193.99 ? 75   GLN A CD  1 
ATOM   396   O  OE1 . GLN A  1  53   ? 228.012 216.308 146.266 1.00   211.97 ? 75   GLN A OE1 1 
ATOM   397   N  NE2 . GLN A  1  53   ? 227.730 215.367 144.223 1.00   217.77 ? 75   GLN A NE2 1 
ATOM   398   N  N   . LEU A  1  54   ? 232.764 215.179 147.838 1.00   133.11 ? 76   LEU A N   1 
ATOM   399   C  CA  . LEU A  1  54   ? 233.128 215.001 149.218 1.00   116.42 ? 76   LEU A CA  1 
ATOM   400   C  C   . LEU A  1  54   ? 232.348 215.958 150.075 1.00   116.93 ? 76   LEU A C   1 
ATOM   401   O  O   . LEU A  1  54   ? 231.808 216.971 149.606 1.00   144.50 ? 76   LEU A O   1 
ATOM   402   C  CB  . LEU A  1  54   ? 234.619 215.217 149.405 1.00   115.87 ? 76   LEU A CB  1 
ATOM   403   C  CG  . LEU A  1  54   ? 235.363 213.899 149.388 1.00   124.73 ? 76   LEU A CG  1 
ATOM   404   C  CD1 . LEU A  1  54   ? 235.265 213.232 148.023 1.00   129.05 ? 76   LEU A CD1 1 
ATOM   405   C  CD2 . LEU A  1  54   ? 236.803 214.140 149.795 1.00   144.70 ? 76   LEU A CD2 1 
ATOM   406   N  N   . ARG A  1  55   ? 232.293 215.624 151.345 1.00   97.55  ? 77   ARG A N   1 
ATOM   407   C  CA  . ARG A  1  55   ? 231.471 216.341 152.255 1.00   114.31 ? 77   ARG A CA  1 
ATOM   408   C  C   . ARG A  1  55   ? 232.277 216.399 153.482 1.00   128.21 ? 77   ARG A C   1 
ATOM   409   O  O   . ARG A  1  55   ? 232.941 215.435 153.806 1.00   157.48 ? 77   ARG A O   1 
ATOM   410   C  CB  . ARG A  1  55   ? 230.190 215.549 152.547 1.00   121.52 ? 77   ARG A CB  1 
ATOM   411   C  CG  . ARG A  1  55   ? 229.013 216.449 152.876 1.00   153.07 ? 77   ARG A CG  1 
ATOM   412   C  CD  . ARG A  1  55   ? 227.679 215.738 152.862 1.00   153.33 ? 77   ARG A CD  1 
ATOM   413   N  NE  . ARG A  1  55   ? 227.624 214.671 153.849 1.00   166.00 ? 77   ARG A NE  1 
ATOM   414   C  CZ  . ARG A  1  55   ? 226.506 214.050 154.214 1.00   195.26 ? 77   ARG A CZ  1 
ATOM   415   N  NH1 . ARG A  1  55   ? 225.338 214.377 153.673 1.00   223.30 ? 77   ARG A NH1 1 
ATOM   416   N  NH2 . ARG A  1  55   ? 226.551 213.089 155.133 1.00   220.68 ? 77   ARG A NH2 1 
ATOM   417   N  N   . LYS A  1  56   ? 232.229 217.518 154.181 1.00   143.34 ? 78   LYS A N   1 
ATOM   418   C  CA  . LYS A  1  56   ? 232.544 217.516 155.610 1.00   147.13 ? 78   LYS A CA  1 
ATOM   419   C  C   . LYS A  1  56   ? 231.704 216.390 156.222 1.00   132.42 ? 78   LYS A C   1 
ATOM   420   O  O   . LYS A  1  56   ? 230.512 216.315 155.971 1.00   151.59 ? 78   LYS A O   1 
ATOM   421   C  CB  . LYS A  1  56   ? 232.142 218.858 156.214 1.00   173.22 ? 78   LYS A CB  1 
ATOM   422   C  CG  . LYS A  1  56   ? 232.583 219.092 157.634 1.00   184.33 ? 78   LYS A CG  1 
ATOM   423   C  CD  . LYS A  1  56   ? 234.099 219.103 157.742 1.00   203.53 ? 78   LYS A CD  1 
ATOM   424   C  CE  . LYS A  1  56   ? 234.526 219.809 159.018 1.00   232.14 ? 78   LYS A CE  1 
ATOM   425   N  NZ  . LYS A  1  56   ? 235.633 219.082 159.675 1.00   252.68 ? 78   LYS A NZ  1 
ATOM   426   N  N   . ALA A  1  57   ? 232.317 215.485 156.963 1.00   137.47 ? 79   ALA A N   1 
ATOM   427   C  CA  . ALA A  1  57   ? 231.571 214.389 157.567 1.00   156.82 ? 79   ALA A CA  1 
ATOM   428   C  C   . ALA A  1  57   ? 230.734 214.848 158.754 1.00   183.69 ? 79   ALA A C   1 
ATOM   429   O  O   . ALA A  1  57   ? 231.006 215.877 159.370 1.00   254.45 ? 79   ALA A O   1 
ATOM   430   C  CB  . ALA A  1  57   ? 232.504 213.311 158.005 1.00   154.86 ? 79   ALA A CB  1 
ATOM   431   N  N   . VAL A  1  58   ? 229.684 214.114 159.034 1.00   173.34 ? 80   VAL A N   1 
ATOM   432   C  CA  . VAL A  1  58   ? 228.932 214.354 160.253 1.00   202.06 ? 80   VAL A CA  1 
ATOM   433   C  C   . VAL A  1  58   ? 228.992 213.088 161.083 1.00   222.70 ? 80   VAL A C   1 
ATOM   434   O  O   . VAL A  1  58   ? 228.560 212.023 160.642 1.00   259.60 ? 80   VAL A O   1 
ATOM   435   C  CB  . VAL A  1  58   ? 227.495 214.858 159.978 1.00   215.57 ? 80   VAL A CB  1 
ATOM   436   C  CG1 . VAL A  1  58   ? 227.544 216.330 159.581 1.00   211.65 ? 80   VAL A CG1 1 
ATOM   437   C  CG2 . VAL A  1  58   ? 226.776 214.031 158.905 1.00   221.41 ? 80   VAL A CG2 1 
ATOM   438   N  N   . SER A  1  59   ? 229.599 213.185 162.261 1.00   228.86 ? 81   SER A N   1 
ATOM   439   C  CA  . SER A  1  59   ? 229.525 212.117 163.242 1.00   245.39 ? 81   SER A CA  1 
ATOM   440   C  C   . SER A  1  59   ? 228.482 212.546 164.274 1.00   256.96 ? 81   SER A C   1 
ATOM   441   O  O   . SER A  1  59   ? 228.514 213.678 164.765 1.00   274.78 ? 81   SER A O   1 
ATOM   442   C  CB  . SER A  1  59   ? 230.904 211.822 163.876 1.00   268.28 ? 81   SER A CB  1 
ATOM   443   O  OG  . SER A  1  59   ? 231.674 212.988 164.161 1.00   242.87 ? 81   SER A OG  1 
ATOM   444   N  N   . GLU A  1  60   ? 227.545 211.650 164.589 1.00   251.77 ? 82   GLU A N   1 
ATOM   445   C  CA  . GLU A  1  60   ? 226.479 211.946 165.545 1.00   249.68 ? 82   GLU A CA  1 
ATOM   446   C  C   . GLU A  1  60   ? 227.058 211.981 166.956 1.00   241.26 ? 82   GLU A C   1 
ATOM   447   O  O   . GLU A  1  60   ? 227.681 211.015 167.408 1.00   226.67 ? 82   GLU A O   1 
ATOM   448   C  CB  . GLU A  1  60   ? 225.354 210.904 165.459 1.00   247.64 ? 82   GLU A CB  1 
ATOM   449   N  N   . ILE A  1  61   ? 226.916 213.124 167.615 1.00   238.55 ? 83   ILE A N   1 
ATOM   450   C  CA  . ILE A  1  61   ? 227.338 213.262 169.009 1.00   267.82 ? 83   ILE A CA  1 
ATOM   451   C  C   . ILE A  1  61   ? 228.872 213.185 169.219 1.00   249.73 ? 83   ILE A C   1 
ATOM   452   O  O   . ILE A  1  61   ? 229.375 212.748 170.247 1.00   267.55 ? 83   ILE A O   1 
ATOM   453   C  CB  . ILE A  1  61   ? 226.605 212.260 169.919 1.00   291.46 ? 83   ILE A CB  1 
ATOM   454   N  N   . GLY A  1  62   ? 229.612 213.582 168.208 1.00   210.53 ? 84   GLY A N   1 
ATOM   455   C  CA  . GLY A  1  62   ? 230.799 214.365 168.441 1.00   230.47 ? 84   GLY A CA  1 
ATOM   456   C  C   . GLY A  1  62   ? 230.417 215.731 167.876 1.00   267.59 ? 84   GLY A C   1 
ATOM   457   O  O   . GLY A  1  62   ? 230.296 216.709 168.612 1.00   294.12 ? 84   GLY A O   1 
ATOM   458   N  N   . GLU A  1  63   ? 230.169 215.762 166.564 1.00   280.38 ? 85   GLU A N   1 
ATOM   459   C  CA  . GLU A  1  63   ? 230.191 217.002 165.774 1.00   261.96 ? 85   GLU A CA  1 
ATOM   460   C  C   . GLU A  1  63   ? 231.551 217.740 165.795 1.00   262.94 ? 85   GLU A C   1 
ATOM   461   O  O   . GLU A  1  63   ? 231.615 218.938 165.470 1.00   204.90 ? 85   GLU A O   1 
ATOM   462   C  CB  . GLU A  1  63   ? 229.041 217.944 166.157 1.00   253.04 ? 85   GLU A CB  1 
ATOM   463   C  CG  . GLU A  1  63   ? 227.664 217.370 165.873 1.00   281.04 ? 85   GLU A CG  1 
ATOM   464   C  CD  . GLU A  1  63   ? 227.151 217.667 164.461 1.00   328.35 ? 85   GLU A CD  1 
ATOM   465   O  OE1 . GLU A  1  63   ? 227.383 218.781 163.933 1.00   362.15 ? 85   GLU A OE1 1 
ATOM   466   O  OE2 . GLU A  1  63   ? 226.487 216.785 163.877 1.00   371.74 ? 85   GLU A OE2 1 
ATOM   467   N  N   . ASP A  1  64   ? 232.615 217.011 166.168 1.00   278.68 ? 86   ASP A N   1 
ATOM   468   C  CA  . ASP A  1  64   ? 234.005 217.460 166.135 1.00   267.77 ? 86   ASP A CA  1 
ATOM   469   C  C   . ASP A  1  64   ? 234.711 216.836 164.933 1.00   238.33 ? 86   ASP A C   1 
ATOM   470   O  O   . ASP A  1  64   ? 235.776 217.320 164.560 1.00   198.85 ? 86   ASP A O   1 
ATOM   471   C  CB  . ASP A  1  64   ? 234.749 217.058 167.415 1.00   322.97 ? 86   ASP A CB  1 
ATOM   472   C  CG  . ASP A  1  64   ? 233.936 217.312 168.687 1.00   364.38 ? 86   ASP A CG  1 
ATOM   473   O  OD1 . ASP A  1  64   ? 233.229 218.336 168.772 1.00   396.06 ? 86   ASP A OD1 1 
ATOM   474   O  OD2 . ASP A  1  64   ? 233.997 216.471 169.604 1.00   404.34 ? 86   ASP A OD2 1 
ATOM   475   N  N   . VAL A  1  65   ? 234.168 215.724 164.404 1.00   221.29 ? 87   VAL A N   1 
ATOM   476   C  CA  . VAL A  1  65   ? 234.249 215.370 162.966 1.00   246.83 ? 87   VAL A CA  1 
ATOM   477   C  C   . VAL A  1  65   ? 235.696 215.279 162.502 1.00   230.57 ? 87   VAL A C   1 
ATOM   478   O  O   . VAL A  1  65   ? 236.408 214.394 162.937 1.00   273.80 ? 87   VAL A O   1 
ATOM   479   C  CB  . VAL A  1  65   ? 233.409 216.362 162.073 1.00   297.13 ? 87   VAL A CB  1 
ATOM   480   C  CG1 . VAL A  1  65   ? 233.533 216.098 160.561 1.00   294.01 ? 87   VAL A CG1 1 
ATOM   481   C  CG2 . VAL A  1  65   ? 231.937 216.345 162.446 1.00   325.33 ? 87   VAL A CG2 1 
ATOM   482   N  N   . ASP A  1  66   ? 236.126 216.295 161.759 1.00   198.45 ? 88   ASP A N   1 
ATOM   483   C  CA  . ASP A  1  66   ? 237.287 216.323 160.871 1.00   214.89 ? 88   ASP A CA  1 
ATOM   484   C  C   . ASP A  1  66   ? 237.393 215.323 159.722 1.00   193.66 ? 88   ASP A C   1 
ATOM   485   O  O   . ASP A  1  66   ? 238.416 215.352 159.042 1.00   226.87 ? 88   ASP A O   1 
ATOM   486   C  CB  . ASP A  1  66   ? 238.623 216.505 161.674 1.00   276.58 ? 88   ASP A CB  1 
ATOM   487   C  CG  . ASP A  1  66   ? 239.331 215.188 162.063 1.00   291.02 ? 88   ASP A CG  1 
ATOM   488   O  OD1 . ASP A  1  66   ? 238.784 214.099 161.854 1.00   334.57 ? 88   ASP A OD1 1 
ATOM   489   O  OD2 . ASP A  1  66   ? 240.467 215.262 162.591 1.00   246.54 ? 88   ASP A OD2 1 
ATOM   490   N  N   . TYR A  1  67   ? 236.399 214.465 159.460 1.00   152.38 ? 89   TYR A N   1 
ATOM   491   C  CA  . TYR A  1  67   ? 236.603 213.440 158.405 1.00   133.82 ? 89   TYR A CA  1 
ATOM   492   C  C   . TYR A  1  67   ? 235.794 213.659 157.165 1.00   130.35 ? 89   TYR A C   1 
ATOM   493   O  O   . TYR A  1  67   ? 234.934 214.524 157.173 1.00   199.66 ? 89   TYR A O   1 
ATOM   494   C  CB  . TYR A  1  67   ? 236.391 212.070 158.966 1.00   121.58 ? 89   TYR A CB  1 
ATOM   495   C  CG  . TYR A  1  67   ? 235.006 211.523 158.975 1.00   131.25 ? 89   TYR A CG  1 
ATOM   496   C  CD1 . TYR A  1  67   ? 234.164 211.733 160.053 1.00   136.96 ? 89   TYR A CD1 1 
ATOM   497   C  CD2 . TYR A  1  67   ? 234.563 210.699 157.941 1.00   131.01 ? 89   TYR A CD2 1 
ATOM   498   C  CE1 . TYR A  1  67   ? 232.903 211.156 160.092 1.00   142.67 ? 89   TYR A CE1 1 
ATOM   499   C  CE2 . TYR A  1  67   ? 233.300 210.125 157.958 1.00   119.47 ? 89   TYR A CE2 1 
ATOM   500   C  CZ  . TYR A  1  67   ? 232.481 210.331 159.044 1.00   129.51 ? 89   TYR A CZ  1 
ATOM   501   O  OH  . TYR A  1  67   ? 231.226 209.769 159.070 1.00   140.74 ? 89   TYR A OH  1 
ATOM   502   N  N   . ASP A  1  68   ? 236.060 212.894 156.110 1.00   118.08 ? 90   ASP A N   1 
ATOM   503   C  CA  . ASP A  1  68   ? 235.495 213.194 154.762 1.00   134.27 ? 90   ASP A CA  1 
ATOM   504   C  C   . ASP A  1  68   ? 234.792 212.062 154.028 1.00   125.27 ? 90   ASP A C   1 
ATOM   505   O  O   . ASP A  1  68   ? 235.452 211.156 153.519 1.00   166.86 ? 90   ASP A O   1 
ATOM   506   C  CB  . ASP A  1  68   ? 236.553 213.802 153.807 1.00   151.54 ? 90   ASP A CB  1 
ATOM   507   C  CG  . ASP A  1  68   ? 237.971 213.367 154.120 1.00   176.50 ? 90   ASP A CG  1 
ATOM   508   O  OD1 . ASP A  1  68   ? 238.250 212.144 154.104 1.00   255.40 ? 90   ASP A OD1 1 
ATOM   509   O  OD2 . ASP A  1  68   ? 238.816 214.257 154.369 1.00   164.44 ? 90   ASP A OD2 1 
ATOM   510   N  N   . GLU A  1  69   ? 233.471 212.144 153.926 1.00   110.12 ? 91   GLU A N   1 
ATOM   511   C  CA  . GLU A  1  69   ? 232.691 211.196 153.119 1.00   111.13 ? 91   GLU A CA  1 
ATOM   512   C  C   . GLU A  1  69   ? 232.830 211.412 151.597 1.00   112.68 ? 91   GLU A C   1 
ATOM   513   O  O   . GLU A  1  69   ? 232.858 212.544 151.151 1.00   155.42 ? 91   GLU A O   1 
ATOM   514   C  CB  . GLU A  1  69   ? 231.229 211.302 153.511 1.00   121.45 ? 91   GLU A CB  1 
ATOM   515   C  CG  . GLU A  1  69   ? 230.952 210.874 154.952 1.00   165.30 ? 91   GLU A CG  1 
ATOM   516   C  CD  . GLU A  1  69   ? 229.493 211.084 155.384 1.00   211.32 ? 91   GLU A CD  1 
ATOM   517   O  OE1 . GLU A  1  69   ? 228.929 210.223 156.113 1.00   197.78 ? 91   GLU A OE1 1 
ATOM   518   O  OE2 . GLU A  1  69   ? 228.906 212.120 154.992 1.00   253.15 ? 91   GLU A OE2 1 
ATOM   519   N  N   . GLU A  1  70   ? 232.918 210.339 150.816 1.00   112.76 ? 92   GLU A N   1 
ATOM   520   C  CA  . GLU A  1  70   ? 232.832 210.405 149.354 1.00   127.51 ? 92   GLU A CA  1 
ATOM   521   C  C   . GLU A  1  70   ? 231.557 209.780 148.866 1.00   134.47 ? 92   GLU A C   1 
ATOM   522   O  O   . GLU A  1  70   ? 230.997 208.862 149.475 1.00   151.43 ? 92   GLU A O   1 
ATOM   523   C  CB  . GLU A  1  70   ? 233.929 209.624 148.658 1.00   152.77 ? 92   GLU A CB  1 
ATOM   524   C  CG  . GLU A  1  70   ? 235.291 209.738 149.300 1.00   206.40 ? 92   GLU A CG  1 
ATOM   525   C  CD  . GLU A  1  70   ? 235.965 208.389 149.450 1.00   240.43 ? 92   GLU A CD  1 
ATOM   526   O  OE1 . GLU A  1  70   ? 236.029 207.641 148.437 1.00   253.47 ? 92   GLU A OE1 1 
ATOM   527   O  OE2 . GLU A  1  70   ? 236.414 208.092 150.584 1.00   230.05 ? 92   GLU A OE2 1 
ATOM   528   N  N   . LEU A  1  71   ? 231.161 210.225 147.691 1.00   144.50 ? 93   LEU A N   1 
ATOM   529   C  CA  . LEU A  1  71   ? 229.956 209.755 147.069 1.00   115.93 ? 93   LEU A CA  1 
ATOM   530   C  C   . LEU A  1  71   ? 230.169 209.554 145.615 1.00   117.88 ? 93   LEU A C   1 
ATOM   531   O  O   . LEU A  1  71   ? 230.109 210.521 144.853 1.00   132.65 ? 93   LEU A O   1 
ATOM   532   C  CB  . LEU A  1  71   ? 228.904 210.794 147.226 1.00   106.18 ? 93   LEU A CB  1 
ATOM   533   C  CG  . LEU A  1  71   ? 227.575 210.229 146.912 1.00   109.02 ? 93   LEU A CG  1 
ATOM   534   C  CD1 . LEU A  1  71   ? 227.393 208.947 147.720 1.00   112.04 ? 93   LEU A CD1 1 
ATOM   535   C  CD2 . LEU A  1  71   ? 226.582 211.324 147.294 1.00   117.44 ? 93   LEU A CD2 1 
ATOM   536   N  N   . TYR A  1  72   ? 230.403 208.296 145.246 1.00   122.54 ? 94   TYR A N   1 
ATOM   537   C  CA  . TYR A  1  72   ? 230.904 207.927 143.936 1.00   118.15 ? 94   TYR A CA  1 
ATOM   538   C  C   . TYR A  1  72   ? 229.815 207.418 143.034 1.00   122.94 ? 94   TYR A C   1 
ATOM   539   O  O   . TYR A  1  72   ? 228.915 206.737 143.493 1.00   142.40 ? 94   TYR A O   1 
ATOM   540   C  CB  . TYR A  1  72   ? 231.863 206.808 144.088 1.00   111.66 ? 94   TYR A CB  1 
ATOM   541   C  CG  . TYR A  1  72   ? 232.760 206.704 142.916 1.00   113.44 ? 94   TYR A CG  1 
ATOM   542   C  CD1 . TYR A  1  72   ? 233.893 207.464 142.857 1.00   112.01 ? 94   TYR A CD1 1 
ATOM   543   C  CD2 . TYR A  1  72   ? 232.503 205.818 141.878 1.00   111.94 ? 94   TYR A CD2 1 
ATOM   544   C  CE1 . TYR A  1  72   ? 234.765 207.346 141.801 1.00   130.52 ? 94   TYR A CE1 1 
ATOM   545   C  CE2 . TYR A  1  72   ? 233.370 205.691 140.805 1.00   115.51 ? 94   TYR A CE2 1 
ATOM   546   C  CZ  . TYR A  1  72   ? 234.501 206.465 140.772 1.00   133.58 ? 94   TYR A CZ  1 
ATOM   547   O  OH  . TYR A  1  72   ? 235.406 206.379 139.736 1.00   164.87 ? 94   TYR A OH  1 
ATOM   548   N  N   . VAL A  1  73   ? 229.922 207.712 141.744 1.00   113.03 ? 95   VAL A N   1 
ATOM   549   C  CA  . VAL A  1  73   ? 228.876 207.382 140.813 1.00   107.11 ? 95   VAL A CA  1 
ATOM   550   C  C   . VAL A  1  73   ? 229.540 206.886 139.557 1.00   117.07 ? 95   VAL A C   1 
ATOM   551   O  O   . VAL A  1  73   ? 230.255 207.650 138.914 1.00   145.61 ? 95   VAL A O   1 
ATOM   552   C  CB  . VAL A  1  73   ? 228.071 208.616 140.431 1.00   116.64 ? 95   VAL A CB  1 
ATOM   553   C  CG1 . VAL A  1  73   ? 226.802 208.183 139.724 1.00   133.20 ? 95   VAL A CG1 1 
ATOM   554   C  CG2 . VAL A  1  73   ? 227.762 209.475 141.642 1.00   124.66 ? 95   VAL A CG2 1 
ATOM   555   N  N   . ALA A  1  74   ? 229.308 205.623 139.203 1.00   118.88 ? 96   ALA A N   1 
ATOM   556   C  CA  . ALA A  1  74   ? 230.034 205.029 138.095 1.00   143.24 ? 96   ALA A CA  1 
ATOM   557   C  C   . ALA A  1  74   ? 229.200 204.465 136.972 1.00   153.90 ? 96   ALA A C   1 
ATOM   558   O  O   . ALA A  1  74   ? 229.719 204.210 135.888 1.00   216.96 ? 96   ALA A O   1 
ATOM   559   C  CB  . ALA A  1  74   ? 230.996 203.973 138.620 1.00   155.29 ? 96   ALA A CB  1 
ATOM   560   N  N   . GLY A  1  75   ? 227.925 204.260 137.199 1.00   125.75 ? 97   GLY A N   1 
ATOM   561   C  CA  . GLY A  1  75   ? 227.161 203.557 136.221 1.00   128.51 ? 97   GLY A CA  1 
ATOM   562   C  C   . GLY A  1  75   ? 225.841 203.515 136.866 1.00   125.17 ? 97   GLY A C   1 
ATOM   563   O  O   . GLY A  1  75   ? 225.327 204.547 137.236 1.00   149.17 ? 97   GLY A O   1 
ATOM   564   N  N   . ASN A  1  76   ? 225.292 202.334 137.022 1.00   116.94 ? 98   ASN A N   1 
ATOM   565   C  CA  . ASN A  1  76   ? 224.111 202.209 137.859 1.00   116.68 ? 98   ASN A CA  1 
ATOM   566   C  C   . ASN A  1  76   ? 224.489 202.268 139.301 1.00   127.64 ? 98   ASN A C   1 
ATOM   567   O  O   . ASN A  1  76   ? 223.607 202.537 140.089 1.00   160.18 ? 98   ASN A O   1 
ATOM   568   C  CB  . ASN A  1  76   ? 223.313 200.942 137.597 1.00   126.00 ? 98   ASN A CB  1 
ATOM   569   C  CG  . ASN A  1  76   ? 224.174 199.810 137.136 1.00   161.29 ? 98   ASN A CG  1 
ATOM   570   O  OD1 . ASN A  1  76   ? 225.386 199.825 137.364 1.00   219.09 ? 98   ASN A OD1 1 
ATOM   571   N  ND2 . ASN A  1  76   ? 223.578 198.844 136.440 1.00   188.08 ? 98   ASN A ND2 1 
ATOM   572   N  N   . MET A  1  77   ? 225.754 202.020 139.683 1.00   138.62 ? 99   MET A N   1 
ATOM   573   C  CA  . MET A  1  77   ? 226.090 202.033 141.129 1.00   137.40 ? 99   MET A CA  1 
ATOM   574   C  C   . MET A  1  77   ? 226.541 203.389 141.578 1.00   119.02 ? 99   MET A C   1 
ATOM   575   O  O   . MET A  1  77   ? 227.252 204.076 140.827 1.00   116.47 ? 99   MET A O   1 
ATOM   576   C  CB  . MET A  1  77   ? 227.149 201.032 141.554 1.00   133.84 ? 99   MET A CB  1 
ATOM   577   C  CG  . MET A  1  77   ? 228.486 201.304 140.934 1.00   155.46 ? 99   MET A CG  1 
ATOM   578   S  SD  . MET A  1  77   ? 228.471 200.368 139.431 1.00   212.36 ? 99   MET A SD  1 
ATOM   579   C  CE  . MET A  1  77   ? 228.942 198.805 140.170 1.00   210.41 ? 99   MET A CE  1 
ATOM   580   N  N   . VAL A  1  78   ? 226.123 203.740 142.802 1.00   105.28 ? 100  VAL A N   1 
ATOM   581   C  CA  . VAL A  1  78   ? 226.645 204.860 143.550 1.00   111.14 ? 100  VAL A CA  1 
ATOM   582   C  C   . VAL A  1  78   ? 227.083 204.391 144.912 1.00   106.58 ? 100  VAL A C   1 
ATOM   583   O  O   . VAL A  1  78   ? 226.276 203.887 145.661 1.00   98.85  ? 100  VAL A O   1 
ATOM   584   C  CB  . VAL A  1  78   ? 225.599 205.961 143.732 1.00   122.05 ? 100  VAL A CB  1 
ATOM   585   C  CG1 . VAL A  1  78   ? 225.997 206.992 144.804 1.00   106.23 ? 100  VAL A CG1 1 
ATOM   586   C  CG2 . VAL A  1  78   ? 225.391 206.657 142.400 1.00   138.18 ? 100  VAL A CG2 1 
ATOM   587   N  N   . ILE A  1  79   ? 228.344 204.639 145.242 1.00   119.86 ? 101  ILE A N   1 
ATOM   588   C  CA  . ILE A  1  79   ? 228.977 204.129 146.444 1.00   105.71 ? 101  ILE A CA  1 
ATOM   589   C  C   . ILE A  1  79   ? 229.474 205.202 147.390 1.00   112.82 ? 101  ILE A C   1 
ATOM   590   O  O   . ILE A  1  79   ? 230.301 206.040 147.012 1.00   132.26 ? 101  ILE A O   1 
ATOM   591   C  CB  . ILE A  1  79   ? 230.181 203.383 146.017 1.00   97.54  ? 101  ILE A CB  1 
ATOM   592   C  CG1 . ILE A  1  79   ? 229.752 202.021 145.580 1.00   103.94 ? 101  ILE A CG1 1 
ATOM   593   C  CG2 . ILE A  1  79   ? 231.159 203.248 147.145 1.00   104.22 ? 101  ILE A CG2 1 
ATOM   594   C  CD1 . ILE A  1  79   ? 230.606 201.609 144.410 1.00   133.86 ? 101  ILE A CD1 1 
ATOM   595   N  N   . TRP A  1  80   ? 229.055 205.074 148.641 1.00   101.72 ? 102  TRP A N   1 
ATOM   596   C  CA  . TRP A  1  80   ? 229.214 206.073 149.680 1.00   106.23 ? 102  TRP A CA  1 
ATOM   597   C  C   . TRP A  1  80   ? 230.277 205.578 150.659 1.00   115.75 ? 102  TRP A C   1 
ATOM   598   O  O   . TRP A  1  80   ? 230.150 204.501 151.230 1.00   147.60 ? 102  TRP A O   1 
ATOM   599   C  CB  . TRP A  1  80   ? 227.880 206.154 150.376 1.00   107.89 ? 102  TRP A CB  1 
ATOM   600   C  CG  . TRP A  1  80   ? 227.746 207.105 151.445 1.00   112.60 ? 102  TRP A CG  1 
ATOM   601   C  CD1 . TRP A  1  80   ? 228.713 207.778 152.080 1.00   122.06 ? 102  TRP A CD1 1 
ATOM   602   C  CD2 . TRP A  1  80   ? 226.536 207.452 152.083 1.00   116.45 ? 102  TRP A CD2 1 
ATOM   603   N  NE1 . TRP A  1  80   ? 228.188 208.545 153.070 1.00   128.76 ? 102  TRP A NE1 1 
ATOM   604   C  CE2 . TRP A  1  80   ? 226.844 208.369 153.088 1.00   110.19 ? 102  TRP A CE2 1 
ATOM   605   C  CE3 . TRP A  1  80   ? 225.213 207.083 151.887 1.00   127.25 ? 102  TRP A CE3 1 
ATOM   606   C  CZ2 . TRP A  1  80   ? 225.909 208.916 153.901 1.00   123.65 ? 102  TRP A CZ2 1 
ATOM   607   C  CZ3 . TRP A  1  80   ? 224.267 207.633 152.686 1.00   148.63 ? 102  TRP A CZ3 1 
ATOM   608   C  CH2 . TRP A  1  80   ? 224.617 208.550 153.687 1.00   157.14 ? 102  TRP A CH2 1 
ATOM   609   N  N   . SER A  1  81   ? 231.301 206.377 150.890 1.00   114.68 ? 103  SER A N   1 
ATOM   610   C  CA  . SER A  1  81   ? 232.484 205.918 151.569 1.00   119.83 ? 103  SER A CA  1 
ATOM   611   C  C   . SER A  1  81   ? 232.947 206.943 152.543 1.00   122.97 ? 103  SER A C   1 
ATOM   612   O  O   . SER A  1  81   ? 232.422 208.036 152.553 1.00   164.19 ? 103  SER A O   1 
ATOM   613   C  CB  . SER A  1  81   ? 233.546 205.718 150.515 1.00   144.11 ? 103  SER A CB  1 
ATOM   614   O  OG  . SER A  1  81   ? 233.038 204.971 149.424 1.00   162.10 ? 103  SER A OG  1 
ATOM   615   N  N   . LYS A  1  82   ? 233.982 206.660 153.307 1.00   124.90 ? 104  LYS A N   1 
ATOM   616   C  CA  . LYS A  1  82   ? 234.161 207.466 154.463 1.00   121.03 ? 104  LYS A CA  1 
ATOM   617   C  C   . LYS A  1  82   ? 235.518 208.146 154.711 1.00   135.82 ? 104  LYS A C   1 
ATOM   618   O  O   . LYS A  1  82   ? 235.531 209.299 155.120 1.00   162.03 ? 104  LYS A O   1 
ATOM   619   C  CB  . LYS A  1  82   ? 233.610 206.690 155.652 1.00   106.21 ? 104  LYS A CB  1 
ATOM   620   C  CG  . LYS A  1  82   ? 232.126 206.917 155.862 1.00   114.81 ? 104  LYS A CG  1 
ATOM   621   C  CD  . LYS A  1  82   ? 231.751 206.746 157.340 1.00   145.49 ? 104  LYS A CD  1 
ATOM   622   C  CE  . LYS A  1  82   ? 230.246 206.635 157.577 1.00   162.27 ? 104  LYS A CE  1 
ATOM   623   N  NZ  . LYS A  1  82   ? 229.472 207.651 156.802 1.00   177.58 ? 104  LYS A NZ  1 
ATOM   624   N  N   . GLY A  1  83   ? 236.647 207.511 154.499 1.00   142.10 ? 105  GLY A N   1 
ATOM   625   C  CA  . GLY A  1  83   ? 237.879 208.120 155.047 1.00   170.92 ? 105  GLY A CA  1 
ATOM   626   C  C   . GLY A  1  83   ? 238.941 208.171 154.006 1.00   203.03 ? 105  GLY A C   1 
ATOM   627   O  O   . GLY A  1  83   ? 239.284 207.148 153.480 1.00   265.17 ? 105  GLY A O   1 
ATOM   628   N  N   . SER A  1  84   ? 239.500 209.336 153.731 1.00   193.17 ? 106  SER A N   1 
ATOM   629   C  CA  . SER A  1  84   ? 240.265 209.502 152.498 1.00   201.83 ? 106  SER A CA  1 
ATOM   630   C  C   . SER A  1  84   ? 241.751 209.147 152.632 1.00   202.49 ? 106  SER A C   1 
ATOM   631   O  O   . SER A  1  84   ? 242.612 210.004 152.483 1.00   242.53 ? 106  SER A O   1 
ATOM   632   C  CB  . SER A  1  84   ? 240.083 210.923 151.956 1.00   224.02 ? 106  SER A CB  1 
ATOM   633   O  OG  . SER A  1  84   ? 238.707 211.199 151.748 1.00   217.42 ? 106  SER A OG  1 
ATOM   634   N  N   . LYS A  1  85   ? 242.053 207.889 152.921 1.00   191.27 ? 107  LYS A N   1 
ATOM   635   C  CA  . LYS A  1  85   ? 243.421 207.344 152.751 1.00   179.41 ? 107  LYS A CA  1 
ATOM   636   C  C   . LYS A  1  85   ? 243.306 205.883 152.395 1.00   176.29 ? 107  LYS A C   1 
ATOM   637   O  O   . LYS A  1  85   ? 242.275 205.282 152.644 1.00   216.50 ? 107  LYS A O   1 
ATOM   638   C  CB  . LYS A  1  85   ? 244.263 207.406 154.030 1.00   172.53 ? 107  LYS A CB  1 
ATOM   639   C  CG  . LYS A  1  85   ? 243.747 208.309 155.139 1.00   194.06 ? 107  LYS A CG  1 
ATOM   640   C  CD  . LYS A  1  85   ? 244.607 208.121 156.379 1.00   211.07 ? 107  LYS A CD  1 
ATOM   641   C  CE  . LYS A  1  85   ? 244.791 209.412 157.164 1.00   260.69 ? 107  LYS A CE  1 
ATOM   642   N  NZ  . LYS A  1  85   ? 246.110 209.398 157.849 1.00   290.69 ? 107  LYS A NZ  1 
ATOM   643   N  N   . SER A  1  86   ? 244.384 205.284 151.907 1.00   174.06 ? 108  SER A N   1 
ATOM   644   C  CA  . SER A  1  86   ? 244.393 203.833 151.606 1.00   205.20 ? 108  SER A CA  1 
ATOM   645   C  C   . SER A  1  86   ? 244.135 202.911 152.832 1.00   193.62 ? 108  SER A C   1 
ATOM   646   O  O   . SER A  1  86   ? 243.524 201.839 152.717 1.00   211.96 ? 108  SER A O   1 
ATOM   647   C  CB  . SER A  1  86   ? 245.721 203.419 150.959 1.00   230.63 ? 108  SER A CB  1 
ATOM   648   O  OG  . SER A  1  86   ? 246.726 203.216 151.946 1.00   267.81 ? 108  SER A OG  1 
ATOM   649   N  N   . GLN A  1  87   ? 244.623 203.330 153.989 1.00   167.26 ? 109  GLN A N   1 
ATOM   650   C  CA  . GLN A  1  87   ? 244.469 202.575 155.219 1.00   175.09 ? 109  GLN A CA  1 
ATOM   651   C  C   . GLN A  1  87   ? 243.098 202.818 155.910 1.00   170.56 ? 109  GLN A C   1 
ATOM   652   O  O   . GLN A  1  87   ? 242.626 201.998 156.678 1.00   192.66 ? 109  GLN A O   1 
ATOM   653   C  CB  . GLN A  1  87   ? 245.622 202.944 156.163 1.00   200.08 ? 109  GLN A CB  1 
ATOM   654   N  N   . ALA A  1  88   ? 242.451 203.942 155.654 1.00   150.62 ? 110  ALA A N   1 
ATOM   655   C  CA  . ALA A  1  88   ? 241.251 204.314 156.416 1.00   143.47 ? 110  ALA A CA  1 
ATOM   656   C  C   . ALA A  1  88   ? 239.942 203.976 155.721 1.00   146.19 ? 110  ALA A C   1 
ATOM   657   O  O   . ALA A  1  88   ? 238.964 203.717 156.396 1.00   172.41 ? 110  ALA A O   1 
ATOM   658   C  CB  . ALA A  1  88   ? 241.269 205.802 156.733 1.00   174.53 ? 110  ALA A CB  1 
ATOM   659   N  N   . LEU A  1  89   ? 239.904 204.014 154.386 1.00   153.63 ? 111  LEU A N   1 
ATOM   660   C  CA  . LEU A  1  89   ? 238.645 203.966 153.603 1.00   143.60 ? 111  LEU A CA  1 
ATOM   661   C  C   . LEU A  1  89   ? 237.724 202.836 153.961 1.00   142.50 ? 111  LEU A C   1 
ATOM   662   O  O   . LEU A  1  89   ? 238.140 201.674 154.065 1.00   145.00 ? 111  LEU A O   1 
ATOM   663   C  CB  . LEU A  1  89   ? 238.944 203.839 152.112 1.00   166.81 ? 111  LEU A CB  1 
ATOM   664   C  CG  . LEU A  1  89   ? 239.438 205.143 151.487 1.00   225.95 ? 111  LEU A CG  1 
ATOM   665   C  CD1 . LEU A  1  89   ? 240.320 204.935 150.259 1.00   266.64 ? 111  LEU A CD1 1 
ATOM   666   C  CD2 . LEU A  1  89   ? 238.287 206.095 151.178 1.00   234.09 ? 111  LEU A CD2 1 
ATOM   667   N  N   . ALA A  1  90   ? 236.464 203.169 154.115 1.00   135.04 ? 112  ALA A N   1 
ATOM   668   C  CA  . ALA A  1  90   ? 235.497 202.166 154.513 1.00   166.70 ? 112  ALA A CA  1 
ATOM   669   C  C   . ALA A  1  90   ? 234.232 202.383 153.740 1.00   151.72 ? 112  ALA A C   1 
ATOM   670   O  O   . ALA A  1  90   ? 233.671 203.471 153.823 1.00   185.84 ? 112  ALA A O   1 
ATOM   671   C  CB  . ALA A  1  90   ? 235.222 202.305 155.996 1.00   206.73 ? 112  ALA A CB  1 
ATOM   672   N  N   . VAL A  1  91   ? 233.757 201.373 153.020 1.00   127.27 ? 113  VAL A N   1 
ATOM   673   C  CA  . VAL A  1  91   ? 232.700 201.616 152.044 1.00   125.84 ? 113  VAL A CA  1 
ATOM   674   C  C   . VAL A  1  91   ? 231.367 201.383 152.675 1.00   116.74 ? 113  VAL A C   1 
ATOM   675   O  O   . VAL A  1  91   ? 230.834 200.317 152.570 1.00   110.55 ? 113  VAL A O   1 
ATOM   676   C  CB  . VAL A  1  91   ? 232.844 200.799 150.755 1.00   137.31 ? 113  VAL A CB  1 
ATOM   677   C  CG1 . VAL A  1  91   ? 233.112 199.322 151.025 1.00   176.02 ? 113  VAL A CG1 1 
ATOM   678   C  CG2 . VAL A  1  91   ? 231.615 200.987 149.878 1.00   142.89 ? 113  VAL A CG2 1 
ATOM   679   N  N   . TYR A  1  92   ? 230.837 202.442 153.267 1.00   129.28 ? 114  TYR A N   1 
ATOM   680   C  CA  . TYR A  1  92   ? 229.633 202.445 154.102 1.00   129.68 ? 114  TYR A CA  1 
ATOM   681   C  C   . TYR A  1  92   ? 228.370 201.847 153.426 1.00   136.28 ? 114  TYR A C   1 
ATOM   682   O  O   . TYR A  1  92   ? 227.683 201.056 154.048 1.00   169.26 ? 114  TYR A O   1 
ATOM   683   C  CB  . TYR A  1  92   ? 229.427 203.897 154.534 1.00   130.85 ? 114  TYR A CB  1 
ATOM   684   C  CG  . TYR A  1  92   ? 228.232 204.234 155.352 1.00   124.62 ? 114  TYR A CG  1 
ATOM   685   C  CD1 . TYR A  1  92   ? 228.106 203.752 156.635 1.00   137.33 ? 114  TYR A CD1 1 
ATOM   686   C  CD2 . TYR A  1  92   ? 227.255 205.118 154.861 1.00   144.98 ? 114  TYR A CD2 1 
ATOM   687   C  CE1 . TYR A  1  92   ? 227.009 204.094 157.417 1.00   173.08 ? 114  TYR A CE1 1 
ATOM   688   C  CE2 . TYR A  1  92   ? 226.153 205.469 155.625 1.00   157.35 ? 114  TYR A CE2 1 
ATOM   689   C  CZ  . TYR A  1  92   ? 226.033 204.955 156.906 1.00   178.52 ? 114  TYR A CZ  1 
ATOM   690   O  OH  . TYR A  1  92   ? 224.947 205.286 157.687 1.00   197.21 ? 114  TYR A OH  1 
ATOM   691   N  N   . LYS A  1  93   ? 228.094 202.177 152.167 1.00   117.64 ? 115  LYS A N   1 
ATOM   692   C  CA  . LYS A  1  93   ? 226.866 201.723 151.513 1.00   118.89 ? 115  LYS A CA  1 
ATOM   693   C  C   . LYS A  1  93   ? 227.006 201.837 150.019 1.00   135.70 ? 115  LYS A C   1 
ATOM   694   O  O   . LYS A  1  93   ? 227.625 202.798 149.543 1.00   181.92 ? 115  LYS A O   1 
ATOM   695   C  CB  . LYS A  1  93   ? 225.690 202.604 151.940 1.00   116.65 ? 115  LYS A CB  1 
ATOM   696   C  CG  . LYS A  1  93   ? 224.905 202.099 153.147 1.00   123.67 ? 115  LYS A CG  1 
ATOM   697   C  CD  . LYS A  1  93   ? 223.686 202.983 153.318 1.00   148.33 ? 115  LYS A CD  1 
ATOM   698   C  CE  . LYS A  1  93   ? 223.050 202.958 154.702 1.00   170.82 ? 115  LYS A CE  1 
ATOM   699   N  NZ  . LYS A  1  93   ? 222.219 204.208 154.907 1.00   179.89 ? 115  LYS A NZ  1 
ATOM   700   N  N   . ALA A  1  94   ? 226.419 200.904 149.272 1.00   115.67 ? 116  ALA A N   1 
ATOM   701   C  CA  . ALA A  1  94   ? 226.406 201.006 147.808 1.00   119.55 ? 116  ALA A CA  1 
ATOM   702   C  C   . ALA A  1  94   ? 225.005 200.846 147.188 1.00   118.52 ? 116  ALA A C   1 
ATOM   703   O  O   . ALA A  1  94   ? 224.227 200.004 147.582 1.00   153.33 ? 116  ALA A O   1 
ATOM   704   C  CB  . ALA A  1  94   ? 227.392 200.027 147.213 1.00   120.77 ? 116  ALA A CB  1 
ATOM   705   N  N   . PHE A  1  95   ? 224.704 201.660 146.197 1.00   124.56 ? 117  PHE A N   1 
ATOM   706   C  CA  . PHE A  1  95   ? 223.383 201.717 145.604 1.00   132.07 ? 117  PHE A CA  1 
ATOM   707   C  C   . PHE A  1  95   ? 223.499 201.404 144.143 1.00   154.09 ? 117  PHE A C   1 
ATOM   708   O  O   . PHE A  1  95   ? 224.138 202.173 143.443 1.00   199.80 ? 117  PHE A O   1 
ATOM   709   C  CB  . PHE A  1  95   ? 222.856 203.133 145.766 1.00   118.06 ? 117  PHE A CB  1 
ATOM   710   C  CG  . PHE A  1  95   ? 222.739 203.534 147.185 1.00   111.21 ? 117  PHE A CG  1 
ATOM   711   C  CD1 . PHE A  1  95   ? 223.785 204.118 147.829 1.00   112.50 ? 117  PHE A CD1 1 
ATOM   712   C  CD2 . PHE A  1  95   ? 221.603 203.248 147.897 1.00   129.29 ? 117  PHE A CD2 1 
ATOM   713   C  CE1 . PHE A  1  95   ? 223.691 204.474 149.147 1.00   116.59 ? 117  PHE A CE1 1 
ATOM   714   C  CE2 . PHE A  1  95   ? 221.489 203.596 149.218 1.00   123.75 ? 117  PHE A CE2 1 
ATOM   715   C  CZ  . PHE A  1  95   ? 222.540 204.216 149.844 1.00   128.85 ? 117  PHE A CZ  1 
ATOM   716   N  N   . THR A  1  96   ? 222.931 200.288 143.685 1.00   121.26 ? 118  THR A N   1 
ATOM   717   C  CA  . THR A  1  96   ? 222.836 200.024 142.256 1.00   123.38 ? 118  THR A CA  1 
ATOM   718   C  C   . THR A  1  96   ? 221.397 200.166 141.840 1.00   123.63 ? 118  THR A C   1 
ATOM   719   O  O   . THR A  1  96   ? 220.508 199.537 142.417 1.00   174.35 ? 118  THR A O   1 
ATOM   720   C  CB  . THR A  1  96   ? 223.333 198.626 141.906 1.00   163.80 ? 118  THR A CB  1 
ATOM   721   O  OG1 . THR A  1  96   ? 222.734 197.669 142.784 1.00   203.25 ? 118  THR A OG1 1 
ATOM   722   C  CG2 . THR A  1  96   ? 224.832 198.546 142.041 1.00   187.78 ? 118  THR A CG2 1 
ATOM   723   N  N   . VAL A  1  97   ? 221.144 200.967 140.826 1.00   107.82 ? 119  VAL A N   1 
ATOM   724   C  CA  . VAL A  1  97   ? 219.769 201.327 140.544 1.00   114.71 ? 119  VAL A CA  1 
ATOM   725   C  C   . VAL A  1  97   ? 219.176 200.829 139.240 1.00   142.03 ? 119  VAL A C   1 
ATOM   726   O  O   . VAL A  1  97   ? 218.069 201.220 138.932 1.00   192.45 ? 119  VAL A O   1 
ATOM   727   C  CB  . VAL A  1  97   ? 219.606 202.842 140.578 1.00   116.46 ? 119  VAL A CB  1 
ATOM   728   C  CG1 . VAL A  1  97   ? 219.837 203.349 141.998 1.00   112.57 ? 119  VAL A CG1 1 
ATOM   729   C  CG2 . VAL A  1  97   ? 220.509 203.508 139.529 1.00   118.05 ? 119  VAL A CG2 1 
ATOM   730   N  N   . ASP A  1  98   ? 219.865 199.988 138.481 1.00   150.83 ? 120  ASP A N   1 
ATOM   731   C  CA  . ASP A  1  98   ? 219.364 199.501 137.171 1.00   176.05 ? 120  ASP A CA  1 
ATOM   732   C  C   . ASP A  1  98   ? 219.498 200.439 135.939 1.00   193.04 ? 120  ASP A C   1 
ATOM   733   O  O   . ASP A  1  98   ? 219.663 199.920 134.828 1.00   222.41 ? 120  ASP A O   1 
ATOM   734   C  CB  . ASP A  1  98   ? 217.933 198.913 137.259 1.00   208.51 ? 120  ASP A CB  1 
ATOM   735   C  CG  . ASP A  1  98   ? 216.827 199.890 136.801 1.00   234.06 ? 120  ASP A CG  1 
ATOM   736   O  OD1 . ASP A  1  98   ? 216.793 200.267 135.611 1.00   271.73 ? 120  ASP A OD1 1 
ATOM   737   O  OD2 . ASP A  1  98   ? 215.958 200.243 137.632 1.00   275.74 ? 120  ASP A OD2 1 
ATOM   738   N  N   . SER A  1  99   ? 219.395 201.769 136.087 1.00   177.23 ? 121  SER A N   1 
ATOM   739   C  CA  . SER A  1  99   ? 219.720 202.686 134.971 1.00   163.59 ? 121  SER A CA  1 
ATOM   740   C  C   . SER A  1  99   ? 220.853 203.602 135.304 1.00   172.12 ? 121  SER A C   1 
ATOM   741   O  O   . SER A  1  99   ? 221.150 203.811 136.480 1.00   228.77 ? 121  SER A O   1 
ATOM   742   C  CB  . SER A  1  99   ? 218.538 203.523 134.592 1.00   164.19 ? 121  SER A CB  1 
ATOM   743   O  OG  . SER A  1  99   ? 217.469 202.659 134.314 1.00   224.56 ? 121  SER A OG  1 
ATOM   744   N  N   . PRO A  1  100  ? 221.501 204.160 134.278 1.00   154.79 ? 122  PRO A N   1 
ATOM   745   C  CA  . PRO A  1  100  ? 222.646 205.030 134.573 1.00   163.48 ? 122  PRO A CA  1 
ATOM   746   C  C   . PRO A  1  100  ? 222.272 206.255 135.412 1.00   151.95 ? 122  PRO A C   1 
ATOM   747   O  O   . PRO A  1  100  ? 221.124 206.723 135.386 1.00   153.23 ? 122  PRO A O   1 
ATOM   748   C  CB  . PRO A  1  100  ? 223.150 205.417 133.189 1.00   175.10 ? 122  PRO A CB  1 
ATOM   749   C  CG  . PRO A  1  100  ? 222.753 204.254 132.347 1.00   174.15 ? 122  PRO A CG  1 
ATOM   750   C  CD  . PRO A  1  100  ? 221.377 203.913 132.839 1.00   155.72 ? 122  PRO A CD  1 
ATOM   751   N  N   . VAL A  1  101  ? 223.229 206.733 136.188 1.00   126.41 ? 123  VAL A N   1 
ATOM   752   C  CA  . VAL A  1  101  ? 222.925 207.763 137.174 1.00   140.75 ? 123  VAL A CA  1 
ATOM   753   C  C   . VAL A  1  101  ? 223.353 209.164 136.708 1.00   148.61 ? 123  VAL A C   1 
ATOM   754   O  O   . VAL A  1  101  ? 224.543 209.441 136.501 1.00   136.34 ? 123  VAL A O   1 
ATOM   755   C  CB  . VAL A  1  101  ? 223.538 207.399 138.542 1.00   131.69 ? 123  VAL A CB  1 
ATOM   756   C  CG1 . VAL A  1  101  ? 223.482 208.563 139.513 1.00   132.82 ? 123  VAL A CG1 1 
ATOM   757   C  CG2 . VAL A  1  101  ? 222.784 206.219 139.142 1.00   129.61 ? 123  VAL A CG2 1 
ATOM   758   N  N   . GLN A  1  102  ? 222.366 210.050 136.564 1.00   144.55 ? 124  GLN A N   1 
ATOM   759   C  CA  . GLN A  1  102  ? 222.644 211.461 136.359 1.00   148.83 ? 124  GLN A CA  1 
ATOM   760   C  C   . GLN A  1  102  ? 223.556 211.949 137.462 1.00   165.23 ? 124  GLN A C   1 
ATOM   761   O  O   . GLN A  1  102  ? 224.660 212.423 137.178 1.00   209.82 ? 124  GLN A O   1 
ATOM   762   C  CB  . GLN A  1  102  ? 221.391 212.364 136.447 1.00   154.69 ? 124  GLN A CB  1 
ATOM   763   C  CG  . GLN A  1  102  ? 220.275 212.147 135.457 1.00   162.39 ? 124  GLN A CG  1 
ATOM   764   C  CD  . GLN A  1  102  ? 220.760 212.098 134.048 1.00   182.95 ? 124  GLN A CD  1 
ATOM   765   O  OE1 . GLN A  1  102  ? 220.340 211.243 133.264 1.00   218.87 ? 124  GLN A OE1 1 
ATOM   766   N  NE2 . GLN A  1  102  ? 221.663 213.012 133.706 1.00   214.37 ? 124  GLN A NE2 1 
ATOM   767   N  N   . GLN A  1  103  ? 223.111 211.826 138.723 1.00   130.59 ? 125  GLN A N   1 
ATOM   768   C  CA  . GLN A  1  103  ? 223.557 212.800 139.697 1.00   140.02 ? 125  GLN A CA  1 
ATOM   769   C  C   . GLN A  1  103  ? 223.997 212.383 141.081 1.00   133.08 ? 125  GLN A C   1 
ATOM   770   O  O   . GLN A  1  103  ? 225.133 212.671 141.494 1.00   133.30 ? 125  GLN A O   1 
ATOM   771   C  CB  . GLN A  1  103  ? 222.462 213.851 139.785 1.00   159.95 ? 125  GLN A CB  1 
ATOM   772   C  CG  . GLN A  1  103  ? 222.722 215.097 138.940 1.00   165.02 ? 125  GLN A CG  1 
ATOM   773   C  CD  . GLN A  1  103  ? 223.169 216.291 139.774 1.00   179.87 ? 125  GLN A CD  1 
ATOM   774   O  OE1 . GLN A  1  103  ? 223.593 216.153 140.945 1.00   158.61 ? 125  GLN A OE1 1 
ATOM   775   N  NE2 . GLN A  1  103  ? 223.071 217.478 139.180 1.00   189.90 ? 125  GLN A NE2 1 
ATOM   776   N  N   . ALA A  1  104  ? 223.093 211.787 141.828 1.00   126.20 ? 126  ALA A N   1 
ATOM   777   C  CA  . ALA A  1  104  ? 223.400 211.395 143.210 1.00   128.29 ? 126  ALA A CA  1 
ATOM   778   C  C   . ALA A  1  104  ? 224.109 212.442 144.123 1.00   126.29 ? 126  ALA A C   1 
ATOM   779   O  O   . ALA A  1  104  ? 225.129 212.162 144.717 1.00   139.57 ? 126  ALA A O   1 
ATOM   780   C  CB  . ALA A  1  104  ? 224.165 210.086 143.224 1.00   116.25 ? 126  ALA A CB  1 
ATOM   781   N  N   . LEU A  1  105  ? 223.594 213.648 144.244 1.00   116.02 ? 127  LEU A N   1 
ATOM   782   C  CA  . LEU A  1  105  ? 223.944 214.447 145.414 1.00   129.17 ? 127  LEU A CA  1 
ATOM   783   C  C   . LEU A  1  105  ? 223.387 213.920 146.777 1.00   125.72 ? 127  LEU A C   1 
ATOM   784   O  O   . LEU A  1  105  ? 222.523 213.025 146.819 1.00   103.12 ? 127  LEU A O   1 
ATOM   785   C  CB  . LEU A  1  105  ? 223.481 215.859 145.205 1.00   139.84 ? 127  LEU A CB  1 
ATOM   786   C  CG  . LEU A  1  105  ? 221.988 216.072 144.901 1.00   155.12 ? 127  LEU A CG  1 
ATOM   787   C  CD1 . LEU A  1  105  ? 220.973 214.982 145.332 1.00   141.07 ? 127  LEU A CD1 1 
ATOM   788   C  CD2 . LEU A  1  105  ? 221.604 217.432 145.490 1.00   154.39 ? 127  LEU A CD2 1 
ATOM   789   N  N   . TRP A  1  106  ? 223.904 214.498 147.870 1.00   129.38 ? 128  TRP A N   1 
ATOM   790   C  CA  . TRP A  1  106  ? 223.364 214.353 149.244 1.00   132.40 ? 128  TRP A CA  1 
ATOM   791   C  C   . TRP A  1  106  ? 222.499 215.542 149.599 1.00   135.65 ? 128  TRP A C   1 
ATOM   792   O  O   . TRP A  1  106  ? 222.945 216.664 149.423 1.00   162.16 ? 128  TRP A O   1 
ATOM   793   C  CB  . TRP A  1  106  ? 224.459 214.458 150.318 1.00   134.85 ? 128  TRP A CB  1 
ATOM   794   C  CG  . TRP A  1  106  ? 225.283 213.284 150.601 1.00   132.15 ? 128  TRP A CG  1 
ATOM   795   C  CD1 . TRP A  1  106  ? 224.887 212.105 151.171 1.00   141.66 ? 128  TRP A CD1 1 
ATOM   796   C  CD2 . TRP A  1  106  ? 226.673 213.195 150.423 1.00   126.04 ? 128  TRP A CD2 1 
ATOM   797   N  NE1 . TRP A  1  106  ? 225.957 211.261 151.324 1.00   124.71 ? 128  TRP A NE1 1 
ATOM   798   C  CE2 . TRP A  1  106  ? 227.070 211.907 150.864 1.00   132.44 ? 128  TRP A CE2 1 
ATOM   799   C  CE3 . TRP A  1  106  ? 227.634 214.072 149.907 1.00   126.59 ? 128  TRP A CE3 1 
ATOM   800   C  CZ2 . TRP A  1  106  ? 228.383 211.472 150.807 1.00   161.91 ? 128  TRP A CZ2 1 
ATOM   801   C  CZ3 . TRP A  1  106  ? 228.937 213.648 149.840 1.00   166.10 ? 128  TRP A CZ3 1 
ATOM   802   C  CH2 . TRP A  1  106  ? 229.313 212.352 150.302 1.00   180.36 ? 128  TRP A CH2 1 
ATOM   803   N  N   . CYS A  1  107  ? 221.330 215.325 150.188 1.00   135.01 ? 129  CYS A N   1 
ATOM   804   C  CA  . CYS A  1  107  ? 220.572 216.442 150.735 1.00   149.61 ? 129  CYS A CA  1 
ATOM   805   C  C   . CYS A  1  107  ? 219.808 216.067 152.004 1.00   144.79 ? 129  CYS A C   1 
ATOM   806   O  O   . CYS A  1  107  ? 220.028 215.026 152.586 1.00   153.85 ? 129  CYS A O   1 
ATOM   807   C  CB  . CYS A  1  107  ? 219.577 216.912 149.695 1.00   154.95 ? 129  CYS A CB  1 
ATOM   808   S  SG  . CYS A  1  107  ? 218.049 216.018 149.927 1.00   179.96 ? 129  CYS A SG  1 
ATOM   809   N  N   . ASP A  1  108  ? 218.909 216.949 152.430 1.00   155.26 ? 130  ASP A N   1 
ATOM   810   C  CA  . ASP A  1  108  ? 217.956 216.655 153.497 1.00   157.31 ? 130  ASP A CA  1 
ATOM   811   C  C   . ASP A  1  108  ? 216.649 217.407 153.311 1.00   130.91 ? 130  ASP A C   1 
ATOM   812   O  O   . ASP A  1  108  ? 216.607 218.426 152.668 1.00   148.86 ? 130  ASP A O   1 
ATOM   813   C  CB  . ASP A  1  108  ? 218.547 217.000 154.872 1.00   187.40 ? 130  ASP A CB  1 
ATOM   814   C  CG  . ASP A  1  108  ? 218.861 218.484 155.032 1.00   220.76 ? 130  ASP A CG  1 
ATOM   815   O  OD1 . ASP A  1  108  ? 219.185 219.150 154.023 1.00   267.18 ? 130  ASP A OD1 1 
ATOM   816   O  OD2 . ASP A  1  108  ? 218.798 218.981 156.176 1.00   253.24 ? 130  ASP A OD2 1 
ATOM   817   N  N   . PHE A  1  109  ? 215.593 216.900 153.922 1.00   118.96 ? 131  PHE A N   1 
ATOM   818   C  CA  . PHE A  1  109  ? 214.305 217.521 153.901 1.00   132.27 ? 131  PHE A CA  1 
ATOM   819   C  C   . PHE A  1  109  ? 213.799 217.742 155.323 1.00   171.05 ? 131  PHE A C   1 
ATOM   820   O  O   . PHE A  1  109  ? 213.962 216.841 156.144 1.00   209.17 ? 131  PHE A O   1 
ATOM   821   C  CB  . PHE A  1  109  ? 213.364 216.577 153.200 1.00   122.17 ? 131  PHE A CB  1 
ATOM   822   C  CG  . PHE A  1  109  ? 213.883 216.075 151.890 1.00   125.08 ? 131  PHE A CG  1 
ATOM   823   C  CD1 . PHE A  1  109  ? 214.508 214.856 151.805 1.00   128.88 ? 131  PHE A CD1 1 
ATOM   824   C  CD2 . PHE A  1  109  ? 213.711 216.813 150.731 1.00   138.54 ? 131  PHE A CD2 1 
ATOM   825   C  CE1 . PHE A  1  109  ? 214.950 214.385 150.585 1.00   125.72 ? 131  PHE A CE1 1 
ATOM   826   C  CE2 . PHE A  1  109  ? 214.146 216.345 149.504 1.00   135.41 ? 131  PHE A CE2 1 
ATOM   827   C  CZ  . PHE A  1  109  ? 214.755 215.124 149.432 1.00   133.68 ? 131  PHE A CZ  1 
ATOM   828   N  N   . ILE A  1  110  ? 213.175 218.894 155.624 1.00   175.47 ? 132  ILE A N   1 
ATOM   829   C  CA  . ILE A  1  110  ? 212.379 219.006 156.870 1.00   176.11 ? 132  ILE A CA  1 
ATOM   830   C  C   . ILE A  1  110  ? 211.053 218.230 156.691 1.00   173.15 ? 132  ILE A C   1 
ATOM   831   O  O   . ILE A  1  110  ? 210.574 218.075 155.570 1.00   156.03 ? 132  ILE A O   1 
ATOM   832   C  CB  . ILE A  1  110  ? 212.037 220.464 157.317 1.00   201.04 ? 132  ILE A CB  1 
ATOM   833   C  CG1 . ILE A  1  110  ? 213.252 221.425 157.258 1.00   201.44 ? 132  ILE A CG1 1 
ATOM   834   C  CG2 . ILE A  1  110  ? 211.417 220.442 158.732 1.00   217.03 ? 132  ILE A CG2 1 
ATOM   835   C  CD1 . ILE A  1  110  ? 213.006 222.827 157.855 1.00   189.00 ? 132  ILE A CD1 1 
ATOM   836   N  N   . ILE A  1  111  ? 210.479 217.738 157.794 1.00   198.60 ? 133  ILE A N   1 
ATOM   837   C  CA  . ILE A  1  111  ? 209.115 217.135 157.825 1.00   211.09 ? 133  ILE A CA  1 
ATOM   838   C  C   . ILE A  1  111  ? 208.153 217.907 158.787 1.00   237.12 ? 133  ILE A C   1 
ATOM   839   O  O   . ILE A  1  111  ? 208.415 217.997 159.989 1.00   266.03 ? 133  ILE A O   1 
ATOM   840   C  CB  . ILE A  1  111  ? 209.126 215.587 158.143 1.00   198.68 ? 133  ILE A CB  1 
ATOM   841   C  CG1 . ILE A  1  111  ? 210.013 215.190 159.353 1.00   215.47 ? 133  ILE A CG1 1 
ATOM   842   C  CG2 . ILE A  1  111  ? 209.601 214.764 156.949 1.00   183.55 ? 133  ILE A CG2 1 
ATOM   843   C  CD1 . ILE A  1  111  ? 209.320 215.179 160.706 1.00   230.40 ? 133  ILE A CD1 1 
ATOM   844   N  N   . SER A  1  112  ? 207.079 218.503 158.248 1.00   244.41 ? 134  SER A N   1 
ATOM   845   C  CA  . SER A  1  112  ? 205.943 219.016 159.067 1.00   241.42 ? 134  SER A CA  1 
ATOM   846   C  C   . SER A  1  112  ? 204.707 219.260 158.200 1.00   225.20 ? 134  SER A C   1 
ATOM   847   O  O   . SER A  1  112  ? 203.580 219.142 158.673 1.00   194.55 ? 134  SER A O   1 
ATOM   848   C  CB  . SER A  1  112  ? 206.287 220.290 159.901 1.00   227.88 ? 134  SER A CB  1 
ATOM   849   O  OG  . SER A  1  112  ? 206.455 221.477 159.128 1.00   169.77 ? 134  SER A OG  1 
ATOM   850   N  N   . GLU A  1  113  ? 212.664 217.844 163.534 1.00   187.11 ? 146  GLU A N   1 
ATOM   851   C  CA  . GLU A  1  113  ? 213.654 216.878 163.043 1.00   201.99 ? 146  GLU A CA  1 
ATOM   852   C  C   . GLU A  1  113  ? 213.625 216.784 161.469 1.00   217.25 ? 146  GLU A C   1 
ATOM   853   O  O   . GLU A  1  113  ? 212.628 217.109 160.768 1.00   136.32 ? 146  GLU A O   1 
ATOM   854   C  CB  . GLU A  1  113  ? 213.571 215.500 163.788 1.00   138.02 ? 146  GLU A CB  1 
ATOM   855   N  N   . VAL A  1  114  ? 214.770 216.355 160.943 1.00   230.33 ? 147  VAL A N   1 
ATOM   856   C  CA  . VAL A  1  114  ? 215.187 216.580 159.553 1.00   195.15 ? 147  VAL A CA  1 
ATOM   857   C  C   . VAL A  1  114  ? 215.621 215.244 158.961 1.00   172.52 ? 147  VAL A C   1 
ATOM   858   O  O   . VAL A  1  114  ? 216.434 214.566 159.590 1.00   199.02 ? 147  VAL A O   1 
ATOM   859   C  CB  . VAL A  1  114  ? 216.435 217.515 159.528 1.00   223.17 ? 147  VAL A CB  1 
ATOM   860   C  CG1 . VAL A  1  114  ? 216.855 217.839 158.099 1.00   224.93 ? 147  VAL A CG1 1 
ATOM   861   C  CG2 . VAL A  1  114  ? 216.222 218.792 160.361 1.00   214.92 ? 147  VAL A CG2 1 
ATOM   862   N  N   . GLU A  1  115  ? 215.116 214.872 157.776 1.00   169.77 ? 148  GLU A N   1 
ATOM   863   C  CA  . GLU A  1  115  ? 215.397 213.529 157.164 1.00   169.06 ? 148  GLU A CA  1 
ATOM   864   C  C   . GLU A  1  115  ? 216.515 213.650 156.162 1.00   140.38 ? 148  GLU A C   1 
ATOM   865   O  O   . GLU A  1  115  ? 216.254 214.102 155.061 1.00   179.76 ? 148  GLU A O   1 
ATOM   866   C  CB  . GLU A  1  115  ? 214.164 212.917 156.446 1.00   158.67 ? 148  GLU A CB  1 
ATOM   867   N  N   . LYS A  1  116  ? 217.735 213.264 156.560 1.00   128.14 ? 149  LYS A N   1 
ATOM   868   C  CA  . LYS A  1  116  ? 218.921 213.348 155.717 1.00   141.83 ? 149  LYS A CA  1 
ATOM   869   C  C   . LYS A  1  116  ? 219.054 212.105 154.877 1.00   139.48 ? 149  LYS A C   1 
ATOM   870   O  O   . LYS A  1  116  ? 219.149 210.994 155.400 1.00   184.73 ? 149  LYS A O   1 
ATOM   871   C  CB  . LYS A  1  116  ? 220.193 213.451 156.540 1.00   154.02 ? 149  LYS A CB  1 
ATOM   872   C  CG  . LYS A  1  116  ? 220.455 214.801 157.123 1.00   169.75 ? 149  LYS A CG  1 
ATOM   873   C  CD  . LYS A  1  116  ? 221.410 214.674 158.287 1.00   197.94 ? 149  LYS A CD  1 
ATOM   874   C  CE  . LYS A  1  116  ? 220.669 214.198 159.527 1.00   225.50 ? 149  LYS A CE  1 
ATOM   875   N  NZ  . LYS A  1  116  ? 221.509 214.364 160.741 1.00   265.63 ? 149  LYS A NZ  1 
ATOM   876   N  N   . CYS A  1  117  ? 219.094 212.291 153.579 1.00   131.66 ? 150  CYS A N   1 
ATOM   877   C  CA  . CYS A  1  117  ? 219.347 211.194 152.713 1.00   134.94 ? 150  CYS A CA  1 
ATOM   878   C  C   . CYS A  1  117  ? 220.250 211.550 151.578 1.00   126.71 ? 150  CYS A C   1 
ATOM   879   O  O   . CYS A  1  117  ? 220.359 212.693 151.191 1.00   159.96 ? 150  CYS A O   1 
ATOM   880   C  CB  . CYS A  1  117  ? 218.037 210.628 152.160 1.00   156.61 ? 150  CYS A CB  1 
ATOM   881   S  SG  . CYS A  1  117  ? 216.679 211.740 151.806 1.00   196.07 ? 150  CYS A SG  1 
ATOM   882   N  N   . ILE A  1  118  ? 220.869 210.523 151.030 1.00   126.99 ? 151  ILE A N   1 
ATOM   883   C  CA  . ILE A  1  118  ? 221.492 210.536 149.713 1.00   120.35 ? 151  ILE A CA  1 
ATOM   884   C  C   . ILE A  1  118  ? 220.434 210.328 148.581 1.00   123.00 ? 151  ILE A C   1 
ATOM   885   O  O   . ILE A  1  118  ? 219.592 209.434 148.700 1.00   98.91  ? 151  ILE A O   1 
ATOM   886   C  CB  . ILE A  1  118  ? 222.612 209.454 149.658 1.00   114.35 ? 151  ILE A CB  1 
ATOM   887   C  CG1 . ILE A  1  118  ? 223.350 209.557 148.330 1.00   130.19 ? 151  ILE A CG1 1 
ATOM   888   C  CG2 . ILE A  1  118  ? 222.091 208.029 149.926 1.00   113.21 ? 151  ILE A CG2 1 
ATOM   889   C  CD1 . ILE A  1  118  ? 223.612 208.245 147.608 1.00   150.89 ? 151  ILE A CD1 1 
ATOM   890   N  N   . CYS A  1  119  ? 220.482 211.144 147.505 1.00   146.45 ? 152  CYS A N   1 
ATOM   891   C  CA  . CYS A  1  119  ? 219.501 211.071 146.383 1.00   148.35 ? 152  CYS A CA  1 
ATOM   892   C  C   . CYS A  1  119  ? 220.120 210.724 145.053 1.00   145.65 ? 152  CYS A C   1 
ATOM   893   O  O   . CYS A  1  119  ? 220.772 211.582 144.464 1.00   149.76 ? 152  CYS A O   1 
ATOM   894   C  CB  . CYS A  1  119  ? 218.770 212.379 146.193 1.00   143.19 ? 152  CYS A CB  1 
ATOM   895   S  SG  . CYS A  1  119  ? 218.206 212.925 147.781 1.00   192.08 ? 152  CYS A SG  1 
ATOM   896   N  N   . ILE A  1  120  ? 219.832 209.502 144.574 1.00   127.56 ? 153  ILE A N   1 
ATOM   897   C  CA  . ILE A  1  120  ? 220.358 208.945 143.338 1.00   104.83 ? 153  ILE A CA  1 
ATOM   898   C  C   . ILE A  1  120  ? 219.371 209.284 142.263 1.00   112.78 ? 153  ILE A C   1 
ATOM   899   O  O   . ILE A  1  120  ? 218.238 208.798 142.315 1.00   119.75 ? 153  ILE A O   1 
ATOM   900   C  CB  . ILE A  1  120  ? 220.388 207.403 143.348 1.00   116.04 ? 153  ILE A CB  1 
ATOM   901   C  CG1 . ILE A  1  120  ? 220.990 206.825 144.667 1.00   125.25 ? 153  ILE A CG1 1 
ATOM   902   C  CG2 . ILE A  1  120  ? 221.020 206.884 142.031 1.00   103.29 ? 153  ILE A CG2 1 
ATOM   903   C  CD1 . ILE A  1  120  ? 222.490 206.905 144.785 1.00   121.07 ? 153  ILE A CD1 1 
ATOM   904   N  N   . LEU A  1  121  ? 219.788 210.098 141.291 1.00   126.37 ? 154  LEU A N   1 
ATOM   905   C  CA  . LEU A  1  121  ? 218.883 210.620 140.281 1.00   119.17 ? 154  LEU A CA  1 
ATOM   906   C  C   . LEU A  1  121  ? 219.125 209.902 138.960 1.00   121.74 ? 154  LEU A C   1 
ATOM   907   O  O   . LEU A  1  121  ? 220.278 209.822 138.531 1.00   139.06 ? 154  LEU A O   1 
ATOM   908   C  CB  . LEU A  1  121  ? 219.106 212.115 140.135 1.00   111.32 ? 154  LEU A CB  1 
ATOM   909   C  CG  . LEU A  1  121  ? 218.459 212.723 138.885 1.00   123.39 ? 154  LEU A CG  1 
ATOM   910   C  CD1 . LEU A  1  121  ? 216.972 212.446 138.849 1.00   134.54 ? 154  LEU A CD1 1 
ATOM   911   C  CD2 . LEU A  1  121  ? 218.682 214.221 138.709 1.00   129.58 ? 154  LEU A CD2 1 
ATOM   912   N  N   . GLN A  1  122  ? 218.060 209.371 138.339 1.00   123.42 ? 155  GLN A N   1 
ATOM   913   C  CA  . GLN A  1  122  ? 218.120 208.829 136.960 1.00   147.30 ? 155  GLN A CA  1 
ATOM   914   C  C   . GLN A  1  122  ? 217.231 209.602 136.001 1.00   177.69 ? 155  GLN A C   1 
ATOM   915   O  O   . GLN A  1  122  ? 216.464 210.480 136.397 1.00   222.48 ? 155  GLN A O   1 
ATOM   916   C  CB  . GLN A  1  122  ? 217.659 207.402 136.914 1.00   136.07 ? 155  GLN A CB  1 
ATOM   917   C  CG  . GLN A  1  122  ? 218.409 206.497 137.835 1.00   143.12 ? 155  GLN A CG  1 
ATOM   918   C  CD  . GLN A  1  122  ? 217.433 205.660 138.598 1.00   154.92 ? 155  GLN A CD  1 
ATOM   919   O  OE1 . GLN A  1  122  ? 216.634 204.921 138.004 1.00   159.43 ? 155  GLN A OE1 1 
ATOM   920   N  NE2 . GLN A  1  122  ? 217.449 205.805 139.918 1.00   151.98 ? 155  GLN A NE2 1 
ATOM   921   N  N   . SER A  1  123  ? 217.331 209.259 134.726 1.00   174.70 ? 156  SER A N   1 
ATOM   922   C  CA  . SER A  1  123  ? 216.483 209.873 133.732 1.00   207.14 ? 156  SER A CA  1 
ATOM   923   C  C   . SER A  1  123  ? 215.026 209.630 134.067 1.00   212.66 ? 156  SER A C   1 
ATOM   924   O  O   . SER A  1  123  ? 214.193 210.530 133.927 1.00   233.54 ? 156  SER A O   1 
ATOM   925   C  CB  . SER A  1  123  ? 216.811 209.308 132.361 1.00   242.94 ? 156  SER A CB  1 
ATOM   926   O  OG  . SER A  1  123  ? 218.203 209.429 132.111 1.00   279.95 ? 156  SER A OG  1 
ATOM   927   N  N   . SER A  1  124  ? 214.737 208.422 134.532 1.00   196.81 ? 157  SER A N   1 
ATOM   928   C  CA  . SER A  1  124  ? 213.388 208.053 134.922 1.00   214.37 ? 157  SER A CA  1 
ATOM   929   C  C   . SER A  1  124  ? 212.878 208.863 136.136 1.00   199.35 ? 157  SER A C   1 
ATOM   930   O  O   . SER A  1  124  ? 211.817 209.491 136.079 1.00   186.46 ? 157  SER A O   1 
ATOM   931   C  CB  . SER A  1  124  ? 213.347 206.542 135.213 1.00   233.19 ? 157  SER A CB  1 
ATOM   932   O  OG  . SER A  1  124  ? 212.023 206.043 135.200 1.00   260.06 ? 157  SER A OG  1 
ATOM   933   N  N   . CYS A  1  125  ? 213.673 208.885 137.201 1.00   193.43 ? 158  CYS A N   1 
ATOM   934   C  CA  . CYS A  1  125  ? 213.160 209.207 138.524 1.00   171.73 ? 158  CYS A CA  1 
ATOM   935   C  C   . CYS A  1  125  ? 214.241 209.424 139.567 1.00   155.07 ? 158  CYS A C   1 
ATOM   936   O  O   . CYS A  1  125  ? 215.417 209.121 139.347 1.00   175.22 ? 158  CYS A O   1 
ATOM   937   C  CB  . CYS A  1  125  ? 212.356 208.009 139.010 1.00   169.24 ? 158  CYS A CB  1 
ATOM   938   S  SG  . CYS A  1  125  ? 213.435 206.577 139.228 1.00   178.12 ? 158  CYS A SG  1 
ATOM   939   N  N   . ILE A  1  126  ? 213.811 209.853 140.745 1.00   116.21 ? 159  ILE A N   1 
ATOM   940   C  CA  . ILE A  1  126  ? 214.703 210.031 141.861 1.00   112.98 ? 159  ILE A CA  1 
ATOM   941   C  C   . ILE A  1  126  ? 214.559 208.907 142.909 1.00   108.68 ? 159  ILE A C   1 
ATOM   942   O  O   . ILE A  1  126  ? 213.456 208.474 143.191 1.00   147.10 ? 159  ILE A O   1 
ATOM   943   C  CB  . ILE A  1  126  ? 214.469 211.458 142.418 1.00   122.30 ? 159  ILE A CB  1 
ATOM   944   C  CG1 . ILE A  1  126  ? 215.537 212.379 141.809 1.00   147.60 ? 159  ILE A CG1 1 
ATOM   945   C  CG2 . ILE A  1  126  ? 214.466 211.500 143.933 1.00   137.30 ? 159  ILE A CG2 1 
ATOM   946   C  CD1 . ILE A  1  126  ? 216.100 213.518 142.648 1.00   161.55 ? 159  ILE A CD1 1 
ATOM   947   N  N   . ASN A  1  127  ? 215.669 208.428 143.473 1.00   107.73 ? 160  ASN A N   1 
ATOM   948   C  CA  . ASN A  1  127  ? 215.645 207.580 144.694 1.00   119.92 ? 160  ASN A CA  1 
ATOM   949   C  C   . ASN A  1  127  ? 216.286 208.263 145.848 1.00   117.01 ? 160  ASN A C   1 
ATOM   950   O  O   . ASN A  1  127  ? 217.371 208.788 145.714 1.00   141.64 ? 160  ASN A O   1 
ATOM   951   C  CB  . ASN A  1  127  ? 216.413 206.292 144.511 1.00   119.98 ? 160  ASN A CB  1 
ATOM   952   C  CG  . ASN A  1  127  ? 215.765 205.405 143.498 1.00   142.64 ? 160  ASN A CG  1 
ATOM   953   O  OD1 . ASN A  1  127  ? 214.551 205.147 143.569 1.00   149.52 ? 160  ASN A OD1 1 
ATOM   954   N  ND2 . ASN A  1  127  ? 216.547 204.946 142.527 1.00   138.09 ? 160  ASN A ND2 1 
ATOM   955   N  N   . MET A  1  128  ? 215.637 208.191 146.997 1.00   110.72 ? 161  MET A N   1 
ATOM   956   C  CA  . MET A  1  128  ? 216.142 208.756 148.218 1.00   117.62 ? 161  MET A CA  1 
ATOM   957   C  C   . MET A  1  128  ? 216.327 207.592 149.163 1.00   117.11 ? 161  MET A C   1 
ATOM   958   O  O   . MET A  1  128  ? 215.649 206.553 149.078 1.00   159.72 ? 161  MET A O   1 
ATOM   959   C  CB  . MET A  1  128  ? 215.140 209.707 148.830 1.00   123.83 ? 161  MET A CB  1 
ATOM   960   C  CG  . MET A  1  128  ? 214.301 210.481 147.842 1.00   143.64 ? 161  MET A CG  1 
ATOM   961   S  SD  . MET A  1  128  ? 215.093 211.991 147.281 1.00   191.59 ? 161  MET A SD  1 
ATOM   962   C  CE  . MET A  1  128  ? 213.631 212.980 146.899 1.00   179.33 ? 161  MET A CE  1 
ATOM   963   N  N   . HIS A  1  129  ? 217.255 207.751 150.068 1.00   103.36 ? 162  HIS A N   1 
ATOM   964   C  CA  . HIS A  1  129  ? 217.432 206.735 151.008 1.00   110.67 ? 162  HIS A CA  1 
ATOM   965   C  C   . HIS A  1  129  ? 217.943 207.360 152.242 1.00   118.45 ? 162  HIS A C   1 
ATOM   966   O  O   . HIS A  1  129  ? 219.120 207.712 152.299 1.00   151.73 ? 162  HIS A O   1 
ATOM   967   C  CB  . HIS A  1  129  ? 218.421 205.732 150.466 1.00   125.25 ? 162  HIS A CB  1 
ATOM   968   C  CG  . HIS A  1  129  ? 218.524 204.529 151.318 1.00   140.89 ? 162  HIS A CG  1 
ATOM   969   N  ND1 . HIS A  1  129  ? 219.431 204.428 152.352 1.00   142.44 ? 162  HIS A ND1 1 
ATOM   970   C  CD2 . HIS A  1  129  ? 217.776 203.406 151.346 1.00   139.30 ? 162  HIS A CD2 1 
ATOM   971   C  CE1 . HIS A  1  129  ? 219.254 203.271 152.959 1.00   159.62 ? 162  HIS A CE1 1 
ATOM   972   N  NE2 . HIS A  1  129  ? 218.255 202.633 152.371 1.00   158.71 ? 162  HIS A NE2 1 
ATOM   973   N  N   . SER A  1  130  ? 217.065 207.502 153.238 1.00   120.23 ? 163  SER A N   1 
ATOM   974   C  CA  . SER A  1  130  ? 217.436 208.045 154.553 1.00   132.05 ? 163  SER A CA  1 
ATOM   975   C  C   . SER A  1  130  ? 218.638 207.340 155.228 1.00   131.07 ? 163  SER A C   1 
ATOM   976   O  O   . SER A  1  130  ? 218.918 206.158 155.001 1.00   142.91 ? 163  SER A O   1 
ATOM   977   C  CB  . SER A  1  130  ? 216.207 208.074 155.486 1.00   144.44 ? 163  SER A CB  1 
ATOM   978   O  OG  . SER A  1  130  ? 215.109 208.768 154.880 1.00   171.33 ? 163  SER A OG  1 
ATOM   979   N  N   . ILE A  1  131  ? 219.378 208.092 156.024 1.00   131.25 ? 164  ILE A N   1 
ATOM   980   C  CA  . ILE A  1  131  ? 220.374 207.492 156.894 1.00   140.12 ? 164  ILE A CA  1 
ATOM   981   C  C   . ILE A  1  131  ? 219.647 206.655 157.933 1.00   153.67 ? 164  ILE A C   1 
ATOM   982   O  O   . ILE A  1  131  ? 220.208 205.679 158.421 1.00   177.33 ? 164  ILE A O   1 
ATOM   983   C  CB  . ILE A  1  131  ? 221.303 208.529 157.571 1.00   156.64 ? 164  ILE A CB  1 
ATOM   984   C  CG1 . ILE A  1  131  ? 220.539 209.457 158.531 1.00   191.61 ? 164  ILE A CG1 1 
ATOM   985   C  CG2 . ILE A  1  131  ? 222.042 209.353 156.517 1.00   175.99 ? 164  ILE A CG2 1 
ATOM   986   C  CD1 . ILE A  1  131  ? 221.383 210.584 159.101 1.00   214.70 ? 164  ILE A CD1 1 
ATOM   987   N  N   . GLU A  1  132  ? 218.401 207.047 158.249 1.00   148.98 ? 165  GLU A N   1 
ATOM   988   C  CA  . GLU A  1  132  ? 217.502 206.275 159.106 1.00   152.39 ? 165  GLU A CA  1 
ATOM   989   C  C   . GLU A  1  132  ? 217.122 204.924 158.487 1.00   143.92 ? 165  GLU A C   1 
ATOM   990   O  O   . GLU A  1  132  ? 216.922 203.954 159.203 1.00   180.98 ? 165  GLU A O   1 
ATOM   991   C  CB  . GLU A  1  132  ? 216.230 207.067 159.386 1.00   189.78 ? 165  GLU A CB  1 
ATOM   992   C  CG  . GLU A  1  132  ? 215.409 206.548 160.570 1.00   233.42 ? 165  GLU A CG  1 
ATOM   993   C  CD  . GLU A  1  132  ? 213.903 206.481 160.308 1.00   263.73 ? 165  GLU A CD  1 
ATOM   994   O  OE1 . GLU A  1  132  ? 213.386 207.245 159.460 1.00   257.67 ? 165  GLU A OE1 1 
ATOM   995   O  OE2 . GLU A  1  132  ? 213.230 205.652 160.960 1.00   299.28 ? 165  GLU A OE2 1 
ATOM   996   N  N   . GLY A  1  133  ? 217.031 204.865 157.168 1.00   124.07 ? 166  GLY A N   1 
ATOM   997   C  CA  . GLY A  1  133  ? 216.776 203.626 156.446 1.00   121.16 ? 166  GLY A CA  1 
ATOM   998   C  C   . GLY A  1  133  ? 215.479 203.613 155.652 1.00   123.92 ? 166  GLY A C   1 
ATOM   999   O  O   . GLY A  1  133  ? 215.206 202.670 154.918 1.00   140.49 ? 166  GLY A O   1 
ATOM   1000  N  N   . LYS A  1  134  ? 214.651 204.633 155.820 1.00   122.29 ? 167  LYS A N   1 
ATOM   1001  C  CA  . LYS A  1  134  ? 213.490 204.817 154.975 1.00   115.37 ? 167  LYS A CA  1 
ATOM   1002  C  C   . LYS A  1  134  ? 213.921 205.103 153.555 1.00   116.79 ? 167  LYS A C   1 
ATOM   1003  O  O   . LYS A  1  134  ? 214.908 205.798 153.331 1.00   171.43 ? 167  LYS A O   1 
ATOM   1004  C  CB  . LYS A  1  134  ? 212.694 206.008 155.476 1.00   138.59 ? 167  LYS A CB  1 
ATOM   1005  C  CG  . LYS A  1  134  ? 211.895 205.764 156.747 1.00   150.92 ? 167  LYS A CG  1 
ATOM   1006  C  CD  . LYS A  1  134  ? 210.567 206.534 156.754 1.00   179.40 ? 167  LYS A CD  1 
ATOM   1007  C  CE  . LYS A  1  134  ? 209.661 206.271 155.536 1.00   180.81 ? 167  LYS A CE  1 
ATOM   1008  N  NZ  . LYS A  1  134  ? 209.625 204.839 155.103 1.00   199.05 ? 167  LYS A NZ  1 
ATOM   1009  N  N   . ASP A  1  135  ? 213.178 204.599 152.594 1.00   116.48 ? 168  ASP A N   1 
ATOM   1010  C  CA  . ASP A  1  135  ? 213.515 204.822 151.186 1.00   141.80 ? 168  ASP A CA  1 
ATOM   1011  C  C   . ASP A  1  135  ? 212.276 205.370 150.492 1.00   131.51 ? 168  ASP A C   1 
ATOM   1012  O  O   . ASP A  1  135  ? 211.141 205.083 150.884 1.00   185.47 ? 168  ASP A O   1 
ATOM   1013  C  CB  . ASP A  1  135  ? 214.096 203.566 150.530 1.00   164.31 ? 168  ASP A CB  1 
ATOM   1014  C  CG  . ASP A  1  135  ? 213.632 202.267 151.215 1.00   252.13 ? 168  ASP A CG  1 
ATOM   1015  O  OD1 . ASP A  1  135  ? 212.552 202.276 151.859 1.00   315.93 ? 168  ASP A OD1 1 
ATOM   1016  O  OD2 . ASP A  1  135  ? 214.336 201.234 151.114 1.00   338.20 ? 168  ASP A OD2 1 
ATOM   1017  N  N   . TYR A  1  136  ? 212.500 206.213 149.501 1.00   112.18 ? 169  TYR A N   1 
ATOM   1018  C  CA  . TYR A  1  136  ? 211.448 206.916 148.819 1.00   103.13 ? 169  TYR A CA  1 
ATOM   1019  C  C   . TYR A  1  136  ? 211.834 206.993 147.367 1.00   117.83 ? 169  TYR A C   1 
ATOM   1020  O  O   . TYR A  1  136  ? 212.915 207.440 147.003 1.00   139.73 ? 169  TYR A O   1 
ATOM   1021  C  CB  . TYR A  1  136  ? 211.310 208.351 149.295 1.00   101.84 ? 169  TYR A CB  1 
ATOM   1022  C  CG  . TYR A  1  136  ? 211.165 208.585 150.770 1.00   103.20 ? 169  TYR A CG  1 
ATOM   1023  C  CD1 . TYR A  1  136  ? 209.913 208.587 151.364 1.00   106.34 ? 169  TYR A CD1 1 
ATOM   1024  C  CD2 . TYR A  1  136  ? 212.274 208.910 151.560 1.00   127.59 ? 169  TYR A CD2 1 
ATOM   1025  C  CE1 . TYR A  1  136  ? 209.746 208.852 152.709 1.00   108.58 ? 169  TYR A CE1 1 
ATOM   1026  C  CE2 . TYR A  1  136  ? 212.125 209.186 152.907 1.00   153.40 ? 169  TYR A CE2 1 
ATOM   1027  C  CZ  . TYR A  1  136  ? 210.845 209.148 153.474 1.00   145.48 ? 169  TYR A CZ  1 
ATOM   1028  O  OH  . TYR A  1  136  ? 210.654 209.420 154.809 1.00   175.01 ? 169  TYR A OH  1 
ATOM   1029  N  N   . ILE A  1  137  ? 210.926 206.558 146.532 1.00   136.67 ? 170  ILE A N   1 
ATOM   1030  C  CA  . ILE A  1  137  ? 211.046 206.772 145.127 1.00   131.75 ? 170  ILE A CA  1 
ATOM   1031  C  C   . ILE A  1  137  ? 210.122 207.935 144.826 1.00   135.35 ? 170  ILE A C   1 
ATOM   1032  O  O   . ILE A  1  137  ? 208.926 207.836 145.049 1.00   168.68 ? 170  ILE A O   1 
ATOM   1033  C  CB  . ILE A  1  137  ? 210.549 205.554 144.369 1.00   128.66 ? 170  ILE A CB  1 
ATOM   1034  C  CG1 . ILE A  1  137  ? 211.407 204.346 144.672 1.00   149.96 ? 170  ILE A CG1 1 
ATOM   1035  C  CG2 . ILE A  1  137  ? 210.588 205.814 142.895 1.00   139.58 ? 170  ILE A CG2 1 
ATOM   1036  C  CD1 . ILE A  1  137  ? 210.650 203.047 144.457 1.00   187.58 ? 170  ILE A CD1 1 
ATOM   1037  N  N   . ALA A  1  138  ? 210.680 209.045 144.364 1.00   149.14 ? 171  ALA A N   1 
ATOM   1038  C  CA  . ALA A  1  138  ? 209.920 210.048 143.597 1.00   139.40 ? 171  ALA A CA  1 
ATOM   1039  C  C   . ALA A  1  138  ? 209.729 209.521 142.207 1.00   145.53 ? 171  ALA A C   1 
ATOM   1040  O  O   . ALA A  1  138  ? 210.315 208.515 141.820 1.00   116.97 ? 171  ALA A O   1 
ATOM   1041  C  CB  . ALA A  1  138  ? 210.677 211.361 143.489 1.00   138.22 ? 171  ALA A CB  1 
ATOM   1042  N  N   . SER A  1  139  ? 208.901 210.213 141.446 1.00   173.27 ? 172  SER A N   1 
ATOM   1043  C  CA  . SER A  1  139  ? 208.998 210.121 139.998 1.00   190.78 ? 172  SER A CA  1 
ATOM   1044  C  C   . SER A  1  139  ? 208.986 211.536 139.490 1.00   160.08 ? 172  SER A C   1 
ATOM   1045  O  O   . SER A  1  139  ? 208.420 212.435 140.116 1.00   140.77 ? 172  SER A O   1 
ATOM   1046  C  CB  . SER A  1  139  ? 207.891 209.266 139.377 1.00   208.33 ? 172  SER A CB  1 
ATOM   1047  O  OG  . SER A  1  139  ? 208.342 208.733 138.138 1.00   195.38 ? 172  SER A OG  1 
ATOM   1048  N  N   . LEU A  1  140  ? 209.651 211.734 138.366 1.00   149.51 ? 173  LEU A N   1 
ATOM   1049  C  CA  . LEU A  1  140  ? 209.808 213.048 137.849 1.00   148.40 ? 173  LEU A CA  1 
ATOM   1050  C  C   . LEU A  1  140  ? 208.797 213.254 136.719 1.00   162.61 ? 173  LEU A C   1 
ATOM   1051  O  O   . LEU A  1  140  ? 208.582 212.365 135.873 1.00   177.26 ? 173  LEU A O   1 
ATOM   1052  C  CB  . LEU A  1  140  ? 211.260 213.308 137.433 1.00   158.87 ? 173  LEU A CB  1 
ATOM   1053  C  CG  . LEU A  1  140  ? 211.882 214.363 138.356 1.00   186.54 ? 173  LEU A CG  1 
ATOM   1054  C  CD1 . LEU A  1  140  ? 212.186 213.753 139.723 1.00   204.57 ? 173  LEU A CD1 1 
ATOM   1055  C  CD2 . LEU A  1  140  ? 213.111 215.009 137.729 1.00   190.21 ? 173  LEU A CD2 1 
ATOM   1056  N  N   . PRO A  1  141  ? 208.113 214.399 136.744 1.00   149.99 ? 174  PRO A N   1 
ATOM   1057  C  CA  . PRO A  1  141  ? 207.256 214.796 135.646 1.00   153.43 ? 174  PRO A CA  1 
ATOM   1058  C  C   . PRO A  1  141  ? 207.991 215.114 134.340 1.00   158.01 ? 174  PRO A C   1 
ATOM   1059  O  O   . PRO A  1  141  ? 207.464 214.878 133.265 1.00   225.31 ? 174  PRO A O   1 
ATOM   1060  C  CB  . PRO A  1  141  ? 206.582 216.051 136.182 1.00   145.04 ? 174  PRO A CB  1 
ATOM   1061  C  CG  . PRO A  1  141  ? 207.527 216.503 137.246 1.00   155.18 ? 174  PRO A CG  1 
ATOM   1062  C  CD  . PRO A  1  141  ? 207.891 215.252 137.912 1.00   140.71 ? 174  PRO A CD  1 
ATOM   1063  N  N   . PHE A  1  142  ? 209.202 215.631 134.424 1.00   138.75 ? 175  PHE A N   1 
ATOM   1064  C  CA  . PHE A  1  142  ? 209.910 216.119 133.246 1.00   142.79 ? 175  PHE A CA  1 
ATOM   1065  C  C   . PHE A  1  142  ? 211.352 215.620 133.159 1.00   144.71 ? 175  PHE A C   1 
ATOM   1066  O  O   . PHE A  1  142  ? 211.893 215.101 134.122 1.00   170.92 ? 175  PHE A O   1 
ATOM   1067  C  CB  . PHE A  1  142  ? 209.903 217.637 133.293 1.00   154.81 ? 175  PHE A CB  1 
ATOM   1068  C  CG  . PHE A  1  142  ? 210.278 218.207 134.639 1.00   151.63 ? 175  PHE A CG  1 
ATOM   1069  C  CD1 . PHE A  1  142  ? 209.305 218.698 135.472 1.00   144.60 ? 175  PHE A CD1 1 
ATOM   1070  C  CD2 . PHE A  1  142  ? 211.603 218.250 135.069 1.00   159.92 ? 175  PHE A CD2 1 
ATOM   1071  C  CE1 . PHE A  1  142  ? 209.630 219.219 136.708 1.00   147.87 ? 175  PHE A CE1 1 
ATOM   1072  C  CE2 . PHE A  1  142  ? 211.927 218.774 136.307 1.00   163.58 ? 175  PHE A CE2 1 
ATOM   1073  C  CZ  . PHE A  1  142  ? 210.938 219.262 137.128 1.00   154.19 ? 175  PHE A CZ  1 
ATOM   1074  N  N   . GLN A  1  143  ? 211.995 215.835 132.019 1.00   162.71 ? 176  GLN A N   1 
ATOM   1075  C  CA  . GLN A  1  143  ? 213.457 215.640 131.903 1.00   189.65 ? 176  GLN A CA  1 
ATOM   1076  C  C   . GLN A  1  143  ? 214.271 216.693 132.677 1.00   180.96 ? 176  GLN A C   1 
ATOM   1077  O  O   . GLN A  1  143  ? 214.133 217.901 132.413 1.00   185.55 ? 176  GLN A O   1 
ATOM   1078  C  CB  . GLN A  1  143  ? 213.884 215.673 130.432 1.00   204.52 ? 176  GLN A CB  1 
ATOM   1079  C  CG  . GLN A  1  143  ? 213.374 214.506 129.604 1.00   215.45 ? 176  GLN A CG  1 
ATOM   1080  C  CD  . GLN A  1  143  ? 213.953 213.169 130.037 1.00   254.35 ? 176  GLN A CD  1 
ATOM   1081  O  OE1 . GLN A  1  143  ? 213.257 212.153 130.013 1.00   298.39 ? 176  GLN A OE1 1 
ATOM   1082  N  NE2 . GLN A  1  143  ? 215.227 213.159 130.449 1.00   252.26 ? 176  GLN A NE2 1 
ATOM   1083  N  N   . VAL A  1  144  ? 215.144 216.229 133.585 1.00   137.05 ? 177  VAL A N   1 
ATOM   1084  C  CA  . VAL A  1  144  ? 215.897 217.128 134.482 1.00   135.66 ? 177  VAL A CA  1 
ATOM   1085  C  C   . VAL A  1  144  ? 217.329 217.414 133.997 1.00   143.82 ? 177  VAL A C   1 
ATOM   1086  O  O   . VAL A  1  144  ? 217.983 216.547 133.426 1.00   165.24 ? 177  VAL A O   1 
ATOM   1087  C  CB  . VAL A  1  144  ? 215.929 216.614 135.943 1.00   130.42 ? 177  VAL A CB  1 
ATOM   1088  C  CG1 . VAL A  1  144  ? 216.676 215.302 136.070 1.00   160.57 ? 177  VAL A CG1 1 
ATOM   1089  C  CG2 . VAL A  1  144  ? 216.591 217.616 136.875 1.00   132.71 ? 177  VAL A CG2 1 
ATOM   1090  N  N   . ALA A  1  145  ? 217.804 218.637 134.244 1.00   148.83 ? 178  ALA A N   1 
ATOM   1091  C  CA  . ALA A  1  145  ? 219.191 219.007 133.976 1.00   164.62 ? 178  ALA A CA  1 
ATOM   1092  C  C   . ALA A  1  145  ? 220.063 218.610 135.169 1.00   172.26 ? 178  ALA A C   1 
ATOM   1093  O  O   . ALA A  1  145  ? 220.927 217.727 135.052 1.00   175.69 ? 178  ALA A O   1 
ATOM   1094  C  CB  . ALA A  1  145  ? 219.307 220.507 133.678 1.00   162.61 ? 178  ALA A CB  1 
ATOM   1095  N  N   . ASN A  1  146  ? 219.808 219.262 136.308 1.00   162.00 ? 179  ASN A N   1 
ATOM   1096  C  CA  . ASN A  1  146  ? 220.558 219.054 137.551 1.00   144.09 ? 179  ASN A CA  1 
ATOM   1097  C  C   . ASN A  1  146  ? 219.626 219.019 138.728 1.00   133.45 ? 179  ASN A C   1 
ATOM   1098  O  O   . ASN A  1  146  ? 218.459 219.416 138.625 1.00   162.18 ? 179  ASN A O   1 
ATOM   1099  C  CB  . ASN A  1  146  ? 221.452 220.233 137.835 1.00   143.54 ? 179  ASN A CB  1 
ATOM   1100  C  CG  . ASN A  1  146  ? 222.600 220.356 136.888 1.00   172.60 ? 179  ASN A CG  1 
ATOM   1101  O  OD1 . ASN A  1  146  ? 223.755 220.297 137.311 1.00   209.53 ? 179  ASN A OD1 1 
ATOM   1102  N  ND2 . ASN A  1  146  ? 222.306 220.590 135.610 1.00   184.84 ? 179  ASN A ND2 1 
ATOM   1103  N  N   . VAL A  1  147  ? 220.153 218.602 139.865 1.00   105.43 ? 180  VAL A N   1 
ATOM   1104  C  CA  . VAL A  1  147  ? 219.480 218.827 141.141 1.00   114.64 ? 180  VAL A CA  1 
ATOM   1105  C  C   . VAL A  1  147  ? 220.440 219.472 142.098 1.00   120.40 ? 180  VAL A C   1 
ATOM   1106  O  O   . VAL A  1  147  ? 221.617 219.141 142.142 1.00   169.29 ? 180  VAL A O   1 
ATOM   1107  C  CB  . VAL A  1  147  ? 218.953 217.554 141.825 1.00   129.15 ? 180  VAL A CB  1 
ATOM   1108  C  CG1 . VAL A  1  147  ? 217.539 217.220 141.382 1.00   133.18 ? 180  VAL A CG1 1 
ATOM   1109  C  CG2 . VAL A  1  147  ? 219.899 216.387 141.604 1.00   152.27 ? 180  VAL A CG2 1 
ATOM   1110  N  N   . TRP A  1  148  ? 219.918 220.401 142.862 1.00   129.33 ? 181  TRP A N   1 
ATOM   1111  C  CA  . TRP A  1  148  ? 220.714 221.254 143.693 1.00   136.72 ? 181  TRP A CA  1 
ATOM   1112  C  C   . TRP A  1  148  ? 220.141 221.166 145.070 1.00   145.28 ? 181  TRP A C   1 
ATOM   1113  O  O   . TRP A  1  148  ? 219.011 221.589 145.301 1.00   205.93 ? 181  TRP A O   1 
ATOM   1114  C  CB  . TRP A  1  148  ? 220.603 222.665 143.164 1.00   138.38 ? 181  TRP A CB  1 
ATOM   1115  C  CG  . TRP A  1  148  ? 221.327 222.758 141.931 1.00   139.48 ? 181  TRP A CG  1 
ATOM   1116  C  CD1 . TRP A  1  148  ? 220.878 222.428 140.709 1.00   131.70 ? 181  TRP A CD1 1 
ATOM   1117  C  CD2 . TRP A  1  148  ? 222.692 223.135 141.787 1.00   144.77 ? 181  TRP A CD2 1 
ATOM   1118  N  NE1 . TRP A  1  148  ? 221.878 222.598 139.795 1.00   140.52 ? 181  TRP A NE1 1 
ATOM   1119  C  CE2 . TRP A  1  148  ? 223.003 223.032 140.430 1.00   133.40 ? 181  TRP A CE2 1 
ATOM   1120  C  CE3 . TRP A  1  148  ? 223.671 223.585 142.678 1.00   172.00 ? 181  TRP A CE3 1 
ATOM   1121  C  CZ2 . TRP A  1  148  ? 224.247 223.365 139.921 1.00   157.08 ? 181  TRP A CZ2 1 
ATOM   1122  C  CZ3 . TRP A  1  148  ? 224.914 223.907 142.182 1.00   183.20 ? 181  TRP A CZ3 1 
ATOM   1123  C  CH2 . TRP A  1  148  ? 225.193 223.801 140.805 1.00   180.96 ? 181  TRP A CH2 1 
ATOM   1124  N  N   . PRO A  1  149  ? 220.896 220.631 145.997 1.00   126.59 ? 182  PRO A N   1 
ATOM   1125  C  CA  . PRO A  1  149  ? 220.314 220.547 147.309 1.00   133.39 ? 182  PRO A CA  1 
ATOM   1126  C  C   . PRO A  1  149  ? 220.274 221.952 147.949 1.00   156.17 ? 182  PRO A C   1 
ATOM   1127  O  O   . PRO A  1  149  ? 221.199 222.744 147.748 1.00   170.03 ? 182  PRO A O   1 
ATOM   1128  C  CB  . PRO A  1  149  ? 221.341 219.735 148.036 1.00   155.76 ? 182  PRO A CB  1 
ATOM   1129  C  CG  . PRO A  1  149  ? 222.654 220.215 147.428 1.00   170.14 ? 182  PRO A CG  1 
ATOM   1130  C  CD  . PRO A  1  149  ? 222.356 220.769 146.064 1.00   140.55 ? 182  PRO A CD  1 
ATOM   1131  N  N   . THR A  1  150  ? 219.233 222.240 148.726 1.00   156.00 ? 183  THR A N   1 
ATOM   1132  C  CA  . THR A  1  150  ? 219.037 223.559 149.360 1.00   155.95 ? 183  THR A CA  1 
ATOM   1133  C  C   . THR A  1  150  ? 218.578 223.393 150.814 1.00   157.77 ? 183  THR A C   1 
ATOM   1134  O  O   . THR A  1  150  ? 217.988 222.363 151.125 1.00   207.72 ? 183  THR A O   1 
ATOM   1135  C  CB  . THR A  1  150  ? 217.952 224.349 148.573 1.00   190.36 ? 183  THR A CB  1 
ATOM   1136  O  OG1 . THR A  1  150  ? 216.635 223.929 148.941 1.00   187.57 ? 183  THR A OG1 1 
ATOM   1137  C  CG2 . THR A  1  150  ? 218.071 224.139 147.062 1.00   210.46 ? 183  THR A CG2 1 
ATOM   1138  N  N   . LYS A  1  151  ? 218.784 224.376 151.706 1.00   168.39 ? 184  LYS A N   1 
ATOM   1139  C  CA  . LYS A  1  151  ? 217.951 224.423 152.946 1.00   182.15 ? 184  LYS A CA  1 
ATOM   1140  C  C   . LYS A  1  151  ? 216.560 224.379 152.328 1.00   191.13 ? 184  LYS A C   1 
ATOM   1141  O  O   . LYS A  1  151  ? 216.402 224.868 151.214 1.00   218.60 ? 184  LYS A O   1 
ATOM   1142  C  CB  . LYS A  1  151  ? 218.146 225.704 153.800 1.00   159.38 ? 184  LYS A CB  1 
ATOM   1143  N  N   . TYR A  1  152  ? 215.568 223.771 152.963 1.00   175.05 ? 185  TYR A N   1 
ATOM   1144  C  CA  . TYR A  1  152  ? 214.217 223.663 152.340 1.00   181.42 ? 185  TYR A CA  1 
ATOM   1145  C  C   . TYR A  1  152  ? 214.071 222.445 151.394 1.00   182.38 ? 185  TYR A C   1 
ATOM   1146  O  O   . TYR A  1  152  ? 213.004 222.231 150.788 1.00   175.85 ? 185  TYR A O   1 
ATOM   1147  C  CB  . TYR A  1  152  ? 213.760 224.977 151.611 1.00   148.66 ? 185  TYR A CB  1 
ATOM   1148  C  CG  . TYR A  1  152  ? 213.797 226.252 152.448 1.00   169.79 ? 185  TYR A CG  1 
ATOM   1149  C  CD1 . TYR A  1  152  ? 212.731 226.578 153.302 1.00   183.59 ? 185  TYR A CD1 1 
ATOM   1150  C  CD2 . TYR A  1  152  ? 214.897 227.141 152.392 1.00   186.42 ? 185  TYR A CD2 1 
ATOM   1151  C  CE1 . TYR A  1  152  ? 212.764 227.738 154.067 1.00   217.83 ? 185  TYR A CE1 1 
ATOM   1152  C  CE2 . TYR A  1  152  ? 214.941 228.291 153.159 1.00   192.42 ? 185  TYR A CE2 1 
ATOM   1153  C  CZ  . TYR A  1  152  ? 213.870 228.590 153.987 1.00   228.41 ? 185  TYR A CZ  1 
ATOM   1154  O  OH  . TYR A  1  152  ? 213.893 229.734 154.747 1.00   279.39 ? 185  TYR A OH  1 
ATOM   1155  N  N   . GLY A  1  153  ? 215.126 221.640 151.283 1.00   186.52 ? 186  GLY A N   1 
ATOM   1156  C  CA  . GLY A  1  153  ? 215.100 220.421 150.468 1.00   179.34 ? 186  GLY A CA  1 
ATOM   1157  C  C   . GLY A  1  153  ? 215.613 220.596 149.062 1.00   163.86 ? 186  GLY A C   1 
ATOM   1158  O  O   . GLY A  1  153  ? 216.323 221.539 148.755 1.00   190.69 ? 186  GLY A O   1 
ATOM   1159  N  N   . LEU A  1  154  ? 215.210 219.697 148.190 1.00   146.33 ? 187  LEU A N   1 
ATOM   1160  C  CA  . LEU A  1  154  ? 215.712 219.675 146.829 1.00   139.56 ? 187  LEU A CA  1 
ATOM   1161  C  C   . LEU A  1  154  ? 215.127 220.725 145.884 1.00   157.37 ? 187  LEU A C   1 
ATOM   1162  O  O   . LEU A  1  154  ? 214.192 221.467 146.233 1.00   194.55 ? 187  LEU A O   1 
ATOM   1163  C  CB  . LEU A  1  154  ? 215.452 218.306 146.244 1.00   123.03 ? 187  LEU A CB  1 
ATOM   1164  C  CG  . LEU A  1  154  ? 216.565 217.618 145.508 1.00   120.60 ? 187  LEU A CG  1 
ATOM   1165  C  CD1 . LEU A  1  154  ? 217.940 218.075 145.966 1.00   148.07 ? 187  LEU A CD1 1 
ATOM   1166  C  CD2 . LEU A  1  154  ? 216.409 216.127 145.780 1.00   114.58 ? 187  LEU A CD2 1 
ATOM   1167  N  N   . LEU A  1  155  ? 215.697 220.750 144.678 1.00   149.98 ? 188  LEU A N   1 
ATOM   1168  C  CA  . LEU A  1  155  ? 215.325 221.696 143.618 1.00   153.04 ? 188  LEU A CA  1 
ATOM   1169  C  C   . LEU A  1  155  ? 215.860 221.196 142.231 1.00   150.66 ? 188  LEU A C   1 
ATOM   1170  O  O   . LEU A  1  155  ? 216.918 220.605 142.127 1.00   177.29 ? 188  LEU A O   1 
ATOM   1171  C  CB  . LEU A  1  155  ? 215.761 223.119 144.016 1.00   132.06 ? 188  LEU A CB  1 
ATOM   1172  C  CG  . LEU A  1  155  ? 216.299 224.070 142.970 1.00   138.68 ? 188  LEU A CG  1 
ATOM   1173  C  CD1 . LEU A  1  155  ? 215.184 224.477 142.054 1.00   167.41 ? 188  LEU A CD1 1 
ATOM   1174  C  CD2 . LEU A  1  155  ? 216.852 225.319 143.644 1.00   155.44 ? 188  LEU A CD2 1 
ATOM   1175  N  N   . PHE A  1  156  ? 215.054 221.385 141.195 1.00   158.33 ? 189  PHE A N   1 
ATOM   1176  C  CA  . PHE A  1  156  ? 215.239 220.807 139.865 1.00   140.31 ? 189  PHE A CA  1 
ATOM   1177  C  C   . PHE A  1  156  ? 215.300 221.917 138.815 1.00   155.83 ? 189  PHE A C   1 
ATOM   1178  O  O   . PHE A  1  156  ? 214.464 222.813 138.771 1.00   186.53 ? 189  PHE A O   1 
ATOM   1179  C  CB  . PHE A  1  156  ? 214.047 219.909 139.528 1.00   108.74 ? 189  PHE A CB  1 
ATOM   1180  C  CG  . PHE A  1  156  ? 213.865 218.791 140.469 1.00   122.03 ? 189  PHE A CG  1 
ATOM   1181  C  CD1 . PHE A  1  156  ? 214.590 217.629 140.315 1.00   144.77 ? 189  PHE A CD1 1 
ATOM   1182  C  CD2 . PHE A  1  156  ? 212.972 218.880 141.528 1.00   154.46 ? 189  PHE A CD2 1 
ATOM   1183  C  CE1 . PHE A  1  156  ? 214.440 216.562 141.194 1.00   150.91 ? 189  PHE A CE1 1 
ATOM   1184  C  CE2 . PHE A  1  156  ? 212.815 217.819 142.420 1.00   154.75 ? 189  PHE A CE2 1 
ATOM   1185  C  CZ  . PHE A  1  156  ? 213.546 216.652 142.251 1.00   152.77 ? 189  PHE A CZ  1 
ATOM   1186  N  N   . GLU A  1  157  ? 216.274 221.846 137.947 1.00   138.44 ? 190  GLU A N   1 
ATOM   1187  C  CA  . GLU A  1  157  ? 216.305 222.713 136.828 1.00   149.83 ? 190  GLU A CA  1 
ATOM   1188  C  C   . GLU A  1  157  ? 215.852 221.837 135.624 1.00   153.06 ? 190  GLU A C   1 
ATOM   1189  O  O   . GLU A  1  157  ? 216.356 220.725 135.449 1.00   151.16 ? 190  GLU A O   1 
ATOM   1190  C  CB  . GLU A  1  157  ? 217.730 223.226 136.707 1.00   172.60 ? 190  GLU A CB  1 
ATOM   1191  C  CG  . GLU A  1  157  ? 217.831 224.612 136.101 1.00   212.54 ? 190  GLU A CG  1 
ATOM   1192  C  CD  . GLU A  1  157  ? 219.115 224.834 135.317 1.00   245.09 ? 190  GLU A CD  1 
ATOM   1193  O  OE1 . GLU A  1  157  ? 219.063 225.614 134.336 1.00   245.57 ? 190  GLU A OE1 1 
ATOM   1194  O  OE2 . GLU A  1  157  ? 220.161 224.230 135.667 1.00   265.14 ? 190  GLU A OE2 1 
ATOM   1195  N  N   . ARG A  1  158  ? 214.919 222.331 134.802 1.00   141.56 ? 191  ARG A N   1 
ATOM   1196  C  CA  . ARG A  1  158  ? 214.318 221.525 133.726 1.00   146.34 ? 191  ARG A CA  1 
ATOM   1197  C  C   . ARG A  1  158  ? 215.129 221.553 132.418 1.00   172.52 ? 191  ARG A C   1 
ATOM   1198  O  O   . ARG A  1  158  ? 216.010 222.416 132.244 1.00   148.82 ? 191  ARG A O   1 
ATOM   1199  C  CB  . ARG A  1  158  ? 212.880 222.008 133.442 1.00   172.66 ? 191  ARG A CB  1 
ATOM   1200  C  CG  . ARG A  1  158  ? 211.858 220.932 133.057 1.00   162.25 ? 191  ARG A CG  1 
ATOM   1201  C  CD  . ARG A  1  158  ? 210.573 221.526 132.473 1.00   151.82 ? 191  ARG A CD  1 
ATOM   1202  N  NE  . ARG A  1  158  ? 210.803 222.078 131.140 1.00   181.98 ? 191  ARG A NE  1 
ATOM   1203  C  CZ  . ARG A  1  158  ? 209.994 222.916 130.490 1.00   218.55 ? 191  ARG A CZ  1 
ATOM   1204  N  NH1 . ARG A  1  158  ? 208.842 223.315 131.028 1.00   223.56 ? 191  ARG A NH1 1 
ATOM   1205  N  NH2 . ARG A  1  158  ? 210.340 223.355 129.274 1.00   228.02 ? 191  ARG A NH2 1 
ATOM   1206  N  N   . SER A  1  159  ? 214.789 220.585 131.535 1.00   197.00 ? 192  SER A N   1 
ATOM   1207  C  CA  . SER A  1  159  ? 215.224 220.421 130.096 1.00   211.17 ? 192  SER A CA  1 
ATOM   1208  C  C   . SER A  1  159  ? 216.596 219.774 130.024 1.00   194.15 ? 192  SER A C   1 
ATOM   1209  O  O   . SER A  1  159  ? 216.706 218.639 129.587 1.00   185.43 ? 192  SER A O   1 
ATOM   1210  C  CB  . SER A  1  159  ? 215.154 221.711 129.200 1.00   214.92 ? 192  SER A CB  1 
ATOM   1211  O  OG  . SER A  1  159  ? 215.096 221.442 127.765 1.00   142.23 ? 192  SER A OG  1 
ATOM   1212  N  N   . PRO A  1  160  ? 203.846 230.146 127.646 1.00   196.08 ? 206  PRO A N   1 
ATOM   1213  C  CA  . PRO A  1  160  ? 205.090 229.981 128.424 1.00   225.03 ? 206  PRO A CA  1 
ATOM   1214  C  C   . PRO A  1  160  ? 204.997 228.816 129.423 1.00   236.16 ? 206  PRO A C   1 
ATOM   1215  O  O   . PRO A  1  160  ? 203.882 228.414 129.747 1.00   258.37 ? 206  PRO A O   1 
ATOM   1216  C  CB  . PRO A  1  160  ? 205.224 231.331 129.162 1.00   189.38 ? 206  PRO A CB  1 
ATOM   1217  N  N   . LEU A  1  161  ? 206.134 228.282 129.893 1.00   223.47 ? 207  LEU A N   1 
ATOM   1218  C  CA  . LEU A  1  161  ? 206.168 227.258 130.978 1.00   217.10 ? 207  LEU A CA  1 
ATOM   1219  C  C   . LEU A  1  161  ? 207.436 227.411 131.855 1.00   227.43 ? 207  LEU A C   1 
ATOM   1220  O  O   . LEU A  1  161  ? 208.426 227.939 131.361 1.00   300.84 ? 207  LEU A O   1 
ATOM   1221  C  CB  . LEU A  1  161  ? 206.091 225.865 130.356 1.00   197.98 ? 207  LEU A CB  1 
ATOM   1222  C  CG  . LEU A  1  161  ? 205.671 224.646 131.181 1.00   206.05 ? 207  LEU A CG  1 
ATOM   1223  C  CD1 . LEU A  1  161  ? 204.378 224.831 131.980 1.00   195.91 ? 207  LEU A CD1 1 
ATOM   1224  C  CD2 . LEU A  1  161  ? 205.542 223.443 130.243 1.00   237.66 ? 207  LEU A CD2 1 
ATOM   1225  N  N   . PRO A  1  162  ? 207.420 226.969 133.145 1.00   193.20 ? 208  PRO A N   1 
ATOM   1226  C  CA  . PRO A  1  162  ? 208.522 227.357 134.056 1.00   187.04 ? 208  PRO A CA  1 
ATOM   1227  C  C   . PRO A  1  162  ? 209.564 226.274 134.276 1.00   174.58 ? 208  PRO A C   1 
ATOM   1228  O  O   . PRO A  1  162  ? 209.194 225.114 134.345 1.00   200.79 ? 208  PRO A O   1 
ATOM   1229  C  CB  . PRO A  1  162  ? 207.784 227.611 135.359 1.00   186.74 ? 208  PRO A CB  1 
ATOM   1230  C  CG  . PRO A  1  162  ? 206.649 226.626 135.327 1.00   183.81 ? 208  PRO A CG  1 
ATOM   1231  C  CD  . PRO A  1  162  ? 206.386 226.236 133.897 1.00   168.74 ? 208  PRO A CD  1 
ATOM   1232  N  N   . THR A  1  163  ? 210.838 226.641 134.422 1.00   160.43 ? 209  THR A N   1 
ATOM   1233  C  CA  . THR A  1  163  ? 211.917 225.633 134.460 1.00   170.08 ? 209  THR A CA  1 
ATOM   1234  C  C   . THR A  1  163  ? 212.373 225.240 135.852 1.00   155.63 ? 209  THR A C   1 
ATOM   1235  O  O   . THR A  1  163  ? 212.623 224.071 136.111 1.00   190.20 ? 209  THR A O   1 
ATOM   1236  C  CB  . THR A  1  163  ? 213.171 226.083 133.722 1.00   186.92 ? 209  THR A CB  1 
ATOM   1237  O  OG1 . THR A  1  163  ? 213.606 227.321 134.294 1.00   193.35 ? 209  THR A OG1 1 
ATOM   1238  C  CG2 . THR A  1  163  ? 212.888 226.214 132.214 1.00   201.03 ? 209  THR A CG2 1 
ATOM   1239  N  N   . MET A  1  164  ? 212.538 226.189 136.750 1.00   136.66 ? 210  MET A N   1 
ATOM   1240  C  CA  . MET A  1  164  ? 212.879 225.804 138.130 1.00   135.65 ? 210  MET A CA  1 
ATOM   1241  C  C   . MET A  1  164  ? 211.702 225.077 138.809 1.00   131.55 ? 210  MET A C   1 
ATOM   1242  O  O   . MET A  1  164  ? 210.548 225.438 138.670 1.00   165.58 ? 210  MET A O   1 
ATOM   1243  C  CB  . MET A  1  164  ? 213.301 227.006 138.997 1.00   137.51 ? 210  MET A CB  1 
ATOM   1244  C  CG  . MET A  1  164  ? 214.792 227.329 139.036 1.00   156.48 ? 210  MET A CG  1 
ATOM   1245  S  SD  . MET A  1  164  ? 215.563 227.799 137.471 1.00   201.41 ? 210  MET A SD  1 
ATOM   1246  C  CE  . MET A  1  164  ? 217.049 228.665 138.010 1.00   174.16 ? 210  MET A CE  1 
ATOM   1247  N  N   . PHE A  1  165  ? 212.007 224.036 139.536 1.00   123.88 ? 211  PHE A N   1 
ATOM   1248  C  CA  . PHE A  1  165  ? 211.034 223.399 140.368 1.00   120.22 ? 211  PHE A CA  1 
ATOM   1249  C  C   . PHE A  1  165  ? 211.635 223.035 141.695 1.00   120.41 ? 211  PHE A C   1 
ATOM   1250  O  O   . PHE A  1  165  ? 212.764 222.605 141.751 1.00   163.35 ? 211  PHE A O   1 
ATOM   1251  C  CB  . PHE A  1  165  ? 210.643 222.126 139.698 1.00   135.29 ? 211  PHE A CB  1 
ATOM   1252  C  CG  . PHE A  1  165  ? 209.658 222.306 138.605 1.00   147.89 ? 211  PHE A CG  1 
ATOM   1253  C  CD1 . PHE A  1  165  ? 208.286 222.282 138.885 1.00   146.51 ? 211  PHE A CD1 1 
ATOM   1254  C  CD2 . PHE A  1  165  ? 210.086 222.442 137.306 1.00   143.44 ? 211  PHE A CD2 1 
ATOM   1255  C  CE1 . PHE A  1  165  ? 207.362 222.397 137.895 1.00   145.21 ? 211  PHE A CE1 1 
ATOM   1256  C  CE2 . PHE A  1  165  ? 209.166 222.566 136.293 1.00   161.93 ? 211  PHE A CE2 1 
ATOM   1257  C  CZ  . PHE A  1  165  ? 207.804 222.553 136.588 1.00   174.11 ? 211  PHE A CZ  1 
ATOM   1258  N  N   . SER A  1  166  ? 210.869 223.146 142.758 1.00   129.35 ? 212  SER A N   1 
ATOM   1259  C  CA  . SER A  1  166  ? 211.312 222.687 144.069 1.00   138.78 ? 212  SER A CA  1 
ATOM   1260  C  C   . SER A  1  166  ? 210.610 221.386 144.474 1.00   139.67 ? 212  SER A C   1 
ATOM   1261  O  O   . SER A  1  166  ? 209.565 221.023 143.950 1.00   154.00 ? 212  SER A O   1 
ATOM   1262  C  CB  . SER A  1  166  ? 211.039 223.763 145.116 1.00   154.04 ? 212  SER A CB  1 
ATOM   1263  O  OG  . SER A  1  166  ? 209.963 223.392 145.988 1.00   140.95 ? 212  SER A OG  1 
ATOM   1264  N  N   . MET A  1  167  ? 211.179 220.707 145.448 1.00   141.84 ? 213  MET A N   1 
ATOM   1265  C  CA  . MET A  1  167  ? 210.525 219.574 146.061 1.00   142.56 ? 213  MET A CA  1 
ATOM   1266  C  C   . MET A  1  167  ? 210.936 219.604 147.498 1.00   137.32 ? 213  MET A C   1 
ATOM   1267  O  O   . MET A  1  167  ? 212.115 219.470 147.777 1.00   159.50 ? 213  MET A O   1 
ATOM   1268  C  CB  . MET A  1  167  ? 211.031 218.328 145.388 1.00   139.12 ? 213  MET A CB  1 
ATOM   1269  C  CG  . MET A  1  167  ? 210.717 217.044 146.100 1.00   152.50 ? 213  MET A CG  1 
ATOM   1270  S  SD  . MET A  1  167  ? 211.833 215.758 145.520 1.00   195.37 ? 213  MET A SD  1 
ATOM   1271  C  CE  . MET A  1  167  ? 210.710 214.382 145.601 1.00   197.50 ? 213  MET A CE  1 
ATOM   1272  N  N   . LEU A  1  168  ? 210.005 219.773 148.426 1.00   137.70 ? 214  LEU A N   1 
ATOM   1273  C  CA  . LEU A  1  168  ? 210.432 219.948 149.831 1.00   146.67 ? 214  LEU A CA  1 
ATOM   1274  C  C   . LEU A  1  168  ? 210.398 218.645 150.610 1.00   161.66 ? 214  LEU A C   1 
ATOM   1275  O  O   . LEU A  1  168  ? 210.708 218.643 151.809 1.00   183.74 ? 214  LEU A O   1 
ATOM   1276  C  CB  . LEU A  1  168  ? 209.612 220.967 150.594 1.00   138.08 ? 214  LEU A CB  1 
ATOM   1277  C  CG  . LEU A  1  168  ? 208.983 222.036 149.759 1.00   152.51 ? 214  LEU A CG  1 
ATOM   1278  C  CD1 . LEU A  1  168  ? 208.186 222.946 150.689 1.00   178.66 ? 214  LEU A CD1 1 
ATOM   1279  C  CD2 . LEU A  1  168  ? 210.094 222.749 149.010 1.00   156.71 ? 214  LEU A CD2 1 
ATOM   1280  N  N   . HIS A  1  169  ? 209.995 217.550 149.968 1.00   140.28 ? 215  HIS A N   1 
ATOM   1281  C  CA  . HIS A  1  169  ? 210.107 216.251 150.574 1.00   122.32 ? 215  HIS A CA  1 
ATOM   1282  C  C   . HIS A  1  169  ? 209.840 215.252 149.472 1.00   119.59 ? 215  HIS A C   1 
ATOM   1283  O  O   . HIS A  1  169  ? 209.214 215.614 148.501 1.00   184.04 ? 215  HIS A O   1 
ATOM   1284  C  CB  . HIS A  1  169  ? 209.108 216.148 151.674 1.00   120.25 ? 215  HIS A CB  1 
ATOM   1285  C  CG  . HIS A  1  169  ? 209.035 214.797 152.257 1.00   139.62 ? 215  HIS A CG  1 
ATOM   1286  N  ND1 . HIS A  1  169  ? 209.908 214.357 153.223 1.00   174.45 ? 215  HIS A ND1 1 
ATOM   1287  C  CD2 . HIS A  1  169  ? 208.208 213.770 151.993 1.00   138.34 ? 215  HIS A CD2 1 
ATOM   1288  C  CE1 . HIS A  1  169  ? 209.602 213.114 153.548 1.00   185.57 ? 215  HIS A CE1 1 
ATOM   1289  N  NE2 . HIS A  1  169  ? 208.569 212.736 152.815 1.00   167.32 ? 215  HIS A NE2 1 
ATOM   1290  N  N   . PRO A  1  170  ? 210.358 214.031 149.563 1.00   113.71 ? 216  PRO A N   1 
ATOM   1291  C  CA  . PRO A  1  170  ? 210.136 213.006 148.531 1.00   140.57 ? 216  PRO A CA  1 
ATOM   1292  C  C   . PRO A  1  170  ? 208.668 212.719 148.140 1.00   153.45 ? 216  PRO A C   1 
ATOM   1293  O  O   . PRO A  1  170  ? 208.321 212.595 146.950 1.00   172.19 ? 216  PRO A O   1 
ATOM   1294  C  CB  . PRO A  1  170  ? 210.739 211.743 149.153 1.00   147.51 ? 216  PRO A CB  1 
ATOM   1295  C  CG  . PRO A  1  170  ? 211.189 212.147 150.521 1.00   151.36 ? 216  PRO A CG  1 
ATOM   1296  C  CD  . PRO A  1  170  ? 211.434 213.615 150.449 1.00   120.30 ? 216  PRO A CD  1 
ATOM   1297  N  N   . LEU A  1  171  ? 207.848 212.536 149.157 1.00   128.42 ? 217  LEU A N   1 
ATOM   1298  C  CA  . LEU A  1  171  ? 206.445 212.318 148.966 1.00   128.66 ? 217  LEU A CA  1 
ATOM   1299  C  C   . LEU A  1  171  ? 205.657 213.489 148.372 1.00   144.19 ? 217  LEU A C   1 
ATOM   1300  O  O   . LEU A  1  171  ? 204.789 213.237 147.555 1.00   186.26 ? 217  LEU A O   1 
ATOM   1301  C  CB  . LEU A  1  171  ? 205.828 211.837 150.267 1.00   120.34 ? 217  LEU A CB  1 
ATOM   1302  C  CG  . LEU A  1  171  ? 206.223 210.388 150.510 1.00   122.31 ? 217  LEU A CG  1 
ATOM   1303  C  CD1 . LEU A  1  171  ? 206.100 209.963 151.971 1.00   118.91 ? 217  LEU A CD1 1 
ATOM   1304  C  CD2 . LEU A  1  171  ? 205.386 209.487 149.579 1.00   141.86 ? 217  LEU A CD2 1 
ATOM   1305  N  N   . ASP A  1  172  ? 205.978 214.730 148.759 1.00   147.96 ? 218  ASP A N   1 
ATOM   1306  C  CA  . ASP A  1  172  ? 205.344 215.959 148.242 1.00   171.23 ? 218  ASP A CA  1 
ATOM   1307  C  C   . ASP A  1  172  ? 205.381 216.064 146.713 1.00   168.32 ? 218  ASP A C   1 
ATOM   1308  O  O   . ASP A  1  172  ? 206.215 215.423 146.040 1.00   174.01 ? 218  ASP A O   1 
ATOM   1309  C  CB  . ASP A  1  172  ? 206.034 217.239 148.806 1.00   227.19 ? 218  ASP A CB  1 
ATOM   1310  C  CG  . ASP A  1  172  ? 205.647 217.566 150.265 1.00   271.91 ? 218  ASP A CG  1 
ATOM   1311  O  OD1 . ASP A  1  172  ? 204.642 217.017 150.777 1.00   324.82 ? 218  ASP A OD1 1 
ATOM   1312  O  OD2 . ASP A  1  172  ? 206.347 218.404 150.896 1.00   239.35 ? 218  ASP A OD2 1 
ATOM   1313  N  N   . GLU A  1  173  ? 204.435 216.844 146.191 1.00   172.22 ? 219  GLU A N   1 
ATOM   1314  C  CA  . GLU A  1  173  ? 204.366 217.124 144.765 1.00   172.27 ? 219  GLU A CA  1 
ATOM   1315  C  C   . GLU A  1  173  ? 205.554 218.017 144.438 1.00   168.83 ? 219  GLU A C   1 
ATOM   1316  O  O   . GLU A  1  173  ? 206.024 218.814 145.293 1.00   152.88 ? 219  GLU A O   1 
ATOM   1317  C  CB  . GLU A  1  173  ? 203.029 217.772 144.374 1.00   144.55 ? 219  GLU A CB  1 
ATOM   1318  N  N   . ILE A  1  174  ? 206.071 217.853 143.220 1.00   146.46 ? 220  ILE A N   1 
ATOM   1319  C  CA  . ILE A  1  174  ? 207.067 218.785 142.698 1.00   139.21 ? 220  ILE A CA  1 
ATOM   1320  C  C   . ILE A  1  174  ? 206.335 220.039 142.231 1.00   145.95 ? 220  ILE A C   1 
ATOM   1321  O  O   . ILE A  1  174  ? 205.358 219.963 141.478 1.00   173.12 ? 220  ILE A O   1 
ATOM   1322  C  CB  . ILE A  1  174  ? 207.910 218.189 141.561 1.00   140.85 ? 220  ILE A CB  1 
ATOM   1323  C  CG1 . ILE A  1  174  ? 208.712 216.997 142.087 1.00   169.85 ? 220  ILE A CG1 1 
ATOM   1324  C  CG2 . ILE A  1  174  ? 208.865 219.235 141.005 1.00   131.87 ? 220  ILE A CG2 1 
ATOM   1325  C  CD1 . ILE A  1  174  ? 209.626 216.340 141.061 1.00   188.11 ? 220  ILE A CD1 1 
ATOM   1326  N  N   . THR A  1  175  ? 206.837 221.190 142.666 1.00   139.89 ? 221  THR A N   1 
ATOM   1327  C  CA  . THR A  1  175  ? 206.166 222.468 142.498 1.00   148.71 ? 221  THR A CA  1 
ATOM   1328  C  C   . THR A  1  175  ? 207.109 223.462 141.853 1.00   158.04 ? 221  THR A C   1 
ATOM   1329  O  O   . THR A  1  175  ? 208.326 223.392 142.048 1.00   208.08 ? 221  THR A O   1 
ATOM   1330  C  CB  . THR A  1  175  ? 205.775 223.049 143.864 1.00   168.90 ? 221  THR A CB  1 
ATOM   1331  O  OG1 . THR A  1  175  ? 206.956 223.434 144.585 1.00   175.77 ? 221  THR A OG1 1 
ATOM   1332  C  CG2 . THR A  1  175  ? 204.982 222.024 144.692 1.00   188.39 ? 221  THR A CG2 1 
ATOM   1333  N  N   . PRO A  1  176  ? 206.569 224.434 141.123 1.00   146.82 ? 222  PRO A N   1 
ATOM   1334  C  CA  . PRO A  1  176  ? 207.491 225.322 140.448 1.00   139.66 ? 222  PRO A CA  1 
ATOM   1335  C  C   . PRO A  1  176  ? 208.110 226.348 141.407 1.00   143.28 ? 222  PRO A C   1 
ATOM   1336  O  O   . PRO A  1  176  ? 207.818 226.421 142.608 1.00   149.22 ? 222  PRO A O   1 
ATOM   1337  C  CB  . PRO A  1  176  ? 206.608 225.997 139.409 1.00   136.22 ? 222  PRO A CB  1 
ATOM   1338  C  CG  . PRO A  1  176  ? 205.228 225.927 139.992 1.00   144.80 ? 222  PRO A CG  1 
ATOM   1339  C  CD  . PRO A  1  176  ? 205.220 225.008 141.173 1.00   130.03 ? 222  PRO A CD  1 
ATOM   1340  N  N   . LEU A  1  177  ? 208.967 227.160 140.842 1.00   146.86 ? 223  LEU A N   1 
ATOM   1341  C  CA  . LEU A  1  177  ? 209.658 228.201 141.581 1.00   163.71 ? 223  LEU A CA  1 
ATOM   1342  C  C   . LEU A  1  177  ? 209.300 229.618 141.118 1.00   182.39 ? 223  LEU A C   1 
ATOM   1343  O  O   . LEU A  1  177  ? 209.090 229.863 139.927 1.00   231.71 ? 223  LEU A O   1 
ATOM   1344  C  CB  . LEU A  1  177  ? 211.133 227.982 141.355 1.00   151.49 ? 223  LEU A CB  1 
ATOM   1345  C  CG  . LEU A  1  177  ? 211.955 228.271 142.572 1.00   166.62 ? 223  LEU A CG  1 
ATOM   1346  C  CD1 . LEU A  1  177  ? 211.666 227.213 143.647 1.00   171.20 ? 223  LEU A CD1 1 
ATOM   1347  C  CD2 . LEU A  1  177  ? 213.424 228.288 142.164 1.00   174.48 ? 223  LEU A CD2 1 
ATOM   1348  N  N   . VAL A  1  178  ? 209.274 230.569 142.041 1.00   160.07 ? 224  VAL A N   1 
ATOM   1349  C  CA  . VAL A  1  178  ? 208.737 231.901 141.741 1.00   148.61 ? 224  VAL A CA  1 
ATOM   1350  C  C   . VAL A  1  178  ? 209.574 232.954 142.401 1.00   155.79 ? 224  VAL A C   1 
ATOM   1351  O  O   . VAL A  1  178  ? 209.949 232.780 143.544 1.00   204.66 ? 224  VAL A O   1 
ATOM   1352  C  CB  . VAL A  1  178  ? 207.282 231.981 142.214 1.00   160.94 ? 224  VAL A CB  1 
ATOM   1353  C  CG1 . VAL A  1  178  ? 206.427 230.965 141.448 1.00   183.92 ? 224  VAL A CG1 1 
ATOM   1354  C  CG2 . VAL A  1  178  ? 207.159 231.743 143.720 1.00   150.32 ? 224  VAL A CG2 1 
ATOM   1355  N  N   . CYS A  1  179  ? 209.880 234.029 141.691 1.00   176.18 ? 225  CYS A N   1 
ATOM   1356  C  CA  . CYS A  1  179  ? 210.839 235.019 142.187 1.00   211.04 ? 225  CYS A CA  1 
ATOM   1357  C  C   . CYS A  1  179  ? 210.214 236.392 142.473 1.00   223.28 ? 225  CYS A C   1 
ATOM   1358  O  O   . CYS A  1  179  ? 209.075 236.668 142.094 1.00   200.56 ? 225  CYS A O   1 
ATOM   1359  C  CB  . CYS A  1  179  ? 212.030 235.128 141.226 1.00   202.40 ? 225  CYS A CB  1 
ATOM   1360  S  SG  . CYS A  1  179  ? 211.590 235.281 139.492 1.00   216.12 ? 225  CYS A SG  1 
ATOM   1361  N  N   . LYS A  1  180  ? 210.989 237.209 143.195 1.00   229.51 ? 226  LYS A N   1 
ATOM   1362  C  CA  . LYS A  1  180  ? 210.721 238.618 143.496 1.00   206.06 ? 226  LYS A CA  1 
ATOM   1363  C  C   . LYS A  1  180  ? 209.434 238.910 144.299 1.00   195.59 ? 226  LYS A C   1 
ATOM   1364  O  O   . LYS A  1  180  ? 209.470 239.578 145.355 1.00   151.50 ? 226  LYS A O   1 
ATOM   1365  C  CB  . LYS A  1  180  ? 210.808 239.485 142.223 1.00   202.46 ? 226  LYS A CB  1 
ATOM   1366  C  CG  . LYS A  1  180  ? 212.157 239.425 141.491 1.00   179.76 ? 226  LYS A CG  1 
ATOM   1367  C  CD  . LYS A  1  180  ? 212.762 240.805 141.195 1.00   187.90 ? 226  LYS A CD  1 
ATOM   1368  C  CE  . LYS A  1  180  ? 212.188 241.502 139.962 1.00   186.34 ? 226  LYS A CE  1 
ATOM   1369  N  NZ  . LYS A  1  180  ? 212.443 242.980 139.991 1.00   172.20 ? 226  LYS A NZ  1 
ATOM   1370  N  N   . ALA A  1  181  ? 205.188 239.919 141.256 1.00   153.83 ? 236  ALA A N   1 
ATOM   1371  C  CA  . ALA A  1  181  ? 205.685 238.577 141.729 1.00   212.91 ? 236  ALA A CA  1 
ATOM   1372  C  C   . ALA A  1  181  ? 205.579 237.323 140.765 1.00   208.28 ? 236  ALA A C   1 
ATOM   1373  O  O   . ALA A  1  181  ? 204.774 236.400 140.993 1.00   172.55 ? 236  ALA A O   1 
ATOM   1374  C  CB  . ALA A  1  181  ? 205.042 238.249 143.076 1.00   200.78 ? 236  ALA A CB  1 
ATOM   1375  N  N   . GLN A  1  182  ? 206.461 237.267 139.760 1.00   195.28 ? 237  GLN A N   1 
ATOM   1376  C  CA  . GLN A  1  182  ? 206.356 236.324 138.621 1.00   182.66 ? 237  GLN A CA  1 
ATOM   1377  C  C   . GLN A  1  182  ? 207.064 234.965 138.833 1.00   187.45 ? 237  GLN A C   1 
ATOM   1378  O  O   . GLN A  1  182  ? 207.952 234.851 139.671 1.00   220.59 ? 237  GLN A O   1 
ATOM   1379  C  CB  . GLN A  1  182  ? 206.872 237.035 137.345 1.00   188.36 ? 237  GLN A CB  1 
ATOM   1380  C  CG  . GLN A  1  182  ? 207.220 236.160 136.127 1.00   211.09 ? 237  GLN A CG  1 
ATOM   1381  C  CD  . GLN A  1  182  ? 206.643 236.634 134.800 1.00   240.03 ? 237  GLN A CD  1 
ATOM   1382  O  OE1 . GLN A  1  182  ? 205.486 237.073 134.723 1.00   264.36 ? 237  GLN A OE1 1 
ATOM   1383  N  NE2 . GLN A  1  182  ? 207.432 236.489 133.730 1.00   226.37 ? 237  GLN A NE2 1 
ATOM   1384  N  N   . TYR A  1  183  ? 206.626 233.944 138.083 1.00   183.84 ? 238  TYR A N   1 
ATOM   1385  C  CA  . TYR A  1  183  ? 207.327 232.634 137.911 1.00   172.95 ? 238  TYR A CA  1 
ATOM   1386  C  C   . TYR A  1  183  ? 208.703 232.710 137.250 1.00   192.51 ? 238  TYR A C   1 
ATOM   1387  O  O   . TYR A  1  183  ? 209.027 233.698 136.592 1.00   244.34 ? 238  TYR A O   1 
ATOM   1388  C  CB  . TYR A  1  183  ? 206.519 231.713 136.994 1.00   164.07 ? 238  TYR A CB  1 
ATOM   1389  C  CG  . TYR A  1  183  ? 205.416 230.956 137.637 1.00   153.17 ? 238  TYR A CG  1 
ATOM   1390  C  CD1 . TYR A  1  183  ? 204.597 231.543 138.606 1.00   175.66 ? 238  TYR A CD1 1 
ATOM   1391  C  CD2 . TYR A  1  183  ? 205.155 229.657 137.250 1.00   133.83 ? 238  TYR A CD2 1 
ATOM   1392  C  CE1 . TYR A  1  183  ? 203.557 230.839 139.187 1.00   202.32 ? 238  TYR A CE1 1 
ATOM   1393  C  CE2 . TYR A  1  183  ? 204.118 228.943 137.813 1.00   166.19 ? 238  TYR A CE2 1 
ATOM   1394  C  CZ  . TYR A  1  183  ? 203.309 229.525 138.789 1.00   192.10 ? 238  TYR A CZ  1 
ATOM   1395  O  OH  . TYR A  1  183  ? 202.248 228.811 139.352 1.00   179.41 ? 238  TYR A OH  1 
ATOM   1396  N  N   . VAL A  1  184  ? 209.478 231.626 137.351 1.00   171.73 ? 239  VAL A N   1 
ATOM   1397  C  CA  . VAL A  1  184  ? 210.797 231.562 136.709 1.00   182.13 ? 239  VAL A CA  1 
ATOM   1398  C  C   . VAL A  1  184  ? 210.643 230.873 135.379 1.00   184.01 ? 239  VAL A C   1 
ATOM   1399  O  O   . VAL A  1  184  ? 210.540 229.643 135.314 1.00   180.63 ? 239  VAL A O   1 
ATOM   1400  C  CB  . VAL A  1  184  ? 211.839 230.811 137.557 1.00   201.23 ? 239  VAL A CB  1 
ATOM   1401  C  CG1 . VAL A  1  184  ? 213.191 230.785 136.831 1.00   207.62 ? 239  VAL A CG1 1 
ATOM   1402  C  CG2 . VAL A  1  184  ? 211.977 231.457 138.933 1.00   219.42 ? 239  VAL A CG2 1 
ATOM   1403  N  N   . VAL A  1  185  ? 210.651 231.674 134.318 1.00   183.00 ? 240  VAL A N   1 
ATOM   1404  C  CA  . VAL A  1  185  ? 210.198 231.199 133.023 1.00   197.27 ? 240  VAL A CA  1 
ATOM   1405  C  C   . VAL A  1  185  ? 211.290 230.986 132.015 1.00   199.16 ? 240  VAL A C   1 
ATOM   1406  O  O   . VAL A  1  185  ? 211.034 230.341 131.012 1.00   222.36 ? 240  VAL A O   1 
ATOM   1407  C  CB  . VAL A  1  185  ? 209.135 232.128 132.390 1.00   225.57 ? 240  VAL A CB  1 
ATOM   1408  C  CG1 . VAL A  1  185  ? 207.943 232.276 133.327 1.00   261.57 ? 240  VAL A CG1 1 
ATOM   1409  C  CG2 . VAL A  1  185  ? 209.715 233.488 132.000 1.00   232.40 ? 240  VAL A CG2 1 
ATOM   1410  N  N   . ASP A  1  186  ? 212.487 231.524 132.250 1.00   216.13 ? 241  ASP A N   1 
ATOM   1411  C  CA  . ASP A  1  186  ? 213.452 231.686 131.153 1.00   224.61 ? 241  ASP A CA  1 
ATOM   1412  C  C   . ASP A  1  186  ? 214.493 230.579 131.157 1.00   210.69 ? 241  ASP A C   1 
ATOM   1413  O  O   . ASP A  1  186  ? 215.109 230.312 132.184 1.00   256.37 ? 241  ASP A O   1 
ATOM   1414  C  CB  . ASP A  1  186  ? 214.130 233.066 131.200 1.00   210.43 ? 241  ASP A CB  1 
ATOM   1415  N  N   . HIS A  1  187  ? 214.718 229.966 129.994 1.00   208.92 ? 242  HIS A N   1 
ATOM   1416  C  CA  . HIS A  1  187  ? 215.708 228.868 129.863 1.00   228.71 ? 242  HIS A CA  1 
ATOM   1417  C  C   . HIS A  1  187  ? 217.119 229.451 129.837 1.00   224.00 ? 242  HIS A C   1 
ATOM   1418  O  O   . HIS A  1  187  ? 218.115 228.720 129.940 1.00   196.29 ? 242  HIS A O   1 
ATOM   1419  C  CB  . HIS A  1  187  ? 215.499 227.987 128.611 1.00   226.98 ? 242  HIS A CB  1 
ATOM   1420  C  CG  . HIS A  1  187  ? 214.113 228.028 128.056 1.00   247.41 ? 242  HIS A CG  1 
ATOM   1421  N  ND1 . HIS A  1  187  ? 213.829 228.538 126.807 1.00   261.43 ? 242  HIS A ND1 1 
ATOM   1422  C  CD2 . HIS A  1  187  ? 212.926 227.665 128.594 1.00   255.79 ? 242  HIS A CD2 1 
ATOM   1423  C  CE1 . HIS A  1  187  ? 212.528 228.469 126.589 1.00   255.58 ? 242  HIS A CE1 1 
ATOM   1424  N  NE2 . HIS A  1  187  ? 211.956 227.944 127.658 1.00   265.30 ? 242  HIS A NE2 1 
ATOM   1425  N  N   . ALA A  1  188  ? 217.188 230.771 129.661 1.00   222.05 ? 243  ALA A N   1 
ATOM   1426  C  CA  . ALA A  1  188  ? 218.414 231.542 129.847 1.00   242.39 ? 243  ALA A CA  1 
ATOM   1427  C  C   . ALA A  1  188  ? 219.049 231.405 131.235 1.00   227.88 ? 243  ALA A C   1 
ATOM   1428  O  O   . ALA A  1  188  ? 220.264 231.220 131.310 1.00   218.64 ? 243  ALA A O   1 
ATOM   1429  C  CB  . ALA A  1  188  ? 218.151 233.014 129.547 1.00   260.76 ? 243  ALA A CB  1 
ATOM   1430  N  N   . MET A  1  189  ? 218.251 231.503 132.310 1.00   228.65 ? 244  MET A N   1 
ATOM   1431  C  CA  . MET A  1  189  ? 218.795 231.464 133.701 1.00   210.08 ? 244  MET A CA  1 
ATOM   1432  C  C   . MET A  1  189  ? 219.194 230.033 134.014 1.00   179.35 ? 244  MET A C   1 
ATOM   1433  O  O   . MET A  1  189  ? 218.382 229.122 133.927 1.00   177.52 ? 244  MET A O   1 
ATOM   1434  C  CB  . MET A  1  189  ? 217.823 231.962 134.803 1.00   213.64 ? 244  MET A CB  1 
ATOM   1435  C  CG  . MET A  1  189  ? 216.958 233.154 134.440 1.00   257.26 ? 244  MET A CG  1 
ATOM   1436  S  SD  . MET A  1  189  ? 217.732 234.301 133.275 1.00   335.48 ? 244  MET A SD  1 
ATOM   1437  C  CE  . MET A  1  189  ? 216.301 235.121 132.555 1.00   325.37 ? 244  MET A CE  1 
ATOM   1438  N  N   . LYS A  1  190  ? 220.463 229.841 134.344 1.00   173.70 ? 245  LYS A N   1 
ATOM   1439  C  CA  . LYS A  1  190  ? 221.007 228.535 134.706 1.00   174.07 ? 245  LYS A CA  1 
ATOM   1440  C  C   . LYS A  1  190  ? 221.588 228.649 136.094 1.00   174.11 ? 245  LYS A C   1 
ATOM   1441  O  O   . LYS A  1  190  ? 222.376 229.547 136.367 1.00   213.02 ? 245  LYS A O   1 
ATOM   1442  C  CB  . LYS A  1  190  ? 222.104 228.122 133.746 1.00   182.94 ? 245  LYS A CB  1 
ATOM   1443  C  CG  . LYS A  1  190  ? 221.600 227.891 132.330 1.00   197.00 ? 245  LYS A CG  1 
ATOM   1444  C  CD  . LYS A  1  190  ? 221.231 226.445 132.062 1.00   197.98 ? 245  LYS A CD  1 
ATOM   1445  C  CE  . LYS A  1  190  ? 222.413 225.671 131.486 1.00   226.32 ? 245  LYS A CE  1 
ATOM   1446  N  NZ  . LYS A  1  190  ? 222.850 226.166 130.142 1.00   237.60 ? 245  LYS A NZ  1 
ATOM   1447  N  N   . ILE A  1  191  ? 221.187 227.738 136.960 1.00   159.11 ? 246  ILE A N   1 
ATOM   1448  C  CA  . ILE A  1  191  ? 221.496 227.829 138.369 1.00   148.39 ? 246  ILE A CA  1 
ATOM   1449  C  C   . ILE A  1  191  ? 222.898 227.280 138.597 1.00   157.59 ? 246  ILE A C   1 
ATOM   1450  O  O   . ILE A  1  191  ? 223.124 226.072 138.681 1.00   170.69 ? 246  ILE A O   1 
ATOM   1451  C  CB  . ILE A  1  191  ? 220.381 227.180 139.202 1.00   151.87 ? 246  ILE A CB  1 
ATOM   1452  C  CG1 . ILE A  1  191  ? 220.473 227.612 140.655 1.00   174.23 ? 246  ILE A CG1 1 
ATOM   1453  C  CG2 . ILE A  1  191  ? 220.352 225.657 139.076 1.00   183.77 ? 246  ILE A CG2 1 
ATOM   1454  C  CD1 . ILE A  1  191  ? 219.118 227.584 141.348 1.00   202.98 ? 246  ILE A CD1 1 
ATOM   1455  N  N   . VAL A  1  192  ? 223.846 228.208 138.634 1.00   148.64 ? 247  VAL A N   1 
ATOM   1456  C  CA  . VAL A  1  192  ? 225.252 227.868 138.701 1.00   143.67 ? 247  VAL A CA  1 
ATOM   1457  C  C   . VAL A  1  192  ? 225.793 227.630 140.102 1.00   128.64 ? 247  VAL A C   1 
ATOM   1458  O  O   . VAL A  1  192  ? 226.924 227.207 140.235 1.00   140.37 ? 247  VAL A O   1 
ATOM   1459  C  CB  . VAL A  1  192  ? 226.116 228.927 137.996 1.00   151.13 ? 247  VAL A CB  1 
ATOM   1460  C  CG1 . VAL A  1  192  ? 226.225 230.207 138.811 1.00   142.92 ? 247  VAL A CG1 1 
ATOM   1461  C  CG2 . VAL A  1  192  ? 227.501 228.357 137.651 1.00   165.38 ? 247  VAL A CG2 1 
ATOM   1462  N  N   . PHE A  1  193  ? 225.010 227.889 141.138 1.00   147.51 ? 248  PHE A N   1 
ATOM   1463  C  CA  . PHE A  1  193  ? 225.456 227.601 142.519 1.00   159.15 ? 248  PHE A CA  1 
ATOM   1464  C  C   . PHE A  1  193  ? 224.361 227.791 143.571 1.00   151.82 ? 248  PHE A C   1 
ATOM   1465  O  O   . PHE A  1  193  ? 223.418 228.559 143.402 1.00   167.25 ? 248  PHE A O   1 
ATOM   1466  C  CB  . PHE A  1  193  ? 226.683 228.470 142.850 1.00   144.20 ? 248  PHE A CB  1 
ATOM   1467  C  CG  . PHE A  1  193  ? 226.877 228.748 144.307 1.00   135.16 ? 248  PHE A CG  1 
ATOM   1468  C  CD1 . PHE A  1  193  ? 226.095 229.686 144.973 1.00   145.40 ? 248  PHE A CD1 1 
ATOM   1469  C  CD2 . PHE A  1  193  ? 227.859 228.088 145.002 1.00   135.86 ? 248  PHE A CD2 1 
ATOM   1470  C  CE1 . PHE A  1  193  ? 226.294 229.933 146.314 1.00   159.75 ? 248  PHE A CE1 1 
ATOM   1471  C  CE2 . PHE A  1  193  ? 228.068 228.336 146.339 1.00   146.43 ? 248  PHE A CE2 1 
ATOM   1472  C  CZ  . PHE A  1  193  ? 227.286 229.258 146.998 1.00   152.88 ? 248  PHE A CZ  1 
ATOM   1473  N  N   . LEU A  1  194  ? 224.519 227.146 144.704 1.00   127.41 ? 249  LEU A N   1 
ATOM   1474  C  CA  . LEU A  1  194  ? 223.485 227.230 145.700 1.00   143.20 ? 249  LEU A CA  1 
ATOM   1475  C  C   . LEU A  1  194  ? 224.067 226.989 147.095 1.00   152.29 ? 249  LEU A C   1 
ATOM   1476  O  O   . LEU A  1  194  ? 224.999 226.214 147.221 1.00   186.01 ? 249  LEU A O   1 
ATOM   1477  C  CB  . LEU A  1  194  ? 222.482 226.168 145.294 1.00   144.32 ? 249  LEU A CB  1 
ATOM   1478  C  CG  . LEU A  1  194  ? 221.104 226.011 145.906 1.00   148.37 ? 249  LEU A CG  1 
ATOM   1479  C  CD1 . LEU A  1  194  ? 220.817 226.935 147.077 1.00   157.95 ? 249  LEU A CD1 1 
ATOM   1480  C  CD2 . LEU A  1  194  ? 220.047 226.160 144.810 1.00   150.57 ? 249  LEU A CD2 1 
ATOM   1481  N  N   . ASN A  1  195  ? 223.559 227.651 148.132 1.00   135.10 ? 250  ASN A N   1 
ATOM   1482  C  CA  . ASN A  1  195  ? 224.173 227.571 149.438 1.00   149.76 ? 250  ASN A CA  1 
ATOM   1483  C  C   . ASN A  1  195  ? 223.185 227.498 150.568 1.00   174.11 ? 250  ASN A C   1 
ATOM   1484  O  O   . ASN A  1  195  ? 222.406 228.409 150.747 1.00   209.74 ? 250  ASN A O   1 
ATOM   1485  C  CB  . ASN A  1  195  ? 225.018 228.826 149.639 1.00   157.63 ? 250  ASN A CB  1 
ATOM   1486  C  CG  . ASN A  1  195  ? 226.235 228.596 150.510 1.00   174.81 ? 250  ASN A CG  1 
ATOM   1487  O  OD1 . ASN A  1  195  ? 227.248 229.264 150.343 1.00   191.20 ? 250  ASN A OD1 1 
ATOM   1488  N  ND2 . ASN A  1  195  ? 226.152 227.669 151.442 1.00   180.69 ? 250  ASN A ND2 1 
ATOM   1489  N  N   . THR A  1  196  ? 223.255 226.453 151.378 1.00   205.45 ? 251  THR A N   1 
ATOM   1490  C  CA  . THR A  1  196  ? 222.358 226.325 152.524 1.00   224.69 ? 251  THR A CA  1 
ATOM   1491  C  C   . THR A  1  196  ? 222.681 227.313 153.669 1.00   227.16 ? 251  THR A C   1 
ATOM   1492  O  O   . THR A  1  196  ? 221.759 227.745 154.358 1.00   235.01 ? 251  THR A O   1 
ATOM   1493  C  CB  . THR A  1  196  ? 222.342 224.877 153.063 1.00   239.98 ? 251  THR A CB  1 
ATOM   1494  O  OG1 . THR A  1  196  ? 223.641 224.530 153.552 1.00   282.37 ? 251  THR A OG1 1 
ATOM   1495  C  CG2 . THR A  1  196  ? 221.947 223.875 151.966 1.00   244.91 ? 251  THR A CG2 1 
ATOM   1496  N  N   . ASP A  1  197  ? 223.966 227.646 153.865 1.00   245.24 ? 252  ASP A N   1 
ATOM   1497  C  CA  . ASP A  1  197  ? 224.448 228.499 154.999 1.00   263.86 ? 252  ASP A CA  1 
ATOM   1498  C  C   . ASP A  1  197  ? 223.923 229.951 155.070 1.00   237.40 ? 252  ASP A C   1 
ATOM   1499  O  O   . ASP A  1  197  ? 223.356 230.316 156.098 1.00   251.50 ? 252  ASP A O   1 
ATOM   1500  C  CB  . ASP A  1  197  ? 225.993 228.476 155.147 1.00   303.23 ? 252  ASP A CB  1 
ATOM   1501  C  CG  . ASP A  1  197  ? 226.546 227.128 155.616 1.00   352.37 ? 252  ASP A CG  1 
ATOM   1502  O  OD1 . ASP A  1  197  ? 225.813 226.337 156.250 1.00   416.06 ? 252  ASP A OD1 1 
ATOM   1503  O  OD2 . ASP A  1  197  ? 227.744 226.866 155.358 1.00   379.47 ? 252  ASP A OD2 1 
ATOM   1504  N  N   . PRO A  1  198  ? 224.183 230.813 154.056 1.00   208.92 ? 253  PRO A N   1 
ATOM   1505  C  CA  . PRO A  1  198  ? 223.210 231.904 153.819 1.00   185.74 ? 253  PRO A CA  1 
ATOM   1506  C  C   . PRO A  1  198  ? 222.443 231.622 152.530 1.00   193.97 ? 253  PRO A C   1 
ATOM   1507  O  O   . PRO A  1  198  ? 223.081 231.394 151.506 1.00   187.71 ? 253  PRO A O   1 
ATOM   1508  C  CB  . PRO A  1  198  ? 224.089 233.147 153.695 1.00   157.59 ? 253  PRO A CB  1 
ATOM   1509  C  CG  . PRO A  1  198  ? 225.499 232.649 153.507 1.00   164.54 ? 253  PRO A CG  1 
ATOM   1510  C  CD  . PRO A  1  198  ? 225.487 231.149 153.458 1.00   186.83 ? 253  PRO A CD  1 
ATOM   1511  N  N   . SER A  1  199  ? 221.105 231.570 152.574 1.00   207.82 ? 254  SER A N   1 
ATOM   1512  C  CA  . SER A  1  199  ? 220.348 231.113 151.394 1.00   199.49 ? 254  SER A CA  1 
ATOM   1513  C  C   . SER A  1  199  ? 220.640 232.098 150.257 1.00   177.28 ? 254  SER A C   1 
ATOM   1514  O  O   . SER A  1  199  ? 220.421 233.296 150.355 1.00   200.44 ? 254  SER A O   1 
ATOM   1515  C  CB  . SER A  1  199  ? 218.845 230.906 151.647 1.00   201.35 ? 254  SER A CB  1 
ATOM   1516  O  OG  . SER A  1  199  ? 218.179 230.588 150.426 1.00   209.14 ? 254  SER A OG  1 
ATOM   1517  N  N   . ILE A  1  200  ? 221.225 231.557 149.213 1.00   136.37 ? 255  ILE A N   1 
ATOM   1518  C  CA  . ILE A  1  200  ? 221.901 232.310 148.203 1.00   124.64 ? 255  ILE A CA  1 
ATOM   1519  C  C   . ILE A  1  200  ? 221.801 231.375 147.031 1.00   126.85 ? 255  ILE A C   1 
ATOM   1520  O  O   . ILE A  1  200  ? 221.635 230.178 147.169 1.00   154.89 ? 255  ILE A O   1 
ATOM   1521  C  CB  . ILE A  1  200  ? 223.384 232.656 148.606 1.00   136.36 ? 255  ILE A CB  1 
ATOM   1522  C  CG1 . ILE A  1  200  ? 223.390 233.881 149.558 1.00   170.92 ? 255  ILE A CG1 1 
ATOM   1523  C  CG2 . ILE A  1  200  ? 224.342 232.890 147.408 1.00   112.55 ? 255  ILE A CG2 1 
ATOM   1524  C  CD1 . ILE A  1  200  ? 224.669 234.714 149.616 1.00   188.57 ? 255  ILE A CD1 1 
ATOM   1525  N  N   . VAL A  1  201  ? 221.888 231.946 145.863 1.00   136.14 ? 256  VAL A N   1 
ATOM   1526  C  CA  . VAL A  1  201  ? 221.825 231.216 144.624 1.00   120.62 ? 256  VAL A CA  1 
ATOM   1527  C  C   . VAL A  1  201  ? 222.640 232.066 143.625 1.00   132.53 ? 256  VAL A C   1 
ATOM   1528  O  O   . VAL A  1  201  ? 222.884 233.272 143.777 1.00   138.28 ? 256  VAL A O   1 
ATOM   1529  C  CB  . VAL A  1  201  ? 220.344 231.094 144.166 1.00   116.92 ? 256  VAL A CB  1 
ATOM   1530  C  CG1 . VAL A  1  201  ? 220.199 230.451 142.800 1.00   118.25 ? 256  VAL A CG1 1 
ATOM   1531  C  CG2 . VAL A  1  201  ? 219.519 230.335 145.173 1.00   111.29 ? 256  VAL A CG2 1 
ATOM   1532  N  N   . MET A  1  202  ? 223.061 231.421 142.580 1.00   130.51 ? 257  MET A N   1 
ATOM   1533  C  CA  . MET A  1  202  ? 223.804 232.067 141.566 1.00   134.58 ? 257  MET A CA  1 
ATOM   1534  C  C   . MET A  1  202  ? 223.218 231.602 140.237 1.00   147.98 ? 257  MET A C   1 
ATOM   1535  O  O   . MET A  1  202  ? 222.979 230.403 140.028 1.00   175.74 ? 257  MET A O   1 
ATOM   1536  C  CB  . MET A  1  202  ? 225.228 231.576 141.720 1.00   153.47 ? 257  MET A CB  1 
ATOM   1537  C  CG  . MET A  1  202  ? 226.268 232.446 141.099 1.00   172.07 ? 257  MET A CG  1 
ATOM   1538  S  SD  . MET A  1  202  ? 226.567 233.761 142.259 1.00   197.78 ? 257  MET A SD  1 
ATOM   1539  C  CE  . MET A  1  202  ? 226.795 235.072 141.073 1.00   236.15 ? 257  MET A CE  1 
ATOM   1540  N  N   . THR A  1  203  ? 222.986 232.534 139.329 1.00   154.58 ? 258  THR A N   1 
ATOM   1541  C  CA  . THR A  1  203  ? 222.599 232.169 137.973 1.00   176.15 ? 258  THR A CA  1 
ATOM   1542  C  C   . THR A  1  203  ? 223.355 232.966 136.923 1.00   175.45 ? 258  THR A C   1 
ATOM   1543  O  O   . THR A  1  203  ? 223.824 234.065 137.187 1.00   177.45 ? 258  THR A O   1 
ATOM   1544  C  CB  . THR A  1  203  ? 221.099 232.383 137.722 1.00   187.03 ? 258  THR A CB  1 
ATOM   1545  O  OG1 . THR A  1  203  ? 220.814 233.789 137.729 1.00   220.86 ? 258  THR A OG1 1 
ATOM   1546  C  CG2 . THR A  1  203  ? 220.258 231.675 138.770 1.00   171.40 ? 258  THR A CG2 1 
ATOM   1547  N  N   . TYR A  1  204  ? 223.419 232.407 135.722 1.00   166.78 ? 259  TYR A N   1 
ATOM   1548  C  CA  . TYR A  1  204  ? 224.065 233.028 134.584 1.00   167.95 ? 259  TYR A CA  1 
ATOM   1549  C  C   . TYR A  1  204  ? 223.007 233.349 133.551 1.00   196.00 ? 259  TYR A C   1 
ATOM   1550  O  O   . TYR A  1  204  ? 222.238 232.471 133.174 1.00   224.85 ? 259  TYR A O   1 
ATOM   1551  C  CB  . TYR A  1  204  ? 225.052 232.032 134.012 1.00   155.03 ? 259  TYR A CB  1 
ATOM   1552  C  CG  . TYR A  1  204  ? 225.886 232.574 132.919 1.00   163.08 ? 259  TYR A CG  1 
ATOM   1553  C  CD1 . TYR A  1  204  ? 226.703 233.696 133.128 1.00   174.94 ? 259  TYR A CD1 1 
ATOM   1554  C  CD2 . TYR A  1  204  ? 225.879 231.973 131.669 1.00   178.90 ? 259  TYR A CD2 1 
ATOM   1555  C  CE1 . TYR A  1  204  ? 227.490 234.204 132.108 1.00   216.24 ? 259  TYR A CE1 1 
ATOM   1556  C  CE2 . TYR A  1  204  ? 226.659 232.475 130.636 1.00   232.81 ? 259  TYR A CE2 1 
ATOM   1557  C  CZ  . TYR A  1  204  ? 227.465 233.590 130.855 1.00   250.91 ? 259  TYR A CZ  1 
ATOM   1558  O  OH  . TYR A  1  204  ? 228.234 234.076 129.823 1.00   287.22 ? 259  TYR A OH  1 
ATOM   1559  N  N   . ASP A  1  205  ? 222.952 234.600 133.101 1.00   221.31 ? 260  ASP A N   1 
ATOM   1560  C  CA  . ASP A  1  205  ? 222.090 234.967 131.988 1.00   246.86 ? 260  ASP A CA  1 
ATOM   1561  C  C   . ASP A  1  205  ? 222.937 235.043 130.714 1.00   262.42 ? 260  ASP A C   1 
ATOM   1562  O  O   . ASP A  1  205  ? 223.849 235.857 130.616 1.00   328.71 ? 260  ASP A O   1 
ATOM   1563  C  CB  . ASP A  1  205  ? 221.394 236.306 132.268 1.00   257.43 ? 260  ASP A CB  1 
ATOM   1564  C  CG  . ASP A  1  205  ? 220.650 236.853 131.050 1.00   290.87 ? 260  ASP A CG  1 
ATOM   1565  O  OD1 . ASP A  1  205  ? 220.408 236.084 130.088 1.00   316.92 ? 260  ASP A OD1 1 
ATOM   1566  O  OD2 . ASP A  1  205  ? 220.327 238.062 131.041 1.00   281.11 ? 260  ASP A OD2 1 
ATOM   1567  N  N   . ALA A  1  206  ? 222.598 234.219 129.726 1.00   233.77 ? 261  ALA A N   1 
ATOM   1568  C  CA  . ALA A  1  206  ? 223.335 234.146 128.464 1.00   260.38 ? 261  ALA A CA  1 
ATOM   1569  C  C   . ALA A  1  206  ? 223.321 235.466 127.695 1.00   279.06 ? 261  ALA A C   1 
ATOM   1570  O  O   . ALA A  1  206  ? 224.330 235.839 127.067 1.00   261.51 ? 261  ALA A O   1 
ATOM   1571  C  CB  . ALA A  1  206  ? 222.749 233.036 127.600 1.00   257.18 ? 261  ALA A CB  1 
ATOM   1572  N  N   . VAL A  1  207  ? 222.183 236.162 127.779 1.00   273.51 ? 262  VAL A N   1 
ATOM   1573  C  CA  . VAL A  1  207  ? 221.887 237.323 126.940 1.00   254.00 ? 262  VAL A CA  1 
ATOM   1574  C  C   . VAL A  1  207  ? 222.579 238.604 127.426 1.00   271.80 ? 262  VAL A C   1 
ATOM   1575  O  O   . VAL A  1  207  ? 223.117 239.351 126.615 1.00   319.93 ? 262  VAL A O   1 
ATOM   1576  C  CB  . VAL A  1  207  ? 220.354 237.487 126.706 1.00   213.13 ? 262  VAL A CB  1 
ATOM   1577  C  CG1 . VAL A  1  207  ? 219.753 236.146 126.267 1.00   190.98 ? 262  VAL A CG1 1 
ATOM   1578  C  CG2 . VAL A  1  207  ? 219.597 238.083 127.904 1.00   205.39 ? 262  VAL A CG2 1 
ATOM   1579  N  N   . GLN A  1  208  ? 222.596 238.846 128.731 1.00   238.93 ? 263  GLN A N   1 
ATOM   1580  C  CA  . GLN A  1  208  ? 223.365 239.954 129.282 1.00   219.12 ? 263  GLN A CA  1 
ATOM   1581  C  C   . GLN A  1  208  ? 224.776 239.504 129.670 1.00   217.00 ? 263  GLN A C   1 
ATOM   1582  O  O   . GLN A  1  208  ? 225.618 240.344 129.981 1.00   239.32 ? 263  GLN A O   1 
ATOM   1583  C  CB  . GLN A  1  208  ? 222.656 240.542 130.488 1.00   225.99 ? 263  GLN A CB  1 
ATOM   1584  C  CG  . GLN A  1  208  ? 221.341 241.216 130.156 1.00   236.17 ? 263  GLN A CG  1 
ATOM   1585  C  CD  . GLN A  1  208  ? 220.676 241.811 131.385 1.00   264.90 ? 263  GLN A CD  1 
ATOM   1586  O  OE1 . GLN A  1  208  ? 221.336 242.136 132.380 1.00   243.18 ? 263  GLN A OE1 1 
ATOM   1587  N  NE2 . GLN A  1  208  ? 219.358 241.961 131.321 1.00   290.53 ? 263  GLN A NE2 1 
ATOM   1588  N  N   . ASN A  1  209  ? 225.028 238.191 129.649 1.00   217.76 ? 264  ASN A N   1 
ATOM   1589  C  CA  . ASN A  1  209  ? 226.323 237.611 129.983 1.00   205.17 ? 264  ASN A CA  1 
ATOM   1590  C  C   . ASN A  1  209  ? 226.802 237.996 131.420 1.00   215.53 ? 264  ASN A C   1 
ATOM   1591  O  O   . ASN A  1  209  ? 227.996 238.250 131.649 1.00   217.20 ? 264  ASN A O   1 
ATOM   1592  C  CB  . ASN A  1  209  ? 227.340 237.958 128.879 1.00   181.28 ? 264  ASN A CB  1 
ATOM   1593  N  N   . VAL A  1  210  ? 225.867 238.012 132.384 1.00   206.93 ? 265  VAL A N   1 
ATOM   1594  C  CA  . VAL A  1  210  ? 226.148 238.439 133.786 1.00   211.04 ? 265  VAL A CA  1 
ATOM   1595  C  C   . VAL A  1  210  ? 225.551 237.506 134.828 1.00   199.74 ? 265  VAL A C   1 
ATOM   1596  O  O   . VAL A  1  210  ? 224.501 236.950 134.592 1.00   218.00 ? 265  VAL A O   1 
ATOM   1597  C  CB  . VAL A  1  210  ? 225.579 239.847 134.125 1.00   206.77 ? 265  VAL A CB  1 
ATOM   1598  C  CG1 . VAL A  1  210  ? 226.387 240.934 133.427 1.00   224.15 ? 265  VAL A CG1 1 
ATOM   1599  C  CG2 . VAL A  1  210  ? 224.077 239.952 133.821 1.00   185.12 ? 265  VAL A CG2 1 
ATOM   1600  N  N   . HIS A  1  211  ? 226.153 237.397 136.016 1.00   177.65 ? 266  HIS A N   1 
ATOM   1601  C  CA  . HIS A  1  211  ? 225.585 236.527 137.054 1.00   160.32 ? 266  HIS A CA  1 
ATOM   1602  C  C   . HIS A  1  211  ? 224.648 237.230 138.024 1.00   186.03 ? 266  HIS A C   1 
ATOM   1603  O  O   . HIS A  1  211  ? 224.835 238.419 138.329 1.00   208.62 ? 266  HIS A O   1 
ATOM   1604  C  CB  . HIS A  1  211  ? 226.649 235.853 137.879 1.00   163.30 ? 266  HIS A CB  1 
ATOM   1605  C  CG  . HIS A  1  211  ? 227.736 235.255 137.075 1.00   166.21 ? 266  HIS A CG  1 
ATOM   1606  N  ND1 . HIS A  1  211  ? 227.659 233.984 136.561 1.00   171.91 ? 266  HIS A ND1 1 
ATOM   1607  C  CD2 . HIS A  1  211  ? 228.925 235.758 136.686 1.00   180.36 ? 266  HIS A CD2 1 
ATOM   1608  C  CE1 . HIS A  1  211  ? 228.760 233.724 135.886 1.00   186.77 ? 266  HIS A CE1 1 
ATOM   1609  N  NE2 . HIS A  1  211  ? 229.546 234.784 135.950 1.00   219.76 ? 266  HIS A NE2 1 
ATOM   1610  N  N   . SER A  1  212  ? 223.665 236.467 138.519 1.00   180.95 ? 267  SER A N   1 
ATOM   1611  C  CA  . SER A  1  212  ? 222.701 236.947 139.513 1.00   192.01 ? 267  SER A CA  1 
ATOM   1612  C  C   . SER A  1  212  ? 222.811 236.157 140.800 1.00   182.99 ? 267  SER A C   1 
ATOM   1613  O  O   . SER A  1  212  ? 223.004 234.939 140.802 1.00   170.89 ? 267  SER A O   1 
ATOM   1614  C  CB  . SER A  1  212  ? 221.261 236.812 139.018 1.00   193.45 ? 267  SER A CB  1 
ATOM   1615  O  OG  . SER A  1  212  ? 221.014 237.631 137.896 1.00   228.61 ? 267  SER A OG  1 
ATOM   1616  N  N   . VAL A  1  213  ? 222.653 236.875 141.896 1.00   168.95 ? 268  VAL A N   1 
ATOM   1617  C  CA  . VAL A  1  213  ? 222.554 236.280 143.200 1.00   152.04 ? 268  VAL A CA  1 
ATOM   1618  C  C   . VAL A  1  213  ? 221.114 236.374 143.625 1.00   161.39 ? 268  VAL A C   1 
ATOM   1619  O  O   . VAL A  1  213  ? 220.478 237.417 143.443 1.00   216.48 ? 268  VAL A O   1 
ATOM   1620  C  CB  . VAL A  1  213  ? 223.394 237.062 144.191 1.00   162.58 ? 268  VAL A CB  1 
ATOM   1621  C  CG1 . VAL A  1  213  ? 223.385 236.408 145.572 1.00   164.72 ? 268  VAL A CG1 1 
ATOM   1622  C  CG2 . VAL A  1  213  ? 224.808 237.169 143.651 1.00   174.60 ? 268  VAL A CG2 1 
ATOM   1623  N  N   . TRP A  1  214  ? 220.596 235.299 144.192 1.00   141.98 ? 269  TRP A N   1 
ATOM   1624  C  CA  . TRP A  1  214  ? 219.260 235.332 144.781 1.00   142.97 ? 269  TRP A CA  1 
ATOM   1625  C  C   . TRP A  1  214  ? 219.248 234.734 146.175 1.00   146.08 ? 269  TRP A C   1 
ATOM   1626  O  O   . TRP A  1  214  ? 220.196 234.080 146.584 1.00   155.50 ? 269  TRP A O   1 
ATOM   1627  C  CB  . TRP A  1  214  ? 218.248 234.590 143.919 1.00   135.94 ? 269  TRP A CB  1 
ATOM   1628  C  CG  . TRP A  1  214  ? 218.405 234.755 142.454 1.00   148.21 ? 269  TRP A CG  1 
ATOM   1629  C  CD1 . TRP A  1  214  ? 219.381 234.218 141.696 1.00   170.10 ? 269  TRP A CD1 1 
ATOM   1630  C  CD2 . TRP A  1  214  ? 217.552 235.477 141.555 1.00   154.40 ? 269  TRP A CD2 1 
ATOM   1631  N  NE1 . TRP A  1  214  ? 219.202 234.554 140.385 1.00   184.44 ? 269  TRP A NE1 1 
ATOM   1632  C  CE2 . TRP A  1  214  ? 218.079 235.324 140.275 1.00   158.94 ? 269  TRP A CE2 1 
ATOM   1633  C  CE3 . TRP A  1  214  ? 216.400 236.243 141.713 1.00   166.83 ? 269  TRP A CE3 1 
ATOM   1634  C  CZ2 . TRP A  1  214  ? 217.501 235.894 139.159 1.00   178.89 ? 269  TRP A CZ2 1 
ATOM   1635  C  CZ3 . TRP A  1  214  ? 215.817 236.800 140.601 1.00   181.77 ? 269  TRP A CZ3 1 
ATOM   1636  C  CH2 . TRP A  1  214  ? 216.373 236.634 139.342 1.00   187.17 ? 269  TRP A CH2 1 
ATOM   1637  N  N   . THR A  1  215  ? 218.162 234.942 146.901 1.00   148.62 ? 270  THR A N   1 
ATOM   1638  C  CA  . THR A  1  215  ? 217.935 234.206 148.148 1.00   163.20 ? 270  THR A CA  1 
ATOM   1639  C  C   . THR A  1  215  ? 216.657 233.365 148.035 1.00   171.56 ? 270  THR A C   1 
ATOM   1640  O  O   . THR A  1  215  ? 215.602 233.902 147.727 1.00   168.60 ? 270  THR A O   1 
ATOM   1641  C  CB  . THR A  1  215  ? 217.845 235.145 149.380 1.00   160.56 ? 270  THR A CB  1 
ATOM   1642  O  OG1 . THR A  1  215  ? 216.489 235.567 149.616 1.00   168.51 ? 270  THR A OG1 1 
ATOM   1643  C  CG2 . THR A  1  215  ? 218.747 236.348 149.199 1.00   161.67 ? 270  THR A CG2 1 
ATOM   1644  N  N   . LEU A  1  216  ? 216.733 232.057 148.283 1.00   168.10 ? 271  LEU A N   1 
ATOM   1645  C  CA  . LEU A  1  216  ? 215.509 231.298 148.527 1.00   155.87 ? 271  LEU A CA  1 
ATOM   1646  C  C   . LEU A  1  216  ? 214.883 231.822 149.826 1.00   170.49 ? 271  LEU A C   1 
ATOM   1647  O  O   . LEU A  1  216  ? 215.586 232.207 150.760 1.00   191.10 ? 271  LEU A O   1 
ATOM   1648  C  CB  . LEU A  1  216  ? 215.762 229.798 148.717 1.00   162.07 ? 271  LEU A CB  1 
ATOM   1649  C  CG  . LEU A  1  216  ? 215.920 228.843 147.559 1.00   160.93 ? 271  LEU A CG  1 
ATOM   1650  C  CD1 . LEU A  1  216  ? 214.571 228.385 147.031 1.00   172.32 ? 271  LEU A CD1 1 
ATOM   1651  C  CD2 . LEU A  1  216  ? 216.725 229.509 146.482 1.00   176.14 ? 271  LEU A CD2 1 
ATOM   1652  N  N   . ARG A  1  217  ? 213.562 231.852 149.877 1.00   170.84 ? 272  ARG A N   1 
ATOM   1653  C  CA  . ARG A  1  217  ? 212.837 231.985 151.146 1.00   166.21 ? 272  ARG A CA  1 
ATOM   1654  C  C   . ARG A  1  217  ? 211.658 231.047 151.036 1.00   148.46 ? 272  ARG A C   1 
ATOM   1655  O  O   . ARG A  1  217  ? 211.515 230.328 150.058 1.00   150.43 ? 272  ARG A O   1 
ATOM   1656  C  CB  . ARG A  1  217  ? 212.332 233.410 151.389 1.00   174.44 ? 272  ARG A CB  1 
ATOM   1657  C  CG  . ARG A  1  217  ? 213.351 234.532 151.291 1.00   190.74 ? 272  ARG A CG  1 
ATOM   1658  C  CD  . ARG A  1  217  ? 212.650 235.891 151.196 1.00   209.46 ? 272  ARG A CD  1 
ATOM   1659  N  NE  . ARG A  1  217  ? 211.867 236.018 149.950 1.00   225.02 ? 272  ARG A NE  1 
ATOM   1660  C  CZ  . ARG A  1  217  ? 210.546 235.840 149.818 1.00   219.33 ? 272  ARG A CZ  1 
ATOM   1661  N  NH1 . ARG A  1  217  ? 209.769 235.555 150.862 1.00   233.88 ? 272  ARG A NH1 1 
ATOM   1662  N  NH2 . ARG A  1  217  ? 209.986 235.961 148.609 1.00   196.24 ? 272  ARG A NH2 1 
ATOM   1663  N  N   . ARG A  1  218  ? 210.777 231.072 152.009 1.00   147.50 ? 273  ARG A N   1 
ATOM   1664  C  CA  . ARG A  1  218  ? 209.660 230.172 151.965 1.00   167.19 ? 273  ARG A CA  1 
ATOM   1665  C  C   . ARG A  1  218  ? 208.521 230.626 151.025 1.00   168.67 ? 273  ARG A C   1 
ATOM   1666  O  O   . ARG A  1  218  ? 207.823 229.751 150.525 1.00   198.22 ? 273  ARG A O   1 
ATOM   1667  C  CB  . ARG A  1  218  ? 209.173 229.899 153.391 1.00   191.53 ? 273  ARG A CB  1 
ATOM   1668  C  CG  . ARG A  1  218  ? 208.330 228.646 153.538 1.00   211.87 ? 273  ARG A CG  1 
ATOM   1669  C  CD  . ARG A  1  218  ? 209.085 227.348 153.283 1.00   201.78 ? 273  ARG A CD  1 
ATOM   1670  N  NE  . ARG A  1  218  ? 208.325 226.260 153.883 1.00   223.26 ? 273  ARG A NE  1 
ATOM   1671  C  CZ  . ARG A  1  218  ? 208.633 225.598 155.001 1.00   232.48 ? 273  ARG A CZ  1 
ATOM   1672  N  NH1 . ARG A  1  218  ? 209.764 225.829 155.682 1.00   214.62 ? 273  ARG A NH1 1 
ATOM   1673  N  NH2 . ARG A  1  218  ? 207.789 224.659 155.424 1.00   242.75 ? 273  ARG A NH2 1 
ATOM   1674  N  N   . VAL A  1  219  ? 208.349 231.942 150.792 1.00   169.20 ? 274  VAL A N   1 
ATOM   1675  C  CA  . VAL A  1  219  ? 207.158 232.585 150.088 1.00   189.87 ? 274  VAL A CA  1 
ATOM   1676  C  C   . VAL A  1  219  ? 206.451 233.761 150.863 1.00   221.79 ? 274  VAL A C   1 
ATOM   1677  O  O   . VAL A  1  219  ? 206.008 234.739 150.229 1.00   201.97 ? 274  VAL A O   1 
ATOM   1678  C  CB  . VAL A  1  219  ? 206.084 231.561 149.554 1.00   167.83 ? 274  VAL A CB  1 
ATOM   1679  C  CG1 . VAL A  1  219  ? 204.752 232.208 149.214 1.00   182.08 ? 274  VAL A CG1 1 
ATOM   1680  C  CG2 . VAL A  1  219  ? 206.590 230.848 148.307 1.00   147.24 ? 274  VAL A CG2 1 
ATOM   1681  N  N   . LYS A  1  220  ? 206.355 233.676 152.197 1.00   251.79 ? 275  LYS A N   1 
ATOM   1682  C  CA  . LYS A  1  220  ? 205.536 234.609 153.016 1.00   243.10 ? 275  LYS A CA  1 
ATOM   1683  C  C   . LYS A  1  220  ? 204.041 234.360 152.671 1.00   258.42 ? 275  LYS A C   1 
ATOM   1684  O  O   . LYS A  1  220  ? 203.650 233.190 152.543 1.00   212.74 ? 275  LYS A O   1 
ATOM   1685  C  CB  . LYS A  1  220  ? 205.990 236.078 152.841 1.00   192.88 ? 275  LYS A CB  1 
ATOM   1686  N  N   . ALA A  1  221  ? 203.216 235.411 152.541 1.00   280.61 ? 276  ALA A N   1 
ATOM   1687  C  CA  . ALA A  1  221  ? 201.854 235.299 151.955 1.00   258.65 ? 276  ALA A CA  1 
ATOM   1688  C  C   . ALA A  1  221  ? 201.707 236.220 150.722 1.00   265.27 ? 276  ALA A C   1 
ATOM   1689  O  O   . ALA A  1  221  ? 201.596 237.466 150.850 1.00   198.05 ? 276  ALA A O   1 
ATOM   1690  C  CB  . ALA A  1  221  ? 200.773 235.590 152.988 1.00   231.07 ? 276  ALA A CB  1 
ATOM   1691  N  N   . GLU A  1  222  ? 201.743 235.574 149.544 1.00   267.38 ? 277  GLU A N   1 
ATOM   1692  C  CA  . GLU A  1  222  ? 201.624 236.206 148.221 1.00   240.75 ? 277  GLU A CA  1 
ATOM   1693  C  C   . GLU A  1  222  ? 200.313 235.766 147.560 1.00   259.93 ? 277  GLU A C   1 
ATOM   1694  O  O   . GLU A  1  222  ? 199.825 234.636 147.792 1.00   209.63 ? 277  GLU A O   1 
ATOM   1695  C  CB  . GLU A  1  222  ? 202.808 235.829 147.300 1.00   168.80 ? 277  GLU A CB  1 
ATOM   1696  N  N   . GLU A  1  223  ? 199.756 236.692 146.765 1.00   288.02 ? 278  GLU A N   1 
ATOM   1697  C  CA  . GLU A  1  223  ? 198.616 236.440 145.869 1.00   270.77 ? 278  GLU A CA  1 
ATOM   1698  C  C   . GLU A  1  223  ? 199.069 235.431 144.815 1.00   306.27 ? 278  GLU A C   1 
ATOM   1699  O  O   . GLU A  1  223  ? 200.197 235.536 144.331 1.00   364.15 ? 278  GLU A O   1 
ATOM   1700  C  CB  . GLU A  1  223  ? 198.158 237.744 145.203 1.00   195.07 ? 278  GLU A CB  1 
ATOM   1701  N  N   . GLU A  1  224  ? 198.204 234.462 144.484 1.00   266.74 ? 279  GLU A N   1 
ATOM   1702  C  CA  . GLU A  1  224  ? 198.511 233.354 143.544 1.00   217.13 ? 279  GLU A CA  1 
ATOM   1703  C  C   . GLU A  1  224  ? 199.244 233.798 142.236 1.00   252.99 ? 279  GLU A C   1 
ATOM   1704  O  O   . GLU A  1  224  ? 198.654 234.491 141.390 1.00   293.08 ? 279  GLU A O   1 
ATOM   1705  C  CB  . GLU A  1  224  ? 197.223 232.608 143.224 1.00   172.32 ? 279  GLU A CB  1 
ATOM   1706  N  N   . UNK A  1  225  ? 200.516 233.399 142.082 1.00   250.43 ? 280  UNK A N   1 
ATOM   1707  C  CA  . UNK A  1  225  ? 201.443 234.023 141.094 1.00   266.95 ? 280  UNK A CA  1 
ATOM   1708  C  C   . UNK A  1  225  ? 201.202 233.564 139.667 1.00   303.66 ? 280  UNK A C   1 
ATOM   1709  O  O   . UNK A  1  225  ? 200.787 232.423 139.444 1.00   367.88 ? 280  UNK A O   1 
ATOM   1710  C  CB  . UNK A  1  225  ? 202.894 233.761 141.471 1.00   280.06 ? 280  UNK A CB  1 
ATOM   1711  N  N   . UNK A  1  226  ? 201.491 234.457 138.714 1.00   312.91 ? 281  UNK A N   1 
ATOM   1712  C  CA  . UNK A  1  226  ? 201.180 234.255 137.292 1.00   331.67 ? 281  UNK A CA  1 
ATOM   1713  C  C   . UNK A  1  226  ? 199.691 233.889 137.115 1.00   353.04 ? 281  UNK A C   1 
ATOM   1714  O  O   . UNK A  1  226  ? 199.357 232.852 136.532 1.00   363.03 ? 281  UNK A O   1 
ATOM   1715  C  CB  . UNK A  1  226  ? 202.108 233.194 136.686 1.00   331.58 ? 281  UNK A CB  1 
ATOM   1716  N  N   . UNK A  1  227  ? 198.822 234.773 137.630 1.00   351.11 ? 282  UNK A N   1 
ATOM   1717  C  CA  . UNK A  1  227  ? 197.364 234.526 137.811 1.00   327.62 ? 282  UNK A CA  1 
ATOM   1718  C  C   . UNK A  1  227  ? 196.575 234.075 136.552 1.00   336.61 ? 282  UNK A C   1 
ATOM   1719  O  O   . UNK A  1  227  ? 195.515 233.430 136.673 1.00   270.52 ? 282  UNK A O   1 
ATOM   1720  C  CB  . UNK A  1  227  ? 196.696 235.752 138.450 1.00   268.64 ? 282  UNK A CB  1 
ATOM   1721  N  N   . UNK A  1  228  ? 197.093 234.420 135.368 1.00   344.81 ? 283  UNK A N   1 
ATOM   1722  C  CA  . UNK A  1  228  ? 196.544 233.966 134.078 1.00   331.12 ? 283  UNK A CA  1 
ATOM   1723  C  C   . UNK A  1  228  ? 196.455 232.432 133.892 1.00   366.31 ? 283  UNK A C   1 
ATOM   1724  O  O   . UNK A  1  228  ? 195.427 231.950 133.414 1.00   378.59 ? 283  UNK A O   1 
ATOM   1725  C  CB  . UNK A  1  228  ? 197.335 234.591 132.927 1.00   277.68 ? 283  UNK A CB  1 
ATOM   1726  N  N   . UNK A  1  229  ? 197.498 231.684 134.290 1.00   365.49 ? 284  UNK A N   1 
ATOM   1727  C  CA  . UNK A  1  229  ? 197.678 230.253 133.913 1.00   321.21 ? 284  UNK A CA  1 
ATOM   1728  C  C   . UNK A  1  229  ? 197.509 229.179 135.031 1.00   307.72 ? 284  UNK A C   1 
ATOM   1729  O  O   . UNK A  1  229  ? 198.412 228.991 135.858 1.00   258.18 ? 284  UNK A O   1 
ATOM   1730  C  CB  . UNK A  1  229  ? 199.043 230.092 133.251 1.00   276.98 ? 284  UNK A CB  1 
ATOM   1731  N  N   . UNK A  1  230  ? 196.346 228.505 135.033 1.00   287.64 ? 285  UNK A N   1 
ATOM   1732  C  CA  . UNK A  1  230  ? 196.095 227.245 135.758 1.00   245.67 ? 285  UNK A CA  1 
ATOM   1733  C  C   . UNK A  1  230  ? 196.418 226.049 134.847 1.00   269.98 ? 285  UNK A C   1 
ATOM   1734  O  O   . UNK A  1  230  ? 196.270 224.890 135.252 1.00   309.05 ? 285  UNK A O   1 
ATOM   1735  C  CB  . UNK A  1  230  ? 194.639 227.172 136.227 1.00   206.44 ? 285  UNK A CB  1 
ATOM   1736  N  N   . UNK A  1  231  ? 196.837 226.346 133.610 1.00   287.69 ? 286  UNK A N   1 
ATOM   1737  C  CA  . UNK A  1  231  ? 197.442 225.369 132.711 1.00   272.61 ? 286  UNK A CA  1 
ATOM   1738  C  C   . UNK A  1  231  ? 198.613 224.629 133.368 1.00   301.90 ? 286  UNK A C   1 
ATOM   1739  O  O   . UNK A  1  231  ? 198.800 223.479 133.040 1.00   298.41 ? 286  UNK A O   1 
ATOM   1740  C  CB  . UNK A  1  231  ? 197.886 226.015 131.396 1.00   234.23 ? 286  UNK A CB  1 
ATOM   1741  N  N   . UNK A  1  232  ? 199.374 225.255 134.286 1.00   307.67 ? 287  UNK A N   1 
ATOM   1742  C  CA  . UNK A  1  232  ? 200.457 224.573 135.054 1.00   248.17 ? 287  UNK A CA  1 
ATOM   1743  C  C   . UNK A  1  232  ? 200.007 223.275 135.689 1.00   218.43 ? 287  UNK A C   1 
ATOM   1744  O  O   . UNK A  1  232  ? 200.582 222.255 135.401 1.00   213.42 ? 287  UNK A O   1 
ATOM   1745  C  CB  . UNK A  1  232  ? 201.042 225.481 136.130 1.00   232.65 ? 287  UNK A CB  1 
ATOM   1746  N  N   . UNK A  1  233  ? 198.972 223.308 136.526 1.00   221.58 ? 288  UNK A N   1 
ATOM   1747  C  CA  . UNK A  1  233  ? 198.479 222.073 137.175 1.00   202.28 ? 288  UNK A CA  1 
ATOM   1748  C  C   . UNK A  1  233  ? 197.954 221.026 136.178 1.00   180.34 ? 288  UNK A C   1 
ATOM   1749  O  O   . UNK A  1  233  ? 198.257 219.851 136.297 1.00   156.08 ? 288  UNK A O   1 
ATOM   1750  C  CB  . UNK A  1  233  ? 197.415 222.384 138.222 1.00   204.59 ? 288  UNK A CB  1 
ATOM   1751  N  N   . GLY A  1  234  ? 197.154 221.465 135.216 1.00   199.88 ? 289  GLY A N   1 
ATOM   1752  C  CA  . GLY A  1  234  ? 196.555 220.566 134.230 1.00   178.43 ? 289  GLY A CA  1 
ATOM   1753  C  C   . GLY A  1  234  ? 197.534 220.176 133.149 1.00   186.73 ? 289  GLY A C   1 
ATOM   1754  O  O   . GLY A  1  234  ? 197.428 219.089 132.581 1.00   186.53 ? 289  GLY A O   1 
ATOM   1755  N  N   . GLY A  1  235  ? 198.470 221.087 132.862 1.00   190.01 ? 290  GLY A N   1 
ATOM   1756  C  CA  . GLY A  1  235  ? 199.477 220.926 131.813 1.00   197.87 ? 290  GLY A CA  1 
ATOM   1757  C  C   . GLY A  1  235  ? 200.604 220.056 132.279 1.00   186.05 ? 290  GLY A C   1 
ATOM   1758  O  O   . GLY A  1  235  ? 201.262 219.435 131.473 1.00   182.12 ? 290  GLY A O   1 
ATOM   1759  N  N   . PHE A  1  236  ? 200.808 220.017 133.589 1.00   198.80 ? 291  PHE A N   1 
ATOM   1760  C  CA  . PHE A  1  236  ? 201.763 219.118 134.266 1.00   211.84 ? 291  PHE A CA  1 
ATOM   1761  C  C   . PHE A  1  236  ? 201.337 217.672 134.217 1.00   173.87 ? 291  PHE A C   1 
ATOM   1762  O  O   . PHE A  1  236  ? 202.142 216.822 133.890 1.00   196.49 ? 291  PHE A O   1 
ATOM   1763  C  CB  . PHE A  1  236  ? 201.833 219.562 135.711 1.00   235.11 ? 291  PHE A CB  1 
ATOM   1764  C  CG  . PHE A  1  236  ? 202.842 218.877 136.557 1.00   175.08 ? 291  PHE A CG  1 
ATOM   1765  C  CD1 . PHE A  1  236  ? 204.103 219.444 136.729 1.00   153.68 ? 291  PHE A CD1 1 
ATOM   1766  C  CD2 . PHE A  1  236  ? 202.471 217.794 137.307 1.00   157.91 ? 291  PHE A CD2 1 
ATOM   1767  C  CE1 . PHE A  1  236  ? 204.994 218.896 137.586 1.00   170.77 ? 291  PHE A CE1 1 
ATOM   1768  C  CE2 . PHE A  1  236  ? 203.363 217.221 138.162 1.00   196.94 ? 291  PHE A CE2 1 
ATOM   1769  C  CZ  . PHE A  1  236  ? 204.624 217.769 138.301 1.00   210.89 ? 291  PHE A CZ  1 
ATOM   1770  N  N   . UNK A  1  237  ? 200.086 217.386 134.562 1.00   152.27 ? 292  UNK A N   1 
ATOM   1771  C  CA  . UNK A  1  237  ? 199.561 216.038 134.343 1.00   173.09 ? 292  UNK A CA  1 
ATOM   1772  C  C   . UNK A  1  237  ? 199.664 215.589 132.843 1.00   212.39 ? 292  UNK A C   1 
ATOM   1773  O  O   . UNK A  1  237  ? 200.119 214.469 132.549 1.00   208.08 ? 292  UNK A O   1 
ATOM   1774  C  CB  . UNK A  1  237  ? 198.143 215.894 134.897 1.00   160.29 ? 292  UNK A CB  1 
ATOM   1775  N  N   . UNK A  1  238  ? 199.301 216.463 131.903 1.00   243.46 ? 293  UNK A N   1 
ATOM   1776  C  CA  . UNK A  1  238  ? 199.405 216.123 130.470 1.00   247.06 ? 293  UNK A CA  1 
ATOM   1777  C  C   . UNK A  1  238  ? 200.865 215.926 130.008 1.00   262.08 ? 293  UNK A C   1 
ATOM   1778  O  O   . UNK A  1  238  ? 201.150 214.983 129.259 1.00   228.03 ? 293  UNK A O   1 
ATOM   1779  C  CB  . UNK A  1  238  ? 198.693 217.163 129.605 1.00   233.03 ? 293  UNK A CB  1 
ATOM   1780  N  N   . UNK A  1  239  ? 201.775 216.792 130.484 1.00   287.17 ? 294  UNK A N   1 
ATOM   1781  C  CA  . UNK A  1  239  ? 203.213 216.776 130.093 1.00   265.61 ? 294  UNK A CA  1 
ATOM   1782  C  C   . UNK A  1  239  ? 204.024 215.655 130.713 1.00   249.76 ? 294  UNK A C   1 
ATOM   1783  O  O   . UNK A  1  239  ? 205.219 215.528 130.388 1.00   173.04 ? 294  UNK A O   1 
ATOM   1784  C  CB  . UNK A  1  239  ? 203.896 218.112 130.417 1.00   255.30 ? 294  UNK A CB  1 
ATOM   1785  N  N   . UNK A  1  240  ? 203.411 214.932 131.658 1.00   272.08 ? 295  UNK A N   1 
ATOM   1786  C  CA  . UNK A  1  240  ? 203.903 213.658 132.178 1.00   315.80 ? 295  UNK A CA  1 
ATOM   1787  C  C   . UNK A  1  240  ? 205.181 213.832 132.974 1.00   379.11 ? 295  UNK A C   1 
ATOM   1788  O  O   . UNK A  1  240  ? 205.205 214.586 133.944 1.00   450.81 ? 295  UNK A O   1 
ATOM   1789  C  CB  . UNK A  1  240  ? 204.090 212.649 131.052 1.00   327.09 ? 295  UNK A CB  1 
ATOM   1790  N  N   . PRO A  1  241  ? 194.659 222.356 141.185 1.00   187.44 ? 402  PRO A N   1 
ATOM   1791  C  CA  . PRO A  1  241  ? 194.852 223.073 142.449 1.00   190.46 ? 402  PRO A CA  1 
ATOM   1792  C  C   . PRO A  1  241  ? 196.241 223.750 142.749 1.00   179.25 ? 402  PRO A C   1 
ATOM   1793  O  O   . PRO A  1  241  ? 196.271 224.606 143.635 1.00   142.57 ? 402  PRO A O   1 
ATOM   1794  C  CB  . PRO A  1  241  ? 194.542 221.974 143.525 1.00   180.78 ? 402  PRO A CB  1 
ATOM   1795  C  CG  . PRO A  1  241  ? 193.851 220.843 142.818 1.00   166.01 ? 402  PRO A CG  1 
ATOM   1796  C  CD  . PRO A  1  241  ? 193.728 221.213 141.348 1.00   175.06 ? 402  PRO A CD  1 
ATOM   1797  N  N   . ILE A  1  242  ? 197.326 223.418 142.011 1.00   206.92 ? 403  ILE A N   1 
ATOM   1798  C  CA  . ILE A  1  242  ? 198.795 223.453 142.481 1.00   197.72 ? 403  ILE A CA  1 
ATOM   1799  C  C   . ILE A  1  242  ? 199.549 224.784 142.698 1.00   193.88 ? 403  ILE A C   1 
ATOM   1800  O  O   . ILE A  1  242  ? 199.558 225.640 141.804 1.00   220.66 ? 403  ILE A O   1 
ATOM   1801  C  CB  . ILE A  1  242  ? 199.701 222.610 141.512 1.00   196.08 ? 403  ILE A CB  1 
ATOM   1802  C  CG1 . ILE A  1  242  ? 199.528 221.095 141.803 1.00   232.94 ? 403  ILE A CG1 1 
ATOM   1803  C  CG2 . ILE A  1  242  ? 201.181 223.009 141.581 1.00   134.42 ? 403  ILE A CG2 1 
ATOM   1804  C  CD1 . ILE A  1  242  ? 199.757 220.158 140.623 1.00   223.56 ? 403  ILE A CD1 1 
ATOM   1805  N  N   . VAL A  1  243  ? 200.278 224.893 143.826 1.00   166.47 ? 404  VAL A N   1 
ATOM   1806  C  CA  . VAL A  1  243  ? 200.883 226.186 144.269 1.00   169.24 ? 404  VAL A CA  1 
ATOM   1807  C  C   . VAL A  1  243  ? 202.381 226.137 144.443 1.00   153.37 ? 404  VAL A C   1 
ATOM   1808  O  O   . VAL A  1  243  ? 202.879 225.162 144.964 1.00   183.28 ? 404  VAL A O   1 
ATOM   1809  C  CB  . VAL A  1  243  ? 200.320 226.699 145.629 1.00   185.30 ? 404  VAL A CB  1 
ATOM   1810  C  CG1 . VAL A  1  243  ? 198.807 226.827 145.581 1.00   217.54 ? 404  VAL A CG1 1 
ATOM   1811  C  CG2 . VAL A  1  243  ? 200.733 225.821 146.811 1.00   201.39 ? 404  VAL A CG2 1 
ATOM   1812  N  N   . PRO A  1  244  ? 203.101 227.207 144.066 1.00   174.76 ? 405  PRO A N   1 
ATOM   1813  C  CA  . PRO A  1  244  ? 204.540 227.236 144.332 1.00   187.61 ? 405  PRO A CA  1 
ATOM   1814  C  C   . PRO A  1  244  ? 204.905 227.507 145.795 1.00   192.86 ? 405  PRO A C   1 
ATOM   1815  O  O   . PRO A  1  244  ? 204.240 228.311 146.481 1.00   161.39 ? 405  PRO A O   1 
ATOM   1816  C  CB  . PRO A  1  244  ? 205.028 228.392 143.459 1.00   195.85 ? 405  PRO A CB  1 
ATOM   1817  C  CG  . PRO A  1  244  ? 203.877 229.325 143.449 1.00   196.73 ? 405  PRO A CG  1 
ATOM   1818  C  CD  . PRO A  1  244  ? 202.666 228.432 143.377 1.00   202.83 ? 405  PRO A CD  1 
ATOM   1819  N  N   . GLU A  1  245  ? 205.968 226.812 146.223 1.00   189.16 ? 406  GLU A N   1 
ATOM   1820  C  CA  . GLU A  1  245  ? 206.663 227.012 147.494 1.00   168.21 ? 406  GLU A CA  1 
ATOM   1821  C  C   . GLU A  1  245  ? 208.078 227.391 147.144 1.00   163.50 ? 406  GLU A C   1 
ATOM   1822  O  O   . GLU A  1  245  ? 208.456 227.301 145.967 1.00   199.37 ? 406  GLU A O   1 
ATOM   1823  C  CB  . GLU A  1  245  ? 206.666 225.723 148.287 1.00   149.05 ? 406  GLU A CB  1 
ATOM   1824  C  CG  . GLU A  1  245  ? 205.266 225.242 148.647 1.00   195.73 ? 406  GLU A CG  1 
ATOM   1825  C  CD  . GLU A  1  245  ? 204.696 225.872 149.919 1.00   257.75 ? 406  GLU A CD  1 
ATOM   1826  O  OE1 . GLU A  1  245  ? 205.455 226.026 150.909 1.00   313.44 ? 406  GLU A OE1 1 
ATOM   1827  O  OE2 . GLU A  1  245  ? 203.477 226.182 149.940 1.00   279.24 ? 406  GLU A OE2 1 
ATOM   1828  N  N   . LEU A  1  246  ? 208.868 227.821 148.119 1.00   126.30 ? 407  LEU A N   1 
ATOM   1829  C  CA  . LEU A  1  246  ? 210.252 228.217 147.820 1.00   148.26 ? 407  LEU A CA  1 
ATOM   1830  C  C   . LEU A  1  246  ? 210.398 229.349 146.738 1.00   160.28 ? 407  LEU A C   1 
ATOM   1831  O  O   . LEU A  1  246  ? 211.025 229.202 145.684 1.00   163.15 ? 407  LEU A O   1 
ATOM   1832  C  CB  . LEU A  1  246  ? 211.107 226.980 147.486 1.00   149.77 ? 407  LEU A CB  1 
ATOM   1833  C  CG  . LEU A  1  246  ? 211.736 226.320 148.708 1.00   185.90 ? 407  LEU A CG  1 
ATOM   1834  C  CD1 . LEU A  1  246  ? 210.652 226.014 149.739 1.00   224.35 ? 407  LEU A CD1 1 
ATOM   1835  C  CD2 . LEU A  1  246  ? 212.527 225.071 148.309 1.00   216.67 ? 407  LEU A CD2 1 
ATOM   1836  N  N   . CYS A  1  247  ? 209.853 230.509 147.048 1.00   148.42 ? 408  CYS A N   1 
ATOM   1837  C  CA  . CYS A  1  247  ? 210.020 231.677 146.196 1.00   143.97 ? 408  CYS A CA  1 
ATOM   1838  C  C   . CYS A  1  247  ? 211.416 232.323 146.300 1.00   148.31 ? 408  CYS A C   1 
ATOM   1839  O  O   . CYS A  1  247  ? 211.773 232.801 147.365 1.00   176.73 ? 408  CYS A O   1 
ATOM   1840  C  CB  . CYS A  1  247  ? 208.991 232.740 146.565 1.00   164.68 ? 408  CYS A CB  1 
ATOM   1841  N  N   . ILE A  1  248  ? 212.176 232.351 145.198 1.00   144.88 ? 409  ILE A N   1 
ATOM   1842  C  CA  . ILE A  1  248  ? 213.418 233.155 145.028 1.00   145.25 ? 409  ILE A CA  1 
ATOM   1843  C  C   . ILE A  1  248  ? 213.208 234.675 145.247 1.00   170.31 ? 409  ILE A C   1 
ATOM   1844  O  O   . ILE A  1  248  ? 212.076 235.163 145.184 1.00   206.92 ? 409  ILE A O   1 
ATOM   1845  C  CB  . ILE A  1  248  ? 213.990 232.923 143.611 1.00   150.39 ? 409  ILE A CB  1 
ATOM   1846  C  CG1 . ILE A  1  248  ? 214.704 231.580 143.559 1.00   189.92 ? 409  ILE A CG1 1 
ATOM   1847  C  CG2 . ILE A  1  248  ? 214.996 233.964 143.208 1.00   155.19 ? 409  ILE A CG2 1 
ATOM   1848  C  CD1 . ILE A  1  248  ? 215.135 231.136 142.166 1.00   215.48 ? 409  ILE A CD1 1 
ATOM   1849  N  N   . ASP A  1  249  ? 214.299 235.398 145.541 1.00   172.91 ? 410  ASP A N   1 
ATOM   1850  C  CA  . ASP A  1  249  ? 214.319 236.878 145.634 1.00   176.87 ? 410  ASP A CA  1 
ATOM   1851  C  C   . ASP A  1  249  ? 215.640 237.439 145.083 1.00   166.65 ? 410  ASP A C   1 
ATOM   1852  O  O   . ASP A  1  249  ? 216.704 236.964 145.452 1.00   169.46 ? 410  ASP A O   1 
ATOM   1853  C  CB  . ASP A  1  249  ? 214.157 237.308 147.107 1.00   204.94 ? 410  ASP A CB  1 
ATOM   1854  C  CG  . ASP A  1  249  ? 213.348 238.599 147.280 1.00   233.61 ? 410  ASP A CG  1 
ATOM   1855  O  OD1 . ASP A  1  249  ? 213.444 239.509 146.423 1.00   274.61 ? 410  ASP A OD1 1 
ATOM   1856  O  OD2 . ASP A  1  249  ? 212.621 238.704 148.297 1.00   237.67 ? 410  ASP A OD2 1 
ATOM   1857  N  N   . HIS A  1  250  ? 215.572 238.453 144.226 1.00   184.64 ? 411  HIS A N   1 
ATOM   1858  C  CA  . HIS A  1  250  ? 216.768 239.027 143.589 1.00   187.26 ? 411  HIS A CA  1 
ATOM   1859  C  C   . HIS A  1  250  ? 217.402 240.091 144.455 1.00   186.76 ? 411  HIS A C   1 
ATOM   1860  O  O   . HIS A  1  250  ? 216.721 241.012 144.939 1.00   170.26 ? 411  HIS A O   1 
ATOM   1861  C  CB  . HIS A  1  250  ? 216.432 239.682 142.250 1.00   202.56 ? 411  HIS A CB  1 
ATOM   1862  C  CG  . HIS A  1  250  ? 217.632 240.164 141.502 1.00   190.29 ? 411  HIS A CG  1 
ATOM   1863  N  ND1 . HIS A  1  250  ? 218.296 239.385 140.576 1.00   208.91 ? 411  HIS A ND1 1 
ATOM   1864  C  CD2 . HIS A  1  250  ? 218.295 241.344 141.548 1.00   195.59 ? 411  HIS A CD2 1 
ATOM   1865  C  CE1 . HIS A  1  250  ? 219.313 240.068 140.081 1.00   227.95 ? 411  HIS A CE1 1 
ATOM   1866  N  NE2 . HIS A  1  250  ? 219.337 241.258 140.655 1.00   234.19 ? 411  HIS A NE2 1 
ATOM   1867  N  N   . LEU A  1  251  ? 218.722 239.985 144.587 1.00   188.13 ? 412  LEU A N   1 
ATOM   1868  C  CA  . LEU A  1  251  ? 219.495 240.928 145.370 1.00   172.80 ? 412  LEU A CA  1 
ATOM   1869  C  C   . LEU A  1  251  ? 220.894 241.309 144.840 1.00   163.25 ? 412  LEU A C   1 
ATOM   1870  O  O   . LEU A  1  251  ? 221.575 242.050 145.537 1.00   203.71 ? 412  LEU A O   1 
ATOM   1871  C  CB  . LEU A  1  251  ? 219.553 240.441 146.827 1.00   166.94 ? 412  LEU A CB  1 
ATOM   1872  C  CG  . LEU A  1  251  ? 220.543 239.356 147.273 1.00   175.36 ? 412  LEU A CG  1 
ATOM   1873  C  CD1 . LEU A  1  251  ? 220.359 239.077 148.765 1.00   192.72 ? 412  LEU A CD1 1 
ATOM   1874  C  CD2 . LEU A  1  251  ? 220.482 238.081 146.462 1.00   164.08 ? 412  LEU A CD2 1 
ATOM   1875  N  N   . TRP A  1  252  ? 221.319 240.879 143.635 1.00   171.92 ? 413  TRP A N   1 
ATOM   1876  C  CA  . TRP A  1  252  ? 222.574 241.431 142.998 1.00   186.38 ? 413  TRP A CA  1 
ATOM   1877  C  C   . TRP A  1  252  ? 222.785 241.333 141.407 1.00   202.85 ? 413  TRP A C   1 
ATOM   1878  O  O   . TRP A  1  252  ? 222.349 240.380 140.732 1.00   171.34 ? 413  TRP A O   1 
ATOM   1879  C  CB  . TRP A  1  252  ? 223.823 240.907 143.769 1.00   189.07 ? 413  TRP A CB  1 
ATOM   1880  C  CG  . TRP A  1  252  ? 225.012 241.709 143.483 1.00   185.79 ? 413  TRP A CG  1 
ATOM   1881  C  CD1 . TRP A  1  252  ? 225.197 243.017 143.796 1.00   181.60 ? 413  TRP A CD1 1 
ATOM   1882  C  CD2 . TRP A  1  252  ? 226.166 241.292 142.749 1.00   192.41 ? 413  TRP A CD2 1 
ATOM   1883  N  NE1 . TRP A  1  252  ? 226.405 243.444 143.306 1.00   211.54 ? 413  TRP A NE1 1 
ATOM   1884  C  CE2 . TRP A  1  252  ? 227.018 242.406 142.654 1.00   204.88 ? 413  TRP A CE2 1 
ATOM   1885  C  CE3 . TRP A  1  252  ? 226.561 240.087 142.150 1.00   178.66 ? 413  TRP A CE3 1 
ATOM   1886  C  CZ2 . TRP A  1  252  ? 228.245 242.352 141.988 1.00   201.57 ? 413  TRP A CZ2 1 
ATOM   1887  C  CZ3 . TRP A  1  252  ? 227.776 240.031 141.488 1.00   168.06 ? 413  TRP A CZ3 1 
ATOM   1888  C  CH2 . TRP A  1  252  ? 228.603 241.155 141.413 1.00   191.93 ? 413  TRP A CH2 1 
ATOM   1889  N  N   . ALA A  1  253  ? 223.470 242.344 140.845 1.00   212.59 ? 414  ALA A N   1 
ATOM   1890  C  CA  . ALA A  1  253  ? 223.869 242.419 139.401 1.00   207.87 ? 414  ALA A CA  1 
ATOM   1891  C  C   . ALA A  1  253  ? 224.912 241.379 138.928 1.00   197.25 ? 414  ALA A C   1 
ATOM   1892  O  O   . ALA A  1  253  ? 225.991 241.717 138.384 1.00   147.88 ? 414  ALA A O   1 
ATOM   1893  C  CB  . ALA A  1  253  ? 224.383 243.825 139.084 1.00   198.76 ? 414  ALA A CB  1 
ATOM   1894  N  N   . ALA A  1  254  ? 231.853 237.180 128.482 1.00   188.77 ? 424  ALA A N   1 
ATOM   1895  C  CA  . ALA A  1  254  ? 231.935 236.667 129.874 1.00   230.65 ? 424  ALA A CA  1 
ATOM   1896  C  C   . ALA A  1  254  ? 231.089 235.386 130.143 1.00   233.40 ? 424  ALA A C   1 
ATOM   1897  O  O   . ALA A  1  254  ? 229.869 235.451 130.212 1.00   291.47 ? 424  ALA A O   1 
ATOM   1898  C  CB  . ALA A  1  254  ? 231.551 237.766 130.866 1.00   209.79 ? 424  ALA A CB  1 
ATOM   1899  N  N   . ALA A  1  255  ? 231.752 234.245 130.344 1.00   216.09 ? 425  ALA A N   1 
ATOM   1900  C  CA  . ALA A  1  255  ? 231.096 232.919 130.373 1.00   207.86 ? 425  ALA A CA  1 
ATOM   1901  C  C   . ALA A  1  255  ? 230.488 232.549 131.727 1.00   211.04 ? 425  ALA A C   1 
ATOM   1902  O  O   . ALA A  1  255  ? 230.693 233.228 132.725 1.00   259.01 ? 425  ALA A O   1 
ATOM   1903  C  CB  . ALA A  1  255  ? 232.077 231.834 129.933 1.00   215.39 ? 425  ALA A CB  1 
ATOM   1904  N  N   . GLN A  1  256  ? 229.729 231.454 131.726 1.00   212.48 ? 426  GLN A N   1 
ATOM   1905  C  CA  . GLN A  1  256  ? 229.153 230.855 132.935 1.00   194.11 ? 426  GLN A CA  1 
ATOM   1906  C  C   . GLN A  1  256  ? 230.283 230.482 133.891 1.00   197.63 ? 426  GLN A C   1 
ATOM   1907  O  O   . GLN A  1  256  ? 231.339 230.013 133.450 1.00   233.63 ? 426  GLN A O   1 
ATOM   1908  C  CB  . GLN A  1  256  ? 228.344 229.613 132.537 1.00   192.27 ? 426  GLN A CB  1 
ATOM   1909  C  CG  . GLN A  1  256  ? 227.374 229.080 133.569 1.00   209.81 ? 426  GLN A CG  1 
ATOM   1910  C  CD  . GLN A  1  256  ? 226.479 227.976 133.014 1.00   229.35 ? 426  GLN A CD  1 
ATOM   1911  O  OE1 . GLN A  1  256  ? 226.824 227.330 132.025 1.00   235.98 ? 426  GLN A OE1 1 
ATOM   1912  N  NE2 . GLN A  1  256  ? 225.328 227.750 133.656 1.00   238.87 ? 426  GLN A NE2 1 
ATOM   1913  N  N   . ALA A  1  257  ? 230.068 230.684 135.188 1.00   180.28 ? 427  ALA A N   1 
ATOM   1914  C  CA  . ALA A  1  257  ? 231.145 230.545 136.170 1.00   174.61 ? 427  ALA A CA  1 
ATOM   1915  C  C   . ALA A  1  257  ? 231.523 229.071 136.314 1.00   186.15 ? 427  ALA A C   1 
ATOM   1916  O  O   . ALA A  1  257  ? 230.645 228.188 136.318 1.00   179.55 ? 427  ALA A O   1 
ATOM   1917  C  CB  . ALA A  1  257  ? 230.731 231.124 137.509 1.00   157.12 ? 427  ALA A CB  1 
ATOM   1918  N  N   . SER A  1  258  ? 232.833 228.811 136.387 1.00   198.57 ? 428  SER A N   1 
ATOM   1919  C  CA  . SER A  1  258  ? 233.368 227.448 136.570 1.00   207.83 ? 428  SER A CA  1 
ATOM   1920  C  C   . SER A  1  258  ? 232.693 226.817 137.772 1.00   189.61 ? 428  SER A C   1 
ATOM   1921  O  O   . SER A  1  258  ? 231.983 225.804 137.674 1.00   190.60 ? 428  SER A O   1 
ATOM   1922  C  CB  . SER A  1  258  ? 234.903 227.444 136.821 1.00   200.52 ? 428  SER A CB  1 
ATOM   1923  O  OG  . SER A  1  258  ? 235.675 227.745 135.666 1.00   219.76 ? 428  SER A OG  1 
ATOM   1924  N  N   . LYS A  1  259  ? 232.897 227.476 138.897 1.00   173.53 ? 429  LYS A N   1 
ATOM   1925  C  CA  . LYS A  1  259  ? 232.535 226.936 140.180 1.00   173.12 ? 429  LYS A CA  1 
ATOM   1926  C  C   . LYS A  1  259  ? 232.742 228.024 141.186 1.00   144.95 ? 429  LYS A C   1 
ATOM   1927  O  O   . LYS A  1  259  ? 233.766 228.682 141.183 1.00   143.04 ? 429  LYS A O   1 
ATOM   1928  C  CB  . LYS A  1  259  ? 233.395 225.712 140.514 1.00   189.96 ? 429  LYS A CB  1 
ATOM   1929  C  CG  . LYS A  1  259  ? 234.879 225.784 140.151 1.00   169.90 ? 429  LYS A CG  1 
ATOM   1930  C  CD  . LYS A  1  259  ? 235.735 226.014 141.374 1.00   177.23 ? 429  LYS A CD  1 
ATOM   1931  C  CE  . LYS A  1  259  ? 235.786 224.797 142.281 1.00   207.10 ? 429  LYS A CE  1 
ATOM   1932  N  NZ  . LYS A  1  259  ? 236.560 225.076 143.527 1.00   252.28 ? 429  LYS A NZ  1 
ATOM   1933  N  N   . VAL A  1  260  ? 231.750 228.247 142.023 1.00   148.05 ? 430  VAL A N   1 
ATOM   1934  C  CA  . VAL A  1  260  ? 231.754 229.422 142.873 1.00   154.65 ? 430  VAL A CA  1 
ATOM   1935  C  C   . VAL A  1  260  ? 231.537 229.011 144.294 1.00   146.82 ? 430  VAL A C   1 
ATOM   1936  O  O   . VAL A  1  260  ? 230.843 228.046 144.561 1.00   186.47 ? 430  VAL A O   1 
ATOM   1937  C  CB  . VAL A  1  260  ? 230.703 230.490 142.441 1.00   163.57 ? 430  VAL A CB  1 
ATOM   1938  C  CG1 . VAL A  1  260  ? 230.586 230.554 140.921 1.00   176.61 ? 430  VAL A CG1 1 
ATOM   1939  C  CG2 . VAL A  1  260  ? 229.334 230.233 143.052 1.00   151.87 ? 430  VAL A CG2 1 
ATOM   1940  N  N   . PHE A  1  261  ? 232.104 229.769 145.205 1.00   133.07 ? 431  PHE A N   1 
ATOM   1941  C  CA  . PHE A  1  261  ? 232.065 229.363 146.563 1.00   130.16 ? 431  PHE A CA  1 
ATOM   1942  C  C   . PHE A  1  261  ? 232.139 230.488 147.506 1.00   130.04 ? 431  PHE A C   1 
ATOM   1943  O  O   . PHE A  1  261  ? 232.914 231.396 147.308 1.00   161.77 ? 431  PHE A O   1 
ATOM   1944  C  CB  . PHE A  1  261  ? 233.213 228.441 146.821 1.00   128.59 ? 431  PHE A CB  1 
ATOM   1945  C  CG  . PHE A  1  261  ? 234.487 228.897 146.231 1.00   131.36 ? 431  PHE A CG  1 
ATOM   1946  C  CD1 . PHE A  1  261  ? 235.244 229.844 146.880 1.00   125.80 ? 431  PHE A CD1 1 
ATOM   1947  C  CD2 . PHE A  1  261  ? 234.965 228.344 145.054 1.00   149.57 ? 431  PHE A CD2 1 
ATOM   1948  C  CE1 . PHE A  1  261  ? 236.464 230.251 146.388 1.00   143.47 ? 431  PHE A CE1 1 
ATOM   1949  C  CE2 . PHE A  1  261  ? 236.193 228.755 144.542 1.00   179.92 ? 431  PHE A CE2 1 
ATOM   1950  C  CZ  . PHE A  1  261  ? 236.946 229.711 145.209 1.00   157.79 ? 431  PHE A CZ  1 
ATOM   1951  N  N   . ILE A  1  262  ? 231.342 230.404 148.555 1.00   141.05 ? 432  ILE A N   1 
ATOM   1952  C  CA  . ILE A  1  262  ? 231.436 231.340 149.651 1.00   159.52 ? 432  ILE A CA  1 
ATOM   1953  C  C   . ILE A  1  262  ? 232.613 230.983 150.562 1.00   162.02 ? 432  ILE A C   1 
ATOM   1954  O  O   . ILE A  1  262  ? 232.871 229.812 150.809 1.00   189.64 ? 432  ILE A O   1 
ATOM   1955  C  CB  . ILE A  1  262  ? 230.112 231.420 150.423 1.00   187.18 ? 432  ILE A CB  1 
ATOM   1956  C  CG1 . ILE A  1  262  ? 229.079 232.067 149.487 1.00   209.44 ? 432  ILE A CG1 1 
ATOM   1957  C  CG2 . ILE A  1  262  ? 230.294 232.175 151.749 1.00   190.94 ? 432  ILE A CG2 1 
ATOM   1958  C  CD1 . ILE A  1  262  ? 227.692 232.257 150.060 1.00   243.27 ? 432  ILE A CD1 1 
ATOM   1959  N  N   . THR A  1  263  ? 233.329 232.013 151.024 1.00   152.89 ? 433  THR A N   1 
ATOM   1960  C  CA  . THR A  1  263  ? 234.558 231.873 151.826 1.00   163.27 ? 433  THR A CA  1 
ATOM   1961  C  C   . THR A  1  263  ? 234.693 233.004 152.800 1.00   176.56 ? 433  THR A C   1 
ATOM   1962  O  O   . THR A  1  263  ? 234.093 234.052 152.630 1.00   221.18 ? 433  THR A O   1 
ATOM   1963  C  CB  . THR A  1  263  ? 235.869 231.974 150.991 1.00   184.32 ? 433  THR A CB  1 
ATOM   1964  O  OG1 . THR A  1  263  ? 236.307 233.345 150.863 1.00   182.09 ? 433  THR A OG1 1 
ATOM   1965  C  CG2 . THR A  1  263  ? 235.695 231.381 149.638 1.00   186.04 ? 433  THR A CG2 1 
ATOM   1966  N  N   . SER A  1  264  ? 235.568 232.834 153.772 1.00   181.33 ? 434  SER A N   1 
ATOM   1967  C  CA  . SER A  1  264  ? 235.854 233.908 154.704 1.00   187.29 ? 434  SER A CA  1 
ATOM   1968  C  C   . SER A  1  264  ? 237.341 234.246 154.742 1.00   197.68 ? 434  SER A C   1 
ATOM   1969  O  O   . SER A  1  264  ? 238.167 233.362 154.637 1.00   263.78 ? 434  SER A O   1 
ATOM   1970  C  CB  . SER A  1  264  ? 235.373 233.508 156.094 1.00   211.08 ? 434  SER A CB  1 
ATOM   1971  O  OG  . SER A  1  264  ? 235.338 234.629 156.950 1.00   262.61 ? 434  SER A OG  1 
ATOM   1972  N  N   . ASP A  1  265  ? 237.679 235.523 154.892 1.00   191.50 ? 435  ASP A N   1 
ATOM   1973  C  CA  . ASP A  1  265  ? 239.067 235.939 155.161 1.00   198.24 ? 435  ASP A CA  1 
ATOM   1974  C  C   . ASP A  1  265  ? 239.401 235.696 156.635 1.00   205.17 ? 435  ASP A C   1 
ATOM   1975  O  O   . ASP A  1  265  ? 238.559 235.195 157.390 1.00   222.62 ? 435  ASP A O   1 
ATOM   1976  C  CB  . ASP A  1  265  ? 239.319 237.403 154.719 1.00   258.08 ? 435  ASP A CB  1 
ATOM   1977  C  CG  . ASP A  1  265  ? 238.280 238.369 155.246 1.00   292.18 ? 435  ASP A CG  1 
ATOM   1978  O  OD1 . ASP A  1  265  ? 237.303 237.879 155.837 1.00   332.07 ? 435  ASP A OD1 1 
ATOM   1979  O  OD2 . ASP A  1  265  ? 238.419 239.600 155.044 1.00   306.53 ? 435  ASP A OD2 1 
ATOM   1980  N  N   . LEU A  1  266  ? 240.604 236.079 157.066 1.00   210.73 ? 436  LEU A N   1 
ATOM   1981  C  CA  . LEU A  1  266  ? 241.142 235.630 158.343 1.00   214.07 ? 436  LEU A CA  1 
ATOM   1982  C  C   . LEU A  1  266  ? 240.491 236.446 159.435 1.00   236.15 ? 436  LEU A C   1 
ATOM   1983  O  O   . LEU A  1  266  ? 240.046 235.892 160.450 1.00   257.91 ? 436  LEU A O   1 
ATOM   1984  C  CB  . LEU A  1  266  ? 242.654 235.772 158.390 1.00   185.49 ? 436  LEU A CB  1 
ATOM   1985  C  CG  . LEU A  1  266  ? 243.423 234.691 157.627 1.00   202.33 ? 436  LEU A CG  1 
ATOM   1986  C  CD1 . LEU A  1  266  ? 244.893 235.079 157.490 1.00   231.06 ? 436  LEU A CD1 1 
ATOM   1987  C  CD2 . LEU A  1  266  ? 243.293 233.333 158.302 1.00   212.33 ? 436  LEU A CD2 1 
ATOM   1988  N  N   . CYS A  1  267  ? 240.443 237.761 159.211 1.00   233.64 ? 437  CYS A N   1 
ATOM   1989  C  CA  . CYS A  1  267  ? 239.544 238.648 159.950 1.00   243.10 ? 437  CYS A CA  1 
ATOM   1990  C  C   . CYS A  1  267  ? 238.143 238.318 159.487 1.00   246.87 ? 437  CYS A C   1 
ATOM   1991  O  O   . CYS A  1  267  ? 237.983 237.813 158.385 1.00   287.42 ? 437  CYS A O   1 
ATOM   1992  C  CB  . CYS A  1  267  ? 239.851 240.115 159.652 1.00   246.80 ? 437  CYS A CB  1 
ATOM   1993  S  SG  . CYS A  1  267  ? 239.896 240.481 157.882 1.00   287.21 ? 437  CYS A SG  1 
ATOM   1994  N  N   . GLY A  1  268  ? 237.136 238.576 160.312 1.00   234.83 ? 438  GLY A N   1 
ATOM   1995  C  CA  . GLY A  1  268  ? 235.764 238.206 159.965 1.00   220.90 ? 438  GLY A CA  1 
ATOM   1996  C  C   . GLY A  1  268  ? 235.216 238.963 158.761 1.00   221.62 ? 438  GLY A C   1 
ATOM   1997  O  O   . GLY A  1  268  ? 234.951 240.158 158.839 1.00   248.58 ? 438  GLY A O   1 
ATOM   1998  N  N   . GLN A  1  269  ? 235.086 238.272 157.632 1.00   208.37 ? 439  GLN A N   1 
ATOM   1999  C  CA  . GLN A  1  269  ? 234.425 238.816 156.437 1.00   196.90 ? 439  GLN A CA  1 
ATOM   2000  C  C   . GLN A  1  269  ? 234.028 237.646 155.558 1.00   195.96 ? 439  GLN A C   1 
ATOM   2001  O  O   . GLN A  1  269  ? 234.546 236.552 155.712 1.00   220.94 ? 439  GLN A O   1 
ATOM   2002  C  CB  . GLN A  1  269  ? 235.355 239.770 155.673 1.00   191.79 ? 439  GLN A CB  1 
ATOM   2003  C  CG  . GLN A  1  269  ? 234.825 241.161 155.503 1.00   218.97 ? 439  GLN A CG  1 
ATOM   2004  C  CD  . GLN A  1  269  ? 233.533 241.170 154.744 1.00   223.97 ? 439  GLN A CD  1 
ATOM   2005  O  OE1 . GLN A  1  269  ? 232.455 241.258 155.338 1.00   230.94 ? 439  GLN A OE1 1 
ATOM   2006  N  NE2 . GLN A  1  269  ? 233.624 241.000 153.438 1.00   230.99 ? 439  GLN A NE2 1 
ATOM   2007  N  N   . LYS A  1  270  ? 233.087 237.855 154.658 1.00   172.91 ? 440  LYS A N   1 
ATOM   2008  C  CA  . LYS A  1  270  ? 232.705 236.805 153.740 1.00   167.68 ? 440  LYS A CA  1 
ATOM   2009  C  C   . LYS A  1  270  ? 232.883 237.285 152.319 1.00   169.73 ? 440  LYS A C   1 
ATOM   2010  O  O   . LYS A  1  270  ? 232.578 238.418 151.996 1.00   215.18 ? 440  LYS A O   1 
ATOM   2011  C  CB  . LYS A  1  270  ? 231.266 236.356 153.994 1.00   172.44 ? 440  LYS A CB  1 
ATOM   2012  C  CG  . LYS A  1  270  ? 231.118 235.458 155.221 1.00   183.01 ? 440  LYS A CG  1 
ATOM   2013  C  CD  . LYS A  1  270  ? 229.796 235.691 155.947 1.00   211.91 ? 440  LYS A CD  1 
ATOM   2014  C  CE  . LYS A  1  270  ? 229.900 236.749 157.051 1.00   244.28 ? 440  LYS A CE  1 
ATOM   2015  N  NZ  . LYS A  1  270  ? 228.586 237.325 157.473 1.00   275.94 ? 440  LYS A NZ  1 
ATOM   2016  N  N   . PHE A  1  271  ? 233.405 236.399 151.484 1.00   176.88 ? 441  PHE A N   1 
ATOM   2017  C  CA  . PHE A  1  271  ? 233.535 236.605 150.047 1.00   155.76 ? 441  PHE A CA  1 
ATOM   2018  C  C   . PHE A  1  271  ? 232.734 235.560 149.283 1.00   141.35 ? 441  PHE A C   1 
ATOM   2019  O  O   . PHE A  1  271  ? 232.378 234.509 149.797 1.00   145.71 ? 441  PHE A O   1 
ATOM   2020  C  CB  . PHE A  1  271  ? 235.007 236.553 149.636 1.00   154.97 ? 441  PHE A CB  1 
ATOM   2021  C  CG  . PHE A  1  271  ? 235.754 237.735 150.098 1.00   163.71 ? 441  PHE A CG  1 
ATOM   2022  C  CD1 . PHE A  1  271  ? 236.046 237.895 151.444 1.00   186.15 ? 441  PHE A CD1 1 
ATOM   2023  C  CD2 . PHE A  1  271  ? 236.068 238.743 149.225 1.00   193.39 ? 441  PHE A CD2 1 
ATOM   2024  C  CE1 . PHE A  1  271  ? 236.696 239.026 151.905 1.00   219.81 ? 441  PHE A CE1 1 
ATOM   2025  C  CE2 . PHE A  1  271  ? 236.719 239.882 149.670 1.00   232.46 ? 441  PHE A CE2 1 
ATOM   2026  C  CZ  . PHE A  1  271  ? 237.037 240.025 151.011 1.00   238.10 ? 441  PHE A CZ  1 
ATOM   2027  N  N   . LEU A  1  272  ? 232.461 235.860 148.036 1.00   143.79 ? 442  LEU A N   1 
ATOM   2028  C  CA  . LEU A  1  272  ? 231.714 234.981 147.164 1.00   140.39 ? 442  LEU A CA  1 
ATOM   2029  C  C   . LEU A  1  272  ? 232.499 235.026 145.853 1.00   153.84 ? 442  LEU A C   1 
ATOM   2030  O  O   . LEU A  1  272  ? 232.763 236.100 145.309 1.00   186.17 ? 442  LEU A O   1 
ATOM   2031  C  CB  . LEU A  1  272  ? 230.287 235.499 147.081 1.00   130.56 ? 442  LEU A CB  1 
ATOM   2032  C  CG  . LEU A  1  272  ? 229.327 235.004 146.027 1.00   146.29 ? 442  LEU A CG  1 
ATOM   2033  C  CD1 . LEU A  1  272  ? 229.464 233.498 145.848 1.00   172.41 ? 442  LEU A CD1 1 
ATOM   2034  C  CD2 . LEU A  1  272  ? 227.913 235.374 146.457 1.00   153.59 ? 442  LEU A CD2 1 
ATOM   2035  N  N   . CYS A  1  273  ? 232.959 233.870 145.395 1.00   158.49 ? 443  CYS A N   1 
ATOM   2036  C  CA  . CYS A  1  273  ? 234.039 233.807 144.404 1.00   163.54 ? 443  CYS A CA  1 
ATOM   2037  C  C   . CYS A  1  273  ? 233.597 233.106 143.164 1.00   164.68 ? 443  CYS A C   1 
ATOM   2038  O  O   . CYS A  1  273  ? 233.463 231.901 143.201 1.00   190.55 ? 443  CYS A O   1 
ATOM   2039  C  CB  . CYS A  1  273  ? 235.228 233.078 145.003 1.00   146.95 ? 443  CYS A CB  1 
ATOM   2040  S  SG  . CYS A  1  273  ? 235.924 234.002 146.386 1.00   199.61 ? 443  CYS A SG  1 
ATOM   2041  N  N   . PHE A  1  274  ? 233.374 233.838 142.070 1.00   177.86 ? 444  PHE A N   1 
ATOM   2042  C  CA  . PHE A  1  274  ? 233.055 233.179 140.801 1.00   163.22 ? 444  PHE A CA  1 
ATOM   2043  C  C   . PHE A  1  274  ? 234.360 232.986 140.140 1.00   150.62 ? 444  PHE A C   1 
ATOM   2044  O  O   . PHE A  1  274  ? 235.054 233.947 139.873 1.00   197.10 ? 444  PHE A O   1 
ATOM   2045  C  CB  . PHE A  1  274  ? 232.137 233.963 139.850 1.00   169.90 ? 444  PHE A CB  1 
ATOM   2046  C  CG  . PHE A  1  274  ? 231.190 234.835 140.541 1.00   157.87 ? 444  PHE A CG  1 
ATOM   2047  C  CD1 . PHE A  1  274  ? 230.509 234.358 141.645 1.00   177.42 ? 444  PHE A CD1 1 
ATOM   2048  C  CD2 . PHE A  1  274  ? 231.016 236.130 140.132 1.00   160.48 ? 444  PHE A CD2 1 
ATOM   2049  C  CE1 . PHE A  1  274  ? 229.660 235.170 142.343 1.00   211.41 ? 444  PHE A CE1 1 
ATOM   2050  C  CE2 . PHE A  1  274  ? 230.150 236.957 140.808 1.00   213.69 ? 444  PHE A CE2 1 
ATOM   2051  C  CZ  . PHE A  1  274  ? 229.472 236.476 141.921 1.00   238.52 ? 444  PHE A CZ  1 
ATOM   2052  N  N   . LEU A  1  275  ? 234.711 231.753 139.892 1.00   129.89 ? 445  LEU A N   1 
ATOM   2053  C  CA  . LEU A  1  275  ? 235.804 231.492 139.002 1.00   152.96 ? 445  LEU A CA  1 
ATOM   2054  C  C   . LEU A  1  275  ? 235.264 231.446 137.548 1.00   171.30 ? 445  LEU A C   1 
ATOM   2055  O  O   . LEU A  1  275  ? 234.273 230.763 137.267 1.00   202.93 ? 445  LEU A O   1 
ATOM   2056  C  CB  . LEU A  1  275  ? 236.447 230.211 139.455 1.00   154.86 ? 445  LEU A CB  1 
ATOM   2057  C  CG  . LEU A  1  275  ? 237.651 229.747 138.679 1.00   175.41 ? 445  LEU A CG  1 
ATOM   2058  C  CD1 . LEU A  1  275  ? 238.811 230.720 138.835 1.00   174.87 ? 445  LEU A CD1 1 
ATOM   2059  C  CD2 . LEU A  1  275  ? 237.985 228.350 139.180 1.00   190.46 ? 445  LEU A CD2 1 
ATOM   2060  N  N   . VAL A  1  276  ? 235.883 232.185 136.633 1.00   171.82 ? 446  VAL A N   1 
ATOM   2061  C  CA  . VAL A  1  276  ? 235.397 232.237 135.261 1.00   181.18 ? 446  VAL A CA  1 
ATOM   2062  C  C   . VAL A  1  276  ? 236.535 231.807 134.331 1.00   210.86 ? 446  VAL A C   1 
ATOM   2063  O  O   . VAL A  1  276  ? 237.571 232.474 134.225 1.00   235.32 ? 446  VAL A O   1 
ATOM   2064  C  CB  . VAL A  1  276  ? 234.848 233.638 134.899 1.00   184.79 ? 446  VAL A CB  1 
ATOM   2065  C  CG1 . VAL A  1  276  ? 234.001 233.563 133.635 1.00   212.54 ? 446  VAL A CG1 1 
ATOM   2066  C  CG2 . VAL A  1  276  ? 234.014 234.216 136.036 1.00   155.84 ? 446  VAL A CG2 1 
ATOM   2067  N  N   . GLU A  1  277  ? 236.338 230.677 133.656 1.00   215.31 ? 447  GLU A N   1 
ATOM   2068  C  CA  . GLU A  1  277  ? 237.358 230.133 132.744 1.00   228.76 ? 447  GLU A CA  1 
ATOM   2069  C  C   . GLU A  1  277  ? 237.600 230.986 131.479 1.00   235.11 ? 447  GLU A C   1 
ATOM   2070  O  O   . GLU A  1  277  ? 238.736 231.084 131.011 1.00   194.53 ? 447  GLU A O   1 
ATOM   2071  C  CB  . GLU A  1  277  ? 236.997 228.692 132.343 1.00   209.79 ? 447  GLU A CB  1 
ATOM   2072  N  N   . SER A  1  278  ? 236.533 231.552 130.909 1.00   255.44 ? 448  SER A N   1 
ATOM   2073  C  CA  . SER A  1  278  ? 236.637 232.501 129.774 1.00   262.67 ? 448  SER A CA  1 
ATOM   2074  C  C   . SER A  1  278  ? 237.580 233.660 130.123 1.00   252.05 ? 448  SER A C   1 
ATOM   2075  O  O   . SER A  1  278  ? 238.539 233.944 129.397 1.00   229.55 ? 448  SER A O   1 
ATOM   2076  C  CB  . SER A  1  278  ? 235.247 233.059 129.398 1.00   275.53 ? 448  SER A CB  1 
ATOM   2077  O  OG  . SER A  1  278  ? 235.307 234.261 128.626 1.00   252.46 ? 448  SER A OG  1 
ATOM   2078  N  N   . GLN A  1  279  ? 237.313 234.287 131.263 1.00   245.87 ? 449  GLN A N   1 
ATOM   2079  C  CA  . GLN A  1  279  ? 238.045 235.476 131.692 1.00   232.14 ? 449  GLN A CA  1 
ATOM   2080  C  C   . GLN A  1  279  ? 239.406 235.057 132.248 1.00   221.14 ? 449  GLN A C   1 
ATOM   2081  O  O   . GLN A  1  279  ? 240.382 235.791 132.141 1.00   188.53 ? 449  GLN A O   1 
ATOM   2082  C  CB  . GLN A  1  279  ? 237.235 236.245 132.751 1.00   243.05 ? 449  GLN A CB  1 
ATOM   2083  C  CG  . GLN A  1  279  ? 237.118 237.742 132.488 1.00   272.06 ? 449  GLN A CG  1 
ATOM   2084  C  CD  . GLN A  1  279  ? 236.059 238.080 131.438 1.00   289.87 ? 449  GLN A CD  1 
ATOM   2085  O  OE1 . GLN A  1  279  ? 235.970 237.430 130.396 1.00   280.67 ? 449  GLN A OE1 1 
ATOM   2086  N  NE2 . GLN A  1  279  ? 235.255 239.105 131.713 1.00   310.50 ? 449  GLN A NE2 1 
ATOM   2087  N  N   . LEU A  1  280  ? 239.446 233.857 132.829 1.00   224.55 ? 450  LEU A N   1 
ATOM   2088  C  CA  . LEU A  1  280  ? 240.620 233.291 133.484 1.00   215.74 ? 450  LEU A CA  1 
ATOM   2089  C  C   . LEU A  1  280  ? 240.954 234.016 134.794 1.00   193.82 ? 450  LEU A C   1 
ATOM   2090  O  O   . LEU A  1  280  ? 242.078 233.960 135.270 1.00   184.02 ? 450  LEU A O   1 
ATOM   2091  C  CB  . LEU A  1  280  ? 241.823 233.254 132.508 1.00   232.21 ? 450  LEU A CB  1 
ATOM   2092  C  CG  . LEU A  1  280  ? 242.798 232.058 132.485 1.00   243.91 ? 450  LEU A CG  1 
ATOM   2093  C  CD1 . LEU A  1  280  ? 243.836 232.134 133.599 1.00   253.08 ? 450  LEU A CD1 1 
ATOM   2094  C  CD2 . LEU A  1  280  ? 242.079 230.707 132.488 1.00   231.82 ? 450  LEU A CD2 1 
ATOM   2095  N  N   . GLN A  1  281  ? 239.985 234.709 135.373 1.00   193.89 ? 451  GLN A N   1 
ATOM   2096  C  CA  . GLN A  1  281  ? 240.176 235.331 136.686 1.00   209.15 ? 451  GLN A CA  1 
ATOM   2097  C  C   . GLN A  1  281  ? 238.939 235.117 137.499 1.00   196.32 ? 451  GLN A C   1 
ATOM   2098  O  O   . GLN A  1  281  ? 237.873 234.871 136.930 1.00   189.55 ? 451  GLN A O   1 
ATOM   2099  C  CB  . GLN A  1  281  ? 240.507 236.821 136.556 1.00   219.52 ? 451  GLN A CB  1 
ATOM   2100  C  CG  . GLN A  1  281  ? 239.430 237.703 135.927 1.00   215.46 ? 451  GLN A CG  1 
ATOM   2101  C  CD  . GLN A  1  281  ? 239.988 239.007 135.359 1.00   233.07 ? 451  GLN A CD  1 
ATOM   2102  O  OE1 . GLN A  1  281  ? 241.207 239.230 135.322 1.00   227.23 ? 451  GLN A OE1 1 
ATOM   2103  N  NE2 . GLN A  1  281  ? 239.098 239.870 134.892 1.00   235.99 ? 451  GLN A NE2 1 
ATOM   2104  N  N   . LEU A  1  282  ? 239.068 235.215 138.828 1.00   174.22 ? 452  LEU A N   1 
ATOM   2105  C  CA  . LEU A  1  282  ? 237.882 235.086 139.681 1.00   155.99 ? 452  LEU A CA  1 
ATOM   2106  C  C   . LEU A  1  282  ? 237.417 236.356 140.372 1.00   157.70 ? 452  LEU A C   1 
ATOM   2107  O  O   . LEU A  1  282  ? 238.214 237.094 140.930 1.00   187.38 ? 452  LEU A O   1 
ATOM   2108  C  CB  . LEU A  1  282  ? 237.969 233.922 140.657 1.00   147.67 ? 452  LEU A CB  1 
ATOM   2109  C  CG  . LEU A  1  282  ? 238.677 233.993 141.991 1.00   161.94 ? 452  LEU A CG  1 
ATOM   2110  C  CD1 . LEU A  1  282  ? 238.158 232.847 142.854 1.00   160.62 ? 452  LEU A CD1 1 
ATOM   2111  C  CD2 . LEU A  1  282  ? 240.187 233.900 141.789 1.00   179.97 ? 452  LEU A CD2 1 
ATOM   2112  N  N   . ARG A  1  283  ? 236.108 236.616 140.264 1.00   170.10 ? 453  ARG A N   1 
ATOM   2113  C  CA  . ARG A  1  283  ? 235.486 237.766 140.885 1.00   183.18 ? 453  ARG A CA  1 
ATOM   2114  C  C   . ARG A  1  283  ? 235.390 237.408 142.327 1.00   185.82 ? 453  ARG A C   1 
ATOM   2115  O  O   . ARG A  1  283  ? 234.968 236.317 142.664 1.00   202.71 ? 453  ARG A O   1 
ATOM   2116  C  CB  . ARG A  1  283  ? 234.073 238.054 140.355 1.00   184.38 ? 453  ARG A CB  1 
ATOM   2117  C  CG  . ARG A  1  283  ? 234.006 238.846 139.056 1.00   206.56 ? 453  ARG A CG  1 
ATOM   2118  C  CD  . ARG A  1  283  ? 233.678 237.962 137.857 1.00   220.69 ? 453  ARG A CD  1 
ATOM   2119  N  NE  . ARG A  1  283  ? 233.721 238.708 136.602 1.00   222.35 ? 453  ARG A NE  1 
ATOM   2120  C  CZ  . ARG A  1  283  ? 234.836 239.094 135.975 1.00   234.44 ? 453  ARG A CZ  1 
ATOM   2121  N  NH1 . ARG A  1  283  ? 234.733 239.773 134.832 1.00   246.95 ? 453  ARG A NH1 1 
ATOM   2122  N  NH2 . ARG A  1  283  ? 236.053 238.813 136.464 1.00   230.19 ? 453  ARG A NH2 1 
ATOM   2123  N  N   . CYS A  1  284  ? 235.832 238.318 143.174 1.00   191.09 ? 454  CYS A N   1 
ATOM   2124  C  CA  . CYS A  1  284  ? 235.536 238.245 144.580 1.00   179.16 ? 454  CYS A CA  1 
ATOM   2125  C  C   . CYS A  1  284  ? 234.607 239.395 144.913 1.00   178.34 ? 454  CYS A C   1 
ATOM   2126  O  O   . CYS A  1  284  ? 234.886 240.549 144.603 1.00   195.34 ? 454  CYS A O   1 
ATOM   2127  C  CB  . CYS A  1  284  ? 236.815 238.299 145.380 1.00   194.47 ? 454  CYS A CB  1 
ATOM   2128  S  SG  . CYS A  1  284  ? 237.641 236.704 145.351 1.00   245.76 ? 454  CYS A SG  1 
ATOM   2129  N  N   . VAL A  1  285  ? 233.491 239.037 145.529 1.00   166.15 ? 455  VAL A N   1 
ATOM   2130  C  CA  . VAL A  1  285  ? 232.434 239.962 145.953 1.00   160.67 ? 455  VAL A CA  1 
ATOM   2131  C  C   . VAL A  1  285  ? 232.224 239.729 147.460 1.00   173.12 ? 455  VAL A C   1 
ATOM   2132  O  O   . VAL A  1  285  ? 232.290 238.596 147.929 1.00   221.40 ? 455  VAL A O   1 
ATOM   2133  C  CB  . VAL A  1  285  ? 231.157 239.805 145.053 1.00   161.92 ? 455  VAL A CB  1 
ATOM   2134  C  CG1 . VAL A  1  285  ? 230.964 238.376 144.570 1.00   168.29 ? 455  VAL A CG1 1 
ATOM   2135  C  CG2 . VAL A  1  285  ? 229.872 240.290 145.731 1.00   167.45 ? 455  VAL A CG2 1 
ATOM   2136  N  N   . LYS A  1  286  ? 231.985 240.804 148.199 1.00   170.65 ? 456  LYS A N   1 
ATOM   2137  C  CA  . LYS A  1  286  ? 232.133 240.829 149.640 1.00   175.00 ? 456  LYS A CA  1 
ATOM   2138  C  C   . LYS A  1  286  ? 230.778 241.167 150.284 1.00   178.24 ? 456  LYS A C   1 
ATOM   2139  O  O   . LYS A  1  286  ? 230.202 242.219 150.003 1.00   252.08 ? 456  LYS A O   1 
ATOM   2140  C  CB  . LYS A  1  286  ? 233.293 241.805 149.947 1.00   173.78 ? 456  LYS A CB  1 
ATOM   2141  C  CG  . LYS A  1  286  ? 233.051 242.915 150.947 1.00   197.67 ? 456  LYS A CG  1 
ATOM   2142  C  CD  . LYS A  1  286  ? 234.365 243.439 151.515 1.00   227.33 ? 456  LYS A CD  1 
ATOM   2143  C  CE  . LYS A  1  286  ? 234.153 244.119 152.870 1.00   250.89 ? 456  LYS A CE  1 
ATOM   2144  N  NZ  . LYS A  1  286  ? 235.336 244.103 153.781 1.00   250.12 ? 456  LYS A NZ  1 
ATOM   2145  N  N   . PHE A  1  287  ? 230.251 240.270 151.115 1.00   159.96 ? 457  PHE A N   1 
ATOM   2146  C  CA  . PHE A  1  287  ? 228.892 240.432 151.695 1.00   186.02 ? 457  PHE A CA  1 
ATOM   2147  C  C   . PHE A  1  287  ? 228.760 240.072 153.182 1.00   200.40 ? 457  PHE A C   1 
ATOM   2148  O  O   . PHE A  1  287  ? 229.475 239.200 153.676 1.00   244.97 ? 457  PHE A O   1 
ATOM   2149  C  CB  . PHE A  1  287  ? 227.930 239.580 150.871 1.00   189.50 ? 457  PHE A CB  1 
ATOM   2150  C  CG  . PHE A  1  287  ? 228.093 238.123 151.101 1.00   176.46 ? 457  PHE A CG  1 
ATOM   2151  C  CD1 . PHE A  1  287  ? 229.027 237.399 150.377 1.00   180.07 ? 457  PHE A CD1 1 
ATOM   2152  C  CD2 . PHE A  1  287  ? 227.338 237.484 152.082 1.00   150.63 ? 457  PHE A CD2 1 
ATOM   2153  C  CE1 . PHE A  1  287  ? 229.195 236.047 150.625 1.00   190.51 ? 457  PHE A CE1 1 
ATOM   2154  C  CE2 . PHE A  1  287  ? 227.510 236.139 152.333 1.00   168.15 ? 457  PHE A CE2 1 
ATOM   2155  C  CZ  . PHE A  1  287  ? 228.438 235.418 151.605 1.00   187.21 ? 457  PHE A CZ  1 
ATOM   2156  N  N   . GLN A  1  288  ? 227.824 240.723 153.878 1.00   195.24 ? 458  GLN A N   1 
ATOM   2157  C  CA  . GLN A  1  288  ? 227.581 240.469 155.302 1.00   197.43 ? 458  GLN A CA  1 
ATOM   2158  C  C   . GLN A  1  288  ? 226.099 240.634 155.649 1.00   214.76 ? 458  GLN A C   1 
ATOM   2159  O  O   . GLN A  1  288  ? 225.389 241.331 154.927 1.00   208.84 ? 458  GLN A O   1 
ATOM   2160  C  CB  . GLN A  1  288  ? 228.444 241.398 156.165 1.00   198.37 ? 458  GLN A CB  1 
ATOM   2161  C  CG  . GLN A  1  288  ? 228.225 242.890 155.930 1.00   210.62 ? 458  GLN A CG  1 
ATOM   2162  C  CD  . GLN A  1  288  ? 229.106 243.464 154.836 1.00   238.00 ? 458  GLN A CD  1 
ATOM   2163  O  OE1 . GLN A  1  288  ? 229.301 242.855 153.783 1.00   235.81 ? 458  GLN A OE1 1 
ATOM   2164  N  NE2 . GLN A  1  288  ? 229.648 244.653 155.087 1.00   254.53 ? 458  GLN A NE2 1 
ATOM   2165  N  N   . GLU A  1  289  ? 225.645 240.000 156.749 1.00   234.75 ? 459  GLU A N   1 
ATOM   2166  C  CA  . GLU A  1  289  ? 224.241 240.126 157.241 1.00   257.09 ? 459  GLU A CA  1 
ATOM   2167  C  C   . GLU A  1  289  ? 223.905 241.526 157.796 1.00   285.56 ? 459  GLU A C   1 
ATOM   2168  O  O   . GLU A  1  289  ? 224.810 242.281 158.161 1.00   297.90 ? 459  GLU A O   1 
ATOM   2169  C  CB  . GLU A  1  289  ? 223.908 239.071 158.327 1.00   270.35 ? 459  GLU A CB  1 
ATOM   2170  C  CG  . GLU A  1  289  ? 224.586 239.265 159.707 1.00   299.28 ? 459  GLU A CG  1 
ATOM   2171  C  CD  . GLU A  1  289  ? 223.650 239.224 160.944 1.00   309.63 ? 459  GLU A CD  1 
ATOM   2172  O  OE1 . GLU A  1  289  ? 224.167 239.329 162.084 1.00   266.55 ? 459  GLU A OE1 1 
ATOM   2173  O  OE2 . GLU A  1  289  ? 222.409 239.100 160.818 1.00   287.84 ? 459  GLU A OE2 1 
ATOM   2174  N  N   . SER A  1  290  ? 222.605 241.848 157.866 1.00   296.62 ? 460  SER A N   1 
ATOM   2175  C  CA  . SER A  1  290  ? 222.094 243.082 158.515 1.00   276.20 ? 460  SER A CA  1 
ATOM   2176  C  C   . SER A  1  290  ? 221.005 242.780 159.559 1.00   268.62 ? 460  SER A C   1 
ATOM   2177  O  O   . SER A  1  290  ? 221.275 242.253 160.647 1.00   223.36 ? 460  SER A O   1 
ATOM   2178  C  CB  . SER A  1  290  ? 221.553 244.079 157.467 1.00   253.42 ? 460  SER A CB  1 
ATOM   2179  O  OG  . SER A  1  290  ? 220.562 243.506 156.623 1.00   252.12 ? 460  SER A OG  1 
ATOM   2180  N  N   . THR A  1  291  ? 217.117 240.539 158.485 1.00   240.02 ? 464  THR A N   1 
ATOM   2181  C  CA  . THR A  1  291  ? 218.373 240.021 157.926 1.00   275.53 ? 464  THR A CA  1 
ATOM   2182  C  C   . THR A  1  291  ? 218.306 239.776 156.373 1.00   267.38 ? 464  THR A C   1 
ATOM   2183  O  O   . THR A  1  291  ? 217.720 238.798 155.899 1.00   226.05 ? 464  THR A O   1 
ATOM   2184  C  CB  . THR A  1  291  ? 218.900 238.774 158.723 1.00   256.97 ? 464  THR A CB  1 
ATOM   2185  O  OG1 . THR A  1  291  ? 217.995 237.668 158.611 1.00   252.09 ? 464  THR A OG1 1 
ATOM   2186  C  CG2 . THR A  1  291  ? 219.097 239.102 160.216 1.00   212.65 ? 464  THR A CG2 1 
ATOM   2187  N  N   . ALA A  1  292  ? 218.880 240.712 155.607 1.00   270.17 ? 465  ALA A N   1 
ATOM   2188  C  CA  . ALA A  1  292  ? 219.149 240.572 154.165 1.00   255.08 ? 465  ALA A CA  1 
ATOM   2189  C  C   . ALA A  1  292  ? 220.646 240.816 153.929 1.00   255.28 ? 465  ALA A C   1 
ATOM   2190  O  O   . ALA A  1  292  ? 221.366 241.232 154.841 1.00   288.45 ? 465  ALA A O   1 
ATOM   2191  C  CB  . ALA A  1  292  ? 218.309 241.564 153.366 1.00   237.61 ? 465  ALA A CB  1 
ATOM   2192  N  N   . LEU A  1  293  ? 221.120 240.559 152.715 1.00   232.49 ? 466  LEU A N   1 
ATOM   2193  C  CA  . LEU A  1  293  ? 222.561 240.536 152.440 1.00   228.28 ? 466  LEU A CA  1 
ATOM   2194  C  C   . LEU A  1  293  ? 223.017 241.663 151.499 1.00   234.32 ? 466  LEU A C   1 
ATOM   2195  O  O   . LEU A  1  293  ? 222.328 242.000 150.534 1.00   260.01 ? 466  LEU A O   1 
ATOM   2196  C  CB  . LEU A  1  293  ? 222.940 239.167 151.899 1.00   213.34 ? 466  LEU A CB  1 
ATOM   2197  C  CG  . LEU A  1  293  ? 222.973 238.098 152.996 1.00   217.18 ? 466  LEU A CG  1 
ATOM   2198  C  CD1 . LEU A  1  293  ? 221.586 237.731 153.523 1.00   203.58 ? 466  LEU A CD1 1 
ATOM   2199  C  CD2 . LEU A  1  293  ? 223.697 236.867 152.468 1.00   238.99 ? 466  LEU A CD2 1 
ATOM   2200  N  N   . ILE A  1  294  ? 224.199 242.222 151.772 1.00   204.50 ? 467  ILE A N   1 
ATOM   2201  C  CA  . ILE A  1  294  ? 224.622 243.488 151.179 1.00   196.96 ? 467  ILE A CA  1 
ATOM   2202  C  C   . ILE A  1  294  ? 226.013 243.376 150.597 1.00   200.22 ? 467  ILE A C   1 
ATOM   2203  O  O   . ILE A  1  294  ? 226.950 243.198 151.365 1.00   212.81 ? 467  ILE A O   1 
ATOM   2204  C  CB  . ILE A  1  294  ? 224.650 244.592 152.253 1.00   201.80 ? 467  ILE A CB  1 
ATOM   2205  C  CG1 . ILE A  1  294  ? 223.424 244.466 153.167 1.00   222.96 ? 467  ILE A CG1 1 
ATOM   2206  C  CG2 . ILE A  1  294  ? 224.722 245.970 151.592 1.00   217.05 ? 467  ILE A CG2 1 
ATOM   2207  C  CD1 . ILE A  1  294  ? 223.195 245.641 154.090 1.00   255.49 ? 467  ILE A CD1 1 
ATOM   2208  N  N   . PHE A  1  295  ? 226.153 243.532 149.271 1.00   210.51 ? 468  PHE A N   1 
ATOM   2209  C  CA  . PHE A  1  295  ? 227.409 243.232 148.545 1.00   227.22 ? 468  PHE A CA  1 
ATOM   2210  C  C   . PHE A  1  295  ? 228.168 244.487 148.165 1.00   205.28 ? 468  PHE A C   1 
ATOM   2211  O  O   . PHE A  1  295  ? 227.641 245.311 147.442 1.00   197.97 ? 468  PHE A O   1 
ATOM   2212  C  CB  . PHE A  1  295  ? 227.101 242.422 147.280 1.00   229.29 ? 468  PHE A CB  1 
ATOM   2213  C  CG  . PHE A  1  295  ? 226.412 241.117 147.552 1.00   222.16 ? 468  PHE A CG  1 
ATOM   2214  C  CD1 . PHE A  1  295  ? 225.035 241.056 147.689 1.00   199.13 ? 468  PHE A CD1 1 
ATOM   2215  C  CD2 . PHE A  1  295  ? 227.150 239.943 147.700 1.00   230.16 ? 468  PHE A CD2 1 
ATOM   2216  C  CE1 . PHE A  1  295  ? 224.415 239.839 147.967 1.00   221.89 ? 468  PHE A CE1 1 
ATOM   2217  C  CE2 . PHE A  1  295  ? 226.539 238.723 147.984 1.00   227.48 ? 468  PHE A CE2 1 
ATOM   2218  C  CZ  . PHE A  1  295  ? 225.163 238.670 148.113 1.00   212.13 ? 468  PHE A CZ  1 
ATOM   2219  N  N   . GLY A  1  296  ? 229.411 244.607 148.620 1.00   216.18 ? 469  GLY A N   1 
ATOM   2220  C  CA  . GLY A  1  296  ? 230.120 245.871 148.564 1.00   247.72 ? 469  GLY A CA  1 
ATOM   2221  C  C   . GLY A  1  296  ? 230.825 246.093 147.252 1.00   254.86 ? 469  GLY A C   1 
ATOM   2222  O  O   . GLY A  1  296  ? 230.548 247.055 146.520 1.00   275.29 ? 469  GLY A O   1 
ATOM   2223  N  N   . SER A  1  297  ? 231.769 245.214 146.968 1.00   237.81 ? 470  SER A N   1 
ATOM   2224  C  CA  . SER A  1  297  ? 232.746 245.475 145.917 1.00   237.62 ? 470  SER A CA  1 
ATOM   2225  C  C   . SER A  1  297  ? 233.217 244.194 145.322 1.00   236.85 ? 470  SER A C   1 
ATOM   2226  O  O   . SER A  1  297  ? 233.227 243.183 146.010 1.00   250.72 ? 470  SER A O   1 
ATOM   2227  C  CB  . SER A  1  297  ? 233.991 246.162 146.483 1.00   239.38 ? 470  SER A CB  1 
ATOM   2228  O  OG  . SER A  1  297  ? 233.665 247.329 147.205 1.00   281.83 ? 470  SER A OG  1 
ATOM   2229  N  N   . VAL A  1  298  ? 233.654 244.261 144.062 1.00   238.82 ? 471  VAL A N   1 
ATOM   2230  C  CA  . VAL A  1  298  ? 234.332 243.143 143.402 1.00   243.08 ? 471  VAL A CA  1 
ATOM   2231  C  C   . VAL A  1  298  ? 235.799 243.482 143.128 1.00   240.24 ? 471  VAL A C   1 
ATOM   2232  O  O   . VAL A  1  298  ? 236.107 244.586 142.682 1.00   254.46 ? 471  VAL A O   1 
ATOM   2233  C  CB  . VAL A  1  298  ? 233.627 242.657 142.092 1.00   233.80 ? 471  VAL A CB  1 
ATOM   2234  C  CG1 . VAL A  1  298  ? 232.141 242.445 142.341 1.00   235.96 ? 471  VAL A CG1 1 
ATOM   2235  C  CG2 . VAL A  1  298  ? 233.855 243.590 140.896 1.00   221.48 ? 471  VAL A CG2 1 
ATOM   2236  N  N   . THR A  1  299  ? 236.693 242.541 143.427 1.00   240.86 ? 472  THR A N   1 
ATOM   2237  C  CA  . THR A  1  299  ? 238.086 242.621 142.985 1.00   242.03 ? 472  THR A CA  1 
ATOM   2238  C  C   . THR A  1  299  ? 238.416 241.345 142.230 1.00   220.58 ? 472  THR A C   1 
ATOM   2239  O  O   . THR A  1  299  ? 238.138 240.238 142.716 1.00   208.08 ? 472  THR A O   1 
ATOM   2240  C  CB  . THR A  1  299  ? 239.081 242.798 144.152 1.00   259.51 ? 472  THR A CB  1 
ATOM   2241  O  OG1 . THR A  1  299  ? 239.111 241.610 144.954 1.00   278.44 ? 472  THR A OG1 1 
ATOM   2242  C  CG2 . THR A  1  299  ? 238.709 244.009 145.023 1.00   262.23 ? 472  THR A CG2 1 
ATOM   2243  N  N   . ASN A  1  300  ? 238.999 241.504 141.043 1.00   209.39 ? 473  ASN A N   1 
ATOM   2244  C  CA  . ASN A  1  300  ? 239.404 240.368 140.237 1.00   217.09 ? 473  ASN A CA  1 
ATOM   2245  C  C   . ASN A  1  300  ? 240.815 239.928 140.618 1.00   223.80 ? 473  ASN A C   1 
ATOM   2246  O  O   . ASN A  1  300  ? 241.672 240.750 140.947 1.00   201.97 ? 473  ASN A O   1 
ATOM   2247  C  CB  . ASN A  1  300  ? 239.271 240.689 138.751 1.00   215.96 ? 473  ASN A CB  1 
ATOM   2248  C  CG  . ASN A  1  300  ? 237.847 241.061 138.368 1.00   231.45 ? 473  ASN A CG  1 
ATOM   2249  O  OD1 . ASN A  1  300  ? 236.913 240.935 139.165 1.00   208.79 ? 473  ASN A OD1 1 
ATOM   2250  N  ND2 . ASN A  1  300  ? 237.677 241.539 137.146 1.00   267.48 ? 473  ASN A ND2 1 
ATOM   2251  N  N   . ILE A  1  301  ? 241.025 238.617 140.590 1.00   230.00 ? 474  ILE A N   1 
ATOM   2252  C  CA  . ILE A  1  301  ? 242.250 237.969 141.054 1.00   207.23 ? 474  ILE A CA  1 
ATOM   2253  C  C   . ILE A  1  301  ? 242.511 236.902 139.986 1.00   194.06 ? 474  ILE A C   1 
ATOM   2254  O  O   . ILE A  1  301  ? 241.592 236.156 139.613 1.00   195.23 ? 474  ILE A O   1 
ATOM   2255  C  CB  . ILE A  1  301  ? 242.108 237.439 142.522 1.00   213.33 ? 474  ILE A CB  1 
ATOM   2256  C  CG1 . ILE A  1  301  ? 242.966 236.179 142.755 1.00   218.72 ? 474  ILE A CG1 1 
ATOM   2257  C  CG2 . ILE A  1  301  ? 240.632 237.218 142.897 1.00   229.33 ? 474  ILE A CG2 1 
ATOM   2258  C  CD1 . ILE A  1  301  ? 242.678 235.438 144.043 1.00   223.22 ? 474  ILE A CD1 1 
ATOM   2259  N  N   . PRO A  1  302  ? 243.750 236.837 139.468 1.00   189.37 ? 475  PRO A N   1 
ATOM   2260  C  CA  . PRO A  1  302  ? 243.954 236.256 138.149 1.00   212.87 ? 475  PRO A CA  1 
ATOM   2261  C  C   . PRO A  1  302  ? 244.390 234.792 138.211 1.00   217.30 ? 475  PRO A C   1 
ATOM   2262  O  O   . PRO A  1  302  ? 245.569 234.486 137.972 1.00   225.58 ? 475  PRO A O   1 
ATOM   2263  C  CB  . PRO A  1  302  ? 245.071 237.145 137.590 1.00   211.10 ? 475  PRO A CB  1 
ATOM   2264  C  CG  . PRO A  1  302  ? 245.907 237.452 138.809 1.00   210.42 ? 475  PRO A CG  1 
ATOM   2265  C  CD  . PRO A  1  302  ? 245.040 237.263 140.039 1.00   191.28 ? 475  PRO A CD  1 
ATOM   2266  N  N   . ALA A  1  303  ? 243.453 233.891 138.509 1.00   200.84 ? 476  ALA A N   1 
ATOM   2267  C  CA  . ALA A  1  303  ? 243.798 232.483 138.748 1.00   216.02 ? 476  ALA A CA  1 
ATOM   2268  C  C   . ALA A  1  303  ? 242.993 231.496 137.936 1.00   202.69 ? 476  ALA A C   1 
ATOM   2269  O  O   . ALA A  1  303  ? 241.778 231.631 137.796 1.00   190.25 ? 476  ALA A O   1 
ATOM   2270  C  CB  . ALA A  1  303  ? 243.659 232.147 140.216 1.00   234.16 ? 476  ALA A CB  1 
ATOM   2271  N  N   . LYS A  1  304  ? 243.709 230.479 137.456 1.00   207.81 ? 477  LYS A N   1 
ATOM   2272  C  CA  . LYS A  1  304  ? 243.177 229.414 136.606 1.00   182.01 ? 477  LYS A CA  1 
ATOM   2273  C  C   . LYS A  1  304  ? 242.076 228.647 137.306 1.00   164.30 ? 477  LYS A C   1 
ATOM   2274  O  O   . LYS A  1  304  ? 241.074 228.330 136.675 1.00   184.86 ? 477  LYS A O   1 
ATOM   2275  C  CB  . LYS A  1  304  ? 244.331 228.472 136.226 1.00   182.02 ? 477  LYS A CB  1 
ATOM   2276  C  CG  . LYS A  1  304  ? 244.044 227.329 135.266 1.00   176.41 ? 477  LYS A CG  1 
ATOM   2277  C  CD  . LYS A  1  304  ? 244.983 226.165 135.596 1.00   198.15 ? 477  LYS A CD  1 
ATOM   2278  C  CE  . LYS A  1  304  ? 245.247 225.239 134.426 1.00   209.21 ? 477  LYS A CE  1 
ATOM   2279  N  NZ  . LYS A  1  304  ? 246.337 225.785 133.575 1.00   215.64 ? 477  LYS A NZ  1 
ATOM   2280  N  N   . ASP A  1  305  ? 242.259 228.368 138.601 1.00   158.74 ? 478  ASP A N   1 
ATOM   2281  C  CA  . ASP A  1  305  ? 241.391 227.441 139.355 1.00   160.32 ? 478  ASP A CA  1 
ATOM   2282  C  C   . ASP A  1  305  ? 241.572 227.593 140.846 1.00   146.91 ? 478  ASP A C   1 
ATOM   2283  O  O   . ASP A  1  305  ? 242.663 227.864 141.322 1.00   167.47 ? 478  ASP A O   1 
ATOM   2284  C  CB  . ASP A  1  305  ? 241.616 225.968 138.969 1.00   176.53 ? 478  ASP A CB  1 
ATOM   2285  C  CG  . ASP A  1  305  ? 240.380 225.118 139.147 1.00   189.26 ? 478  ASP A CG  1 
ATOM   2286  O  OD1 . ASP A  1  305  ? 239.611 225.361 140.097 1.00   197.30 ? 478  ASP A OD1 1 
ATOM   2287  O  OD2 . ASP A  1  305  ? 240.183 224.198 138.327 1.00   234.96 ? 478  ASP A OD2 1 
ATOM   2288  N  N   . ALA A  1  306  ? 240.496 227.397 141.582 1.00   137.69 ? 479  ALA A N   1 
ATOM   2289  C  CA  . ALA A  1  306  ? 240.403 227.938 142.922 1.00   144.16 ? 479  ALA A CA  1 
ATOM   2290  C  C   . ALA A  1  306  ? 239.493 227.095 143.734 1.00   151.83 ? 479  ALA A C   1 
ATOM   2291  O  O   . ALA A  1  306  ? 238.419 226.731 143.298 1.00   177.37 ? 479  ALA A O   1 
ATOM   2292  C  CB  . ALA A  1  306  ? 239.852 229.355 142.894 1.00   139.49 ? 479  ALA A CB  1 
ATOM   2293  N  N   . ALA A  1  307  ? 239.925 226.794 144.934 1.00   159.27 ? 480  ALA A N   1 
ATOM   2294  C  CA  . ALA A  1  307  ? 239.094 226.115 145.891 1.00   144.18 ? 480  ALA A CA  1 
ATOM   2295  C  C   . ALA A  1  307  ? 239.218 226.860 147.189 1.00   140.54 ? 480  ALA A C   1 
ATOM   2296  O  O   . ALA A  1  307  ? 240.272 227.406 147.471 1.00   200.08 ? 480  ALA A O   1 
ATOM   2297  C  CB  . ALA A  1  307  ? 239.590 224.707 146.075 1.00   138.79 ? 480  ALA A CB  1 
ATOM   2298  N  N   . PRO A  1  308  ? 238.178 226.854 148.018 1.00   137.86 ? 481  PRO A N   1 
ATOM   2299  C  CA  . PRO A  1  308  ? 238.256 227.512 149.309 1.00   161.27 ? 481  PRO A CA  1 
ATOM   2300  C  C   . PRO A  1  308  ? 238.619 226.548 150.428 1.00   181.30 ? 481  PRO A C   1 
ATOM   2301  O  O   . PRO A  1  308  ? 238.002 225.488 150.541 1.00   187.64 ? 481  PRO A O   1 
ATOM   2302  C  CB  . PRO A  1  308  ? 236.824 227.979 149.511 1.00   168.79 ? 481  PRO A CB  1 
ATOM   2303  C  CG  . PRO A  1  308  ? 235.992 226.895 148.883 1.00   160.16 ? 481  PRO A CG  1 
ATOM   2304  C  CD  . PRO A  1  308  ? 236.832 226.306 147.774 1.00   148.27 ? 481  PRO A CD  1 
ATOM   2305  N  N   . VAL A  1  309  ? 239.582 226.888 151.268 1.00   184.58 ? 482  VAL A N   1 
ATOM   2306  C  CA  . VAL A  1  309  ? 239.814 226.023 152.395 1.00   184.55 ? 482  VAL A CA  1 
ATOM   2307  C  C   . VAL A  1  309  ? 239.068 226.591 153.602 1.00   191.46 ? 482  VAL A C   1 
ATOM   2308  O  O   . VAL A  1  309  ? 239.230 227.752 153.959 1.00   200.77 ? 482  VAL A O   1 
ATOM   2309  C  CB  . VAL A  1  309  ? 241.303 225.678 152.556 1.00   177.85 ? 482  VAL A CB  1 
ATOM   2310  C  CG1 . VAL A  1  309  ? 242.097 226.741 153.303 1.00   179.07 ? 482  VAL A CG1 1 
ATOM   2311  C  CG2 . VAL A  1  309  ? 241.402 224.347 153.258 1.00   191.67 ? 482  VAL A CG2 1 
ATOM   2312  N  N   . GLU A  1  310  ? 238.187 225.783 154.172 1.00   182.02 ? 483  GLU A N   1 
ATOM   2313  C  CA  . GLU A  1  310  ? 237.247 226.247 155.179 1.00   196.60 ? 483  GLU A CA  1 
ATOM   2314  C  C   . GLU A  1  310  ? 237.881 226.465 156.561 1.00   209.19 ? 483  GLU A C   1 
ATOM   2315  O  O   . GLU A  1  310  ? 237.621 227.486 157.193 1.00   199.41 ? 483  GLU A O   1 
ATOM   2316  C  CB  . GLU A  1  310  ? 236.113 225.232 155.277 1.00   227.89 ? 483  GLU A CB  1 
ATOM   2317  C  CG  . GLU A  1  310  ? 234.872 225.709 155.998 1.00   261.40 ? 483  GLU A CG  1 
ATOM   2318  C  CD  . GLU A  1  310  ? 233.754 224.682 155.937 1.00   301.27 ? 483  GLU A CD  1 
ATOM   2319  O  OE1 . GLU A  1  310  ? 232.648 225.037 155.474 1.00   359.96 ? 483  GLU A OE1 1 
ATOM   2320  O  OE2 . GLU A  1  310  ? 233.982 223.515 156.334 1.00   314.78 ? 483  GLU A OE2 1 
ATOM   2321  N  N   . LYS A  1  311  ? 238.727 225.519 156.994 1.00   219.29 ? 484  LYS A N   1 
ATOM   2322  C  CA  . LYS A  1  311  ? 239.230 225.443 158.382 1.00   202.44 ? 484  LYS A CA  1 
ATOM   2323  C  C   . LYS A  1  311  ? 240.162 226.555 158.727 1.00   201.36 ? 484  LYS A C   1 
ATOM   2324  O  O   . LYS A  1  311  ? 240.099 227.079 159.827 1.00   232.62 ? 484  LYS A O   1 
ATOM   2325  C  CB  . LYS A  1  311  ? 239.999 224.153 158.638 1.00   201.37 ? 484  LYS A CB  1 
ATOM   2326  N  N   . ILE A  1  312  ? 241.056 226.880 157.805 1.00   174.29 ? 485  ILE A N   1 
ATOM   2327  C  CA  . ILE A  1  312  ? 241.976 227.989 158.003 1.00   178.89 ? 485  ILE A CA  1 
ATOM   2328  C  C   . ILE A  1  312  ? 241.312 229.342 157.786 1.00   199.66 ? 485  ILE A C   1 
ATOM   2329  O  O   . ILE A  1  312  ? 241.714 230.315 158.407 1.00   224.79 ? 485  ILE A O   1 
ATOM   2330  C  CB  . ILE A  1  312  ? 243.159 227.873 157.059 1.00   185.30 ? 485  ILE A CB  1 
ATOM   2331  C  CG1 . ILE A  1  312  ? 243.893 226.570 157.344 1.00   224.36 ? 485  ILE A CG1 1 
ATOM   2332  C  CG2 . ILE A  1  312  ? 244.128 229.042 157.210 1.00   184.44 ? 485  ILE A CG2 1 
ATOM   2333  C  CD1 . ILE A  1  312  ? 244.532 226.016 156.105 1.00   252.77 ? 485  ILE A CD1 1 
ATOM   2334  N  N   . ASP A  1  313  ? 240.306 229.408 156.919 1.00   212.58 ? 486  ASP A N   1 
ATOM   2335  C  CA  . ASP A  1  313  ? 239.688 230.677 156.486 1.00   205.47 ? 486  ASP A CA  1 
ATOM   2336  C  C   . ASP A  1  313  ? 240.539 231.420 155.432 1.00   202.04 ? 486  ASP A C   1 
ATOM   2337  O  O   . ASP A  1  313  ? 240.520 232.654 155.363 1.00   227.15 ? 486  ASP A O   1 
ATOM   2338  C  CB  . ASP A  1  313  ? 239.343 231.594 157.694 1.00   165.00 ? 486  ASP A CB  1 
ATOM   2339  N  N   . THR A  1  314  ? 241.261 230.677 154.598 1.00   212.21 ? 487  THR A N   1 
ATOM   2340  C  CA  . THR A  1  314  ? 242.047 231.267 153.513 1.00   240.23 ? 487  THR A CA  1 
ATOM   2341  C  C   . THR A  1  314  ? 241.822 230.464 152.219 1.00   246.78 ? 487  THR A C   1 
ATOM   2342  O  O   . THR A  1  314  ? 242.133 229.294 152.174 1.00   282.65 ? 487  THR A O   1 
ATOM   2343  C  CB  . THR A  1  314  ? 243.565 231.268 153.849 1.00   262.62 ? 487  THR A CB  1 
ATOM   2344  O  OG1 . THR A  1  314  ? 244.039 229.922 154.005 1.00   271.40 ? 487  THR A OG1 1 
ATOM   2345  C  CG2 . THR A  1  314  ? 243.883 232.055 155.141 1.00   268.33 ? 487  THR A CG2 1 
ATOM   2346  N  N   . MET A  1  315  ? 241.335 231.086 151.150 1.00   217.45 ? 488  MET A N   1 
ATOM   2347  C  CA  . MET A  1  315  ? 241.119 230.374 149.876 1.00   176.51 ? 488  MET A CA  1 
ATOM   2348  C  C   . MET A  1  315  ? 242.392 230.099 149.011 1.00   160.87 ? 488  MET A C   1 
ATOM   2349  O  O   . MET A  1  315  ? 243.246 230.966 148.870 1.00   191.13 ? 488  MET A O   1 
ATOM   2350  C  CB  . MET A  1  315  ? 240.080 231.138 149.072 1.00   175.55 ? 488  MET A CB  1 
ATOM   2351  C  CG  . MET A  1  315  ? 240.181 231.015 147.564 1.00   179.52 ? 488  MET A CG  1 
ATOM   2352  S  SD  . MET A  1  315  ? 239.577 232.541 146.849 1.00   232.76 ? 488  MET A SD  1 
ATOM   2353  C  CE  . MET A  1  315  ? 240.992 233.615 147.048 1.00   231.06 ? 488  MET A CE  1 
ATOM   2354  N  N   . LEU A  1  316  ? 242.491 228.914 148.405 1.00   146.00 ? 489  LEU A N   1 
ATOM   2355  C  CA  . LEU A  1  316  ? 243.595 228.562 147.472 1.00   138.22 ? 489  LEU A CA  1 
ATOM   2356  C  C   . LEU A  1  316  ? 243.298 228.848 146.009 1.00   149.57 ? 489  LEU A C   1 
ATOM   2357  O  O   . LEU A  1  316  ? 242.288 228.383 145.490 1.00   181.34 ? 489  LEU A O   1 
ATOM   2358  C  CB  . LEU A  1  316  ? 243.850 227.063 147.478 1.00   137.13 ? 489  LEU A CB  1 
ATOM   2359  C  CG  . LEU A  1  316  ? 244.913 226.429 148.345 1.00   170.60 ? 489  LEU A CG  1 
ATOM   2360  C  CD1 . LEU A  1  316  ? 245.117 224.958 147.908 1.00   169.37 ? 489  LEU A CD1 1 
ATOM   2361  C  CD2 . LEU A  1  316  ? 246.199 227.242 148.288 1.00   163.88 ? 489  LEU A CD2 1 
ATOM   2362  N  N   . VAL A  1  317  ? 244.194 229.534 145.311 1.00   145.36 ? 490  VAL A N   1 
ATOM   2363  C  CA  . VAL A  1  317  ? 244.079 229.645 143.843 1.00   142.86 ? 490  VAL A CA  1 
ATOM   2364  C  C   . VAL A  1  317  ? 245.396 229.253 143.201 1.00   142.78 ? 490  VAL A C   1 
ATOM   2365  O  O   . VAL A  1  317  ? 246.433 229.259 143.867 1.00   157.26 ? 490  VAL A O   1 
ATOM   2366  C  CB  . VAL A  1  317  ? 243.628 231.039 143.380 1.00   143.54 ? 490  VAL A CB  1 
ATOM   2367  C  CG1 . VAL A  1  317  ? 242.509 231.558 144.262 1.00   161.12 ? 490  VAL A CG1 1 
ATOM   2368  C  CG2 . VAL A  1  317  ? 244.765 232.038 143.405 1.00   163.67 ? 490  VAL A CG2 1 
ATOM   2369  N  N   . LEU A  1  318  ? 245.358 228.884 141.930 1.00   131.40 ? 491  LEU A N   1 
ATOM   2370  C  CA  . LEU A  1  318  ? 246.587 228.503 141.252 1.00   151.73 ? 491  LEU A CA  1 
ATOM   2371  C  C   . LEU A  1  318  ? 246.683 229.427 140.039 1.00   177.50 ? 491  LEU A C   1 
ATOM   2372  O  O   . LEU A  1  318  ? 245.818 229.448 139.177 1.00   190.63 ? 491  LEU A O   1 
ATOM   2373  C  CB  . LEU A  1  318  ? 246.696 226.972 141.012 1.00   137.41 ? 491  LEU A CB  1 
ATOM   2374  C  CG  . LEU A  1  318  ? 246.195 226.211 139.773 1.00   146.56 ? 491  LEU A CG  1 
ATOM   2375  C  CD1 . LEU A  1  318  ? 246.414 224.695 139.831 1.00   131.61 ? 491  LEU A CD1 1 
ATOM   2376  C  CD2 . LEU A  1  318  ? 244.731 226.465 139.608 1.00   152.95 ? 491  LEU A CD2 1 
ATOM   2377  N  N   . GLU A  1  319  ? 247.715 230.268 140.049 1.00   219.58 ? 492  GLU A N   1 
ATOM   2378  C  CA  . GLU A  1  319  ? 247.828 231.380 139.122 1.00   240.61 ? 492  GLU A CA  1 
ATOM   2379  C  C   . GLU A  1  319  ? 248.726 230.971 137.965 1.00   262.18 ? 492  GLU A C   1 
ATOM   2380  O  O   . GLU A  1  319  ? 249.799 230.389 138.182 1.00   286.52 ? 492  GLU A O   1 
ATOM   2381  C  CB  . GLU A  1  319  ? 248.402 232.604 139.848 1.00   229.79 ? 492  GLU A CB  1 
ATOM   2382  N  N   . GLY A  1  320  ? 248.289 231.267 136.744 1.00   253.07 ? 493  GLY A N   1 
ATOM   2383  C  CA  . GLY A  1  320  ? 249.088 230.978 135.562 1.00   252.43 ? 493  GLY A CA  1 
ATOM   2384  C  C   . GLY A  1  320  ? 249.292 229.485 135.419 1.00   264.86 ? 493  GLY A C   1 
ATOM   2385  O  O   . GLY A  1  320  ? 248.307 228.729 135.468 1.00   226.16 ? 493  GLY A O   1 
ATOM   2386  N  N   . SER A  1  321  ? 250.563 229.073 135.306 1.00   283.82 ? 494  SER A N   1 
ATOM   2387  C  CA  . SER A  1  321  ? 250.947 227.689 134.997 1.00   290.93 ? 494  SER A CA  1 
ATOM   2388  C  C   . SER A  1  321  ? 251.522 226.997 136.224 1.00   289.96 ? 494  SER A C   1 
ATOM   2389  O  O   . SER A  1  321  ? 252.698 227.196 136.570 1.00   247.24 ? 494  SER A O   1 
ATOM   2390  C  CB  . SER A  1  321  ? 251.960 227.641 133.842 1.00   256.09 ? 494  SER A CB  1 
ATOM   2391  N  N   . GLY A  1  322  ? 250.653 226.219 136.876 1.00   290.27 ? 495  GLY A N   1 
ATOM   2392  C  CA  . GLY A  1  322  ? 251.007 225.299 137.946 1.00   273.41 ? 495  GLY A CA  1 
ATOM   2393  C  C   . GLY A  1  322  ? 251.671 225.930 139.140 1.00   264.21 ? 495  GLY A C   1 
ATOM   2394  O  O   . GLY A  1  322  ? 252.490 225.275 139.789 1.00   257.03 ? 495  GLY A O   1 
ATOM   2395  N  N   . ASN A  1  323  ? 251.338 227.190 139.425 1.00   256.79 ? 496  ASN A N   1 
ATOM   2396  C  CA  . ASN A  1  323  ? 251.955 227.907 140.533 1.00   256.41 ? 496  ASN A CA  1 
ATOM   2397  C  C   . ASN A  1  323  ? 250.907 228.222 141.587 1.00   232.49 ? 496  ASN A C   1 
ATOM   2398  O  O   . ASN A  1  323  ? 250.301 229.298 141.610 1.00   251.49 ? 496  ASN A O   1 
ATOM   2399  C  CB  . ASN A  1  323  ? 252.727 229.154 140.085 1.00   241.53 ? 496  ASN A CB  1 
ATOM   2400  C  CG  . ASN A  1  323  ? 253.710 229.658 141.157 1.00   250.28 ? 496  ASN A CG  1 
ATOM   2401  O  OD1 . ASN A  1  323  ? 254.124 228.928 142.086 1.00   195.11 ? 496  ASN A OD1 1 
ATOM   2402  N  ND2 . ASN A  1  323  ? 254.096 230.915 141.025 1.00   274.19 ? 496  ASN A ND2 1 
ATOM   2403  N  N   . LEU A  1  324  ? 250.753 227.248 142.476 1.00   186.55 ? 497  LEU A N   1 
ATOM   2404  C  CA  . LEU A  1  324  ? 249.718 227.231 143.495 1.00   169.37 ? 497  LEU A CA  1 
ATOM   2405  C  C   . LEU A  1  324  ? 249.984 228.307 144.595 1.00   166.04 ? 497  LEU A C   1 
ATOM   2406  O  O   . LEU A  1  324  ? 251.102 228.390 145.105 1.00   171.90 ? 497  LEU A O   1 
ATOM   2407  C  CB  . LEU A  1  324  ? 249.707 225.818 144.094 1.00   154.04 ? 497  LEU A CB  1 
ATOM   2408  C  CG  . LEU A  1  324  ? 248.382 225.176 144.480 1.00   168.96 ? 497  LEU A CG  1 
ATOM   2409  C  CD1 . LEU A  1  324  ? 248.687 224.025 145.438 1.00   172.69 ? 497  LEU A CD1 1 
ATOM   2410  C  CD2 . LEU A  1  324  ? 247.384 226.167 145.071 1.00   172.31 ? 497  LEU A CD2 1 
ATOM   2411  N  N   . VAL A  1  325  ? 248.969 229.104 144.959 1.00   135.24 ? 498  VAL A N   1 
ATOM   2412  C  CA  . VAL A  1  325  ? 249.118 230.218 145.921 1.00   143.25 ? 498  VAL A CA  1 
ATOM   2413  C  C   . VAL A  1  325  ? 247.897 230.313 146.794 1.00   147.40 ? 498  VAL A C   1 
ATOM   2414  O  O   . VAL A  1  325  ? 246.849 229.753 146.470 1.00   151.94 ? 498  VAL A O   1 
ATOM   2415  C  CB  . VAL A  1  325  ? 249.296 231.612 145.243 1.00   180.53 ? 498  VAL A CB  1 
ATOM   2416  C  CG1 . VAL A  1  325  ? 250.725 231.818 144.765 1.00   211.08 ? 498  VAL A CG1 1 
ATOM   2417  C  CG2 . VAL A  1  325  ? 248.330 231.794 144.084 1.00   198.91 ? 498  VAL A CG2 1 
ATOM   2418  N  N   . LEU A  1  326  ? 248.025 231.066 147.883 1.00   154.54 ? 499  LEU A N   1 
ATOM   2419  C  CA  . LEU A  1  326  ? 247.005 231.107 148.924 1.00   158.69 ? 499  LEU A CA  1 
ATOM   2420  C  C   . LEU A  1  326  ? 246.611 232.523 149.242 1.00   155.92 ? 499  LEU A C   1 
ATOM   2421  O  O   . LEU A  1  326  ? 247.470 233.350 149.502 1.00   206.44 ? 499  LEU A O   1 
ATOM   2422  C  CB  . LEU A  1  326  ? 247.560 230.440 150.174 1.00   165.63 ? 499  LEU A CB  1 
ATOM   2423  C  CG  . LEU A  1  326  ? 246.686 230.283 151.415 1.00   176.56 ? 499  LEU A CG  1 
ATOM   2424  C  CD1 . LEU A  1  326  ? 245.254 229.840 151.106 1.00   185.13 ? 499  LEU A CD1 1 
ATOM   2425  C  CD2 . LEU A  1  326  ? 247.389 229.299 152.354 1.00   181.92 ? 499  LEU A CD2 1 
ATOM   2426  N  N   . TYR A  1  327  ? 245.316 232.809 149.195 1.00   161.47 ? 500  TYR A N   1 
ATOM   2427  C  CA  . TYR A  1  327  ? 244.806 234.144 149.462 1.00   161.83 ? 500  TYR A CA  1 
ATOM   2428  C  C   . TYR A  1  327  ? 243.872 234.061 150.666 1.00   171.01 ? 500  TYR A C   1 
ATOM   2429  O  O   . TYR A  1  327  ? 242.984 233.223 150.708 1.00   212.37 ? 500  TYR A O   1 
ATOM   2430  C  CB  . TYR A  1  327  ? 244.041 234.669 148.258 1.00   143.63 ? 500  TYR A CB  1 
ATOM   2431  C  CG  . TYR A  1  327  ? 244.901 235.084 147.119 1.00   140.38 ? 500  TYR A CG  1 
ATOM   2432  C  CD1 . TYR A  1  327  ? 245.680 234.160 146.444 1.00   152.74 ? 500  TYR A CD1 1 
ATOM   2433  C  CD2 . TYR A  1  327  ? 244.922 236.407 146.677 1.00   172.07 ? 500  TYR A CD2 1 
ATOM   2434  C  CE1 . TYR A  1  327  ? 246.486 234.545 145.383 1.00   176.63 ? 500  TYR A CE1 1 
ATOM   2435  C  CE2 . TYR A  1  327  ? 245.715 236.804 145.607 1.00   184.27 ? 500  TYR A CE2 1 
ATOM   2436  C  CZ  . TYR A  1  327  ? 246.496 235.863 144.960 1.00   191.09 ? 500  TYR A CZ  1 
ATOM   2437  O  OH  . TYR A  1  327  ? 247.288 236.222 143.896 1.00   216.17 ? 500  TYR A OH  1 
ATOM   2438  N  N   . THR A  1  328  ? 244.070 234.936 151.641 1.00   170.78 ? 501  THR A N   1 
ATOM   2439  C  CA  . THR A  1  328  ? 243.201 235.031 152.807 1.00   177.08 ? 501  THR A CA  1 
ATOM   2440  C  C   . THR A  1  328  ? 241.799 235.387 152.338 1.00   188.46 ? 501  THR A C   1 
ATOM   2441  O  O   . THR A  1  328  ? 240.815 234.725 152.686 1.00   225.12 ? 501  THR A O   1 
ATOM   2442  C  CB  . THR A  1  328  ? 243.736 236.113 153.785 1.00   212.56 ? 501  THR A CB  1 
ATOM   2443  O  OG1 . THR A  1  328  ? 244.942 235.651 154.412 1.00   262.31 ? 501  THR A OG1 1 
ATOM   2444  C  CG2 . THR A  1  328  ? 242.752 236.480 154.844 1.00   206.70 ? 501  THR A CG2 1 
ATOM   2445  N  N   . GLY A  1  329  ? 241.728 236.440 151.541 1.00   197.79 ? 502  GLY A N   1 
ATOM   2446  C  CA  . GLY A  1  329  ? 240.500 236.811 150.863 1.00   210.47 ? 502  GLY A CA  1 
ATOM   2447  C  C   . GLY A  1  329  ? 240.979 237.494 149.626 1.00   217.20 ? 502  GLY A C   1 
ATOM   2448  O  O   . GLY A  1  329  ? 241.125 236.870 148.581 1.00   243.42 ? 502  GLY A O   1 
ATOM   2449  N  N   . VAL A  1  330  ? 241.306 238.766 149.780 1.00   199.73 ? 503  VAL A N   1 
ATOM   2450  C  CA  . VAL A  1  330  ? 241.866 239.534 148.685 1.00   202.28 ? 503  VAL A CA  1 
ATOM   2451  C  C   . VAL A  1  330  ? 243.398 239.614 148.764 1.00   191.32 ? 503  VAL A C   1 
ATOM   2452  O  O   . VAL A  1  330  ? 244.051 239.906 147.759 1.00   199.51 ? 503  VAL A O   1 
ATOM   2453  C  CB  . VAL A  1  330  ? 241.224 240.932 148.630 1.00   227.97 ? 503  VAL A CB  1 
ATOM   2454  C  CG1 . VAL A  1  330  ? 241.564 241.643 147.320 1.00   247.91 ? 503  VAL A CG1 1 
ATOM   2455  C  CG2 . VAL A  1  330  ? 239.712 240.817 148.795 1.00   216.14 ? 503  VAL A CG2 1 
ATOM   2456  N  N   . VAL A  1  331  ? 243.981 239.340 149.925 1.00   178.61 ? 504  VAL A N   1 
ATOM   2457  C  CA  . VAL A  1  331  ? 245.433 239.461 150.047 1.00   197.99 ? 504  VAL A CA  1 
ATOM   2458  C  C   . VAL A  1  331  ? 246.117 238.172 149.669 1.00   188.61 ? 504  VAL A C   1 
ATOM   2459  O  O   . VAL A  1  331  ? 245.512 237.111 149.675 1.00   197.01 ? 504  VAL A O   1 
ATOM   2460  C  CB  . VAL A  1  331  ? 245.858 239.892 151.446 1.00   221.36 ? 504  VAL A CB  1 
ATOM   2461  C  CG1 . VAL A  1  331  ? 245.083 241.156 151.844 1.00   258.35 ? 504  VAL A CG1 1 
ATOM   2462  C  CG2 . VAL A  1  331  ? 245.705 238.749 152.448 1.00   209.61 ? 504  VAL A CG2 1 
ATOM   2463  N  N   . ARG A  1  332  ? 247.389 238.283 149.343 1.00   172.01 ? 505  ARG A N   1 
ATOM   2464  C  CA  . ARG A  1  332  ? 248.144 237.156 148.838 1.00   186.28 ? 505  ARG A CA  1 
ATOM   2465  C  C   . ARG A  1  332  ? 249.040 236.604 149.936 1.00   198.09 ? 505  ARG A C   1 
ATOM   2466  O  O   . ARG A  1  332  ? 250.045 237.225 150.262 1.00   220.48 ? 505  ARG A O   1 
ATOM   2467  C  CB  . ARG A  1  332  ? 248.985 237.611 147.644 1.00   194.92 ? 505  ARG A CB  1 
ATOM   2468  C  CG  . ARG A  1  332  ? 249.675 236.469 146.926 1.00   208.98 ? 505  ARG A CG  1 
ATOM   2469  C  CD  . ARG A  1  332  ? 250.447 236.956 145.716 1.00   215.96 ? 505  ARG A CD  1 
ATOM   2470  N  NE  . ARG A  1  332  ? 251.351 235.916 145.223 1.00   225.75 ? 505  ARG A NE  1 
ATOM   2471  C  CZ  . ARG A  1  332  ? 252.639 235.777 145.559 1.00   253.18 ? 505  ARG A CZ  1 
ATOM   2472  N  NH1 . ARG A  1  332  ? 253.255 236.622 146.399 1.00   244.91 ? 505  ARG A NH1 1 
ATOM   2473  N  NH2 . ARG A  1  332  ? 253.335 234.770 145.037 1.00   271.51 ? 505  ARG A NH2 1 
ATOM   2474  N  N   . VAL A  1  333  ? 248.701 235.436 150.486 1.00   202.02 ? 506  VAL A N   1 
ATOM   2475  C  CA  . VAL A  1  333  ? 249.422 234.877 151.650 1.00   190.26 ? 506  VAL A CA  1 
ATOM   2476  C  C   . VAL A  1  333  ? 250.785 234.342 151.268 1.00   171.64 ? 506  VAL A C   1 
ATOM   2477  O  O   . VAL A  1  333  ? 251.770 234.667 151.935 1.00   196.56 ? 506  VAL A O   1 
ATOM   2478  C  CB  . VAL A  1  333  ? 248.621 233.794 152.412 1.00   198.80 ? 506  VAL A CB  1 
ATOM   2479  C  CG1 . VAL A  1  333  ? 249.403 233.274 153.615 1.00   214.95 ? 506  VAL A CG1 1 
ATOM   2480  C  CG2 . VAL A  1  333  ? 247.305 234.367 152.891 1.00   199.69 ? 506  VAL A CG2 1 
ATOM   2481  N  N   . GLY A  1  334  ? 250.857 233.529 150.225 1.00   151.28 ? 507  GLY A N   1 
ATOM   2482  C  CA  . GLY A  1  334  ? 252.178 233.157 149.716 1.00   186.58 ? 507  GLY A CA  1 
ATOM   2483  C  C   . GLY A  1  334  ? 252.166 232.004 148.769 1.00   181.29 ? 507  GLY A C   1 
ATOM   2484  O  O   . GLY A  1  334  ? 251.119 231.375 148.612 1.00   171.94 ? 507  GLY A O   1 
ATOM   2485  N  N   . LYS A  1  335  ? 253.321 231.733 148.137 1.00   181.45 ? 508  LYS A N   1 
ATOM   2486  C  CA  . LYS A  1  335  ? 253.420 230.593 147.209 1.00   210.65 ? 508  LYS A CA  1 
ATOM   2487  C  C   . LYS A  1  335  ? 253.502 229.285 148.017 1.00   218.13 ? 508  LYS A C   1 
ATOM   2488  O  O   . LYS A  1  335  ? 254.513 228.979 148.655 1.00   224.47 ? 508  LYS A O   1 
ATOM   2489  C  CB  . LYS A  1  335  ? 254.531 230.759 146.131 1.00   206.44 ? 508  LYS A CB  1 
ATOM   2490  C  CG  . LYS A  1  335  ? 255.942 230.313 146.491 1.00   247.63 ? 508  LYS A CG  1 
ATOM   2491  C  CD  . LYS A  1  335  ? 256.239 228.829 146.209 1.00   259.32 ? 508  LYS A CD  1 
ATOM   2492  C  CE  . LYS A  1  335  ? 257.235 228.250 147.233 1.00   265.42 ? 508  LYS A CE  1 
ATOM   2493  N  NZ  . LYS A  1  335  ? 258.046 227.079 146.781 1.00   251.02 ? 508  LYS A NZ  1 
ATOM   2494  N  N   . VAL A  1  336  ? 252.391 228.549 148.028 1.00   196.22 ? 509  VAL A N   1 
ATOM   2495  C  CA  . VAL A  1  336  ? 252.318 227.266 148.728 1.00   174.95 ? 509  VAL A CA  1 
ATOM   2496  C  C   . VAL A  1  336  ? 253.163 226.235 147.980 1.00   177.24 ? 509  VAL A C   1 
ATOM   2497  O  O   . VAL A  1  336  ? 253.287 226.311 146.765 1.00   205.54 ? 509  VAL A O   1 
ATOM   2498  C  CB  . VAL A  1  336  ? 250.862 226.818 148.927 1.00   173.02 ? 509  VAL A CB  1 
ATOM   2499  C  CG1 . VAL A  1  336  ? 250.107 226.766 147.611 1.00   202.36 ? 509  VAL A CG1 1 
ATOM   2500  C  CG2 . VAL A  1  336  ? 250.803 225.479 149.634 1.00   199.32 ? 509  VAL A CG2 1 
ATOM   2501  N  N   . PHE A  1  337  ? 253.779 225.313 148.709 1.00   179.68 ? 510  PHE A N   1 
ATOM   2502  C  CA  . PHE A  1  337  ? 254.775 224.389 148.146 1.00   192.33 ? 510  PHE A CA  1 
ATOM   2503  C  C   . PHE A  1  337  ? 254.450 222.990 148.581 1.00   183.08 ? 510  PHE A C   1 
ATOM   2504  O  O   . PHE A  1  337  ? 254.304 222.715 149.764 1.00   194.27 ? 510  PHE A O   1 
ATOM   2505  C  CB  . PHE A  1  337  ? 256.189 224.747 148.636 1.00   229.97 ? 510  PHE A CB  1 
ATOM   2506  C  CG  . PHE A  1  337  ? 257.262 223.726 148.286 1.00   238.38 ? 510  PHE A CG  1 
ATOM   2507  C  CD1 . PHE A  1  337  ? 257.472 223.328 146.962 1.00   243.03 ? 510  PHE A CD1 1 
ATOM   2508  C  CD2 . PHE A  1  337  ? 258.092 223.193 149.284 1.00   214.72 ? 510  PHE A CD2 1 
ATOM   2509  C  CE1 . PHE A  1  337  ? 258.472 222.412 146.643 1.00   222.05 ? 510  PHE A CE1 1 
ATOM   2510  C  CE2 . PHE A  1  337  ? 259.090 222.281 148.971 1.00   195.97 ? 510  PHE A CE2 1 
ATOM   2511  C  CZ  . PHE A  1  337  ? 259.278 221.890 147.650 1.00   219.09 ? 510  PHE A CZ  1 
ATOM   2512  N  N   . ILE A  1  338  ? 254.363 222.099 147.617 1.00   187.99 ? 511  ILE A N   1 
ATOM   2513  C  CA  . ILE A  1  338  ? 254.132 220.707 147.911 1.00   203.77 ? 511  ILE A CA  1 
ATOM   2514  C  C   . ILE A  1  338  ? 255.491 220.008 147.808 1.00   236.74 ? 511  ILE A C   1 
ATOM   2515  O  O   . ILE A  1  338  ? 256.288 220.313 146.909 1.00   306.69 ? 511  ILE A O   1 
ATOM   2516  C  CB  . ILE A  1  338  ? 253.036 220.117 146.990 1.00   203.99 ? 511  ILE A CB  1 
ATOM   2517  C  CG1 . ILE A  1  338  ? 253.448 220.127 145.487 1.00   227.29 ? 511  ILE A CG1 1 
ATOM   2518  C  CG2 . ILE A  1  338  ? 251.728 220.898 147.211 1.00   174.93 ? 511  ILE A CG2 1 
ATOM   2519  C  CD1 . ILE A  1  338  ? 253.246 218.814 144.740 1.00   219.12 ? 511  ILE A CD1 1 
ATOM   2520  N  N   . PRO A  1  339  ? 255.800 219.110 148.751 1.00   225.30 ? 512  PRO A N   1 
ATOM   2521  C  CA  . PRO A  1  339  ? 257.015 218.304 148.585 1.00   241.96 ? 512  PRO A CA  1 
ATOM   2522  C  C   . PRO A  1  339  ? 257.323 217.605 147.204 1.00   271.89 ? 512  PRO A C   1 
ATOM   2523  O  O   . PRO A  1  339  ? 258.459 217.701 146.744 1.00   279.55 ? 512  PRO A O   1 
ATOM   2524  C  CB  . PRO A  1  339  ? 256.881 217.301 149.725 1.00   226.40 ? 512  PRO A CB  1 
ATOM   2525  C  CG  . PRO A  1  339  ? 256.300 218.142 150.826 1.00   212.02 ? 512  PRO A CG  1 
ATOM   2526  C  CD  . PRO A  1  339  ? 255.373 219.133 150.164 1.00   198.87 ? 512  PRO A CD  1 
ATOM   2527  N  N   . ALA A  1  340  ? 256.360 216.965 146.531 1.00   285.55 ? 513  ALA A N   1 
ATOM   2528  C  CA  . ALA A  1  340  ? 256.654 216.126 145.330 1.00   255.16 ? 513  ALA A CA  1 
ATOM   2529  C  C   . ALA A  1  340  ? 257.281 216.834 144.078 1.00   232.75 ? 513  ALA A C   1 
ATOM   2530  O  O   . ALA A  1  340  ? 256.733 217.775 143.459 1.00   161.30 ? 513  ALA A O   1 
ATOM   2531  C  CB  . ALA A  1  340  ? 255.417 215.313 144.936 1.00   236.87 ? 513  ALA A CB  1 
ATOM   2532  N  N   . THR A  1  341  ? 250.871 221.595 131.867 1.00   227.99 ? 582  THR A N   1 
ATOM   2533  C  CA  . THR A  1  341  ? 251.199 221.987 133.247 1.00   256.23 ? 582  THR A CA  1 
ATOM   2534  C  C   . THR A  1  341  ? 251.363 220.767 134.162 1.00   249.55 ? 582  THR A C   1 
ATOM   2535  O  O   . THR A  1  341  ? 250.746 219.734 133.907 1.00   242.78 ? 582  THR A O   1 
ATOM   2536  C  CB  . THR A  1  341  ? 250.130 222.945 133.854 1.00   254.38 ? 582  THR A CB  1 
ATOM   2537  O  OG1 . THR A  1  341  ? 248.795 222.511 133.517 1.00   186.48 ? 582  THR A OG1 1 
ATOM   2538  C  CG2 . THR A  1  341  ? 250.371 224.409 133.385 1.00   263.20 ? 582  THR A CG2 1 
ATOM   2539  N  N   . TYR A  1  342  ? 252.179 220.882 135.216 1.00   228.69 ? 583  TYR A N   1 
ATOM   2540  C  CA  . TYR A  1  342  ? 252.311 219.771 136.164 1.00   221.55 ? 583  TYR A CA  1 
ATOM   2541  C  C   . TYR A  1  342  ? 251.063 219.540 136.993 1.00   210.94 ? 583  TYR A C   1 
ATOM   2542  O  O   . TYR A  1  342  ? 250.754 218.377 137.262 1.00   250.02 ? 583  TYR A O   1 
ATOM   2543  C  CB  . TYR A  1  342  ? 253.567 219.842 137.051 1.00   235.22 ? 583  TYR A CB  1 
ATOM   2544  C  CG  . TYR A  1  342  ? 254.626 218.783 136.683 1.00   280.83 ? 583  TYR A CG  1 
ATOM   2545  C  CD1 . TYR A  1  342  ? 254.339 217.393 136.755 1.00   254.90 ? 583  TYR A CD1 1 
ATOM   2546  C  CD2 . TYR A  1  342  ? 255.913 219.165 136.260 1.00   285.61 ? 583  TYR A CD2 1 
ATOM   2547  C  CE1 . TYR A  1  342  ? 255.304 216.436 136.418 1.00   238.38 ? 583  TYR A CE1 1 
ATOM   2548  C  CE2 . TYR A  1  342  ? 256.883 218.216 135.923 1.00   270.62 ? 583  TYR A CE2 1 
ATOM   2549  C  CZ  . TYR A  1  342  ? 256.588 216.857 136.000 1.00   263.22 ? 583  TYR A CZ  1 
ATOM   2550  O  OH  . TYR A  1  342  ? 257.585 215.951 135.660 1.00   217.82 ? 583  TYR A OH  1 
ATOM   2551  N  N   . ILE A  1  343  ? 250.322 220.595 137.364 1.00   196.45 ? 584  ILE A N   1 
ATOM   2552  C  CA  . ILE A  1  343  ? 249.061 220.407 138.157 1.00   190.97 ? 584  ILE A CA  1 
ATOM   2553  C  C   . ILE A  1  343  ? 247.767 220.998 137.514 1.00   186.47 ? 584  ILE A C   1 
ATOM   2554  O  O   . ILE A  1  343  ? 247.675 222.207 137.292 1.00   177.24 ? 584  ILE A O   1 
ATOM   2555  C  CB  . ILE A  1  343  ? 249.256 220.819 139.652 1.00   179.60 ? 584  ILE A CB  1 
ATOM   2556  C  CG1 . ILE A  1  343  ? 248.345 221.977 140.080 1.00   154.76 ? 584  ILE A CG1 1 
ATOM   2557  C  CG2 . ILE A  1  343  ? 250.745 221.062 139.981 1.00   188.19 ? 584  ILE A CG2 1 
ATOM   2558  C  CD1 . ILE A  1  343  ? 248.369 222.205 141.572 1.00   163.04 ? 584  ILE A CD1 1 
ATOM   2559  N  N   . HIS A  1  344  ? 246.764 220.140 137.262 1.00   193.50 ? 585  HIS A N   1 
ATOM   2560  C  CA  . HIS A  1  344  ? 245.591 220.485 136.416 1.00   185.79 ? 585  HIS A CA  1 
ATOM   2561  C  C   . HIS A  1  344  ? 244.535 221.295 137.075 1.00   167.71 ? 585  HIS A C   1 
ATOM   2562  O  O   . HIS A  1  344  ? 243.981 222.196 136.444 1.00   152.78 ? 585  HIS A O   1 
ATOM   2563  C  CB  . HIS A  1  344  ? 244.899 219.255 135.822 1.00   169.86 ? 585  HIS A CB  1 
ATOM   2564  C  CG  . HIS A  1  344  ? 245.521 218.807 134.550 1.00   222.95 ? 585  HIS A CG  1 
ATOM   2565  N  ND1 . HIS A  1  344  ? 244.805 218.637 133.388 1.00   250.86 ? 585  HIS A ND1 1 
ATOM   2566  C  CD2 . HIS A  1  344  ? 246.816 218.562 134.241 1.00   259.53 ? 585  HIS A CD2 1 
ATOM   2567  C  CE1 . HIS A  1  344  ? 245.630 218.260 132.423 1.00   279.50 ? 585  HIS A CE1 1 
ATOM   2568  N  NE2 . HIS A  1  344  ? 246.855 218.200 132.916 1.00   276.56 ? 585  HIS A NE2 1 
ATOM   2569  N  N   . SER A  1  345  ? 244.210 220.938 138.312 1.00   157.73 ? 586  SER A N   1 
ATOM   2570  C  CA  . SER A  1  345  ? 243.148 221.617 139.039 1.00   173.23 ? 586  SER A CA  1 
ATOM   2571  C  C   . SER A  1  345  ? 243.199 221.396 140.537 1.00   159.87 ? 586  SER A C   1 
ATOM   2572  O  O   . SER A  1  345  ? 243.921 220.539 141.037 1.00   175.04 ? 586  SER A O   1 
ATOM   2573  C  CB  . SER A  1  345  ? 241.766 221.154 138.536 1.00   203.51 ? 586  SER A CB  1 
ATOM   2574  O  OG  . SER A  1  345  ? 241.317 219.967 139.179 1.00   205.64 ? 586  SER A OG  1 
ATOM   2575  N  N   . ILE A  1  346  ? 242.378 222.179 141.226 1.00   144.08 ? 587  ILE A N   1 
ATOM   2576  C  CA  . ILE A  1  346  ? 242.111 222.061 142.642 1.00   131.24 ? 587  ILE A CA  1 
ATOM   2577  C  C   . ILE A  1  346  ? 240.646 221.686 142.786 1.00   148.34 ? 587  ILE A C   1 
ATOM   2578  O  O   . ILE A  1  346  ? 239.790 222.247 142.112 1.00   162.63 ? 587  ILE A O   1 
ATOM   2579  C  CB  . ILE A  1  346  ? 242.318 223.401 143.316 1.00   156.50 ? 587  ILE A CB  1 
ATOM   2580  C  CG1 . ILE A  1  346  ? 243.693 223.965 142.938 1.00   195.63 ? 587  ILE A CG1 1 
ATOM   2581  C  CG2 . ILE A  1  346  ? 242.235 223.217 144.802 1.00   181.37 ? 587  ILE A CG2 1 
ATOM   2582  C  CD1 . ILE A  1  346  ? 244.158 225.144 143.769 1.00   216.85 ? 587  ILE A CD1 1 
ATOM   2583  N  N   . ARG A  1  347  ? 240.353 220.771 143.697 1.00   176.01 ? 588  ARG A N   1 
ATOM   2584  C  CA  . ARG A  1  347  ? 239.055 220.102 143.736 1.00   164.86 ? 588  ARG A CA  1 
ATOM   2585  C  C   . ARG A  1  347  ? 238.723 219.633 145.182 1.00   165.34 ? 588  ARG A C   1 
ATOM   2586  O  O   . ARG A  1  347  ? 239.584 219.689 146.070 1.00   201.34 ? 588  ARG A O   1 
ATOM   2587  C  CB  . ARG A  1  347  ? 239.121 218.964 142.699 1.00   155.21 ? 588  ARG A CB  1 
ATOM   2588  C  CG  . ARG A  1  347  ? 238.088 217.879 142.843 1.00   180.81 ? 588  ARG A CG  1 
ATOM   2589  C  CD  . ARG A  1  347  ? 238.074 216.859 141.725 1.00   187.40 ? 588  ARG A CD  1 
ATOM   2590  N  NE  . ARG A  1  347  ? 236.804 216.135 141.760 1.00   193.22 ? 588  ARG A NE  1 
ATOM   2591  C  CZ  . ARG A  1  347  ? 236.266 215.452 140.756 1.00   221.22 ? 588  ARG A CZ  1 
ATOM   2592  N  NH1 . ARG A  1  347  ? 236.895 215.346 139.585 1.00   251.93 ? 588  ARG A NH1 1 
ATOM   2593  N  NH2 . ARG A  1  347  ? 235.080 214.861 140.927 1.00   222.73 ? 588  ARG A NH2 1 
ATOM   2594  N  N   . ASP A  1  348  ? 237.466 219.235 145.402 1.00   178.19 ? 589  ASP A N   1 
ATOM   2595  C  CA  . ASP A  1  348  ? 236.935 218.509 146.622 1.00   192.81 ? 589  ASP A CA  1 
ATOM   2596  C  C   . ASP A  1  348  ? 237.484 218.934 147.972 1.00   167.42 ? 589  ASP A C   1 
ATOM   2597  O  O   . ASP A  1  348  ? 238.013 218.126 148.728 1.00   171.06 ? 589  ASP A O   1 
ATOM   2598  C  CB  . ASP A  1  348  ? 237.053 216.961 146.527 1.00   226.84 ? 589  ASP A CB  1 
ATOM   2599  C  CG  . ASP A  1  348  ? 236.365 216.365 145.307 1.00   282.74 ? 589  ASP A CG  1 
ATOM   2600  O  OD1 . ASP A  1  348  ? 235.373 216.938 144.808 1.00   351.74 ? 589  ASP A OD1 1 
ATOM   2601  O  OD2 . ASP A  1  348  ? 236.825 215.295 144.842 1.00   299.88 ? 589  ASP A OD2 1 
ATOM   2602  N  N   . PRO A  1  349  ? 237.312 220.201 148.309 1.00   154.66 ? 590  PRO A N   1 
ATOM   2603  C  CA  . PRO A  1  349  ? 237.993 220.691 149.469 1.00   153.99 ? 590  PRO A CA  1 
ATOM   2604  C  C   . PRO A  1  349  ? 237.091 220.679 150.693 1.00   142.51 ? 590  PRO A C   1 
ATOM   2605  O  O   . PRO A  1  349  ? 236.049 221.350 150.668 1.00   115.57 ? 590  PRO A O   1 
ATOM   2606  C  CB  . PRO A  1  349  ? 238.316 222.112 149.056 1.00   162.46 ? 590  PRO A CB  1 
ATOM   2607  C  CG  . PRO A  1  349  ? 237.172 222.497 148.156 1.00   158.53 ? 590  PRO A CG  1 
ATOM   2608  C  CD  . PRO A  1  349  ? 236.501 221.256 147.684 1.00   147.87 ? 590  PRO A CD  1 
ATOM   2609  N  N   . VAL A  1  350  ? 237.502 219.952 151.743 1.00   131.08 ? 591  VAL A N   1 
ATOM   2610  C  CA  . VAL A  1  350  ? 236.776 219.965 153.023 1.00   142.17 ? 591  VAL A CA  1 
ATOM   2611  C  C   . VAL A  1  350  ? 237.681 220.182 154.209 1.00   145.76 ? 591  VAL A C   1 
ATOM   2612  O  O   . VAL A  1  350  ? 238.610 219.412 154.433 1.00   144.35 ? 591  VAL A O   1 
ATOM   2613  C  CB  . VAL A  1  350  ? 236.008 218.678 153.293 1.00   139.70 ? 591  VAL A CB  1 
ATOM   2614  C  CG1 . VAL A  1  350  ? 234.858 218.577 152.321 1.00   166.26 ? 591  VAL A CG1 1 
ATOM   2615  C  CG2 . VAL A  1  350  ? 236.916 217.469 153.200 1.00   149.94 ? 591  VAL A CG2 1 
ATOM   2616  N  N   . HIS A  1  351  ? 237.391 221.246 154.953 1.00   150.24 ? 592  HIS A N   1 
ATOM   2617  C  CA  . HIS A  1  351  ? 237.984 221.521 156.247 1.00   166.28 ? 592  HIS A CA  1 
ATOM   2618  C  C   . HIS A  1  351  ? 239.500 221.353 156.296 1.00   164.25 ? 592  HIS A C   1 
ATOM   2619  O  O   . HIS A  1  351  ? 240.011 220.497 157.023 1.00   200.68 ? 592  HIS A O   1 
ATOM   2620  C  CB  . HIS A  1  351  ? 237.316 220.654 157.327 1.00   185.15 ? 592  HIS A CB  1 
ATOM   2621  C  CG  . HIS A  1  351  ? 237.824 220.924 158.716 1.00   240.93 ? 592  HIS A CG  1 
ATOM   2622  N  ND1 . HIS A  1  351  ? 237.331 221.943 159.500 1.00   271.89 ? 592  HIS A ND1 1 
ATOM   2623  C  CD2 . HIS A  1  351  ? 238.780 220.309 159.461 1.00   258.40 ? 592  HIS A CD2 1 
ATOM   2624  C  CE1 . HIS A  1  351  ? 237.969 221.955 160.659 1.00   286.58 ? 592  HIS A CE1 1 
ATOM   2625  N  NE2 . HIS A  1  351  ? 238.857 220.974 160.659 1.00   267.01 ? 592  HIS A NE2 1 
ATOM   2626  N  N   . ASN A  1  352  ? 240.226 222.154 155.529 1.00   132.17 ? 593  ASN A N   1 
ATOM   2627  C  CA  . ASN A  1  352  ? 241.677 222.133 155.612 1.00   139.54 ? 593  ASN A CA  1 
ATOM   2628  C  C   . ASN A  1  352  ? 242.312 221.225 154.587 1.00   142.54 ? 593  ASN A C   1 
ATOM   2629  O  O   . ASN A  1  352  ? 243.473 221.396 154.253 1.00   166.88 ? 593  ASN A O   1 
ATOM   2630  C  CB  . ASN A  1  352  ? 242.165 221.695 157.009 1.00   159.72 ? 593  ASN A CB  1 
ATOM   2631  C  CG  . ASN A  1  352  ? 243.632 221.903 157.196 1.00   199.76 ? 593  ASN A CG  1 
ATOM   2632  O  OD1 . ASN A  1  352  ? 244.201 222.846 156.653 1.00   263.78 ? 593  ASN A OD1 1 
ATOM   2633  N  ND2 . ASN A  1  352  ? 244.261 221.017 157.956 1.00   204.90 ? 593  ASN A ND2 1 
ATOM   2634  N  N   . ARG A  1  353  ? 241.593 220.228 154.111 1.00   142.16 ? 594  ARG A N   1 
ATOM   2635  C  CA  . ARG A  1  353  ? 242.160 219.347 153.126 1.00   140.66 ? 594  ARG A CA  1 
ATOM   2636  C  C   . ARG A  1  353  ? 241.593 219.707 151.754 1.00   161.27 ? 594  ARG A C   1 
ATOM   2637  O  O   . ARG A  1  353  ? 240.391 219.952 151.580 1.00   210.58 ? 594  ARG A O   1 
ATOM   2638  C  CB  . ARG A  1  353  ? 241.900 217.885 153.473 1.00   153.25 ? 594  ARG A CB  1 
ATOM   2639  C  CG  . ARG A  1  353  ? 242.693 217.341 154.643 1.00   156.05 ? 594  ARG A CG  1 
ATOM   2640  C  CD  . ARG A  1  353  ? 242.138 215.997 155.108 1.00   174.33 ? 594  ARG A CD  1 
ATOM   2641  N  NE  . ARG A  1  353  ? 240.716 216.070 155.498 1.00   193.68 ? 594  ARG A NE  1 
ATOM   2642  C  CZ  . ARG A  1  353  ? 240.240 216.574 156.648 1.00   198.05 ? 594  ARG A CZ  1 
ATOM   2643  N  NH1 . ARG A  1  353  ? 241.064 217.085 157.570 1.00   218.12 ? 594  ARG A NH1 1 
ATOM   2644  N  NH2 . ARG A  1  353  ? 238.920 216.574 156.883 1.00   173.08 ? 594  ARG A NH2 1 
ATOM   2645  N  N   . VAL A  1  354  ? 242.481 219.723 150.778 1.00   152.86 ? 595  VAL A N   1 
ATOM   2646  C  CA  . VAL A  1  354  ? 242.153 220.033 149.403 1.00   134.52 ? 595  VAL A CA  1 
ATOM   2647  C  C   . VAL A  1  354  ? 242.680 218.868 148.584 1.00   128.81 ? 595  VAL A C   1 
ATOM   2648  O  O   . VAL A  1  354  ? 243.586 218.162 149.017 1.00   143.38 ? 595  VAL A O   1 
ATOM   2649  C  CB  . VAL A  1  354  ? 242.867 221.340 149.042 1.00   144.79 ? 595  VAL A CB  1 
ATOM   2650  C  CG1 . VAL A  1  354  ? 242.867 221.589 147.561 1.00   163.97 ? 595  VAL A CG1 1 
ATOM   2651  C  CG2 . VAL A  1  354  ? 242.226 222.501 149.774 1.00   155.70 ? 595  VAL A CG2 1 
ATOM   2652  N  N   . THR A  1  355  ? 242.113 218.643 147.415 1.00   137.77 ? 596  THR A N   1 
ATOM   2653  C  CA  . THR A  1  355  ? 242.727 217.708 146.460 1.00   143.46 ? 596  THR A CA  1 
ATOM   2654  C  C   . THR A  1  355  ? 243.153 218.364 145.138 1.00   143.11 ? 596  THR A C   1 
ATOM   2655  O  O   . THR A  1  355  ? 242.506 219.284 144.621 1.00   163.75 ? 596  THR A O   1 
ATOM   2656  C  CB  . THR A  1  355  ? 241.868 216.450 146.189 1.00   148.58 ? 596  THR A CB  1 
ATOM   2657  O  OG1 . THR A  1  355  ? 242.663 215.509 145.476 1.00   173.48 ? 596  THR A OG1 1 
ATOM   2658  C  CG2 . THR A  1  355  ? 240.605 216.726 145.374 1.00   158.94 ? 596  THR A CG2 1 
ATOM   2659  N  N   . LEU A  1  356  ? 244.251 217.845 144.609 1.00   149.56 ? 597  LEU A N   1 
ATOM   2660  C  CA  . LEU A  1  356  ? 244.888 218.340 143.401 1.00   155.79 ? 597  LEU A CA  1 
ATOM   2661  C  C   . LEU A  1  356  ? 244.920 217.240 142.345 1.00   174.05 ? 597  LEU A C   1 
ATOM   2662  O  O   . LEU A  1  356  ? 245.395 216.144 142.630 1.00   191.46 ? 597  LEU A O   1 
ATOM   2663  C  CB  . LEU A  1  356  ? 246.332 218.713 143.712 1.00   137.19 ? 597  LEU A CB  1 
ATOM   2664  C  CG  . LEU A  1  356  ? 246.509 219.703 144.850 1.00   137.43 ? 597  LEU A CG  1 
ATOM   2665  C  CD1 . LEU A  1  356  ? 248.005 219.903 145.046 1.00   138.74 ? 597  LEU A CD1 1 
ATOM   2666  C  CD2 . LEU A  1  356  ? 245.770 221.017 144.566 1.00   132.31 ? 597  LEU A CD2 1 
ATOM   2667  N  N   . GLU A  1  357  ? 244.450 217.531 141.134 1.00   169.31 ? 598  GLU A N   1 
ATOM   2668  C  CA  . GLU A  1  357  ? 244.537 216.603 140.019 1.00   181.33 ? 598  GLU A CA  1 
ATOM   2669  C  C   . GLU A  1  357  ? 245.760 216.997 139.195 1.00   186.63 ? 598  GLU A C   1 
ATOM   2670  O  O   . GLU A  1  357  ? 245.897 218.173 138.832 1.00   180.22 ? 598  GLU A O   1 
ATOM   2671  C  CB  . GLU A  1  357  ? 243.261 216.717 139.189 1.00   224.32 ? 598  GLU A CB  1 
ATOM   2672  C  CG  . GLU A  1  357  ? 243.010 215.528 138.269 1.00   286.11 ? 598  GLU A CG  1 
ATOM   2673  C  CD  . GLU A  1  357  ? 241.691 215.607 137.501 1.00   315.66 ? 598  GLU A CD  1 
ATOM   2674  O  OE1 . GLU A  1  357  ? 240.740 216.271 137.978 1.00   338.21 ? 598  GLU A OE1 1 
ATOM   2675  O  OE2 . GLU A  1  357  ? 241.598 214.988 136.415 1.00   325.47 ? 598  GLU A OE2 1 
ATOM   2676  N  N   . LEU A  1  358  ? 246.648 216.036 138.936 1.00   176.05 ? 599  LEU A N   1 
ATOM   2677  C  CA  . LEU A  1  358  ? 247.899 216.292 138.230 1.00   198.76 ? 599  LEU A CA  1 
ATOM   2678  C  C   . LEU A  1  358  ? 247.794 215.848 136.777 1.00   241.42 ? 599  LEU A C   1 
ATOM   2679  O  O   . LEU A  1  358  ? 246.881 215.093 136.415 1.00   265.45 ? 599  LEU A O   1 
ATOM   2680  C  CB  . LEU A  1  358  ? 249.046 215.563 138.924 1.00   196.40 ? 599  LEU A CB  1 
ATOM   2681  C  CG  . LEU A  1  358  ? 249.163 215.804 140.433 1.00   203.53 ? 599  LEU A CG  1 
ATOM   2682  C  CD1 . LEU A  1  358  ? 250.252 214.911 141.020 1.00   206.69 ? 599  LEU A CD1 1 
ATOM   2683  C  CD2 . LEU A  1  358  ? 249.413 217.278 140.743 1.00   190.47 ? 599  LEU A CD2 1 
ATOM   2684  N  N   . SER A  1  359  ? 248.743 216.302 135.953 1.00   263.71 ? 600  SER A N   1 
ATOM   2685  C  CA  . SER A  1  359  ? 248.795 215.906 134.538 1.00   261.88 ? 600  SER A CA  1 
ATOM   2686  C  C   . SER A  1  359  ? 249.011 214.404 134.383 1.00   230.49 ? 600  SER A C   1 
ATOM   2687  O  O   . SER A  1  359  ? 248.545 213.799 133.426 1.00   229.52 ? 600  SER A O   1 
ATOM   2688  C  CB  . SER A  1  359  ? 249.863 216.678 133.774 1.00   275.64 ? 600  SER A CB  1 
ATOM   2689  O  OG  . SER A  1  359  ? 249.556 216.698 132.390 1.00   301.65 ? 600  SER A OG  1 
ATOM   2690  N  N   . ASN A  1  360  ? 249.716 213.813 135.337 1.00   216.95 ? 601  ASN A N   1 
ATOM   2691  C  CA  . ASN A  1  360  ? 249.713 212.365 135.552 1.00   245.47 ? 601  ASN A CA  1 
ATOM   2692  C  C   . ASN A  1  360  ? 248.302 211.706 135.585 1.00   257.38 ? 601  ASN A C   1 
ATOM   2693  O  O   . ASN A  1  360  ? 248.132 210.574 135.131 1.00   264.91 ? 601  ASN A O   1 
ATOM   2694  C  CB  . ASN A  1  360  ? 250.462 212.097 136.873 1.00   256.92 ? 601  ASN A CB  1 
ATOM   2695  C  CG  . ASN A  1  360  ? 250.786 210.634 137.101 1.00   280.45 ? 601  ASN A CG  1 
ATOM   2696  O  OD1 . ASN A  1  360  ? 250.758 209.811 136.184 1.00   302.77 ? 601  ASN A OD1 1 
ATOM   2697  N  ND2 . ASN A  1  360  ? 251.125 210.309 138.343 1.00   285.16 ? 601  ASN A ND2 1 
ATOM   2698  N  N   . GLY A  1  361  ? 247.299 212.407 136.117 1.00   263.95 ? 602  GLY A N   1 
ATOM   2699  C  CA  . GLY A  1  361  ? 245.975 211.821 136.370 1.00   257.30 ? 602  GLY A CA  1 
ATOM   2700  C  C   . GLY A  1  361  ? 245.875 211.138 137.729 1.00   246.56 ? 602  GLY A C   1 
ATOM   2701  O  O   . GLY A  1  361  ? 244.892 210.452 138.016 1.00   235.25 ? 602  GLY A O   1 
ATOM   2702  N  N   . SER A  1  362  ? 246.901 211.303 138.557 1.00   230.94 ? 603  SER A N   1 
ATOM   2703  C  CA  . SER A  1  362  ? 246.839 210.950 139.954 1.00   229.58 ? 603  SER A CA  1 
ATOM   2704  C  C   . SER A  1  362  ? 246.391 212.188 140.748 1.00   210.92 ? 603  SER A C   1 
ATOM   2705  O  O   . SER A  1  362  ? 246.770 213.325 140.448 1.00   200.10 ? 603  SER A O   1 
ATOM   2706  C  CB  . SER A  1  362  ? 248.209 210.460 140.429 1.00   234.48 ? 603  SER A CB  1 
ATOM   2707  O  OG  . SER A  1  362  ? 248.110 209.730 141.638 1.00   233.21 ? 603  SER A OG  1 
ATOM   2708  N  N   . MET A  1  363  ? 245.575 211.949 141.760 1.00   173.38 ? 604  MET A N   1 
ATOM   2709  C  CA  . MET A  1  363  ? 245.109 212.989 142.625 1.00   152.78 ? 604  MET A CA  1 
ATOM   2710  C  C   . MET A  1  363  ? 245.795 212.852 143.957 1.00   147.93 ? 604  MET A C   1 
ATOM   2711  O  O   . MET A  1  363  ? 245.864 211.744 144.483 1.00   202.48 ? 604  MET A O   1 
ATOM   2712  C  CB  . MET A  1  363  ? 243.621 212.808 142.840 1.00   184.11 ? 604  MET A CB  1 
ATOM   2713  C  CG  . MET A  1  363  ? 242.785 212.851 141.574 1.00   217.91 ? 604  MET A CG  1 
ATOM   2714  S  SD  . MET A  1  363  ? 241.131 213.459 141.966 1.00   274.82 ? 604  MET A SD  1 
ATOM   2715  C  CE  . MET A  1  363  ? 240.705 214.332 140.459 1.00   264.64 ? 604  MET A CE  1 
ATOM   2716  N  N   . VAL A  1  364  ? 246.266 213.957 144.531 1.00   140.54 ? 605  VAL A N   1 
ATOM   2717  C  CA  . VAL A  1  364  ? 246.822 213.933 145.905 1.00   146.17 ? 605  VAL A CA  1 
ATOM   2718  C  C   . VAL A  1  364  ? 246.143 214.900 146.821 1.00   132.66 ? 605  VAL A C   1 
ATOM   2719  O  O   . VAL A  1  364  ? 245.996 216.064 146.477 1.00   169.39 ? 605  VAL A O   1 
ATOM   2720  C  CB  . VAL A  1  364  ? 248.336 214.229 145.977 1.00   159.52 ? 605  VAL A CB  1 
ATOM   2721  C  CG1 . VAL A  1  364  ? 249.093 213.133 145.240 1.00   185.99 ? 605  VAL A CG1 1 
ATOM   2722  C  CG2 . VAL A  1  364  ? 248.690 215.629 145.448 1.00   155.21 ? 605  VAL A CG2 1 
ATOM   2723  N  N   . ARG A  1  365  ? 245.766 214.437 148.005 1.00   126.73 ? 606  ARG A N   1 
ATOM   2724  C  CA  . ARG A  1  365  ? 245.235 215.351 149.009 1.00   138.71 ? 606  ARG A CA  1 
ATOM   2725  C  C   . ARG A  1  365  ? 246.338 216.015 149.827 1.00   146.82 ? 606  ARG A C   1 
ATOM   2726  O  O   . ARG A  1  365  ? 247.380 215.418 150.089 1.00   179.22 ? 606  ARG A O   1 
ATOM   2727  C  CB  . ARG A  1  365  ? 244.208 214.687 149.907 1.00   132.65 ? 606  ARG A CB  1 
ATOM   2728  C  CG  . ARG A  1  365  ? 242.847 214.648 149.265 1.00   125.29 ? 606  ARG A CG  1 
ATOM   2729  C  CD  . ARG A  1  365  ? 241.841 214.040 150.220 1.00   142.64 ? 606  ARG A CD  1 
ATOM   2730  N  NE  . ARG A  1  365  ? 241.122 215.053 150.978 1.00   148.87 ? 606  ARG A NE  1 
ATOM   2731  C  CZ  . ARG A  1  365  ? 240.225 215.887 150.450 1.00   170.42 ? 606  ARG A CZ  1 
ATOM   2732  N  NH1 . ARG A  1  365  ? 239.942 215.852 149.146 1.00   199.01 ? 606  ARG A NH1 1 
ATOM   2733  N  NH2 . ARG A  1  365  ? 239.602 216.774 151.219 1.00   168.85 ? 606  ARG A NH2 1 
ATOM   2734  N  N   . ILE A  1  366  ? 246.094 217.270 150.184 1.00   147.89 ? 607  ILE A N   1 
ATOM   2735  C  CA  . ILE A  1  366  ? 247.023 218.062 150.976 1.00   146.62 ? 607  ILE A CA  1 
ATOM   2736  C  C   . ILE A  1  366  ? 246.307 218.694 152.136 1.00   165.24 ? 607  ILE A C   1 
ATOM   2737  O  O   . ILE A  1  366  ? 245.108 218.953 152.090 1.00   196.41 ? 607  ILE A O   1 
ATOM   2738  C  CB  . ILE A  1  366  ? 247.673 219.209 150.188 1.00   136.53 ? 607  ILE A CB  1 
ATOM   2739  C  CG1 . ILE A  1  366  ? 246.632 220.306 149.875 1.00   153.28 ? 607  ILE A CG1 1 
ATOM   2740  C  CG2 . ILE A  1  366  ? 248.372 218.652 148.962 1.00   134.12 ? 607  ILE A CG2 1 
ATOM   2741  C  CD1 . ILE A  1  366  ? 247.040 221.326 148.848 1.00   185.62 ? 607  ILE A CD1 1 
ATOM   2742  N  N   . THR A  1  367  ? 247.074 218.976 153.164 1.00   169.85 ? 608  THR A N   1 
ATOM   2743  C  CA  . THR A  1  367  ? 246.564 219.685 154.306 1.00   187.49 ? 608  THR A CA  1 
ATOM   2744  C  C   . THR A  1  367  ? 247.293 220.999 154.330 1.00   179.57 ? 608  THR A C   1 
ATOM   2745  O  O   . THR A  1  367  ? 248.522 221.020 154.369 1.00   233.30 ? 608  THR A O   1 
ATOM   2746  C  CB  . THR A  1  367  ? 246.846 218.923 155.611 1.00   227.49 ? 608  THR A CB  1 
ATOM   2747  O  OG1 . THR A  1  367  ? 248.169 218.374 155.561 1.00   266.59 ? 608  THR A OG1 1 
ATOM   2748  C  CG2 . THR A  1  367  ? 245.848 217.800 155.812 1.00   235.63 ? 608  THR A CG2 1 
ATOM   2749  N  N   . ILE A  1  368  ? 246.554 222.097 154.337 1.00   141.04 ? 609  ILE A N   1 
ATOM   2750  C  CA  . ILE A  1  368  ? 247.186 223.395 154.507 1.00   138.13 ? 609  ILE A CA  1 
ATOM   2751  C  C   . ILE A  1  368  ? 247.373 223.684 156.014 1.00   149.25 ? 609  ILE A C   1 
ATOM   2752  O  O   . ILE A  1  368  ? 246.515 223.331 156.793 1.00   207.24 ? 609  ILE A O   1 
ATOM   2753  C  CB  . ILE A  1  368  ? 246.324 224.439 153.865 1.00   135.64 ? 609  ILE A CB  1 
ATOM   2754  C  CG1 . ILE A  1  368  ? 246.127 224.092 152.400 1.00   156.36 ? 609  ILE A CG1 1 
ATOM   2755  C  CG2 . ILE A  1  368  ? 246.997 225.794 153.949 1.00   169.24 ? 609  ILE A CG2 1 
ATOM   2756  C  CD1 . ILE A  1  368  ? 244.982 224.867 151.793 1.00   189.03 ? 609  ILE A CD1 1 
ATOM   2757  N  N   . PRO A  1  369  ? 248.490 224.296 156.450 1.00   145.40 ? 610  PRO A N   1 
ATOM   2758  C  CA  . PRO A  1  369  ? 248.659 224.510 157.921 1.00   152.10 ? 610  PRO A CA  1 
ATOM   2759  C  C   . PRO A  1  369  ? 247.652 225.449 158.591 1.00   163.59 ? 610  PRO A C   1 
ATOM   2760  O  O   . PRO A  1  369  ? 247.268 226.401 157.976 1.00   167.86 ? 610  PRO A O   1 
ATOM   2761  C  CB  . PRO A  1  369  ? 250.044 225.134 158.044 1.00   173.17 ? 610  PRO A CB  1 
ATOM   2762  C  CG  . PRO A  1  369  ? 250.733 224.785 156.775 1.00   204.76 ? 610  PRO A CG  1 
ATOM   2763  C  CD  . PRO A  1  369  ? 249.693 224.670 155.699 1.00   175.91 ? 610  PRO A CD  1 
ATOM   2764  N  N   . GLU A  1  370  ? 247.264 225.203 159.845 1.00   202.71 ? 611  GLU A N   1 
ATOM   2765  C  CA  . GLU A  1  370  ? 246.320 226.090 160.587 1.00   199.77 ? 611  GLU A CA  1 
ATOM   2766  C  C   . GLU A  1  370  ? 247.102 227.316 161.016 1.00   203.34 ? 611  GLU A C   1 
ATOM   2767  O  O   . GLU A  1  370  ? 248.343 227.244 161.095 1.00   210.21 ? 611  GLU A O   1 
ATOM   2768  C  CB  . GLU A  1  370  ? 245.769 225.432 161.856 1.00   230.15 ? 611  GLU A CB  1 
ATOM   2769  C  CG  . GLU A  1  370  ? 245.342 223.963 161.761 1.00   253.46 ? 611  GLU A CG  1 
ATOM   2770  C  CD  . GLU A  1  370  ? 245.944 223.075 162.857 1.00   269.79 ? 611  GLU A CD  1 
ATOM   2771  O  OE1 . GLU A  1  370  ? 246.285 223.570 163.963 1.00   310.36 ? 611  GLU A OE1 1 
ATOM   2772  O  OE2 . GLU A  1  370  ? 246.074 221.857 162.611 1.00   267.74 ? 611  GLU A OE2 1 
ATOM   2773  N  N   . ILE A  1  371  ? 246.415 228.428 161.315 1.00   195.99 ? 612  ILE A N   1 
ATOM   2774  C  CA  . ILE A  1  371  ? 247.174 229.632 161.709 1.00   194.78 ? 612  ILE A CA  1 
ATOM   2775  C  C   . ILE A  1  371  ? 247.796 229.444 163.053 1.00   190.07 ? 612  ILE A C   1 
ATOM   2776  O  O   . ILE A  1  371  ? 248.905 229.848 163.213 1.00   221.53 ? 612  ILE A O   1 
ATOM   2777  C  CB  . ILE A  1  371  ? 246.440 231.000 161.749 1.00   179.34 ? 612  ILE A CB  1 
ATOM   2778  C  CG1 . ILE A  1  371  ? 245.262 231.011 162.736 1.00   203.95 ? 612  ILE A CG1 1 
ATOM   2779  C  CG2 . ILE A  1  371  ? 246.032 231.428 160.352 1.00   192.85 ? 612  ILE A CG2 1 
ATOM   2780  C  CD1 . ILE A  1  371  ? 244.697 232.397 162.980 1.00   216.99 ? 612  ILE A CD1 1 
ATOM   2781  N  N   . ALA A  1  372  ? 247.109 228.821 164.006 1.00   195.82 ? 613  ALA A N   1 
ATOM   2782  C  CA  . ALA A  1  372  ? 247.548 228.910 165.407 1.00   203.19 ? 613  ALA A CA  1 
ATOM   2783  C  C   . ALA A  1  372  ? 248.111 227.631 166.004 1.00   194.84 ? 613  ALA A C   1 
ATOM   2784  O  O   . ALA A  1  372  ? 249.310 227.529 166.170 1.00   223.69 ? 613  ALA A O   1 
ATOM   2785  C  CB  . ALA A  1  372  ? 246.432 229.456 166.271 1.00   218.58 ? 613  ALA A CB  1 
ATOM   2786  N  N   . THR A  1  373  ? 247.262 226.676 166.361 1.00   173.54 ? 614  THR A N   1 
ATOM   2787  C  CA  . THR A  1  373  ? 247.712 225.419 166.949 1.00   179.29 ? 614  THR A CA  1 
ATOM   2788  C  C   . THR A  1  373  ? 247.915 225.479 168.452 1.00   188.71 ? 614  THR A C   1 
ATOM   2789  O  O   . THR A  1  373  ? 247.791 224.434 169.085 1.00   225.47 ? 614  THR A O   1 
ATOM   2790  C  CB  . THR A  1  373  ? 249.032 224.856 166.338 1.00   192.93 ? 614  THR A CB  1 
ATOM   2791  O  OG1 . THR A  1  373  ? 248.984 224.951 164.911 1.00   239.72 ? 614  THR A OG1 1 
ATOM   2792  C  CG2 . THR A  1  373  ? 249.278 223.393 166.747 1.00   198.46 ? 614  THR A CG2 1 
ATOM   2793  N  N   . SER A  1  374  ? 248.235 226.637 169.043 1.00   180.19 ? 615  SER A N   1 
ATOM   2794  C  CA  . SER A  1  374  ? 248.434 226.732 170.510 1.00   183.98 ? 615  SER A CA  1 
ATOM   2795  C  C   . SER A  1  374  ? 247.465 227.696 171.062 1.00   186.55 ? 615  SER A C   1 
ATOM   2796  O  O   . SER A  1  374  ? 247.238 228.740 170.451 1.00   230.78 ? 615  SER A O   1 
ATOM   2797  C  CB  . SER A  1  374  ? 249.823 227.226 170.871 1.00   202.55 ? 615  SER A CB  1 
ATOM   2798  O  OG  . SER A  1  374  ? 250.715 226.142 170.930 1.00   253.22 ? 615  SER A OG  1 
ATOM   2799  N  N   . GLU A  1  375  ? 246.900 227.385 172.217 1.00   174.50 ? 616  GLU A N   1 
ATOM   2800  C  CA  . GLU A  1  375  ? 245.785 228.190 172.641 1.00   186.53 ? 616  GLU A CA  1 
ATOM   2801  C  C   . GLU A  1  375  ? 246.241 229.601 172.995 1.00   195.54 ? 616  GLU A C   1 
ATOM   2802  O  O   . GLU A  1  375  ? 245.569 230.543 172.612 1.00   225.80 ? 616  GLU A O   1 
ATOM   2803  C  CB  . GLU A  1  375  ? 244.990 227.540 173.742 1.00   198.56 ? 616  GLU A CB  1 
ATOM   2804  C  CG  . GLU A  1  375  ? 243.509 227.657 173.456 1.00   234.84 ? 616  GLU A CG  1 
ATOM   2805  C  CD  . GLU A  1  375  ? 242.654 227.259 174.630 1.00   298.25 ? 616  GLU A CD  1 
ATOM   2806  O  OE1 . GLU A  1  375  ? 243.017 226.292 175.338 1.00   342.11 ? 616  GLU A OE1 1 
ATOM   2807  O  OE2 . GLU A  1  375  ? 241.633 227.943 174.861 1.00   342.75 ? 616  GLU A OE2 1 
ATOM   2808  N  N   . LEU A  1  376  ? 247.394 229.754 173.658 1.00   176.22 ? 617  LEU A N   1 
ATOM   2809  C  CA  . LEU A  1  376  ? 247.960 231.082 173.897 1.00   154.23 ? 617  LEU A CA  1 
ATOM   2810  C  C   . LEU A  1  376  ? 248.156 231.853 172.646 1.00   170.93 ? 617  LEU A C   1 
ATOM   2811  O  O   . LEU A  1  376  ? 247.878 233.042 172.634 1.00   224.07 ? 617  LEU A O   1 
ATOM   2812  C  CB  . LEU A  1  376  ? 249.354 231.019 174.445 1.00   167.39 ? 617  LEU A CB  1 
ATOM   2813  C  CG  . LEU A  1  376  ? 249.603 230.394 175.776 1.00   237.58 ? 617  LEU A CG  1 
ATOM   2814  C  CD1 . LEU A  1  376  ? 251.088 230.573 176.095 1.00   272.29 ? 617  LEU A CD1 1 
ATOM   2815  C  CD2 . LEU A  1  376  ? 248.682 231.044 176.787 1.00   247.28 ? 617  LEU A CD2 1 
ATOM   2816  N  N   . VAL A  1  377  ? 248.715 231.205 171.623 1.00   156.62 ? 618  VAL A N   1 
ATOM   2817  C  CA  . VAL A  1  377  ? 249.128 231.923 170.420 1.00   153.31 ? 618  VAL A CA  1 
ATOM   2818  C  C   . VAL A  1  377  ? 247.895 232.396 169.701 1.00   162.51 ? 618  VAL A C   1 
ATOM   2819  O  O   . VAL A  1  377  ? 247.824 233.540 169.260 1.00   176.18 ? 618  VAL A O   1 
ATOM   2820  C  CB  . VAL A  1  377  ? 249.941 231.075 169.442 1.00   155.15 ? 618  VAL A CB  1 
ATOM   2821  C  CG1 . VAL A  1  377  ? 250.329 231.927 168.243 1.00   167.31 ? 618  VAL A CG1 1 
ATOM   2822  C  CG2 . VAL A  1  377  ? 251.199 230.526 170.100 1.00   177.55 ? 618  VAL A CG2 1 
ATOM   2823  N  N   . GLN A  1  378  ? 246.933 231.490 169.609 1.00   162.15 ? 619  GLN A N   1 
ATOM   2824  C  CA  . GLN A  1  378  ? 245.672 231.761 168.962 1.00   163.79 ? 619  GLN A CA  1 
ATOM   2825  C  C   . GLN A  1  378  ? 244.980 232.923 169.634 1.00   160.39 ? 619  GLN A C   1 
ATOM   2826  O  O   . GLN A  1  378  ? 244.578 233.881 168.982 1.00   198.86 ? 619  GLN A O   1 
ATOM   2827  C  CB  . GLN A  1  378  ? 244.787 230.527 169.012 1.00   153.03 ? 619  GLN A CB  1 
ATOM   2828  C  CG  . GLN A  1  378  ? 243.705 230.538 167.967 1.00   167.97 ? 619  GLN A CG  1 
ATOM   2829  C  CD  . GLN A  1  378  ? 242.999 229.207 167.898 1.00   220.59 ? 619  GLN A CD  1 
ATOM   2830  O  OE1 . GLN A  1  378  ? 243.431 228.230 168.514 1.00   241.72 ? 619  GLN A OE1 1 
ATOM   2831  N  NE2 . GLN A  1  378  ? 241.903 229.160 167.152 1.00   269.87 ? 619  GLN A NE2 1 
ATOM   2832  N  N   . THR A  1  379  ? 244.895 232.835 170.950 1.00   146.89 ? 620  THR A N   1 
ATOM   2833  C  CA  . THR A  1  379  ? 244.197 233.803 171.760 1.00   158.56 ? 620  THR A CA  1 
ATOM   2834  C  C   . THR A  1  379  ? 244.735 235.180 171.484 1.00   153.71 ? 620  THR A C   1 
ATOM   2835  O  O   . THR A  1  379  ? 243.979 236.099 171.199 1.00   183.57 ? 620  THR A O   1 
ATOM   2836  C  CB  . THR A  1  379  ? 244.421 233.495 173.247 1.00   180.41 ? 620  THR A CB  1 
ATOM   2837  O  OG1 . THR A  1  379  ? 244.275 232.094 173.476 1.00   244.74 ? 620  THR A OG1 1 
ATOM   2838  C  CG2 . THR A  1  379  ? 243.448 234.215 174.095 1.00   186.77 ? 620  THR A CG2 1 
ATOM   2839  N  N   . CYS A  1  380  ? 246.048 235.309 171.553 1.00   157.01 ? 621  CYS A N   1 
ATOM   2840  C  CA  . CYS A  1  380  ? 246.696 236.589 171.341 1.00   183.20 ? 621  CYS A CA  1 
ATOM   2841  C  C   . CYS A  1  380  ? 246.415 237.076 169.936 1.00   192.81 ? 621  CYS A C   1 
ATOM   2842  O  O   . CYS A  1  380  ? 246.097 238.249 169.744 1.00   214.94 ? 621  CYS A O   1 
ATOM   2843  C  CB  . CYS A  1  380  ? 248.195 236.495 171.608 1.00   188.99 ? 621  CYS A CB  1 
ATOM   2844  S  SG  . CYS A  1  380  ? 248.523 235.908 173.291 1.00   239.49 ? 621  CYS A SG  1 
ATOM   2845  N  N   . LEU A  1  381  ? 246.468 236.173 168.961 1.00   182.46 ? 622  LEU A N   1 
ATOM   2846  C  CA  . LEU A  1  381  ? 246.190 236.576 167.594 1.00   178.78 ? 622  LEU A CA  1 
ATOM   2847  C  C   . LEU A  1  381  ? 244.821 237.207 167.466 1.00   175.33 ? 622  LEU A C   1 
ATOM   2848  O  O   . LEU A  1  381  ? 244.711 238.279 166.870 1.00   229.54 ? 622  LEU A O   1 
ATOM   2849  C  CB  . LEU A  1  381  ? 246.362 235.426 166.612 1.00   167.62 ? 622  LEU A CB  1 
ATOM   2850  C  CG  . LEU A  1  381  ? 247.843 235.150 166.345 1.00   182.34 ? 622  LEU A CG  1 
ATOM   2851  C  CD1 . LEU A  1  381  ? 247.923 233.916 165.468 1.00   219.12 ? 622  LEU A CD1 1 
ATOM   2852  C  CD2 . LEU A  1  381  ? 248.603 236.313 165.698 1.00   171.89 ? 622  LEU A CD2 1 
ATOM   2853  N  N   . GLN A  1  382  ? 243.801 236.569 168.037 1.00   168.53 ? 623  GLN A N   1 
ATOM   2854  C  CA  . GLN A  1  382  ? 242.429 237.093 167.965 1.00   192.79 ? 623  GLN A CA  1 
ATOM   2855  C  C   . GLN A  1  382  ? 242.411 238.513 168.463 1.00   191.42 ? 623  GLN A C   1 
ATOM   2856  O  O   . GLN A  1  382  ? 241.891 239.420 167.800 1.00   231.51 ? 623  GLN A O   1 
ATOM   2857  C  CB  . GLN A  1  382  ? 241.429 236.294 168.840 1.00   206.35 ? 623  GLN A CB  1 
ATOM   2858  C  CG  . GLN A  1  382  ? 241.245 234.819 168.515 1.00   227.90 ? 623  GLN A CG  1 
ATOM   2859  C  CD  . GLN A  1  382  ? 241.103 234.555 167.031 1.00   252.80 ? 623  GLN A CD  1 
ATOM   2860  O  OE1 . GLN A  1  382  ? 241.850 233.759 166.452 1.00   274.55 ? 623  GLN A OE1 1 
ATOM   2861  N  NE2 . GLN A  1  382  ? 240.151 235.243 166.401 1.00   253.87 ? 623  GLN A NE2 1 
ATOM   2862  N  N   . ALA A  1  383  ? 242.977 238.685 169.647 1.00   168.76 ? 624  ALA A N   1 
ATOM   2863  C  CA  . ALA A  1  383  ? 242.920 239.962 170.317 1.00   179.48 ? 624  ALA A CA  1 
ATOM   2864  C  C   . ALA A  1  383  ? 243.731 241.011 169.548 1.00   177.99 ? 624  ALA A C   1 
ATOM   2865  O  O   . ALA A  1  383  ? 243.273 242.137 169.383 1.00   216.57 ? 624  ALA A O   1 
ATOM   2866  C  CB  . ALA A  1  383  ? 243.385 239.823 171.755 1.00   184.51 ? 624  ALA A CB  1 
ATOM   2867  N  N   . ILE A  1  384  ? 244.906 240.628 169.060 1.00   156.66 ? 625  ILE A N   1 
ATOM   2868  C  CA  . ILE A  1  384  ? 245.752 241.506 168.256 1.00   163.63 ? 625  ILE A CA  1 
ATOM   2869  C  C   . ILE A  1  384  ? 245.024 242.007 167.023 1.00   176.55 ? 625  ILE A C   1 
ATOM   2870  O  O   . ILE A  1  384  ? 245.077 243.184 166.695 1.00   217.38 ? 625  ILE A O   1 
ATOM   2871  C  CB  . ILE A  1  384  ? 247.020 240.744 167.827 1.00   188.61 ? 625  ILE A CB  1 
ATOM   2872  C  CG1 . ILE A  1  384  ? 248.004 240.716 169.011 1.00   208.02 ? 625  ILE A CG1 1 
ATOM   2873  C  CG2 . ILE A  1  384  ? 247.652 241.322 166.554 1.00   196.70 ? 625  ILE A CG2 1 
ATOM   2874  C  CD1 . ILE A  1  384  ? 248.956 239.529 169.018 1.00   214.88 ? 625  ILE A CD1 1 
ATOM   2875  N  N   . LYS A  1  385  ? 244.378 241.076 166.343 1.00   173.43 ? 626  LYS A N   1 
ATOM   2876  C  CA  . LYS A  1  385  ? 243.634 241.344 165.125 1.00   186.28 ? 626  LYS A CA  1 
ATOM   2877  C  C   . LYS A  1  385  ? 242.444 242.272 165.371 1.00   193.96 ? 626  LYS A C   1 
ATOM   2878  O  O   . LYS A  1  385  ? 242.219 243.194 164.591 1.00   248.35 ? 626  LYS A O   1 
ATOM   2879  C  CB  . LYS A  1  385  ? 243.158 240.007 164.587 1.00   194.27 ? 626  LYS A CB  1 
ATOM   2880  C  CG  . LYS A  1  385  ? 242.344 240.013 163.316 1.00   215.32 ? 626  LYS A CG  1 
ATOM   2881  C  CD  . LYS A  1  385  ? 242.131 238.581 162.846 1.00   245.39 ? 626  LYS A CD  1 
ATOM   2882  C  CE  . LYS A  1  385  ? 241.234 237.762 163.775 1.00   265.85 ? 626  LYS A CE  1 
ATOM   2883  N  NZ  . LYS A  1  385  ? 241.078 236.347 163.329 1.00   281.14 ? 626  LYS A NZ  1 
ATOM   2884  N  N   . PHE A  1  386  ? 241.690 242.016 166.438 1.00   174.10 ? 627  PHE A N   1 
ATOM   2885  C  CA  . PHE A  1  386  ? 240.590 242.882 166.843 1.00   184.27 ? 627  PHE A CA  1 
ATOM   2886  C  C   . PHE A  1  386  ? 241.038 244.333 167.054 1.00   195.21 ? 627  PHE A C   1 
ATOM   2887  O  O   . PHE A  1  386  ? 240.376 245.240 166.558 1.00   206.12 ? 627  PHE A O   1 
ATOM   2888  C  CB  . PHE A  1  386  ? 239.927 242.377 168.131 1.00   179.60 ? 627  PHE A CB  1 
ATOM   2889  C  CG  . PHE A  1  386  ? 238.875 243.311 168.679 1.00   206.53 ? 627  PHE A CG  1 
ATOM   2890  C  CD1 . PHE A  1  386  ? 239.229 244.506 169.344 1.00   231.46 ? 627  PHE A CD1 1 
ATOM   2891  C  CD2 . PHE A  1  386  ? 237.528 243.020 168.527 1.00   232.08 ? 627  PHE A CD2 1 
ATOM   2892  C  CE1 . PHE A  1  386  ? 238.268 245.382 169.833 1.00   249.54 ? 627  PHE A CE1 1 
ATOM   2893  C  CE2 . PHE A  1  386  ? 236.558 243.890 169.028 1.00   281.34 ? 627  PHE A CE2 1 
ATOM   2894  C  CZ  . PHE A  1  386  ? 236.929 245.074 169.678 1.00   276.37 ? 627  PHE A CZ  1 
ATOM   2895  N  N   . ILE A  1  387  ? 242.109 244.566 167.815 1.00   177.14 ? 628  ILE A N   1 
ATOM   2896  C  CA  . ILE A  1  387  ? 242.471 245.955 168.128 1.00   175.30 ? 628  ILE A CA  1 
ATOM   2897  C  C   . ILE A  1  387  ? 243.039 246.762 166.981 1.00   195.86 ? 628  ILE A C   1 
ATOM   2898  O  O   . ILE A  1  387  ? 242.743 247.947 166.900 1.00   201.80 ? 628  ILE A O   1 
ATOM   2899  C  CB  . ILE A  1  387  ? 243.465 246.129 169.276 1.00   185.17 ? 628  ILE A CB  1 
ATOM   2900  C  CG1 . ILE A  1  387  ? 244.732 245.292 169.031 1.00   232.49 ? 628  ILE A CG1 1 
ATOM   2901  C  CG2 . ILE A  1  387  ? 242.784 245.831 170.597 1.00   180.02 ? 628  ILE A CG2 1 
ATOM   2902  C  CD1 . ILE A  1  387  ? 246.023 246.006 169.358 1.00   260.75 ? 628  ILE A CD1 1 
ATOM   2903  N  N   . LEU A  1  388  ? 243.873 246.170 166.128 1.00   193.60 ? 629  LEU A N   1 
ATOM   2904  C  CA  . LEU A  1  388  ? 244.486 246.946 165.042 1.00   198.00 ? 629  LEU A CA  1 
ATOM   2905  C  C   . LEU A  1  388  ? 243.382 247.126 163.950 1.00   236.41 ? 629  LEU A C   1 
ATOM   2906  O  O   . LEU A  1  388  ? 242.343 246.469 164.050 1.00   277.04 ? 629  LEU A O   1 
ATOM   2907  C  CB  . LEU A  1  388  ? 245.794 246.292 164.588 1.00   185.25 ? 629  LEU A CB  1 
ATOM   2908  C  CG  . LEU A  1  388  ? 245.698 244.838 164.114 1.00   249.83 ? 629  LEU A CG  1 
ATOM   2909  C  CD1 . LEU A  1  388  ? 244.701 244.678 162.973 1.00   305.43 ? 629  LEU A CD1 1 
ATOM   2910  C  CD2 . LEU A  1  388  ? 247.068 244.297 163.704 1.00   279.75 ? 629  LEU A CD2 1 
ATOM   2911  N  N   . PRO A  1  389  ? 243.555 248.026 162.943 1.00   228.51 ? 630  PRO A N   1 
ATOM   2912  C  CA  . PRO A  1  389  ? 242.383 248.306 162.069 1.00   220.59 ? 630  PRO A CA  1 
ATOM   2913  C  C   . PRO A  1  389  ? 241.971 247.139 161.131 1.00   232.05 ? 630  PRO A C   1 
ATOM   2914  O  O   . PRO A  1  389  ? 241.467 246.141 161.624 1.00   259.95 ? 630  PRO A O   1 
ATOM   2915  C  CB  . PRO A  1  389  ? 242.801 249.589 161.343 1.00   209.76 ? 630  PRO A CB  1 
ATOM   2916  C  CG  . PRO A  1  389  ? 244.267 249.451 161.232 1.00   209.05 ? 630  PRO A CG  1 
ATOM   2917  C  CD  . PRO A  1  389  ? 244.705 248.862 162.552 1.00   209.55 ? 630  PRO A CD  1 
ATOM   2918  N  N   . LYS A  1  390  ? 242.059 247.263 159.812 1.00   226.98 ? 631  LYS A N   1 
ATOM   2919  C  CA  . LYS A  1  390  ? 241.913 246.079 158.947 1.00   220.17 ? 631  LYS A CA  1 
ATOM   2920  C  C   . LYS A  1  390  ? 243.163 245.896 158.119 1.00   221.71 ? 631  LYS A C   1 
ATOM   2921  O  O   . LYS A  1  390  ? 243.578 244.768 157.907 1.00   253.42 ? 631  LYS A O   1 
ATOM   2922  C  CB  . LYS A  1  390  ? 240.647 246.126 158.063 1.00   170.97 ? 631  LYS A CB  1 
ATOM   2923  N  N   . GLU A  1  391  ? 243.733 246.997 157.628 1.00   214.67 ? 632  GLU A N   1 
ATOM   2924  C  CA  . GLU A  1  391  ? 244.980 246.982 156.878 1.00   217.49 ? 632  GLU A CA  1 
ATOM   2925  C  C   . GLU A  1  391  ? 246.067 246.288 157.672 1.00   229.21 ? 632  GLU A C   1 
ATOM   2926  O  O   . GLU A  1  391  ? 246.800 245.426 157.153 1.00   267.72 ? 632  GLU A O   1 
ATOM   2927  C  CB  . GLU A  1  391  ? 245.424 248.419 156.551 1.00   192.29 ? 632  GLU A CB  1 
ATOM   2928  N  N   . ILE A  1  392  ? 246.185 246.654 158.937 1.00   205.86 ? 633  ILE A N   1 
ATOM   2929  C  CA  . ILE A  1  392  ? 247.317 246.148 159.679 1.00   216.03 ? 633  ILE A CA  1 
ATOM   2930  C  C   . ILE A  1  392  ? 247.108 244.626 159.917 1.00   220.22 ? 633  ILE A C   1 
ATOM   2931  O  O   . ILE A  1  392  ? 248.073 243.878 159.822 1.00   220.74 ? 633  ILE A O   1 
ATOM   2932  C  CB  . ILE A  1  392  ? 247.650 247.000 160.933 1.00   241.79 ? 633  ILE A CB  1 
ATOM   2933  C  CG1 . ILE A  1  392  ? 247.828 248.488 160.548 1.00   226.38 ? 633  ILE A CG1 1 
ATOM   2934  C  CG2 . ILE A  1  392  ? 248.951 246.518 161.583 1.00   236.14 ? 633  ILE A CG2 1 
ATOM   2935  C  CD1 . ILE A  1  392  ? 248.045 249.414 161.735 1.00   254.52 ? 633  ILE A CD1 1 
ATOM   2936  N  N   . ALA A  1  393  ? 245.867 244.164 160.145 1.00   214.84 ? 634  ALA A N   1 
ATOM   2937  C  CA  . ALA A  1  393  ? 245.573 242.705 160.383 1.00   222.81 ? 634  ALA A CA  1 
ATOM   2938  C  C   . ALA A  1  393  ? 246.056 241.855 159.225 1.00   217.85 ? 634  ALA A C   1 
ATOM   2939  O  O   . ALA A  1  393  ? 246.627 240.777 159.403 1.00   239.51 ? 634  ALA A O   1 
ATOM   2940  C  CB  . ALA A  1  393  ? 244.072 242.464 160.563 1.00   219.87 ? 634  ALA A CB  1 
ATOM   2941  N  N   . VAL A  1  394  ? 245.774 242.351 158.033 1.00   221.15 ? 635  VAL A N   1 
ATOM   2942  C  CA  . VAL A  1  394  ? 246.247 241.754 156.803 1.00   220.36 ? 635  VAL A CA  1 
ATOM   2943  C  C   . VAL A  1  394  ? 247.735 241.499 156.885 1.00   199.16 ? 635  VAL A C   1 
ATOM   2944  O  O   . VAL A  1  394  ? 248.183 240.360 156.772 1.00   189.82 ? 635  VAL A O   1 
ATOM   2945  C  CB  . VAL A  1  394  ? 245.921 242.699 155.611 1.00   263.69 ? 635  VAL A CB  1 
ATOM   2946  C  CG1 . VAL A  1  394  ? 246.812 242.462 154.385 1.00   276.95 ? 635  VAL A CG1 1 
ATOM   2947  C  CG2 . VAL A  1  394  ? 244.440 242.610 155.257 1.00   287.20 ? 635  VAL A CG2 1 
ATOM   2948  N  N   . GLN A  1  395  ? 248.479 242.565 157.129 1.00   198.64 ? 636  GLN A N   1 
ATOM   2949  C  CA  . GLN A  1  395  ? 249.936 242.498 157.025 1.00   224.41 ? 636  GLN A CA  1 
ATOM   2950  C  C   . GLN A  1  395  ? 250.569 241.746 158.203 1.00   213.68 ? 636  GLN A C   1 
ATOM   2951  O  O   . GLN A  1  395  ? 251.580 241.071 158.038 1.00   202.75 ? 636  GLN A O   1 
ATOM   2952  C  CB  . GLN A  1  395  ? 250.517 243.897 156.872 1.00   238.67 ? 636  GLN A CB  1 
ATOM   2953  C  CG  . GLN A  1  395  ? 250.039 244.606 155.616 1.00   243.89 ? 636  GLN A CG  1 
ATOM   2954  C  CD  . GLN A  1  395  ? 250.413 246.066 155.622 1.00   265.28 ? 636  GLN A CD  1 
ATOM   2955  O  OE1 . GLN A  1  395  ? 249.551 246.948 155.657 1.00   279.22 ? 636  GLN A OE1 1 
ATOM   2956  N  NE2 . GLN A  1  395  ? 251.711 246.332 155.613 1.00   278.43 ? 636  GLN A NE2 1 
ATOM   2957  N  N   . MET A  1  396  ? 249.989 241.892 159.391 1.00   198.93 ? 637  MET A N   1 
ATOM   2958  C  CA  . MET A  1  396  ? 250.377 241.109 160.588 1.00   196.16 ? 637  MET A CA  1 
ATOM   2959  C  C   . MET A  1  396  ? 250.189 239.653 160.319 1.00   191.94 ? 637  MET A C   1 
ATOM   2960  O  O   . MET A  1  396  ? 251.125 238.859 160.422 1.00   203.08 ? 637  MET A O   1 
ATOM   2961  C  CB  . MET A  1  396  ? 249.484 241.514 161.794 1.00   214.07 ? 637  MET A CB  1 
ATOM   2962  C  CG  . MET A  1  396  ? 249.253 240.507 162.933 1.00   222.80 ? 637  MET A CG  1 
ATOM   2963  S  SD  . MET A  1  396  ? 250.707 239.685 163.633 1.00   301.00 ? 637  MET A SD  1 
ATOM   2964  C  CE  . MET A  1  396  ? 251.930 241.005 163.731 1.00   314.68 ? 637  MET A CE  1 
ATOM   2965  N  N   . LEU A  1  397  ? 248.949 239.310 159.995 1.00   193.55 ? 638  LEU A N   1 
ATOM   2966  C  CA  . LEU A  1  397  ? 248.596 237.915 159.973 1.00   180.26 ? 638  LEU A CA  1 
ATOM   2967  C  C   . LEU A  1  397  ? 249.359 237.207 158.857 1.00   184.17 ? 638  LEU A C   1 
ATOM   2968  O  O   . LEU A  1  397  ? 249.896 236.107 159.063 1.00   216.00 ? 638  LEU A O   1 
ATOM   2969  C  CB  . LEU A  1  397  ? 247.086 237.686 159.921 1.00   166.04 ? 638  LEU A CB  1 
ATOM   2970  C  CG  . LEU A  1  397  ? 246.634 236.753 161.045 1.00   196.25 ? 638  LEU A CG  1 
ATOM   2971  C  CD1 . LEU A  1  397  ? 245.121 236.711 161.146 1.00   215.74 ? 638  LEU A CD1 1 
ATOM   2972  C  CD2 . LEU A  1  397  ? 247.206 235.356 160.831 1.00   233.52 ? 638  LEU A CD2 1 
ATOM   2973  N  N   . VAL A  1  398  ? 249.458 237.842 157.693 1.00   183.42 ? 639  VAL A N   1 
ATOM   2974  C  CA  . VAL A  1  398  ? 250.222 237.261 156.592 1.00   197.94 ? 639  VAL A CA  1 
ATOM   2975  C  C   . VAL A  1  398  ? 251.679 237.015 156.965 1.00   175.14 ? 639  VAL A C   1 
ATOM   2976  O  O   . VAL A  1  398  ? 252.261 235.993 156.590 1.00   177.91 ? 639  VAL A O   1 
ATOM   2977  C  CB  . VAL A  1  398  ? 250.170 238.088 155.273 1.00   230.85 ? 639  VAL A CB  1 
ATOM   2978  C  CG1 . VAL A  1  398  ? 250.854 239.440 155.413 1.00   244.84 ? 639  VAL A CG1 1 
ATOM   2979  C  CG2 . VAL A  1  398  ? 250.809 237.312 154.121 1.00   240.87 ? 639  VAL A CG2 1 
ATOM   2980  N  N   . LYS A  1  399  ? 252.257 237.962 157.694 1.00   172.47 ? 640  LYS A N   1 
ATOM   2981  C  CA  . LYS A  1  399  ? 253.675 237.908 158.057 1.00   213.66 ? 640  LYS A CA  1 
ATOM   2982  C  C   . LYS A  1  399  ? 253.908 236.652 158.893 1.00   194.95 ? 640  LYS A C   1 
ATOM   2983  O  O   . LYS A  1  399  ? 254.835 235.848 158.639 1.00   163.91 ? 640  LYS A O   1 
ATOM   2984  C  CB  . LYS A  1  399  ? 254.061 239.210 158.809 1.00   223.72 ? 640  LYS A CB  1 
ATOM   2985  C  CG  . LYS A  1  399  ? 255.467 239.325 159.395 1.00   225.44 ? 640  LYS A CG  1 
ATOM   2986  C  CD  . LYS A  1  399  ? 256.568 239.385 158.340 1.00   231.01 ? 640  LYS A CD  1 
ATOM   2987  C  CE  . LYS A  1  399  ? 257.345 238.073 158.196 1.00   260.09 ? 640  LYS A CE  1 
ATOM   2988  N  NZ  . LYS A  1  399  ? 256.840 237.084 157.192 1.00   280.46 ? 640  LYS A NZ  1 
ATOM   2989  N  N   . TRP A  1  400  ? 253.024 236.483 159.868 1.00   184.97 ? 641  TRP A N   1 
ATOM   2990  C  CA  . TRP A  1  400  ? 253.194 235.433 160.843 1.00   181.20 ? 641  TRP A CA  1 
ATOM   2991  C  C   . TRP A  1  400  ? 252.903 234.114 160.235 1.00   178.15 ? 641  TRP A C   1 
ATOM   2992  O  O   . TRP A  1  400  ? 253.650 233.174 160.463 1.00   186.71 ? 641  TRP A O   1 
ATOM   2993  C  CB  . TRP A  1  400  ? 252.299 235.604 162.065 1.00   169.88 ? 641  TRP A CB  1 
ATOM   2994  C  CG  . TRP A  1  400  ? 252.636 234.565 163.020 1.00   158.04 ? 641  TRP A CG  1 
ATOM   2995  C  CD1 . TRP A  1  400  ? 253.833 234.386 163.700 1.00   191.78 ? 641  TRP A CD1 1 
ATOM   2996  C  CD2 . TRP A  1  400  ? 251.844 233.493 163.334 1.00   139.87 ? 641  TRP A CD2 1 
ATOM   2997  N  NE1 . TRP A  1  400  ? 253.792 233.250 164.471 1.00   157.11 ? 641  TRP A NE1 1 
ATOM   2998  C  CE2 . TRP A  1  400  ? 252.581 232.670 164.267 1.00   145.42 ? 641  TRP A CE2 1 
ATOM   2999  C  CE3 . TRP A  1  400  ? 250.584 233.120 162.933 1.00   144.02 ? 641  TRP A CE3 1 
ATOM   3000  C  CZ2 . TRP A  1  400  ? 252.081 231.517 164.797 1.00   140.44 ? 641  TRP A CZ2 1 
ATOM   3001  C  CZ3 . TRP A  1  400  ? 250.071 232.002 163.455 1.00   188.07 ? 641  TRP A CZ3 1 
ATOM   3002  C  CH2 . TRP A  1  400  ? 250.822 231.181 164.401 1.00   191.13 ? 641  TRP A CH2 1 
ATOM   3003  N  N   . TYR A  1  401  ? 251.833 234.065 159.451 1.00   187.09 ? 642  TYR A N   1 
ATOM   3004  C  CA  . TYR A  1  401  ? 251.427 232.853 158.765 1.00   189.29 ? 642  TYR A CA  1 
ATOM   3005  C  C   . TYR A  1  401  ? 252.577 232.250 157.968 1.00   165.55 ? 642  TYR A C   1 
ATOM   3006  O  O   . TYR A  1  401  ? 252.834 231.046 158.065 1.00   190.32 ? 642  TYR A O   1 
ATOM   3007  C  CB  . TYR A  1  401  ? 250.237 233.078 157.821 1.00   190.15 ? 642  TYR A CB  1 
ATOM   3008  C  CG  . TYR A  1  401  ? 249.664 231.767 157.371 1.00   173.19 ? 642  TYR A CG  1 
ATOM   3009  C  CD1 . TYR A  1  401  ? 250.355 230.970 156.465 1.00   184.37 ? 642  TYR A CD1 1 
ATOM   3010  C  CD2 . TYR A  1  401  ? 248.476 231.297 157.881 1.00   162.80 ? 642  TYR A CD2 1 
ATOM   3011  C  CE1 . TYR A  1  401  ? 249.884 229.748 156.079 1.00   186.96 ? 642  TYR A CE1 1 
ATOM   3012  C  CE2 . TYR A  1  401  ? 247.985 230.082 157.479 1.00   188.21 ? 642  TYR A CE2 1 
ATOM   3013  C  CZ  . TYR A  1  401  ? 248.711 229.318 156.578 1.00   196.53 ? 642  TYR A CZ  1 
ATOM   3014  O  OH  . TYR A  1  401  ? 248.274 228.106 156.135 1.00   254.00 ? 642  TYR A OH  1 
ATOM   3015  N  N   . ASN A  1  402  ? 253.225 233.079 157.161 1.00   143.79 ? 643  ASN A N   1 
ATOM   3016  C  CA  . ASN A  1  402  ? 254.331 232.626 156.367 1.00   162.39 ? 643  ASN A CA  1 
ATOM   3017  C  C   . ASN A  1  402  ? 255.368 231.910 157.262 1.00   176.74 ? 643  ASN A C   1 
ATOM   3018  O  O   . ASN A  1  402  ? 255.832 230.808 156.919 1.00   170.49 ? 643  ASN A O   1 
ATOM   3019  C  CB  . ASN A  1  402  ? 254.954 233.799 155.567 1.00   203.39 ? 643  ASN A CB  1 
ATOM   3020  C  CG  . ASN A  1  402  ? 255.708 233.336 154.312 1.00   244.61 ? 643  ASN A CG  1 
ATOM   3021  O  OD1 . ASN A  1  402  ? 256.034 232.154 154.167 1.00   277.25 ? 643  ASN A OD1 1 
ATOM   3022  N  ND2 . ASN A  1  402  ? 255.991 234.275 153.399 1.00   253.53 ? 643  ASN A ND2 1 
ATOM   3023  N  N   . VAL A  1  403  ? 255.699 232.516 158.407 1.00   201.29 ? 644  VAL A N   1 
ATOM   3024  C  CA  . VAL A  1  403  ? 256.746 231.990 159.294 1.00   205.02 ? 644  VAL A CA  1 
ATOM   3025  C  C   . VAL A  1  403  ? 256.273 230.806 160.144 1.00   186.26 ? 644  VAL A C   1 
ATOM   3026  O  O   . VAL A  1  403  ? 257.025 229.839 160.302 1.00   182.01 ? 644  VAL A O   1 
ATOM   3027  C  CB  . VAL A  1  403  ? 257.399 233.111 160.141 1.00   194.61 ? 644  VAL A CB  1 
ATOM   3028  C  CG1 . VAL A  1  403  ? 258.245 232.561 161.290 1.00   188.19 ? 644  VAL A CG1 1 
ATOM   3029  C  CG2 . VAL A  1  403  ? 258.269 233.970 159.228 1.00   194.96 ? 644  VAL A CG2 1 
ATOM   3030  N  N   . HIS A  1  404  ? 255.044 230.849 160.660 1.00   181.03 ? 645  HIS A N   1 
ATOM   3031  C  CA  . HIS A  1  404  ? 254.485 229.724 161.445 1.00   186.03 ? 645  HIS A CA  1 
ATOM   3032  C  C   . HIS A  1  404  ? 254.489 228.417 160.693 1.00   180.71 ? 645  HIS A C   1 
ATOM   3033  O  O   . HIS A  1  404  ? 254.701 227.390 161.337 1.00   186.51 ? 645  HIS A O   1 
ATOM   3034  C  CB  . HIS A  1  404  ? 253.064 230.000 161.978 1.00   207.87 ? 645  HIS A CB  1 
ATOM   3035  C  CG  . HIS A  1  404  ? 252.211 228.769 162.162 1.00   236.27 ? 645  HIS A CG  1 
ATOM   3036  N  ND1 . HIS A  1  404  ? 252.538 227.752 163.039 1.00   215.72 ? 645  HIS A ND1 1 
ATOM   3037  C  CD2 . HIS A  1  404  ? 251.041 228.399 161.577 1.00   272.22 ? 645  HIS A CD2 1 
ATOM   3038  C  CE1 . HIS A  1  404  ? 251.608 226.810 162.979 1.00   233.53 ? 645  HIS A CE1 1 
ATOM   3039  N  NE2 . HIS A  1  404  ? 250.690 227.178 162.102 1.00   255.13 ? 645  HIS A NE2 1 
ATOM   3040  N  N   . SER A  1  405  ? 254.260 228.428 159.368 1.00   195.06 ? 646  SER A N   1 
ATOM   3041  C  CA  . SER A  1  405  ? 254.349 227.185 158.564 1.00   210.53 ? 646  SER A CA  1 
ATOM   3042  C  C   . SER A  1  405  ? 255.718 226.536 158.765 1.00   268.50 ? 646  SER A C   1 
ATOM   3043  O  O   . SER A  1  405  ? 255.824 225.305 158.889 1.00   307.19 ? 646  SER A O   1 
ATOM   3044  C  CB  . SER A  1  405  ? 254.146 227.413 157.063 1.00   190.80 ? 646  SER A CB  1 
ATOM   3045  O  OG  . SER A  1  405  ? 255.397 227.570 156.406 1.00   181.01 ? 646  SER A OG  1 
ATOM   3046  N  N   . ALA A  1  406  ? 256.751 227.386 158.795 1.00   315.41 ? 647  ALA A N   1 
ATOM   3047  C  CA  . ALA A  1  406  ? 258.126 226.992 159.148 1.00   342.34 ? 647  ALA A CA  1 
ATOM   3048  C  C   . ALA A  1  406  ? 258.620 225.816 158.311 1.00   346.87 ? 647  ALA A C   1 
ATOM   3049  O  O   . ALA A  1  406  ? 259.012 224.773 158.860 1.00   367.14 ? 647  ALA A O   1 
ATOM   3050  C  CB  . ALA A  1  406  ? 258.213 226.678 160.641 1.00   345.28 ? 647  ALA A CB  1 
ATOM   3051  N  N   . PRO A  1  407  ? 258.607 225.977 156.975 1.00   307.08 ? 648  PRO A N   1 
ATOM   3052  C  CA  . PRO A  1  407  ? 258.986 224.859 156.119 1.00   284.69 ? 648  PRO A CA  1 
ATOM   3053  C  C   . PRO A  1  407  ? 260.509 224.757 156.037 1.00   293.29 ? 648  PRO A C   1 
ATOM   3054  O  O   . PRO A  1  407  ? 261.066 225.010 154.974 1.00   258.76 ? 648  PRO A O   1 
ATOM   3055  C  CB  . PRO A  1  407  ? 258.372 225.263 154.779 1.00   264.67 ? 648  PRO A CB  1 
ATOM   3056  C  CG  . PRO A  1  407  ? 258.384 226.770 154.788 1.00   261.49 ? 648  PRO A CG  1 
ATOM   3057  C  CD  . PRO A  1  407  ? 258.576 227.239 156.206 1.00   255.31 ? 648  PRO A CD  1 
ATOM   3058  N  N   . GLY A  1  408  ? 261.164 224.397 157.145 1.00   318.13 ? 649  GLY A N   1 
ATOM   3059  C  CA  . GLY A  1  408  ? 262.597 224.664 157.313 1.00   323.02 ? 649  GLY A CA  1 
ATOM   3060  C  C   . GLY A  1  408  ? 263.315 223.801 158.324 1.00   317.93 ? 649  GLY A C   1 
ATOM   3061  O  O   . GLY A  1  408  ? 263.196 224.005 159.538 1.00   273.55 ? 649  GLY A O   1 
ATOM   3062  N  N   . GLY A  1  409  ? 264.059 222.829 157.796 1.00   344.33 ? 650  GLY A N   1 
ATOM   3063  C  CA  . GLY A  1  409  ? 265.077 222.094 158.533 1.00   364.67 ? 650  GLY A CA  1 
ATOM   3064  C  C   . GLY A  1  409  ? 264.537 221.293 159.699 1.00   388.98 ? 650  GLY A C   1 
ATOM   3065  O  O   . GLY A  1  409  ? 263.574 220.533 159.546 1.00   390.13 ? 650  GLY A O   1 
ATOM   3066  N  N   . ALA A  1  410  ? 265.135 221.503 160.872 1.00   400.03 ? 651  ALA A N   1 
ATOM   3067  C  CA  . ALA A  1  410  ? 264.865 220.697 162.063 1.00   381.97 ? 651  ALA A CA  1 
ATOM   3068  C  C   . ALA A  1  410  ? 263.722 221.193 162.960 1.00   386.17 ? 651  ALA A C   1 
ATOM   3069  O  O   . ALA A  1  410  ? 263.421 220.525 163.939 1.00   386.14 ? 651  ALA A O   1 
ATOM   3070  C  CB  . ALA A  1  410  ? 266.143 220.556 162.891 1.00   338.99 ? 651  ALA A CB  1 
ATOM   3071  N  N   . SER A  1  411  ? 263.077 222.320 162.626 1.00   377.39 ? 652  SER A N   1 
ATOM   3072  C  CA  . SER A  1  411  ? 262.165 223.038 163.534 1.00   356.30 ? 652  SER A CA  1 
ATOM   3073  C  C   . SER A  1  411  ? 262.965 223.491 164.773 1.00   363.56 ? 652  SER A C   1 
ATOM   3074  O  O   . SER A  1  411  ? 263.774 224.408 164.655 1.00   357.99 ? 652  SER A O   1 
ATOM   3075  C  CB  . SER A  1  411  ? 260.882 222.225 163.846 1.00   328.15 ? 652  SER A CB  1 
ATOM   3076  O  OG  . SER A  1  411  ? 260.079 222.861 164.831 1.00   310.35 ? 652  SER A OG  1 
ATOM   3077  N  N   . TYR A  1  412  ? 262.750 222.848 165.926 1.00   365.12 ? 653  TYR A N   1 
ATOM   3078  C  CA  . TYR A  1  412  ? 263.562 223.007 167.155 1.00   350.97 ? 653  TYR A CA  1 
ATOM   3079  C  C   . TYR A  1  412  ? 263.073 224.079 168.130 1.00   332.06 ? 653  TYR A C   1 
ATOM   3080  O  O   . TYR A  1  412  ? 263.286 223.924 169.333 1.00   328.55 ? 653  TYR A O   1 
ATOM   3081  C  CB  . TYR A  1  412  ? 265.085 223.146 166.884 1.00   338.71 ? 653  TYR A CB  1 
ATOM   3082  C  CG  . TYR A  1  412  ? 265.934 222.956 168.134 1.00   315.91 ? 653  TYR A CG  1 
ATOM   3083  C  CD1 . TYR A  1  412  ? 266.210 221.680 168.636 1.00   296.97 ? 653  TYR A CD1 1 
ATOM   3084  C  CD2 . TYR A  1  412  ? 266.433 224.060 168.835 1.00   310.99 ? 653  TYR A CD2 1 
ATOM   3085  C  CE1 . TYR A  1  412  ? 266.967 221.507 169.790 1.00   293.99 ? 653  TYR A CE1 1 
ATOM   3086  C  CE2 . TYR A  1  412  ? 267.192 223.897 169.988 1.00   318.39 ? 653  TYR A CE2 1 
ATOM   3087  C  CZ  . TYR A  1  412  ? 267.458 222.622 170.465 1.00   311.94 ? 653  TYR A CZ  1 
ATOM   3088  O  OH  . TYR A  1  412  ? 268.213 222.465 171.609 1.00   298.20 ? 653  TYR A OH  1 
ATOM   3089  N  N   . HIS A  1  413  ? 262.453 225.151 167.631 1.00   302.98 ? 654  HIS A N   1 
ATOM   3090  C  CA  . HIS A  1  413  ? 261.845 226.180 168.486 1.00   257.82 ? 654  HIS A CA  1 
ATOM   3091  C  C   . HIS A  1  413  ? 260.373 225.832 168.655 1.00   238.06 ? 654  HIS A C   1 
ATOM   3092  O  O   . HIS A  1  413  ? 259.789 225.127 167.819 1.00   223.61 ? 654  HIS A O   1 
ATOM   3093  C  CB  . HIS A  1  413  ? 262.016 227.590 167.884 1.00   245.06 ? 654  HIS A CB  1 
ATOM   3094  C  CG  . HIS A  1  413  ? 263.409 227.879 167.404 1.00   269.78 ? 654  HIS A CG  1 
ATOM   3095  N  ND1 . HIS A  1  413  ? 264.418 228.307 168.243 1.00   271.59 ? 654  HIS A ND1 1 
ATOM   3096  C  CD2 . HIS A  1  413  ? 263.964 227.779 166.172 1.00   271.08 ? 654  HIS A CD2 1 
ATOM   3097  C  CE1 . HIS A  1  413  ? 265.533 228.460 167.548 1.00   261.30 ? 654  HIS A CE1 1 
ATOM   3098  N  NE2 . HIS A  1  413  ? 265.284 228.150 166.288 1.00   259.83 ? 654  HIS A NE2 1 
ATOM   3099  N  N   . SER A  1  414  ? 259.778 226.325 169.734 1.00   245.46 ? 655  SER A N   1 
ATOM   3100  C  CA  . SER A  1  414  ? 258.356 226.082 170.026 1.00   252.17 ? 655  SER A CA  1 
ATOM   3101  C  C   . SER A  1  414  ? 257.493 227.058 169.264 1.00   232.39 ? 655  SER A C   1 
ATOM   3102  O  O   . SER A  1  414  ? 258.021 227.962 168.607 1.00   262.66 ? 655  SER A O   1 
ATOM   3103  C  CB  . SER A  1  414  ? 258.059 226.248 171.518 1.00   242.41 ? 655  SER A CB  1 
ATOM   3104  O  OG  . SER A  1  414  ? 257.760 227.599 171.830 1.00   202.54 ? 655  SER A OG  1 
ATOM   3105  N  N   . GLU A  1  415  ? 256.177 226.893 169.383 1.00   191.55 ? 656  GLU A N   1 
ATOM   3106  C  CA  . GLU A  1  415  ? 255.253 227.803 168.730 1.00   198.49 ? 656  GLU A CA  1 
ATOM   3107  C  C   . GLU A  1  415  ? 255.402 229.176 169.295 1.00   175.72 ? 656  GLU A C   1 
ATOM   3108  O  O   . GLU A  1  415  ? 255.678 230.127 168.566 1.00   201.29 ? 656  GLU A O   1 
ATOM   3109  C  CB  . GLU A  1  415  ? 253.797 227.369 168.872 1.00   209.35 ? 656  GLU A CB  1 
ATOM   3110  C  CG  . GLU A  1  415  ? 253.333 226.492 167.716 1.00   249.51 ? 656  GLU A CG  1 
ATOM   3111  C  CD  . GLU A  1  415  ? 252.076 227.015 167.060 1.00   260.22 ? 656  GLU A CD  1 
ATOM   3112  O  OE1 . GLU A  1  415  ? 251.111 227.288 167.796 1.00   284.48 ? 656  GLU A OE1 1 
ATOM   3113  O  OE2 . GLU A  1  415  ? 252.049 227.142 165.819 1.00   267.65 ? 656  GLU A OE2 1 
ATOM   3114  N  N   . TRP A  1  416  ? 255.230 229.258 170.601 1.00   157.26 ? 657  TRP A N   1 
ATOM   3115  C  CA  . TRP A  1  416  ? 255.209 230.544 171.259 1.00   167.08 ? 657  TRP A CA  1 
ATOM   3116  C  C   . TRP A  1  416  ? 256.529 231.316 171.090 1.00   158.11 ? 657  TRP A C   1 
ATOM   3117  O  O   . TRP A  1  416  ? 256.512 232.519 170.805 1.00   161.41 ? 657  TRP A O   1 
ATOM   3118  C  CB  . TRP A  1  416  ? 254.847 230.385 172.734 1.00   182.03 ? 657  TRP A CB  1 
ATOM   3119  C  CG  . TRP A  1  416  ? 254.878 231.660 173.403 1.00   156.22 ? 657  TRP A CG  1 
ATOM   3120  C  CD1 . TRP A  1  416  ? 255.939 232.208 174.017 1.00   159.19 ? 657  TRP A CD1 1 
ATOM   3121  C  CD2 . TRP A  1  416  ? 253.832 232.607 173.461 1.00   139.97 ? 657  TRP A CD2 1 
ATOM   3122  N  NE1 . TRP A  1  416  ? 255.611 233.426 174.497 1.00   165.31 ? 657  TRP A NE1 1 
ATOM   3123  C  CE2 . TRP A  1  416  ? 254.318 233.706 174.155 1.00   162.41 ? 657  TRP A CE2 1 
ATOM   3124  C  CE3 . TRP A  1  416  ? 252.522 232.626 173.009 1.00   160.68 ? 657  TRP A CE3 1 
ATOM   3125  C  CZ2 . TRP A  1  416  ? 253.537 234.830 174.415 1.00   184.28 ? 657  TRP A CZ2 1 
ATOM   3126  C  CZ3 . TRP A  1  416  ? 251.739 233.729 173.277 1.00   163.51 ? 657  TRP A CZ3 1 
ATOM   3127  C  CH2 . TRP A  1  416  ? 252.250 234.819 173.964 1.00   174.50 ? 657  TRP A CH2 1 
ATOM   3128  N  N   . ASN A  1  417  ? 257.654 230.631 171.272 1.00   155.94 ? 658  ASN A N   1 
ATOM   3129  C  CA  . ASN A  1  417  ? 258.933 231.321 171.235 1.00   182.50 ? 658  ASN A CA  1 
ATOM   3130  C  C   . ASN A  1  417  ? 259.113 231.976 169.863 1.00   181.27 ? 658  ASN A C   1 
ATOM   3131  O  O   . ASN A  1  417  ? 259.555 233.129 169.800 1.00   234.11 ? 658  ASN A O   1 
ATOM   3132  C  CB  . ASN A  1  417  ? 260.125 230.399 171.621 1.00   221.07 ? 658  ASN A CB  1 
ATOM   3133  C  CG  . ASN A  1  417  ? 261.418 231.180 172.012 1.00   266.92 ? 658  ASN A CG  1 
ATOM   3134  O  OD1 . ASN A  1  417  ? 261.453 232.415 172.060 1.00   277.68 ? 658  ASN A OD1 1 
ATOM   3135  N  ND2 . ASN A  1  417  ? 262.493 230.436 172.288 1.00   264.73 ? 658  ASN A ND2 1 
ATOM   3136  N  N   . LEU A  1  418  ? 258.741 231.283 168.779 1.00   162.10 ? 659  LEU A N   1 
ATOM   3137  C  CA  . LEU A  1  418  ? 258.946 231.849 167.438 1.00   173.52 ? 659  LEU A CA  1 
ATOM   3138  C  C   . LEU A  1  418  ? 257.932 232.957 167.139 1.00   163.62 ? 659  LEU A C   1 
ATOM   3139  O  O   . LEU A  1  418  ? 258.277 233.981 166.533 1.00   197.96 ? 659  LEU A O   1 
ATOM   3140  C  CB  . LEU A  1  418  ? 259.009 230.783 166.351 1.00   171.59 ? 659  LEU A CB  1 
ATOM   3141  C  CG  . LEU A  1  418  ? 257.752 230.142 165.786 1.00   195.50 ? 659  LEU A CG  1 
ATOM   3142  C  CD1 . LEU A  1  418  ? 256.884 231.096 164.958 1.00   208.61 ? 659  LEU A CD1 1 
ATOM   3143  C  CD2 . LEU A  1  418  ? 258.221 228.965 164.933 1.00   218.43 ? 659  LEU A CD2 1 
ATOM   3144  N  N   . PHE A  1  419  ? 256.704 232.764 167.589 1.00   150.76 ? 660  PHE A N   1 
ATOM   3145  C  CA  . PHE A  1  419  ? 255.678 233.806 167.491 1.00   169.51 ? 660  PHE A CA  1 
ATOM   3146  C  C   . PHE A  1  419  ? 256.165 235.110 168.115 1.00   169.49 ? 660  PHE A C   1 
ATOM   3147  O  O   . PHE A  1  419  ? 256.039 236.171 167.501 1.00   191.27 ? 660  PHE A O   1 
ATOM   3148  C  CB  . PHE A  1  419  ? 254.356 233.353 168.152 1.00   171.76 ? 660  PHE A CB  1 
ATOM   3149  C  CG  . PHE A  1  419  ? 253.400 234.477 168.413 1.00   147.02 ? 660  PHE A CG  1 
ATOM   3150  C  CD1 . PHE A  1  419  ? 253.491 235.217 169.578 1.00   155.86 ? 660  PHE A CD1 1 
ATOM   3151  C  CD2 . PHE A  1  419  ? 252.450 234.822 167.481 1.00   173.00 ? 660  PHE A CD2 1 
ATOM   3152  C  CE1 . PHE A  1  419  ? 252.644 236.285 169.810 1.00   184.41 ? 660  PHE A CE1 1 
ATOM   3153  C  CE2 . PHE A  1  419  ? 251.594 235.888 167.704 1.00   205.09 ? 660  PHE A CE2 1 
ATOM   3154  C  CZ  . PHE A  1  419  ? 251.685 236.617 168.875 1.00   200.89 ? 660  PHE A CZ  1 
ATOM   3155  N  N   . VAL A  1  420  ? 256.730 235.018 169.319 1.00   167.61 ? 661  VAL A N   1 
ATOM   3156  C  CA  . VAL A  1  420  ? 257.176 236.202 170.053 1.00   179.44 ? 661  VAL A CA  1 
ATOM   3157  C  C   . VAL A  1  420  ? 258.311 236.901 169.324 1.00   169.94 ? 661  VAL A C   1 
ATOM   3158  O  O   . VAL A  1  420  ? 258.401 238.133 169.359 1.00   202.88 ? 661  VAL A O   1 
ATOM   3159  C  CB  . VAL A  1  420  ? 257.612 235.864 171.489 1.00   196.42 ? 661  VAL A CB  1 
ATOM   3160  C  CG1 . VAL A  1  420  ? 258.207 237.098 172.201 1.00   213.77 ? 661  VAL A CG1 1 
ATOM   3161  C  CG2 . VAL A  1  420  ? 256.425 235.297 172.259 1.00   197.07 ? 661  VAL A CG2 1 
ATOM   3162  N  N   . THR A  1  421  ? 259.179 236.116 168.680 1.00   157.08 ? 662  THR A N   1 
ATOM   3163  C  CA  . THR A  1  421  ? 260.305 236.697 167.934 1.00   199.54 ? 662  THR A CA  1 
ATOM   3164  C  C   . THR A  1  421  ? 259.750 237.522 166.774 1.00   214.13 ? 662  THR A C   1 
ATOM   3165  O  O   . THR A  1  421  ? 260.197 238.649 166.558 1.00   253.04 ? 662  THR A O   1 
ATOM   3166  C  CB  . THR A  1  421  ? 261.404 235.701 167.408 1.00   194.84 ? 662  THR A CB  1 
ATOM   3167  O  OG1 . THR A  1  421  ? 260.950 235.005 166.239 1.00   195.55 ? 662  THR A OG1 1 
ATOM   3168  C  CG2 . THR A  1  421  ? 261.918 234.712 168.495 1.00   172.68 ? 662  THR A CG2 1 
ATOM   3169  N  N   . CYS A  1  422  ? 258.750 236.974 166.080 1.00   198.98 ? 663  CYS A N   1 
ATOM   3170  C  CA  . CYS A  1  422  ? 258.089 237.680 164.987 1.00   225.11 ? 663  CYS A CA  1 
ATOM   3171  C  C   . CYS A  1  422  ? 257.401 238.980 165.437 1.00   229.29 ? 663  CYS A C   1 
ATOM   3172  O  O   . CYS A  1  422  ? 257.578 240.028 164.813 1.00   273.74 ? 663  CYS A O   1 
ATOM   3173  C  CB  . CYS A  1  422  ? 257.062 236.771 164.311 1.00   213.38 ? 663  CYS A CB  1 
ATOM   3174  S  SG  . CYS A  1  422  ? 256.145 237.606 162.990 1.00   272.17 ? 663  CYS A SG  1 
ATOM   3175  N  N   . LEU A  1  423  ? 256.622 238.913 166.506 1.00   191.37 ? 664  LEU A N   1 
ATOM   3176  C  CA  . LEU A  1  423  ? 255.934 240.110 166.969 1.00   181.16 ? 664  LEU A CA  1 
ATOM   3177  C  C   . LEU A  1  423  ? 256.933 241.188 167.549 1.00   208.29 ? 664  LEU A C   1 
ATOM   3178  O  O   . LEU A  1  423  ? 256.715 242.413 167.379 1.00   231.81 ? 664  LEU A O   1 
ATOM   3179  C  CB  . LEU A  1  423  ? 254.744 239.739 167.868 1.00   179.84 ? 664  LEU A CB  1 
ATOM   3180  C  CG  . LEU A  1  423  ? 254.363 240.576 169.097 1.00   212.67 ? 664  LEU A CG  1 
ATOM   3181  C  CD1 . LEU A  1  423  ? 253.865 242.006 168.848 1.00   193.25 ? 664  LEU A CD1 1 
ATOM   3182  C  CD2 . LEU A  1  423  ? 253.301 239.788 169.851 1.00   236.01 ? 664  LEU A CD2 1 
ATOM   3183  N  N   . MET A  1  424  ? 258.057 240.764 168.137 1.00   203.05 ? 665  MET A N   1 
ATOM   3184  C  CA  . MET A  1  424  ? 259.083 241.761 168.514 1.00   236.15 ? 665  MET A CA  1 
ATOM   3185  C  C   . MET A  1  424  ? 259.737 242.426 167.262 1.00   257.90 ? 665  MET A C   1 
ATOM   3186  O  O   . MET A  1  424  ? 260.185 243.581 167.351 1.00   333.72 ? 665  MET A O   1 
ATOM   3187  C  CB  . MET A  1  424  ? 260.131 241.271 169.550 1.00   245.14 ? 665  MET A CB  1 
ATOM   3188  C  CG  . MET A  1  424  ? 259.963 241.768 171.021 1.00   247.92 ? 665  MET A CG  1 
ATOM   3189  S  SD  . MET A  1  424  ? 259.786 243.535 171.550 1.00   268.37 ? 665  MET A SD  1 
ATOM   3190  C  CE  . MET A  1  424  ? 261.367 244.422 171.449 1.00   164.74 ? 665  MET A CE  1 
ATOM   3191  N  N   . ASN A  1  425  ? 259.751 241.752 166.101 1.00   232.82 ? 666  ASN A N   1 
ATOM   3192  C  CA  . ASN A  1  425  ? 260.220 242.393 164.851 1.00   212.50 ? 666  ASN A CA  1 
ATOM   3193  C  C   . ASN A  1  425  ? 259.427 243.661 164.535 1.00   206.69 ? 666  ASN A C   1 
ATOM   3194  O  O   . ASN A  1  425  ? 260.033 244.708 164.339 1.00   256.89 ? 666  ASN A O   1 
ATOM   3195  C  CB  . ASN A  1  425  ? 260.198 241.455 163.632 1.00   203.65 ? 666  ASN A CB  1 
ATOM   3196  C  CG  . ASN A  1  425  ? 261.375 240.494 163.608 1.00   217.97 ? 666  ASN A CG  1 
ATOM   3197  O  OD1 . ASN A  1  425  ? 262.097 240.397 162.607 1.00   200.72 ? 666  ASN A OD1 1 
ATOM   3198  N  ND2 . ASN A  1  425  ? 261.570 239.770 164.706 1.00   232.66 ? 666  ASN A ND2 1 
ATOM   3199  N  N   . MET A  1  426  ? 258.086 243.581 164.545 1.00   217.26 ? 667  MET A N   1 
ATOM   3200  C  CA  . MET A  1  426  ? 257.211 244.776 164.378 1.00   247.03 ? 667  MET A CA  1 
ATOM   3201  C  C   . MET A  1  426  ? 257.556 245.891 165.345 1.00   270.82 ? 667  MET A C   1 
ATOM   3202  O  O   . MET A  1  426  ? 257.140 247.029 165.141 1.00   294.77 ? 667  MET A O   1 
ATOM   3203  C  CB  . MET A  1  426  ? 255.701 244.486 164.550 1.00   242.54 ? 667  MET A CB  1 
ATOM   3204  C  CG  . MET A  1  426  ? 255.139 243.229 163.889 1.00   258.35 ? 667  MET A CG  1 
ATOM   3205  S  SD  . MET A  1  426  ? 256.095 242.609 162.496 1.00   285.13 ? 667  MET A SD  1 
ATOM   3206  C  CE  . MET A  1  426  ? 256.021 244.014 161.376 1.00   277.98 ? 667  MET A CE  1 
ATOM   3207  N  N   . MET A  1  427  ? 258.283 245.550 166.406 1.00   290.60 ? 668  MET A N   1 
ATOM   3208  C  CA  . MET A  1  427  ? 258.827 246.517 167.369 1.00   305.60 ? 668  MET A CA  1 
ATOM   3209  C  C   . MET A  1  427  ? 260.376 246.849 167.198 1.00   257.88 ? 668  MET A C   1 
ATOM   3210  O  O   . MET A  1  427  ? 260.754 248.004 166.906 1.00   162.74 ? 668  MET A O   1 
ATOM   3211  C  CB  . MET A  1  427  ? 258.391 246.010 168.765 1.00   344.15 ? 668  MET A CB  1 
ATOM   3212  C  CG  . MET A  1  427  ? 256.885 245.642 168.789 1.00   336.88 ? 668  MET A CG  1 
ATOM   3213  S  SD  . MET A  1  427  ? 256.216 244.536 170.045 1.00   362.24 ? 668  MET A SD  1 
ATOM   3214  C  CE  . MET A  1  427  ? 256.164 245.604 171.480 1.00   392.48 ? 668  MET A CE  1 
ATOM   3215  N  N   . GLY A  1  428  ? 261.259 245.854 167.347 1.00   239.70 ? 669  GLY A N   1 
ATOM   3216  C  CA  . GLY A  1  428  ? 262.723 246.004 167.109 1.00   198.27 ? 669  GLY A CA  1 
ATOM   3217  C  C   . GLY A  1  428  ? 263.492 244.856 167.787 1.00   215.99 ? 669  GLY A C   1 
ATOM   3218  O  O   . GLY A  1  428  ? 263.065 244.417 168.855 1.00   185.48 ? 669  GLY A O   1 
ATOM   3219  N  N   . TYR A  1  429  ? 264.612 244.370 167.208 1.00   228.41 ? 670  TYR A N   1 
ATOM   3220  C  CA  . TYR A  1  429  ? 265.339 243.145 167.717 1.00   217.31 ? 670  TYR A CA  1 
ATOM   3221  C  C   . TYR A  1  429  ? 266.848 243.022 167.349 1.00   183.17 ? 670  TYR A C   1 
ATOM   3222  O  O   . TYR A  1  429  ? 267.495 241.987 167.627 1.00   141.73 ? 670  TYR A O   1 
ATOM   3223  C  CB  . TYR A  1  429  ? 264.601 241.853 167.283 1.00   184.12 ? 670  TYR A CB  1 
ATOM   3224  N  N   . THR A  1  430  ? 255.809 250.701 164.840 1.00   188.78 ? 757  THR A N   1 
ATOM   3225  C  CA  . THR A  1  430  ? 255.167 251.004 166.132 1.00   230.73 ? 757  THR A CA  1 
ATOM   3226  C  C   . THR A  1  430  ? 253.648 250.636 166.141 1.00   228.39 ? 757  THR A C   1 
ATOM   3227  O  O   . THR A  1  430  ? 253.309 249.530 165.647 1.00   159.34 ? 757  THR A O   1 
ATOM   3228  C  CB  . THR A  1  430  ? 255.445 252.465 166.592 1.00   236.82 ? 757  THR A CB  1 
ATOM   3229  O  OG1 . THR A  1  430  ? 254.533 253.372 165.930 1.00   236.15 ? 757  THR A OG1 1 
ATOM   3230  C  CG2 . THR A  1  430  ? 256.978 252.851 166.397 1.00   182.75 ? 757  THR A CG2 1 
ATOM   3231  N  N   . HIS A  1  431  ? 252.771 251.515 166.683 1.00   222.10 ? 758  HIS A N   1 
ATOM   3232  C  CA  . HIS A  1  431  ? 251.380 251.152 167.032 1.00   230.15 ? 758  HIS A CA  1 
ATOM   3233  C  C   . HIS A  1  431  ? 251.290 250.236 168.310 1.00   244.53 ? 758  HIS A C   1 
ATOM   3234  O  O   . HIS A  1  431  ? 250.277 249.551 168.579 1.00   200.97 ? 758  HIS A O   1 
ATOM   3235  C  CB  . HIS A  1  431  ? 250.760 250.493 165.801 1.00   222.69 ? 758  HIS A CB  1 
ATOM   3236  C  CG  . HIS A  1  431  ? 249.296 250.671 165.684 1.00   211.91 ? 758  HIS A CG  1 
ATOM   3237  N  ND1 . HIS A  1  431  ? 248.717 251.896 165.448 1.00   207.71 ? 758  HIS A ND1 1 
ATOM   3238  C  CD2 . HIS A  1  431  ? 248.292 249.766 165.714 1.00   212.22 ? 758  HIS A CD2 1 
ATOM   3239  C  CE1 . HIS A  1  431  ? 247.407 251.739 165.363 1.00   236.96 ? 758  HIS A CE1 1 
ATOM   3240  N  NE2 . HIS A  1  431  ? 247.126 250.454 165.512 1.00   234.62 ? 758  HIS A NE2 1 
ATOM   3241  N  N   . ILE A  1  432  ? 252.356 250.294 169.109 1.00   243.99 ? 759  ILE A N   1 
ATOM   3242  C  CA  . ILE A  1  432  ? 252.609 249.379 170.207 1.00   195.65 ? 759  ILE A CA  1 
ATOM   3243  C  C   . ILE A  1  432  ? 251.689 249.591 171.364 1.00   187.51 ? 759  ILE A C   1 
ATOM   3244  O  O   . ILE A  1  432  ? 251.266 248.603 171.939 1.00   186.78 ? 759  ILE A O   1 
ATOM   3245  C  CB  . ILE A  1  432  ? 254.064 249.499 170.713 1.00   210.15 ? 759  ILE A CB  1 
ATOM   3246  C  CG1 . ILE A  1  432  ? 255.004 248.825 169.711 1.00   271.59 ? 759  ILE A CG1 1 
ATOM   3247  C  CG2 . ILE A  1  432  ? 254.241 248.863 172.085 1.00   193.63 ? 759  ILE A CG2 1 
ATOM   3248  C  CD1 . ILE A  1  432  ? 256.467 249.216 169.830 1.00   300.23 ? 759  ILE A CD1 1 
ATOM   3249  N  N   . PRO A  1  433  ? 251.391 250.866 171.736 1.00   212.48 ? 760  PRO A N   1 
ATOM   3250  C  CA  . PRO A  1  433  ? 250.643 250.984 172.992 1.00   210.77 ? 760  PRO A CA  1 
ATOM   3251  C  C   . PRO A  1  433  ? 249.324 250.236 172.989 1.00   201.34 ? 760  PRO A C   1 
ATOM   3252  O  O   . PRO A  1  433  ? 248.970 249.624 173.992 1.00   197.34 ? 760  PRO A O   1 
ATOM   3253  C  CB  . PRO A  1  433  ? 250.393 252.506 173.136 1.00   222.54 ? 760  PRO A CB  1 
ATOM   3254  C  CG  . PRO A  1  433  ? 250.543 253.075 171.777 1.00   218.14 ? 760  PRO A CG  1 
ATOM   3255  C  CD  . PRO A  1  433  ? 251.575 252.199 171.110 1.00   232.15 ? 760  PRO A CD  1 
ATOM   3256  N  N   . ALA A  1  434  ? 248.607 250.288 171.871 1.00   223.92 ? 761  ALA A N   1 
ATOM   3257  C  CA  . ALA A  1  434  ? 247.333 249.579 171.769 1.00   214.66 ? 761  ALA A CA  1 
ATOM   3258  C  C   . ALA A  1  434  ? 247.523 248.075 171.877 1.00   180.37 ? 761  ALA A C   1 
ATOM   3259  O  O   . ALA A  1  434  ? 246.717 247.419 172.525 1.00   129.25 ? 761  ALA A O   1 
ATOM   3260  C  CB  . ALA A  1  434  ? 246.607 249.934 170.482 1.00   241.67 ? 761  ALA A CB  1 
ATOM   3261  N  N   . ILE A  1  435  ? 248.588 247.546 171.260 1.00   178.04 ? 762  ILE A N   1 
ATOM   3262  C  CA  . ILE A  1  435  ? 248.926 246.103 171.342 1.00   188.90 ? 762  ILE A CA  1 
ATOM   3263  C  C   . ILE A  1  435  ? 249.067 245.612 172.770 1.00   168.51 ? 762  ILE A C   1 
ATOM   3264  O  O   . ILE A  1  435  ? 248.472 244.619 173.183 1.00   160.76 ? 762  ILE A O   1 
ATOM   3265  C  CB  . ILE A  1  435  ? 250.242 245.772 170.565 1.00   199.23 ? 762  ILE A CB  1 
ATOM   3266  C  CG1 . ILE A  1  435  ? 249.967 245.801 169.054 1.00   216.70 ? 762  ILE A CG1 1 
ATOM   3267  C  CG2 . ILE A  1  435  ? 250.887 244.435 170.999 1.00   190.32 ? 762  ILE A CG2 1 
ATOM   3268  C  CD1 . ILE A  1  435  ? 249.366 244.526 168.474 1.00   213.33 ? 762  ILE A CD1 1 
ATOM   3269  N  N   . PHE A  1  436  ? 249.921 246.305 173.489 1.00   173.33 ? 763  PHE A N   1 
ATOM   3270  C  CA  . PHE A  1  436  ? 250.247 245.948 174.840 1.00   172.59 ? 763  PHE A CA  1 
ATOM   3271  C  C   . PHE A  1  436  ? 249.008 245.765 175.683 1.00   152.89 ? 763  PHE A C   1 
ATOM   3272  O  O   . PHE A  1  436  ? 248.897 244.806 176.434 1.00   144.81 ? 763  PHE A O   1 
ATOM   3273  C  CB  . PHE A  1  436  ? 251.089 247.056 175.469 1.00   188.61 ? 763  PHE A CB  1 
ATOM   3274  C  CG  . PHE A  1  436  ? 251.269 246.887 176.933 1.00   186.53 ? 763  PHE A CG  1 
ATOM   3275  C  CD1 . PHE A  1  436  ? 252.146 245.930 177.416 1.00   191.40 ? 763  PHE A CD1 1 
ATOM   3276  C  CD2 . PHE A  1  436  ? 250.509 247.630 177.830 1.00   175.11 ? 763  PHE A CD2 1 
ATOM   3277  C  CE1 . PHE A  1  436  ? 252.304 245.739 178.769 1.00   208.33 ? 763  PHE A CE1 1 
ATOM   3278  C  CE2 . PHE A  1  436  ? 250.649 247.438 179.188 1.00   190.44 ? 763  PHE A CE2 1 
ATOM   3279  C  CZ  . PHE A  1  436  ? 251.550 246.497 179.660 1.00   213.86 ? 763  PHE A CZ  1 
ATOM   3280  N  N   . PHE A  1  437  ? 248.099 246.719 175.566 1.00   147.82 ? 764  PHE A N   1 
ATOM   3281  C  CA  . PHE A  1  437  ? 246.924 246.774 176.414 1.00   177.98 ? 764  PHE A CA  1 
ATOM   3282  C  C   . PHE A  1  437  ? 246.123 245.505 176.243 1.00   173.16 ? 764  PHE A C   1 
ATOM   3283  O  O   . PHE A  1  437  ? 245.763 244.846 177.222 1.00   191.42 ? 764  PHE A O   1 
ATOM   3284  C  CB  . PHE A  1  437  ? 246.088 247.993 176.001 1.00   213.54 ? 764  PHE A CB  1 
ATOM   3285  C  CG  . PHE A  1  437  ? 245.057 248.431 177.007 1.00   223.66 ? 764  PHE A CG  1 
ATOM   3286  C  CD1 . PHE A  1  437  ? 244.055 247.551 177.456 1.00   187.49 ? 764  PHE A CD1 1 
ATOM   3287  C  CD2 . PHE A  1  437  ? 245.052 249.774 177.456 1.00   222.25 ? 764  PHE A CD2 1 
ATOM   3288  C  CE1 . PHE A  1  437  ? 243.104 247.988 178.357 1.00   204.27 ? 764  PHE A CE1 1 
ATOM   3289  C  CE2 . PHE A  1  437  ? 244.096 250.218 178.344 1.00   226.21 ? 764  PHE A CE2 1 
ATOM   3290  C  CZ  . PHE A  1  437  ? 243.122 249.324 178.797 1.00   248.91 ? 764  PHE A CZ  1 
ATOM   3291  N  N   . VAL A  1  438  ? 245.835 245.173 174.993 1.00   169.26 ? 765  VAL A N   1 
ATOM   3292  C  CA  . VAL A  1  438  ? 244.923 244.073 174.730 1.00   171.83 ? 765  VAL A CA  1 
ATOM   3293  C  C   . VAL A  1  438  ? 245.561 242.722 175.017 1.00   175.57 ? 765  VAL A C   1 
ATOM   3294  O  O   . VAL A  1  438  ? 244.895 241.769 175.465 1.00   173.83 ? 765  VAL A O   1 
ATOM   3295  C  CB  . VAL A  1  438  ? 244.407 244.086 173.299 1.00   170.18 ? 765  VAL A CB  1 
ATOM   3296  C  CG1 . VAL A  1  438  ? 245.401 243.428 172.315 1.00   161.17 ? 765  VAL A CG1 1 
ATOM   3297  C  CG2 . VAL A  1  438  ? 243.038 243.439 173.278 1.00   162.44 ? 765  VAL A CG2 1 
ATOM   3298  N  N   . LEU A  1  439  ? 246.858 242.651 174.763 1.00   159.20 ? 766  LEU A N   1 
ATOM   3299  C  CA  . LEU A  1  439  ? 247.601 241.455 175.040 1.00   137.48 ? 766  LEU A CA  1 
ATOM   3300  C  C   . LEU A  1  439  ? 247.667 241.246 176.579 1.00   144.22 ? 766  LEU A C   1 
ATOM   3301  O  O   . LEU A  1  439  ? 247.487 240.142 177.069 1.00   124.80 ? 766  LEU A O   1 
ATOM   3302  C  CB  . LEU A  1  439  ? 248.955 241.596 174.384 1.00   131.03 ? 766  LEU A CB  1 
ATOM   3303  C  CG  . LEU A  1  439  ? 249.628 240.296 174.052 1.00   140.35 ? 766  LEU A CG  1 
ATOM   3304  C  CD1 . LEU A  1  439  ? 250.367 240.441 172.742 1.00   160.81 ? 766  LEU A CD1 1 
ATOM   3305  C  CD2 . LEU A  1  439  ? 250.560 239.906 175.186 1.00   152.78 ? 766  LEU A CD2 1 
ATOM   3306  N  N   . HIS A  1  440  ? 247.876 242.320 177.338 1.00   154.07 ? 767  HIS A N   1 
ATOM   3307  C  CA  . HIS A  1  440  ? 247.705 242.280 178.791 1.00   146.53 ? 767  HIS A CA  1 
ATOM   3308  C  C   . HIS A  1  440  ? 246.324 241.780 179.196 1.00   139.22 ? 767  HIS A C   1 
ATOM   3309  O  O   . HIS A  1  440  ? 246.208 240.980 180.111 1.00   159.32 ? 767  HIS A O   1 
ATOM   3310  C  CB  . HIS A  1  440  ? 247.911 243.657 179.403 1.00   158.85 ? 767  HIS A CB  1 
ATOM   3311  C  CG  . HIS A  1  440  ? 247.429 243.773 180.818 1.00   159.01 ? 767  HIS A CG  1 
ATOM   3312  N  ND1 . HIS A  1  440  ? 248.294 243.817 181.888 1.00   166.44 ? 767  HIS A ND1 1 
ATOM   3313  C  CD2 . HIS A  1  440  ? 246.182 243.867 181.338 1.00   138.01 ? 767  HIS A CD2 1 
ATOM   3314  C  CE1 . HIS A  1  440  ? 247.607 243.927 183.005 1.00   162.80 ? 767  HIS A CE1 1 
ATOM   3315  N  NE2 . HIS A  1  440  ? 246.322 243.958 182.702 1.00   151.15 ? 767  HIS A NE2 1 
ATOM   3316  N  N   . LEU A  1  441  ? 245.270 242.272 178.556 1.00   125.97 ? 768  LEU A N   1 
ATOM   3317  C  CA  . LEU A  1  441  ? 243.929 241.773 178.866 1.00   132.05 ? 768  LEU A CA  1 
ATOM   3318  C  C   . LEU A  1  441  ? 243.803 240.271 178.653 1.00   151.30 ? 768  LEU A C   1 
ATOM   3319  O  O   . LEU A  1  441  ? 243.121 239.604 179.426 1.00   198.63 ? 768  LEU A O   1 
ATOM   3320  C  CB  . LEU A  1  441  ? 242.813 242.512 178.121 1.00   143.69 ? 768  LEU A CB  1 
ATOM   3321  C  CG  . LEU A  1  441  ? 242.291 243.741 178.880 1.00   180.12 ? 768  LEU A CG  1 
ATOM   3322  C  CD1 . LEU A  1  441  ? 241.289 244.566 178.074 1.00   199.82 ? 768  LEU A CD1 1 
ATOM   3323  C  CD2 . LEU A  1  441  ? 241.669 243.331 180.211 1.00   203.24 ? 768  LEU A CD2 1 
ATOM   3324  N  N   . VAL A  1  442  ? 244.472 239.729 177.641 1.00   147.14 ? 769  VAL A N   1 
ATOM   3325  C  CA  . VAL A  1  442  ? 244.556 238.266 177.490 1.00   156.32 ? 769  VAL A CA  1 
ATOM   3326  C  C   . VAL A  1  442  ? 245.100 237.580 178.746 1.00   149.84 ? 769  VAL A C   1 
ATOM   3327  O  O   . VAL A  1  442  ? 244.571 236.579 179.200 1.00   165.04 ? 769  VAL A O   1 
ATOM   3328  C  CB  . VAL A  1  442  ? 245.422 237.907 176.266 1.00   168.86 ? 769  VAL A CB  1 
ATOM   3329  C  CG1 . VAL A  1  442  ? 245.986 236.480 176.322 1.00   146.98 ? 769  VAL A CG1 1 
ATOM   3330  C  CG2 . VAL A  1  442  ? 244.609 238.150 175.004 1.00   193.54 ? 769  VAL A CG2 1 
ATOM   3331  N  N   . TYR A  1  443  ? 246.177 238.127 179.274 1.00   143.03 ? 770  TYR A N   1 
ATOM   3332  C  CA  . TYR A  1  443  ? 246.777 237.651 180.509 1.00   146.76 ? 770  TYR A CA  1 
ATOM   3333  C  C   . TYR A  1  443  ? 245.802 237.574 181.657 1.00   148.03 ? 770  TYR A C   1 
ATOM   3334  O  O   . TYR A  1  443  ? 245.852 236.620 182.406 1.00   180.06 ? 770  TYR A O   1 
ATOM   3335  C  CB  . TYR A  1  443  ? 247.922 238.582 180.869 1.00   155.11 ? 770  TYR A CB  1 
ATOM   3336  C  CG  . TYR A  1  443  ? 248.425 238.482 182.267 1.00   150.02 ? 770  TYR A CG  1 
ATOM   3337  C  CD1 . TYR A  1  443  ? 248.948 237.320 182.723 1.00   157.43 ? 770  TYR A CD1 1 
ATOM   3338  C  CD2 . TYR A  1  443  ? 248.432 239.571 183.106 1.00   181.26 ? 770  TYR A CD2 1 
ATOM   3339  C  CE1 . TYR A  1  443  ? 249.454 237.212 183.997 1.00   179.80 ? 770  TYR A CE1 1 
ATOM   3340  C  CE2 . TYR A  1  443  ? 248.934 239.481 184.386 1.00   202.39 ? 770  TYR A CE2 1 
ATOM   3341  C  CZ  . TYR A  1  443  ? 249.459 238.303 184.817 1.00   190.14 ? 770  TYR A CZ  1 
ATOM   3342  O  OH  . TYR A  1  443  ? 249.944 238.222 186.091 1.00   228.31 ? 770  TYR A OH  1 
ATOM   3343  N  N   . GLU A  1  444  ? 244.924 238.560 181.804 1.00   152.52 ? 771  GLU A N   1 
ATOM   3344  C  CA  . GLU A  1  444  ? 243.913 238.515 182.867 1.00   170.52 ? 771  GLU A CA  1 
ATOM   3345  C  C   . GLU A  1  444  ? 242.809 237.516 182.587 1.00   164.51 ? 771  GLU A C   1 
ATOM   3346  O  O   . GLU A  1  444  ? 242.276 236.919 183.513 1.00   186.78 ? 771  GLU A O   1 
ATOM   3347  C  CB  . GLU A  1  444  ? 243.265 239.867 183.121 1.00   201.10 ? 771  GLU A CB  1 
ATOM   3348  C  CG  . GLU A  1  444  ? 244.228 241.020 183.320 1.00   246.05 ? 771  GLU A CG  1 
ATOM   3349  C  CD  . GLU A  1  444  ? 245.249 240.816 184.423 1.00   258.17 ? 771  GLU A CD  1 
ATOM   3350  O  OE1 . GLU A  1  444  ? 245.201 239.801 185.155 1.00   236.77 ? 771  GLU A OE1 1 
ATOM   3351  O  OE2 . GLU A  1  444  ? 246.113 241.709 184.550 1.00   322.00 ? 771  GLU A OE2 1 
ATOM   3352  N  N   . GLU A  1  445  ? 242.447 237.349 181.326 1.00   155.04 ? 772  GLU A N   1 
ATOM   3353  C  CA  . GLU A  1  445  ? 241.538 236.275 180.925 1.00   167.56 ? 772  GLU A CA  1 
ATOM   3354  C  C   . GLU A  1  445  ? 242.135 234.878 181.204 1.00   175.55 ? 772  GLU A C   1 
ATOM   3355  O  O   . GLU A  1  445  ? 241.439 233.983 181.689 1.00   168.78 ? 772  GLU A O   1 
ATOM   3356  C  CB  . GLU A  1  445  ? 241.224 236.395 179.440 1.00   201.92 ? 772  GLU A CB  1 
ATOM   3357  C  CG  . GLU A  1  445  ? 239.750 236.526 179.135 1.00   245.23 ? 772  GLU A CG  1 
ATOM   3358  C  CD  . GLU A  1  445  ? 238.921 235.277 179.411 1.00   270.14 ? 772  GLU A CD  1 
ATOM   3359  O  OE1 . GLU A  1  445  ? 239.476 234.154 179.475 1.00   306.48 ? 772  GLU A OE1 1 
ATOM   3360  O  OE2 . GLU A  1  445  ? 237.686 235.438 179.540 1.00   265.16 ? 772  GLU A OE2 1 
ATOM   3361  N  N   . LEU A  1  446  ? 243.421 234.700 180.893 1.00   172.78 ? 773  LEU A N   1 
ATOM   3362  C  CA  . LEU A  1  446  ? 244.099 233.411 181.122 1.00   147.23 ? 773  LEU A CA  1 
ATOM   3363  C  C   . LEU A  1  446  ? 244.263 233.090 182.578 1.00   138.00 ? 773  LEU A C   1 
ATOM   3364  O  O   . LEU A  1  446  ? 244.124 231.948 182.995 1.00   145.88 ? 773  LEU A O   1 
ATOM   3365  C  CB  . LEU A  1  446  ? 245.462 233.360 180.465 1.00   136.24 ? 773  LEU A CB  1 
ATOM   3366  C  CG  . LEU A  1  446  ? 245.325 233.429 178.954 1.00   171.39 ? 773  LEU A CG  1 
ATOM   3367  C  CD1 . LEU A  1  446  ? 246.692 233.090 178.390 1.00   206.86 ? 773  LEU A CD1 1 
ATOM   3368  C  CD2 . LEU A  1  446  ? 244.180 232.586 178.339 1.00   155.48 ? 773  LEU A CD2 1 
ATOM   3369  N  N   . LYS A  1  447  ? 244.541 234.113 183.363 1.00   156.28 ? 774  LYS A N   1 
ATOM   3370  C  CA  . LYS A  1  447  ? 244.598 234.005 184.816 1.00   153.49 ? 774  LYS A CA  1 
ATOM   3371  C  C   . LYS A  1  447  ? 243.365 233.349 185.318 1.00   133.99 ? 774  LYS A C   1 
ATOM   3372  O  O   . LYS A  1  447  ? 243.433 232.539 186.204 1.00   158.14 ? 774  LYS A O   1 
ATOM   3373  C  CB  . LYS A  1  447  ? 244.685 235.409 185.412 1.00   189.05 ? 774  LYS A CB  1 
ATOM   3374  C  CG  . LYS A  1  447  ? 244.732 235.506 186.927 1.00   203.98 ? 774  LYS A CG  1 
ATOM   3375  C  CD  . LYS A  1  447  ? 245.196 236.897 187.355 1.00   197.10 ? 774  LYS A CD  1 
ATOM   3376  C  CE  . LYS A  1  447  ? 246.687 236.915 187.624 1.00   195.60 ? 774  LYS A CE  1 
ATOM   3377  N  NZ  . LYS A  1  447  ? 247.495 236.468 186.451 1.00   176.05 ? 774  LYS A NZ  1 
ATOM   3378  N  N   . LEU A  1  448  ? 242.246 233.723 184.724 1.00   125.11 ? 775  LEU A N   1 
ATOM   3379  C  CA  . LEU A  1  448  ? 240.963 233.222 185.117 1.00   144.55 ? 775  LEU A CA  1 
ATOM   3380  C  C   . LEU A  1  448  ? 240.712 231.797 184.658 1.00   141.52 ? 775  LEU A C   1 
ATOM   3381  O  O   . LEU A  1  448  ? 239.837 231.119 185.214 1.00   137.34 ? 775  LEU A O   1 
ATOM   3382  C  CB  . LEU A  1  448  ? 239.908 234.145 184.545 1.00   145.64 ? 775  LEU A CB  1 
ATOM   3383  C  CG  . LEU A  1  448  ? 238.496 233.940 185.035 1.00   161.39 ? 775  LEU A CG  1 
ATOM   3384  C  CD1 . LEU A  1  448  ? 238.470 233.981 186.562 1.00   180.18 ? 775  LEU A CD1 1 
ATOM   3385  C  CD2 . LEU A  1  448  ? 237.618 235.010 184.400 1.00   158.96 ? 775  LEU A CD2 1 
ATOM   3386  N  N   . ASN A  1  449  ? 241.458 231.340 183.653 1.00   134.79 ? 776  ASN A N   1 
ATOM   3387  C  CA  . ASN A  1  449  ? 241.168 230.045 183.066 1.00   155.28 ? 776  ASN A CA  1 
ATOM   3388  C  C   . ASN A  1  449  ? 241.648 228.870 183.859 1.00   150.95 ? 776  ASN A C   1 
ATOM   3389  O  O   . ASN A  1  449  ? 240.918 227.896 183.981 1.00   181.74 ? 776  ASN A O   1 
ATOM   3390  C  CB  . ASN A  1  449  ? 241.686 229.902 181.646 1.00   176.79 ? 776  ASN A CB  1 
ATOM   3391  C  CG  . ASN A  1  449  ? 241.266 228.588 181.013 1.00   182.79 ? 776  ASN A CG  1 
ATOM   3392  O  OD1 . ASN A  1  449  ? 240.269 227.976 181.414 1.00   161.37 ? 776  ASN A OD1 1 
ATOM   3393  N  ND2 . ASN A  1  449  ? 242.034 228.136 180.033 1.00   213.34 ? 776  ASN A ND2 1 
ATOM   3394  N  N   . THR A  1  450  ? 242.867 228.909 184.358 1.00   147.75 ? 777  THR A N   1 
ATOM   3395  C  CA  . THR A  1  450  ? 243.410 227.773 185.139 1.00   182.21 ? 777  THR A CA  1 
ATOM   3396  C  C   . THR A  1  450  ? 243.882 226.605 184.285 1.00   179.68 ? 777  THR A C   1 
ATOM   3397  O  O   . THR A  1  450  ? 244.759 225.887 184.717 1.00   187.03 ? 777  THR A O   1 
ATOM   3398  C  CB  . THR A  1  450  ? 242.430 227.190 186.200 1.00   182.08 ? 777  THR A CB  1 
ATOM   3399  O  OG1 . THR A  1  450  ? 242.042 228.223 187.113 1.00   209.85 ? 777  THR A OG1 1 
ATOM   3400  C  CG2 . THR A  1  450  ? 243.037 226.052 187.003 1.00   187.30 ? 777  THR A CG2 1 
ATOM   3401  N  N   . LEU A  1  451  ? 243.335 226.358 183.106 1.00   169.01 ? 778  LEU A N   1 
ATOM   3402  C  CA  . LEU A  1  451  ? 243.948 225.327 182.294 1.00   147.88 ? 778  LEU A CA  1 
ATOM   3403  C  C   . LEU A  1  451  ? 245.167 225.856 181.583 1.00   156.92 ? 778  LEU A C   1 
ATOM   3404  O  O   . LEU A  1  451  ? 245.927 225.054 181.093 1.00   198.80 ? 778  LEU A O   1 
ATOM   3405  C  CB  . LEU A  1  451  ? 242.996 224.688 181.296 1.00   151.19 ? 778  LEU A CB  1 
ATOM   3406  C  CG  . LEU A  1  451  ? 242.037 223.667 181.908 1.00   157.81 ? 778  LEU A CG  1 
ATOM   3407  C  CD1 . LEU A  1  451  ? 240.802 223.475 181.026 1.00   182.26 ? 778  LEU A CD1 1 
ATOM   3408  C  CD2 . LEU A  1  451  ? 242.693 222.325 182.149 1.00   148.28 ? 778  LEU A CD2 1 
ATOM   3409  N  N   . MET A  1  452  ? 245.387 227.172 181.522 1.00   159.53 ? 779  MET A N   1 
ATOM   3410  C  CA  . MET A  1  452  ? 246.592 227.713 180.887 1.00   179.00 ? 779  MET A CA  1 
ATOM   3411  C  C   . MET A  1  452  ? 247.723 227.780 181.888 1.00   192.48 ? 779  MET A C   1 
ATOM   3412  O  O   . MET A  1  452  ? 248.279 228.838 182.176 1.00   201.49 ? 779  MET A O   1 
ATOM   3413  C  CB  . MET A  1  452  ? 246.365 229.106 180.332 1.00   200.13 ? 779  MET A CB  1 
ATOM   3414  C  CG  . MET A  1  452  ? 245.218 229.239 179.373 1.00   220.24 ? 779  MET A CG  1 
ATOM   3415  S  SD  . MET A  1  452  ? 245.070 228.051 178.027 1.00   261.88 ? 779  MET A SD  1 
ATOM   3416  C  CE  . MET A  1  452  ? 243.830 228.942 177.076 1.00   276.81 ? 779  MET A CE  1 
ATOM   3417  N  N   . GLY A  1  453  ? 248.044 226.626 182.442 1.00   218.09 ? 780  GLY A N   1 
ATOM   3418  C  CA  . GLY A  1  453  ? 249.167 226.508 183.333 1.00   253.73 ? 780  GLY A CA  1 
ATOM   3419  C  C   . GLY A  1  453  ? 250.348 226.584 182.410 1.00   245.87 ? 780  GLY A C   1 
ATOM   3420  O  O   . GLY A  1  453  ? 250.364 225.914 181.360 1.00   259.92 ? 780  GLY A O   1 
ATOM   3421  N  N   . GLU A  1  454  ? 251.294 227.456 182.751 1.00   215.05 ? 781  GLU A N   1 
ATOM   3422  C  CA  . GLU A  1  454  ? 252.562 227.542 182.031 1.00   241.19 ? 781  GLU A CA  1 
ATOM   3423  C  C   . GLU A  1  454  ? 252.470 228.526 180.891 1.00   219.19 ? 781  GLU A C   1 
ATOM   3424  O  O   . GLU A  1  454  ? 253.478 229.116 180.524 1.00   215.62 ? 781  GLU A O   1 
ATOM   3425  C  CB  . GLU A  1  454  ? 253.045 226.173 181.441 1.00   290.84 ? 781  GLU A CB  1 
ATOM   3426  C  CG  . GLU A  1  454  ? 252.943 224.896 182.312 1.00   302.08 ? 781  GLU A CG  1 
ATOM   3427  C  CD  . GLU A  1  454  ? 252.178 223.713 181.665 1.00   285.06 ? 781  GLU A CD  1 
ATOM   3428  O  OE1 . GLU A  1  454  ? 252.048 223.617 180.419 1.00   221.81 ? 781  GLU A OE1 1 
ATOM   3429  O  OE2 . GLU A  1  454  ? 251.683 222.849 182.420 1.00   292.44 ? 781  GLU A OE2 1 
ATOM   3430  N  N   . GLY A  1  455  ? 251.291 228.661 180.288 1.00   212.71 ? 782  GLY A N   1 
ATOM   3431  C  CA  . GLY A  1  455  ? 251.105 229.589 179.193 1.00   213.98 ? 782  GLY A CA  1 
ATOM   3432  C  C   . GLY A  1  455  ? 251.089 231.019 179.684 1.00   200.73 ? 782  GLY A C   1 
ATOM   3433  O  O   . GLY A  1  455  ? 251.681 231.916 179.087 1.00   199.60 ? 782  GLY A O   1 
ATOM   3434  N  N   . ILE A  1  456  ? 250.393 231.219 180.785 1.00   196.05 ? 783  ILE A N   1 
ATOM   3435  C  CA  . ILE A  1  456  ? 250.431 232.463 181.515 1.00   185.66 ? 783  ILE A CA  1 
ATOM   3436  C  C   . ILE A  1  456  ? 251.888 232.908 181.780 1.00   182.03 ? 783  ILE A C   1 
ATOM   3437  O  O   . ILE A  1  456  ? 252.260 234.053 181.511 1.00   212.19 ? 783  ILE A O   1 
ATOM   3438  C  CB  . ILE A  1  456  ? 249.608 232.284 182.810 1.00   205.55 ? 783  ILE A CB  1 
ATOM   3439  C  CG1 . ILE A  1  456  ? 249.212 233.634 183.389 1.00   205.72 ? 783  ILE A CG1 1 
ATOM   3440  C  CG2 . ILE A  1  456  ? 250.285 231.327 183.807 1.00   232.11 ? 783  ILE A CG2 1 
ATOM   3441  C  CD1 . ILE A  1  456  ? 247.980 234.191 182.717 1.00   212.48 ? 783  ILE A CD1 1 
ATOM   3442  N  N   . CYS A  1  457  ? 252.718 231.973 182.233 1.00   182.43 ? 784  CYS A N   1 
ATOM   3443  C  CA  . CYS A  1  457  ? 254.085 232.267 182.631 1.00   217.09 ? 784  CYS A CA  1 
ATOM   3444  C  C   . CYS A  1  457  ? 254.928 232.741 181.440 1.00   214.54 ? 784  CYS A C   1 
ATOM   3445  O  O   . CYS A  1  457  ? 255.669 233.717 181.544 1.00   253.17 ? 784  CYS A O   1 
ATOM   3446  C  CB  . CYS A  1  457  ? 254.719 231.032 183.279 1.00   228.87 ? 784  CYS A CB  1 
ATOM   3447  S  SG  . CYS A  1  457  ? 256.068 231.438 184.407 1.00   274.94 ? 784  CYS A SG  1 
ATOM   3448  N  N   . SER A  1  458  ? 254.808 232.036 180.322 1.00   183.97 ? 785  SER A N   1 
ATOM   3449  C  CA  . SER A  1  458  ? 255.448 232.412 179.052 1.00   199.10 ? 785  SER A CA  1 
ATOM   3450  C  C   . SER A  1  458  ? 255.058 233.824 178.601 1.00   198.92 ? 785  SER A C   1 
ATOM   3451  O  O   . SER A  1  458  ? 255.911 234.640 178.213 1.00   189.25 ? 785  SER A O   1 
ATOM   3452  C  CB  . SER A  1  458  ? 255.037 231.400 177.969 1.00   210.89 ? 785  SER A CB  1 
ATOM   3453  O  OG  . SER A  1  458  ? 255.354 231.839 176.664 1.00   211.83 ? 785  SER A OG  1 
ATOM   3454  N  N   . LEU A  1  459  ? 253.758 234.095 178.668 1.00   187.36 ? 786  LEU A N   1 
ATOM   3455  C  CA  . LEU A  1  459  ? 253.186 235.356 178.176 1.00   168.30 ? 786  LEU A CA  1 
ATOM   3456  C  C   . LEU A  1  459  ? 253.793 236.491 178.919 1.00   154.53 ? 786  LEU A C   1 
ATOM   3457  O  O   . LEU A  1  459  ? 254.130 237.494 178.350 1.00   161.68 ? 786  LEU A O   1 
ATOM   3458  C  CB  . LEU A  1  459  ? 251.665 235.388 178.395 1.00   174.12 ? 786  LEU A CB  1 
ATOM   3459  C  CG  . LEU A  1  459  ? 250.816 236.365 177.562 1.00   166.31 ? 786  LEU A CG  1 
ATOM   3460  C  CD1 . LEU A  1  459  ? 249.364 235.889 177.482 1.00   173.66 ? 786  LEU A CD1 1 
ATOM   3461  C  CD2 . LEU A  1  459  ? 250.885 237.796 178.063 1.00   154.48 ? 786  LEU A CD2 1 
ATOM   3462  N  N   . VAL A  1  460  ? 253.894 236.295 180.219 1.00   162.53 ? 787  VAL A N   1 
ATOM   3463  C  CA  . VAL A  1  460  ? 254.434 237.257 181.130 1.00   175.29 ? 787  VAL A CA  1 
ATOM   3464  C  C   . VAL A  1  460  ? 255.892 237.646 180.784 1.00   181.19 ? 787  VAL A C   1 
ATOM   3465  O  O   . VAL A  1  460  ? 256.212 238.830 180.948 1.00   176.86 ? 787  VAL A O   1 
ATOM   3466  C  CB  . VAL A  1  460  ? 254.168 236.775 182.595 1.00   188.36 ? 787  VAL A CB  1 
ATOM   3467  C  CG1 . VAL A  1  460  ? 255.357 236.961 183.531 1.00   220.03 ? 787  VAL A CG1 1 
ATOM   3468  C  CG2 . VAL A  1  460  ? 252.894 237.431 183.130 1.00   165.32 ? 787  VAL A CG2 1 
ATOM   3469  N  N   . GLU A  1  461  ? 256.747 236.723 180.281 1.00   166.40 ? 788  GLU A N   1 
ATOM   3470  C  CA  . GLU A  1  461  ? 258.070 237.169 179.754 1.00   193.74 ? 788  GLU A CA  1 
ATOM   3471  C  C   . GLU A  1  461  ? 257.830 238.355 178.822 1.00   201.81 ? 788  GLU A C   1 
ATOM   3472  O  O   . GLU A  1  461  ? 258.443 239.416 178.975 1.00   194.14 ? 788  GLU A O   1 
ATOM   3473  C  CB  . GLU A  1  461  ? 258.956 236.099 178.992 1.00   221.84 ? 788  GLU A CB  1 
ATOM   3474  C  CG  . GLU A  1  461  ? 259.914 236.723 177.881 1.00   263.60 ? 788  GLU A CG  1 
ATOM   3475  C  CD  . GLU A  1  461  ? 261.249 235.996 177.503 1.00   257.21 ? 788  GLU A CD  1 
ATOM   3476  O  OE1 . GLU A  1  461  ? 261.527 234.887 178.008 1.00   276.39 ? 788  GLU A OE1 1 
ATOM   3477  O  OE2 . GLU A  1  461  ? 262.063 236.551 176.688 1.00   173.08 ? 788  GLU A OE2 1 
ATOM   3478  N  N   . LEU A  1  462  ? 256.938 238.141 177.856 1.00   199.22 ? 789  LEU A N   1 
ATOM   3479  C  CA  . LEU A  1  462  ? 256.689 239.104 176.780 1.00   185.73 ? 789  LEU A CA  1 
ATOM   3480  C  C   . LEU A  1  462  ? 256.276 240.432 177.346 1.00   155.72 ? 789  LEU A C   1 
ATOM   3481  O  O   . LEU A  1  462  ? 256.835 241.454 176.978 1.00   186.94 ? 789  LEU A O   1 
ATOM   3482  C  CB  . LEU A  1  462  ? 255.578 238.594 175.847 1.00   194.53 ? 789  LEU A CB  1 
ATOM   3483  C  CG  . LEU A  1  462  ? 255.373 239.215 174.465 1.00   184.46 ? 789  LEU A CG  1 
ATOM   3484  C  CD1 . LEU A  1  462  ? 254.304 238.386 173.758 1.00   177.46 ? 789  LEU A CD1 1 
ATOM   3485  C  CD2 . LEU A  1  462  ? 254.981 240.688 174.523 1.00   176.40 ? 789  LEU A CD2 1 
ATOM   3486  N  N   . LEU A  1  463  ? 255.291 240.396 178.240 1.00   148.16 ? 790  LEU A N   1 
ATOM   3487  C  CA  . LEU A  1  463  ? 254.711 241.621 178.783 1.00   164.79 ? 790  LEU A CA  1 
ATOM   3488  C  C   . LEU A  1  463  ? 255.705 242.486 179.542 1.00   180.58 ? 790  LEU A C   1 
ATOM   3489  O  O   . LEU A  1  463  ? 255.778 243.695 179.313 1.00   159.66 ? 790  LEU A O   1 
ATOM   3490  C  CB  . LEU A  1  463  ? 253.505 241.325 179.671 1.00   152.58 ? 790  LEU A CB  1 
ATOM   3491  C  CG  . LEU A  1  463  ? 252.263 240.865 178.915 1.00   170.38 ? 790  LEU A CG  1 
ATOM   3492  C  CD1 . LEU A  1  463  ? 251.049 240.804 179.833 1.00   189.11 ? 790  LEU A CD1 1 
ATOM   3493  C  CD2 . LEU A  1  463  ? 251.944 241.753 177.723 1.00   182.35 ? 790  LEU A CD2 1 
ATOM   3494  N  N   . VAL A  1  464  ? 256.497 241.860 180.403 1.00   180.50 ? 791  VAL A N   1 
ATOM   3495  C  CA  . VAL A  1  464  ? 257.469 242.597 181.171 1.00   168.57 ? 791  VAL A CA  1 
ATOM   3496  C  C   . VAL A  1  464  ? 258.516 243.243 180.273 1.00   167.32 ? 791  VAL A C   1 
ATOM   3497  O  O   . VAL A  1  464  ? 258.778 244.412 180.441 1.00   202.14 ? 791  VAL A O   1 
ATOM   3498  C  CB  . VAL A  1  464  ? 258.154 241.724 182.229 1.00   220.35 ? 791  VAL A CB  1 
ATOM   3499  C  CG1 . VAL A  1  464  ? 259.303 242.474 182.914 1.00   244.30 ? 791  VAL A CG1 1 
ATOM   3500  C  CG2 . VAL A  1  464  ? 257.129 241.280 183.262 1.00   253.27 ? 791  VAL A CG2 1 
ATOM   3501  N  N   . GLN A  1  465  ? 259.122 242.493 179.349 1.00   189.60 ? 792  GLN A N   1 
ATOM   3502  C  CA  . GLN A  1  465  ? 260.189 243.031 178.445 1.00   190.85 ? 792  GLN A CA  1 
ATOM   3503  C  C   . GLN A  1  465  ? 259.633 244.207 177.644 1.00   179.69 ? 792  GLN A C   1 
ATOM   3504  O  O   . GLN A  1  465  ? 260.290 245.234 177.457 1.00   218.35 ? 792  GLN A O   1 
ATOM   3505  C  CB  . GLN A  1  465  ? 260.748 241.914 177.502 1.00   210.80 ? 792  GLN A CB  1 
ATOM   3506  C  CG  . GLN A  1  465  ? 262.165 242.096 176.898 1.00   230.41 ? 792  GLN A CG  1 
ATOM   3507  C  CD  . GLN A  1  465  ? 262.811 240.801 176.286 1.00   250.80 ? 792  GLN A CD  1 
ATOM   3508  O  OE1 . GLN A  1  465  ? 263.674 240.863 175.370 1.00   207.93 ? 792  GLN A OE1 1 
ATOM   3509  N  NE2 . GLN A  1  465  ? 262.419 239.634 176.808 1.00   223.50 ? 792  GLN A NE2 1 
ATOM   3510  N  N   . LEU A  1  466  ? 258.396 244.044 177.205 1.00   170.11 ? 793  LEU A N   1 
ATOM   3511  C  CA  . LEU A  1  466  ? 257.692 245.051 176.436 1.00   198.75 ? 793  LEU A CA  1 
ATOM   3512  C  C   . LEU A  1  466  ? 257.384 246.239 177.303 1.00   202.59 ? 793  LEU A C   1 
ATOM   3513  O  O   . LEU A  1  466  ? 257.620 247.378 176.907 1.00   227.03 ? 793  LEU A O   1 
ATOM   3514  C  CB  . LEU A  1  466  ? 256.381 244.466 175.895 1.00   216.28 ? 793  LEU A CB  1 
ATOM   3515  C  CG  . LEU A  1  466  ? 255.447 245.293 175.003 1.00   222.26 ? 793  LEU A CG  1 
ATOM   3516  C  CD1 . LEU A  1  466  ? 254.332 244.409 174.441 1.00   218.83 ? 793  LEU A CD1 1 
ATOM   3517  C  CD2 . LEU A  1  466  ? 254.851 246.498 175.725 1.00   237.74 ? 793  LEU A CD2 1 
ATOM   3518  N  N   . ALA A  1  467  ? 256.810 245.968 178.468 1.00   189.12 ? 794  ALA A N   1 
ATOM   3519  C  CA  . ALA A  1  467  ? 256.370 247.033 179.364 1.00   185.50 ? 794  ALA A CA  1 
ATOM   3520  C  C   . ALA A  1  467  ? 257.544 247.837 179.928 1.00   170.52 ? 794  ALA A C   1 
ATOM   3521  O  O   . ALA A  1  467  ? 257.412 249.037 180.086 1.00   175.65 ? 794  ALA A O   1 
ATOM   3522  C  CB  . ALA A  1  467  ? 255.518 246.490 180.490 1.00   212.46 ? 794  ALA A CB  1 
ATOM   3523  N  N   . ARG A  1  468  ? 258.675 247.187 180.233 1.00   174.26 ? 795  ARG A N   1 
ATOM   3524  C  CA  . ARG A  1  468  ? 259.901 247.901 180.624 1.00   195.28 ? 795  ARG A CA  1 
ATOM   3525  C  C   . ARG A  1  468  ? 260.274 248.930 179.528 1.00   217.90 ? 795  ARG A C   1 
ATOM   3526  O  O   . ARG A  1  468  ? 260.432 250.121 179.841 1.00   196.77 ? 795  ARG A O   1 
ATOM   3527  C  CB  . ARG A  1  468  ? 261.100 246.945 180.940 1.00   197.32 ? 795  ARG A CB  1 
ATOM   3528  C  CG  . ARG A  1  468  ? 261.199 246.356 182.362 1.00   187.58 ? 795  ARG A CG  1 
ATOM   3529  C  CD  . ARG A  1  468  ? 262.558 245.657 182.608 1.00   221.69 ? 795  ARG A CD  1 
ATOM   3530  N  NE  . ARG A  1  468  ? 262.790 245.218 184.009 1.00   264.55 ? 795  ARG A NE  1 
ATOM   3531  C  CZ  . ARG A  1  468  ? 263.951 244.763 184.538 1.00   251.58 ? 795  ARG A CZ  1 
ATOM   3532  N  NH1 . ARG A  1  468  ? 265.079 244.661 183.806 1.00   209.73 ? 795  ARG A NH1 1 
ATOM   3533  N  NH2 . ARG A  1  468  ? 263.993 244.405 185.838 1.00   203.26 ? 795  ARG A NH2 1 
ATOM   3534  N  N   . ASP A  1  469  ? 260.358 248.493 178.262 1.00   246.01 ? 796  ASP A N   1 
ATOM   3535  C  CA  . ASP A  1  469  ? 260.736 249.430 177.177 1.00   262.55 ? 796  ASP A CA  1 
ATOM   3536  C  C   . ASP A  1  469  ? 259.614 250.468 176.827 1.00   243.17 ? 796  ASP A C   1 
ATOM   3537  O  O   . ASP A  1  469  ? 259.927 251.580 176.413 1.00   226.02 ? 796  ASP A O   1 
ATOM   3538  C  CB  . ASP A  1  469  ? 261.365 248.733 175.924 1.00   272.65 ? 796  ASP A CB  1 
ATOM   3539  C  CG  . ASP A  1  469  ? 262.947 248.705 175.957 1.00   253.48 ? 796  ASP A CG  1 
ATOM   3540  O  OD1 . ASP A  1  469  ? 263.520 248.397 177.043 1.00   206.01 ? 796  ASP A OD1 1 
ATOM   3541  O  OD2 . ASP A  1  469  ? 263.611 248.985 174.897 1.00   171.98 ? 796  ASP A OD2 1 
ATOM   3542  N  N   . LEU A  1  470  ? 258.341 250.133 177.049 1.00   233.88 ? 797  LEU A N   1 
ATOM   3543  C  CA  . LEU A  1  470  ? 257.253 251.145 176.977 1.00   229.23 ? 797  LEU A CA  1 
ATOM   3544  C  C   . LEU A  1  470  ? 257.318 252.174 178.101 1.00   239.51 ? 797  LEU A C   1 
ATOM   3545  O  O   . LEU A  1  470  ? 256.749 253.251 177.965 1.00   227.83 ? 797  LEU A O   1 
ATOM   3546  C  CB  . LEU A  1  470  ? 255.856 250.503 177.016 1.00   244.00 ? 797  LEU A CB  1 
ATOM   3547  C  CG  . LEU A  1  470  ? 255.018 250.301 175.752 1.00   267.78 ? 797  LEU A CG  1 
ATOM   3548  C  CD1 . LEU A  1  470  ? 253.674 249.682 176.143 1.00   284.38 ? 797  LEU A CD1 1 
ATOM   3549  C  CD2 . LEU A  1  470  ? 254.797 251.604 174.984 1.00   253.55 ? 797  LEU A CD2 1 
ATOM   3550  N  N   . LYS A  1  471  ? 257.977 251.822 179.207 1.00   244.68 ? 798  LYS A N   1 
ATOM   3551  C  CA  . LYS A  1  471  ? 258.311 252.758 180.279 1.00   231.16 ? 798  LYS A CA  1 
ATOM   3552  C  C   . LYS A  1  471  ? 257.150 253.022 181.226 1.00   209.62 ? 798  LYS A C   1 
ATOM   3553  O  O   . LYS A  1  471  ? 257.206 254.001 181.950 1.00   225.37 ? 798  LYS A O   1 
ATOM   3554  C  CB  . LYS A  1  471  ? 258.832 254.092 179.695 1.00   251.67 ? 798  LYS A CB  1 
ATOM   3555  C  CG  . LYS A  1  471  ? 259.833 254.838 180.555 1.00   256.78 ? 798  LYS A CG  1 
ATOM   3556  C  CD  . LYS A  1  471  ? 259.964 256.270 180.075 1.00   255.80 ? 798  LYS A CD  1 
ATOM   3557  C  CE  . LYS A  1  471  ? 261.121 256.967 180.764 1.00   275.71 ? 798  LYS A CE  1 
ATOM   3558  N  NZ  . LYS A  1  471  ? 261.406 258.291 180.149 1.00   291.22 ? 798  LYS A NZ  1 
ATOM   3559  N  N   . LEU A  1  472  ? 256.112 252.184 181.252 1.00   215.51 ? 799  LEU A N   1 
ATOM   3560  C  CA  . LEU A  1  472  ? 254.917 252.490 182.076 1.00   233.10 ? 799  LEU A CA  1 
ATOM   3561  C  C   . LEU A  1  472  ? 255.210 252.401 183.561 1.00   248.77 ? 799  LEU A C   1 
ATOM   3562  O  O   . LEU A  1  472  ? 255.090 253.398 184.270 1.00   297.18 ? 799  LEU A O   1 
ATOM   3563  C  CB  . LEU A  1  472  ? 253.701 251.633 181.696 1.00   229.52 ? 799  LEU A CB  1 
ATOM   3564  C  CG  . LEU A  1  472  ? 252.892 252.264 180.556 1.00   236.44 ? 799  LEU A CG  1 
ATOM   3565  C  CD1 . LEU A  1  472  ? 253.666 252.180 179.251 1.00   252.95 ? 799  LEU A CD1 1 
ATOM   3566  C  CD2 . LEU A  1  472  ? 251.527 251.612 180.401 1.00   233.60 ? 799  LEU A CD2 1 
ATOM   3567  N  N   . GLY A  1  473  ? 255.623 251.231 184.021 1.00   222.67 ? 800  GLY A N   1 
ATOM   3568  C  CA  . GLY A  1  473  ? 255.991 251.083 185.417 1.00   219.98 ? 800  GLY A CA  1 
ATOM   3569  C  C   . GLY A  1  473  ? 254.896 250.472 186.268 1.00   213.86 ? 800  GLY A C   1 
ATOM   3570  O  O   . GLY A  1  473  ? 255.116 249.393 186.800 1.00   186.57 ? 800  GLY A O   1 
ATOM   3571  N  N   . PRO A  1  474  ? 253.720 251.148 186.427 1.00   216.75 ? 801  PRO A N   1 
ATOM   3572  C  CA  . PRO A  1  474  ? 252.684 250.488 187.229 1.00   194.66 ? 801  PRO A CA  1 
ATOM   3573  C  C   . PRO A  1  474  ? 252.291 249.117 186.720 1.00   190.38 ? 801  PRO A C   1 
ATOM   3574  O  O   . PRO A  1  474  ? 251.939 248.263 187.514 1.00   200.34 ? 801  PRO A O   1 
ATOM   3575  C  CB  . PRO A  1  474  ? 251.483 251.430 187.125 1.00   197.35 ? 801  PRO A CB  1 
ATOM   3576  C  CG  . PRO A  1  474  ? 252.074 252.759 186.891 1.00   197.83 ? 801  PRO A CG  1 
ATOM   3577  C  CD  . PRO A  1  474  ? 253.279 252.506 186.042 1.00   213.12 ? 801  PRO A CD  1 
ATOM   3578  N  N   . TYR A  1  475  ? 252.338 248.895 185.412 1.00   209.06 ? 802  TYR A N   1 
ATOM   3579  C  CA  . TYR A  1  475  ? 252.095 247.540 184.879 1.00   210.37 ? 802  TYR A CA  1 
ATOM   3580  C  C   . TYR A  1  475  ? 253.195 246.541 185.234 1.00   200.18 ? 802  TYR A C   1 
ATOM   3581  O  O   . TYR A  1  475  ? 252.904 245.383 185.505 1.00   158.13 ? 802  TYR A O   1 
ATOM   3582  C  CB  . TYR A  1  475  ? 251.923 247.549 183.363 1.00   203.82 ? 802  TYR A CB  1 
ATOM   3583  C  CG  . TYR A  1  475  ? 250.571 248.014 182.934 1.00   190.81 ? 802  TYR A CG  1 
ATOM   3584  C  CD1 . TYR A  1  475  ? 250.315 249.371 182.800 1.00   203.63 ? 802  TYR A CD1 1 
ATOM   3585  C  CD2 . TYR A  1  475  ? 249.548 247.110 182.663 1.00   162.65 ? 802  TYR A CD2 1 
ATOM   3586  C  CE1 . TYR A  1  475  ? 249.074 249.827 182.405 1.00   217.87 ? 802  TYR A CE1 1 
ATOM   3587  C  CE2 . TYR A  1  475  ? 248.305 247.556 182.272 1.00   178.28 ? 802  TYR A CE2 1 
ATOM   3588  C  CZ  . TYR A  1  475  ? 248.077 248.921 182.135 1.00   212.19 ? 802  TYR A CZ  1 
ATOM   3589  O  OH  . TYR A  1  475  ? 246.856 249.411 181.730 1.00   279.30 ? 802  TYR A OH  1 
ATOM   3590  N  N   . VAL A  1  476  ? 254.447 246.995 185.204 1.00   205.24 ? 803  VAL A N   1 
ATOM   3591  C  CA  . VAL A  1  476  ? 255.612 246.173 185.549 1.00   197.98 ? 803  VAL A CA  1 
ATOM   3592  C  C   . VAL A  1  476  ? 255.431 245.597 186.936 1.00   186.28 ? 803  VAL A C   1 
ATOM   3593  O  O   . VAL A  1  476  ? 255.492 244.387 187.113 1.00   173.23 ? 803  VAL A O   1 
ATOM   3594  C  CB  . VAL A  1  476  ? 256.926 247.023 185.504 1.00   214.61 ? 803  VAL A CB  1 
ATOM   3595  C  CG1 . VAL A  1  476  ? 258.114 246.303 186.135 1.00   214.97 ? 803  VAL A CG1 1 
ATOM   3596  C  CG2 . VAL A  1  476  ? 257.264 247.434 184.073 1.00   240.00 ? 803  VAL A CG2 1 
ATOM   3597  N  N   . ASP A  1  477  ? 255.231 246.477 187.909 1.00   198.39 ? 804  ASP A N   1 
ATOM   3598  C  CA  . ASP A  1  477  ? 255.088 246.070 189.314 1.00   206.07 ? 804  ASP A CA  1 
ATOM   3599  C  C   . ASP A  1  477  ? 253.914 245.148 189.531 1.00   170.16 ? 804  ASP A C   1 
ATOM   3600  O  O   . ASP A  1  477  ? 253.977 244.284 190.381 1.00   181.07 ? 804  ASP A O   1 
ATOM   3601  C  CB  . ASP A  1  477  ? 254.920 247.265 190.248 1.00   244.38 ? 804  ASP A CB  1 
ATOM   3602  C  CG  . ASP A  1  477  ? 253.798 248.149 189.818 1.00   286.61 ? 804  ASP A CG  1 
ATOM   3603  O  OD1 . ASP A  1  477  ? 253.696 248.270 188.596 1.00   304.60 ? 804  ASP A OD1 1 
ATOM   3604  O  OD2 . ASP A  1  477  ? 253.022 248.672 190.641 1.00   337.70 ? 804  ASP A OD2 1 
ATOM   3605  N  N   . HIS A  1  478  ? 252.847 245.324 188.767 1.00   165.02 ? 805  HIS A N   1 
ATOM   3606  C  CA  . HIS A  1  478  ? 251.702 244.436 188.878 1.00   153.95 ? 805  HIS A CA  1 
ATOM   3607  C  C   . HIS A  1  478  ? 252.098 243.004 188.517 1.00   137.47 ? 805  HIS A C   1 
ATOM   3608  O  O   . HIS A  1  478  ? 251.776 242.080 189.256 1.00   170.80 ? 805  HIS A O   1 
ATOM   3609  C  CB  . HIS A  1  478  ? 250.543 244.946 188.032 1.00   163.43 ? 805  HIS A CB  1 
ATOM   3610  C  CG  . HIS A  1  478  ? 249.378 244.037 188.043 1.00   174.98 ? 805  HIS A CG  1 
ATOM   3611  N  ND1 . HIS A  1  478  ? 249.106 243.174 187.003 1.00   191.71 ? 805  HIS A ND1 1 
ATOM   3612  C  CD2 . HIS A  1  478  ? 248.464 243.783 189.000 1.00   193.46 ? 805  HIS A CD2 1 
ATOM   3613  C  CE1 . HIS A  1  478  ? 248.049 242.446 187.309 1.00   191.45 ? 805  HIS A CE1 1 
ATOM   3614  N  NE2 . HIS A  1  478  ? 247.645 242.793 188.518 1.00   218.22 ? 805  HIS A NE2 1 
ATOM   3615  N  N   . TYR A  1  479  ? 252.843 242.801 187.434 1.00   146.53 ? 806  TYR A N   1 
ATOM   3616  C  CA  . TYR A  1  479  ? 253.340 241.434 187.151 1.00   159.97 ? 806  TYR A CA  1 
ATOM   3617  C  C   . TYR A  1  479  ? 254.377 240.959 188.163 1.00   158.50 ? 806  TYR A C   1 
ATOM   3618  O  O   . TYR A  1  479  ? 254.418 239.773 188.438 1.00   149.04 ? 806  TYR A O   1 
ATOM   3619  C  CB  . TYR A  1  479  ? 253.923 241.246 185.758 1.00   171.39 ? 806  TYR A CB  1 
ATOM   3620  C  CG  . TYR A  1  479  ? 253.057 241.769 184.682 1.00   166.18 ? 806  TYR A CG  1 
ATOM   3621  C  CD1 . TYR A  1  479  ? 251.746 241.338 184.548 1.00   139.19 ? 806  TYR A CD1 1 
ATOM   3622  C  CD2 . TYR A  1  479  ? 253.545 242.738 183.804 1.00   192.84 ? 806  TYR A CD2 1 
ATOM   3623  C  CE1 . TYR A  1  479  ? 250.943 241.865 183.560 1.00   159.81 ? 806  TYR A CE1 1 
ATOM   3624  C  CE2 . TYR A  1  479  ? 252.751 243.259 182.814 1.00   201.65 ? 806  TYR A CE2 1 
ATOM   3625  C  CZ  . TYR A  1  479  ? 251.450 242.817 182.699 1.00   184.32 ? 806  TYR A CZ  1 
ATOM   3626  O  OH  . TYR A  1  479  ? 250.647 243.329 181.717 1.00   188.75 ? 806  TYR A OH  1 
ATOM   3627  N  N   . TYR A  1  480  ? 255.213 241.849 188.702 1.00   163.55 ? 807  TYR A N   1 
ATOM   3628  C  CA  . TYR A  1  480  ? 256.064 241.491 189.853 1.00   169.92 ? 807  TYR A CA  1 
ATOM   3629  C  C   . TYR A  1  480  ? 255.218 240.899 190.995 1.00   152.98 ? 807  TYR A C   1 
ATOM   3630  O  O   . TYR A  1  480  ? 255.576 239.899 191.636 1.00   157.41 ? 807  TYR A O   1 
ATOM   3631  C  CB  . TYR A  1  480  ? 256.822 242.708 190.389 1.00   180.80 ? 807  TYR A CB  1 
ATOM   3632  C  CG  . TYR A  1  480  ? 257.546 242.430 191.681 1.00   186.02 ? 807  TYR A CG  1 
ATOM   3633  C  CD1 . TYR A  1  480  ? 258.831 241.941 191.667 1.00   205.07 ? 807  TYR A CD1 1 
ATOM   3634  C  CD2 . TYR A  1  480  ? 256.934 242.634 192.909 1.00   192.51 ? 807  TYR A CD2 1 
ATOM   3635  C  CE1 . TYR A  1  480  ? 259.504 241.666 192.836 1.00   223.48 ? 807  TYR A CE1 1 
ATOM   3636  C  CE2 . TYR A  1  480  ? 257.595 242.357 194.087 1.00   212.66 ? 807  TYR A CE2 1 
ATOM   3637  C  CZ  . TYR A  1  480  ? 258.881 241.871 194.045 1.00   231.16 ? 807  TYR A CZ  1 
ATOM   3638  O  OH  . TYR A  1  480  ? 259.555 241.590 195.213 1.00   290.22 ? 807  TYR A OH  1 
ATOM   3639  N  N   . ARG A  1  481  ? 254.111 241.566 191.270 1.00   149.91 ? 808  ARG A N   1 
ATOM   3640  C  CA  . ARG A  1  481  ? 253.220 241.125 192.335 1.00   180.99 ? 808  ARG A CA  1 
ATOM   3641  C  C   . ARG A  1  481  ? 252.743 239.710 192.057 1.00   169.38 ? 808  ARG A C   1 
ATOM   3642  O  O   . ARG A  1  481  ? 252.714 238.852 192.945 1.00   197.00 ? 808  ARG A O   1 
ATOM   3643  C  CB  . ARG A  1  481  ? 251.999 242.054 192.486 1.00   210.48 ? 808  ARG A CB  1 
ATOM   3644  C  CG  . ARG A  1  481  ? 251.795 242.591 193.893 1.00   213.23 ? 808  ARG A CG  1 
ATOM   3645  C  CD  . ARG A  1  481  ? 252.702 243.795 194.182 1.00   207.71 ? 808  ARG A CD  1 
ATOM   3646  N  NE  . ARG A  1  481  ? 252.103 244.609 195.217 1.00   201.62 ? 808  ARG A NE  1 
ATOM   3647  C  CZ  . ARG A  1  481  ? 251.010 245.347 195.042 1.00   235.09 ? 808  ARG A CZ  1 
ATOM   3648  N  NH1 . ARG A  1  481  ? 250.398 245.430 193.857 1.00   238.21 ? 808  ARG A NH1 1 
ATOM   3649  N  NH2 . ARG A  1  481  ? 250.522 246.021 196.069 1.00   274.96 ? 808  ARG A NH2 1 
ATOM   3650  N  N   . ASP A  1  482  ? 252.336 239.491 190.819 1.00   150.58 ? 809  ASP A N   1 
ATOM   3651  C  CA  . ASP A  1  482  ? 251.716 238.249 190.459 1.00   182.51 ? 809  ASP A CA  1 
ATOM   3652  C  C   . ASP A  1  482  ? 252.749 237.150 190.281 1.00   194.26 ? 809  ASP A C   1 
ATOM   3653  O  O   . ASP A  1  482  ? 252.436 235.993 190.523 1.00   229.22 ? 809  ASP A O   1 
ATOM   3654  C  CB  . ASP A  1  482  ? 250.875 238.408 189.185 1.00   222.69 ? 809  ASP A CB  1 
ATOM   3655  C  CG  . ASP A  1  482  ? 249.603 239.240 189.404 1.00   256.09 ? 809  ASP A CG  1 
ATOM   3656  O  OD1 . ASP A  1  482  ? 249.201 239.441 190.574 1.00   285.22 ? 809  ASP A OD1 1 
ATOM   3657  O  OD2 . ASP A  1  482  ? 248.997 239.675 188.393 1.00   290.37 ? 809  ASP A OD2 1 
ATOM   3658  N  N   . TYR A  1  483  ? 253.952 237.502 189.822 1.00   177.59 ? 810  TYR A N   1 
ATOM   3659  C  CA  . TYR A  1  483  ? 255.014 236.518 189.560 1.00   179.56 ? 810  TYR A CA  1 
ATOM   3660  C  C   . TYR A  1  483  ? 256.253 237.128 190.117 1.00   179.63 ? 810  TYR A C   1 
ATOM   3661  O  O   . TYR A  1  483  ? 256.728 238.116 189.575 1.00   227.02 ? 810  TYR A O   1 
ATOM   3662  C  CB  . TYR A  1  483  ? 255.190 236.211 188.055 1.00   181.43 ? 810  TYR A CB  1 
ATOM   3663  C  CG  . TYR A  1  483  ? 254.051 235.374 187.545 1.00   163.08 ? 810  TYR A CG  1 
ATOM   3664  C  CD1 . TYR A  1  483  ? 252.808 235.936 187.346 1.00   168.16 ? 810  TYR A CD1 1 
ATOM   3665  C  CD2 . TYR A  1  483  ? 254.189 234.029 187.333 1.00   149.76 ? 810  TYR A CD2 1 
ATOM   3666  C  CE1 . TYR A  1  483  ? 251.732 235.194 186.945 1.00   166.01 ? 810  TYR A CE1 1 
ATOM   3667  C  CE2 . TYR A  1  483  ? 253.112 233.275 186.923 1.00   170.44 ? 810  TYR A CE2 1 
ATOM   3668  C  CZ  . TYR A  1  483  ? 251.884 233.874 186.735 1.00   170.32 ? 810  TYR A CZ  1 
ATOM   3669  O  OH  . TYR A  1  483  ? 250.779 233.171 186.328 1.00   196.50 ? 810  TYR A OH  1 
ATOM   3670  N  N   . PRO A  1  484  ? 256.760 236.576 191.213 1.00   179.83 ? 811  PRO A N   1 
ATOM   3671  C  CA  . PRO A  1  484  ? 257.849 237.203 191.923 1.00   191.81 ? 811  PRO A CA  1 
ATOM   3672  C  C   . PRO A  1  484  ? 259.106 237.269 191.067 1.00   200.08 ? 811  PRO A C   1 
ATOM   3673  O  O   . PRO A  1  484  ? 259.816 238.274 191.105 1.00   196.78 ? 811  PRO A O   1 
ATOM   3674  C  CB  . PRO A  1  484  ? 258.094 236.242 193.071 1.00   216.55 ? 811  PRO A CB  1 
ATOM   3675  C  CG  . PRO A  1  484  ? 257.790 234.923 192.471 1.00   232.67 ? 811  PRO A CG  1 
ATOM   3676  C  CD  . PRO A  1  484  ? 256.619 235.155 191.573 1.00   211.24 ? 811  PRO A CD  1 
ATOM   3677  N  N   . THR A  1  485  ? 259.332 236.217 190.275 1.00   206.57 ? 812  THR A N   1 
ATOM   3678  C  CA  . THR A  1  485  ? 260.555 236.013 189.524 1.00   218.54 ? 812  THR A CA  1 
ATOM   3679  C  C   . THR A  1  485  ? 260.116 236.140 188.085 1.00   220.76 ? 812  THR A C   1 
ATOM   3680  O  O   . THR A  1  485  ? 258.960 235.813 187.755 1.00   188.72 ? 812  THR A O   1 
ATOM   3681  C  CB  . THR A  1  485  ? 261.224 234.649 189.836 1.00   197.12 ? 812  THR A CB  1 
ATOM   3682  O  OG1 . THR A  1  485  ? 260.248 233.708 190.304 1.00   152.58 ? 812  THR A OG1 1 
ATOM   3683  C  CG2 . THR A  1  485  ? 262.270 234.813 190.933 1.00   191.80 ? 812  THR A CG2 1 
ATOM   3684  N  N   . LEU A  1  486  ? 261.027 236.627 187.251 1.00   216.09 ? 813  LEU A N   1 
ATOM   3685  C  CA  . LEU A  1  486  ? 260.663 237.267 185.993 1.00   226.89 ? 813  LEU A CA  1 
ATOM   3686  C  C   . LEU A  1  486  ? 260.142 238.684 186.305 1.00   207.87 ? 813  LEU A C   1 
ATOM   3687  O  O   . LEU A  1  486  ? 258.975 239.036 186.042 1.00   157.96 ? 813  LEU A O   1 
ATOM   3688  C  CB  . LEU A  1  486  ? 259.645 236.438 185.181 1.00   240.95 ? 813  LEU A CB  1 
ATOM   3689  C  CG  . LEU A  1  486  ? 259.843 234.914 185.103 1.00   242.18 ? 813  LEU A CG  1 
ATOM   3690  C  CD1 . LEU A  1  486  ? 258.508 234.239 184.812 1.00   257.10 ? 813  LEU A CD1 1 
ATOM   3691  C  CD2 . LEU A  1  486  ? 260.909 234.556 184.079 1.00   254.65 ? 813  LEU A CD2 1 
ATOM   3692  N  N   . ALA A  1  487  ? 261.023 239.487 186.903 1.00   203.85 ? 814  ALA A N   1 
ATOM   3693  C  CA  . ALA A  1  487  ? 260.791 240.941 187.077 1.00   222.17 ? 814  ALA A CA  1 
ATOM   3694  C  C   . ALA A  1  487  ? 261.878 241.614 187.946 1.00   212.12 ? 814  ALA A C   1 
ATOM   3695  O  O   . ALA A  1  487  ? 262.997 241.112 188.100 1.00   171.60 ? 814  ALA A O   1 
ATOM   3696  C  CB  . ALA A  1  487  ? 259.380 241.238 187.644 1.00   205.01 ? 814  ALA A CB  1 
ATOM   3697  N  N   . SER A  1  488  ? 244.714 252.946 180.367 1.00   166.75 ? 839  SER A N   1 
ATOM   3698  C  CA  . SER A  1  488  ? 244.387 253.237 181.804 1.00   227.28 ? 839  SER A CA  1 
ATOM   3699  C  C   . SER A  1  488  ? 245.490 252.866 182.873 1.00   253.08 ? 839  SER A C   1 
ATOM   3700  O  O   . SER A  1  488  ? 246.642 252.639 182.495 1.00   267.16 ? 839  SER A O   1 
ATOM   3701  C  CB  . SER A  1  488  ? 243.053 252.565 182.168 1.00   205.57 ? 839  SER A CB  1 
ATOM   3702  N  N   . GLU A  1  489  ? 245.153 252.853 184.182 1.00   258.93 ? 840  GLU A N   1 
ATOM   3703  C  CA  . GLU A  1  489  ? 246.006 252.223 185.251 1.00   244.50 ? 840  GLU A CA  1 
ATOM   3704  C  C   . GLU A  1  489  ? 245.578 250.751 185.474 1.00   253.29 ? 840  GLU A C   1 
ATOM   3705  O  O   . GLU A  1  489  ? 244.383 250.459 185.529 1.00   243.94 ? 840  GLU A O   1 
ATOM   3706  C  CB  . GLU A  1  489  ? 245.946 252.994 186.574 1.00   195.44 ? 840  GLU A CB  1 
ATOM   3707  N  N   . PRO A  1  490  ? 246.557 249.836 185.656 1.00   232.13 ? 841  PRO A N   1 
ATOM   3708  C  CA  . PRO A  1  490  ? 246.478 248.397 185.255 1.00   199.68 ? 841  PRO A CA  1 
ATOM   3709  C  C   . PRO A  1  490  ? 245.276 247.616 185.764 1.00   184.14 ? 841  PRO A C   1 
ATOM   3710  O  O   . PRO A  1  490  ? 245.071 247.592 186.962 1.00   216.57 ? 841  PRO A O   1 
ATOM   3711  C  CB  . PRO A  1  490  ? 247.770 247.792 185.813 1.00   204.77 ? 841  PRO A CB  1 
ATOM   3712  C  CG  . PRO A  1  490  ? 248.218 248.742 186.869 1.00   232.19 ? 841  PRO A CG  1 
ATOM   3713  C  CD  . PRO A  1  490  ? 247.731 250.114 186.500 1.00   219.20 ? 841  PRO A CD  1 
ATOM   3714  N  N   . PRO A  1  491  ? 244.490 246.983 184.859 1.00   181.46 ? 842  PRO A N   1 
ATOM   3715  C  CA  . PRO A  1  491  ? 243.294 246.253 185.265 1.00   185.70 ? 842  PRO A CA  1 
ATOM   3716  C  C   . PRO A  1  491  ? 243.631 244.816 185.559 1.00   191.19 ? 842  PRO A C   1 
ATOM   3717  O  O   . PRO A  1  491  ? 244.121 244.117 184.682 1.00   227.67 ? 842  PRO A O   1 
ATOM   3718  C  CB  . PRO A  1  491  ? 242.403 246.318 184.024 1.00   174.07 ? 842  PRO A CB  1 
ATOM   3719  C  CG  . PRO A  1  491  ? 243.372 246.319 182.888 1.00   176.51 ? 842  PRO A CG  1 
ATOM   3720  C  CD  . PRO A  1  491  ? 244.688 246.876 183.403 1.00   177.88 ? 842  PRO A CD  1 
ATOM   3721  N  N   . SER A  1  492  ? 243.385 244.386 186.786 1.00   191.17 ? 843  SER A N   1 
ATOM   3722  C  CA  . SER A  1  492  ? 243.541 242.996 187.175 1.00   190.13 ? 843  SER A CA  1 
ATOM   3723  C  C   . SER A  1  492  ? 242.178 242.504 187.503 1.00   167.49 ? 843  SER A C   1 
ATOM   3724  O  O   . SER A  1  492  ? 241.499 243.174 188.283 1.00   206.70 ? 843  SER A O   1 
ATOM   3725  C  CB  . SER A  1  492  ? 244.374 242.916 188.440 1.00   207.21 ? 843  SER A CB  1 
ATOM   3726  O  OG  . SER A  1  492  ? 244.334 241.617 189.032 1.00   200.53 ? 843  SER A OG  1 
ATOM   3727  N  N   . ILE A  1  493  ? 241.761 241.352 186.988 1.00   130.63 ? 844  ILE A N   1 
ATOM   3728  C  CA  . ILE A  1  493  ? 240.458 240.853 187.414 1.00   153.87 ? 844  ILE A CA  1 
ATOM   3729  C  C   . ILE A  1  493  ? 240.361 240.475 188.918 1.00   161.50 ? 844  ILE A C   1 
ATOM   3730  O  O   . ILE A  1  493  ? 239.320 240.694 189.527 1.00   179.81 ? 844  ILE A O   1 
ATOM   3731  C  CB  . ILE A  1  493  ? 239.898 239.700 186.562 1.00   181.11 ? 844  ILE A CB  1 
ATOM   3732  C  CG1 . ILE A  1  493  ? 238.370 239.873 186.497 1.00   177.70 ? 844  ILE A CG1 1 
ATOM   3733  C  CG2 . ILE A  1  493  ? 240.336 238.320 187.096 1.00   199.33 ? 844  ILE A CG2 1 
ATOM   3734  C  CD1 . ILE A  1  493  ? 237.576 238.648 186.153 1.00   165.70 ? 844  ILE A CD1 1 
ATOM   3735  N  N   . TYR A  1  494  ? 241.416 239.930 189.516 1.00   159.96 ? 845  TYR A N   1 
ATOM   3736  C  CA  . TYR A  1  494  ? 241.389 239.666 190.963 1.00   161.81 ? 845  TYR A CA  1 
ATOM   3737  C  C   . TYR A  1  494  ? 241.238 240.925 191.803 1.00   170.65 ? 845  TYR A C   1 
ATOM   3738  O  O   . TYR A  1  494  ? 240.426 240.979 192.729 1.00   142.60 ? 845  TYR A O   1 
ATOM   3739  C  CB  . TYR A  1  494  ? 242.655 238.979 191.415 1.00   159.66 ? 845  TYR A CB  1 
ATOM   3740  C  CG  . TYR A  1  494  ? 242.770 237.584 190.980 1.00   153.11 ? 845  TYR A CG  1 
ATOM   3741  C  CD1 . TYR A  1  494  ? 241.638 236.798 190.765 1.00   144.39 ? 845  TYR A CD1 1 
ATOM   3742  C  CD2 . TYR A  1  494  ? 244.018 237.021 190.812 1.00   165.62 ? 845  TYR A CD2 1 
ATOM   3743  C  CE1 . TYR A  1  494  ? 241.753 235.488 190.380 1.00   172.84 ? 845  TYR A CE1 1 
ATOM   3744  C  CE2 . TYR A  1  494  ? 244.146 235.707 190.427 1.00   201.19 ? 845  TYR A CE2 1 
ATOM   3745  C  CZ  . TYR A  1  494  ? 243.007 234.943 190.216 1.00   204.37 ? 845  TYR A CZ  1 
ATOM   3746  O  OH  . TYR A  1  494  ? 243.124 233.633 189.822 1.00   233.97 ? 845  TYR A OH  1 
ATOM   3747  N  N   . GLN A  1  495  ? 242.032 241.936 191.468 1.00   172.19 ? 846  GLN A N   1 
ATOM   3748  C  CA  . GLN A  1  495  ? 241.959 243.220 192.135 1.00   164.37 ? 846  GLN A CA  1 
ATOM   3749  C  C   . GLN A  1  495  ? 240.565 243.746 192.091 1.00   151.80 ? 846  GLN A C   1 
ATOM   3750  O  O   . GLN A  1  495  ? 240.075 244.228 193.075 1.00   184.54 ? 846  GLN A O   1 
ATOM   3751  C  CB  . GLN A  1  495  ? 242.877 244.244 191.460 1.00   188.74 ? 846  GLN A CB  1 
ATOM   3752  C  CG  . GLN A  1  495  ? 242.971 245.587 192.175 1.00   215.78 ? 846  GLN A CG  1 
ATOM   3753  C  CD  . GLN A  1  495  ? 243.279 245.457 193.664 1.00   233.76 ? 846  GLN A CD  1 
ATOM   3754  O  OE1 . GLN A  1  495  ? 242.481 245.858 194.512 1.00   266.63 ? 846  GLN A OE1 1 
ATOM   3755  N  NE2 . GLN A  1  495  ? 244.432 244.875 193.984 1.00   233.46 ? 846  GLN A NE2 1 
ATOM   3756  N  N   . TRP A  1  496  ? 239.947 243.674 190.930 1.00   152.74 ? 847  TRP A N   1 
ATOM   3757  C  CA  . TRP A  1  496  ? 238.599 244.164 190.751 1.00   163.78 ? 847  TRP A CA  1 
ATOM   3758  C  C   . TRP A  1  496  ? 237.609 243.435 191.614 1.00   142.44 ? 847  TRP A C   1 
ATOM   3759  O  O   . TRP A  1  496  ? 236.666 244.052 192.096 1.00   194.04 ? 847  TRP A O   1 
ATOM   3760  C  CB  . TRP A  1  496  ? 238.173 243.977 189.319 1.00   167.91 ? 847  TRP A CB  1 
ATOM   3761  C  CG  . TRP A  1  496  ? 236.894 244.586 189.026 1.00   159.86 ? 847  TRP A CG  1 
ATOM   3762  C  CD1 . TRP A  1  496  ? 236.693 245.831 188.561 1.00   164.62 ? 847  TRP A CD1 1 
ATOM   3763  C  CD2 . TRP A  1  496  ? 235.611 243.977 189.160 1.00   147.21 ? 847  TRP A CD2 1 
ATOM   3764  N  NE1 . TRP A  1  496  ? 235.356 246.039 188.367 1.00   192.83 ? 847  TRP A NE1 1 
ATOM   3765  C  CE2 . TRP A  1  496  ? 234.670 244.916 188.738 1.00   150.31 ? 847  TRP A CE2 1 
ATOM   3766  C  CE3 . TRP A  1  496  ? 235.173 242.732 189.605 1.00   160.15 ? 847  TRP A CE3 1 
ATOM   3767  C  CZ2 . TRP A  1  496  ? 233.306 244.660 188.747 1.00   150.40 ? 847  TRP A CZ2 1 
ATOM   3768  C  CZ3 . TRP A  1  496  ? 233.823 242.468 189.604 1.00   184.52 ? 847  TRP A CZ3 1 
ATOM   3769  C  CH2 . TRP A  1  496  ? 232.899 243.435 189.178 1.00   178.63 ? 847  TRP A CH2 1 
ATOM   3770  N  N   . VAL A  1  497  ? 237.779 242.135 191.779 1.00   121.28 ? 848  VAL A N   1 
ATOM   3771  C  CA  . VAL A  1  497  ? 236.828 241.379 192.588 1.00   151.14 ? 848  VAL A CA  1 
ATOM   3772  C  C   . VAL A  1  497  ? 236.975 241.712 194.053 1.00   155.13 ? 848  VAL A C   1 
ATOM   3773  O  O   . VAL A  1  497  ? 235.981 242.017 194.722 1.00   181.94 ? 848  VAL A O   1 
ATOM   3774  C  CB  . VAL A  1  497  ? 236.958 239.853 192.443 1.00   165.83 ? 848  VAL A CB  1 
ATOM   3775  C  CG1 . VAL A  1  497  ? 236.018 239.126 193.415 1.00   147.74 ? 848  VAL A CG1 1 
ATOM   3776  C  CG2 . VAL A  1  497  ? 236.688 239.436 191.003 1.00   193.24 ? 848  VAL A CG2 1 
ATOM   3777  N  N   . SER A  1  498  ? 238.203 241.625 194.554 1.00   149.02 ? 849  SER A N   1 
ATOM   3778  C  CA  . SER A  1  498  ? 238.463 241.913 195.961 1.00   172.73 ? 849  SER A CA  1 
ATOM   3779  C  C   . SER A  1  498  ? 237.880 243.270 196.315 1.00   173.01 ? 849  SER A C   1 
ATOM   3780  O  O   . SER A  1  498  ? 237.060 243.397 197.238 1.00   169.57 ? 849  SER A O   1 
ATOM   3781  C  CB  . SER A  1  498  ? 239.976 241.895 196.277 1.00   191.81 ? 849  SER A CB  1 
ATOM   3782  O  OG  . SER A  1  498  ? 240.719 242.738 195.414 1.00   207.19 ? 849  SER A OG  1 
ATOM   3783  N  N   . SER A  1  499  ? 238.299 244.263 195.533 1.00   176.74 ? 850  SER A N   1 
ATOM   3784  C  CA  . SER A  1  499  ? 237.883 245.644 195.702 1.00   192.20 ? 850  SER A CA  1 
ATOM   3785  C  C   . SER A  1  499  ? 236.389 245.734 195.706 1.00   191.92 ? 850  SER A C   1 
ATOM   3786  O  O   . SER A  1  499  ? 235.842 246.373 196.588 1.00   236.81 ? 850  SER A O   1 
ATOM   3787  C  CB  . SER A  1  499  ? 238.435 246.544 194.580 1.00   213.16 ? 850  SER A CB  1 
ATOM   3788  O  OG  . SER A  1  499  ? 239.841 246.687 194.670 1.00   251.07 ? 850  SER A OG  1 
ATOM   3789  N  N   . CYS A  1  500  ? 235.754 245.083 194.725 1.00   196.80 ? 851  CYS A N   1 
ATOM   3790  C  CA  . CYS A  1  500  ? 234.305 245.135 194.520 1.00   209.44 ? 851  CYS A CA  1 
ATOM   3791  C  C   . CYS A  1  500  ? 233.569 244.675 195.734 1.00   215.55 ? 851  CYS A C   1 
ATOM   3792  O  O   . CYS A  1  500  ? 232.638 245.361 196.191 1.00   295.47 ? 851  CYS A O   1 
ATOM   3793  C  CB  . CYS A  1  500  ? 233.847 244.253 193.335 1.00   220.08 ? 851  CYS A CB  1 
ATOM   3794  S  SG  . CYS A  1  500  ? 232.082 243.793 193.394 1.00   258.88 ? 851  CYS A SG  1 
ATOM   3795  N  N   . LEU A  1  501  ? 233.959 243.511 196.244 1.00   173.63 ? 852  LEU A N   1 
ATOM   3796  C  CA  . LEU A  1  501  ? 233.222 242.969 197.355 1.00   182.82 ? 852  LEU A CA  1 
ATOM   3797  C  C   . LEU A  1  501  ? 233.530 243.691 198.692 1.00   202.53 ? 852  LEU A C   1 
ATOM   3798  O  O   . LEU A  1  501  ? 232.634 243.814 199.525 1.00   191.10 ? 852  LEU A O   1 
ATOM   3799  C  CB  . LEU A  1  501  ? 233.323 241.447 197.391 1.00   179.09 ? 852  LEU A CB  1 
ATOM   3800  C  CG  . LEU A  1  501  ? 234.576 240.760 197.905 1.00   198.52 ? 852  LEU A CG  1 
ATOM   3801  C  CD1 . LEU A  1  501  ? 234.814 241.063 199.391 1.00   207.13 ? 852  LEU A CD1 1 
ATOM   3802  C  CD2 . LEU A  1  501  ? 234.437 239.256 197.625 1.00   171.45 ? 852  LEU A CD2 1 
ATOM   3803  N  N   . LYS A  1  502  ? 234.734 244.228 198.886 1.00   204.92 ? 853  LYS A N   1 
ATOM   3804  C  CA  . LYS A  1  502  ? 234.942 245.143 200.031 1.00   222.33 ? 853  LYS A CA  1 
ATOM   3805  C  C   . LYS A  1  502  ? 234.261 246.530 199.873 1.00   239.77 ? 853  LYS A C   1 
ATOM   3806  O  O   . LYS A  1  502  ? 233.376 246.897 200.655 1.00   246.30 ? 853  LYS A O   1 
ATOM   3807  C  CB  . LYS A  1  502  ? 236.415 245.333 200.321 1.00   210.45 ? 853  LYS A CB  1 
ATOM   3808  C  CG  . LYS A  1  502  ? 237.113 244.052 200.721 1.00   213.36 ? 853  LYS A CG  1 
ATOM   3809  C  CD  . LYS A  1  502  ? 238.558 244.342 201.098 1.00   234.20 ? 853  LYS A CD  1 
ATOM   3810  C  CE  . LYS A  1  502  ? 239.391 244.759 199.888 1.00   237.76 ? 853  LYS A CE  1 
ATOM   3811  N  NZ  . LYS A  1  502  ? 240.837 244.939 200.174 1.00   245.67 ? 853  LYS A NZ  1 
ATOM   3812  N  N   . GLY A  1  503  ? 234.684 247.295 198.868 1.00   226.92 ? 854  GLY A N   1 
ATOM   3813  C  CA  . GLY A  1  503  ? 234.164 248.648 198.606 1.00   204.94 ? 854  GLY A CA  1 
ATOM   3814  C  C   . GLY A  1  503  ? 233.673 248.761 197.176 1.00   244.46 ? 854  GLY A C   1 
ATOM   3815  O  O   . GLY A  1  503  ? 234.300 248.237 196.274 1.00   296.50 ? 854  GLY A O   1 
ATOM   3816  N  N   . GLU A  1  504  ? 232.559 249.444 196.941 1.00   273.16 ? 855  GLU A N   1 
ATOM   3817  C  CA  . GLU A  1  504  ? 231.888 249.385 195.616 1.00   300.25 ? 855  GLU A CA  1 
ATOM   3818  C  C   . GLU A  1  504  ? 232.717 249.765 194.336 1.00   316.61 ? 855  GLU A C   1 
ATOM   3819  O  O   . GLU A  1  504  ? 233.565 250.664 194.370 1.00   318.71 ? 855  GLU A O   1 
ATOM   3820  C  CB  . GLU A  1  504  ? 230.597 250.219 195.647 1.00   283.73 ? 855  GLU A CB  1 
ATOM   3821  N  N   . GLY A  1  505  ? 232.466 249.036 193.240 1.00   300.06 ? 856  GLY A N   1 
ATOM   3822  C  CA  . GLY A  1  505  ? 232.824 249.422 191.854 1.00   267.20 ? 856  GLY A CA  1 
ATOM   3823  C  C   . GLY A  1  505  ? 234.271 249.699 191.426 1.00   266.98 ? 856  GLY A C   1 
ATOM   3824  O  O   . GLY A  1  505  ? 235.086 248.791 191.292 1.00   248.32 ? 856  GLY A O   1 
ATOM   3825  N  N   . ALA A  1  506  ? 234.562 250.980 191.213 1.00   276.24 ? 857  ALA A N   1 
ATOM   3826  C  CA  . ALA A  1  506  ? 235.748 251.506 190.488 1.00   266.12 ? 857  ALA A CA  1 
ATOM   3827  C  C   . ALA A  1  506  ? 235.625 251.516 188.917 1.00   257.33 ? 857  ALA A C   1 
ATOM   3828  O  O   . ALA A  1  506  ? 235.277 252.549 188.357 1.00   277.84 ? 857  ALA A O   1 
ATOM   3829  C  CB  . ALA A  1  506  ? 237.086 250.975 191.041 1.00   247.89 ? 857  ALA A CB  1 
ATOM   3830  N  N   . PRO A  1  507  ? 235.892 250.411 188.196 1.00   254.45 ? 858  PRO A N   1 
ATOM   3831  C  CA  . PRO A  1  507  ? 235.495 250.444 186.757 1.00   226.91 ? 858  PRO A CA  1 
ATOM   3832  C  C   . PRO A  1  507  ? 234.325 249.476 186.418 1.00   249.93 ? 858  PRO A C   1 
ATOM   3833  O  O   . PRO A  1  507  ? 234.252 248.379 186.987 1.00   350.33 ? 858  PRO A O   1 
ATOM   3834  C  CB  . PRO A  1  507  ? 236.785 250.011 186.043 1.00   222.51 ? 858  PRO A CB  1 
ATOM   3835  C  CG  . PRO A  1  507  ? 237.615 249.301 187.102 1.00   264.09 ? 858  PRO A CG  1 
ATOM   3836  C  CD  . PRO A  1  507  ? 236.889 249.355 188.426 1.00   277.54 ? 858  PRO A CD  1 
ATOM   3837  N  N   . PRO A  1  508  ? 233.419 249.852 185.488 1.00   245.89 ? 859  PRO A N   1 
ATOM   3838  C  CA  . PRO A  1  508  ? 232.319 248.951 184.985 1.00   220.06 ? 859  PRO A CA  1 
ATOM   3839  C  C   . PRO A  1  508  ? 232.768 247.890 183.942 1.00   223.90 ? 859  PRO A C   1 
ATOM   3840  O  O   . PRO A  1  508  ? 231.888 247.110 183.408 1.00   114.25 ? 859  PRO A O   1 
ATOM   3841  C  CB  . PRO A  1  508  ? 231.343 249.940 184.357 1.00   219.04 ? 859  PRO A CB  1 
ATOM   3842  C  CG  . PRO A  1  508  ? 232.236 251.039 183.851 1.00   241.98 ? 859  PRO A CG  1 
ATOM   3843  C  CD  . PRO A  1  508  ? 233.425 251.142 184.774 1.00   242.61 ? 859  PRO A CD  1 
ATOM   3844  N  N   . TYR A  1  509  ? 234.058 248.080 183.551 1.00   252.17 ? 860  TYR A N   1 
ATOM   3845  C  CA  . TYR A  1  509  ? 235.174 247.108 183.246 1.00   231.61 ? 860  TYR A CA  1 
ATOM   3846  C  C   . TYR A  1  509  ? 235.455 246.992 181.751 1.00   237.35 ? 860  TYR A C   1 
ATOM   3847  O  O   . TYR A  1  509  ? 234.546 247.328 180.944 1.00   201.11 ? 860  TYR A O   1 
ATOM   3848  C  CB  . TYR A  1  509  ? 235.011 245.729 183.900 1.00   209.30 ? 860  TYR A CB  1 
ATOM   3849  C  CG  . TYR A  1  509  ? 236.293 244.891 183.960 1.00   183.15 ? 860  TYR A CG  1 
ATOM   3850  C  CD1 . TYR A  1  509  ? 237.162 244.967 185.043 1.00   198.78 ? 860  TYR A CD1 1 
ATOM   3851  C  CD2 . TYR A  1  509  ? 236.640 244.018 182.921 1.00   181.20 ? 860  TYR A CD2 1 
ATOM   3852  C  CE1 . TYR A  1  509  ? 238.330 244.196 185.098 1.00   193.67 ? 860  TYR A CE1 1 
ATOM   3853  C  CE2 . TYR A  1  509  ? 237.809 243.255 182.967 1.00   183.88 ? 860  TYR A CE2 1 
ATOM   3854  C  CZ  . TYR A  1  509  ? 238.647 243.344 184.059 1.00   181.43 ? 860  TYR A CZ  1 
ATOM   3855  O  OH  . TYR A  1  509  ? 239.782 242.575 184.107 1.00   159.09 ? 860  TYR A OH  1 
ATOM   3856  N  N   . PRO A  1  510  ? 236.716 246.561 181.376 1.00   209.19 ? 861  PRO A N   1 
ATOM   3857  C  CA  . PRO A  1  510  ? 237.003 246.299 179.948 1.00   199.63 ? 861  PRO A CA  1 
ATOM   3858  C  C   . PRO A  1  510  ? 236.944 244.830 179.461 1.00   186.71 ? 861  PRO A C   1 
ATOM   3859  O  O   . PRO A  1  510  ? 237.821 244.053 179.804 1.00   180.39 ? 861  PRO A O   1 
ATOM   3860  C  CB  . PRO A  1  510  ? 238.437 246.826 179.794 1.00   169.77 ? 861  PRO A CB  1 
ATOM   3861  C  CG  . PRO A  1  510  ? 239.072 246.568 181.115 1.00   157.62 ? 861  PRO A CG  1 
ATOM   3862  C  CD  . PRO A  1  510  ? 237.992 246.679 182.144 1.00   161.74 ? 861  PRO A CD  1 
ATOM   3863  N  N   . TYR A  1  511  ? 235.937 244.514 178.626 1.00   193.82 ? 862  TYR A N   1 
ATOM   3864  C  CA  . TYR A  1  511  ? 235.737 243.220 177.911 1.00   162.61 ? 862  TYR A CA  1 
ATOM   3865  C  C   . TYR A  1  511  ? 236.244 243.423 176.481 1.00   183.29 ? 862  TYR A C   1 
ATOM   3866  O  O   . TYR A  1  511  ? 236.070 244.496 175.871 1.00   211.71 ? 862  TYR A O   1 
ATOM   3867  C  CB  . TYR A  1  511  ? 234.233 242.773 177.822 1.00   140.77 ? 862  TYR A CB  1 
ATOM   3868  C  CG  . TYR A  1  511  ? 233.374 243.728 176.954 1.00   243.07 ? 862  TYR A CG  1 
ATOM   3869  C  CD1 . TYR A  1  511  ? 232.935 244.999 177.428 1.00   275.80 ? 862  TYR A CD1 1 
ATOM   3870  C  CD2 . TYR A  1  511  ? 233.048 243.403 175.636 1.00   301.14 ? 862  TYR A CD2 1 
ATOM   3871  C  CE1 . TYR A  1  511  ? 232.183 245.883 176.617 1.00   247.56 ? 862  TYR A CE1 1 
ATOM   3872  C  CE2 . TYR A  1  511  ? 232.289 244.275 174.826 1.00   307.38 ? 862  TYR A CE2 1 
ATOM   3873  C  CZ  . TYR A  1  511  ? 231.851 245.513 175.306 1.00   252.18 ? 862  TYR A CZ  1 
ATOM   3874  O  OH  . TYR A  1  511  ? 231.097 246.327 174.465 1.00   150.92 ? 862  TYR A OH  1 
ATOM   3875  N  N   . LEU A  1  512  ? 236.875 242.389 175.948 1.00   188.09 ? 863  LEU A N   1 
ATOM   3876  C  CA  . LEU A  1  512  ? 236.882 242.168 174.506 1.00   209.75 ? 863  LEU A CA  1 
ATOM   3877  C  C   . LEU A  1  512  ? 235.955 241.011 174.195 1.00   244.38 ? 863  LEU A C   1 
ATOM   3878  O  O   . LEU A  1  512  ? 236.127 239.944 174.772 1.00   332.96 ? 863  LEU A O   1 
ATOM   3879  C  CB  . LEU A  1  512  ? 238.283 241.873 174.021 1.00   212.17 ? 863  LEU A CB  1 
ATOM   3880  C  CG  . LEU A  1  512  ? 238.802 243.048 173.225 1.00   243.95 ? 863  LEU A CG  1 
ATOM   3881  C  CD1 . LEU A  1  512  ? 238.854 244.344 174.044 1.00   245.16 ? 863  LEU A CD1 1 
ATOM   3882  C  CD2 . LEU A  1  512  ? 240.146 242.614 172.693 1.00   251.25 ? 863  LEU A CD2 1 
ATOM   3883  N  N   . PRO A  1  513  ? 234.975 241.216 173.294 1.00   229.29 ? 864  PRO A N   1 
ATOM   3884  C  CA  . PRO A  1  513  ? 233.900 240.234 173.136 1.00   232.86 ? 864  PRO A CA  1 
ATOM   3885  C  C   . PRO A  1  513  ? 234.417 238.875 172.683 1.00   230.24 ? 864  PRO A C   1 
ATOM   3886  O  O   . PRO A  1  513  ? 233.979 237.847 173.217 1.00   251.84 ? 864  PRO A O   1 
ATOM   3887  C  CB  . PRO A  1  513  ? 232.993 240.871 172.075 1.00   239.74 ? 864  PRO A CB  1 
ATOM   3888  C  CG  . PRO A  1  513  ? 233.898 241.748 171.277 1.00   242.87 ? 864  PRO A CG  1 
ATOM   3889  C  CD  . PRO A  1  513  ? 234.977 242.222 172.213 1.00   221.59 ? 864  PRO A CD  1 
ATOM   3890  N  N   . GLY A  1  514  ? 235.381 238.895 171.755 1.00   213.88 ? 865  GLY A N   1 
ATOM   3891  C  CA  . GLY A  1  514  ? 235.903 237.701 171.118 1.00   226.39 ? 865  GLY A CA  1 
ATOM   3892  C  C   . GLY A  1  514  ? 236.541 236.716 172.071 1.00   239.18 ? 865  GLY A C   1 
ATOM   3893  O  O   . GLY A  1  514  ? 236.181 235.539 172.086 1.00   257.82 ? 865  GLY A O   1 
ATOM   3894  N  N   . ILE A  1  515  ? 237.481 237.189 172.870 1.00   216.91 ? 866  ILE A N   1 
ATOM   3895  C  CA  . ILE A  1  515  ? 238.250 236.287 173.713 1.00   217.66 ? 866  ILE A CA  1 
ATOM   3896  C  C   . ILE A  1  515  ? 237.782 236.276 175.161 1.00   210.16 ? 866  ILE A C   1 
ATOM   3897  O  O   . ILE A  1  515  ? 237.846 235.240 175.850 1.00   220.40 ? 866  ILE A O   1 
ATOM   3898  C  CB  . ILE A  1  515  ? 239.783 236.556 173.595 1.00   235.93 ? 866  ILE A CB  1 
ATOM   3899  C  CG1 . ILE A  1  515  ? 240.575 235.742 174.643 1.00   257.05 ? 866  ILE A CG1 1 
ATOM   3900  C  CG2 . ILE A  1  515  ? 240.117 238.053 173.676 1.00   214.88 ? 866  ILE A CG2 1 
ATOM   3901  C  CD1 . ILE A  1  515  ? 240.394 234.223 174.568 1.00   251.84 ? 866  ILE A CD1 1 
ATOM   3902  N  N   . CYS A  1  516  ? 237.293 237.402 175.641 1.00   220.06 ? 867  CYS A N   1 
ATOM   3903  C  CA  . CYS A  1  516  ? 237.168 237.574 177.068 1.00   230.43 ? 867  CYS A CA  1 
ATOM   3904  C  C   . CYS A  1  516  ? 235.827 237.058 177.594 1.00   206.41 ? 867  CYS A C   1 
ATOM   3905  O  O   . CYS A  1  516  ? 235.300 237.609 178.543 1.00   206.06 ? 867  CYS A O   1 
ATOM   3906  C  CB  . CYS A  1  516  ? 237.475 239.044 177.469 1.00   265.35 ? 867  CYS A CB  1 
ATOM   3907  S  SG  . CYS A  1  516  ? 239.010 239.780 176.785 1.00   260.06 ? 867  CYS A SG  1 
ATOM   3908  N  N   . GLU A  1  517  ? 235.332 235.943 177.051 1.00   208.44 ? 868  GLU A N   1 
ATOM   3909  C  CA  . GLU A  1  517  ? 233.989 235.430 177.379 1.00   217.23 ? 868  GLU A CA  1 
ATOM   3910  C  C   . GLU A  1  517  ? 233.891 234.996 178.817 1.00   193.17 ? 868  GLU A C   1 
ATOM   3911  O  O   . GLU A  1  517  ? 232.941 235.328 179.531 1.00   251.20 ? 868  GLU A O   1 
ATOM   3912  C  CB  . GLU A  1  517  ? 233.643 234.252 176.474 1.00   234.34 ? 868  GLU A CB  1 
ATOM   3913  C  CG  . GLU A  1  517  ? 233.418 234.696 175.032 1.00   275.74 ? 868  GLU A CG  1 
ATOM   3914  C  CD  . GLU A  1  517  ? 233.965 233.743 173.986 1.00   306.72 ? 868  GLU A CD  1 
ATOM   3915  O  OE1 . GLU A  1  517  ? 234.956 233.026 174.250 1.00   321.56 ? 868  GLU A OE1 1 
ATOM   3916  O  OE2 . GLU A  1  517  ? 233.402 233.728 172.872 1.00   356.97 ? 868  GLU A OE2 1 
ATOM   3917  N  N   . ARG A  1  518  ? 234.905 234.272 179.232 1.00   171.88 ? 869  ARG A N   1 
ATOM   3918  C  CA  . ARG A  1  518  ? 235.019 233.849 180.613 1.00   171.97 ? 869  ARG A CA  1 
ATOM   3919  C  C   . ARG A  1  518  ? 235.152 235.042 181.589 1.00   168.73 ? 869  ARG A C   1 
ATOM   3920  O  O   . ARG A  1  518  ? 234.589 234.999 182.684 1.00   177.65 ? 869  ARG A O   1 
ATOM   3921  C  CB  . ARG A  1  518  ? 236.213 232.912 180.716 1.00   183.01 ? 869  ARG A CB  1 
ATOM   3922  C  CG  . ARG A  1  518  ? 236.280 232.048 181.941 1.00   169.22 ? 869  ARG A CG  1 
ATOM   3923  C  CD  . ARG A  1  518  ? 237.574 231.248 181.875 1.00   168.73 ? 869  ARG A CD  1 
ATOM   3924  N  NE  . ARG A  1  518  ? 237.421 229.998 182.582 1.00   170.54 ? 869  ARG A NE  1 
ATOM   3925  C  CZ  . ARG A  1  518  ? 236.718 228.963 182.139 1.00   193.57 ? 869  ARG A CZ  1 
ATOM   3926  N  NH1 . ARG A  1  518  ? 236.092 228.995 180.955 1.00   203.95 ? 869  ARG A NH1 1 
ATOM   3927  N  NH2 . ARG A  1  518  ? 236.638 227.878 182.894 1.00   212.13 ? 869  ARG A NH2 1 
ATOM   3928  N  N   . SER A  1  519  ? 235.871 236.097 181.194 1.00   155.51 ? 870  SER A N   1 
ATOM   3929  C  CA  . SER A  1  519  ? 236.020 237.311 182.022 1.00   156.18 ? 870  SER A CA  1 
ATOM   3930  C  C   . SER A  1  519  ? 234.688 238.052 182.173 1.00   147.16 ? 870  SER A C   1 
ATOM   3931  O  O   . SER A  1  519  ? 234.270 238.411 183.275 1.00   129.22 ? 870  SER A O   1 
ATOM   3932  C  CB  . SER A  1  519  ? 237.081 238.252 181.413 1.00   179.02 ? 870  SER A CB  1 
ATOM   3933  O  OG  . SER A  1  519  ? 237.100 239.550 182.003 1.00   165.49 ? 870  SER A OG  1 
ATOM   3934  N  N   . ARG A  1  520  ? 234.009 238.269 181.052 1.00   156.11 ? 871  ARG A N   1 
ATOM   3935  C  CA  . ARG A  1  520  ? 232.668 238.860 181.087 1.00   175.13 ? 871  ARG A CA  1 
ATOM   3936  C  C   . ARG A  1  520  ? 231.786 238.076 182.042 1.00   165.59 ? 871  ARG A C   1 
ATOM   3937  O  O   . ARG A  1  520  ? 231.124 238.685 182.871 1.00   190.11 ? 871  ARG A O   1 
ATOM   3938  C  CB  . ARG A  1  520  ? 231.985 238.982 179.695 1.00   203.73 ? 871  ARG A CB  1 
ATOM   3939  C  CG  . ARG A  1  520  ? 230.792 238.034 179.386 1.00   204.87 ? 871  ARG A CG  1 
ATOM   3940  C  CD  . ARG A  1  520  ? 229.711 238.714 178.579 1.00   213.71 ? 871  ARG A CD  1 
ATOM   3941  N  NE  . ARG A  1  520  ? 230.279 239.389 177.415 1.00   247.72 ? 871  ARG A NE  1 
ATOM   3942  C  CZ  . ARG A  1  520  ? 229.643 240.291 176.669 1.00   282.87 ? 871  ARG A CZ  1 
ATOM   3943  N  NH1 . ARG A  1  520  ? 228.379 240.657 176.938 1.00   276.47 ? 871  ARG A NH1 1 
ATOM   3944  N  NH2 . ARG A  1  520  ? 230.284 240.828 175.634 1.00   292.78 ? 871  ARG A NH2 1 
ATOM   3945  N  N   . LEU A  1  521  ? 231.787 236.743 181.930 1.00   159.32 ? 872  LEU A N   1 
ATOM   3946  C  CA  . LEU A  1  521  ? 230.935 235.894 182.758 1.00   167.69 ? 872  LEU A CA  1 
ATOM   3947  C  C   . LEU A  1  521  ? 231.165 236.242 184.201 1.00   158.18 ? 872  LEU A C   1 
ATOM   3948  O  O   . LEU A  1  521  ? 230.215 236.487 184.938 1.00   205.34 ? 872  LEU A O   1 
ATOM   3949  C  CB  . LEU A  1  521  ? 231.202 234.391 182.569 1.00   186.88 ? 872  LEU A CB  1 
ATOM   3950  C  CG  . LEU A  1  521  ? 230.652 233.434 183.673 1.00   202.76 ? 872  LEU A CG  1 
ATOM   3951  C  CD1 . LEU A  1  521  ? 230.165 232.146 183.033 1.00   232.03 ? 872  LEU A CD1 1 
ATOM   3952  C  CD2 . LEU A  1  521  ? 231.613 233.119 184.837 1.00   179.97 ? 872  LEU A CD2 1 
ATOM   3953  N  N   . VAL A  1  522  ? 232.416 236.237 184.624 1.00   136.59 ? 873  VAL A N   1 
ATOM   3954  C  CA  . VAL A  1  522  ? 232.656 236.364 186.047 1.00   142.06 ? 873  VAL A CA  1 
ATOM   3955  C  C   . VAL A  1  522  ? 232.311 237.756 186.569 1.00   146.44 ? 873  VAL A C   1 
ATOM   3956  O  O   . VAL A  1  522  ? 231.706 237.896 187.634 1.00   183.91 ? 873  VAL A O   1 
ATOM   3957  C  CB  . VAL A  1  522  ? 234.058 235.914 186.453 1.00   142.18 ? 873  VAL A CB  1 
ATOM   3958  C  CG1 . VAL A  1  522  ? 235.119 236.782 185.820 1.00   177.74 ? 873  VAL A CG1 1 
ATOM   3959  C  CG2 . VAL A  1  522  ? 234.196 235.898 187.964 1.00   124.23 ? 873  VAL A CG2 1 
ATOM   3960  N  N   . VAL A  1  523  ? 232.664 238.783 185.823 1.00   149.31 ? 874  VAL A N   1 
ATOM   3961  C  CA  . VAL A  1  523  ? 232.351 240.133 186.253 1.00   155.56 ? 874  VAL A CA  1 
ATOM   3962  C  C   . VAL A  1  523  ? 230.842 240.269 186.457 1.00   161.45 ? 874  VAL A C   1 
ATOM   3963  O  O   . VAL A  1  523  ? 230.415 240.763 187.510 1.00   160.85 ? 874  VAL A O   1 
ATOM   3964  C  CB  . VAL A  1  523  ? 232.941 241.167 185.267 1.00   167.77 ? 874  VAL A CB  1 
ATOM   3965  C  CG1 . VAL A  1  523  ? 231.953 242.278 184.865 1.00   160.87 ? 874  VAL A CG1 1 
ATOM   3966  C  CG2 . VAL A  1  523  ? 234.249 241.698 185.845 1.00   164.06 ? 874  VAL A CG2 1 
ATOM   3967  N  N   . LEU A  1  524  ? 230.058 239.833 185.459 1.00   144.17 ? 875  LEU A N   1 
ATOM   3968  C  CA  . LEU A  1  524  ? 228.588 239.852 185.544 1.00   137.03 ? 875  LEU A CA  1 
ATOM   3969  C  C   . LEU A  1  524  ? 228.048 238.932 186.644 1.00   159.51 ? 875  LEU A C   1 
ATOM   3970  O  O   . LEU A  1  524  ? 227.092 239.284 187.316 1.00   193.64 ? 875  LEU A O   1 
ATOM   3971  C  CB  . LEU A  1  524  ? 227.934 239.490 184.214 1.00   150.60 ? 875  LEU A CB  1 
ATOM   3972  C  CG  . LEU A  1  524  ? 227.862 240.614 183.171 1.00   187.31 ? 875  LEU A CG  1 
ATOM   3973  C  CD1 . LEU A  1  524  ? 227.987 240.065 181.741 1.00   197.95 ? 875  LEU A CD1 1 
ATOM   3974  C  CD2 . LEU A  1  524  ? 226.585 241.451 183.346 1.00   198.81 ? 875  LEU A CD2 1 
ATOM   3975  N  N   . SER A  1  525  ? 228.661 237.767 186.836 1.00   151.12 ? 876  SER A N   1 
ATOM   3976  C  CA  . SER A  1  525  ? 228.268 236.864 187.915 1.00   143.62 ? 876  SER A CA  1 
ATOM   3977  C  C   . SER A  1  525  ? 228.482 237.463 189.284 1.00   141.55 ? 876  SER A C   1 
ATOM   3978  O  O   . SER A  1  525  ? 227.668 237.294 190.156 1.00   154.50 ? 876  SER A O   1 
ATOM   3979  C  CB  . SER A  1  525  ? 229.087 235.596 187.858 1.00   171.30 ? 876  SER A CB  1 
ATOM   3980  O  OG  . SER A  1  525  ? 230.414 235.864 188.271 1.00   186.46 ? 876  SER A OG  1 
ATOM   3981  N  N   . ILE A  1  526  ? 229.601 238.137 189.486 1.00   170.91 ? 877  ILE A N   1 
ATOM   3982  C  CA  . ILE A  1  526  ? 229.813 238.850 190.743 1.00   176.25 ? 877  ILE A CA  1 
ATOM   3983  C  C   . ILE A  1  526  ? 228.828 239.983 190.869 1.00   164.33 ? 877  ILE A C   1 
ATOM   3984  O  O   . ILE A  1  526  ? 228.276 240.179 191.929 1.00   192.06 ? 877  ILE A O   1 
ATOM   3985  C  CB  . ILE A  1  526  ? 231.227 239.429 190.903 1.00   183.05 ? 877  ILE A CB  1 
ATOM   3986  C  CG1 . ILE A  1  526  ? 232.188 238.320 191.282 1.00   200.97 ? 877  ILE A CG1 1 
ATOM   3987  C  CG2 . ILE A  1  526  ? 231.276 240.470 192.019 1.00   203.62 ? 877  ILE A CG2 1 
ATOM   3988  C  CD1 . ILE A  1  526  ? 233.626 238.707 191.049 1.00   206.81 ? 877  ILE A CD1 1 
ATOM   3989  N  N   . ALA A  1  527  ? 228.620 240.740 189.809 1.00   141.28 ? 878  ALA A N   1 
ATOM   3990  C  CA  . ALA A  1  527  ? 227.642 241.813 189.860 1.00   166.83 ? 878  ALA A CA  1 
ATOM   3991  C  C   . ALA A  1  527  ? 226.216 241.325 190.186 1.00   167.08 ? 878  ALA A C   1 
ATOM   3992  O  O   . ALA A  1  527  ? 225.501 241.991 190.922 1.00   211.88 ? 878  ALA A O   1 
ATOM   3993  C  CB  . ALA A  1  527  ? 227.655 242.614 188.564 1.00   183.77 ? 878  ALA A CB  1 
ATOM   3994  N  N   . LEU A  1  528  ? 225.797 240.193 189.626 1.00   163.44 ? 879  LEU A N   1 
ATOM   3995  C  CA  . LEU A  1  528  ? 224.479 239.640 189.977 1.00   171.52 ? 879  LEU A CA  1 
ATOM   3996  C  C   . LEU A  1  528  ? 224.399 239.282 191.429 1.00   165.81 ? 879  LEU A C   1 
ATOM   3997  O  O   . LEU A  1  528  ? 223.460 239.660 192.120 1.00   213.18 ? 879  LEU A O   1 
ATOM   3998  C  CB  . LEU A  1  528  ? 224.134 238.392 189.159 1.00   168.33 ? 879  LEU A CB  1 
ATOM   3999  C  CG  . LEU A  1  528  ? 223.240 238.718 187.965 1.00   200.42 ? 879  LEU A CG  1 
ATOM   4000  C  CD1 . LEU A  1  528  ? 223.419 237.704 186.844 1.00   227.06 ? 879  LEU A CD1 1 
ATOM   4001  C  CD2 . LEU A  1  528  ? 221.784 238.828 188.412 1.00   205.16 ? 879  LEU A CD2 1 
ATOM   4002  N  N   . TYR A  1  529  ? 225.388 238.531 191.873 1.00   167.07 ? 880  TYR A N   1 
ATOM   4003  C  CA  . TYR A  1  529  ? 225.343 237.932 193.186 1.00   163.55 ? 880  TYR A CA  1 
ATOM   4004  C  C   . TYR A  1  529  ? 225.596 238.927 194.291 1.00   184.02 ? 880  TYR A C   1 
ATOM   4005  O  O   . TYR A  1  529  ? 225.091 238.777 195.392 1.00   225.36 ? 880  TYR A O   1 
ATOM   4006  C  CB  . TYR A  1  529  ? 226.366 236.815 193.293 1.00   162.83 ? 880  TYR A CB  1 
ATOM   4007  C  CG  . TYR A  1  529  ? 226.073 235.885 194.415 1.00   160.01 ? 880  TYR A CG  1 
ATOM   4008  C  CD1 . TYR A  1  529  ? 224.897 235.130 194.416 1.00   153.35 ? 880  TYR A CD1 1 
ATOM   4009  C  CD2 . TYR A  1  529  ? 226.947 235.766 195.491 1.00   179.03 ? 880  TYR A CD2 1 
ATOM   4010  C  CE1 . TYR A  1  529  ? 224.605 234.272 195.462 1.00   161.85 ? 880  TYR A CE1 1 
ATOM   4011  C  CE2 . TYR A  1  529  ? 226.661 234.908 196.540 1.00   190.27 ? 880  TYR A CE2 1 
ATOM   4012  C  CZ  . TYR A  1  529  ? 225.494 234.166 196.517 1.00   165.65 ? 880  TYR A CZ  1 
ATOM   4013  O  OH  . TYR A  1  529  ? 225.217 233.334 197.563 1.00   167.62 ? 880  TYR A OH  1 
ATOM   4014  N  N   . ILE A  1  530  ? 226.387 239.939 194.012 1.00   186.98 ? 881  ILE A N   1 
ATOM   4015  C  CA  . ILE A  1  530  ? 226.764 240.888 195.025 1.00   197.00 ? 881  ILE A CA  1 
ATOM   4016  C  C   . ILE A  1  530  ? 226.117 242.278 194.763 1.00   204.01 ? 881  ILE A C   1 
ATOM   4017  O  O   . ILE A  1  530  ? 226.300 243.196 195.568 1.00   187.87 ? 881  ILE A O   1 
ATOM   4018  C  CB  . ILE A  1  530  ? 228.305 240.802 195.153 1.00   175.37 ? 881  ILE A CB  1 
ATOM   4019  C  CG1 . ILE A  1  530  ? 228.636 239.381 195.670 1.00   147.20 ? 881  ILE A CG1 1 
ATOM   4020  C  CG2 . ILE A  1  530  ? 228.893 241.904 196.028 1.00   180.10 ? 881  ILE A CG2 1 
ATOM   4021  C  CD1 . ILE A  1  530  ? 230.112 239.064 195.692 1.00   172.27 ? 881  ILE A CD1 1 
ATOM   4022  N  N   . LEU A  1  531  ? 225.313 242.429 193.701 1.00   204.74 ? 882  LEU A N   1 
ATOM   4023  C  CA  . LEU A  1  531  ? 224.716 243.743 193.363 1.00   198.64 ? 882  LEU A CA  1 
ATOM   4024  C  C   . LEU A  1  531  ? 223.614 243.718 192.245 1.00   193.21 ? 882  LEU A C   1 
ATOM   4025  O  O   . LEU A  1  531  ? 222.486 243.205 192.387 1.00   167.30 ? 882  LEU A O   1 
ATOM   4026  C  CB  . LEU A  1  531  ? 225.823 244.758 192.930 1.00   203.38 ? 882  LEU A CB  1 
ATOM   4027  C  CG  . LEU A  1  531  ? 227.225 245.023 193.578 1.00   188.04 ? 882  LEU A CG  1 
ATOM   4028  C  CD1 . LEU A  1  531  ? 228.354 244.066 193.158 1.00   155.79 ? 882  LEU A CD1 1 
ATOM   4029  C  CD2 . LEU A  1  531  ? 227.668 246.442 193.260 1.00   200.27 ? 882  LEU A CD2 1 
ATOM   4030  N  N   . SER A  1  532  ? 217.374 234.734 198.019 1.00   275.27 ? 924  SER A N   1 
ATOM   4031  C  CA  . SER A  1  532  ? 216.670 233.615 197.398 1.00   276.32 ? 924  SER A CA  1 
ATOM   4032  C  C   . SER A  1  532  ? 216.578 233.785 195.877 1.00   263.67 ? 924  SER A C   1 
ATOM   4033  O  O   . SER A  1  532  ? 217.297 233.108 195.134 1.00   228.37 ? 924  SER A O   1 
ATOM   4034  C  CB  . SER A  1  532  ? 215.280 233.457 198.029 1.00   279.59 ? 924  SER A CB  1 
ATOM   4035  O  OG  . SER A  1  532  ? 214.590 234.699 198.076 1.00   270.67 ? 924  SER A OG  1 
ATOM   4036  N  N   . SER A  1  533  ? 215.709 234.695 195.424 1.00   282.88 ? 925  SER A N   1 
ATOM   4037  C  CA  . SER A  1  533  ? 215.521 234.959 193.980 1.00   279.54 ? 925  SER A CA  1 
ATOM   4038  C  C   . SER A  1  533  ? 216.857 235.455 193.375 1.00   279.07 ? 925  SER A C   1 
ATOM   4039  O  O   . SER A  1  533  ? 217.208 235.081 192.260 1.00   328.64 ? 925  SER A O   1 
ATOM   4040  C  CB  . SER A  1  533  ? 214.346 235.950 193.708 1.00   255.29 ? 925  SER A CB  1 
ATOM   4041  O  OG  . SER A  1  533  ? 213.606 235.653 192.517 1.00   195.46 ? 925  SER A OG  1 
ATOM   4042  N  N   . LEU A  1  534  ? 217.608 236.256 194.139 1.00   227.37 ? 926  LEU A N   1 
ATOM   4043  C  CA  . LEU A  1  534  ? 218.956 236.710 193.761 1.00   215.89 ? 926  LEU A CA  1 
ATOM   4044  C  C   . LEU A  1  534  ? 219.920 235.561 193.421 1.00   218.41 ? 926  LEU A C   1 
ATOM   4045  O  O   . LEU A  1  534  ? 220.601 235.577 192.384 1.00   233.95 ? 926  LEU A O   1 
ATOM   4046  C  CB  . LEU A  1  534  ? 219.534 237.545 194.908 1.00   213.60 ? 926  LEU A CB  1 
ATOM   4047  C  CG  . LEU A  1  534  ? 220.994 238.022 194.821 1.00   224.79 ? 926  LEU A CG  1 
ATOM   4048  C  CD1 . LEU A  1  534  ? 221.171 239.350 195.558 1.00   222.70 ? 926  LEU A CD1 1 
ATOM   4049  C  CD2 . LEU A  1  534  ? 221.999 236.969 195.315 1.00   221.86 ? 926  LEU A CD2 1 
ATOM   4050  N  N   . ALA A  1  535  ? 219.982 234.573 194.314 1.00   205.38 ? 927  ALA A N   1 
ATOM   4051  C  CA  . ALA A  1  535  ? 220.849 233.405 194.130 1.00   186.24 ? 927  ALA A CA  1 
ATOM   4052  C  C   . ALA A  1  535  ? 220.417 232.577 192.938 1.00   178.57 ? 927  ALA A C   1 
ATOM   4053  O  O   . ALA A  1  535  ? 221.250 232.252 192.108 1.00   182.61 ? 927  ALA A O   1 
ATOM   4054  C  CB  . ALA A  1  535  ? 220.879 232.536 195.386 1.00   190.30 ? 927  ALA A CB  1 
ATOM   4055  N  N   . GLU A  1  536  ? 219.125 232.240 192.868 1.00   187.13 ? 928  GLU A N   1 
ATOM   4056  C  CA  . GLU A  1  536  ? 218.536 231.499 191.727 1.00   179.15 ? 928  GLU A CA  1 
ATOM   4057  C  C   . GLU A  1  536  ? 218.716 232.231 190.392 1.00   163.09 ? 928  GLU A C   1 
ATOM   4058  O  O   . GLU A  1  536  ? 218.840 231.586 189.355 1.00   133.50 ? 928  GLU A O   1 
ATOM   4059  C  CB  . GLU A  1  536  ? 217.044 231.266 191.979 1.00   207.36 ? 928  GLU A CB  1 
ATOM   4060  C  CG  . GLU A  1  536  ? 216.328 230.404 190.943 1.00   248.21 ? 928  GLU A CG  1 
ATOM   4061  C  CD  . GLU A  1  536  ? 214.810 230.531 191.002 1.00   302.88 ? 928  GLU A CD  1 
ATOM   4062  O  OE1 . GLU A  1  536  ? 214.165 230.272 189.959 1.00   339.85 ? 928  GLU A OE1 1 
ATOM   4063  O  OE2 . GLU A  1  536  ? 214.261 230.880 192.072 1.00   334.63 ? 928  GLU A OE2 1 
ATOM   4064  N  N   . ARG A  1  537  ? 218.730 233.570 190.430 1.00   167.14 ? 929  ARG A N   1 
ATOM   4065  C  CA  . ARG A  1  537  ? 219.020 234.405 189.251 1.00   187.78 ? 929  ARG A CA  1 
ATOM   4066  C  C   . ARG A  1  537  ? 220.387 234.057 188.701 1.00   174.13 ? 929  ARG A C   1 
ATOM   4067  O  O   . ARG A  1  537  ? 220.533 233.813 187.500 1.00   169.24 ? 929  ARG A O   1 
ATOM   4068  C  CB  . ARG A  1  537  ? 218.983 235.940 189.556 1.00   209.49 ? 929  ARG A CB  1 
ATOM   4069  C  CG  . ARG A  1  537  ? 217.633 236.674 189.485 1.00   218.20 ? 929  ARG A CG  1 
ATOM   4070  C  CD  . ARG A  1  537  ? 217.251 237.160 188.081 1.00   246.92 ? 929  ARG A CD  1 
ATOM   4071  N  NE  . ARG A  1  537  ? 218.115 238.221 187.524 1.00   276.42 ? 929  ARG A NE  1 
ATOM   4072  C  CZ  . ARG A  1  537  ? 217.986 238.770 186.300 1.00   275.93 ? 929  ARG A CZ  1 
ATOM   4073  N  NH1 . ARG A  1  537  ? 217.017 238.375 185.470 1.00   272.39 ? 929  ARG A NH1 1 
ATOM   4074  N  NH2 . ARG A  1  537  ? 218.832 239.727 185.894 1.00   236.68 ? 929  ARG A NH2 1 
ATOM   4075  N  N   . LEU A  1  538  ? 221.386 234.049 189.580 1.00   166.82 ? 930  LEU A N   1 
ATOM   4076  C  CA  . LEU A  1  538  ? 222.747 233.786 189.133 1.00   169.20 ? 930  LEU A CA  1 
ATOM   4077  C  C   . LEU A  1  538  ? 222.870 232.403 188.521 1.00   158.15 ? 930  LEU A C   1 
ATOM   4078  O  O   . LEU A  1  538  ? 223.460 232.250 187.464 1.00   183.90 ? 930  LEU A O   1 
ATOM   4079  C  CB  . LEU A  1  538  ? 223.788 233.966 190.245 1.00   160.07 ? 930  LEU A CB  1 
ATOM   4080  C  CG  . LEU A  1  538  ? 225.223 233.581 189.791 1.00   159.70 ? 930  LEU A CG  1 
ATOM   4081  C  CD1 . LEU A  1  538  ? 225.713 234.306 188.530 1.00   150.39 ? 930  LEU A CD1 1 
ATOM   4082  C  CD2 . LEU A  1  538  ? 226.228 233.786 190.906 1.00   175.39 ? 930  LEU A CD2 1 
ATOM   4083  N  N   . VAL A  1  539  ? 222.317 231.405 189.186 1.00   158.08 ? 931  VAL A N   1 
ATOM   4084  C  CA  . VAL A  1  539  ? 222.329 230.045 188.655 1.00   165.43 ? 931  VAL A CA  1 
ATOM   4085  C  C   . VAL A  1  539  ? 221.683 229.959 187.274 1.00   166.39 ? 931  VAL A C   1 
ATOM   4086  O  O   . VAL A  1  539  ? 222.334 229.531 186.308 1.00   152.89 ? 931  VAL A O   1 
ATOM   4087  C  CB  . VAL A  1  539  ? 221.646 229.066 189.637 1.00   168.06 ? 931  VAL A CB  1 
ATOM   4088  C  CG1 . VAL A  1  539  ? 221.166 227.779 188.958 1.00   140.18 ? 931  VAL A CG1 1 
ATOM   4089  C  CG2 . VAL A  1  539  ? 222.606 228.778 190.791 1.00   180.93 ? 931  VAL A CG2 1 
ATOM   4090  N  N   . VAL A  1  540  ? 220.424 230.374 187.183 1.00   161.31 ? 932  VAL A N   1 
ATOM   4091  C  CA  . VAL A  1  540  ? 219.684 230.222 185.939 1.00   172.75 ? 932  VAL A CA  1 
ATOM   4092  C  C   . VAL A  1  540  ? 220.323 231.002 184.783 1.00   174.76 ? 932  VAL A C   1 
ATOM   4093  O  O   . VAL A  1  540  ? 220.347 230.528 183.648 1.00   171.48 ? 932  VAL A O   1 
ATOM   4094  C  CB  . VAL A  1  540  ? 218.193 230.569 186.113 1.00   192.90 ? 932  VAL A CB  1 
ATOM   4095  C  CG1 . VAL A  1  540  ? 217.965 232.083 186.184 1.00   185.92 ? 932  VAL A CG1 1 
ATOM   4096  C  CG2 . VAL A  1  540  ? 217.374 229.927 184.999 1.00   208.24 ? 932  VAL A CG2 1 
ATOM   4097  N  N   . TRP A  1  541  ? 220.857 232.184 185.090 1.00   185.56 ? 933  TRP A N   1 
ATOM   4098  C  CA  . TRP A  1  541  ? 221.581 233.015 184.119 1.00   191.32 ? 933  TRP A CA  1 
ATOM   4099  C  C   . TRP A  1  541  ? 222.752 232.259 183.542 1.00   172.55 ? 933  TRP A C   1 
ATOM   4100  O  O   . TRP A  1  541  ? 222.965 232.263 182.327 1.00   200.32 ? 933  TRP A O   1 
ATOM   4101  C  CB  . TRP A  1  541  ? 222.090 234.291 184.806 1.00   189.09 ? 933  TRP A CB  1 
ATOM   4102  C  CG  . TRP A  1  541  ? 222.927 235.179 183.937 1.00   202.21 ? 933  TRP A CG  1 
ATOM   4103  C  CD1 . TRP A  1  541  ? 222.492 236.014 182.950 1.00   215.58 ? 933  TRP A CD1 1 
ATOM   4104  C  CD2 . TRP A  1  541  ? 224.342 235.338 183.999 1.00   203.58 ? 933  TRP A CD2 1 
ATOM   4105  N  NE1 . TRP A  1  541  ? 223.551 236.678 182.388 1.00   212.10 ? 933  TRP A NE1 1 
ATOM   4106  C  CE2 . TRP A  1  541  ? 224.701 236.277 183.011 1.00   210.70 ? 933  TRP A CE2 1 
ATOM   4107  C  CE3 . TRP A  1  541  ? 225.345 234.776 184.793 1.00   200.18 ? 933  TRP A CE3 1 
ATOM   4108  C  CZ2 . TRP A  1  541  ? 226.017 236.660 182.796 1.00   209.90 ? 933  TRP A CZ2 1 
ATOM   4109  C  CZ3 . TRP A  1  541  ? 226.650 235.159 184.583 1.00   205.55 ? 933  TRP A CZ3 1 
ATOM   4110  C  CH2 . TRP A  1  541  ? 226.976 236.090 183.586 1.00   208.60 ? 933  TRP A CH2 1 
ATOM   4111  N  N   . MET A  1  542  ? 223.490 231.607 184.438 1.00   162.15 ? 934  MET A N   1 
ATOM   4112  C  CA  . MET A  1  542  ? 224.715 230.903 184.083 1.00   177.04 ? 934  MET A CA  1 
ATOM   4113  C  C   . MET A  1  542  ? 224.421 229.687 183.233 1.00   181.45 ? 934  MET A C   1 
ATOM   4114  O  O   . MET A  1  542  ? 225.185 229.367 182.323 1.00   202.08 ? 934  MET A O   1 
ATOM   4115  C  CB  . MET A  1  542  ? 225.464 230.453 185.322 1.00   186.56 ? 934  MET A CB  1 
ATOM   4116  C  CG  . MET A  1  542  ? 226.935 230.821 185.292 1.00   211.37 ? 934  MET A CG  1 
ATOM   4117  S  SD  . MET A  1  542  ? 227.850 230.296 186.748 1.00   247.33 ? 934  MET A SD  1 
ATOM   4118  C  CE  . MET A  1  542  ? 226.583 229.674 187.874 1.00   238.66 ? 934  MET A CE  1 
ATOM   4119  N  N   . THR A  1  543  ? 223.333 228.992 183.533 1.00   163.35 ? 935  THR A N   1 
ATOM   4120  C  CA  . THR A  1  543  ? 222.911 227.899 182.654 1.00   178.15 ? 935  THR A CA  1 
ATOM   4121  C  C   . THR A  1  543  ? 222.719 228.391 181.228 1.00   193.37 ? 935  THR A C   1 
ATOM   4122  O  O   . THR A  1  543  ? 223.184 227.751 180.283 1.00   202.78 ? 935  THR A O   1 
ATOM   4123  C  CB  . THR A  1  543  ? 221.626 227.217 183.153 1.00   188.73 ? 935  THR A CB  1 
ATOM   4124  O  OG1 . THR A  1  543  ? 221.978 226.292 184.193 1.00   179.11 ? 935  THR A OG1 1 
ATOM   4125  C  CG2 . THR A  1  543  ? 220.868 226.459 182.010 1.00   188.58 ? 935  THR A CG2 1 
ATOM   4126  N  N   . ASN A  1  544  ? 222.053 229.532 181.088 1.00   209.86 ? 936  ASN A N   1 
ATOM   4127  C  CA  . ASN A  1  544  ? 221.794 230.116 179.768 1.00   214.50 ? 936  ASN A CA  1 
ATOM   4128  C  C   . ASN A  1  544  ? 223.084 230.578 179.078 1.00   196.85 ? 936  ASN A C   1 
ATOM   4129  O  O   . ASN A  1  544  ? 223.225 230.446 177.868 1.00   161.29 ? 936  ASN A O   1 
ATOM   4130  C  CB  . ASN A  1  544  ? 220.797 231.274 179.877 1.00   232.45 ? 936  ASN A CB  1 
ATOM   4131  C  CG  . ASN A  1  544  ? 219.588 230.924 180.740 1.00   254.19 ? 936  ASN A CG  1 
ATOM   4132  O  OD1 . ASN A  1  544  ? 219.059 229.801 180.684 1.00   216.87 ? 936  ASN A OD1 1 
ATOM   4133  N  ND2 . ASN A  1  544  ? 219.175 231.872 181.577 1.00   270.58 ? 936  ASN A ND2 1 
ATOM   4134  N  N   . VAL A  1  545  ? 224.037 231.100 179.843 1.00   216.68 ? 937  VAL A N   1 
ATOM   4135  C  CA  . VAL A  1  545  ? 225.348 231.448 179.276 1.00   197.54 ? 937  VAL A CA  1 
ATOM   4136  C  C   . VAL A  1  545  ? 226.051 230.100 179.007 1.00   178.73 ? 937  VAL A C   1 
ATOM   4137  O  O   . VAL A  1  545  ? 225.711 229.108 179.649 1.00   158.46 ? 937  VAL A O   1 
ATOM   4138  C  CB  . VAL A  1  545  ? 226.150 232.430 180.205 1.00   216.12 ? 937  VAL A CB  1 
ATOM   4139  C  CG1 . VAL A  1  545  ? 227.522 232.762 179.631 1.00   229.69 ? 937  VAL A CG1 1 
ATOM   4140  C  CG2 . VAL A  1  545  ? 225.388 233.741 180.454 1.00   197.44 ? 937  VAL A CG2 1 
ATOM   4141  N  N   . GLY A  1  546  ? 226.998 230.040 178.070 1.00   210.40 ? 938  GLY A N   1 
ATOM   4142  C  CA  . GLY A  1  546  ? 227.674 228.770 177.692 1.00   245.24 ? 938  GLY A CA  1 
ATOM   4143  C  C   . GLY A  1  546  ? 228.246 227.883 178.806 1.00   245.00 ? 938  GLY A C   1 
ATOM   4144  O  O   . GLY A  1  546  ? 228.331 226.670 178.672 1.00   261.72 ? 938  GLY A O   1 
ATOM   4145  N  N   . PHE A  1  547  ? 228.629 228.519 179.899 1.00   227.37 ? 939  PHE A N   1 
ATOM   4146  C  CA  . PHE A  1  547  ? 229.164 227.884 181.104 1.00   209.67 ? 939  PHE A CA  1 
ATOM   4147  C  C   . PHE A  1  547  ? 228.276 226.802 181.757 1.00   201.59 ? 939  PHE A C   1 
ATOM   4148  O  O   . PHE A  1  547  ? 227.057 226.969 181.896 1.00   174.32 ? 939  PHE A O   1 
ATOM   4149  C  CB  . PHE A  1  547  ? 229.392 229.032 182.067 1.00   208.96 ? 939  PHE A CB  1 
ATOM   4150  C  CG  . PHE A  1  547  ? 229.930 228.655 183.395 1.00   209.62 ? 939  PHE A CG  1 
ATOM   4151  C  CD1 . PHE A  1  547  ? 229.081 228.186 184.402 1.00   196.03 ? 939  PHE A CD1 1 
ATOM   4152  C  CD2 . PHE A  1  547  ? 231.273 228.874 183.677 1.00   211.99 ? 939  PHE A CD2 1 
ATOM   4153  C  CE1 . PHE A  1  547  ? 229.587 227.886 185.646 1.00   199.18 ? 939  PHE A CE1 1 
ATOM   4154  C  CE2 . PHE A  1  547  ? 231.781 228.587 184.928 1.00   212.19 ? 939  PHE A CE2 1 
ATOM   4155  C  CZ  . PHE A  1  547  ? 230.930 228.104 185.907 1.00   208.01 ? 939  PHE A CZ  1 
ATOM   4156  N  N   . ILE A  1  548  ? 228.940 225.735 182.219 1.00   186.17 ? 940  ILE A N   1 
ATOM   4157  C  CA  . ILE A  1  548  ? 228.315 224.508 182.755 1.00   194.77 ? 940  ILE A CA  1 
ATOM   4158  C  C   . ILE A  1  548  ? 229.128 223.989 183.914 1.00   178.89 ? 940  ILE A C   1 
ATOM   4159  O  O   . ILE A  1  548  ? 230.243 224.441 184.084 1.00   178.44 ? 940  ILE A O   1 
ATOM   4160  C  CB  . ILE A  1  548  ? 228.280 223.383 181.706 1.00   241.78 ? 940  ILE A CB  1 
ATOM   4161  C  CG1 . ILE A  1  548  ? 229.687 223.093 181.141 1.00   234.74 ? 940  ILE A CG1 1 
ATOM   4162  C  CG2 . ILE A  1  548  ? 227.325 223.759 180.584 1.00   297.42 ? 940  ILE A CG2 1 
ATOM   4163  C  CD1 . ILE A  1  548  ? 229.780 221.813 180.334 1.00   244.20 ? 940  ILE A CD1 1 
ATOM   4164  N  N   . LEU A  1  549  ? 228.619 223.010 184.665 1.00   199.24 ? 941  LEU A N   1 
ATOM   4165  C  CA  . LEU A  1  549  ? 229.235 222.641 185.967 1.00   203.14 ? 941  LEU A CA  1 
ATOM   4166  C  C   . LEU A  1  549  ? 230.647 222.122 185.883 1.00   191.29 ? 941  LEU A C   1 
ATOM   4167  O  O   . LEU A  1  549  ? 231.462 222.417 186.766 1.00   194.01 ? 941  LEU A O   1 
ATOM   4168  C  CB  . LEU A  1  549  ? 228.409 221.602 186.740 1.00   200.74 ? 941  LEU A CB  1 
ATOM   4169  C  CG  . LEU A  1  549  ? 229.070 221.023 188.016 1.00   189.39 ? 941  LEU A CG  1 
ATOM   4170  C  CD1 . LEU A  1  549  ? 228.082 220.911 189.164 1.00   205.05 ? 941  LEU A CD1 1 
ATOM   4171  C  CD2 . LEU A  1  549  ? 229.752 219.673 187.757 1.00   179.40 ? 941  LEU A CD2 1 
ATOM   4172  N  N   . ARG A  1  550  ? 230.926 221.293 184.886 1.00   173.93 ? 942  ARG A N   1 
ATOM   4173  C  CA  . ARG A  1  550  ? 232.247 220.708 184.822 1.00   177.82 ? 942  ARG A CA  1 
ATOM   4174  C  C   . ARG A  1  550  ? 233.277 221.760 184.401 1.00   175.24 ? 942  ARG A C   1 
ATOM   4175  O  O   . ARG A  1  550  ? 234.393 221.739 184.883 1.00   206.97 ? 942  ARG A O   1 
ATOM   4176  C  CB  . ARG A  1  550  ? 232.308 219.471 183.936 1.00   193.56 ? 942  ARG A CB  1 
ATOM   4177  C  CG  . ARG A  1  550  ? 233.645 218.746 184.100 1.00   216.46 ? 942  ARG A CG  1 
ATOM   4178  C  CD  . ARG A  1  550  ? 233.671 217.339 183.533 1.00   219.33 ? 942  ARG A CD  1 
ATOM   4179  N  NE  . ARG A  1  550  ? 233.465 216.349 184.594 1.00   229.93 ? 942  ARG A NE  1 
ATOM   4180  C  CZ  . ARG A  1  550  ? 232.378 215.590 184.767 1.00   255.91 ? 942  ARG A CZ  1 
ATOM   4181  N  NH1 . ARG A  1  550  ? 231.312 215.663 183.959 1.00   272.57 ? 942  ARG A NH1 1 
ATOM   4182  N  NH2 . ARG A  1  550  ? 232.356 214.730 185.787 1.00   250.77 ? 942  ARG A NH2 1 
ATOM   4183  N  N   . ASP A  1  551  ? 232.886 222.673 183.519 1.00   189.86 ? 943  ASP A N   1 
ATOM   4184  C  CA  . ASP A  1  551  ? 233.697 223.843 183.129 1.00   203.99 ? 943  ASP A CA  1 
ATOM   4185  C  C   . ASP A  1  551  ? 234.049 224.675 184.354 1.00   170.72 ? 943  ASP A C   1 
ATOM   4186  O  O   . ASP A  1  551  ? 235.200 224.993 184.578 1.00   163.20 ? 943  ASP A O   1 
ATOM   4187  C  CB  . ASP A  1  551  ? 232.910 224.695 182.109 1.00   242.82 ? 943  ASP A CB  1 
ATOM   4188  C  CG  . ASP A  1  551  ? 233.774 225.716 181.392 1.00   276.56 ? 943  ASP A CG  1 
ATOM   4189  O  OD1 . ASP A  1  551  ? 234.281 226.642 182.063 1.00   302.86 ? 943  ASP A OD1 1 
ATOM   4190  O  OD2 . ASP A  1  551  ? 233.919 225.606 180.149 1.00   294.38 ? 943  ASP A OD2 1 
ATOM   4191  N  N   . LEU A  1  552  ? 233.034 224.990 185.152 1.00   170.01 ? 944  LEU A N   1 
ATOM   4192  C  CA  . LEU A  1  552  ? 233.180 225.688 186.437 1.00   159.79 ? 944  LEU A CA  1 
ATOM   4193  C  C   . LEU A  1  552  ? 234.327 225.181 187.249 1.00   149.49 ? 944  LEU A C   1 
ATOM   4194  O  O   . LEU A  1  552  ? 234.855 225.911 188.049 1.00   154.88 ? 944  LEU A O   1 
ATOM   4195  C  CB  . LEU A  1  552  ? 231.944 225.471 187.315 1.00   170.38 ? 944  LEU A CB  1 
ATOM   4196  C  CG  . LEU A  1  552  ? 231.835 226.137 188.696 1.00   166.13 ? 944  LEU A CG  1 
ATOM   4197  C  CD1 . LEU A  1  552  ? 232.490 227.515 188.841 1.00   175.70 ? 944  LEU A CD1 1 
ATOM   4198  C  CD2 . LEU A  1  552  ? 230.370 226.206 189.100 1.00   167.09 ? 944  LEU A CD2 1 
ATOM   4199  N  N   . GLU A  1  553  ? 234.664 223.909 187.098 1.00   158.40 ? 945  GLU A N   1 
ATOM   4200  C  CA  . GLU A  1  553  ? 235.788 223.327 187.797 1.00   159.08 ? 945  GLU A CA  1 
ATOM   4201  C  C   . GLU A  1  553  ? 237.081 224.057 187.499 1.00   136.83 ? 945  GLU A C   1 
ATOM   4202  O  O   . GLU A  1  553  ? 237.787 224.346 188.430 1.00   170.39 ? 945  GLU A O   1 
ATOM   4203  C  CB  . GLU A  1  553  ? 235.926 221.830 187.481 1.00   212.49 ? 945  GLU A CB  1 
ATOM   4204  C  CG  . GLU A  1  553  ? 236.589 220.986 188.566 1.00   269.45 ? 945  GLU A CG  1 
ATOM   4205  C  CD  . GLU A  1  553  ? 235.635 220.548 189.676 1.00   288.11 ? 945  GLU A CD  1 
ATOM   4206  O  OE1 . GLU A  1  553  ? 234.852 221.401 190.159 1.00   302.78 ? 945  GLU A OE1 1 
ATOM   4207  O  OE2 . GLU A  1  553  ? 235.682 219.355 190.077 1.00   273.20 ? 945  GLU A OE2 1 
ATOM   4208  N  N   . THR A  1  554  ? 237.368 224.431 186.258 1.00   123.70 ? 946  THR A N   1 
ATOM   4209  C  CA  . THR A  1  554  ? 238.598 225.203 185.988 1.00   143.83 ? 946  THR A CA  1 
ATOM   4210  C  C   . THR A  1  554  ? 238.741 226.567 186.692 1.00   163.80 ? 946  THR A C   1 
ATOM   4211  O  O   . THR A  1  554  ? 239.838 226.848 187.148 1.00   204.59 ? 946  THR A O   1 
ATOM   4212  C  CB  . THR A  1  554  ? 238.803 225.485 184.519 1.00   156.83 ? 946  THR A CB  1 
ATOM   4213  O  OG1 . THR A  1  554  ? 237.609 226.066 184.000 1.00   174.74 ? 946  THR A OG1 1 
ATOM   4214  C  CG2 . THR A  1  554  ? 239.108 224.234 183.802 1.00   190.99 ? 946  THR A CG2 1 
ATOM   4215  N  N   . LEU A  1  555  ? 237.692 227.406 186.787 1.00   136.92 ? 947  LEU A N   1 
ATOM   4216  C  CA  . LEU A  1  555  ? 237.782 228.704 187.522 1.00   122.08 ? 947  LEU A CA  1 
ATOM   4217  C  C   . LEU A  1  555  ? 238.572 228.586 188.826 1.00   139.99 ? 947  LEU A C   1 
ATOM   4218  O  O   . LEU A  1  555  ? 238.408 227.633 189.569 1.00   151.05 ? 947  LEU A O   1 
ATOM   4219  C  CB  . LEU A  1  555  ? 236.408 229.263 187.875 1.00   139.27 ? 947  LEU A CB  1 
ATOM   4220  C  CG  . LEU A  1  555  ? 235.814 230.282 186.910 1.00   169.99 ? 947  LEU A CG  1 
ATOM   4221  C  CD1 . LEU A  1  555  ? 235.869 229.791 185.473 1.00   189.46 ? 947  LEU A CD1 1 
ATOM   4222  C  CD2 . LEU A  1  555  ? 234.378 230.603 187.295 1.00   164.18 ? 947  LEU A CD2 1 
ATOM   4223  N  N   . PRO A  1  556  ? 239.462 229.539 189.106 1.00   161.87 ? 948  PRO A N   1 
ATOM   4224  C  CA  . PRO A  1  556  ? 240.240 229.499 190.364 1.00   164.10 ? 948  PRO A CA  1 
ATOM   4225  C  C   . PRO A  1  556  ? 239.314 229.595 191.576 1.00   171.10 ? 948  PRO A C   1 
ATOM   4226  O  O   . PRO A  1  556  ? 238.395 230.421 191.559 1.00   219.11 ? 948  PRO A O   1 
ATOM   4227  C  CB  . PRO A  1  556  ? 241.127 230.734 190.261 1.00   167.83 ? 948  PRO A CB  1 
ATOM   4228  C  CG  . PRO A  1  556  ? 241.126 231.114 188.824 1.00   170.03 ? 948  PRO A CG  1 
ATOM   4229  C  CD  . PRO A  1  556  ? 239.857 230.639 188.218 1.00   150.89 ? 948  PRO A CD  1 
ATOM   4230  N  N   . PHE A  1  557  ? 239.499 228.738 192.582 1.00   160.70 ? 949  PHE A N   1 
ATOM   4231  C  CA  . PHE A  1  557  ? 238.474 228.633 193.648 1.00   162.06 ? 949  PHE A CA  1 
ATOM   4232  C  C   . PHE A  1  557  ? 238.080 229.948 194.337 1.00   149.45 ? 949  PHE A C   1 
ATOM   4233  O  O   . PHE A  1  557  ? 236.920 230.108 194.707 1.00   177.20 ? 949  PHE A O   1 
ATOM   4234  C  CB  . PHE A  1  557  ? 238.749 227.511 194.661 1.00   158.95 ? 949  PHE A CB  1 
ATOM   4235  C  CG  . PHE A  1  557  ? 240.031 227.655 195.378 1.00   162.95 ? 949  PHE A CG  1 
ATOM   4236  C  CD1 . PHE A  1  557  ? 241.175 227.058 194.887 1.00   177.11 ? 949  PHE A CD1 1 
ATOM   4237  C  CD2 . PHE A  1  557  ? 240.101 228.391 196.557 1.00   183.89 ? 949  PHE A CD2 1 
ATOM   4238  C  CE1 . PHE A  1  557  ? 242.389 227.214 195.557 1.00   222.46 ? 949  PHE A CE1 1 
ATOM   4239  C  CE2 . PHE A  1  557  ? 241.314 228.555 197.231 1.00   204.91 ? 949  PHE A CE2 1 
ATOM   4240  C  CZ  . PHE A  1  557  ? 242.462 227.963 196.732 1.00   197.60 ? 949  PHE A CZ  1 
ATOM   4241  N  N   . GLY A  1  558  ? 239.002 230.906 194.432 1.00   162.87 ? 950  GLY A N   1 
ATOM   4242  C  CA  . GLY A  1  558  ? 238.700 232.247 194.993 1.00   175.55 ? 950  GLY A CA  1 
ATOM   4243  C  C   . GLY A  1  558  ? 237.592 233.006 194.269 1.00   173.48 ? 950  GLY A C   1 
ATOM   4244  O  O   . GLY A  1  558  ? 236.778 233.715 194.888 1.00   172.91 ? 950  GLY A O   1 
ATOM   4245  N  N   . ILE A  1  559  ? 237.566 232.828 192.955 1.00   152.35 ? 951  ILE A N   1 
ATOM   4246  C  CA  . ILE A  1  559  ? 236.516 233.360 192.116 1.00   146.99 ? 951  ILE A CA  1 
ATOM   4247  C  C   . ILE A  1  559  ? 235.332 232.397 192.044 1.00   157.82 ? 951  ILE A C   1 
ATOM   4248  O  O   . ILE A  1  559  ? 234.174 232.809 191.951 1.00   177.84 ? 951  ILE A O   1 
ATOM   4249  C  CB  . ILE A  1  559  ? 237.012 233.568 190.679 1.00   149.26 ? 951  ILE A CB  1 
ATOM   4250  C  CG1 . ILE A  1  559  ? 238.369 234.263 190.621 1.00   157.78 ? 951  ILE A CG1 1 
ATOM   4251  C  CG2 . ILE A  1  559  ? 236.006 234.375 189.907 1.00   149.33 ? 951  ILE A CG2 1 
ATOM   4252  C  CD1 . ILE A  1  559  ? 238.409 235.617 191.275 1.00   177.42 ? 951  ILE A CD1 1 
ATOM   4253  N  N   . ALA A  1  560  ? 235.625 231.110 192.024 1.00   161.01 ? 952  ALA A N   1 
ATOM   4254  C  CA  . ALA A  1  560  ? 234.574 230.128 191.975 1.00   171.83 ? 952  ALA A CA  1 
ATOM   4255  C  C   . ALA A  1  560  ? 233.679 230.244 193.209 1.00   193.90 ? 952  ALA A C   1 
ATOM   4256  O  O   . ALA A  1  560  ? 232.487 230.008 193.085 1.00   229.45 ? 952  ALA A O   1 
ATOM   4257  C  CB  . ALA A  1  560  ? 235.134 228.717 191.859 1.00   185.03 ? 952  ALA A CB  1 
ATOM   4258  N  N   . LEU A  1  561  ? 234.223 230.627 194.376 1.00   189.96 ? 953  LEU A N   1 
ATOM   4259  C  CA  . LEU A  1  561  ? 233.437 230.621 195.621 1.00   180.72 ? 953  LEU A CA  1 
ATOM   4260  C  C   . LEU A  1  561  ? 232.132 231.381 195.534 1.00   160.07 ? 953  LEU A C   1 
ATOM   4261  O  O   . LEU A  1  561  ? 231.116 230.821 195.889 1.00   168.33 ? 953  LEU A O   1 
ATOM   4262  C  CB  . LEU A  1  561  ? 234.229 231.086 196.859 1.00   193.97 ? 953  LEU A CB  1 
ATOM   4263  C  CG  . LEU A  1  561  ? 235.062 230.071 197.658 1.00   239.98 ? 953  LEU A CG  1 
ATOM   4264  C  CD1 . LEU A  1  561  ? 234.952 230.371 199.149 1.00   248.68 ? 953  LEU A CD1 1 
ATOM   4265  C  CD2 . LEU A  1  561  ? 234.710 228.608 197.420 1.00   258.82 ? 953  LEU A CD2 1 
ATOM   4266  N  N   . PRO A  1  562  ? 232.152 232.646 195.088 1.00   145.14 ? 954  PRO A N   1 
ATOM   4267  C  CA  . PRO A  1  562  ? 230.936 233.413 194.832 1.00   154.80 ? 954  PRO A CA  1 
ATOM   4268  C  C   . PRO A  1  562  ? 229.858 232.678 194.065 1.00   175.22 ? 954  PRO A C   1 
ATOM   4269  O  O   . PRO A  1  562  ? 228.693 232.644 194.484 1.00   186.57 ? 954  PRO A O   1 
ATOM   4270  C  CB  . PRO A  1  562  ? 231.449 234.574 193.981 1.00   175.72 ? 954  PRO A CB  1 
ATOM   4271  C  CG  . PRO A  1  562  ? 232.801 234.834 194.564 1.00   195.89 ? 954  PRO A CG  1 
ATOM   4272  C  CD  . PRO A  1  562  ? 233.318 233.542 195.154 1.00   171.73 ? 954  PRO A CD  1 
ATOM   4273  N  N   . ILE A  1  563  ? 230.273 232.104 192.943 1.00   187.96 ? 955  ILE A N   1 
ATOM   4274  C  CA  . ILE A  1  563  ? 229.386 231.356 192.059 1.00   158.42 ? 955  ILE A CA  1 
ATOM   4275  C  C   . ILE A  1  563  ? 228.940 230.074 192.706 1.00   132.35 ? 955  ILE A C   1 
ATOM   4276  O  O   . ILE A  1  563  ? 227.780 229.739 192.630 1.00   123.87 ? 955  ILE A O   1 
ATOM   4277  C  CB  . ILE A  1  563  ? 230.102 231.001 190.756 1.00   159.00 ? 955  ILE A CB  1 
ATOM   4278  C  CG1 . ILE A  1  563  ? 230.353 232.290 189.948 1.00   189.87 ? 955  ILE A CG1 1 
ATOM   4279  C  CG2 . ILE A  1  563  ? 229.304 229.966 189.990 1.00   123.81 ? 955  ILE A CG2 1 
ATOM   4280  C  CD1 . ILE A  1  563  ? 231.452 232.185 188.913 1.00   205.55 ? 955  ILE A CD1 1 
ATOM   4281  N  N   . ARG A  1  564  ? 229.880 229.375 193.334 1.00   135.49 ? 956  ARG A N   1 
ATOM   4282  C  CA  . ARG A  1  564  ? 229.569 228.147 194.034 1.00   148.11 ? 956  ARG A CA  1 
ATOM   4283  C  C   . ARG A  1  564  ? 228.653 228.347 195.243 1.00   159.17 ? 956  ARG A C   1 
ATOM   4284  O  O   . ARG A  1  564  ? 227.816 227.481 195.531 1.00   181.00 ? 956  ARG A O   1 
ATOM   4285  C  CB  . ARG A  1  564  ? 230.824 227.386 194.448 1.00   155.12 ? 956  ARG A CB  1 
ATOM   4286  C  CG  . ARG A  1  564  ? 230.523 225.902 194.462 1.00   182.52 ? 956  ARG A CG  1 
ATOM   4287  C  CD  . ARG A  1  564  ? 231.720 225.018 194.728 1.00   197.43 ? 956  ARG A CD  1 
ATOM   4288  N  NE  . ARG A  1  564  ? 232.850 225.120 193.785 1.00   210.62 ? 956  ARG A NE  1 
ATOM   4289  C  CZ  . ARG A  1  564  ? 232.861 224.688 192.521 1.00   205.86 ? 956  ARG A CZ  1 
ATOM   4290  N  NH1 . ARG A  1  564  ? 231.771 224.175 191.948 1.00   209.19 ? 956  ARG A NH1 1 
ATOM   4291  N  NH2 . ARG A  1  564  ? 233.977 224.797 191.805 1.00   196.92 ? 956  ARG A NH2 1 
ATOM   4292  N  N   . ASP A  1  565  ? 228.785 229.475 195.938 1.00   165.43 ? 957  ASP A N   1 
ATOM   4293  C  CA  . ASP A  1  565  ? 227.859 229.830 197.027 1.00   169.30 ? 957  ASP A CA  1 
ATOM   4294  C  C   . ASP A  1  565  ? 226.476 229.897 196.457 1.00   145.36 ? 957  ASP A C   1 
ATOM   4295  O  O   . ASP A  1  565  ? 225.542 229.383 197.065 1.00   137.06 ? 957  ASP A O   1 
ATOM   4296  C  CB  . ASP A  1  565  ? 228.223 231.183 197.694 1.00   203.50 ? 957  ASP A CB  1 
ATOM   4297  C  CG  . ASP A  1  565  ? 227.563 231.390 199.099 1.00   232.42 ? 957  ASP A CG  1 
ATOM   4298  O  OD1 . ASP A  1  565  ? 227.608 230.470 199.945 1.00   291.32 ? 957  ASP A OD1 1 
ATOM   4299  O  OD2 . ASP A  1  565  ? 227.046 232.507 199.388 1.00   217.35 ? 957  ASP A OD2 1 
ATOM   4300  N  N   . ALA A  1  566  ? 226.344 230.507 195.287 1.00   134.69 ? 958  ALA A N   1 
ATOM   4301  C  CA  . ALA A  1  566  ? 225.038 230.597 194.661 1.00   167.02 ? 958  ALA A CA  1 
ATOM   4302  C  C   . ALA A  1  566  ? 224.459 229.217 194.467 1.00   147.06 ? 958  ALA A C   1 
ATOM   4303  O  O   . ALA A  1  566  ? 223.311 228.979 194.807 1.00   156.62 ? 958  ALA A O   1 
ATOM   4304  C  CB  . ALA A  1  566  ? 225.096 231.323 193.330 1.00   207.62 ? 958  ALA A CB  1 
ATOM   4305  N  N   . ILE A  1  567  ? 225.259 228.309 193.941 1.00   132.38 ? 959  ILE A N   1 
ATOM   4306  C  CA  . ILE A  1  567  ? 224.805 226.948 193.725 1.00   137.40 ? 959  ILE A CA  1 
ATOM   4307  C  C   . ILE A  1  567  ? 224.448 226.243 195.043 1.00   138.25 ? 959  ILE A C   1 
ATOM   4308  O  O   . ILE A  1  567  ? 223.409 225.598 195.117 1.00   145.89 ? 959  ILE A O   1 
ATOM   4309  C  CB  . ILE A  1  567  ? 225.818 226.181 192.864 1.00   145.63 ? 959  ILE A CB  1 
ATOM   4310  C  CG1 . ILE A  1  567  ? 225.700 226.709 191.428 1.00   135.19 ? 959  ILE A CG1 1 
ATOM   4311  C  CG2 . ILE A  1  567  ? 225.599 224.667 192.931 1.00   169.65 ? 959  ILE A CG2 1 
ATOM   4312  C  CD1 . ILE A  1  567  ? 226.979 226.600 190.641 1.00   143.14 ? 959  ILE A CD1 1 
ATOM   4313  N  N   . TYR A  1  568  ? 225.265 226.386 196.084 1.00   140.55 ? 960  TYR A N   1 
ATOM   4314  C  CA  . TYR A  1  568  ? 224.880 225.861 197.399 1.00   160.22 ? 960  TYR A CA  1 
ATOM   4315  C  C   . TYR A  1  568  ? 223.513 226.473 197.857 1.00   165.99 ? 960  TYR A C   1 
ATOM   4316  O  O   . TYR A  1  568  ? 222.594 225.754 198.321 1.00   139.38 ? 960  TYR A O   1 
ATOM   4317  C  CB  . TYR A  1  568  ? 226.010 226.120 198.405 1.00   161.50 ? 960  TYR A CB  1 
ATOM   4318  C  CG  . TYR A  1  568  ? 225.822 225.493 199.784 1.00   199.54 ? 960  TYR A CG  1 
ATOM   4319  C  CD1 . TYR A  1  568  ? 224.684 225.751 200.583 1.00   208.38 ? 960  TYR A CD1 1 
ATOM   4320  C  CD2 . TYR A  1  568  ? 226.810 224.685 200.325 1.00   242.53 ? 960  TYR A CD2 1 
ATOM   4321  C  CE1 . TYR A  1  568  ? 224.533 225.189 201.845 1.00   218.46 ? 960  TYR A CE1 1 
ATOM   4322  C  CE2 . TYR A  1  568  ? 226.665 224.114 201.589 1.00   269.91 ? 960  TYR A CE2 1 
ATOM   4323  C  CZ  . TYR A  1  568  ? 225.529 224.369 202.344 1.00   244.82 ? 960  TYR A CZ  1 
ATOM   4324  O  OH  . TYR A  1  568  ? 225.412 223.797 203.589 1.00   236.75 ? 960  TYR A OH  1 
ATOM   4325  N  N   . HIS A  1  569  ? 223.370 227.792 197.723 1.00   171.76 ? 961  HIS A N   1 
ATOM   4326  C  CA  . HIS A  1  569  ? 222.133 228.452 198.154 1.00   164.57 ? 961  HIS A CA  1 
ATOM   4327  C  C   . HIS A  1  569  ? 220.930 228.100 197.259 1.00   152.87 ? 961  HIS A C   1 
ATOM   4328  O  O   . HIS A  1  569  ? 219.812 228.040 197.728 1.00   172.95 ? 961  HIS A O   1 
ATOM   4329  C  CB  . HIS A  1  569  ? 222.323 229.966 198.405 1.00   164.80 ? 961  HIS A CB  1 
ATOM   4330  C  CG  . HIS A  1  569  ? 223.074 230.286 199.680 1.00   185.00 ? 961  HIS A CG  1 
ATOM   4331  N  ND1 . HIS A  1  569  ? 223.348 229.352 200.667 1.00   183.06 ? 961  HIS A ND1 1 
ATOM   4332  C  CD2 . HIS A  1  569  ? 223.580 231.457 200.139 1.00   210.12 ? 961  HIS A CD2 1 
ATOM   4333  C  CE1 . HIS A  1  569  ? 223.998 229.926 201.662 1.00   182.50 ? 961  HIS A CE1 1 
ATOM   4334  N  NE2 . HIS A  1  569  ? 224.156 231.205 201.367 1.00   209.73 ? 961  HIS A NE2 1 
ATOM   4335  N  N   . CYS A  1  570  ? 221.174 227.784 195.996 1.00   145.04 ? 962  CYS A N   1 
ATOM   4336  C  CA  . CYS A  1  570  ? 220.115 227.273 195.108 1.00   162.07 ? 962  CYS A CA  1 
ATOM   4337  C  C   . CYS A  1  570  ? 219.713 225.806 195.375 1.00   147.01 ? 962  CYS A C   1 
ATOM   4338  O  O   . CYS A  1  570  ? 218.576 225.432 195.171 1.00   135.78 ? 962  CYS A O   1 
ATOM   4339  C  CB  . CYS A  1  570  ? 220.496 227.473 193.644 1.00   154.83 ? 962  CYS A CB  1 
ATOM   4340  S  SG  . CYS A  1  570  ? 219.082 227.956 192.623 1.00   208.33 ? 962  CYS A SG  1 
ATOM   4341  N  N   . ARG A  1  571  ? 220.634 224.993 195.855 1.00   143.59 ? 963  ARG A N   1 
ATOM   4342  C  CA  . ARG A  1  571  ? 220.328 223.630 196.228 1.00   151.26 ? 963  ARG A CA  1 
ATOM   4343  C  C   . ARG A  1  571  ? 219.593 223.534 197.559 1.00   183.43 ? 963  ARG A C   1 
ATOM   4344  O  O   . ARG A  1  571  ? 218.917 222.543 197.779 1.00   185.59 ? 963  ARG A O   1 
ATOM   4345  C  CB  . ARG A  1  571  ? 221.608 222.836 196.320 1.00   169.30 ? 963  ARG A CB  1 
ATOM   4346  C  CG  . ARG A  1  571  ? 221.444 221.330 196.410 1.00   194.08 ? 963  ARG A CG  1 
ATOM   4347  C  CD  . ARG A  1  571  ? 222.823 220.680 196.284 1.00   216.50 ? 963  ARG A CD  1 
ATOM   4348  N  NE  . ARG A  1  571  ? 223.749 221.200 197.304 1.00   205.73 ? 963  ARG A NE  1 
ATOM   4349  C  CZ  . ARG A  1  571  ? 225.038 221.500 197.132 1.00   201.13 ? 963  ARG A CZ  1 
ATOM   4350  N  NH1 . ARG A  1  571  ? 225.659 221.355 195.953 1.00   190.97 ? 963  ARG A NH1 1 
ATOM   4351  N  NH2 . ARG A  1  571  ? 225.716 221.981 198.169 1.00   214.39 ? 963  ARG A NH2 1 
ATOM   4352  N  N   . GLU A  1  572  ? 219.759 224.504 198.470 1.00   221.40 ? 964  GLU A N   1 
ATOM   4353  C  CA  . GLU A  1  572  ? 218.933 224.501 199.713 1.00   253.76 ? 964  GLU A CA  1 
ATOM   4354  C  C   . GLU A  1  572  ? 217.441 224.601 199.355 1.00   244.71 ? 964  GLU A C   1 
ATOM   4355  O  O   . GLU A  1  572  ? 216.605 223.935 199.974 1.00   215.08 ? 964  GLU A O   1 
ATOM   4356  C  CB  . GLU A  1  572  ? 219.188 225.630 200.775 1.00   307.84 ? 964  GLU A CB  1 
ATOM   4357  C  CG  . GLU A  1  572  ? 220.346 226.623 200.676 1.00   322.46 ? 964  GLU A CG  1 
ATOM   4358  C  CD  . GLU A  1  572  ? 220.072 228.010 201.343 1.00   312.17 ? 964  GLU A CD  1 
ATOM   4359  O  OE1 . GLU A  1  572  ? 218.996 228.279 201.963 1.00   218.49 ? 964  GLU A OE1 1 
ATOM   4360  O  OE2 . GLU A  1  572  ? 220.961 228.879 201.272 1.00   307.27 ? 964  GLU A OE2 1 
ATOM   4361  N  N   . GLN A  1  573  ? 217.126 225.468 198.389 1.00   233.92 ? 965  GLN A N   1 
ATOM   4362  C  CA  . GLN A  1  573  ? 215.742 225.838 198.086 1.00   235.62 ? 965  GLN A CA  1 
ATOM   4363  C  C   . GLN A  1  573  ? 215.392 225.520 196.655 1.00   239.86 ? 965  GLN A C   1 
ATOM   4364  O  O   . GLN A  1  573  ? 215.113 226.437 195.868 1.00   230.26 ? 965  GLN A O   1 
ATOM   4365  C  CB  . GLN A  1  573  ? 215.498 227.333 198.370 1.00   256.10 ? 965  GLN A CB  1 
ATOM   4366  C  CG  . GLN A  1  573  ? 215.879 227.794 199.770 1.00   290.34 ? 965  GLN A CG  1 
ATOM   4367  C  CD  . GLN A  1  573  ? 215.402 226.847 200.856 1.00   333.89 ? 965  GLN A CD  1 
ATOM   4368  O  OE1 . GLN A  1  573  ? 214.306 226.289 200.771 1.00   343.84 ? 965  GLN A OE1 1 
ATOM   4369  N  NE2 . GLN A  1  573  ? 216.225 226.650 201.878 1.00   372.71 ? 965  GLN A NE2 1 
ATOM   4370  N  N   . PRO A  1  574  ? 215.342 224.212 196.312 1.00   260.80 ? 966  PRO A N   1 
ATOM   4371  C  CA  . PRO A  1  574  ? 214.818 223.872 194.993 1.00   270.10 ? 966  PRO A CA  1 
ATOM   4372  C  C   . PRO A  1  574  ? 213.349 224.260 194.953 1.00   262.83 ? 966  PRO A C   1 
ATOM   4373  O  O   . PRO A  1  574  ? 212.605 223.930 195.877 1.00   272.16 ? 966  PRO A O   1 
ATOM   4374  C  CB  . PRO A  1  574  ? 215.007 222.356 194.911 1.00   270.03 ? 966  PRO A CB  1 
ATOM   4375  C  CG  . PRO A  1  574  ? 214.918 221.901 196.324 1.00   270.66 ? 966  PRO A CG  1 
ATOM   4376  C  CD  . PRO A  1  574  ? 215.470 223.016 197.167 1.00   259.48 ? 966  PRO A CD  1 
ATOM   4377  N  N   . ALA A  1  575  ? 212.954 224.988 193.915 1.00   261.93 ? 967  ALA A N   1 
ATOM   4378  C  CA  . ALA A  1  575  ? 211.668 225.679 193.912 1.00   296.87 ? 967  ALA A CA  1 
ATOM   4379  C  C   . ALA A  1  575  ? 210.732 225.081 192.865 1.00   297.84 ? 967  ALA A C   1 
ATOM   4380  O  O   . ALA A  1  575  ? 209.731 224.427 193.188 1.00   287.80 ? 967  ALA A O   1 
ATOM   4381  C  CB  . ALA A  1  575  ? 211.891 227.174 193.678 1.00   280.54 ? 967  ALA A CB  1 
ATOM   4382  N  N   . SER A  1  576  ? 211.088 225.293 191.609 1.00   283.91 ? 968  SER A N   1 
ATOM   4383  C  CA  . SER A  1  576  ? 210.230 224.973 190.496 1.00   271.66 ? 968  SER A CA  1 
ATOM   4384  C  C   . SER A  1  576  ? 211.030 224.166 189.508 1.00   273.80 ? 968  SER A C   1 
ATOM   4385  O  O   . SER A  1  576  ? 212.268 224.213 189.505 1.00   275.56 ? 968  SER A O   1 
ATOM   4386  C  CB  . SER A  1  576  ? 209.752 226.268 189.841 1.00   264.63 ? 968  SER A CB  1 
ATOM   4387  O  OG  . SER A  1  576  ? 208.927 226.014 188.720 1.00   260.67 ? 968  SER A OG  1 
ATOM   4388  N  N   . ASP A  1  577  ? 210.327 223.423 188.659 1.00   275.91 ? 969  ASP A N   1 
ATOM   4389  C  CA  . ASP A  1  577  ? 210.989 222.715 187.585 1.00   282.24 ? 969  ASP A CA  1 
ATOM   4390  C  C   . ASP A  1  577  ? 211.804 223.719 186.783 1.00   250.57 ? 969  ASP A C   1 
ATOM   4391  O  O   . ASP A  1  577  ? 211.265 224.642 186.181 1.00   257.47 ? 969  ASP A O   1 
ATOM   4392  C  CB  . ASP A  1  577  ? 210.009 222.008 186.660 1.00   314.68 ? 969  ASP A CB  1 
ATOM   4393  C  CG  . ASP A  1  577  ? 210.716 221.308 185.513 1.00   350.63 ? 969  ASP A CG  1 
ATOM   4394  O  OD1 . ASP A  1  577  ? 211.318 220.242 185.754 1.00   384.32 ? 969  ASP A OD1 1 
ATOM   4395  O  OD2 . ASP A  1  577  ? 210.693 221.837 184.381 1.00   384.71 ? 969  ASP A OD2 1 
ATOM   4396  N  N   . TRP A  1  578  ? 213.111 223.551 186.851 1.00   218.23 ? 970  TRP A N   1 
ATOM   4397  C  CA  . TRP A  1  578  ? 214.023 224.341 186.073 1.00   202.79 ? 970  TRP A CA  1 
ATOM   4398  C  C   . TRP A  1  578  ? 214.323 223.567 184.807 1.00   202.67 ? 970  TRP A C   1 
ATOM   4399  O  O   . TRP A  1  578  ? 214.033 222.368 184.712 1.00   232.84 ? 970  TRP A O   1 
ATOM   4400  C  CB  . TRP A  1  578  ? 215.318 224.532 186.834 1.00   214.51 ? 970  TRP A CB  1 
ATOM   4401  C  CG  . TRP A  1  578  ? 215.289 225.526 187.926 1.00   217.56 ? 970  TRP A CG  1 
ATOM   4402  C  CD1 . TRP A  1  578  ? 215.022 226.865 187.819 1.00   209.38 ? 970  TRP A CD1 1 
ATOM   4403  C  CD2 . TRP A  1  578  ? 215.624 225.284 189.291 1.00   198.27 ? 970  TRP A CD2 1 
ATOM   4404  N  NE1 . TRP A  1  578  ? 215.144 227.462 189.046 1.00   190.31 ? 970  TRP A NE1 1 
ATOM   4405  C  CE2 . TRP A  1  578  ? 215.512 226.514 189.967 1.00   192.00 ? 970  TRP A CE2 1 
ATOM   4406  C  CE3 . TRP A  1  578  ? 215.997 224.137 190.015 1.00   194.36 ? 970  TRP A CE3 1 
ATOM   4407  C  CZ2 . TRP A  1  578  ? 215.747 226.633 191.335 1.00   203.85 ? 970  TRP A CZ2 1 
ATOM   4408  C  CZ3 . TRP A  1  578  ? 216.229 224.253 191.372 1.00   192.15 ? 970  TRP A CZ3 1 
ATOM   4409  C  CH2 . TRP A  1  578  ? 216.106 225.498 192.016 1.00   204.98 ? 970  TRP A CH2 1 
ATOM   4410  N  N   . PRO A  1  579  ? 214.959 224.230 183.833 1.00   192.47 ? 971  PRO A N   1 
ATOM   4411  C  CA  . PRO A  1  579  ? 215.477 223.467 182.703 1.00   211.88 ? 971  PRO A CA  1 
ATOM   4412  C  C   . PRO A  1  579  ? 216.471 222.408 183.146 1.00   208.47 ? 971  PRO A C   1 
ATOM   4413  O  O   . PRO A  1  579  ? 217.141 222.572 184.167 1.00   230.75 ? 971  PRO A O   1 
ATOM   4414  C  CB  . PRO A  1  579  ? 216.157 224.533 181.834 1.00   228.03 ? 971  PRO A CB  1 
ATOM   4415  C  CG  . PRO A  1  579  ? 216.360 225.695 182.740 1.00   224.97 ? 971  PRO A CG  1 
ATOM   4416  C  CD  . PRO A  1  579  ? 215.183 225.673 183.659 1.00   201.86 ? 971  PRO A CD  1 
ATOM   4417  N  N   . GLU A  1  580  ? 216.535 221.322 182.388 1.00   194.07 ? 972  GLU A N   1 
ATOM   4418  C  CA  . GLU A  1  580  ? 217.367 220.182 182.753 1.00   208.52 ? 972  GLU A CA  1 
ATOM   4419  C  C   . GLU A  1  580  ? 218.802 220.590 183.045 1.00   197.88 ? 972  GLU A C   1 
ATOM   4420  O  O   . GLU A  1  580  ? 219.413 220.064 183.969 1.00   210.28 ? 972  GLU A O   1 
ATOM   4421  C  CB  . GLU A  1  580  ? 217.371 219.120 181.647 1.00   238.45 ? 972  GLU A CB  1 
ATOM   4422  C  CG  . GLU A  1  580  ? 218.150 217.853 182.015 1.00   262.74 ? 972  GLU A CG  1 
ATOM   4423  C  CD  . GLU A  1  580  ? 218.016 216.735 180.993 1.00   297.06 ? 972  GLU A CD  1 
ATOM   4424  O  OE1 . GLU A  1  580  ? 218.099 217.022 179.777 1.00   335.98 ? 972  GLU A OE1 1 
ATOM   4425  O  OE2 . GLU A  1  580  ? 217.845 215.562 181.407 1.00   291.75 ? 972  GLU A OE2 1 
ATOM   4426  N  N   . ALA A  1  581  ? 219.324 221.514 182.244 1.00   186.34 ? 973  ALA A N   1 
ATOM   4427  C  CA  . ALA A  1  581  ? 220.682 222.027 182.418 1.00   184.54 ? 973  ALA A CA  1 
ATOM   4428  C  C   . ALA A  1  581  ? 220.916 222.574 183.823 1.00   165.71 ? 973  ALA A C   1 
ATOM   4429  O  O   . ALA A  1  581  ? 221.977 222.330 184.398 1.00   182.58 ? 973  ALA A O   1 
ATOM   4430  C  CB  . ALA A  1  581  ? 220.992 223.095 181.376 1.00   200.33 ? 973  ALA A CB  1 
ATOM   4431  N  N   . VAL A  1  582  ? 219.930 223.300 184.365 1.00   152.66 ? 974  VAL A N   1 
ATOM   4432  C  CA  . VAL A  1  582  ? 220.029 223.882 185.714 1.00   152.54 ? 974  VAL A CA  1 
ATOM   4433  C  C   . VAL A  1  582  ? 220.044 222.807 186.781 1.00   152.57 ? 974  VAL A C   1 
ATOM   4434  O  O   . VAL A  1  582  ? 220.771 222.912 187.751 1.00   153.94 ? 974  VAL A O   1 
ATOM   4435  C  CB  . VAL A  1  582  ? 218.866 224.847 186.050 1.00   169.42 ? 974  VAL A CB  1 
ATOM   4436  C  CG1 . VAL A  1  582  ? 218.819 225.201 187.544 1.00   163.78 ? 974  VAL A CG1 1 
ATOM   4437  C  CG2 . VAL A  1  582  ? 218.943 226.120 185.216 1.00   190.59 ? 974  VAL A CG2 1 
ATOM   4438  N  N   . CYS A  1  583  ? 219.214 221.790 186.623 1.00   186.82 ? 975  CYS A N   1 
ATOM   4439  C  CA  . CYS A  1  583  ? 219.178 220.702 187.588 1.00   208.65 ? 975  CYS A CA  1 
ATOM   4440  C  C   . CYS A  1  583  ? 220.545 220.063 187.707 1.00   189.97 ? 975  CYS A C   1 
ATOM   4441  O  O   . CYS A  1  583  ? 221.019 219.857 188.798 1.00   206.27 ? 975  CYS A O   1 
ATOM   4442  C  CB  . CYS A  1  583  ? 218.120 219.673 187.197 1.00   247.65 ? 975  CYS A CB  1 
ATOM   4443  S  SG  . CYS A  1  583  ? 216.488 220.434 186.987 1.00   299.13 ? 975  CYS A SG  1 
ATOM   4444  N  N   . LEU A  1  584  ? 221.192 219.814 186.574 1.00   206.86 ? 976  LEU A N   1 
ATOM   4445  C  CA  . LEU A  1  584  ? 222.538 219.224 186.558 1.00   200.55 ? 976  LEU A CA  1 
ATOM   4446  C  C   . LEU A  1  584  ? 223.647 220.167 186.986 1.00   158.82 ? 976  LEU A C   1 
ATOM   4447  O  O   . LEU A  1  584  ? 224.656 219.686 187.462 1.00   163.62 ? 976  LEU A O   1 
ATOM   4448  C  CB  . LEU A  1  584  ? 222.890 218.682 185.170 1.00   208.03 ? 976  LEU A CB  1 
ATOM   4449  C  CG  . LEU A  1  584  ? 222.261 217.350 184.756 1.00   224.81 ? 976  LEU A CG  1 
ATOM   4450  C  CD1 . LEU A  1  584  ? 220.878 217.067 185.369 1.00   216.32 ? 976  LEU A CD1 1 
ATOM   4451  C  CD2 . LEU A  1  584  ? 222.211 217.320 183.229 1.00   236.44 ? 976  LEU A CD2 1 
ATOM   4452  N  N   . LEU A  1  585  ? 223.500 221.474 186.785 1.00   147.59 ? 977  LEU A N   1 
ATOM   4453  C  CA  . LEU A  1  585  ? 224.485 222.452 187.304 1.00   148.58 ? 977  LEU A CA  1 
ATOM   4454  C  C   . LEU A  1  585  ? 224.500 222.520 188.841 1.00   153.56 ? 977  LEU A C   1 
ATOM   4455  O  O   . LEU A  1  585  ? 225.557 222.567 189.455 1.00   131.54 ? 977  LEU A O   1 
ATOM   4456  C  CB  . LEU A  1  585  ? 224.214 223.841 186.748 1.00   141.14 ? 977  LEU A CB  1 
ATOM   4457  C  CG  . LEU A  1  585  ? 225.033 224.940 187.410 1.00   148.78 ? 977  LEU A CG  1 
ATOM   4458  C  CD1 . LEU A  1  585  ? 226.518 224.715 187.195 1.00   147.57 ? 977  LEU A CD1 1 
ATOM   4459  C  CD2 . LEU A  1  585  ? 224.608 226.276 186.849 1.00   192.29 ? 977  LEU A CD2 1 
ATOM   4460  N  N   . ILE A  1  586  ? 223.326 222.566 189.448 1.00   154.55 ? 978  ILE A N   1 
ATOM   4461  C  CA  . ILE A  1  586  ? 223.198 222.320 190.879 1.00   143.02 ? 978  ILE A CA  1 
ATOM   4462  C  C   . ILE A  1  586  ? 223.434 220.818 191.103 1.00   162.51 ? 978  ILE A C   1 
ATOM   4463  O  O   . ILE A  1  586  ? 223.221 220.027 190.190 1.00   179.29 ? 978  ILE A O   1 
ATOM   4464  C  CB  . ILE A  1  586  ? 221.804 222.735 191.329 1.00   169.25 ? 978  ILE A CB  1 
ATOM   4465  C  CG1 . ILE A  1  586  ? 221.730 224.259 191.300 1.00   182.10 ? 978  ILE A CG1 1 
ATOM   4466  C  CG2 . ILE A  1  586  ? 221.436 222.162 192.703 1.00   189.82 ? 978  ILE A CG2 1 
ATOM   4467  C  CD1 . ILE A  1  586  ? 220.311 224.761 191.435 1.00   222.45 ? 978  ILE A CD1 1 
ATOM   4468  N  N   . GLY A  1  587  ? 223.893 220.399 192.269 1.00   173.15 ? 979  GLY A N   1 
ATOM   4469  C  CA  . GLY A  1  587  ? 224.080 218.962 192.501 1.00   183.89 ? 979  GLY A CA  1 
ATOM   4470  C  C   . GLY A  1  587  ? 222.784 218.264 192.877 1.00   206.20 ? 979  GLY A C   1 
ATOM   4471  O  O   . GLY A  1  587  ? 222.593 217.912 194.044 1.00   278.62 ? 979  GLY A O   1 
ATOM   4472  N  N   . ARG A  1  588  ? 221.888 218.042 191.916 1.00   203.97 ? 980  ARG A N   1 
ATOM   4473  C  CA  . ARG A  1  588  ? 220.521 217.607 192.250 1.00   179.40 ? 980  ARG A CA  1 
ATOM   4474  C  C   . ARG A  1  588  ? 219.786 217.091 191.041 1.00   165.52 ? 980  ARG A C   1 
ATOM   4475  O  O   . ARG A  1  588  ? 218.802 217.690 190.606 1.00   131.30 ? 980  ARG A O   1 
ATOM   4476  C  CB  . ARG A  1  588  ? 219.756 218.781 192.880 1.00   179.44 ? 980  ARG A CB  1 
ATOM   4477  C  CG  . ARG A  1  588  ? 218.485 218.381 193.572 1.00   165.59 ? 980  ARG A CG  1 
ATOM   4478  C  CD  . ARG A  1  588  ? 218.329 219.089 194.911 1.00   174.21 ? 980  ARG A CD  1 
ATOM   4479  N  NE  . ARG A  1  588  ? 216.922 219.066 195.260 1.00   191.01 ? 980  ARG A NE  1 
ATOM   4480  C  CZ  . ARG A  1  588  ? 216.246 217.982 195.658 1.00   217.33 ? 980  ARG A CZ  1 
ATOM   4481  N  NH1 . ARG A  1  588  ? 216.836 216.790 195.815 1.00   231.71 ? 980  ARG A NH1 1 
ATOM   4482  N  NH2 . ARG A  1  588  ? 214.945 218.094 195.907 1.00   246.19 ? 980  ARG A NH2 1 
ATOM   4483  N  N   . GLN A  1  589  ? 220.276 215.957 190.537 1.00   180.75 ? 981  GLN A N   1 
ATOM   4484  C  CA  . GLN A  1  589  ? 219.857 215.376 189.246 1.00   206.37 ? 981  GLN A CA  1 
ATOM   4485  C  C   . GLN A  1  589  ? 218.445 214.840 189.256 1.00   208.88 ? 981  GLN A C   1 
ATOM   4486  O  O   . GLN A  1  589  ? 217.820 214.723 188.200 1.00   201.24 ? 981  GLN A O   1 
ATOM   4487  C  CB  . GLN A  1  589  ? 220.737 214.185 188.880 1.00   211.51 ? 981  GLN A CB  1 
ATOM   4488  C  CG  . GLN A  1  589  ? 222.234 214.442 188.907 1.00   237.79 ? 981  GLN A CG  1 
ATOM   4489  C  CD  . GLN A  1  589  ? 222.958 213.506 189.858 1.00   280.92 ? 981  GLN A CD  1 
ATOM   4490  O  OE1 . GLN A  1  589  ? 222.624 212.324 189.972 1.00   305.09 ? 981  GLN A OE1 1 
ATOM   4491  N  NE2 . GLN A  1  589  ? 223.957 214.035 190.552 1.00   318.72 ? 981  GLN A NE2 1 
ATOM   4492  N  N   . ASP A  1  590  ? 217.984 214.459 190.447 1.00   208.61 ? 982  ASP A N   1 
ATOM   4493  C  CA  . ASP A  1  590  ? 216.674 213.858 190.648 1.00   195.07 ? 982  ASP A CA  1 
ATOM   4494  C  C   . ASP A  1  590  ? 215.519 214.686 190.113 1.00   197.81 ? 982  ASP A C   1 
ATOM   4495  O  O   . ASP A  1  590  ? 214.519 214.107 189.693 1.00   278.88 ? 982  ASP A O   1 
ATOM   4496  C  CB  . ASP A  1  590  ? 216.426 213.502 192.131 1.00   188.26 ? 982  ASP A CB  1 
ATOM   4497  C  CG  . ASP A  1  590  ? 216.127 214.714 193.017 1.00   189.63 ? 982  ASP A CG  1 
ATOM   4498  O  OD1 . ASP A  1  590  ? 215.548 215.702 192.520 1.00   163.10 ? 982  ASP A OD1 1 
ATOM   4499  O  OD2 . ASP A  1  590  ? 216.437 214.656 194.234 1.00   210.89 ? 982  ASP A OD2 1 
ATOM   4500  N  N   . LEU A  1  591  ? 215.636 216.014 190.140 1.00   157.19 ? 983  LEU A N   1 
ATOM   4501  C  CA  . LEU A  1  591  ? 214.528 216.862 189.719 1.00   174.74 ? 983  LEU A CA  1 
ATOM   4502  C  C   . LEU A  1  591  ? 214.140 216.639 188.265 1.00   204.33 ? 983  LEU A C   1 
ATOM   4503  O  O   . LEU A  1  591  ? 212.946 216.520 187.946 1.00   232.51 ? 983  LEU A O   1 
ATOM   4504  C  CB  . LEU A  1  591  ? 214.828 218.332 189.968 1.00   168.20 ? 983  LEU A CB  1 
ATOM   4505  C  CG  . LEU A  1  591  ? 214.713 218.708 191.445 1.00   179.91 ? 983  LEU A CG  1 
ATOM   4506  C  CD1 . LEU A  1  591  ? 215.466 220.015 191.703 1.00   206.13 ? 983  LEU A CD1 1 
ATOM   4507  C  CD2 . LEU A  1  591  ? 213.254 218.758 191.920 1.00   153.99 ? 983  LEU A CD2 1 
ATOM   4508  N  N   . SER A  1  592  ? 215.147 216.515 187.408 1.00   208.64 ? 984  SER A N   1 
ATOM   4509  C  CA  . SER A  1  592  ? 214.908 216.392 185.982 1.00   247.62 ? 984  SER A CA  1 
ATOM   4510  C  C   . SER A  1  592  ? 215.114 214.990 185.413 1.00   234.37 ? 984  SER A C   1 
ATOM   4511  O  O   . SER A  1  592  ? 214.958 214.831 184.197 1.00   220.46 ? 984  SER A O   1 
ATOM   4512  C  CB  . SER A  1  592  ? 215.744 217.436 185.217 1.00   281.96 ? 984  SER A CB  1 
ATOM   4513  O  OG  . SER A  1  592  ? 215.117 218.713 185.250 1.00   262.64 ? 984  SER A OG  1 
ATOM   4514  N  N   . ALA A  1  593  ? 215.408 213.976 186.244 1.00   242.92 ? 985  ALA A N   1 
ATOM   4515  C  CA  . ALA A  1  593  ? 215.557 212.586 185.730 1.00   256.89 ? 985  ALA A CA  1 
ATOM   4516  C  C   . ALA A  1  593  ? 214.346 212.122 184.881 1.00   301.04 ? 985  ALA A C   1 
ATOM   4517  O  O   . ALA A  1  593  ? 214.531 211.423 183.887 1.00   315.49 ? 985  ALA A O   1 
ATOM   4518  C  CB  . ALA A  1  593  ? 215.874 211.569 186.837 1.00   196.93 ? 985  ALA A CB  1 
ATOM   4519  N  N   . ALA A  1  594  ? 213.134 212.533 185.277 1.00   305.45 ? 986  ALA A N   1 
ATOM   4520  C  CA  . ALA A  1  594  ? 211.902 212.469 184.438 1.00   264.85 ? 986  ALA A CA  1 
ATOM   4521  C  C   . ALA A  1  594  ? 211.603 211.119 183.776 1.00   240.92 ? 986  ALA A C   1 
ATOM   4522  O  O   . ALA A  1  594  ? 211.968 210.067 184.297 1.00   219.11 ? 986  ALA A O   1 
ATOM   4523  C  CB  . ALA A  1  594  ? 211.919 213.582 183.385 1.00   230.17 ? 986  ALA A CB  1 
ATOM   4524  N  N   . ASP A  1  595  ? 205.333 177.794 186.737 1.00   219.66 ? 1013 ASP A N   1 
ATOM   4525  C  CA  . ASP A  1  595  ? 204.948 176.861 187.795 1.00   212.55 ? 1013 ASP A CA  1 
ATOM   4526  C  C   . ASP A  1  595  ? 204.468 177.689 188.987 1.00   196.99 ? 1013 ASP A C   1 
ATOM   4527  O  O   . ASP A  1  595  ? 205.182 178.555 189.485 1.00   185.42 ? 1013 ASP A O   1 
ATOM   4528  C  CB  . ASP A  1  595  ? 206.153 175.953 188.182 1.00   217.67 ? 1013 ASP A CB  1 
ATOM   4529  C  CG  . ASP A  1  595  ? 205.742 174.650 188.899 1.00   203.80 ? 1013 ASP A CG  1 
ATOM   4530  O  OD1 . ASP A  1  595  ? 204.533 174.317 188.919 1.00   215.64 ? 1013 ASP A OD1 1 
ATOM   4531  O  OD2 . ASP A  1  595  ? 206.644 173.951 189.432 1.00   137.20 ? 1013 ASP A OD2 1 
ATOM   4532  N  N   . ASP A  1  596  ? 203.243 177.440 189.420 1.00   177.26 ? 1014 ASP A N   1 
ATOM   4533  C  CA  . ASP A  1  596  ? 202.641 178.191 190.526 1.00   177.50 ? 1014 ASP A CA  1 
ATOM   4534  C  C   . ASP A  1  596  ? 202.091 179.610 190.180 1.00   175.41 ? 1014 ASP A C   1 
ATOM   4535  O  O   . ASP A  1  596  ? 201.256 180.126 190.907 1.00   194.27 ? 1014 ASP A O   1 
ATOM   4536  C  CB  . ASP A  1  596  ? 203.616 178.308 191.733 1.00   185.01 ? 1014 ASP A CB  1 
ATOM   4537  C  CG  . ASP A  1  596  ? 202.912 178.719 193.014 1.00   241.88 ? 1014 ASP A CG  1 
ATOM   4538  O  OD1 . ASP A  1  596  ? 201.695 178.431 193.119 1.00   326.71 ? 1014 ASP A OD1 1 
ATOM   4539  O  OD2 . ASP A  1  596  ? 203.558 179.343 193.892 1.00   211.86 ? 1014 ASP A OD2 1 
ATOM   4540  N  N   . GLY A  1  597  ? 202.521 180.250 189.087 1.00   178.43 ? 1015 GLY A N   1 
ATOM   4541  C  CA  . GLY A  1  597  ? 202.352 181.700 188.936 1.00   135.43 ? 1015 GLY A CA  1 
ATOM   4542  C  C   . GLY A  1  597  ? 203.361 182.251 189.903 1.00   139.95 ? 1015 GLY A C   1 
ATOM   4543  O  O   . GLY A  1  597  ? 204.171 181.508 190.437 1.00   177.64 ? 1015 GLY A O   1 
ATOM   4544  N  N   . MET A  1  598  ? 203.339 183.540 190.148 1.00   145.80 ? 1016 MET A N   1 
ATOM   4545  C  CA  . MET A  1  598  ? 204.051 184.106 191.297 1.00   157.31 ? 1016 MET A CA  1 
ATOM   4546  C  C   . MET A  1  598  ? 205.579 184.205 191.171 1.00   168.31 ? 1016 MET A C   1 
ATOM   4547  O  O   . MET A  1  598  ? 206.257 184.655 192.096 1.00   199.28 ? 1016 MET A O   1 
ATOM   4548  C  CB  . MET A  1  598  ? 203.667 183.345 192.579 1.00   151.68 ? 1016 MET A CB  1 
ATOM   4549  C  CG  . MET A  1  598  ? 202.231 182.836 192.604 1.00   147.29 ? 1016 MET A CG  1 
ATOM   4550  S  SD  . MET A  1  598  ? 201.410 182.985 194.196 1.00   165.14 ? 1016 MET A SD  1 
ATOM   4551  C  CE  . MET A  1  598  ? 200.737 181.337 194.371 1.00   159.48 ? 1016 MET A CE  1 
ATOM   4552  N  N   . ASN A  1  599  ? 206.122 183.823 190.026 1.00   175.73 ? 1017 ASN A N   1 
ATOM   4553  C  CA  . ASN A  1  599  ? 207.550 183.851 189.867 1.00   185.35 ? 1017 ASN A CA  1 
ATOM   4554  C  C   . ASN A  1  599  ? 208.067 185.239 189.571 1.00   193.04 ? 1017 ASN A C   1 
ATOM   4555  O  O   . ASN A  1  599  ? 209.106 185.601 190.107 1.00   232.49 ? 1017 ASN A O   1 
ATOM   4556  C  CB  . ASN A  1  599  ? 207.984 182.843 188.816 1.00   205.37 ? 1017 ASN A CB  1 
ATOM   4557  C  CG  . ASN A  1  599  ? 207.893 181.424 189.325 1.00   205.78 ? 1017 ASN A CG  1 
ATOM   4558  O  OD1 . ASN A  1  599  ? 208.129 181.173 190.514 1.00   179.10 ? 1017 ASN A OD1 1 
ATOM   4559  N  ND2 . ASN A  1  599  ? 207.543 180.484 188.438 1.00   229.60 ? 1017 ASN A ND2 1 
ATOM   4560  N  N   . ASP A  1  600  ? 207.375 186.009 188.737 1.00   180.01 ? 1018 ASP A N   1 
ATOM   4561  C  CA  . ASP A  1  600  ? 207.738 187.408 188.561 1.00   212.37 ? 1018 ASP A CA  1 
ATOM   4562  C  C   . ASP A  1  600  ? 206.941 188.262 189.522 1.00   197.30 ? 1018 ASP A C   1 
ATOM   4563  O  O   . ASP A  1  600  ? 205.769 188.560 189.279 1.00   222.48 ? 1018 ASP A O   1 
ATOM   4564  C  CB  . ASP A  1  600  ? 207.512 187.875 187.121 1.00   274.39 ? 1018 ASP A CB  1 
ATOM   4565  C  CG  . ASP A  1  600  ? 208.020 189.314 186.873 1.00   324.89 ? 1018 ASP A CG  1 
ATOM   4566  O  OD1 . ASP A  1  600  ? 207.907 190.185 187.773 1.00   326.59 ? 1018 ASP A OD1 1 
ATOM   4567  O  OD2 . ASP A  1  600  ? 208.528 189.574 185.761 1.00   390.11 ? 1018 ASP A OD2 1 
ATOM   4568  N  N   . MET A  1  601  ? 207.587 188.672 190.604 1.00   175.57 ? 1019 MET A N   1 
ATOM   4569  C  CA  . MET A  1  601  ? 206.953 189.559 191.549 1.00   183.81 ? 1019 MET A CA  1 
ATOM   4570  C  C   . MET A  1  601  ? 207.684 190.887 191.798 1.00   190.30 ? 1019 MET A C   1 
ATOM   4571  O  O   . MET A  1  601  ? 207.136 191.744 192.484 1.00   187.19 ? 1019 MET A O   1 
ATOM   4572  C  CB  . MET A  1  601  ? 206.744 188.832 192.882 1.00   202.75 ? 1019 MET A CB  1 
ATOM   4573  C  CG  . MET A  1  601  ? 205.858 187.581 192.844 1.00   192.02 ? 1019 MET A CG  1 
ATOM   4574  S  SD  . MET A  1  601  ? 204.030 187.656 192.785 1.00   166.08 ? 1019 MET A SD  1 
ATOM   4575  C  CE  . MET A  1  601  ? 203.450 189.330 193.170 1.00   155.08 ? 1019 MET A CE  1 
ATOM   4576  N  N   . ASN A  1  602  ? 208.882 191.095 191.250 1.00   204.78 ? 1020 ASN A N   1 
ATOM   4577  C  CA  . ASN A  1  602  ? 209.685 192.296 191.582 1.00   199.87 ? 1020 ASN A CA  1 
ATOM   4578  C  C   . ASN A  1  602  ? 209.940 192.378 193.089 1.00   184.90 ? 1020 ASN A C   1 
ATOM   4579  O  O   . ASN A  1  602  ? 209.607 193.367 193.762 1.00   158.08 ? 1020 ASN A O   1 
ATOM   4580  C  CB  . ASN A  1  602  ? 209.019 193.582 191.053 1.00   214.10 ? 1020 ASN A CB  1 
ATOM   4581  C  CG  . ASN A  1  602  ? 209.841 194.831 191.327 1.00   226.63 ? 1020 ASN A CG  1 
ATOM   4582  O  OD1 . ASN A  1  602  ? 211.048 194.751 191.568 1.00   227.39 ? 1020 ASN A OD1 1 
ATOM   4583  N  ND2 . ASN A  1  602  ? 209.180 195.997 191.306 1.00   241.84 ? 1020 ASN A ND2 1 
ATOM   4584  N  N   . HIS A  1  603  ? 210.520 191.298 193.599 1.00   181.42 ? 1021 HIS A N   1 
ATOM   4585  C  CA  . HIS A  1  603  ? 210.684 191.112 195.028 1.00   160.11 ? 1021 HIS A CA  1 
ATOM   4586  C  C   . HIS A  1  603  ? 211.441 192.217 195.707 1.00   163.06 ? 1021 HIS A C   1 
ATOM   4587  O  O   . HIS A  1  603  ? 211.147 192.496 196.853 1.00   197.40 ? 1021 HIS A O   1 
ATOM   4588  C  CB  . HIS A  1  603  ? 211.327 189.768 195.347 1.00   163.17 ? 1021 HIS A CB  1 
ATOM   4589  C  CG  . HIS A  1  603  ? 210.350 188.633 195.339 1.00   209.23 ? 1021 HIS A CG  1 
ATOM   4590  N  ND1 . HIS A  1  603  ? 210.104 187.865 194.221 1.00   230.06 ? 1021 HIS A ND1 1 
ATOM   4591  C  CD2 . HIS A  1  603  ? 209.538 188.150 196.310 1.00   240.18 ? 1021 HIS A CD2 1 
ATOM   4592  C  CE1 . HIS A  1  603  ? 209.201 186.943 194.509 1.00   237.86 ? 1021 HIS A CE1 1 
ATOM   4593  N  NE2 . HIS A  1  603  ? 208.836 187.099 195.767 1.00   244.04 ? 1021 HIS A NE2 1 
ATOM   4594  N  N   . GLU A  1  604  ? 212.381 192.855 195.005 1.00   171.25 ? 1022 GLU A N   1 
ATOM   4595  C  CA  . GLU A  1  604  ? 213.121 194.033 195.507 1.00   177.84 ? 1022 GLU A CA  1 
ATOM   4596  C  C   . GLU A  1  604  ? 212.215 195.019 196.204 1.00   157.38 ? 1022 GLU A C   1 
ATOM   4597  O  O   . GLU A  1  604  ? 212.444 195.360 197.361 1.00   189.03 ? 1022 GLU A O   1 
ATOM   4598  C  CB  . GLU A  1  604  ? 213.818 194.782 194.361 1.00   225.84 ? 1022 GLU A CB  1 
ATOM   4599  C  CG  . GLU A  1  604  ? 215.001 194.062 193.710 1.00   298.86 ? 1022 GLU A CG  1 
ATOM   4600  C  CD  . GLU A  1  604  ? 215.529 194.781 192.468 1.00   345.40 ? 1022 GLU A CD  1 
ATOM   4601  O  OE1 . GLU A  1  604  ? 215.497 196.035 192.430 1.00   392.18 ? 1022 GLU A OE1 1 
ATOM   4602  O  OE2 . GLU A  1  604  ? 215.990 194.089 191.526 1.00   337.83 ? 1022 GLU A OE2 1 
ATOM   4603  N  N   . VAL A  1  605  ? 211.189 195.476 195.485 1.00   170.31 ? 1023 VAL A N   1 
ATOM   4604  C  CA  . VAL A  1  605  ? 210.231 196.452 196.049 1.00   154.28 ? 1023 VAL A CA  1 
ATOM   4605  C  C   . VAL A  1  605  ? 209.260 195.779 196.981 1.00   138.93 ? 1023 VAL A C   1 
ATOM   4606  O  O   . VAL A  1  605  ? 208.942 196.322 198.014 1.00   170.96 ? 1023 VAL A O   1 
ATOM   4607  C  CB  . VAL A  1  605  ? 209.371 197.207 195.018 1.00   145.68 ? 1023 VAL A CB  1 
ATOM   4608  C  CG1 . VAL A  1  605  ? 208.446 198.176 195.729 1.00   127.82 ? 1023 VAL A CG1 1 
ATOM   4609  C  CG2 . VAL A  1  605  ? 210.245 197.966 194.031 1.00   163.88 ? 1023 VAL A CG2 1 
ATOM   4610  N  N   . MET A  1  606  ? 208.762 194.620 196.607 1.00   134.68 ? 1024 MET A N   1 
ATOM   4611  C  CA  . MET A  1  606  ? 207.913 193.862 197.505 1.00   133.75 ? 1024 MET A CA  1 
ATOM   4612  C  C   . MET A  1  606  ? 208.586 193.543 198.834 1.00   142.10 ? 1024 MET A C   1 
ATOM   4613  O  O   . MET A  1  606  ? 207.921 193.499 199.835 1.00   166.06 ? 1024 MET A O   1 
ATOM   4614  C  CB  . MET A  1  606  ? 207.485 192.556 196.859 1.00   158.23 ? 1024 MET A CB  1 
ATOM   4615  C  CG  . MET A  1  606  ? 206.188 192.037 197.416 1.00   165.23 ? 1024 MET A CG  1 
ATOM   4616  S  SD  . MET A  1  606  ? 205.324 190.904 196.305 1.00   163.20 ? 1024 MET A SD  1 
ATOM   4617  C  CE  . MET A  1  606  ? 206.444 189.501 196.368 1.00   193.99 ? 1024 MET A CE  1 
ATOM   4618  N  N   . SER A  1  607  ? 209.895 193.316 198.846 1.00   159.47 ? 1025 SER A N   1 
ATOM   4619  C  CA  . SER A  1  607  ? 210.623 193.062 200.084 1.00   158.02 ? 1025 SER A CA  1 
ATOM   4620  C  C   . SER A  1  607  ? 210.924 194.332 200.897 1.00   133.46 ? 1025 SER A C   1 
ATOM   4621  O  O   . SER A  1  607  ? 211.065 194.271 202.098 1.00   159.22 ? 1025 SER A O   1 
ATOM   4622  C  CB  . SER A  1  607  ? 211.900 192.295 199.802 1.00   172.50 ? 1025 SER A CB  1 
ATOM   4623  O  OG  . SER A  1  607  ? 212.393 191.746 201.000 1.00   211.34 ? 1025 SER A OG  1 
ATOM   4624  N  N   . LEU A  1  608  ? 211.016 195.480 200.264 1.00   125.73 ? 1026 LEU A N   1 
ATOM   4625  C  CA  . LEU A  1  608  ? 210.953 196.756 200.997 1.00   138.87 ? 1026 LEU A CA  1 
ATOM   4626  C  C   . LEU A  1  608  ? 209.639 197.007 201.726 1.00   138.65 ? 1026 LEU A C   1 
ATOM   4627  O  O   . LEU A  1  608  ? 209.659 197.505 202.827 1.00   180.13 ? 1026 LEU A O   1 
ATOM   4628  C  CB  . LEU A  1  608  ? 211.200 197.955 200.071 1.00   144.26 ? 1026 LEU A CB  1 
ATOM   4629  C  CG  . LEU A  1  608  ? 212.621 198.519 200.047 1.00   153.05 ? 1026 LEU A CG  1 
ATOM   4630  C  CD1 . LEU A  1  608  ? 213.709 197.452 200.210 1.00   171.18 ? 1026 LEU A CD1 1 
ATOM   4631  C  CD2 . LEU A  1  608  ? 212.794 199.299 198.749 1.00   159.29 ? 1026 LEU A CD2 1 
ATOM   4632  N  N   . ILE A  1  609  ? 208.505 196.716 201.109 1.00   128.13 ? 1027 ILE A N   1 
ATOM   4633  C  CA  . ILE A  1  609  ? 207.206 196.896 201.772 1.00   126.39 ? 1027 ILE A CA  1 
ATOM   4634  C  C   . ILE A  1  609  ? 207.084 195.955 203.002 1.00   135.93 ? 1027 ILE A C   1 
ATOM   4635  O  O   . ILE A  1  609  ? 206.590 196.358 204.055 1.00   163.15 ? 1027 ILE A O   1 
ATOM   4636  C  CB  . ILE A  1  609  ? 206.041 196.626 200.815 1.00   134.86 ? 1027 ILE A CB  1 
ATOM   4637  C  CG1 . ILE A  1  609  ? 206.081 197.579 199.626 1.00   158.87 ? 1027 ILE A CG1 1 
ATOM   4638  C  CG2 . ILE A  1  609  ? 204.702 196.833 201.496 1.00   161.80 ? 1027 ILE A CG2 1 
ATOM   4639  C  CD1 . ILE A  1  609  ? 205.077 197.235 198.537 1.00   171.55 ? 1027 ILE A CD1 1 
ATOM   4640  N  N   . TRP A  1  610  ? 207.545 194.715 202.886 1.00   129.77 ? 1028 TRP A N   1 
ATOM   4641  C  CA  . TRP A  1  610  ? 207.494 193.773 204.013 1.00   145.18 ? 1028 TRP A CA  1 
ATOM   4642  C  C   . TRP A  1  610  ? 208.864 193.185 204.339 1.00   173.75 ? 1028 TRP A C   1 
ATOM   4643  O  O   . TRP A  1  610  ? 209.156 192.031 203.986 1.00   211.96 ? 1028 TRP A O   1 
ATOM   4644  C  CB  . TRP A  1  610  ? 206.444 192.650 203.768 1.00   144.07 ? 1028 TRP A CB  1 
ATOM   4645  C  CG  . TRP A  1  610  ? 205.178 193.241 203.367 1.00   131.34 ? 1028 TRP A CG  1 
ATOM   4646  C  CD1 . TRP A  1  610  ? 204.450 194.099 204.087 1.00   148.13 ? 1028 TRP A CD1 1 
ATOM   4647  C  CD2 . TRP A  1  610  ? 204.531 193.124 202.108 1.00   120.25 ? 1028 TRP A CD2 1 
ATOM   4648  N  NE1 . TRP A  1  610  ? 203.359 194.516 203.376 1.00   155.12 ? 1028 TRP A NE1 1 
ATOM   4649  C  CE2 . TRP A  1  610  ? 203.398 193.927 202.144 1.00   141.64 ? 1028 TRP A CE2 1 
ATOM   4650  C  CE3 . TRP A  1  610  ? 204.798 192.423 200.953 1.00   132.22 ? 1028 TRP A CE3 1 
ATOM   4651  C  CZ2 . TRP A  1  610  ? 202.529 194.044 201.059 1.00   153.16 ? 1028 TRP A CZ2 1 
ATOM   4652  C  CZ3 . TRP A  1  610  ? 203.932 192.556 199.875 1.00   126.58 ? 1028 TRP A CZ3 1 
ATOM   4653  C  CH2 . TRP A  1  610  ? 202.827 193.346 199.934 1.00   117.84 ? 1028 TRP A CH2 1 
ATOM   4654  N  N   . SER A  1  611  ? 209.707 193.965 205.017 1.00   163.85 ? 1029 SER A N   1 
ATOM   4655  C  CA  . SER A  1  611  ? 210.827 193.359 205.739 1.00   173.09 ? 1029 SER A CA  1 
ATOM   4656  C  C   . SER A  1  611  ? 210.241 192.910 207.082 1.00   203.83 ? 1029 SER A C   1 
ATOM   4657  O  O   . SER A  1  611  ? 209.018 192.776 207.214 1.00   241.33 ? 1029 SER A O   1 
ATOM   4658  C  CB  . SER A  1  611  ? 211.965 194.331 205.929 1.00   172.14 ? 1029 SER A CB  1 
ATOM   4659  O  OG  . SER A  1  611  ? 211.713 195.136 207.055 1.00   193.31 ? 1029 SER A OG  1 
ATOM   4660  N  N   . GLU A  1  612  ? 211.089 192.699 208.084 1.00   212.95 ? 1030 GLU A N   1 
ATOM   4661  C  CA  . GLU A  1  612  ? 210.665 192.115 209.361 1.00   199.20 ? 1030 GLU A CA  1 
ATOM   4662  C  C   . GLU A  1  612  ? 210.299 190.656 208.987 1.00   188.56 ? 1030 GLU A C   1 
ATOM   4663  O  O   . GLU A  1  612  ? 211.178 189.944 208.472 1.00   194.14 ? 1030 GLU A O   1 
ATOM   4664  C  CB  . GLU A  1  612  ? 209.603 193.007 210.102 1.00   206.34 ? 1030 GLU A CB  1 
ATOM   4665  C  CG  . GLU A  1  612  ? 209.921 194.548 210.072 1.00   249.82 ? 1030 GLU A CG  1 
ATOM   4666  C  CD  . GLU A  1  612  ? 209.148 195.474 211.079 1.00   272.90 ? 1030 GLU A CD  1 
ATOM   4667  O  OE1 . GLU A  1  612  ? 208.562 194.924 212.039 1.00   324.89 ? 1030 GLU A OE1 1 
ATOM   4668  O  OE2 . GLU A  1  612  ? 209.121 196.764 210.945 1.00   180.52 ? 1030 GLU A OE2 1 
ATOM   4669  N  N   . ASP A  1  613  ? 209.061 190.213 209.174 1.00   192.56 ? 1031 ASP A N   1 
ATOM   4670  C  CA  . ASP A  1  613  ? 208.660 188.871 208.697 1.00   215.46 ? 1031 ASP A CA  1 
ATOM   4671  C  C   . ASP A  1  613  ? 208.634 188.715 207.184 1.00   173.78 ? 1031 ASP A C   1 
ATOM   4672  O  O   . ASP A  1  613  ? 208.229 189.638 206.494 1.00   217.75 ? 1031 ASP A O   1 
ATOM   4673  C  CB  . ASP A  1  613  ? 207.258 188.535 209.177 1.00   271.11 ? 1031 ASP A CB  1 
ATOM   4674  C  CG  . ASP A  1  613  ? 206.705 187.295 208.497 1.00   290.14 ? 1031 ASP A CG  1 
ATOM   4675  O  OD1 . ASP A  1  613  ? 207.318 186.223 208.664 1.00   328.34 ? 1031 ASP A OD1 1 
ATOM   4676  O  OD2 . ASP A  1  613  ? 205.682 187.399 207.793 1.00   283.13 ? 1031 ASP A OD2 1 
ATOM   4677  N  N   . LEU A  1  614  ? 208.995 187.526 206.690 1.00   146.89 ? 1032 LEU A N   1 
ATOM   4678  C  CA  . LEU A  1  614  ? 208.834 187.209 205.249 1.00   167.59 ? 1032 LEU A CA  1 
ATOM   4679  C  C   . LEU A  1  614  ? 207.414 186.707 204.922 1.00   155.17 ? 1032 LEU A C   1 
ATOM   4680  O  O   . LEU A  1  614  ? 207.165 185.511 204.755 1.00   151.37 ? 1032 LEU A O   1 
ATOM   4681  C  CB  . LEU A  1  614  ? 209.939 186.283 204.713 1.00   184.55 ? 1032 LEU A CB  1 
ATOM   4682  C  CG  . LEU A  1  614  ? 209.982 184.773 204.956 1.00   203.64 ? 1032 LEU A CG  1 
ATOM   4683  C  CD1 . LEU A  1  614  ? 211.010 184.139 204.020 1.00   222.28 ? 1032 LEU A CD1 1 
ATOM   4684  C  CD2 . LEU A  1  614  ? 210.258 184.454 206.421 1.00   202.06 ? 1032 LEU A CD2 1 
ATOM   4685  N  N   . ARG A  1  615  ? 206.499 187.671 204.832 1.00   153.72 ? 1033 ARG A N   1 
ATOM   4686  C  CA  . ARG A  1  615  ? 205.051 187.429 204.715 1.00   139.86 ? 1033 ARG A CA  1 
ATOM   4687  C  C   . ARG A  1  615  ? 204.692 186.778 203.411 1.00   151.63 ? 1033 ARG A C   1 
ATOM   4688  O  O   . ARG A  1  615  ? 203.917 185.801 203.367 1.00   144.52 ? 1033 ARG A O   1 
ATOM   4689  C  CB  . ARG A  1  615  ? 204.277 188.745 204.755 1.00   131.86 ? 1033 ARG A CB  1 
ATOM   4690  C  CG  . ARG A  1  615  ? 204.343 189.473 206.055 1.00   129.66 ? 1033 ARG A CG  1 
ATOM   4691  C  CD  . ARG A  1  615  ? 203.797 190.850 205.885 1.00   122.10 ? 1033 ARG A CD  1 
ATOM   4692  N  NE  . ARG A  1  615  ? 203.801 191.466 207.187 1.00   154.48 ? 1033 ARG A NE  1 
ATOM   4693  C  CZ  . ARG A  1  615  ? 203.139 192.573 207.493 1.00   228.82 ? 1033 ARG A CZ  1 
ATOM   4694  N  NH1 . ARG A  1  615  ? 202.431 193.222 206.570 1.00   277.90 ? 1033 ARG A NH1 1 
ATOM   4695  N  NH2 . ARG A  1  615  ? 203.201 193.054 208.734 1.00   255.14 ? 1033 ARG A NH2 1 
ATOM   4696  N  N   . VAL A  1  616  ? 205.225 187.374 202.350 1.00   148.75 ? 1034 VAL A N   1 
ATOM   4697  C  CA  . VAL A  1  616  ? 204.869 186.963 201.016 1.00   144.15 ? 1034 VAL A CA  1 
ATOM   4698  C  C   . VAL A  1  616  ? 205.276 185.553 200.723 1.00   146.09 ? 1034 VAL A C   1 
ATOM   4699  O  O   . VAL A  1  616  ? 204.541 184.855 200.050 1.00   151.59 ? 1034 VAL A O   1 
ATOM   4700  C  CB  . VAL A  1  616  ? 205.419 187.886 199.947 1.00   150.53 ? 1034 VAL A CB  1 
ATOM   4701  C  CG1 . VAL A  1  616  ? 204.555 189.129 199.917 1.00   162.82 ? 1034 VAL A CG1 1 
ATOM   4702  C  CG2 . VAL A  1  616  ? 206.899 188.202 200.179 1.00   164.24 ? 1034 VAL A CG2 1 
ATOM   4703  N  N   . GLN A  1  617  ? 206.411 185.107 201.245 1.00   156.37 ? 1035 GLN A N   1 
ATOM   4704  C  CA  . GLN A  1  617  ? 206.747 183.695 201.108 1.00   173.50 ? 1035 GLN A CA  1 
ATOM   4705  C  C   . GLN A  1  617  ? 205.609 182.806 201.676 1.00   163.55 ? 1035 GLN A C   1 
ATOM   4706  O  O   . GLN A  1  617  ? 205.220 181.838 201.035 1.00   171.24 ? 1035 GLN A O   1 
ATOM   4707  C  CB  . GLN A  1  617  ? 208.136 183.393 201.712 1.00   206.03 ? 1035 GLN A CB  1 
ATOM   4708  C  CG  . GLN A  1  617  ? 208.514 181.919 201.860 1.00   231.39 ? 1035 GLN A CG  1 
ATOM   4709  C  CD  . GLN A  1  617  ? 208.081 181.052 200.683 1.00   254.65 ? 1035 GLN A CD  1 
ATOM   4710  O  OE1 . GLN A  1  617  ? 208.196 181.449 199.521 1.00   236.79 ? 1035 GLN A OE1 1 
ATOM   4711  N  NE2 . GLN A  1  617  ? 207.550 179.866 200.992 1.00   282.24 ? 1035 GLN A NE2 1 
ATOM   4712  N  N   . ASP A  1  618  ? 205.037 183.178 202.825 1.00   174.57 ? 1036 ASP A N   1 
ATOM   4713  C  CA  . ASP A  1  618  ? 203.936 182.410 203.421 1.00   172.36 ? 1036 ASP A CA  1 
ATOM   4714  C  C   . ASP A  1  618  ? 202.661 182.506 202.626 1.00   144.87 ? 1036 ASP A C   1 
ATOM   4715  O  O   . ASP A  1  618  ? 201.982 181.515 202.447 1.00   152.92 ? 1036 ASP A O   1 
ATOM   4716  C  CB  . ASP A  1  618  ? 203.656 182.847 204.846 1.00   219.52 ? 1036 ASP A CB  1 
ATOM   4717  C  CG  . ASP A  1  618  ? 204.838 182.613 205.758 1.00   295.20 ? 1036 ASP A CG  1 
ATOM   4718  O  OD1 . ASP A  1  618  ? 205.549 181.589 205.592 1.00   305.07 ? 1036 ASP A OD1 1 
ATOM   4719  O  OD2 . ASP A  1  618  ? 205.054 183.468 206.640 1.00   368.63 ? 1036 ASP A OD2 1 
ATOM   4720  N  N   . VAL A  1  619  ? 202.333 183.691 202.144 1.00   131.55 ? 1037 VAL A N   1 
ATOM   4721  C  CA  . VAL A  1  619  ? 201.182 183.846 201.247 1.00   125.15 ? 1037 VAL A CA  1 
ATOM   4722  C  C   . VAL A  1  619  ? 201.313 183.016 199.960 1.00   122.07 ? 1037 VAL A C   1 
ATOM   4723  O  O   . VAL A  1  619  ? 200.381 182.312 199.618 1.00   128.29 ? 1037 VAL A O   1 
ATOM   4724  C  CB  . VAL A  1  619  ? 200.953 185.322 200.900 1.00   139.38 ? 1037 VAL A CB  1 
ATOM   4725  C  CG1 . VAL A  1  619  ? 199.959 185.487 199.740 1.00   150.03 ? 1037 VAL A CG1 1 
ATOM   4726  C  CG2 . VAL A  1  619  ? 200.502 186.070 202.142 1.00   130.02 ? 1037 VAL A CG2 1 
ATOM   4727  N  N   . ARG A  1  620  ? 202.456 183.084 199.265 1.00   121.82 ? 1038 ARG A N   1 
ATOM   4728  C  CA  . ARG A  1  620  ? 202.687 182.227 198.083 1.00   119.84 ? 1038 ARG A CA  1 
ATOM   4729  C  C   . ARG A  1  620  ? 202.477 180.748 198.394 1.00   130.54 ? 1038 ARG A C   1 
ATOM   4730  O  O   . ARG A  1  620  ? 202.115 180.017 197.527 1.00   152.12 ? 1038 ARG A O   1 
ATOM   4731  C  CB  . ARG A  1  620  ? 204.072 182.408 197.477 1.00   127.89 ? 1038 ARG A CB  1 
ATOM   4732  C  CG  . ARG A  1  620  ? 204.291 183.761 196.789 1.00   179.37 ? 1038 ARG A CG  1 
ATOM   4733  C  CD  . ARG A  1  620  ? 205.733 184.030 196.310 1.00   197.50 ? 1038 ARG A CD  1 
ATOM   4734  N  NE  . ARG A  1  620  ? 206.094 183.256 195.116 1.00   197.97 ? 1038 ARG A NE  1 
ATOM   4735  C  CZ  . ARG A  1  620  ? 206.571 182.006 195.095 1.00   190.23 ? 1038 ARG A CZ  1 
ATOM   4736  N  NH1 . ARG A  1  620  ? 206.793 181.306 196.212 1.00   195.29 ? 1038 ARG A NH1 1 
ATOM   4737  N  NH2 . ARG A  1  620  ? 206.847 181.447 193.922 1.00   192.11 ? 1038 ARG A NH2 1 
ATOM   4738  N  N   . ARG A  1  621  ? 202.704 180.314 199.626 1.00   151.17 ? 1039 ARG A N   1 
ATOM   4739  C  CA  . ARG A  1  621  ? 202.372 178.952 200.041 1.00   148.16 ? 1039 ARG A CA  1 
ATOM   4740  C  C   . ARG A  1  621  ? 200.856 178.799 200.253 1.00   130.71 ? 1039 ARG A C   1 
ATOM   4741  O  O   . ARG A  1  621  ? 200.282 177.784 199.881 1.00   150.97 ? 1039 ARG A O   1 
ATOM   4742  C  CB  . ARG A  1  621  ? 203.145 178.602 201.306 1.00   177.13 ? 1039 ARG A CB  1 
ATOM   4743  C  CG  . ARG A  1  621  ? 203.140 177.142 201.714 1.00   199.40 ? 1039 ARG A CG  1 
ATOM   4744  C  CD  . ARG A  1  621  ? 204.095 176.971 202.886 1.00   240.30 ? 1039 ARG A CD  1 
ATOM   4745  N  NE  . ARG A  1  621  ? 205.505 176.942 202.464 1.00   273.74 ? 1039 ARG A NE  1 
ATOM   4746  C  CZ  . ARG A  1  621  ? 206.551 177.453 203.131 1.00   280.94 ? 1039 ARG A CZ  1 
ATOM   4747  N  NH1 . ARG A  1  621  ? 206.408 178.110 204.285 1.00   272.95 ? 1039 ARG A NH1 1 
ATOM   4748  N  NH2 . ARG A  1  621  ? 207.775 177.318 202.616 1.00   264.82 ? 1039 ARG A NH2 1 
ATOM   4749  N  N   . LEU A  1  622  ? 200.194 179.795 200.843 1.00   118.55 ? 1040 LEU A N   1 
ATOM   4750  C  CA  . LEU A  1  622  ? 198.727 179.695 201.070 1.00   129.84 ? 1040 LEU A CA  1 
ATOM   4751  C  C   . LEU A  1  622  ? 197.974 179.609 199.778 1.00   132.69 ? 1040 LEU A C   1 
ATOM   4752  O  O   . LEU A  1  622  ? 196.969 178.963 199.757 1.00   146.75 ? 1040 LEU A O   1 
ATOM   4753  C  CB  . LEU A  1  622  ? 198.113 180.885 201.828 1.00   120.71 ? 1040 LEU A CB  1 
ATOM   4754  C  CG  . LEU A  1  622  ? 198.118 180.978 203.358 1.00   145.44 ? 1040 LEU A CG  1 
ATOM   4755  C  CD1 . LEU A  1  622  ? 199.474 180.788 204.046 1.00   157.22 ? 1040 LEU A CD1 1 
ATOM   4756  C  CD2 . LEU A  1  622  ? 197.550 182.325 203.775 1.00   144.03 ? 1040 LEU A CD2 1 
ATOM   4757  N  N   . LEU A  1  623  ? 198.424 180.286 198.723 1.00   126.97 ? 1041 LEU A N   1 
ATOM   4758  C  CA  . LEU A  1  623  ? 197.601 180.459 197.517 1.00   112.20 ? 1041 LEU A CA  1 
ATOM   4759  C  C   . LEU A  1  623  ? 197.999 179.537 196.436 1.00   129.36 ? 1041 LEU A C   1 
ATOM   4760  O  O   . LEU A  1  623  ? 197.356 179.572 195.385 1.00   156.47 ? 1041 LEU A O   1 
ATOM   4761  C  CB  . LEU A  1  623  ? 197.771 181.863 196.953 1.00   104.99 ? 1041 LEU A CB  1 
ATOM   4762  C  CG  . LEU A  1  623  ? 197.074 182.908 197.793 1.00   121.69 ? 1041 LEU A CG  1 
ATOM   4763  C  CD1 . LEU A  1  623  ? 197.575 184.341 197.510 1.00   115.23 ? 1041 LEU A CD1 1 
ATOM   4764  C  CD2 . LEU A  1  623  ? 195.569 182.685 197.584 1.00   124.14 ? 1041 LEU A CD2 1 
ATOM   4765  N  N   . GLN A  1  624  ? 199.063 178.753 196.635 1.00   130.46 ? 1042 GLN A N   1 
ATOM   4766  C  CA  . GLN A  1  624  ? 199.695 178.101 195.485 1.00   143.11 ? 1042 GLN A CA  1 
ATOM   4767  C  C   . GLN A  1  624  ? 198.790 177.028 195.054 1.00   136.00 ? 1042 GLN A C   1 
ATOM   4768  O  O   . GLN A  1  624  ? 198.394 176.251 195.888 1.00   140.30 ? 1042 GLN A O   1 
ATOM   4769  C  CB  . GLN A  1  624  ? 201.122 177.593 195.744 1.00   178.13 ? 1042 GLN A CB  1 
ATOM   4770  C  CG  . GLN A  1  624  ? 201.373 176.776 196.988 1.00   202.62 ? 1042 GLN A CG  1 
ATOM   4771  C  CD  . GLN A  1  624  ? 200.769 175.414 196.891 1.00   208.20 ? 1042 GLN A CD  1 
ATOM   4772  O  OE1 . GLN A  1  624  ? 200.538 174.921 195.793 1.00   173.61 ? 1042 GLN A OE1 1 
ATOM   4773  N  NE2 . GLN A  1  624  ? 200.493 174.798 198.030 1.00   274.68 ? 1042 GLN A NE2 1 
ATOM   4774  N  N   . SER A  1  625  ? 198.378 177.037 193.786 1.00   164.07 ? 1043 SER A N   1 
ATOM   4775  C  CA  . SER A  1  625  ? 197.410 176.052 193.291 1.00   174.34 ? 1043 SER A CA  1 
ATOM   4776  C  C   . SER A  1  625  ? 198.062 174.915 192.488 1.00   174.71 ? 1043 SER A C   1 
ATOM   4777  O  O   . SER A  1  625  ? 197.481 173.832 192.342 1.00   161.02 ? 1043 SER A O   1 
ATOM   4778  C  CB  . SER A  1  625  ? 196.322 176.746 192.488 1.00   178.53 ? 1043 SER A CB  1 
ATOM   4779  O  OG  . SER A  1  625  ? 195.161 175.940 192.496 1.00   164.11 ? 1043 SER A OG  1 
ATOM   4780  N  N   . ALA A  1  626  ? 199.269 175.145 191.983 1.00   154.65 ? 1044 ALA A N   1 
ATOM   4781  C  CA  . ALA A  1  626  ? 200.085 174.042 191.491 1.00   162.49 ? 1044 ALA A CA  1 
ATOM   4782  C  C   . ALA A  1  626  ? 200.566 173.169 192.666 1.00   179.78 ? 1044 ALA A C   1 
ATOM   4783  O  O   . ALA A  1  626  ? 200.310 173.469 193.818 1.00   208.54 ? 1044 ALA A O   1 
ATOM   4784  C  CB  . ALA A  1  626  ? 201.262 174.584 190.702 1.00   186.86 ? 1044 ALA A CB  1 
ATOM   4785  N  N   . HIS A  1  627  ? 201.267 172.085 192.378 1.00   178.62 ? 1045 HIS A N   1 
ATOM   4786  C  CA  . HIS A  1  627  ? 201.689 171.107 193.403 1.00   177.94 ? 1045 HIS A CA  1 
ATOM   4787  C  C   . HIS A  1  627  ? 200.525 170.286 193.802 1.00   171.94 ? 1045 HIS A C   1 
ATOM   4788  O  O   . HIS A  1  627  ? 199.398 170.608 193.433 1.00   205.76 ? 1045 HIS A O   1 
ATOM   4789  C  CB  . HIS A  1  627  ? 202.340 171.708 194.672 1.00   162.22 ? 1045 HIS A CB  1 
ATOM   4790  C  CG  . HIS A  1  627  ? 203.440 172.656 194.350 1.00   173.34 ? 1045 HIS A CG  1 
ATOM   4791  N  ND1 . HIS A  1  627  ? 203.395 173.985 194.697 1.00   181.72 ? 1045 HIS A ND1 1 
ATOM   4792  C  CD2 . HIS A  1  627  ? 204.570 172.489 193.624 1.00   172.44 ? 1045 HIS A CD2 1 
ATOM   4793  C  CE1 . HIS A  1  627  ? 204.477 174.590 194.240 1.00   192.13 ? 1045 HIS A CE1 1 
ATOM   4794  N  NE2 . HIS A  1  627  ? 205.202 173.704 193.577 1.00   197.32 ? 1045 HIS A NE2 1 
ATOM   4795  N  N   . PRO A  1  628  ? 200.786 169.196 194.530 1.00   164.15 ? 1046 PRO A N   1 
ATOM   4796  C  CA  . PRO A  1  628  ? 199.662 168.469 195.024 1.00   179.01 ? 1046 PRO A CA  1 
ATOM   4797  C  C   . PRO A  1  628  ? 199.374 168.902 196.470 1.00   193.01 ? 1046 PRO A C   1 
ATOM   4798  O  O   . PRO A  1  628  ? 200.209 169.609 197.105 1.00   160.27 ? 1046 PRO A O   1 
ATOM   4799  C  CB  . PRO A  1  628  ? 200.113 167.001 194.886 1.00   177.11 ? 1046 PRO A CB  1 
ATOM   4800  C  CG  . PRO A  1  628  ? 201.433 167.050 194.168 1.00   168.02 ? 1046 PRO A CG  1 
ATOM   4801  C  CD  . PRO A  1  628  ? 201.985 168.358 194.612 1.00   162.64 ? 1046 PRO A CD  1 
ATOM   4802  N  N   . VAL A  1  629  ? 198.171 168.529 196.924 1.00   174.34 ? 1047 VAL A N   1 
ATOM   4803  C  CA  . VAL A  1  629  ? 197.732 168.751 198.291 1.00   163.24 ? 1047 VAL A CA  1 
ATOM   4804  C  C   . VAL A  1  629  ? 198.110 167.479 198.988 1.00   181.41 ? 1047 VAL A C   1 
ATOM   4805  O  O   . VAL A  1  629  ? 197.938 166.412 198.411 1.00   188.14 ? 1047 VAL A O   1 
ATOM   4806  C  CB  . VAL A  1  629  ? 196.215 168.820 198.474 1.00   178.29 ? 1047 VAL A CB  1 
ATOM   4807  C  CG1 . VAL A  1  629  ? 195.936 169.720 199.664 1.00   208.60 ? 1047 VAL A CG1 1 
ATOM   4808  C  CG2 . VAL A  1  629  ? 195.479 169.287 197.221 1.00   196.10 ? 1047 VAL A CG2 1 
ATOM   4809  N  N   . ARG A  1  630  ? 198.620 167.570 200.211 1.00   186.09 ? 1048 ARG A N   1 
ATOM   4810  C  CA  . ARG A  1  630  ? 198.981 166.355 200.938 1.00   181.27 ? 1048 ARG A CA  1 
ATOM   4811  C  C   . ARG A  1  630  ? 197.811 165.980 201.874 1.00   164.59 ? 1048 ARG A C   1 
ATOM   4812  O  O   . ARG A  1  630  ? 197.368 166.778 202.693 1.00   180.86 ? 1048 ARG A O   1 
ATOM   4813  C  CB  . ARG A  1  630  ? 200.363 166.479 201.613 1.00   194.87 ? 1048 ARG A CB  1 
ATOM   4814  C  CG  . ARG A  1  630  ? 200.401 166.502 203.131 1.00   216.64 ? 1048 ARG A CG  1 
ATOM   4815  C  CD  . ARG A  1  630  ? 201.774 166.104 203.628 1.00   243.40 ? 1048 ARG A CD  1 
ATOM   4816  N  NE  . ARG A  1  630  ? 202.076 166.688 204.929 1.00   277.84 ? 1048 ARG A NE  1 
ATOM   4817  C  CZ  . ARG A  1  630  ? 203.229 166.534 205.583 1.00   312.57 ? 1048 ARG A CZ  1 
ATOM   4818  N  NH1 . ARG A  1  630  ? 203.398 167.124 206.764 1.00   326.81 ? 1048 ARG A NH1 1 
ATOM   4819  N  NH2 . ARG A  1  630  ? 204.213 165.792 205.074 1.00   332.71 ? 1048 ARG A NH2 1 
ATOM   4820  N  N   . VAL A  1  631  ? 197.332 164.750 201.721 1.00   152.11 ? 1049 VAL A N   1 
ATOM   4821  C  CA  . VAL A  1  631  ? 196.076 164.289 202.280 1.00   156.82 ? 1049 VAL A CA  1 
ATOM   4822  C  C   . VAL A  1  631  ? 196.408 163.138 203.213 1.00   192.72 ? 1049 VAL A C   1 
ATOM   4823  O  O   . VAL A  1  631  ? 196.670 162.021 202.753 1.00   227.70 ? 1049 VAL A O   1 
ATOM   4824  C  CB  . VAL A  1  631  ? 195.065 163.861 201.160 1.00   172.78 ? 1049 VAL A CB  1 
ATOM   4825  C  CG1 . VAL A  1  631  ? 195.683 163.030 200.022 1.00   154.93 ? 1049 VAL A CG1 1 
ATOM   4826  C  CG2 . VAL A  1  631  ? 193.884 163.119 201.756 1.00   191.39 ? 1049 VAL A CG2 1 
ATOM   4827  N  N   . ASN A  1  632  ? 196.393 163.418 204.518 1.00   226.23 ? 1050 ASN A N   1 
ATOM   4828  C  CA  . ASN A  1  632  ? 196.919 162.487 205.535 1.00   236.91 ? 1050 ASN A CA  1 
ATOM   4829  C  C   . ASN A  1  632  ? 195.806 161.999 206.457 1.00   206.63 ? 1050 ASN A C   1 
ATOM   4830  O  O   . ASN A  1  632  ? 195.147 162.794 207.129 1.00   199.10 ? 1050 ASN A O   1 
ATOM   4831  C  CB  . ASN A  1  632  ? 198.117 163.088 206.321 1.00   251.38 ? 1050 ASN A CB  1 
ATOM   4832  C  CG  . ASN A  1  632  ? 197.900 164.537 206.766 1.00   254.55 ? 1050 ASN A CG  1 
ATOM   4833  O  OD1 . ASN A  1  632  ? 196.917 165.179 206.389 1.00   270.13 ? 1050 ASN A OD1 1 
ATOM   4834  N  ND2 . ASN A  1  632  ? 198.835 165.058 207.573 1.00   221.31 ? 1050 ASN A ND2 1 
ATOM   4835  N  N   . VAL A  1  633  ? 195.600 160.685 206.450 1.00   196.37 ? 1051 VAL A N   1 
ATOM   4836  C  CA  . VAL A  1  633  ? 194.510 160.049 207.169 1.00   207.62 ? 1051 VAL A CA  1 
ATOM   4837  C  C   . VAL A  1  633  ? 195.040 158.831 207.945 1.00   230.62 ? 1051 VAL A C   1 
ATOM   4838  O  O   . VAL A  1  633  ? 195.453 157.834 207.355 1.00   240.38 ? 1051 VAL A O   1 
ATOM   4839  C  CB  . VAL A  1  633  ? 193.343 159.662 206.212 1.00   193.65 ? 1051 VAL A CB  1 
ATOM   4840  C  CG1 . VAL A  1  633  ? 192.462 160.875 205.944 1.00   194.92 ? 1051 VAL A CG1 1 
ATOM   4841  C  CG2 . VAL A  1  633  ? 193.840 159.064 204.896 1.00   166.50 ? 1051 VAL A CG2 1 
ATOM   4842  N  N   . VAL A  1  634  ? 195.067 158.939 209.274 1.00   253.86 ? 1052 VAL A N   1 
ATOM   4843  C  CA  . VAL A  1  634  ? 195.278 157.777 210.146 1.00   299.64 ? 1052 VAL A CA  1 
ATOM   4844  C  C   . VAL A  1  634  ? 194.061 156.846 209.973 1.00   331.57 ? 1052 VAL A C   1 
ATOM   4845  O  O   . VAL A  1  634  ? 192.923 157.322 209.927 1.00   397.97 ? 1052 VAL A O   1 
ATOM   4846  C  CB  . VAL A  1  634  ? 195.520 158.209 211.628 1.00   295.39 ? 1052 VAL A CB  1 
ATOM   4847  C  CG1 . VAL A  1  634  ? 194.244 158.715 212.307 1.00   273.92 ? 1052 VAL A CG1 1 
ATOM   4848  C  CG2 . VAL A  1  634  ? 196.149 157.082 212.437 1.00   300.01 ? 1052 VAL A CG2 1 
ATOM   4849  N  N   . GLN A  1  635  ? 194.297 155.541 209.836 1.00   304.98 ? 1053 GLN A N   1 
ATOM   4850  C  CA  . GLN A  1  635  ? 193.220 154.593 209.561 1.00   260.85 ? 1053 GLN A CA  1 
ATOM   4851  C  C   . GLN A  1  635  ? 193.218 153.550 210.670 1.00   267.47 ? 1053 GLN A C   1 
ATOM   4852  O  O   . GLN A  1  635  ? 194.281 153.128 211.145 1.00   253.30 ? 1053 GLN A O   1 
ATOM   4853  C  CB  . GLN A  1  635  ? 193.324 153.973 208.155 1.00   240.02 ? 1053 GLN A CB  1 
ATOM   4854  C  CG  . GLN A  1  635  ? 194.528 153.078 207.877 1.00   235.92 ? 1053 GLN A CG  1 
ATOM   4855  C  CD  . GLN A  1  635  ? 195.820 153.841 207.658 1.00   228.42 ? 1053 GLN A CD  1 
ATOM   4856  O  OE1 . GLN A  1  635  ? 195.942 155.019 208.011 1.00   207.22 ? 1053 GLN A OE1 1 
ATOM   4857  N  NE2 . GLN A  1  635  ? 196.801 153.162 207.075 1.00   230.98 ? 1053 GLN A NE2 1 
ATOM   4858  N  N   . TYR A  1  636  ? 192.011 153.174 211.093 1.00   262.67 ? 1054 TYR A N   1 
ATOM   4859  C  CA  . TYR A  1  636  ? 191.794 152.122 212.083 1.00   263.95 ? 1054 TYR A CA  1 
ATOM   4860  C  C   . TYR A  1  636  ? 191.613 150.784 211.331 1.00   289.74 ? 1054 TYR A C   1 
ATOM   4861  O  O   . TYR A  1  636  ? 190.709 150.704 210.509 1.00   335.96 ? 1054 TYR A O   1 
ATOM   4862  C  CB  . TYR A  1  636  ? 190.528 152.449 212.889 1.00   207.40 ? 1054 TYR A CB  1 
ATOM   4863  N  N   . PRO A  1  637  ? 192.449 149.741 211.585 1.00   266.69 ? 1055 PRO A N   1 
ATOM   4864  C  CA  . PRO A  1  637  ? 192.369 148.480 210.789 1.00   248.43 ? 1055 PRO A CA  1 
ATOM   4865  C  C   . PRO A  1  637  ? 190.985 147.776 210.724 1.00   259.22 ? 1055 PRO A C   1 
ATOM   4866  O  O   . PRO A  1  637  ? 190.840 146.601 211.086 1.00   259.09 ? 1055 PRO A O   1 
ATOM   4867  C  CB  . PRO A  1  637  ? 193.427 147.590 211.463 1.00   236.84 ? 1055 PRO A CB  1 
ATOM   4868  C  CG  . PRO A  1  637  ? 194.423 148.555 212.001 1.00   234.45 ? 1055 PRO A CG  1 
ATOM   4869  C  CD  . PRO A  1  637  ? 193.627 149.737 212.476 1.00   236.78 ? 1055 PRO A CD  1 
ATOM   4870  N  N   . GLU A  1  638  ? 189.989 148.521 210.256 1.00   266.92 ? 1056 GLU A N   1 
ATOM   4871  C  CA  . GLU A  1  638  ? 188.657 148.025 209.943 1.00   259.57 ? 1056 GLU A CA  1 
ATOM   4872  C  C   . GLU A  1  638  ? 188.292 148.459 208.512 1.00   280.58 ? 1056 GLU A C   1 
ATOM   4873  O  O   . GLU A  1  638  ? 187.106 148.502 208.165 1.00   283.84 ? 1056 GLU A O   1 
ATOM   4874  C  CB  . GLU A  1  638  ? 187.641 148.586 210.947 1.00   204.93 ? 1056 GLU A CB  1 
ATOM   4875  N  N   . LEU A  1  639  ? 189.312 148.777 207.700 1.00   272.48 ? 1057 LEU A N   1 
ATOM   4876  C  CA  . LEU A  1  639  ? 189.134 149.141 206.307 1.00   249.43 ? 1057 LEU A CA  1 
ATOM   4877  C  C   . LEU A  1  639  ? 189.997 148.246 205.442 1.00   228.22 ? 1057 LEU A C   1 
ATOM   4878  O  O   . LEU A  1  639  ? 191.185 148.081 205.713 1.00   205.37 ? 1057 LEU A O   1 
ATOM   4879  C  CB  . LEU A  1  639  ? 189.522 150.599 206.038 1.00   247.29 ? 1057 LEU A CB  1 
ATOM   4880  C  CG  . LEU A  1  639  ? 188.829 151.774 206.733 1.00   272.36 ? 1057 LEU A CG  1 
ATOM   4881  C  CD1 . LEU A  1  639  ? 187.303 151.680 206.687 1.00   308.79 ? 1057 LEU A CD1 1 
ATOM   4882  C  CD2 . LEU A  1  639  ? 189.310 151.917 208.162 1.00   281.11 ? 1057 LEU A CD2 1 
ATOM   4883  N  N   . SER A  1  640  ? 189.400 147.673 204.400 1.00   236.66 ? 1058 SER A N   1 
ATOM   4884  C  CA  . SER A  1  640  ? 190.174 147.033 203.337 1.00   253.24 ? 1058 SER A CA  1 
ATOM   4885  C  C   . SER A  1  640  ? 191.037 148.099 202.668 1.00   232.40 ? 1058 SER A C   1 
ATOM   4886  O  O   . SER A  1  640  ? 190.683 149.273 202.686 1.00   245.84 ? 1058 SER A O   1 
ATOM   4887  C  CB  . SER A  1  640  ? 189.256 146.426 202.259 1.00   273.37 ? 1058 SER A CB  1 
ATOM   4888  O  OG  . SER A  1  640  ? 188.448 145.373 202.757 1.00   268.22 ? 1058 SER A OG  1 
ATOM   4889  N  N   . GLU A  1  641  ? 192.130 147.706 202.032 1.00   223.52 ? 1059 GLU A N   1 
ATOM   4890  C  CA  . GLU A  1  641  ? 192.898 148.656 201.221 1.00   246.74 ? 1059 GLU A CA  1 
ATOM   4891  C  C   . GLU A  1  641  ? 192.021 149.429 200.191 1.00   269.33 ? 1059 GLU A C   1 
ATOM   4892  O  O   . GLU A  1  641  ? 192.172 150.642 200.041 1.00   284.52 ? 1059 GLU A O   1 
ATOM   4893  C  CB  . GLU A  1  641  ? 194.054 147.930 200.523 1.00   260.01 ? 1059 GLU A CB  1 
ATOM   4894  N  N   . HIS A  1  642  ? 191.104 148.727 199.512 1.00   259.21 ? 1060 HIS A N   1 
ATOM   4895  C  CA  . HIS A  1  642  ? 190.131 149.379 198.597 1.00   245.48 ? 1060 HIS A CA  1 
ATOM   4896  C  C   . HIS A  1  642  ? 189.088 150.269 199.316 1.00   248.14 ? 1060 HIS A C   1 
ATOM   4897  O  O   . HIS A  1  642  ? 188.556 151.208 198.741 1.00   277.55 ? 1060 HIS A O   1 
ATOM   4898  C  CB  . HIS A  1  642  ? 189.401 148.349 197.734 1.00   234.92 ? 1060 HIS A CB  1 
ATOM   4899  C  CG  . HIS A  1  642  ? 188.571 147.381 198.523 1.00   298.90 ? 1060 HIS A CG  1 
ATOM   4900  N  ND1 . HIS A  1  642  ? 188.954 146.074 198.731 1.00   336.77 ? 1060 HIS A ND1 1 
ATOM   4901  C  CD2 . HIS A  1  642  ? 187.394 147.536 199.174 1.00   322.88 ? 1060 HIS A CD2 1 
ATOM   4902  C  CE1 . HIS A  1  642  ? 188.040 145.460 199.461 1.00   349.69 ? 1060 HIS A CE1 1 
ATOM   4903  N  NE2 . HIS A  1  642  ? 187.087 146.328 199.752 1.00   354.46 ? 1060 HIS A NE2 1 
ATOM   4904  N  N   . GLU A  1  643  ? 188.744 149.903 200.543 1.00   225.10 ? 1061 GLU A N   1 
ATOM   4905  C  CA  . GLU A  1  643  ? 187.872 150.699 201.398 1.00   222.59 ? 1061 GLU A CA  1 
ATOM   4906  C  C   . GLU A  1  643  ? 188.597 151.960 201.878 1.00   206.22 ? 1061 GLU A C   1 
ATOM   4907  O  O   . GLU A  1  643  ? 188.027 153.033 201.904 1.00   219.58 ? 1061 GLU A O   1 
ATOM   4908  C  CB  . GLU A  1  643  ? 187.465 149.850 202.602 1.00   267.75 ? 1061 GLU A CB  1 
ATOM   4909  C  CG  . GLU A  1  643  ? 186.294 150.391 203.405 1.00   287.95 ? 1061 GLU A CG  1 
ATOM   4910  C  CD  . GLU A  1  643  ? 185.888 149.461 204.549 1.00   302.06 ? 1061 GLU A CD  1 
ATOM   4911  O  OE1 . GLU A  1  643  ? 186.578 148.435 204.791 1.00   330.59 ? 1061 GLU A OE1 1 
ATOM   4912  O  OE2 . GLU A  1  643  ? 184.864 149.754 205.205 1.00   262.65 ? 1061 GLU A OE2 1 
ATOM   4913  N  N   . PHE A  1  644  ? 189.856 151.787 202.275 1.00   190.17 ? 1062 PHE A N   1 
ATOM   4914  C  CA  . PHE A  1  644  ? 190.726 152.882 202.733 1.00   175.49 ? 1062 PHE A CA  1 
ATOM   4915  C  C   . PHE A  1  644  ? 191.023 153.875 201.633 1.00   172.36 ? 1062 PHE A C   1 
ATOM   4916  O  O   . PHE A  1  644  ? 191.095 155.055 201.912 1.00   181.64 ? 1062 PHE A O   1 
ATOM   4917  C  CB  . PHE A  1  644  ? 192.053 152.322 203.267 1.00   198.39 ? 1062 PHE A CB  1 
ATOM   4918  C  CG  . PHE A  1  644  ? 193.130 153.353 203.475 1.00   169.37 ? 1062 PHE A CG  1 
ATOM   4919  C  CD1 . PHE A  1  644  ? 192.975 154.350 204.420 1.00   175.76 ? 1062 PHE A CD1 1 
ATOM   4920  C  CD2 . PHE A  1  644  ? 194.312 153.304 202.742 1.00   183.82 ? 1062 PHE A CD2 1 
ATOM   4921  C  CE1 . PHE A  1  644  ? 193.972 155.295 204.623 1.00   189.93 ? 1062 PHE A CE1 1 
ATOM   4922  C  CE2 . PHE A  1  644  ? 195.318 154.240 202.941 1.00   185.85 ? 1062 PHE A CE2 1 
ATOM   4923  C  CZ  . PHE A  1  644  ? 195.148 155.239 203.883 1.00   187.18 ? 1062 PHE A CZ  1 
ATOM   4924  N  N   . ILE A  1  645  ? 191.194 153.413 200.391 1.00   181.85 ? 1063 ILE A N   1 
ATOM   4925  C  CA  . ILE A  1  645  ? 191.452 154.339 199.270 1.00   200.23 ? 1063 ILE A CA  1 
ATOM   4926  C  C   . ILE A  1  645  ? 190.313 155.371 199.081 1.00   198.22 ? 1063 ILE A C   1 
ATOM   4927  O  O   . ILE A  1  645  ? 190.584 156.551 198.857 1.00   197.14 ? 1063 ILE A O   1 
ATOM   4928  C  CB  . ILE A  1  645  ? 191.814 153.603 197.938 1.00   210.22 ? 1063 ILE A CB  1 
ATOM   4929  C  CG1 . ILE A  1  645  ? 192.533 154.540 196.963 1.00   220.70 ? 1063 ILE A CG1 1 
ATOM   4930  C  CG2 . ILE A  1  645  ? 190.596 153.015 197.242 1.00   219.16 ? 1063 ILE A CG2 1 
ATOM   4931  C  CD1 . ILE A  1  645  ? 192.949 153.870 195.669 1.00   231.53 ? 1063 ILE A CD1 1 
ATOM   4932  N  N   . GLU A  1  646  ? 189.066 154.920 199.188 1.00   174.27 ? 1064 GLU A N   1 
ATOM   4933  C  CA  . GLU A  1  646  ? 187.894 155.789 199.152 1.00   176.72 ? 1064 GLU A CA  1 
ATOM   4934  C  C   . GLU A  1  646  ? 187.904 156.831 200.310 1.00   178.85 ? 1064 GLU A C   1 
ATOM   4935  O  O   . GLU A  1  646  ? 187.485 157.960 200.105 1.00   222.57 ? 1064 GLU A O   1 
ATOM   4936  C  CB  . GLU A  1  646  ? 186.629 154.907 199.152 1.00   224.56 ? 1064 GLU A CB  1 
ATOM   4937  C  CG  . GLU A  1  646  ? 185.315 155.499 199.674 1.00   277.98 ? 1064 GLU A CG  1 
ATOM   4938  C  CD  . GLU A  1  646  ? 184.257 154.439 199.984 1.00   319.72 ? 1064 GLU A CD  1 
ATOM   4939  O  OE1 . GLU A  1  646  ? 183.186 154.811 200.516 1.00   328.66 ? 1064 GLU A OE1 1 
ATOM   4940  O  OE2 . GLU A  1  646  ? 184.477 153.235 199.707 1.00   359.79 ? 1064 GLU A OE2 1 
ATOM   4941  N  N   . GLU A  1  647  ? 188.398 156.462 201.499 1.00   166.57 ? 1065 GLU A N   1 
ATOM   4942  C  CA  . GLU A  1  647  ? 188.499 157.387 202.653 1.00   171.44 ? 1065 GLU A CA  1 
ATOM   4943  C  C   . GLU A  1  647  ? 189.504 158.502 202.454 1.00   166.73 ? 1065 GLU A C   1 
ATOM   4944  O  O   . GLU A  1  647  ? 189.256 159.624 202.895 1.00   198.83 ? 1065 GLU A O   1 
ATOM   4945  C  CB  . GLU A  1  647  ? 188.886 156.670 203.938 1.00   221.54 ? 1065 GLU A CB  1 
ATOM   4946  C  CG  . GLU A  1  647  ? 187.803 155.780 204.522 1.00   293.52 ? 1065 GLU A CG  1 
ATOM   4947  C  CD  . GLU A  1  647  ? 188.167 155.231 205.897 1.00   353.18 ? 1065 GLU A CD  1 
ATOM   4948  O  OE1 . GLU A  1  647  ? 187.258 154.724 206.589 1.00   383.63 ? 1065 GLU A OE1 1 
ATOM   4949  O  OE2 . GLU A  1  647  ? 189.354 155.302 206.293 1.00   393.45 ? 1065 GLU A OE2 1 
ATOM   4950  N  N   . LYS A  1  648  ? 190.640 158.207 201.829 1.00   158.16 ? 1066 LYS A N   1 
ATOM   4951  C  CA  . LYS A  1  648  ? 191.584 159.279 201.470 1.00   157.21 ? 1066 LYS A CA  1 
ATOM   4952  C  C   . LYS A  1  648  ? 191.108 160.102 200.288 1.00   157.17 ? 1066 LYS A C   1 
ATOM   4953  O  O   . LYS A  1  648  ? 191.292 161.308 200.288 1.00   189.85 ? 1066 LYS A O   1 
ATOM   4954  C  CB  . LYS A  1  648  ? 193.036 158.822 201.281 1.00   161.48 ? 1066 LYS A CB  1 
ATOM   4955  C  CG  . LYS A  1  648  ? 193.313 157.786 200.216 1.00   163.78 ? 1066 LYS A CG  1 
ATOM   4956  C  CD  . LYS A  1  648  ? 194.768 157.330 200.314 1.00   173.61 ? 1066 LYS A CD  1 
ATOM   4957  C  CE  . LYS A  1  648  ? 194.950 155.950 199.700 1.00   188.48 ? 1066 LYS A CE  1 
ATOM   4958  N  NZ  . LYS A  1  648  ? 196.368 155.696 199.330 1.00   209.53 ? 1066 LYS A NZ  1 
ATOM   4959  N  N   . GLU A  1  649  ? 190.482 159.492 199.294 1.00   156.13 ? 1067 GLU A N   1 
ATOM   4960  C  CA  . GLU A  1  649  ? 189.846 160.317 198.256 1.00   171.04 ? 1067 GLU A CA  1 
ATOM   4961  C  C   . GLU A  1  649  ? 188.770 161.268 198.798 1.00   157.44 ? 1067 GLU A C   1 
ATOM   4962  O  O   . GLU A  1  649  ? 188.677 162.408 198.363 1.00   173.45 ? 1067 GLU A O   1 
ATOM   4963  C  CB  . GLU A  1  649  ? 189.293 159.475 197.133 1.00   179.06 ? 1067 GLU A CB  1 
ATOM   4964  C  CG  . GLU A  1  649  ? 190.394 158.804 196.333 1.00   208.00 ? 1067 GLU A CG  1 
ATOM   4965  C  CD  . GLU A  1  649  ? 190.069 158.681 194.861 1.00   275.78 ? 1067 GLU A CD  1 
ATOM   4966  O  OE1 . GLU A  1  649  ? 188.927 159.000 194.442 1.00   344.32 ? 1067 GLU A OE1 1 
ATOM   4967  O  OE2 . GLU A  1  649  ? 190.985 158.259 194.125 1.00   317.67 ? 1067 GLU A OE2 1 
ATOM   4968  N  N   . ASN A  1  650  ? 187.987 160.829 199.767 1.00   149.66 ? 1068 ASN A N   1 
ATOM   4969  C  CA  . ASN A  1  650  ? 187.036 161.735 200.384 1.00   160.27 ? 1068 ASN A CA  1 
ATOM   4970  C  C   . ASN A  1  650  ? 187.664 162.888 201.143 1.00   135.91 ? 1068 ASN A C   1 
ATOM   4971  O  O   . ASN A  1  650  ? 187.158 163.993 201.060 1.00   181.79 ? 1068 ASN A O   1 
ATOM   4972  C  CB  . ASN A  1  650  ? 186.030 160.983 201.249 1.00   189.86 ? 1068 ASN A CB  1 
ATOM   4973  C  CG  . ASN A  1  650  ? 185.038 160.186 200.414 1.00   198.87 ? 1068 ASN A CG  1 
ATOM   4974  O  OD1 . ASN A  1  650  ? 184.802 160.475 199.217 1.00   174.37 ? 1068 ASN A OD1 1 
ATOM   4975  N  ND2 . ASN A  1  650  ? 184.445 159.173 201.039 1.00   208.80 ? 1068 ASN A ND2 1 
ATOM   4976  N  N   . ARG A  1  651  ? 188.760 162.663 201.844 1.00   126.05 ? 1069 ARG A N   1 
ATOM   4977  C  CA  . ARG A  1  651  ? 189.528 163.793 202.421 1.00   148.78 ? 1069 ARG A CA  1 
ATOM   4978  C  C   . ARG A  1  651  ? 190.102 164.697 201.313 1.00   138.84 ? 1069 ARG A C   1 
ATOM   4979  O  O   . ARG A  1  651  ? 190.227 165.921 201.476 1.00   165.97 ? 1069 ARG A O   1 
ATOM   4980  C  CB  . ARG A  1  651  ? 190.661 163.297 203.331 1.00   158.49 ? 1069 ARG A CB  1 
ATOM   4981  C  CG  . ARG A  1  651  ? 191.552 164.366 203.968 1.00   148.58 ? 1069 ARG A CG  1 
ATOM   4982  C  CD  . ARG A  1  651  ? 191.039 164.824 205.309 1.00   171.44 ? 1069 ARG A CD  1 
ATOM   4983  N  NE  . ARG A  1  651  ? 191.511 166.175 205.595 1.00   192.05 ? 1069 ARG A NE  1 
ATOM   4984  C  CZ  . ARG A  1  651  ? 190.871 167.305 205.279 1.00   234.97 ? 1069 ARG A CZ  1 
ATOM   4985  N  NH1 . ARG A  1  651  ? 189.688 167.298 204.654 1.00   247.34 ? 1069 ARG A NH1 1 
ATOM   4986  N  NH2 . ARG A  1  651  ? 191.421 168.477 205.598 1.00   273.61 ? 1069 ARG A NH2 1 
ATOM   4987  N  N   . LEU A  1  652  ? 190.434 164.086 200.185 1.00   116.28 ? 1070 LEU A N   1 
ATOM   4988  C  CA  . LEU A  1  652  ? 190.973 164.840 199.066 1.00   133.91 ? 1070 LEU A CA  1 
ATOM   4989  C  C   . LEU A  1  652  ? 189.935 165.741 198.482 1.00   139.37 ? 1070 LEU A C   1 
ATOM   4990  O  O   . LEU A  1  652  ? 190.212 166.899 198.202 1.00   171.17 ? 1070 LEU A O   1 
ATOM   4991  C  CB  . LEU A  1  652  ? 191.445 163.926 197.947 1.00   133.62 ? 1070 LEU A CB  1 
ATOM   4992  C  CG  . LEU A  1  652  ? 191.937 164.677 196.713 1.00   131.79 ? 1070 LEU A CG  1 
ATOM   4993  C  CD1 . LEU A  1  652  ? 193.014 165.712 197.112 1.00   135.06 ? 1070 LEU A CD1 1 
ATOM   4994  C  CD2 . LEU A  1  652  ? 192.428 163.660 195.688 1.00   138.22 ? 1070 LEU A CD2 1 
ATOM   4995  N  N   . LEU A  1  653  ? 188.741 165.189 198.279 1.00   142.54 ? 1071 LEU A N   1 
ATOM   4996  C  CA  . LEU A  1  653  ? 187.642 165.928 197.686 1.00   137.02 ? 1071 LEU A CA  1 
ATOM   4997  C  C   . LEU A  1  653  ? 187.417 167.200 198.439 1.00   145.84 ? 1071 LEU A C   1 
ATOM   4998  O  O   . LEU A  1  653  ? 187.383 168.256 197.830 1.00   187.59 ? 1071 LEU A O   1 
ATOM   4999  C  CB  . LEU A  1  653  ? 186.354 165.140 197.714 1.00   147.27 ? 1071 LEU A CB  1 
ATOM   5000  C  CG  . LEU A  1  653  ? 185.552 165.204 196.435 1.00   177.59 ? 1071 LEU A CG  1 
ATOM   5001  C  CD1 . LEU A  1  653  ? 184.095 164.951 196.822 1.00   210.75 ? 1071 LEU A CD1 1 
ATOM   5002  C  CD2 . LEU A  1  653  ? 185.701 166.513 195.657 1.00   179.09 ? 1071 LEU A CD2 1 
ATOM   5003  N  N   . GLN A  1  654  ? 187.284 167.093 199.760 1.00   144.53 ? 1072 GLN A N   1 
ATOM   5004  C  CA  . GLN A  1  654  ? 187.186 168.259 200.655 1.00   163.06 ? 1072 GLN A CA  1 
ATOM   5005  C  C   . GLN A  1  654  ? 188.333 169.269 200.513 1.00   157.93 ? 1072 GLN A C   1 
ATOM   5006  O  O   . GLN A  1  654  ? 188.113 170.489 200.557 1.00   228.55 ? 1072 GLN A O   1 
ATOM   5007  C  CB  . GLN A  1  654  ? 187.146 167.837 202.115 1.00   163.77 ? 1072 GLN A CB  1 
ATOM   5008  C  CG  . GLN A  1  654  ? 185.901 167.099 202.543 1.00   178.22 ? 1072 GLN A CG  1 
ATOM   5009  C  CD  . GLN A  1  654  ? 186.094 166.498 203.914 1.00   217.55 ? 1072 GLN A CD  1 
ATOM   5010  O  OE1 . GLN A  1  654  ? 186.912 166.988 204.713 1.00   223.03 ? 1072 GLN A OE1 1 
ATOM   5011  N  NE2 . GLN A  1  654  ? 185.365 165.426 204.197 1.00   251.26 ? 1072 GLN A NE2 1 
ATOM   5012  N  N   . LEU A  1  655  ? 189.552 168.765 200.376 1.00   127.31 ? 1073 LEU A N   1 
ATOM   5013  C  CA  . LEU A  1  655  ? 190.698 169.632 200.120 1.00   144.75 ? 1073 LEU A CA  1 
ATOM   5014  C  C   . LEU A  1  655  ? 190.604 170.305 198.771 1.00   146.89 ? 1073 LEU A C   1 
ATOM   5015  O  O   . LEU A  1  655  ? 191.065 171.450 198.576 1.00   154.04 ? 1073 LEU A O   1 
ATOM   5016  C  CB  . LEU A  1  655  ? 191.982 168.831 200.163 1.00   151.94 ? 1073 LEU A CB  1 
ATOM   5017  C  CG  . LEU A  1  655  ? 192.313 168.374 201.563 1.00   182.80 ? 1073 LEU A CG  1 
ATOM   5018  C  CD1 . LEU A  1  655  ? 193.358 167.272 201.420 1.00   210.60 ? 1073 LEU A CD1 1 
ATOM   5019  C  CD2 . LEU A  1  655  ? 192.762 169.551 202.451 1.00   179.65 ? 1073 LEU A CD2 1 
ATOM   5020  N  N   . CYS A  1  656  ? 190.009 169.589 197.824 1.00   140.37 ? 1074 CYS A N   1 
ATOM   5021  C  CA  . CYS A  1  656  ? 189.865 170.154 196.502 1.00   139.01 ? 1074 CYS A CA  1 
ATOM   5022  C  C   . CYS A  1  656  ? 188.934 171.335 196.460 1.00   133.62 ? 1074 CYS A C   1 
ATOM   5023  O  O   . CYS A  1  656  ? 189.209 172.281 195.740 1.00   126.92 ? 1074 CYS A O   1 
ATOM   5024  C  CB  . CYS A  1  656  ? 189.618 169.103 195.436 1.00   134.81 ? 1074 CYS A CB  1 
ATOM   5025  S  SG  . CYS A  1  656  ? 191.289 168.455 195.101 1.00   195.72 ? 1074 CYS A SG  1 
ATOM   5026  N  N   . GLN A  1  657  ? 187.914 171.339 197.304 1.00   141.84 ? 1075 GLN A N   1 
ATOM   5027  C  CA  . GLN A  1  657  ? 187.022 172.480 197.404 1.00   130.61 ? 1075 GLN A CA  1 
ATOM   5028  C  C   . GLN A  1  657  ? 187.819 173.705 197.770 1.00   110.61 ? 1075 GLN A C   1 
ATOM   5029  O  O   . GLN A  1  657  ? 187.621 174.721 197.147 1.00   155.14 ? 1075 GLN A O   1 
ATOM   5030  C  CB  . GLN A  1  657  ? 185.801 172.201 198.321 1.00   136.89 ? 1075 GLN A CB  1 
ATOM   5031  C  CG  . GLN A  1  657  ? 184.818 171.129 197.768 1.00   143.78 ? 1075 GLN A CG  1 
ATOM   5032  C  CD  . GLN A  1  657  ? 185.064 170.743 196.283 1.00   174.16 ? 1075 GLN A CD  1 
ATOM   5033  O  OE1 . GLN A  1  657  ? 186.014 170.013 195.968 1.00   206.79 ? 1075 GLN A OE1 1 
ATOM   5034  N  NE2 . GLN A  1  657  ? 184.232 171.250 195.370 1.00   180.33 ? 1075 GLN A NE2 1 
ATOM   5035  N  N   . ARG A  1  658  ? 188.800 173.601 198.646 1.00   102.45 ? 1076 ARG A N   1 
ATOM   5036  C  CA  . ARG A  1  658  ? 189.718 174.726 198.841 1.00   121.23 ? 1076 ARG A CA  1 
ATOM   5037  C  C   . ARG A  1  658  ? 190.534 175.081 197.606 1.00   126.20 ? 1076 ARG A C   1 
ATOM   5038  O  O   . ARG A  1  658  ? 190.749 176.286 197.328 1.00   137.49 ? 1076 ARG A O   1 
ATOM   5039  C  CB  . ARG A  1  658  ? 190.676 174.442 199.981 1.00   133.78 ? 1076 ARG A CB  1 
ATOM   5040  C  CG  . ARG A  1  658  ? 191.615 175.587 200.385 1.00   128.47 ? 1076 ARG A CG  1 
ATOM   5041  C  CD  . ARG A  1  658  ? 191.954 175.451 201.869 1.00   157.58 ? 1076 ARG A CD  1 
ATOM   5042  N  NE  . ARG A  1  658  ? 193.338 175.103 202.223 1.00   168.81 ? 1076 ARG A NE  1 
ATOM   5043  C  CZ  . ARG A  1  658  ? 193.934 173.925 202.039 1.00   199.04 ? 1076 ARG A CZ  1 
ATOM   5044  N  NH1 . ARG A  1  658  ? 193.307 172.871 201.504 1.00   189.70 ? 1076 ARG A NH1 1 
ATOM   5045  N  NH2 . ARG A  1  658  ? 195.198 173.808 202.437 1.00   223.21 ? 1076 ARG A NH2 1 
ATOM   5046  N  N   . THR A  1  659  ? 191.008 174.062 196.884 1.00   109.96 ? 1077 THR A N   1 
ATOM   5047  C  CA  . THR A  1  659  ? 191.959 174.396 195.840 1.00   122.54 ? 1077 THR A CA  1 
ATOM   5048  C  C   . THR A  1  659  ? 191.310 175.189 194.729 1.00   117.59 ? 1077 THR A C   1 
ATOM   5049  O  O   . THR A  1  659  ? 191.898 176.153 194.310 1.00   162.60 ? 1077 THR A O   1 
ATOM   5050  C  CB  . THR A  1  659  ? 192.735 173.259 195.219 1.00   125.54 ? 1077 THR A CB  1 
ATOM   5051  O  OG1 . THR A  1  659  ? 191.972 172.717 194.136 1.00   124.88 ? 1077 THR A OG1 1 
ATOM   5052  C  CG2 . THR A  1  659  ? 193.152 172.240 196.274 1.00   135.81 ? 1077 THR A CG2 1 
ATOM   5053  N  N   . MET A  1  660  ? 190.136 174.801 194.254 1.00   101.94 ? 1078 MET A N   1 
ATOM   5054  C  CA  . MET A  1  660  ? 189.353 175.669 193.347 1.00   104.70 ? 1078 MET A CA  1 
ATOM   5055  C  C   . MET A  1  660  ? 189.270 177.159 193.754 1.00   115.52 ? 1078 MET A C   1 
ATOM   5056  O  O   . MET A  1  660  ? 189.361 178.093 192.944 1.00   144.12 ? 1078 MET A O   1 
ATOM   5057  C  CB  . MET A  1  660  ? 187.907 175.262 193.352 1.00   116.34 ? 1078 MET A CB  1 
ATOM   5058  C  CG  . MET A  1  660  ? 187.586 173.820 193.398 1.00   134.90 ? 1078 MET A CG  1 
ATOM   5059  S  SD  . MET A  1  660  ? 188.808 173.056 192.394 1.00   155.94 ? 1078 MET A SD  1 
ATOM   5060  C  CE  . MET A  1  660  ? 187.744 171.665 191.965 1.00   166.62 ? 1078 MET A CE  1 
ATOM   5061  N  N   . ALA A  1  661  ? 189.027 177.380 195.018 1.00   95.31  ? 1079 ALA A N   1 
ATOM   5062  C  CA  . ALA A  1  661  ? 188.843 178.704 195.462 1.00   115.27 ? 1079 ALA A CA  1 
ATOM   5063  C  C   . ALA A  1  661  ? 190.152 179.500 195.330 1.00   124.55 ? 1079 ALA A C   1 
ATOM   5064  O  O   . ALA A  1  661  ? 190.124 180.735 195.166 1.00   154.74 ? 1079 ALA A O   1 
ATOM   5065  C  CB  . ALA A  1  661  ? 188.350 178.681 196.895 1.00   135.75 ? 1079 ALA A CB  1 
ATOM   5066  N  N   . LEU A  1  662  ? 191.293 178.816 195.421 1.00   97.09  ? 1080 LEU A N   1 
ATOM   5067  C  CA  . LEU A  1  662  ? 192.534 179.519 195.554 1.00   124.41 ? 1080 LEU A CA  1 
ATOM   5068  C  C   . LEU A  1  662  ? 192.761 180.444 194.393 1.00   137.83 ? 1080 LEU A C   1 
ATOM   5069  O  O   . LEU A  1  662  ? 193.162 181.579 194.622 1.00   170.76 ? 1080 LEU A O   1 
ATOM   5070  C  CB  . LEU A  1  662  ? 193.720 178.580 195.697 1.00   130.72 ? 1080 LEU A CB  1 
ATOM   5071  C  CG  . LEU A  1  662  ? 193.642 177.729 196.930 1.00   154.04 ? 1080 LEU A CG  1 
ATOM   5072  C  CD1 . LEU A  1  662  ? 194.806 176.729 196.962 1.00   174.08 ? 1080 LEU A CD1 1 
ATOM   5073  C  CD2 . LEU A  1  662  ? 193.565 178.662 198.137 1.00   165.95 ? 1080 LEU A CD2 1 
ATOM   5074  N  N   . PRO A  1  663  ? 192.488 179.981 193.157 1.00   104.87 ? 1081 PRO A N   1 
ATOM   5075  C  CA  . PRO A  1  663  ? 192.669 180.802 192.011 1.00   105.23 ? 1081 PRO A CA  1 
ATOM   5076  C  C   . PRO A  1  663  ? 192.139 182.167 192.101 1.00   96.79  ? 1081 PRO A C   1 
ATOM   5077  O  O   . PRO A  1  663  ? 192.777 183.055 191.620 1.00   113.21 ? 1081 PRO A O   1 
ATOM   5078  C  CB  . PRO A  1  663  ? 191.889 180.064 190.964 1.00   111.89 ? 1081 PRO A CB  1 
ATOM   5079  C  CG  . PRO A  1  663  ? 192.378 178.699 191.208 1.00   116.31 ? 1081 PRO A CG  1 
ATOM   5080  C  CD  . PRO A  1  663  ? 192.476 178.590 192.712 1.00   108.27 ? 1081 PRO A CD  1 
ATOM   5081  N  N   . VAL A  1  664  ? 190.988 182.380 192.691 1.00   111.85 ? 1082 VAL A N   1 
ATOM   5082  C  CA  . VAL A  1  664  ? 190.421 183.711 192.533 1.00   125.47 ? 1082 VAL A CA  1 
ATOM   5083  C  C   . VAL A  1  664  ? 191.272 184.682 193.272 1.00   120.97 ? 1082 VAL A C   1 
ATOM   5084  O  O   . VAL A  1  664  ? 191.667 185.768 192.739 1.00   110.87 ? 1082 VAL A O   1 
ATOM   5085  C  CB  . VAL A  1  664  ? 189.002 183.821 193.025 1.00   129.53 ? 1082 VAL A CB  1 
ATOM   5086  C  CG1 . VAL A  1  664  ? 188.473 185.224 192.708 1.00   111.12 ? 1082 VAL A CG1 1 
ATOM   5087  C  CG2 . VAL A  1  664  ? 188.184 182.703 192.367 1.00   144.49 ? 1082 VAL A CG2 1 
ATOM   5088  N  N   . GLY A  1  665  ? 191.560 184.260 194.494 1.00   115.42 ? 1083 GLY A N   1 
ATOM   5089  C  CA  . GLY A  1  665  ? 192.481 185.017 195.328 1.00   144.41 ? 1083 GLY A CA  1 
ATOM   5090  C  C   . GLY A  1  665  ? 193.886 185.191 194.759 1.00   117.67 ? 1083 GLY A C   1 
ATOM   5091  O  O   . GLY A  1  665  ? 194.537 186.252 194.901 1.00   100.01 ? 1083 GLY A O   1 
ATOM   5092  N  N   . ARG A  1  666  ? 194.367 184.115 194.152 1.00   92.93  ? 1084 ARG A N   1 
ATOM   5093  C  CA  . ARG A  1  666  ? 195.718 184.117 193.636 1.00   99.17  ? 1084 ARG A CA  1 
ATOM   5094  C  C   . ARG A  1  666  ? 195.876 185.209 192.605 1.00   89.80  ? 1084 ARG A C   1 
ATOM   5095  O  O   . ARG A  1  666  ? 196.895 185.831 192.585 1.00   109.88 ? 1084 ARG A O   1 
ATOM   5096  C  CB  . ARG A  1  666  ? 196.109 182.732 193.079 1.00   106.59 ? 1084 ARG A CB  1 
ATOM   5097  C  CG  . ARG A  1  666  ? 197.579 182.606 192.727 1.00   115.23 ? 1084 ARG A CG  1 
ATOM   5098  C  CD  . ARG A  1  666  ? 197.795 182.531 191.246 1.00   113.00 ? 1084 ARG A CD  1 
ATOM   5099  N  NE  . ARG A  1  666  ? 197.160 181.295 190.861 1.00   132.24 ? 1084 ARG A NE  1 
ATOM   5100  C  CZ  . ARG A  1  666  ? 196.881 180.974 189.613 1.00   158.66 ? 1084 ARG A CZ  1 
ATOM   5101  N  NH1 . ARG A  1  666  ? 197.226 181.792 188.581 1.00   149.61 ? 1084 ARG A NH1 1 
ATOM   5102  N  NH2 . ARG A  1  666  ? 196.264 179.818 189.406 1.00   155.61 ? 1084 ARG A NH2 1 
ATOM   5103  N  N   . GLY A  1  667  ? 194.851 185.471 191.800 1.00   98.84  ? 1085 GLY A N   1 
ATOM   5104  C  CA  . GLY A  1  667  ? 194.911 186.501 190.769 1.00   105.56 ? 1085 GLY A CA  1 
ATOM   5105  C  C   . GLY A  1  667  ? 195.123 187.871 191.397 1.00   116.45 ? 1085 GLY A C   1 
ATOM   5106  O  O   . GLY A  1  667  ? 195.969 188.692 190.973 1.00   114.68 ? 1085 GLY A O   1 
ATOM   5107  N  N   . MET A  1  668  ? 194.394 188.113 192.467 1.00   109.45 ? 1086 MET A N   1 
ATOM   5108  C  CA  . MET A  1  668  ? 194.492 189.399 193.125 1.00   108.45 ? 1086 MET A CA  1 
ATOM   5109  C  C   . MET A  1  668  ? 195.903 189.559 193.595 1.00   106.10 ? 1086 MET A C   1 
ATOM   5110  O  O   . MET A  1  668  ? 196.472 190.634 193.498 1.00   107.89 ? 1086 MET A O   1 
ATOM   5111  C  CB  . MET A  1  668  ? 193.524 189.448 194.293 1.00   123.21 ? 1086 MET A CB  1 
ATOM   5112  C  CG  . MET A  1  668  ? 192.127 189.271 193.792 1.00   153.26 ? 1086 MET A CG  1 
ATOM   5113  S  SD  . MET A  1  668  ? 191.034 188.432 194.886 1.00   212.92 ? 1086 MET A SD  1 
ATOM   5114  C  CE  . MET A  1  668  ? 190.271 189.894 195.514 1.00   202.80 ? 1086 MET A CE  1 
ATOM   5115  N  N   . PHE A  1  669  ? 196.470 188.451 194.075 1.00   106.34 ? 1087 PHE A N   1 
ATOM   5116  C  CA  . PHE A  1  669  ? 197.786 188.489 194.658 1.00   107.18 ? 1087 PHE A CA  1 
ATOM   5117  C  C   . PHE A  1  669  ? 198.834 188.913 193.670 1.00   102.60 ? 1087 PHE A C   1 
ATOM   5118  O  O   . PHE A  1  669  ? 199.741 189.662 194.029 1.00   124.37 ? 1087 PHE A O   1 
ATOM   5119  C  CB  . PHE A  1  669  ? 198.200 187.147 195.294 1.00   112.22 ? 1087 PHE A CB  1 
ATOM   5120  C  CG  . PHE A  1  669  ? 199.633 187.149 195.709 1.00   118.50 ? 1087 PHE A CG  1 
ATOM   5121  C  CD1 . PHE A  1  669  ? 200.120 188.191 196.539 1.00   107.50 ? 1087 PHE A CD1 1 
ATOM   5122  C  CD2 . PHE A  1  669  ? 200.510 186.221 195.206 1.00   113.22 ? 1087 PHE A CD2 1 
ATOM   5123  C  CE1 . PHE A  1  669  ? 201.438 188.283 196.885 1.00   107.64 ? 1087 PHE A CE1 1 
ATOM   5124  C  CE2 . PHE A  1  669  ? 201.850 186.306 195.557 1.00   139.06 ? 1087 PHE A CE2 1 
ATOM   5125  C  CZ  . PHE A  1  669  ? 202.315 187.337 196.392 1.00   133.15 ? 1087 PHE A CZ  1 
ATOM   5126  N  N   . THR A  1  670  ? 198.704 188.444 192.440 1.00   98.24  ? 1088 THR A N   1 
ATOM   5127  C  CA  . THR A  1  670  ? 199.721 188.656 191.430 1.00   104.59 ? 1088 THR A CA  1 
ATOM   5128  C  C   . THR A  1  670  ? 199.108 189.374 190.257 1.00   97.29  ? 1088 THR A C   1 
ATOM   5129  O  O   . THR A  1  670  ? 199.021 188.855 189.176 1.00   136.17 ? 1088 THR A O   1 
ATOM   5130  C  CB  . THR A  1  670  ? 200.377 187.332 190.982 1.00   117.13 ? 1088 THR A CB  1 
ATOM   5131  O  OG1 . THR A  1  670  ? 201.254 187.598 189.868 1.00   166.21 ? 1088 THR A OG1 1 
ATOM   5132  C  CG2 . THR A  1  670  ? 199.329 186.215 190.588 1.00   126.62 ? 1088 THR A CG2 1 
ATOM   5133  N  N   . LEU A  1  671  ? 198.679 190.587 190.471 1.00   98.57  ? 1089 LEU A N   1 
ATOM   5134  C  CA  . LEU A  1  671  ? 197.848 191.266 189.510 1.00   100.29 ? 1089 LEU A CA  1 
ATOM   5135  C  C   . LEU A  1  671  ? 198.674 192.361 188.871 1.00   112.18 ? 1089 LEU A C   1 
ATOM   5136  O  O   . LEU A  1  671  ? 199.398 193.088 189.560 1.00   122.30 ? 1089 LEU A O   1 
ATOM   5137  C  CB  . LEU A  1  671  ? 196.596 191.807 190.208 1.00   89.89  ? 1089 LEU A CB  1 
ATOM   5138  C  CG  . LEU A  1  671  ? 195.913 193.001 189.548 1.00   96.84  ? 1089 LEU A CG  1 
ATOM   5139  C  CD1 . LEU A  1  671  ? 194.641 192.565 188.864 1.00   110.61 ? 1089 LEU A CD1 1 
ATOM   5140  C  CD2 . LEU A  1  671  ? 195.625 194.092 190.566 1.00   98.21  ? 1089 LEU A CD2 1 
ATOM   5141  N  N   . PHE A  1  672  ? 198.533 192.483 187.548 1.00   114.32 ? 1090 PHE A N   1 
ATOM   5142  C  CA  . PHE A  1  672  ? 199.144 193.540 186.763 1.00   111.63 ? 1090 PHE A CA  1 
ATOM   5143  C  C   . PHE A  1  672  ? 200.636 193.607 186.885 1.00   126.47 ? 1090 PHE A C   1 
ATOM   5144  O  O   . PHE A  1  672  ? 201.241 194.664 186.692 1.00   144.31 ? 1090 PHE A O   1 
ATOM   5145  C  CB  . PHE A  1  672  ? 198.560 194.862 187.190 1.00   111.52 ? 1090 PHE A CB  1 
ATOM   5146  C  CG  . PHE A  1  672  ? 197.152 195.069 186.773 1.00   105.20 ? 1090 PHE A CG  1 
ATOM   5147  C  CD1 . PHE A  1  672  ? 196.614 194.418 185.688 1.00   97.61  ? 1090 PHE A CD1 1 
ATOM   5148  C  CD2 . PHE A  1  672  ? 196.394 196.000 187.431 1.00   117.48 ? 1090 PHE A CD2 1 
ATOM   5149  C  CE1 . PHE A  1  672  ? 195.335 194.662 185.268 1.00   114.58 ? 1090 PHE A CE1 1 
ATOM   5150  C  CE2 . PHE A  1  672  ? 195.110 196.250 187.028 1.00   153.91 ? 1090 PHE A CE2 1 
ATOM   5151  C  CZ  . PHE A  1  672  ? 194.570 195.569 185.936 1.00   146.99 ? 1090 PHE A CZ  1 
ATOM   5152  N  N   . SER A  1  673  ? 201.234 192.454 187.149 1.00   140.43 ? 1091 SER A N   1 
ATOM   5153  C  CA  . SER A  1  673  ? 202.572 192.401 187.686 1.00   152.69 ? 1091 SER A CA  1 
ATOM   5154  C  C   . SER A  1  673  ? 203.673 192.151 186.654 1.00   146.86 ? 1091 SER A C   1 
ATOM   5155  O  O   . SER A  1  673  ? 204.835 192.427 186.943 1.00   208.63 ? 1091 SER A O   1 
ATOM   5156  C  CB  . SER A  1  673  ? 202.592 191.349 188.803 1.00   146.61 ? 1091 SER A CB  1 
ATOM   5157  O  OG  . SER A  1  673  ? 202.057 190.134 188.348 1.00   133.88 ? 1091 SER A OG  1 
ATOM   5158  N  N   . TYR A  1  674  ? 203.320 191.707 185.453 1.00   124.69 ? 1092 TYR A N   1 
ATOM   5159  C  CA  . TYR A  1  674  ? 204.241 190.949 184.606 1.00   128.54 ? 1092 TYR A CA  1 
ATOM   5160  C  C   . TYR A  1  674  ? 204.133 191.333 183.154 1.00   130.74 ? 1092 TYR A C   1 
ATOM   5161  O  O   . TYR A  1  674  ? 203.074 191.171 182.571 1.00   140.04 ? 1092 TYR A O   1 
ATOM   5162  C  CB  . TYR A  1  674  ? 203.875 189.475 184.752 1.00   143.02 ? 1092 TYR A CB  1 
ATOM   5163  C  CG  . TYR A  1  674  ? 204.491 188.549 183.732 1.00   146.54 ? 1092 TYR A CG  1 
ATOM   5164  C  CD1 . TYR A  1  674  ? 205.844 188.320 183.746 1.00   160.57 ? 1092 TYR A CD1 1 
ATOM   5165  C  CD2 . TYR A  1  674  ? 203.712 187.875 182.790 1.00   147.26 ? 1092 TYR A CD2 1 
ATOM   5166  C  CE1 . TYR A  1  674  ? 206.428 187.468 182.853 1.00   173.94 ? 1092 TYR A CE1 1 
ATOM   5167  C  CE2 . TYR A  1  674  ? 204.291 187.031 181.881 1.00   149.58 ? 1092 TYR A CE2 1 
ATOM   5168  C  CZ  . TYR A  1  674  ? 205.655 186.838 181.924 1.00   161.43 ? 1092 TYR A CZ  1 
ATOM   5169  O  OH  . TYR A  1  674  ? 206.305 186.024 181.044 1.00   195.41 ? 1092 TYR A OH  1 
ATOM   5170  N  N   . HIS A  1  675  ? 205.210 191.824 182.557 1.00   160.15 ? 1093 HIS A N   1 
ATOM   5171  C  CA  . HIS A  1  675  ? 205.178 192.230 181.139 1.00   167.90 ? 1093 HIS A CA  1 
ATOM   5172  C  C   . HIS A  1  675  ? 205.629 191.026 180.424 1.00   148.93 ? 1093 HIS A C   1 
ATOM   5173  O  O   . HIS A  1  675  ? 206.628 190.447 180.836 1.00   191.75 ? 1093 HIS A O   1 
ATOM   5174  C  CB  . HIS A  1  675  ? 206.126 193.375 180.869 1.00   165.88 ? 1093 HIS A CB  1 
ATOM   5175  C  CG  . HIS A  1  675  ? 205.799 194.575 181.681 1.00   193.78 ? 1093 HIS A CG  1 
ATOM   5176  N  ND1 . HIS A  1  675  ? 205.469 195.783 181.112 1.00   214.65 ? 1093 HIS A ND1 1 
ATOM   5177  C  CD2 . HIS A  1  675  ? 205.671 194.733 183.021 1.00   194.43 ? 1093 HIS A CD2 1 
ATOM   5178  C  CE1 . HIS A  1  675  ? 205.192 196.651 182.068 1.00   233.95 ? 1093 HIS A CE1 1 
ATOM   5179  N  NE2 . HIS A  1  675  ? 205.305 196.039 183.235 1.00   236.44 ? 1093 HIS A NE2 1 
ATOM   5180  N  N   . PRO A  1  676  ? 204.905 190.600 179.393 1.00   134.70 ? 1094 PRO A N   1 
ATOM   5181  C  CA  . PRO A  1  676  ? 205.338 189.332 178.823 1.00   161.46 ? 1094 PRO A CA  1 
ATOM   5182  C  C   . PRO A  1  676  ? 206.276 189.570 177.619 1.00   185.44 ? 1094 PRO A C   1 
ATOM   5183  O  O   . PRO A  1  676  ? 206.376 190.713 177.099 1.00   170.70 ? 1094 PRO A O   1 
ATOM   5184  C  CB  . PRO A  1  676  ? 204.012 188.628 178.466 1.00   153.62 ? 1094 PRO A CB  1 
ATOM   5185  C  CG  . PRO A  1  676  ? 202.957 189.702 178.580 1.00   156.38 ? 1094 PRO A CG  1 
ATOM   5186  C  CD  . PRO A  1  676  ? 203.657 191.033 178.773 1.00   133.80 ? 1094 PRO A CD  1 
ATOM   5187  N  N   . VAL A  1  677  ? 206.993 188.507 177.235 1.00   176.77 ? 1095 VAL A N   1 
ATOM   5188  C  CA  . VAL A  1  677  ? 207.917 188.542 176.109 1.00   148.64 ? 1095 VAL A CA  1 
ATOM   5189  C  C   . VAL A  1  677  ? 207.022 188.402 174.904 1.00   152.33 ? 1095 VAL A C   1 
ATOM   5190  O  O   . VAL A  1  677  ? 206.145 187.539 174.904 1.00   150.89 ? 1095 VAL A O   1 
ATOM   5191  C  CB  . VAL A  1  677  ? 208.878 187.340 176.094 1.00   176.63 ? 1095 VAL A CB  1 
ATOM   5192  C  CG1 . VAL A  1  677  ? 209.932 187.498 174.998 1.00   200.80 ? 1095 VAL A CG1 1 
ATOM   5193  C  CG2 . VAL A  1  677  ? 209.557 187.160 177.449 1.00   192.90 ? 1095 VAL A CG2 1 
ATOM   5194  N  N   . PRO A  1  678  ? 207.218 189.245 173.877 1.00   158.40 ? 1096 PRO A N   1 
ATOM   5195  C  CA  . PRO A  1  678  ? 206.371 189.209 172.648 1.00   137.51 ? 1096 PRO A CA  1 
ATOM   5196  C  C   . PRO A  1  678  ? 206.263 187.879 171.929 1.00   113.60 ? 1096 PRO A C   1 
ATOM   5197  O  O   . PRO A  1  678  ? 205.364 187.694 171.161 1.00   125.96 ? 1096 PRO A O   1 
ATOM   5198  C  CB  . PRO A  1  678  ? 207.054 190.216 171.728 1.00   159.56 ? 1096 PRO A CB  1 
ATOM   5199  C  CG  . PRO A  1  678  ? 207.726 191.187 172.663 1.00   187.56 ? 1096 PRO A CG  1 
ATOM   5200  C  CD  . PRO A  1  678  ? 208.076 190.449 173.931 1.00   165.72 ? 1096 PRO A CD  1 
ATOM   5201  N  N   . THR A  1  679  ? 207.209 186.987 172.170 1.00   134.44 ? 1097 THR A N   1 
ATOM   5202  C  CA  . THR A  1  679  ? 207.269 185.625 171.630 1.00   141.68 ? 1097 THR A CA  1 
ATOM   5203  C  C   . THR A  1  679  ? 206.611 184.492 172.455 1.00   138.57 ? 1097 THR A C   1 
ATOM   5204  O  O   . THR A  1  679  ? 205.863 183.713 171.909 1.00   141.02 ? 1097 THR A O   1 
ATOM   5205  C  CB  . THR A  1  679  ? 208.749 185.283 171.512 1.00   168.91 ? 1097 THR A CB  1 
ATOM   5206  O  OG1 . THR A  1  679  ? 209.356 186.208 170.583 1.00   144.04 ? 1097 THR A OG1 1 
ATOM   5207  C  CG2 . THR A  1  679  ? 208.969 183.772 171.163 1.00   187.48 ? 1097 THR A CG2 1 
ATOM   5208  N  N   . GLU A  1  680  ? 206.941 184.367 173.740 1.00   139.21 ? 1098 GLU A N   1 
ATOM   5209  C  CA  . GLU A  1  680  ? 206.336 183.358 174.642 1.00   147.67 ? 1098 GLU A CA  1 
ATOM   5210  C  C   . GLU A  1  680  ? 204.810 183.197 174.558 1.00   130.14 ? 1098 GLU A C   1 
ATOM   5211  O  O   . GLU A  1  680  ? 204.121 184.109 174.133 1.00   136.46 ? 1098 GLU A O   1 
ATOM   5212  C  CB  . GLU A  1  680  ? 206.650 183.722 176.107 1.00   165.04 ? 1098 GLU A CB  1 
ATOM   5213  N  N   . PRO A  1  681  ? 204.268 182.034 174.958 1.00   132.75 ? 1099 PRO A N   1 
ATOM   5214  C  CA  . PRO A  1  681  ? 202.810 182.045 175.123 1.00   136.06 ? 1099 PRO A CA  1 
ATOM   5215  C  C   . PRO A  1  681  ? 202.346 182.707 176.421 1.00   147.54 ? 1099 PRO A C   1 
ATOM   5216  O  O   . PRO A  1  681  ? 201.784 183.796 176.293 1.00   183.96 ? 1099 PRO A O   1 
ATOM   5217  C  CB  . PRO A  1  681  ? 202.395 180.588 174.971 1.00   131.87 ? 1099 PRO A CB  1 
ATOM   5218  C  CG  . PRO A  1  681  ? 203.502 179.996 174.203 1.00   154.38 ? 1099 PRO A CG  1 
ATOM   5219  C  CD  . PRO A  1  681  ? 204.751 180.684 174.684 1.00   147.58 ? 1099 PRO A CD  1 
ATOM   5220  N  N   . LEU A  1  682  ? 202.489 182.144 177.633 1.00   126.94 ? 1100 LEU A N   1 
ATOM   5221  C  CA  . LEU A  1  682  ? 202.238 183.024 178.806 1.00   119.19 ? 1100 LEU A CA  1 
ATOM   5222  C  C   . LEU A  1  682  ? 203.127 182.869 180.001 1.00   154.71 ? 1100 LEU A C   1 
ATOM   5223  O  O   . LEU A  1  682  ? 203.955 183.742 180.223 1.00   281.84 ? 1100 LEU A O   1 
ATOM   5224  C  CB  . LEU A  1  682  ? 200.781 183.138 179.260 1.00   108.30 ? 1100 LEU A CB  1 
ATOM   5225  C  CG  . LEU A  1  682  ? 200.243 184.547 179.672 1.00   125.06 ? 1100 LEU A CG  1 
ATOM   5226  C  CD1 . LEU A  1  682  ? 198.938 184.441 180.464 1.00   136.58 ? 1100 LEU A CD1 1 
ATOM   5227  C  CD2 . LEU A  1  682  ? 201.184 185.425 180.499 1.00   147.18 ? 1100 LEU A CD2 1 
ATOM   5228  N  N   . PRO A  1  683  ? 203.001 181.822 180.797 1.00   162.69 ? 1101 PRO A N   1 
ATOM   5229  C  CA  . PRO A  1  683  ? 202.127 180.686 180.573 1.00   167.67 ? 1101 PRO A CA  1 
ATOM   5230  C  C   . PRO A  1  683  ? 201.179 180.599 181.728 1.00   162.91 ? 1101 PRO A C   1 
ATOM   5231  O  O   . PRO A  1  683  ? 201.319 181.336 182.737 1.00   172.30 ? 1101 PRO A O   1 
ATOM   5232  C  CB  . PRO A  1  683  ? 203.090 179.525 180.674 1.00   217.82 ? 1101 PRO A CB  1 
ATOM   5233  C  CG  . PRO A  1  683  ? 204.065 179.977 181.747 1.00   230.63 ? 1101 PRO A CG  1 
ATOM   5234  C  CD  . PRO A  1  683  ? 204.087 181.488 181.739 1.00   185.41 ? 1101 PRO A CD  1 
ATOM   5235  N  N   . ILE A  1  684  ? 200.238 179.677 181.611 1.00   141.80 ? 1102 ILE A N   1 
ATOM   5236  C  CA  . ILE A  1  684  ? 199.237 179.510 182.656 1.00   129.69 ? 1102 ILE A CA  1 
ATOM   5237  C  C   . ILE A  1  684  ? 199.662 178.331 183.523 1.00   141.77 ? 1102 ILE A C   1 
ATOM   5238  O  O   . ILE A  1  684  ? 200.048 177.288 182.977 1.00   166.17 ? 1102 ILE A O   1 
ATOM   5239  C  CB  . ILE A  1  684  ? 197.826 179.344 182.061 1.00   120.19 ? 1102 ILE A CB  1 
ATOM   5240  C  CG1 . ILE A  1  684  ? 197.317 180.728 181.493 1.00   139.65 ? 1102 ILE A CG1 1 
ATOM   5241  C  CG2 . ILE A  1  684  ? 196.894 178.752 183.120 1.00   109.94 ? 1102 ILE A CG2 1 
ATOM   5242  C  CD1 . ILE A  1  684  ? 196.876 180.836 180.006 1.00   133.94 ? 1102 ILE A CD1 1 
ATOM   5243  N  N   . PRO A  1  685  ? 199.623 178.494 184.871 1.00   129.24 ? 1103 PRO A N   1 
ATOM   5244  C  CA  . PRO A  1  685  ? 199.931 177.381 185.774 1.00   131.24 ? 1103 PRO A CA  1 
ATOM   5245  C  C   . PRO A  1  685  ? 198.823 176.402 185.761 1.00   133.65 ? 1103 PRO A C   1 
ATOM   5246  O  O   . PRO A  1  685  ? 197.696 176.771 185.442 1.00   156.66 ? 1103 PRO A O   1 
ATOM   5247  C  CB  . PRO A  1  685  ? 199.919 178.026 187.150 1.00   133.70 ? 1103 PRO A CB  1 
ATOM   5248  C  CG  . PRO A  1  685  ? 198.993 179.161 187.005 1.00   132.86 ? 1103 PRO A CG  1 
ATOM   5249  C  CD  . PRO A  1  685  ? 199.298 179.704 185.639 1.00   129.60 ? 1103 PRO A CD  1 
ATOM   5250  N  N   . LYS A  1  686  ? 199.111 175.175 186.151 1.00   141.06 ? 1104 LYS A N   1 
ATOM   5251  C  CA  . LYS A  1  686  ? 198.094 174.144 186.095 1.00   153.68 ? 1104 LYS A CA  1 
ATOM   5252  C  C   . LYS A  1  686  ? 197.507 174.028 187.481 1.00   161.52 ? 1104 LYS A C   1 
ATOM   5253  O  O   . LYS A  1  686  ? 198.240 173.918 188.462 1.00   186.73 ? 1104 LYS A O   1 
ATOM   5254  C  CB  . LYS A  1  686  ? 198.693 172.854 185.567 1.00   169.82 ? 1104 LYS A CB  1 
ATOM   5255  C  CG  . LYS A  1  686  ? 197.898 171.573 185.743 1.00   177.80 ? 1104 LYS A CG  1 
ATOM   5256  C  CD  . LYS A  1  686  ? 198.887 170.409 185.685 1.00   221.90 ? 1104 LYS A CD  1 
ATOM   5257  C  CE  . LYS A  1  686  ? 199.820 170.355 186.913 1.00   242.21 ? 1104 LYS A CE  1 
ATOM   5258  N  NZ  . LYS A  1  686  ? 201.289 170.338 186.612 1.00   235.42 ? 1104 LYS A NZ  1 
ATOM   5259  N  N   . LEU A  1  687  ? 196.178 174.120 187.535 1.00   176.32 ? 1105 LEU A N   1 
ATOM   5260  C  CA  . LEU A  1  687  ? 195.375 173.885 188.734 1.00   157.38 ? 1105 LEU A CA  1 
ATOM   5261  C  C   . LEU A  1  687  ? 195.095 172.384 188.738 1.00   162.40 ? 1105 LEU A C   1 
ATOM   5262  O  O   . LEU A  1  687  ? 194.332 171.888 187.896 1.00   168.62 ? 1105 LEU A O   1 
ATOM   5263  C  CB  . LEU A  1  687  ? 194.084 174.699 188.652 1.00   157.93 ? 1105 LEU A CB  1 
ATOM   5264  C  CG  . LEU A  1  687  ? 192.807 174.170 189.307 1.00   170.21 ? 1105 LEU A CG  1 
ATOM   5265  C  CD1 . LEU A  1  687  ? 192.743 174.598 190.761 1.00   179.27 ? 1105 LEU A CD1 1 
ATOM   5266  C  CD2 . LEU A  1  687  ? 191.585 174.635 188.535 1.00   159.27 ? 1105 LEU A CD2 1 
ATOM   5267  N  N   . ASN A  1  688  ? 195.774 171.669 189.637 1.00   168.39 ? 1106 ASN A N   1 
ATOM   5268  C  CA  . ASN A  1  688  ? 195.662 170.210 189.749 1.00   181.58 ? 1106 ASN A CA  1 
ATOM   5269  C  C   . ASN A  1  688  ? 195.233 169.876 191.138 1.00   172.52 ? 1106 ASN A C   1 
ATOM   5270  O  O   . ASN A  1  688  ? 195.546 170.565 192.097 1.00   183.64 ? 1106 ASN A O   1 
ATOM   5271  C  CB  . ASN A  1  688  ? 196.967 169.468 189.430 1.00   197.19 ? 1106 ASN A CB  1 
ATOM   5272  C  CG  . ASN A  1  688  ? 198.053 169.686 190.480 1.00   208.37 ? 1106 ASN A CG  1 
ATOM   5273  O  OD1 . ASN A  1  688  ? 198.237 170.800 190.977 1.00   198.35 ? 1106 ASN A OD1 1 
ATOM   5274  N  ND2 . ASN A  1  688  ? 198.785 168.624 190.808 1.00   216.51 ? 1106 ASN A ND2 1 
ATOM   5275  N  N   . LEU A  1  689  ? 194.497 168.804 191.227 1.00   169.70 ? 1107 LEU A N   1 
ATOM   5276  C  CA  . LEU A  1  689  ? 193.791 168.514 192.422 1.00   168.61 ? 1107 LEU A CA  1 
ATOM   5277  C  C   . LEU A  1  689  ? 194.040 167.040 192.473 1.00   181.75 ? 1107 LEU A C   1 
ATOM   5278  O  O   . LEU A  1  689  ? 193.176 166.205 192.224 1.00   216.61 ? 1107 LEU A O   1 
ATOM   5279  C  CB  . LEU A  1  689  ? 192.349 168.999 192.271 1.00   163.25 ? 1107 LEU A CB  1 
ATOM   5280  C  CG  . LEU A  1  689  ? 191.916 169.561 190.899 1.00   164.97 ? 1107 LEU A CG  1 
ATOM   5281  C  CD1 . LEU A  1  689  ? 191.150 168.495 190.129 1.00   182.17 ? 1107 LEU A CD1 1 
ATOM   5282  C  CD2 . LEU A  1  689  ? 191.103 170.833 191.038 1.00   140.47 ? 1107 LEU A CD2 1 
ATOM   5283  N  N   . THR A  1  690  ? 195.321 166.760 192.671 1.00   171.24 ? 1108 THR A N   1 
ATOM   5284  C  CA  . THR A  1  690  ? 195.806 165.437 192.964 1.00   169.23 ? 1108 THR A CA  1 
ATOM   5285  C  C   . THR A  1  690  ? 196.556 165.593 194.262 1.00   169.20 ? 1108 THR A C   1 
ATOM   5286  O  O   . THR A  1  690  ? 196.978 166.692 194.645 1.00   165.59 ? 1108 THR A O   1 
ATOM   5287  C  CB  . THR A  1  690  ? 196.724 164.901 191.863 1.00   184.75 ? 1108 THR A CB  1 
ATOM   5288  O  OG1 . THR A  1  690  ? 197.992 165.574 191.911 1.00   218.71 ? 1108 THR A OG1 1 
ATOM   5289  C  CG2 . THR A  1  690  ? 196.081 165.116 190.501 1.00   195.01 ? 1108 THR A CG2 1 
ATOM   5290  N  N   . GLY A  1  691  ? 196.720 164.490 194.956 1.00   159.34 ? 1109 GLY A N   1 
ATOM   5291  C  CA  . GLY A  1  691  ? 197.085 164.592 196.339 1.00   163.71 ? 1109 GLY A CA  1 
ATOM   5292  C  C   . GLY A  1  691  ? 198.051 163.527 196.705 1.00   159.97 ? 1109 GLY A C   1 
ATOM   5293  O  O   . GLY A  1  691  ? 197.803 162.350 196.442 1.00   163.36 ? 1109 GLY A O   1 
ATOM   5294  N  N   . ARG A  1  692  ? 199.140 163.944 197.343 1.00   154.19 ? 1110 ARG A N   1 
ATOM   5295  C  CA  . ARG A  1  692  ? 200.207 163.038 197.658 1.00   165.13 ? 1110 ARG A CA  1 
ATOM   5296  C  C   . ARG A  1  692  ? 200.159 162.673 199.120 1.00   176.62 ? 1110 ARG A C   1 
ATOM   5297  O  O   . ARG A  1  692  ? 200.442 163.530 199.964 1.00   189.83 ? 1110 ARG A O   1 
ATOM   5298  C  CB  . ARG A  1  692  ? 201.544 163.634 197.234 1.00   159.89 ? 1110 ARG A CB  1 
ATOM   5299  C  CG  . ARG A  1  692  ? 201.707 163.522 195.726 1.00   157.32 ? 1110 ARG A CG  1 
ATOM   5300  C  CD  . ARG A  1  692  ? 203.148 163.523 195.322 1.00   181.59 ? 1110 ARG A CD  1 
ATOM   5301  N  NE  . ARG A  1  692  ? 203.285 163.533 193.876 1.00   230.15 ? 1110 ARG A NE  1 
ATOM   5302  C  CZ  . ARG A  1  692  ? 204.454 163.545 193.237 1.00   309.92 ? 1110 ARG A CZ  1 
ATOM   5303  N  NH1 . ARG A  1  692  ? 204.471 163.554 191.906 1.00   367.56 ? 1110 ARG A NH1 1 
ATOM   5304  N  NH2 . ARG A  1  692  ? 205.609 163.550 193.909 1.00   320.52 ? 1110 ARG A NH2 1 
ATOM   5305  N  N   . ALA A  1  693  ? 199.799 161.402 199.386 1.00   168.88 ? 1111 ALA A N   1 
ATOM   5306  C  CA  . ALA A  1  693  ? 199.581 160.876 200.743 1.00   188.83 ? 1111 ALA A CA  1 
ATOM   5307  C  C   . ALA A  1  693  ? 200.884 160.364 201.384 1.00   195.17 ? 1111 ALA A C   1 
ATOM   5308  O  O   . ALA A  1  693  ? 201.615 159.615 200.737 1.00   193.60 ? 1111 ALA A O   1 
ATOM   5309  C  CB  . ALA A  1  693  ? 198.543 159.749 200.713 1.00   176.68 ? 1111 ALA A CB  1 
ATOM   5310  N  N   . PRO A  1  694  ? 201.185 160.765 202.647 1.00   216.14 ? 1112 PRO A N   1 
ATOM   5311  C  CA  . PRO A  1  694  ? 202.271 160.073 203.366 1.00   248.28 ? 1112 PRO A CA  1 
ATOM   5312  C  C   . PRO A  1  694  ? 201.874 158.625 203.745 1.00   262.90 ? 1112 PRO A C   1 
ATOM   5313  O  O   . PRO A  1  694  ? 200.668 158.350 203.857 1.00   231.17 ? 1112 PRO A O   1 
ATOM   5314  C  CB  . PRO A  1  694  ? 202.473 160.941 204.620 1.00   247.04 ? 1112 PRO A CB  1 
ATOM   5315  C  CG  . PRO A  1  694  ? 201.185 161.662 204.806 1.00   229.81 ? 1112 PRO A CG  1 
ATOM   5316  C  CD  . PRO A  1  694  ? 200.662 161.909 203.423 1.00   216.25 ? 1112 PRO A CD  1 
ATOM   5317  N  N   . PRO A  1  695  ? 202.834 157.705 203.951 1.00   273.08 ? 1113 PRO A N   1 
ATOM   5318  C  CA  . PRO A  1  695  ? 204.295 157.960 203.979 1.00   274.90 ? 1113 PRO A CA  1 
ATOM   5319  C  C   . PRO A  1  695  ? 205.037 157.796 202.632 1.00   274.89 ? 1113 PRO A C   1 
ATOM   5320  O  O   . PRO A  1  695  ? 206.046 158.466 202.391 1.00   246.93 ? 1113 PRO A O   1 
ATOM   5321  C  CB  . PRO A  1  695  ? 204.790 156.894 204.957 1.00   265.78 ? 1113 PRO A CB  1 
ATOM   5322  C  CG  . PRO A  1  695  ? 203.863 155.743 204.727 1.00   266.53 ? 1113 PRO A CG  1 
ATOM   5323  C  CD  . PRO A  1  695  ? 202.516 156.328 204.382 1.00   258.51 ? 1113 PRO A CD  1 
ATOM   5324  N  N   . ARG A  1  696  ? 204.523 156.915 201.773 1.00   283.71 ? 1114 ARG A N   1 
ATOM   5325  C  CA  . ARG A  1  696  ? 205.126 156.600 200.468 1.00   268.36 ? 1114 ARG A CA  1 
ATOM   5326  C  C   . ARG A  1  696  ? 205.250 157.809 199.525 1.00   247.20 ? 1114 ARG A C   1 
ATOM   5327  O  O   . ARG A  1  696  ? 206.107 157.816 198.634 1.00   213.63 ? 1114 ARG A O   1 
ATOM   5328  C  CB  . ARG A  1  696  ? 204.283 155.513 199.758 1.00   265.55 ? 1114 ARG A CB  1 
ATOM   5329  C  CG  . ARG A  1  696  ? 204.078 154.201 200.514 1.00   243.33 ? 1114 ARG A CG  1 
ATOM   5330  C  CD  . ARG A  1  696  ? 205.398 153.666 201.041 1.00   275.55 ? 1114 ARG A CD  1 
ATOM   5331  N  NE  . ARG A  1  696  ? 206.400 153.524 199.985 1.00   295.03 ? 1114 ARG A NE  1 
ATOM   5332  C  CZ  . ARG A  1  696  ? 207.688 153.236 200.184 1.00   300.18 ? 1114 ARG A CZ  1 
ATOM   5333  N  NH1 . ARG A  1  696  ? 208.177 153.055 201.414 1.00   298.19 ? 1114 ARG A NH1 1 
ATOM   5334  N  NH2 . ARG A  1  696  ? 208.503 153.126 199.134 1.00   297.54 ? 1114 ARG A NH2 1 
ATOM   5335  N  N   . ASN A  1  697  ? 204.386 158.808 199.731 1.00   232.27 ? 1115 ASN A N   1 
ATOM   5336  C  CA  . ASN A  1  697  ? 204.167 159.914 198.802 1.00   205.07 ? 1115 ASN A CA  1 
ATOM   5337  C  C   . ASN A  1  697  ? 203.514 159.424 197.481 1.00   197.30 ? 1115 ASN A C   1 
ATOM   5338  O  O   . ASN A  1  697  ? 203.889 159.829 196.382 1.00   175.70 ? 1115 ASN A O   1 
ATOM   5339  C  CB  . ASN A  1  697  ? 205.465 160.718 198.605 1.00   204.89 ? 1115 ASN A CB  1 
ATOM   5340  C  CG  . ASN A  1  697  ? 205.241 162.220 198.619 1.00   220.98 ? 1115 ASN A CG  1 
ATOM   5341  O  OD1 . ASN A  1  697  ? 204.350 162.732 199.299 1.00   234.90 ? 1115 ASN A OD1 1 
ATOM   5342  N  ND2 . ASN A  1  697  ? 206.078 162.940 197.888 1.00   247.55 ? 1115 ASN A ND2 1 
ATOM   5343  N  N   . THR A  1  698  ? 202.516 158.544 197.627 1.00   216.84 ? 1116 THR A N   1 
ATOM   5344  C  CA  . THR A  1  698  ? 201.695 158.038 196.519 1.00   216.92 ? 1116 THR A CA  1 
ATOM   5345  C  C   . THR A  1  698  ? 200.655 159.073 196.167 1.00   208.79 ? 1116 THR A C   1 
ATOM   5346  O  O   . THR A  1  698  ? 200.230 159.842 197.037 1.00   202.02 ? 1116 THR A O   1 
ATOM   5347  C  CB  . THR A  1  698  ? 200.916 156.753 196.896 1.00   229.84 ? 1116 THR A CB  1 
ATOM   5348  O  OG1 . THR A  1  698  ? 200.127 156.978 198.081 1.00   208.23 ? 1116 THR A OG1 1 
ATOM   5349  C  CG2 . THR A  1  698  ? 201.868 155.570 197.109 1.00   236.79 ? 1116 THR A CG2 1 
ATOM   5350  N  N   . THR A  1  699  ? 200.221 159.060 194.906 1.00   199.74 ? 1117 THR A N   1 
ATOM   5351  C  CA  . THR A  1  699  ? 199.295 160.071 194.380 1.00   220.79 ? 1117 THR A CA  1 
ATOM   5352  C  C   . THR A  1  699  ? 197.874 159.539 194.320 1.00   212.24 ? 1117 THR A C   1 
ATOM   5353  O  O   . THR A  1  699  ? 197.659 158.417 193.869 1.00   228.93 ? 1117 THR A O   1 
ATOM   5354  C  CB  . THR A  1  699  ? 199.692 160.524 192.963 1.00   225.89 ? 1117 THR A CB  1 
ATOM   5355  O  OG1 . THR A  1  699  ? 199.939 159.376 192.149 1.00   238.04 ? 1117 THR A OG1 1 
ATOM   5356  C  CG2 . THR A  1  699  ? 200.939 161.406 192.990 1.00   225.03 ? 1117 THR A CG2 1 
ATOM   5357  N  N   . VAL A  1  700  ? 196.914 160.353 194.760 1.00   199.11 ? 1118 VAL A N   1 
ATOM   5358  C  CA  . VAL A  1  700  ? 195.495 159.996 194.682 1.00   194.54 ? 1118 VAL A CA  1 
ATOM   5359  C  C   . VAL A  1  700  ? 194.768 160.922 193.709 1.00   208.43 ? 1118 VAL A C   1 
ATOM   5360  O  O   . VAL A  1  700  ? 194.819 162.141 193.828 1.00   197.27 ? 1118 VAL A O   1 
ATOM   5361  C  CB  . VAL A  1  700  ? 194.806 159.917 196.073 1.00   178.26 ? 1118 VAL A CB  1 
ATOM   5362  C  CG1 . VAL A  1  700  ? 195.173 158.597 196.721 1.00   204.09 ? 1118 VAL A CG1 1 
ATOM   5363  C  CG2 . VAL A  1  700  ? 195.151 161.083 197.009 1.00   138.43 ? 1118 VAL A CG2 1 
ATOM   5364  N  N   . ASP A  1  701  ? 194.120 160.316 192.722 1.00   235.01 ? 1119 ASP A N   1 
ATOM   5365  C  CA  . ASP A  1  701  ? 193.473 161.037 191.632 1.00   259.27 ? 1119 ASP A CA  1 
ATOM   5366  C  C   . ASP A  1  701  ? 191.977 160.851 191.767 1.00   229.67 ? 1119 ASP A C   1 
ATOM   5367  O  O   . ASP A  1  701  ? 191.497 159.725 191.693 1.00   257.97 ? 1119 ASP A O   1 
ATOM   5368  C  CB  . ASP A  1  701  ? 193.949 160.461 190.286 1.00   295.05 ? 1119 ASP A CB  1 
ATOM   5369  C  CG  . ASP A  1  701  ? 193.277 161.111 189.069 1.00   305.93 ? 1119 ASP A CG  1 
ATOM   5370  O  OD1 . ASP A  1  701  ? 192.419 162.005 189.234 1.00   307.97 ? 1119 ASP A OD1 1 
ATOM   5371  O  OD2 . ASP A  1  701  ? 193.616 160.716 187.935 1.00   333.88 ? 1119 ASP A OD2 1 
ATOM   5372  N  N   . LEU A  1  702  ? 191.243 161.952 191.907 1.00   201.18 ? 1120 LEU A N   1 
ATOM   5373  C  CA  . LEU A  1  702  ? 189.778 161.868 191.970 1.00   223.40 ? 1120 LEU A CA  1 
ATOM   5374  C  C   . LEU A  1  702  ? 189.176 161.460 190.629 1.00   248.72 ? 1120 LEU A C   1 
ATOM   5375  O  O   . LEU A  1  702  ? 188.143 160.791 190.598 1.00   253.07 ? 1120 LEU A O   1 
ATOM   5376  C  CB  . LEU A  1  702  ? 189.130 163.179 192.410 1.00   224.63 ? 1120 LEU A CB  1 
ATOM   5377  C  CG  . LEU A  1  702  ? 189.685 163.830 193.674 1.00   202.08 ? 1120 LEU A CG  1 
ATOM   5378  C  CD1 . LEU A  1  702  ? 190.502 165.040 193.243 1.00   191.44 ? 1120 LEU A CD1 1 
ATOM   5379  C  CD2 . LEU A  1  702  ? 188.596 164.201 194.690 1.00   178.77 ? 1120 LEU A CD2 1 
ATOM   5380  N  N   . ASN A  1  703  ? 189.824 161.867 189.533 1.00   275.46 ? 1121 ASN A N   1 
ATOM   5381  C  CA  . ASN A  1  703  ? 189.329 161.574 188.181 1.00   291.28 ? 1121 ASN A CA  1 
ATOM   5382  C  C   . ASN A  1  703  ? 189.332 160.081 187.815 1.00   285.36 ? 1121 ASN A C   1 
ATOM   5383  O  O   . ASN A  1  703  ? 188.644 159.683 186.874 1.00   300.52 ? 1121 ASN A O   1 
ATOM   5384  C  CB  . ASN A  1  703  ? 190.065 162.413 187.120 1.00   296.41 ? 1121 ASN A CB  1 
ATOM   5385  C  CG  . ASN A  1  703  ? 189.871 163.916 187.313 1.00   321.72 ? 1121 ASN A CG  1 
ATOM   5386  O  OD1 . ASN A  1  703  ? 189.777 164.408 188.442 1.00   337.20 ? 1121 ASN A OD1 1 
ATOM   5387  N  ND2 . ASN A  1  703  ? 189.812 164.651 186.206 1.00   333.37 ? 1121 ASN A ND2 1 
ATOM   5388  N  N   . SER A  1  704  ? 190.075 159.256 188.560 1.00   271.08 ? 1122 SER A N   1 
ATOM   5389  C  CA  . SER A  1  704  ? 189.917 157.789 188.477 1.00   259.02 ? 1122 SER A CA  1 
ATOM   5390  C  C   . SER A  1  704  ? 188.551 157.315 189.025 1.00   257.52 ? 1122 SER A C   1 
ATOM   5391  O  O   . SER A  1  704  ? 187.799 158.095 189.611 1.00   252.68 ? 1122 SER A O   1 
ATOM   5392  C  CB  . SER A  1  704  ? 191.078 157.070 189.183 1.00   244.11 ? 1122 SER A CB  1 
ATOM   5393  O  OG  . SER A  1  704  ? 191.196 157.453 190.538 1.00   236.31 ? 1122 SER A OG  1 
ATOM   5394  N  N   . GLY A  1  705  ? 188.240 156.035 188.820 1.00   262.23 ? 1123 GLY A N   1 
ATOM   5395  C  CA  . GLY A  1  705  ? 186.919 155.468 189.139 1.00   269.98 ? 1123 GLY A CA  1 
ATOM   5396  C  C   . GLY A  1  705  ? 186.425 155.537 190.581 1.00   267.00 ? 1123 GLY A C   1 
ATOM   5397  O  O   . GLY A  1  705  ? 185.212 155.559 190.819 1.00   257.98 ? 1123 GLY A O   1 
ATOM   5398  N  N   . ASN A  1  706  ? 187.354 155.570 191.538 1.00   257.35 ? 1124 ASN A N   1 
ATOM   5399  C  CA  . ASN A  1  706  ? 186.999 155.598 192.964 1.00   256.08 ? 1124 ASN A CA  1 
ATOM   5400  C  C   . ASN A  1  706  ? 186.284 156.902 193.296 1.00   256.72 ? 1124 ASN A C   1 
ATOM   5401  O  O   . ASN A  1  706  ? 186.687 157.964 192.815 1.00   268.19 ? 1124 ASN A O   1 
ATOM   5402  C  CB  . ASN A  1  706  ? 188.240 155.463 193.862 1.00   260.64 ? 1124 ASN A CB  1 
ATOM   5403  C  CG  . ASN A  1  706  ? 189.087 154.245 193.532 1.00   267.28 ? 1124 ASN A CG  1 
ATOM   5404  O  OD1 . ASN A  1  706  ? 190.309 154.345 193.363 1.00   215.74 ? 1124 ASN A OD1 1 
ATOM   5405  N  ND2 . ASN A  1  706  ? 188.443 153.090 193.431 1.00   293.68 ? 1124 ASN A ND2 1 
ATOM   5406  N  N   . ILE A  1  707  ? 185.238 156.815 194.120 1.00   253.26 ? 1125 ILE A N   1 
ATOM   5407  C  CA  . ILE A  1  707  ? 184.368 157.959 194.479 1.00   250.50 ? 1125 ILE A CA  1 
ATOM   5408  C  C   . ILE A  1  707  ? 183.520 158.425 193.285 1.00   249.63 ? 1125 ILE A C   1 
ATOM   5409  O  O   . ILE A  1  707  ? 183.937 158.312 192.124 1.00   223.27 ? 1125 ILE A O   1 
ATOM   5410  C  CB  . ILE A  1  707  ? 185.144 159.177 195.085 1.00   256.79 ? 1125 ILE A CB  1 
ATOM   5411  C  CG1 . ILE A  1  707  ? 186.264 158.730 196.037 1.00   272.18 ? 1125 ILE A CG1 1 
ATOM   5412  C  CG2 . ILE A  1  707  ? 184.199 160.125 195.824 1.00   246.15 ? 1125 ILE A CG2 1 
ATOM   5413  C  CD1 . ILE A  1  707  ? 185.845 157.745 197.107 1.00   274.49 ? 1125 ILE A CD1 1 
ATOM   5414  N  N   . ASP A  1  708  ? 182.318 158.921 193.590 1.00   269.53 ? 1126 ASP A N   1 
ATOM   5415  C  CA  . ASP A  1  708  ? 181.452 159.612 192.627 1.00   268.99 ? 1126 ASP A CA  1 
ATOM   5416  C  C   . ASP A  1  708  ? 181.593 161.137 192.849 1.00   273.85 ? 1126 ASP A C   1 
ATOM   5417  O  O   . ASP A  1  708  ? 181.363 161.630 193.961 1.00   278.18 ? 1126 ASP A O   1 
ATOM   5418  C  CB  . ASP A  1  708  ? 179.997 159.145 192.785 1.00   229.32 ? 1126 ASP A CB  1 
ATOM   5419  N  N   . VAL A  1  709  ? 181.991 161.864 191.800 1.00   256.21 ? 1127 VAL A N   1 
ATOM   5420  C  CA  . VAL A  1  709  ? 182.263 163.312 191.875 1.00   235.41 ? 1127 VAL A CA  1 
ATOM   5421  C  C   . VAL A  1  709  ? 181.413 164.020 190.833 1.00   239.89 ? 1127 VAL A C   1 
ATOM   5422  O  O   . VAL A  1  709  ? 181.031 163.399 189.833 1.00   242.78 ? 1127 VAL A O   1 
ATOM   5423  C  CB  . VAL A  1  709  ? 183.763 163.652 191.652 1.00   222.18 ? 1127 VAL A CB  1 
ATOM   5424  C  CG1 . VAL A  1  709  ? 184.621 162.957 192.695 1.00   236.83 ? 1127 VAL A CG1 1 
ATOM   5425  C  CG2 . VAL A  1  709  ? 184.238 163.301 190.242 1.00   213.89 ? 1127 VAL A CG2 1 
ATOM   5426  N  N   . PRO A  1  710  ? 181.121 165.320 191.052 1.00   238.97 ? 1128 PRO A N   1 
ATOM   5427  C  CA  . PRO A  1  710  ? 180.260 166.034 190.090 1.00   240.12 ? 1128 PRO A CA  1 
ATOM   5428  C  C   . PRO A  1  710  ? 180.952 166.179 188.736 1.00   246.66 ? 1128 PRO A C   1 
ATOM   5429  O  O   . PRO A  1  710  ? 182.158 166.420 188.692 1.00   296.79 ? 1128 PRO A O   1 
ATOM   5430  C  CB  . PRO A  1  710  ? 180.022 167.400 190.745 1.00   241.72 ? 1128 PRO A CB  1 
ATOM   5431  C  CG  . PRO A  1  710  ? 181.099 167.552 191.767 1.00   237.25 ? 1128 PRO A CG  1 
ATOM   5432  C  CD  . PRO A  1  710  ? 181.589 166.189 192.150 1.00   214.86 ? 1128 PRO A CD  1 
ATOM   5433  N  N   . PRO A  1  711  ? 180.201 166.027 187.638 1.00   233.35 ? 1129 PRO A N   1 
ATOM   5434  C  CA  . PRO A  1  711  ? 180.831 165.839 186.321 1.00   251.27 ? 1129 PRO A CA  1 
ATOM   5435  C  C   . PRO A  1  711  ? 181.491 167.096 185.735 1.00   236.84 ? 1129 PRO A C   1 
ATOM   5436  O  O   . PRO A  1  711  ? 182.568 167.025 185.145 1.00   236.60 ? 1129 PRO A O   1 
ATOM   5437  C  CB  . PRO A  1  711  ? 179.663 165.374 185.447 1.00   266.63 ? 1129 PRO A CB  1 
ATOM   5438  C  CG  . PRO A  1  711  ? 178.449 165.966 186.091 1.00   263.60 ? 1129 PRO A CG  1 
ATOM   5439  C  CD  . PRO A  1  711  ? 178.730 166.098 187.560 1.00   230.96 ? 1129 PRO A CD  1 
ATOM   5440  N  N   . ASN A  1  712  ? 180.837 168.231 185.929 1.00   217.49 ? 1130 ASN A N   1 
ATOM   5441  C  CA  . ASN A  1  712  ? 181.298 169.515 185.408 1.00   208.30 ? 1130 ASN A CA  1 
ATOM   5442  C  C   . ASN A  1  712  ? 182.567 170.004 186.114 1.00   187.88 ? 1130 ASN A C   1 
ATOM   5443  O  O   . ASN A  1  712  ? 183.414 170.611 185.457 1.00   179.19 ? 1130 ASN A O   1 
ATOM   5444  C  CB  . ASN A  1  712  ? 180.215 170.591 185.626 1.00   257.70 ? 1130 ASN A CB  1 
ATOM   5445  C  CG  . ASN A  1  712  ? 178.811 170.118 185.278 1.00   283.95 ? 1130 ASN A CG  1 
ATOM   5446  O  OD1 . ASN A  1  712  ? 177.856 170.331 186.044 1.00   256.62 ? 1130 ASN A OD1 1 
ATOM   5447  N  ND2 . ASN A  1  712  ? 178.681 169.454 184.135 1.00   327.32 ? 1130 ASN A ND2 1 
ATOM   5448  N  N   . MET A  1  713  ? 182.653 169.710 187.434 1.00   170.39 ? 1131 MET A N   1 
ATOM   5449  C  CA  . MET A  1  713  ? 183.560 170.313 188.446 1.00   150.14 ? 1131 MET A CA  1 
ATOM   5450  C  C   . MET A  1  713  ? 184.921 170.588 187.915 1.00   175.87 ? 1131 MET A C   1 
ATOM   5451  O  O   . MET A  1  713  ? 185.460 169.779 187.142 1.00   177.70 ? 1131 MET A O   1 
ATOM   5452  C  CB  . MET A  1  713  ? 183.729 169.407 189.687 1.00   174.89 ? 1131 MET A CB  1 
ATOM   5453  C  CG  . MET A  1  713  ? 185.019 169.613 190.519 1.00   207.42 ? 1131 MET A CG  1 
ATOM   5454  S  SD  . MET A  1  713  ? 185.315 168.436 191.864 1.00   250.23 ? 1131 MET A SD  1 
ATOM   5455  C  CE  . MET A  1  713  ? 187.096 168.460 192.117 1.00   201.41 ? 1131 MET A CE  1 
ATOM   5456  N  N   . THR A  1  714  ? 185.488 171.703 188.379 1.00   166.36 ? 1132 THR A N   1 
ATOM   5457  C  CA  . THR A  1  714  ? 186.756 172.212 187.873 1.00   164.99 ? 1132 THR A CA  1 
ATOM   5458  C  C   . THR A  1  714  ? 186.558 173.040 186.622 1.00   154.86 ? 1132 THR A C   1 
ATOM   5459  O  O   . THR A  1  714  ? 187.469 173.734 186.244 1.00   147.60 ? 1132 THR A O   1 
ATOM   5460  C  CB  . THR A  1  714  ? 187.816 171.113 187.552 1.00   197.60 ? 1132 THR A CB  1 
ATOM   5461  O  OG1 . THR A  1  714  ? 187.912 170.189 188.641 1.00   253.28 ? 1132 THR A OG1 1 
ATOM   5462  C  CG2 . THR A  1  714  ? 189.206 171.703 187.289 1.00   212.10 ? 1132 THR A CG2 1 
ATOM   5463  N  N   . SER A  1  715  ? 185.404 172.988 185.957 1.00   178.56 ? 1133 SER A N   1 
ATOM   5464  C  CA  . SER A  1  715  ? 185.180 173.870 184.816 1.00   162.83 ? 1133 SER A CA  1 
ATOM   5465  C  C   . SER A  1  715  ? 185.389 175.274 185.320 1.00   138.83 ? 1133 SER A C   1 
ATOM   5466  O  O   . SER A  1  715  ? 186.211 176.008 184.774 1.00   151.86 ? 1133 SER A O   1 
ATOM   5467  C  CB  . SER A  1  715  ? 183.769 173.741 184.227 1.00   179.41 ? 1133 SER A CB  1 
ATOM   5468  O  OG  . SER A  1  715  ? 182.799 174.443 184.994 1.00   165.81 ? 1133 SER A OG  1 
ATOM   5469  N  N   . TRP A  1  716  ? 184.675 175.635 186.380 1.00   111.77 ? 1134 TRP A N   1 
ATOM   5470  C  CA  . TRP A  1  716  ? 184.772 176.999 186.837 1.00   112.81 ? 1134 TRP A CA  1 
ATOM   5471  C  C   . TRP A  1  716  ? 186.142 177.294 187.434 1.00   108.51 ? 1134 TRP A C   1 
ATOM   5472  O  O   . TRP A  1  716  ? 186.721 178.320 187.142 1.00   100.28 ? 1134 TRP A O   1 
ATOM   5473  C  CB  . TRP A  1  716  ? 183.606 177.367 187.769 1.00   116.88 ? 1134 TRP A CB  1 
ATOM   5474  C  CG  . TRP A  1  716  ? 182.473 177.845 186.983 1.00   110.22 ? 1134 TRP A CG  1 
ATOM   5475  C  CD1 . TRP A  1  716  ? 181.377 177.137 186.594 1.00   150.41 ? 1134 TRP A CD1 1 
ATOM   5476  C  CD2 . TRP A  1  716  ? 182.346 179.110 186.404 1.00   103.93 ? 1134 TRP A CD2 1 
ATOM   5477  N  NE1 . TRP A  1  716  ? 180.561 177.902 185.804 1.00   147.44 ? 1134 TRP A NE1 1 
ATOM   5478  C  CE2 . TRP A  1  716  ? 181.137 179.133 185.685 1.00   132.94 ? 1134 TRP A CE2 1 
ATOM   5479  C  CE3 . TRP A  1  716  ? 183.151 180.221 186.383 1.00   116.98 ? 1134 TRP A CE3 1 
ATOM   5480  C  CZ2 . TRP A  1  716  ? 180.724 180.231 184.963 1.00   139.61 ? 1134 TRP A CZ2 1 
ATOM   5481  C  CZ3 . TRP A  1  716  ? 182.729 181.320 185.687 1.00   136.57 ? 1134 TRP A CZ3 1 
ATOM   5482  C  CH2 . TRP A  1  716  ? 181.529 181.320 184.982 1.00   133.74 ? 1134 TRP A CH2 1 
ATOM   5483  N  N   . ALA A  1  717  ? 186.690 176.393 188.232 1.00   114.30 ? 1135 ALA A N   1 
ATOM   5484  C  CA  . ALA A  1  717  ? 188.026 176.642 188.769 1.00   120.85 ? 1135 ALA A CA  1 
ATOM   5485  C  C   . ALA A  1  717  ? 189.050 176.909 187.654 1.00   117.99 ? 1135 ALA A C   1 
ATOM   5486  O  O   . ALA A  1  717  ? 189.887 177.805 187.779 1.00   137.90 ? 1135 ALA A O   1 
ATOM   5487  C  CB  . ALA A  1  717  ? 188.484 175.491 189.651 1.00   126.57 ? 1135 ALA A CB  1 
ATOM   5488  N  N   . SER A  1  718  ? 188.956 176.157 186.559 1.00   105.75 ? 1136 SER A N   1 
ATOM   5489  C  CA  . SER A  1  718  ? 189.859 176.335 185.423 1.00   107.55 ? 1136 SER A CA  1 
ATOM   5490  C  C   . SER A  1  718  ? 189.749 177.736 184.886 1.00   99.63  ? 1136 SER A C   1 
ATOM   5491  O  O   . SER A  1  718  ? 190.734 178.426 184.796 1.00   123.86 ? 1136 SER A O   1 
ATOM   5492  C  CB  . SER A  1  718  ? 189.580 175.357 184.288 1.00   131.92 ? 1136 SER A CB  1 
ATOM   5493  O  OG  . SER A  1  718  ? 190.791 175.005 183.647 1.00   163.96 ? 1136 SER A OG  1 
ATOM   5494  N  N   . PHE A  1  719  ? 188.546 178.175 184.569 1.00   96.04  ? 1137 PHE A N   1 
ATOM   5495  C  CA  . PHE A  1  719  ? 188.305 179.584 184.208 1.00   82.13  ? 1137 PHE A CA  1 
ATOM   5496  C  C   . PHE A  1  719  ? 188.937 180.556 185.214 1.00   84.56  ? 1137 PHE A C   1 
ATOM   5497  O  O   . PHE A  1  719  ? 189.628 181.466 184.833 1.00   99.31  ? 1137 PHE A O   1 
ATOM   5498  C  CB  . PHE A  1  719  ? 186.801 179.841 184.136 1.00   72.22  ? 1137 PHE A CB  1 
ATOM   5499  C  CG  . PHE A  1  719  ? 186.449 181.201 183.728 1.00   75.45  ? 1137 PHE A CG  1 
ATOM   5500  C  CD1 . PHE A  1  719  ? 186.483 182.289 184.683 1.00   83.44  ? 1137 PHE A CD1 1 
ATOM   5501  C  CD2 . PHE A  1  719  ? 186.053 181.450 182.413 1.00   77.88  ? 1137 PHE A CD2 1 
ATOM   5502  C  CE1 . PHE A  1  719  ? 186.135 183.611 184.288 1.00   87.61  ? 1137 PHE A CE1 1 
ATOM   5503  C  CE2 . PHE A  1  719  ? 185.709 182.778 182.026 1.00   105.66 ? 1137 PHE A CE2 1 
ATOM   5504  C  CZ  . PHE A  1  719  ? 185.741 183.867 182.950 1.00   83.80  ? 1137 PHE A CZ  1 
ATOM   5505  N  N   . HIS A  1  720  ? 188.692 180.389 186.498 1.00   92.25  ? 1138 HIS A N   1 
ATOM   5506  C  CA  . HIS A  1  720  ? 189.299 181.303 187.467 1.00   107.69 ? 1138 HIS A CA  1 
ATOM   5507  C  C   . HIS A  1  720  ? 190.782 181.322 187.294 1.00   104.28 ? 1138 HIS A C   1 
ATOM   5508  O  O   . HIS A  1  720  ? 191.421 182.378 187.349 1.00   107.85 ? 1138 HIS A O   1 
ATOM   5509  C  CB  . HIS A  1  720  ? 188.942 180.940 188.912 1.00   114.83 ? 1138 HIS A CB  1 
ATOM   5510  C  CG  . HIS A  1  720  ? 187.556 181.320 189.227 1.00   132.19 ? 1138 HIS A CG  1 
ATOM   5511  N  ND1 . HIS A  1  720  ? 186.517 180.452 189.045 1.00   156.61 ? 1138 HIS A ND1 1 
ATOM   5512  C  CD2 . HIS A  1  720  ? 187.005 182.515 189.526 1.00   136.36 ? 1138 HIS A CD2 1 
ATOM   5513  C  CE1 . HIS A  1  720  ? 185.384 181.073 189.315 1.00   171.28 ? 1138 HIS A CE1 1 
ATOM   5514  N  NE2 . HIS A  1  720  ? 185.655 182.328 189.611 1.00   156.62 ? 1138 HIS A NE2 1 
ATOM   5515  N  N   . ASN A  1  721  ? 191.312 180.133 187.071 1.00   95.57  ? 1139 ASN A N   1 
ATOM   5516  C  CA  . ASN A  1  721  ? 192.726 179.922 187.049 1.00   97.79  ? 1139 ASN A CA  1 
ATOM   5517  C  C   . ASN A  1  721  ? 193.339 180.626 185.883 1.00   99.70  ? 1139 ASN A C   1 
ATOM   5518  O  O   . ASN A  1  721  ? 194.363 181.296 185.993 1.00   129.28 ? 1139 ASN A O   1 
ATOM   5519  C  CB  . ASN A  1  721  ? 192.973 178.458 186.915 1.00   99.89  ? 1139 ASN A CB  1 
ATOM   5520  C  CG  . ASN A  1  721  ? 194.397 178.156 186.954 1.00   119.05 ? 1139 ASN A CG  1 
ATOM   5521  O  OD1 . ASN A  1  721  ? 195.059 178.531 187.919 1.00   140.96 ? 1139 ASN A OD1 1 
ATOM   5522  N  ND2 . ASN A  1  721  ? 194.916 177.526 185.897 1.00   128.99 ? 1139 ASN A ND2 1 
ATOM   5523  N  N   . GLY A  1  722  ? 192.675 180.479 184.756 1.00   85.16  ? 1140 GLY A N   1 
ATOM   5524  C  CA  . GLY A  1  722  ? 192.991 181.290 183.593 1.00   92.23  ? 1140 GLY A CA  1 
ATOM   5525  C  C   . GLY A  1  722  ? 192.872 182.800 183.782 1.00   83.14  ? 1140 GLY A C   1 
ATOM   5526  O  O   . GLY A  1  722  ? 193.741 183.538 183.357 1.00   98.26  ? 1140 GLY A O   1 
ATOM   5527  N  N   . VAL A  1  723  ? 191.810 183.264 184.420 1.00   73.13  ? 1141 VAL A N   1 
ATOM   5528  C  CA  . VAL A  1  723  ? 191.700 184.683 184.665 1.00   81.92  ? 1141 VAL A CA  1 
ATOM   5529  C  C   . VAL A  1  723  ? 192.826 185.148 185.591 1.00   93.20  ? 1141 VAL A C   1 
ATOM   5530  O  O   . VAL A  1  723  ? 193.340 186.266 185.514 1.00   97.83  ? 1141 VAL A O   1 
ATOM   5531  C  CB  . VAL A  1  723  ? 190.414 185.073 185.387 1.00   90.66  ? 1141 VAL A CB  1 
ATOM   5532  C  CG1 . VAL A  1  723  ? 190.296 186.617 185.466 1.00   103.33 ? 1141 VAL A CG1 1 
ATOM   5533  C  CG2 . VAL A  1  723  ? 189.202 184.471 184.714 1.00   92.18  ? 1141 VAL A CG2 1 
ATOM   5534  N  N   . ALA A  1  724  ? 193.164 184.299 186.529 1.00   86.72  ? 1142 ALA A N   1 
ATOM   5535  C  CA  . ALA A  1  724  ? 194.201 184.655 187.421 1.00   107.78 ? 1142 ALA A CA  1 
ATOM   5536  C  C   . ALA A  1  724  ? 195.421 184.979 186.589 1.00   116.02 ? 1142 ALA A C   1 
ATOM   5537  O  O   . ALA A  1  724  ? 196.006 186.066 186.749 1.00   132.87 ? 1142 ALA A O   1 
ATOM   5538  C  CB  . ALA A  1  724  ? 194.479 183.496 188.344 1.00   142.79 ? 1142 ALA A CB  1 
ATOM   5539  N  N   . ALA A  1  725  ? 195.767 184.040 185.695 1.00   92.77  ? 1143 ALA A N   1 
ATOM   5540  C  CA  . ALA A  1  725  ? 196.898 184.206 184.781 1.00   104.23 ? 1143 ALA A CA  1 
ATOM   5541  C  C   . ALA A  1  725  ? 196.859 185.496 183.918 1.00   104.43 ? 1143 ALA A C   1 
ATOM   5542  O  O   . ALA A  1  725  ? 197.816 186.263 183.846 1.00   114.14 ? 1143 ALA A O   1 
ATOM   5543  C  CB  . ALA A  1  725  ? 197.025 183.008 183.869 1.00   102.11 ? 1143 ALA A CB  1 
ATOM   5544  N  N   . GLY A  1  726  ? 195.752 185.753 183.267 1.00   99.04  ? 1144 GLY A N   1 
ATOM   5545  C  CA  . GLY A  1  726  ? 195.684 186.950 182.455 1.00   106.89 ? 1144 GLY A CA  1 
ATOM   5546  C  C   . GLY A  1  726  ? 195.730 188.262 183.256 1.00   114.60 ? 1144 GLY A C   1 
ATOM   5547  O  O   . GLY A  1  726  ? 196.013 189.375 182.727 1.00   122.45 ? 1144 GLY A O   1 
ATOM   5548  N  N   . LEU A  1  727  ? 195.397 188.173 184.530 1.00   104.16 ? 1145 LEU A N   1 
ATOM   5549  C  CA  . LEU A  1  727  ? 195.364 189.372 185.289 1.00   100.43 ? 1145 LEU A CA  1 
ATOM   5550  C  C   . LEU A  1  727  ? 196.757 189.803 185.526 1.00   107.12 ? 1145 LEU A C   1 
ATOM   5551  O  O   . LEU A  1  727  ? 196.966 190.993 185.733 1.00   124.44 ? 1145 LEU A O   1 
ATOM   5552  C  CB  . LEU A  1  727  ? 194.567 189.202 186.577 1.00   96.70  ? 1145 LEU A CB  1 
ATOM   5553  C  CG  . LEU A  1  727  ? 193.097 189.451 186.207 1.00   100.72 ? 1145 LEU A CG  1 
ATOM   5554  C  CD1 . LEU A  1  727  ? 192.152 189.273 187.388 1.00   99.91  ? 1145 LEU A CD1 1 
ATOM   5555  C  CD2 . LEU A  1  727  ? 192.905 190.823 185.530 1.00   102.06 ? 1145 LEU A CD2 1 
ATOM   5556  N  N   . LYS A  1  728  ? 197.715 188.872 185.458 1.00   96.29  ? 1146 LYS A N   1 
ATOM   5557  C  CA  . LYS A  1  728  ? 199.089 189.253 185.695 1.00   94.89  ? 1146 LYS A CA  1 
ATOM   5558  C  C   . LYS A  1  728  ? 199.747 190.067 184.591 1.00   96.24  ? 1146 LYS A C   1 
ATOM   5559  O  O   . LYS A  1  728  ? 200.693 190.794 184.878 1.00   132.73 ? 1146 LYS A O   1 
ATOM   5560  C  CB  . LYS A  1  728  ? 199.945 188.101 186.240 1.00   105.70 ? 1146 LYS A CB  1 
ATOM   5561  C  CG  . LYS A  1  728  ? 200.534 187.032 185.349 1.00   112.27 ? 1146 LYS A CG  1 
ATOM   5562  C  CD  . LYS A  1  728  ? 201.585 186.266 186.173 1.00   127.49 ? 1146 LYS A CD  1 
ATOM   5563  C  CE  . LYS A  1  728  ? 201.529 184.766 185.881 1.00   173.26 ? 1146 LYS A CE  1 
ATOM   5564  N  NZ  . LYS A  1  728  ? 200.454 184.042 186.643 1.00   202.65 ? 1146 LYS A NZ  1 
ATOM   5565  N  N   . ILE A  1  729  ? 199.219 190.037 183.376 1.00   93.36  ? 1147 ILE A N   1 
ATOM   5566  C  CA  . ILE A  1  729  ? 199.735 190.911 182.306 1.00   86.92  ? 1147 ILE A CA  1 
ATOM   5567  C  C   . ILE A  1  729  ? 199.551 192.354 182.671 1.00   81.85  ? 1147 ILE A C   1 
ATOM   5568  O  O   . ILE A  1  729  ? 198.473 192.714 183.035 1.00   114.00 ? 1147 ILE A O   1 
ATOM   5569  C  CB  . ILE A  1  729  ? 198.999 190.667 181.012 1.00   89.38  ? 1147 ILE A CB  1 
ATOM   5570  C  CG1 . ILE A  1  729  ? 199.327 189.255 180.523 1.00   110.31 ? 1147 ILE A CG1 1 
ATOM   5571  C  CG2 . ILE A  1  729  ? 199.399 191.711 179.978 1.00   88.52  ? 1147 ILE A CG2 1 
ATOM   5572  C  CD1 . ILE A  1  729  ? 198.191 188.653 179.741 1.00   125.82 ? 1147 ILE A CD1 1 
ATOM   5573  N  N   . ALA A  1  730  ? 200.581 193.184 182.576 1.00   93.38  ? 1148 ALA A N   1 
ATOM   5574  C  CA  . ALA A  1  730  ? 200.495 194.538 183.140 1.00   104.67 ? 1148 ALA A CA  1 
ATOM   5575  C  C   . ALA A  1  730  ? 199.742 195.426 182.175 1.00   116.65 ? 1148 ALA A C   1 
ATOM   5576  O  O   . ALA A  1  730  ? 199.826 195.225 180.957 1.00   113.26 ? 1148 ALA A O   1 
ATOM   5577  C  CB  . ALA A  1  730  ? 201.860 195.127 183.410 1.00   117.73 ? 1148 ALA A CB  1 
ATOM   5578  N  N   . PRO A  1  731  ? 199.001 196.413 182.701 1.00   128.71 ? 1149 PRO A N   1 
ATOM   5579  C  CA  . PRO A  1  731  ? 198.232 197.370 181.887 1.00   137.83 ? 1149 PRO A CA  1 
ATOM   5580  C  C   . PRO A  1  731  ? 199.081 198.269 181.016 1.00   147.58 ? 1149 PRO A C   1 
ATOM   5581  O  O   . PRO A  1  731  ? 198.591 198.789 180.021 1.00   154.83 ? 1149 PRO A O   1 
ATOM   5582  C  CB  . PRO A  1  731  ? 197.538 198.244 182.928 1.00   150.43 ? 1149 PRO A CB  1 
ATOM   5583  C  CG  . PRO A  1  731  ? 197.556 197.437 184.174 1.00   150.16 ? 1149 PRO A CG  1 
ATOM   5584  C  CD  . PRO A  1  731  ? 198.835 196.676 184.134 1.00   133.89 ? 1149 PRO A CD  1 
ATOM   5585  N  N   . ALA A  1  732  ? 200.329 198.488 181.422 1.00   162.46 ? 1150 ALA A N   1 
ATOM   5586  C  CA  . ALA A  1  732  ? 201.318 199.185 180.610 1.00   178.50 ? 1150 ALA A CA  1 
ATOM   5587  C  C   . ALA A  1  732  ? 201.611 198.459 179.278 1.00   184.70 ? 1150 ALA A C   1 
ATOM   5588  O  O   . ALA A  1  732  ? 201.422 199.050 178.205 1.00   178.34 ? 1150 ALA A O   1 
ATOM   5589  C  CB  . ALA A  1  732  ? 202.598 199.345 181.420 1.00   185.79 ? 1150 ALA A CB  1 
ATOM   5590  N  N   . SER A  1  733  ? 202.014 197.179 179.379 1.00   176.15 ? 1151 SER A N   1 
ATOM   5591  C  CA  . SER A  1  733  ? 202.652 196.404 178.279 1.00   171.71 ? 1151 SER A CA  1 
ATOM   5592  C  C   . SER A  1  733  ? 201.829 196.288 177.006 1.00   152.53 ? 1151 SER A C   1 
ATOM   5593  O  O   . SER A  1  733  ? 200.612 196.207 177.081 1.00   182.08 ? 1151 SER A O   1 
ATOM   5594  C  CB  . SER A  1  733  ? 202.989 194.986 178.749 1.00   186.60 ? 1151 SER A CB  1 
ATOM   5595  O  OG  . SER A  1  733  ? 201.815 194.202 178.853 1.00   197.74 ? 1151 SER A OG  1 
ATOM   5596  N  N   . GLN A  1  734  ? 202.509 196.248 175.859 1.00   154.95 ? 1152 GLN A N   1 
ATOM   5597  C  CA  . GLN A  1  734  ? 201.873 196.418 174.547 1.00   173.80 ? 1152 GLN A CA  1 
ATOM   5598  C  C   . GLN A  1  734  ? 201.639 195.080 173.914 1.00   171.08 ? 1152 GLN A C   1 
ATOM   5599  O  O   . GLN A  1  734  ? 202.617 194.421 173.542 1.00   188.98 ? 1152 GLN A O   1 
ATOM   5600  C  CB  . GLN A  1  734  ? 202.806 197.181 173.618 1.00   198.33 ? 1152 GLN A CB  1 
ATOM   5601  C  CG  . GLN A  1  734  ? 203.280 198.523 174.126 1.00   233.47 ? 1152 GLN A CG  1 
ATOM   5602  C  CD  . GLN A  1  734  ? 204.531 198.991 173.408 1.00   271.77 ? 1152 GLN A CD  1 
ATOM   5603  O  OE1 . GLN A  1  734  ? 204.802 198.594 172.271 1.00   289.68 ? 1152 GLN A OE1 1 
ATOM   5604  N  NE2 . GLN A  1  734  ? 205.305 199.838 174.072 1.00   322.90 ? 1152 GLN A NE2 1 
ATOM   5605  N  N   . ILE A  1  735  ? 200.383 194.659 173.769 1.00   153.83 ? 1153 ILE A N   1 
ATOM   5606  C  CA  . ILE A  1  735  ? 200.134 193.332 173.189 1.00   152.28 ? 1153 ILE A CA  1 
ATOM   5607  C  C   . ILE A  1  735  ? 199.156 193.384 172.034 1.00   144.52 ? 1153 ILE A C   1 
ATOM   5608  O  O   . ILE A  1  735  ? 198.134 194.020 172.155 1.00   170.95 ? 1153 ILE A O   1 
ATOM   5609  C  CB  . ILE A  1  735  ? 199.700 192.288 174.249 1.00   149.40 ? 1153 ILE A CB  1 
ATOM   5610  C  CG1 . ILE A  1  735  ? 198.347 192.605 174.847 1.00   133.20 ? 1153 ILE A CG1 1 
ATOM   5611  C  CG2 . ILE A  1  735  ? 200.737 192.165 175.372 1.00   164.82 ? 1153 ILE A CG2 1 
ATOM   5612  C  CD1 . ILE A  1  735  ? 197.846 191.427 175.644 1.00   141.47 ? 1153 ILE A CD1 1 
ATOM   5613  N  N   . ASP A  1  736  ? 199.475 192.720 170.923 1.00   147.41 ? 1154 ASP A N   1 
ATOM   5614  C  CA  . ASP A  1  736  ? 198.610 192.736 169.716 1.00   174.09 ? 1154 ASP A CA  1 
ATOM   5615  C  C   . ASP A  1  736  ? 197.582 191.631 169.748 1.00   149.90 ? 1154 ASP A C   1 
ATOM   5616  O  O   . ASP A  1  736  ? 197.655 190.738 170.569 1.00   163.01 ? 1154 ASP A O   1 
ATOM   5617  C  CB  . ASP A  1  736  ? 199.403 192.695 168.381 1.00   231.21 ? 1154 ASP A CB  1 
ATOM   5618  C  CG  . ASP A  1  736  ? 200.453 191.560 168.306 1.00   281.40 ? 1154 ASP A CG  1 
ATOM   5619  O  OD1 . ASP A  1  736  ? 200.938 191.103 169.364 1.00   334.06 ? 1154 ASP A OD1 1 
ATOM   5620  O  OD2 . ASP A  1  736  ? 200.826 191.156 167.175 1.00   286.89 ? 1154 ASP A OD2 1 
ATOM   5621  N  N   . SER A  1  737  ? 196.608 191.726 168.860 1.00   129.75 ? 1155 SER A N   1 
ATOM   5622  C  CA  . SER A  1  737  ? 195.608 190.687 168.716 1.00   148.16 ? 1155 SER A CA  1 
ATOM   5623  C  C   . SER A  1  737  ? 196.227 189.307 168.551 1.00   143.04 ? 1155 SER A C   1 
ATOM   5624  O  O   . SER A  1  737  ? 195.844 188.335 169.228 1.00   121.73 ? 1155 SER A O   1 
ATOM   5625  C  CB  . SER A  1  737  ? 194.757 190.955 167.479 1.00   173.34 ? 1155 SER A CB  1 
ATOM   5626  O  OG  . SER A  1  737  ? 193.969 189.817 167.118 1.00   180.46 ? 1155 SER A OG  1 
ATOM   5627  N  N   . ALA A  1  738  ? 197.166 189.227 167.614 1.00   135.61 ? 1156 ALA A N   1 
ATOM   5628  C  CA  . ALA A  1  738  ? 197.765 187.968 167.260 1.00   133.10 ? 1156 ALA A CA  1 
ATOM   5629  C  C   . ALA A  1  738  ? 198.336 187.319 168.472 1.00   115.50 ? 1156 ALA A C   1 
ATOM   5630  O  O   . ALA A  1  738  ? 198.297 186.122 168.541 1.00   94.07  ? 1156 ALA A O   1 
ATOM   5631  C  CB  . ALA A  1  738  ? 198.847 188.173 166.241 1.00   160.65 ? 1156 ALA A CB  1 
ATOM   5632  N  N   . TRP A  1  739  ? 198.876 188.094 169.418 1.00   117.46 ? 1157 TRP A N   1 
ATOM   5633  C  CA  . TRP A  1  739  ? 199.386 187.515 170.675 1.00   102.49 ? 1157 TRP A CA  1 
ATOM   5634  C  C   . TRP A  1  739  ? 198.325 186.850 171.480 1.00   91.72  ? 1157 TRP A C   1 
ATOM   5635  O  O   . TRP A  1  739  ? 198.522 185.760 171.941 1.00   107.52 ? 1157 TRP A O   1 
ATOM   5636  C  CB  . TRP A  1  739  ? 200.038 188.542 171.554 1.00   103.06 ? 1157 TRP A CB  1 
ATOM   5637  C  CG  . TRP A  1  739  ? 200.722 187.935 172.656 1.00   105.15 ? 1157 TRP A CG  1 
ATOM   5638  C  CD1 . TRP A  1  739  ? 201.904 187.330 172.616 1.00   119.19 ? 1157 TRP A CD1 1 
ATOM   5639  C  CD2 . TRP A  1  739  ? 200.273 187.866 173.988 1.00   103.18 ? 1157 TRP A CD2 1 
ATOM   5640  N  NE1 . TRP A  1  739  ? 202.242 186.893 173.845 1.00   127.94 ? 1157 TRP A NE1 1 
ATOM   5641  C  CE2 . TRP A  1  739  ? 201.246 187.218 174.713 1.00   103.74 ? 1157 TRP A CE2 1 
ATOM   5642  C  CE3 . TRP A  1  739  ? 199.150 188.322 174.643 1.00   112.29 ? 1157 TRP A CE3 1 
ATOM   5643  C  CZ2 . TRP A  1  739  ? 201.140 186.999 176.044 1.00   103.38 ? 1157 TRP A CZ2 1 
ATOM   5644  C  CZ3 . TRP A  1  739  ? 199.042 188.108 175.954 1.00   115.44 ? 1157 TRP A CZ3 1 
ATOM   5645  C  CH2 . TRP A  1  739  ? 200.030 187.446 176.654 1.00   108.10 ? 1157 TRP A CH2 1 
ATOM   5646  N  N   . ILE A  1  740  ? 197.190 187.510 171.645 1.00   99.91  ? 1158 ILE A N   1 
ATOM   5647  C  CA  . ILE A  1  740  ? 196.061 186.939 172.354 1.00   96.75  ? 1158 ILE A CA  1 
ATOM   5648  C  C   . ILE A  1  740  ? 195.635 185.650 171.688 1.00   102.95 ? 1158 ILE A C   1 
ATOM   5649  O  O   . ILE A  1  740  ? 195.574 184.644 172.352 1.00   127.70 ? 1158 ILE A O   1 
ATOM   5650  C  CB  . ILE A  1  740  ? 194.929 187.933 172.407 1.00   96.72  ? 1158 ILE A CB  1 
ATOM   5651  C  CG1 . ILE A  1  740  ? 195.225 188.946 173.512 1.00   112.59 ? 1158 ILE A CG1 1 
ATOM   5652  C  CG2 . ILE A  1  740  ? 193.610 187.249 172.666 1.00   114.48 ? 1158 ILE A CG2 1 
ATOM   5653  C  CD1 . ILE A  1  740  ? 194.782 190.362 173.157 1.00   122.35 ? 1158 ILE A CD1 1 
ATOM   5654  N  N   . VAL A  1  741  ? 195.383 185.647 170.391 1.00   95.20  ? 1159 VAL A N   1 
ATOM   5655  C  CA  . VAL A  1  741  ? 195.096 184.376 169.694 1.00   107.20 ? 1159 VAL A CA  1 
ATOM   5656  C  C   . VAL A  1  741  ? 196.201 183.307 169.835 1.00   117.53 ? 1159 VAL A C   1 
ATOM   5657  O  O   . VAL A  1  741  ? 195.942 182.098 169.737 1.00   128.50 ? 1159 VAL A O   1 
ATOM   5658  C  CB  . VAL A  1  741  ? 194.953 184.625 168.198 1.00   122.98 ? 1159 VAL A CB  1 
ATOM   5659  C  CG1 . VAL A  1  741  ? 194.610 183.327 167.448 1.00   123.18 ? 1159 VAL A CG1 1 
ATOM   5660  C  CG2 . VAL A  1  741  ? 193.927 185.722 167.961 1.00   146.70 ? 1159 VAL A CG2 1 
ATOM   5661  N  N   . TYR A  1  742  ? 197.445 183.759 170.000 1.00   116.24 ? 1160 TYR A N   1 
ATOM   5662  C  CA  . TYR A  1  742  ? 198.615 182.872 170.045 1.00   114.80 ? 1160 TYR A CA  1 
ATOM   5663  C  C   . TYR A  1  742  ? 198.599 181.993 171.259 1.00   115.65 ? 1160 TYR A C   1 
ATOM   5664  O  O   . TYR A  1  742  ? 199.080 180.855 171.184 1.00   134.13 ? 1160 TYR A O   1 
ATOM   5665  C  CB  . TYR A  1  742  ? 199.941 183.689 169.995 1.00   124.23 ? 1160 TYR A CB  1 
ATOM   5666  C  CG  . TYR A  1  742  ? 201.173 182.826 170.101 1.00   115.31 ? 1160 TYR A CG  1 
ATOM   5667  C  CD1 . TYR A  1  742  ? 201.458 181.902 169.124 1.00   131.68 ? 1160 TYR A CD1 1 
ATOM   5668  C  CD2 . TYR A  1  742  ? 201.988 182.887 171.197 1.00   115.12 ? 1160 TYR A CD2 1 
ATOM   5669  C  CE1 . TYR A  1  742  ? 202.546 181.081 169.222 1.00   135.60 ? 1160 TYR A CE1 1 
ATOM   5670  C  CE2 . TYR A  1  742  ? 203.052 182.053 171.326 1.00   117.28 ? 1160 TYR A CE2 1 
ATOM   5671  C  CZ  . TYR A  1  742  ? 203.334 181.155 170.333 1.00   126.40 ? 1160 TYR A CZ  1 
ATOM   5672  O  OH  . TYR A  1  742  ? 204.423 180.323 170.434 1.00   150.79 ? 1160 TYR A OH  1 
ATOM   5673  N  N   . ASN A  1  743  ? 198.044 182.535 172.358 1.00   97.63  ? 1161 ASN A N   1 
ATOM   5674  C  CA  . ASN A  1  743  ? 197.801 181.772 173.589 1.00   108.90 ? 1161 ASN A CA  1 
ATOM   5675  C  C   . ASN A  1  743  ? 196.596 180.769 173.582 1.00   111.64 ? 1161 ASN A C   1 
ATOM   5676  O  O   . ASN A  1  743  ? 196.422 180.052 174.572 1.00   124.17 ? 1161 ASN A O   1 
ATOM   5677  C  CB  . ASN A  1  743  ? 197.580 182.726 174.754 1.00   120.89 ? 1161 ASN A CB  1 
ATOM   5678  C  CG  . ASN A  1  743  ? 198.771 183.642 175.026 1.00   142.38 ? 1161 ASN A CG  1 
ATOM   5679  O  OD1 . ASN A  1  743  ? 199.030 184.637 174.336 1.00   132.46 ? 1161 ASN A OD1 1 
ATOM   5680  N  ND2 . ASN A  1  743  ? 199.443 183.349 176.106 1.00   183.99 ? 1161 ASN A ND2 1 
ATOM   5681  N  N   . LYS A  1  744  ? 195.765 180.715 172.520 1.00   112.38 ? 1162 LYS A N   1 
ATOM   5682  C  CA  . LYS A  1  744  ? 194.696 179.686 172.406 1.00   126.74 ? 1162 LYS A CA  1 
ATOM   5683  C  C   . LYS A  1  744  ? 195.313 178.338 172.609 1.00   126.96 ? 1162 LYS A C   1 
ATOM   5684  O  O   . LYS A  1  744  ? 196.408 178.135 172.129 1.00   179.76 ? 1162 LYS A O   1 
ATOM   5685  C  CB  . LYS A  1  744  ? 193.987 179.676 171.050 1.00   135.93 ? 1162 LYS A CB  1 
ATOM   5686  C  CG  . LYS A  1  744  ? 192.894 178.597 170.958 1.00   156.84 ? 1162 LYS A CG  1 
ATOM   5687  C  CD  . LYS A  1  744  ? 191.644 179.055 170.240 1.00   190.80 ? 1162 LYS A CD  1 
ATOM   5688  C  CE  . LYS A  1  744  ? 191.831 179.071 168.728 1.00   227.88 ? 1162 LYS A CE  1 
ATOM   5689  N  NZ  . LYS A  1  744  ? 191.329 180.310 168.050 1.00   249.40 ? 1162 LYS A NZ  1 
ATOM   5690  N  N   . PRO A  1  745  ? 194.634 177.407 173.298 1.00   127.60 ? 1163 PRO A N   1 
ATOM   5691  C  CA  . PRO A  1  745  ? 195.480 176.330 173.767 1.00   174.61 ? 1163 PRO A CA  1 
ATOM   5692  C  C   . PRO A  1  745  ? 195.510 175.074 172.866 1.00   198.90 ? 1163 PRO A C   1 
ATOM   5693  O  O   . PRO A  1  745  ? 196.446 174.250 173.007 1.00   185.10 ? 1163 PRO A O   1 
ATOM   5694  C  CB  . PRO A  1  745  ? 194.936 176.058 175.165 1.00   179.11 ? 1163 PRO A CB  1 
ATOM   5695  C  CG  . PRO A  1  745  ? 193.530 176.525 175.134 1.00   166.46 ? 1163 PRO A CG  1 
ATOM   5696  C  CD  . PRO A  1  745  ? 193.292 177.310 173.883 1.00   143.55 ? 1163 PRO A CD  1 
ATOM   5697  N  N   . LYS A  1  746  ? 194.522 174.918 171.977 1.00   196.37 ? 1164 LYS A N   1 
ATOM   5698  C  CA  . LYS A  1  746  ? 194.560 173.929 170.868 1.00   240.95 ? 1164 LYS A CA  1 
ATOM   5699  C  C   . LYS A  1  746  ? 194.746 172.435 171.225 1.00   251.01 ? 1164 LYS A C   1 
ATOM   5700  O  O   . LYS A  1  746  ? 194.750 171.584 170.325 1.00   236.30 ? 1164 LYS A O   1 
ATOM   5701  C  CB  . LYS A  1  746  ? 195.558 174.362 169.771 1.00   250.80 ? 1164 LYS A CB  1 
ATOM   5702  C  CG  . LYS A  1  746  ? 196.970 173.778 169.840 1.00   274.45 ? 1164 LYS A CG  1 
ATOM   5703  C  CD  . LYS A  1  746  ? 197.874 174.406 168.788 1.00   306.49 ? 1164 LYS A CD  1 
ATOM   5704  C  CE  . LYS A  1  746  ? 199.350 174.119 169.044 1.00   329.82 ? 1164 LYS A CE  1 
ATOM   5705  N  NZ  . LYS A  1  746  ? 199.716 172.691 168.825 1.00   341.79 ? 1164 LYS A NZ  1 
ATOM   5706  N  N   . HIS A  1  747  ? 194.925 172.123 172.513 1.00   252.20 ? 1165 HIS A N   1 
ATOM   5707  C  CA  . HIS A  1  747  ? 194.648 170.797 173.047 1.00   248.25 ? 1165 HIS A CA  1 
ATOM   5708  C  C   . HIS A  1  747  ? 193.160 170.504 172.875 1.00   261.89 ? 1165 HIS A C   1 
ATOM   5709  O  O   . HIS A  1  747  ? 192.791 169.365 172.588 1.00   311.91 ? 1165 HIS A O   1 
ATOM   5710  C  CB  . HIS A  1  747  ? 195.006 170.735 174.532 1.00   260.30 ? 1165 HIS A CB  1 
ATOM   5711  C  CG  . HIS A  1  747  ? 194.770 169.394 175.159 1.00   287.64 ? 1165 HIS A CG  1 
ATOM   5712  N  ND1 . HIS A  1  747  ? 195.799 168.553 175.522 1.00   296.45 ? 1165 HIS A ND1 1 
ATOM   5713  C  CD2 . HIS A  1  747  ? 193.625 168.754 175.496 1.00   307.85 ? 1165 HIS A CD2 1 
ATOM   5714  C  CE1 . HIS A  1  747  ? 195.299 167.450 176.050 1.00   303.87 ? 1165 HIS A CE1 1 
ATOM   5715  N  NE2 . HIS A  1  747  ? 193.980 167.544 176.043 1.00   301.20 ? 1165 HIS A NE2 1 
ATOM   5716  N  N   . ALA A  1  748  ? 192.323 171.533 173.063 1.00   236.06 ? 1166 ALA A N   1 
ATOM   5717  C  CA  . ALA A  1  748  ? 190.852 171.449 172.946 1.00   248.96 ? 1166 ALA A CA  1 
ATOM   5718  C  C   . ALA A  1  748  ? 190.165 170.856 174.189 1.00   239.96 ? 1166 ALA A C   1 
ATOM   5719  O  O   . ALA A  1  748  ? 189.007 170.446 174.135 1.00   278.60 ? 1166 ALA A O   1 
ATOM   5720  C  CB  . ALA A  1  748  ? 190.422 170.716 171.670 1.00   269.58 ? 1166 ALA A CB  1 
ATOM   5721  N  N   . GLU A  1  749  ? 190.887 170.820 175.302 1.00   229.61 ? 1167 GLU A N   1 
ATOM   5722  C  CA  . GLU A  1  749  ? 190.341 170.507 176.627 1.00   238.37 ? 1167 GLU A CA  1 
ATOM   5723  C  C   . GLU A  1  749  ? 191.219 171.367 177.461 1.00   203.53 ? 1167 GLU A C   1 
ATOM   5724  O  O   . GLU A  1  749  ? 192.389 171.491 177.136 1.00   221.21 ? 1167 GLU A O   1 
ATOM   5725  C  CB  . GLU A  1  749  ? 190.518 169.047 177.037 1.00   277.30 ? 1167 GLU A CB  1 
ATOM   5726  C  CG  . GLU A  1  749  ? 190.013 168.038 176.020 1.00   315.07 ? 1167 GLU A CG  1 
ATOM   5727  C  CD  . GLU A  1  749  ? 189.942 166.635 176.589 1.00   359.24 ? 1167 GLU A CD  1 
ATOM   5728  O  OE1 . GLU A  1  749  ? 190.888 166.230 177.299 1.00   411.80 ? 1167 GLU A OE1 1 
ATOM   5729  O  OE2 . GLU A  1  749  ? 188.939 165.938 176.325 1.00   403.56 ? 1167 GLU A OE2 1 
ATOM   5730  N  N   . LEU A  1  750  ? 190.688 171.978 178.501 1.00   182.14 ? 1168 LEU A N   1 
ATOM   5731  C  CA  . LEU A  1  750  ? 191.327 173.180 179.069 1.00   181.43 ? 1168 LEU A CA  1 
ATOM   5732  C  C   . LEU A  1  750  ? 191.198 174.454 178.162 1.00   159.98 ? 1168 LEU A C   1 
ATOM   5733  O  O   . LEU A  1  750  ? 191.826 175.483 178.392 1.00   104.89 ? 1168 LEU A O   1 
ATOM   5734  C  CB  . LEU A  1  750  ? 192.779 172.878 179.535 1.00   175.12 ? 1168 LEU A CB  1 
ATOM   5735  C  CG  . LEU A  1  750  ? 194.032 173.653 179.096 1.00   155.43 ? 1168 LEU A CG  1 
ATOM   5736  C  CD1 . LEU A  1  750  ? 195.240 173.149 179.885 1.00   179.68 ? 1168 LEU A CD1 1 
ATOM   5737  C  CD2 . LEU A  1  750  ? 194.320 173.568 177.610 1.00   132.07 ? 1168 LEU A CD2 1 
ATOM   5738  N  N   . ALA A  1  751  ? 190.324 174.404 177.160 1.00   168.01 ? 1169 ALA A N   1 
ATOM   5739  C  CA  . ALA A  1  751  ? 189.860 175.624 176.488 1.00   169.62 ? 1169 ALA A CA  1 
ATOM   5740  C  C   . ALA A  1  751  ? 189.103 176.502 177.475 1.00   149.94 ? 1169 ALA A C   1 
ATOM   5741  O  O   . ALA A  1  751  ? 188.982 177.714 177.287 1.00   125.35 ? 1169 ALA A O   1 
ATOM   5742  C  CB  . ALA A  1  751  ? 188.953 175.274 175.320 1.00   200.87 ? 1169 ALA A CB  1 
ATOM   5743  N  N   . ASN A  1  752  ? 188.561 175.864 178.504 1.00   142.92 ? 1170 ASN A N   1 
ATOM   5744  C  CA  . ASN A  1  752  ? 187.887 176.535 179.588 1.00   131.94 ? 1170 ASN A CA  1 
ATOM   5745  C  C   . ASN A  1  752  ? 188.766 177.574 180.305 1.00   115.58 ? 1170 ASN A C   1 
ATOM   5746  O  O   . ASN A  1  752  ? 188.371 178.732 180.535 1.00   90.20  ? 1170 ASN A O   1 
ATOM   5747  C  CB  . ASN A  1  752  ? 187.361 175.489 180.570 1.00   131.07 ? 1170 ASN A CB  1 
ATOM   5748  C  CG  . ASN A  1  752  ? 186.045 175.895 181.139 1.00   143.01 ? 1170 ASN A CG  1 
ATOM   5749  O  OD1 . ASN A  1  752  ? 185.029 175.239 180.963 1.00   141.99 ? 1170 ASN A OD1 1 
ATOM   5750  N  ND2 . ASN A  1  752  ? 186.046 177.041 181.773 1.00   203.73 ? 1170 ASN A ND2 1 
ATOM   5751  N  N   . GLU A  1  753  ? 189.980 177.173 180.616 1.00   113.95 ? 1171 GLU A N   1 
ATOM   5752  C  CA  . GLU A  1  753  ? 190.897 178.080 181.284 1.00   118.33 ? 1171 GLU A CA  1 
ATOM   5753  C  C   . GLU A  1  753  ? 191.338 179.188 180.330 1.00   103.85 ? 1171 GLU A C   1 
ATOM   5754  O  O   . GLU A  1  753  ? 191.656 180.275 180.741 1.00   107.27 ? 1171 GLU A O   1 
ATOM   5755  C  CB  . GLU A  1  753  ? 192.069 177.313 181.895 1.00   137.62 ? 1171 GLU A CB  1 
ATOM   5756  C  CG  . GLU A  1  753  ? 193.226 177.010 180.978 1.00   165.63 ? 1171 GLU A CG  1 
ATOM   5757  C  CD  . GLU A  1  753  ? 194.114 178.203 180.757 1.00   200.34 ? 1171 GLU A CD  1 
ATOM   5758  O  OE1 . GLU A  1  753  ? 195.071 178.096 179.957 1.00   287.41 ? 1171 GLU A OE1 1 
ATOM   5759  O  OE2 . GLU A  1  753  ? 193.843 179.248 181.384 1.00   177.17 ? 1171 GLU A OE2 1 
ATOM   5760  N  N   . TYR A  1  754  ? 191.345 178.932 179.046 1.00   98.85  ? 1172 TYR A N   1 
ATOM   5761  C  CA  . TYR A  1  754  ? 191.607 180.005 178.109 1.00   100.64 ? 1172 TYR A CA  1 
ATOM   5762  C  C   . TYR A  1  754  ? 190.540 181.027 178.070 1.00   94.40  ? 1172 TYR A C   1 
ATOM   5763  O  O   . TYR A  1  754  ? 190.861 182.196 177.949 1.00   100.75 ? 1172 TYR A O   1 
ATOM   5764  C  CB  . TYR A  1  754  ? 191.667 179.475 176.729 1.00   118.34 ? 1172 TYR A CB  1 
ATOM   5765  C  CG  . TYR A  1  754  ? 191.971 180.495 175.668 1.00   114.14 ? 1172 TYR A CG  1 
ATOM   5766  C  CD1 . TYR A  1  754  ? 193.158 181.255 175.722 1.00   111.05 ? 1172 TYR A CD1 1 
ATOM   5767  C  CD2 . TYR A  1  754  ? 191.130 180.641 174.563 1.00   102.55 ? 1172 TYR A CD2 1 
ATOM   5768  C  CE1 . TYR A  1  754  ? 193.477 182.150 174.718 1.00   99.39  ? 1172 TYR A CE1 1 
ATOM   5769  C  CE2 . TYR A  1  754  ? 191.455 181.523 173.550 1.00   108.56 ? 1172 TYR A CE2 1 
ATOM   5770  C  CZ  . TYR A  1  754  ? 192.630 182.270 173.631 1.00   104.38 ? 1172 TYR A CZ  1 
ATOM   5771  O  OH  . TYR A  1  754  ? 192.935 183.158 172.633 1.00   133.76 ? 1172 TYR A OH  1 
ATOM   5772  N  N   . ALA A  1  755  ? 189.280 180.589 178.130 1.00   110.14 ? 1173 ALA A N   1 
ATOM   5773  C  CA  . ALA A  1  755  ? 188.104 181.506 178.263 1.00   125.22 ? 1173 ALA A CA  1 
ATOM   5774  C  C   . ALA A  1  755  ? 188.268 182.482 179.398 1.00   117.31 ? 1173 ALA A C   1 
ATOM   5775  O  O   . ALA A  1  755  ? 188.009 183.691 179.278 1.00   98.97  ? 1173 ALA A O   1 
ATOM   5776  C  CB  . ALA A  1  755  ? 186.832 180.729 178.525 1.00   122.33 ? 1173 ALA A CB  1 
ATOM   5777  N  N   . GLY A  1  756  ? 188.667 181.910 180.523 1.00   103.08 ? 1174 GLY A N   1 
ATOM   5778  C  CA  . GLY A  1  756  ? 189.124 182.704 181.630 1.00   101.99 ? 1174 GLY A CA  1 
ATOM   5779  C  C   . GLY A  1  756  ? 190.165 183.709 181.227 1.00   83.80  ? 1174 GLY A C   1 
ATOM   5780  O  O   . GLY A  1  756  ? 189.990 184.872 181.453 1.00   97.43  ? 1174 GLY A O   1 
ATOM   5781  N  N   . PHE A  1  757  ? 191.234 183.245 180.610 1.00   85.50  ? 1175 PHE A N   1 
ATOM   5782  C  CA  . PHE A  1  757  ? 192.376 184.109 180.304 1.00   95.89  ? 1175 PHE A CA  1 
ATOM   5783  C  C   . PHE A  1  757  ? 191.949 185.309 179.420 1.00   95.22  ? 1175 PHE A C   1 
ATOM   5784  O  O   . PHE A  1  757  ? 192.284 186.482 179.692 1.00   89.46  ? 1175 PHE A O   1 
ATOM   5785  C  CB  . PHE A  1  757  ? 193.565 183.286 179.713 1.00   94.72  ? 1175 PHE A CB  1 
ATOM   5786  C  CG  . PHE A  1  757  ? 194.520 184.115 178.940 1.00   105.28 ? 1175 PHE A CG  1 
ATOM   5787  C  CD1 . PHE A  1  757  ? 195.456 184.903 179.600 1.00   109.26 ? 1175 PHE A CD1 1 
ATOM   5788  C  CD2 . PHE A  1  757  ? 194.421 184.201 177.547 1.00   110.30 ? 1175 PHE A CD2 1 
ATOM   5789  C  CE1 . PHE A  1  757  ? 196.312 185.741 178.887 1.00   104.92 ? 1175 PHE A CE1 1 
ATOM   5790  C  CE2 . PHE A  1  757  ? 195.270 185.038 176.820 1.00   119.57 ? 1175 PHE A CE2 1 
ATOM   5791  C  CZ  . PHE A  1  757  ? 196.229 185.800 177.492 1.00   116.53 ? 1175 PHE A CZ  1 
ATOM   5792  N  N   . LEU A  1  758  ? 191.196 184.965 178.386 1.00   87.88  ? 1176 LEU A N   1 
ATOM   5793  C  CA  . LEU A  1  758  ? 190.570 185.908 177.443 1.00   107.37 ? 1176 LEU A CA  1 
ATOM   5794  C  C   . LEU A  1  758  ? 189.821 187.059 178.139 1.00   103.92 ? 1176 LEU A C   1 
ATOM   5795  O  O   . LEU A  1  758  ? 189.867 188.228 177.757 1.00   106.02 ? 1176 LEU A O   1 
ATOM   5796  C  CB  . LEU A  1  758  ? 189.557 185.111 176.570 1.00   123.81 ? 1176 LEU A CB  1 
ATOM   5797  C  CG  . LEU A  1  758  ? 189.638 185.267 175.063 1.00   131.90 ? 1176 LEU A CG  1 
ATOM   5798  C  CD1 . LEU A  1  758  ? 189.424 186.730 174.749 1.00   167.87 ? 1176 LEU A CD1 1 
ATOM   5799  C  CD2 . LEU A  1  758  ? 190.976 184.839 174.521 1.00   127.68 ? 1176 LEU A CD2 1 
ATOM   5800  N  N   . MET A  1  759  ? 189.096 186.692 179.165 1.00   94.47  ? 1177 MET A N   1 
ATOM   5801  C  CA  . MET A  1  759  ? 188.267 187.644 179.887 1.00   108.95 ? 1177 MET A CA  1 
ATOM   5802  C  C   . MET A  1  759  ? 189.109 188.556 180.757 1.00   101.43 ? 1177 MET A C   1 
ATOM   5803  O  O   . MET A  1  759  ? 188.811 189.707 180.982 1.00   100.86 ? 1177 MET A O   1 
ATOM   5804  C  CB  . MET A  1  759  ? 187.246 186.858 180.729 1.00   122.24 ? 1177 MET A CB  1 
ATOM   5805  C  CG  . MET A  1  759  ? 187.393 186.872 182.229 1.00   115.01 ? 1177 MET A CG  1 
ATOM   5806  S  SD  . MET A  1  759  ? 186.055 187.915 182.684 1.00   133.38 ? 1177 MET A SD  1 
ATOM   5807  C  CE  . MET A  1  759  ? 186.276 187.895 184.465 1.00   140.84 ? 1177 MET A CE  1 
ATOM   5808  N  N   . ALA A  1  760  ? 190.164 187.990 181.280 1.00   103.15 ? 1178 ALA A N   1 
ATOM   5809  C  CA  . ALA A  1  760  ? 191.070 188.722 182.095 1.00   108.09 ? 1178 ALA A CA  1 
ATOM   5810  C  C   . ALA A  1  760  ? 191.619 189.876 181.282 1.00   112.67 ? 1178 ALA A C   1 
ATOM   5811  O  O   . ALA A  1  760  ? 191.813 190.955 181.831 1.00   117.03 ? 1178 ALA A O   1 
ATOM   5812  C  CB  . ALA A  1  760  ? 192.191 187.805 182.544 1.00   109.13 ? 1178 ALA A CB  1 
ATOM   5813  N  N   . LEU A  1  761  ? 191.885 189.645 179.990 1.00   104.45 ? 1179 LEU A N   1 
ATOM   5814  C  CA  . LEU A  1  761  ? 192.439 190.708 179.157 1.00   113.60 ? 1179 LEU A CA  1 
ATOM   5815  C  C   . LEU A  1  761  ? 191.480 191.838 179.011 1.00   123.53 ? 1179 LEU A C   1 
ATOM   5816  O  O   . LEU A  1  761  ? 191.898 192.991 178.919 1.00   171.56 ? 1179 LEU A O   1 
ATOM   5817  C  CB  . LEU A  1  761  ? 192.811 190.271 177.745 1.00   111.20 ? 1179 LEU A CB  1 
ATOM   5818  C  CG  . LEU A  1  761  ? 194.174 189.653 177.515 1.00   114.59 ? 1179 LEU A CG  1 
ATOM   5819  C  CD1 . LEU A  1  761  ? 195.201 190.213 178.503 1.00   123.74 ? 1179 LEU A CD1 1 
ATOM   5820  C  CD2 . LEU A  1  761  ? 194.112 188.140 177.581 1.00   112.15 ? 1179 LEU A CD2 1 
ATOM   5821  N  N   . GLY A  1  762  ? 190.202 191.531 178.953 1.00   106.14 ? 1180 GLY A N   1 
ATOM   5822  C  CA  . GLY A  1  762  ? 189.236 192.595 178.849 1.00   121.18 ? 1180 GLY A CA  1 
ATOM   5823  C  C   . GLY A  1  762  ? 189.181 193.524 180.057 1.00   127.00 ? 1180 GLY A C   1 
ATOM   5824  O  O   . GLY A  1  762  ? 188.999 194.746 179.914 1.00   161.57 ? 1180 GLY A O   1 
ATOM   5825  N  N   . LEU A  1  763  ? 189.322 192.943 181.243 1.00   97.98  ? 1181 LEU A N   1 
ATOM   5826  C  CA  . LEU A  1  763  ? 189.355 193.723 182.472 1.00   99.48  ? 1181 LEU A CA  1 
ATOM   5827  C  C   . LEU A  1  763  ? 190.556 194.685 182.539 1.00   123.31 ? 1181 LEU A C   1 
ATOM   5828  O  O   . LEU A  1  763  ? 190.487 195.832 182.963 1.00   145.09 ? 1181 LEU A O   1 
ATOM   5829  C  CB  . LEU A  1  763  ? 189.457 192.753 183.604 1.00   91.19  ? 1181 LEU A CB  1 
ATOM   5830  C  CG  . LEU A  1  763  ? 188.197 192.086 184.145 1.00   105.25 ? 1181 LEU A CG  1 
ATOM   5831  C  CD1 . LEU A  1  763  ? 186.923 192.218 183.310 1.00   127.33 ? 1181 LEU A CD1 1 
ATOM   5832  C  CD2 . LEU A  1  763  ? 188.526 190.624 184.450 1.00   121.54 ? 1181 LEU A CD2 1 
ATOM   5833  N  N   . ASN A  1  764  ? 191.667 194.134 182.112 1.00   141.10 ? 1182 ASN A N   1 
ATOM   5834  C  CA  . ASN A  1  764  ? 192.952 194.779 181.967 1.00   138.44 ? 1182 ASN A CA  1 
ATOM   5835  C  C   . ASN A  1  764  ? 192.961 195.919 180.965 1.00   137.79 ? 1182 ASN A C   1 
ATOM   5836  O  O   . ASN A  1  764  ? 193.680 196.877 181.165 1.00   157.07 ? 1182 ASN A O   1 
ATOM   5837  C  CB  . ASN A  1  764  ? 193.864 193.659 181.435 1.00   168.77 ? 1182 ASN A CB  1 
ATOM   5838  C  CG  . ASN A  1  764  ? 195.312 193.897 181.656 1.00   177.00 ? 1182 ASN A CG  1 
ATOM   5839  O  OD1 . ASN A  1  764  ? 195.750 195.000 182.005 1.00   175.72 ? 1182 ASN A OD1 1 
ATOM   5840  N  ND2 . ASN A  1  764  ? 196.090 192.833 181.451 1.00   176.14 ? 1182 ASN A ND2 1 
ATOM   5841  N  N   . GLY A  1  765  ? 192.195 195.800 179.875 1.00   146.61 ? 1183 GLY A N   1 
ATOM   5842  C  CA  . GLY A  1  765  ? 192.147 196.831 178.798 1.00   148.36 ? 1183 GLY A CA  1 
ATOM   5843  C  C   . GLY A  1  765  ? 192.769 196.397 177.475 1.00   137.36 ? 1183 GLY A C   1 
ATOM   5844  O  O   . GLY A  1  765  ? 192.639 197.059 176.457 1.00   134.64 ? 1183 GLY A O   1 
ATOM   5845  N  N   . HIS A  1  766  ? 193.425 195.248 177.484 1.00   144.84 ? 1184 HIS A N   1 
ATOM   5846  C  CA  . HIS A  1  766  ? 194.187 194.768 176.354 1.00   126.73 ? 1184 HIS A CA  1 
ATOM   5847  C  C   . HIS A  1  766  ? 193.339 194.174 175.280 1.00   120.68 ? 1184 HIS A C   1 
ATOM   5848  O  O   . HIS A  1  766  ? 193.798 194.061 174.172 1.00   141.76 ? 1184 HIS A O   1 
ATOM   5849  C  CB  . HIS A  1  766  ? 195.218 193.763 176.845 1.00   118.95 ? 1184 HIS A CB  1 
ATOM   5850  C  CG  . HIS A  1  766  ? 196.379 194.414 177.525 1.00   143.22 ? 1184 HIS A CG  1 
ATOM   5851  N  ND1 . HIS A  1  766  ? 196.356 195.727 177.961 1.00   167.34 ? 1184 HIS A ND1 1 
ATOM   5852  C  CD2 . HIS A  1  766  ? 197.610 193.944 177.831 1.00   151.46 ? 1184 HIS A CD2 1 
ATOM   5853  C  CE1 . HIS A  1  766  ? 197.515 196.028 178.509 1.00   175.39 ? 1184 HIS A CE1 1 
ATOM   5854  N  NE2 . HIS A  1  766  ? 198.296 194.962 178.444 1.00   171.04 ? 1184 HIS A NE2 1 
ATOM   5855  N  N   . LEU A  1  767  ? 192.100 193.808 175.587 1.00   123.79 ? 1185 LEU A N   1 
ATOM   5856  C  CA  . LEU A  1  767  ? 191.242 193.147 174.634 1.00   102.42 ? 1185 LEU A CA  1 
ATOM   5857  C  C   . LEU A  1  767  ? 190.572 194.068 173.610 1.00   119.38 ? 1185 LEU A C   1 
ATOM   5858  O  O   . LEU A  1  767  ? 190.063 193.567 172.601 1.00   140.90 ? 1185 LEU A O   1 
ATOM   5859  C  CB  . LEU A  1  767  ? 190.190 192.356 175.363 1.00   97.60  ? 1185 LEU A CB  1 
ATOM   5860  C  CG  . LEU A  1  767  ? 189.739 191.169 174.514 1.00   120.43 ? 1185 LEU A CG  1 
ATOM   5861  C  CD1 . LEU A  1  767  ? 190.859 190.126 174.471 1.00   121.95 ? 1185 LEU A CD1 1 
ATOM   5862  C  CD2 . LEU A  1  767  ? 188.399 190.560 174.976 1.00   129.00 ? 1185 LEU A CD2 1 
ATOM   5863  N  N   . THR A  1  768  ? 190.572 195.390 173.813 1.00   126.85 ? 1186 THR A N   1 
ATOM   5864  C  CA  . THR A  1  768  ? 190.154 196.320 172.735 1.00   149.47 ? 1186 THR A CA  1 
ATOM   5865  C  C   . THR A  1  768  ? 190.960 196.098 171.456 1.00   159.85 ? 1186 THR A C   1 
ATOM   5866  O  O   . THR A  1  768  ? 190.461 196.225 170.329 1.00   162.61 ? 1186 THR A O   1 
ATOM   5867  C  CB  . THR A  1  768  ? 190.421 197.789 173.077 1.00   188.54 ? 1186 THR A CB  1 
ATOM   5868  O  OG1 . THR A  1  768  ? 191.765 197.925 173.569 1.00   222.79 ? 1186 THR A OG1 1 
ATOM   5869  C  CG2 . THR A  1  768  ? 189.429 198.312 174.096 1.00   223.19 ? 1186 THR A CG2 1 
ATOM   5870  N  N   . LYS A  1  769  ? 192.233 195.762 171.640 1.00   180.13 ? 1187 LYS A N   1 
ATOM   5871  C  CA  . LYS A  1  769  ? 193.109 195.486 170.508 1.00   167.21 ? 1187 LYS A CA  1 
ATOM   5872  C  C   . LYS A  1  769  ? 192.801 194.149 169.844 1.00   141.79 ? 1187 LYS A C   1 
ATOM   5873  O  O   . LYS A  1  769  ? 193.356 193.889 168.788 1.00   165.09 ? 1187 LYS A O   1 
ATOM   5874  C  CB  . LYS A  1  769  ? 194.592 195.552 170.903 1.00   162.06 ? 1187 LYS A CB  1 
ATOM   5875  C  CG  . LYS A  1  769  ? 195.058 196.945 171.274 1.00   175.48 ? 1187 LYS A CG  1 
ATOM   5876  C  CD  . LYS A  1  769  ? 196.519 196.961 171.722 1.00   229.54 ? 1187 LYS A CD  1 
ATOM   5877  C  CE  . LYS A  1  769  ? 196.788 196.366 173.117 1.00   248.23 ? 1187 LYS A CE  1 
ATOM   5878  N  NZ  . LYS A  1  769  ? 196.383 197.184 174.299 1.00   257.90 ? 1187 LYS A NZ  1 
ATOM   5879  N  N   . LEU A  1  770  ? 191.938 193.307 170.427 1.00   116.15 ? 1188 LEU A N   1 
ATOM   5880  C  CA  . LEU A  1  770  ? 191.593 192.046 169.769 1.00   128.50 ? 1188 LEU A CA  1 
ATOM   5881  C  C   . LEU A  1  770  ? 190.777 192.330 168.501 1.00   145.18 ? 1188 LEU A C   1 
ATOM   5882  O  O   . LEU A  1  770  ? 190.016 193.306 168.436 1.00   161.51 ? 1188 LEU A O   1 
ATOM   5883  C  CB  . LEU A  1  770  ? 190.870 191.030 170.674 1.00   119.50 ? 1188 LEU A CB  1 
ATOM   5884  C  CG  . LEU A  1  770  ? 190.547 189.669 169.996 1.00   123.77 ? 1188 LEU A CG  1 
ATOM   5885  C  CD1 . LEU A  1  770  ? 191.801 188.903 169.630 1.00   127.79 ? 1188 LEU A CD1 1 
ATOM   5886  C  CD2 . LEU A  1  770  ? 189.638 188.736 170.796 1.00   133.11 ? 1188 LEU A CD2 1 
ATOM   5887  N  N   . ALA A  1  771  ? 190.982 191.488 167.487 1.00   142.80 ? 1189 ALA A N   1 
ATOM   5888  C  CA  . ALA A  1  771  ? 190.382 191.685 166.170 1.00   151.12 ? 1189 ALA A CA  1 
ATOM   5889  C  C   . ALA A  1  771  ? 188.931 191.320 166.224 1.00   170.36 ? 1189 ALA A C   1 
ATOM   5890  O  O   . ALA A  1  771  ? 188.594 190.234 166.725 1.00   177.82 ? 1189 ALA A O   1 
ATOM   5891  C  CB  . ALA A  1  771  ? 191.065 190.793 165.141 1.00   160.42 ? 1189 ALA A CB  1 
ATOM   5892  N  N   . THR A  1  772  ? 188.075 192.191 165.680 1.00   180.61 ? 1190 THR A N   1 
ATOM   5893  C  CA  . THR A  1  772  ? 186.622 191.915 165.610 1.00   183.81 ? 1190 THR A CA  1 
ATOM   5894  C  C   . THR A  1  772  ? 186.273 190.589 164.964 1.00   141.15 ? 1190 THR A C   1 
ATOM   5895  O  O   . THR A  1  772  ? 185.380 189.890 165.395 1.00   125.22 ? 1190 THR A O   1 
ATOM   5896  C  CB  . THR A  1  772  ? 185.858 192.988 164.817 1.00   203.23 ? 1190 THR A CB  1 
ATOM   5897  O  OG1 . THR A  1  772  ? 184.453 192.702 164.895 1.00   217.90 ? 1190 THR A OG1 1 
ATOM   5898  C  CG2 . THR A  1  772  ? 186.311 193.059 163.314 1.00   201.71 ? 1190 THR A CG2 1 
ATOM   5899  N  N   . LEU A  1  773  ? 187.026 190.285 163.928 1.00   130.81 ? 1191 LEU A N   1 
ATOM   5900  C  CA  . LEU A  1  773  ? 186.841 189.133 163.126 1.00   131.46 ? 1191 LEU A CA  1 
ATOM   5901  C  C   . LEU A  1  773  ? 187.259 187.888 163.876 1.00   130.43 ? 1191 LEU A C   1 
ATOM   5902  O  O   . LEU A  1  773  ? 186.709 186.799 163.654 1.00   143.68 ? 1191 LEU A O   1 
ATOM   5903  C  CB  . LEU A  1  773  ? 187.655 189.362 161.899 1.00   138.81 ? 1191 LEU A CB  1 
ATOM   5904  C  CG  . LEU A  1  773  ? 187.866 188.237 160.935 1.00   167.94 ? 1191 LEU A CG  1 
ATOM   5905  C  CD1 . LEU A  1  773  ? 188.268 188.948 159.646 1.00   211.98 ? 1191 LEU A CD1 1 
ATOM   5906  C  CD2 . LEU A  1  773  ? 188.923 187.252 161.458 1.00   166.58 ? 1191 LEU A CD2 1 
ATOM   5907  N  N   . ASN A  1  774  ? 188.229 188.034 164.770 1.00   135.77 ? 1192 ASN A N   1 
ATOM   5908  C  CA  . ASN A  1  774  ? 188.558 186.921 165.669 1.00   150.55 ? 1192 ASN A CA  1 
ATOM   5909  C  C   . ASN A  1  774  ? 187.531 186.639 166.730 1.00   143.81 ? 1192 ASN A C   1 
ATOM   5910  O  O   . ASN A  1  774  ? 187.283 185.482 167.068 1.00   141.67 ? 1192 ASN A O   1 
ATOM   5911  C  CB  . ASN A  1  774  ? 189.918 187.080 166.307 1.00   146.04 ? 1192 ASN A CB  1 
ATOM   5912  C  CG  . ASN A  1  774  ? 190.932 186.270 165.592 1.00   171.85 ? 1192 ASN A CG  1 
ATOM   5913  O  OD1 . ASN A  1  774  ? 190.819 185.030 165.542 1.00   176.08 ? 1192 ASN A OD1 1 
ATOM   5914  N  ND2 . ASN A  1  774  ? 191.892 186.943 164.956 1.00   203.01 ? 1192 ASN A ND2 1 
ATOM   5915  N  N   . ILE A  1  775  ? 186.924 187.703 167.235 1.00   130.15 ? 1193 ILE A N   1 
ATOM   5916  C  CA  . ILE A  1  775  ? 185.838 187.569 168.186 1.00   117.42 ? 1193 ILE A CA  1 
ATOM   5917  C  C   . ILE A  1  775  ? 184.708 186.720 167.607 1.00   116.20 ? 1193 ILE A C   1 
ATOM   5918  O  O   . ILE A  1  775  ? 184.097 185.948 168.326 1.00   140.15 ? 1193 ILE A O   1 
ATOM   5919  C  CB  . ILE A  1  775  ? 185.320 188.943 168.595 1.00   114.73 ? 1193 ILE A CB  1 
ATOM   5920  C  CG1 . ILE A  1  775  ? 186.418 189.664 169.389 1.00   143.91 ? 1193 ILE A CG1 1 
ATOM   5921  C  CG2 . ILE A  1  775  ? 184.040 188.821 169.418 1.00   106.35 ? 1193 ILE A CG2 1 
ATOM   5922  C  CD1 . ILE A  1  775  ? 186.220 191.160 169.545 1.00   174.57 ? 1193 ILE A CD1 1 
ATOM   5923  N  N   . HIS A  1  776  ? 184.448 186.867 166.310 1.00   113.20 ? 1194 HIS A N   1 
ATOM   5924  C  CA  . HIS A  1  776  ? 183.462 186.060 165.612 1.00   121.74 ? 1194 HIS A CA  1 
ATOM   5925  C  C   . HIS A  1  776  ? 183.789 184.577 165.691 1.00   128.56 ? 1194 HIS A C   1 
ATOM   5926  O  O   . HIS A  1  776  ? 182.911 183.735 165.895 1.00   149.50 ? 1194 HIS A O   1 
ATOM   5927  C  CB  . HIS A  1  776  ? 183.373 186.441 164.124 1.00   114.92 ? 1194 HIS A CB  1 
ATOM   5928  C  CG  . HIS A  1  776  ? 182.534 185.491 163.328 1.00   139.64 ? 1194 HIS A CG  1 
ATOM   5929  N  ND1 . HIS A  1  776  ? 183.063 184.361 162.729 1.00   161.07 ? 1194 HIS A ND1 1 
ATOM   5930  C  CD2 . HIS A  1  776  ? 181.198 185.439 163.117 1.00   144.70 ? 1194 HIS A CD2 1 
ATOM   5931  C  CE1 . HIS A  1  776  ? 182.095 183.686 162.136 1.00   159.58 ? 1194 HIS A CE1 1 
ATOM   5932  N  NE2 . HIS A  1  776  ? 180.952 184.314 162.364 1.00   161.08 ? 1194 HIS A NE2 1 
ATOM   5933  N  N   . ASP A  1  777  ? 185.048 184.269 165.458 1.00   132.57 ? 1195 ASP A N   1 
ATOM   5934  C  CA  . ASP A  1  777  ? 185.512 182.901 165.481 1.00   168.95 ? 1195 ASP A CA  1 
ATOM   5935  C  C   . ASP A  1  777  ? 185.233 182.247 166.836 1.00   159.59 ? 1195 ASP A C   1 
ATOM   5936  O  O   . ASP A  1  777  ? 184.787 181.111 166.867 1.00   161.28 ? 1195 ASP A O   1 
ATOM   5937  C  CB  . ASP A  1  777  ? 187.011 182.882 165.147 1.00   215.60 ? 1195 ASP A CB  1 
ATOM   5938  C  CG  . ASP A  1  777  ? 187.649 181.531 165.373 1.00   278.19 ? 1195 ASP A CG  1 
ATOM   5939  O  OD1 . ASP A  1  777  ? 186.990 180.500 165.107 1.00   328.96 ? 1195 ASP A OD1 1 
ATOM   5940  O  OD2 . ASP A  1  777  ? 188.819 181.506 165.814 1.00   321.95 ? 1195 ASP A OD2 1 
ATOM   5941  N  N   . TYR A  1  778  ? 185.499 182.947 167.938 1.00   140.81 ? 1196 TYR A N   1 
ATOM   5942  C  CA  . TYR A  1  778  ? 185.283 182.338 169.258 1.00   127.29 ? 1196 TYR A CA  1 
ATOM   5943  C  C   . TYR A  1  778  ? 183.818 182.197 169.663 1.00   131.57 ? 1196 TYR A C   1 
ATOM   5944  O  O   . TYR A  1  778  ? 183.438 181.210 170.303 1.00   148.54 ? 1196 TYR A O   1 
ATOM   5945  C  CB  . TYR A  1  778  ? 185.966 183.121 170.353 1.00   126.05 ? 1196 TYR A CB  1 
ATOM   5946  C  CG  . TYR A  1  778  ? 187.449 183.211 170.234 1.00   132.29 ? 1196 TYR A CG  1 
ATOM   5947  C  CD1 . TYR A  1  778  ? 188.209 182.073 170.106 1.00   119.22 ? 1196 TYR A CD1 1 
ATOM   5948  C  CD2 . TYR A  1  778  ? 188.103 184.462 170.275 1.00   170.18 ? 1196 TYR A CD2 1 
ATOM   5949  C  CE1 . TYR A  1  778  ? 189.570 182.153 169.996 1.00   139.18 ? 1196 TYR A CE1 1 
ATOM   5950  C  CE2 . TYR A  1  778  ? 189.482 184.558 170.178 1.00   171.17 ? 1196 TYR A CE2 1 
ATOM   5951  C  CZ  . TYR A  1  778  ? 190.209 183.394 170.032 1.00   173.68 ? 1196 TYR A CZ  1 
ATOM   5952  O  OH  . TYR A  1  778  ? 191.569 183.466 169.931 1.00   209.42 ? 1196 TYR A OH  1 
ATOM   5953  N  N   . LEU A  1  779  ? 183.002 183.193 169.354 1.00   129.89 ? 1197 LEU A N   1 
ATOM   5954  C  CA  . LEU A  1  779  ? 181.622 183.137 169.791 1.00   113.34 ? 1197 LEU A CA  1 
ATOM   5955  C  C   . LEU A  1  779  ? 180.927 182.043 169.040 1.00   121.14 ? 1197 LEU A C   1 
ATOM   5956  O  O   . LEU A  1  779  ? 180.231 181.262 169.659 1.00   149.18 ? 1197 LEU A O   1 
ATOM   5957  C  CB  . LEU A  1  779  ? 180.913 184.464 169.603 1.00   115.22 ? 1197 LEU A CB  1 
ATOM   5958  C  CG  . LEU A  1  779  ? 181.452 185.612 170.484 1.00   128.38 ? 1197 LEU A CG  1 
ATOM   5959  C  CD1 . LEU A  1  779  ? 181.105 186.934 169.838 1.00   128.92 ? 1197 LEU A CD1 1 
ATOM   5960  C  CD2 . LEU A  1  779  ? 180.976 185.613 171.932 1.00   123.81 ? 1197 LEU A CD2 1 
ATOM   5961  N  N   . THR A  1  780  ? 181.137 181.942 167.725 1.00   124.68 ? 1198 THR A N   1 
ATOM   5962  C  CA  . THR A  1  780  ? 180.441 180.899 166.952 1.00   135.32 ? 1198 THR A CA  1 
ATOM   5963  C  C   . THR A  1  780  ? 181.000 179.493 167.219 1.00   140.83 ? 1198 THR A C   1 
ATOM   5964  O  O   . THR A  1  780  ? 180.371 178.529 166.831 1.00   171.67 ? 1198 THR A O   1 
ATOM   5965  C  CB  . THR A  1  780  ? 180.397 181.116 165.413 1.00   147.05 ? 1198 THR A CB  1 
ATOM   5966  O  OG1 . THR A  1  780  ? 181.658 180.772 164.827 1.00   178.88 ? 1198 THR A OG1 1 
ATOM   5967  C  CG2 . THR A  1  780  ? 179.994 182.544 165.024 1.00   159.66 ? 1198 THR A CG2 1 
ATOM   5968  N  N   . LYS A  1  781  ? 182.162 179.352 167.853 1.00   151.21 ? 1199 LYS A N   1 
ATOM   5969  C  CA  . LYS A  1  781  ? 182.576 178.039 168.382 1.00   173.12 ? 1199 LYS A CA  1 
ATOM   5970  C  C   . LYS A  1  781  ? 181.485 177.480 169.274 1.00   177.07 ? 1199 LYS A C   1 
ATOM   5971  O  O   . LYS A  1  781  ? 181.271 176.272 169.280 1.00   184.95 ? 1199 LYS A O   1 
ATOM   5972  C  CB  . LYS A  1  781  ? 183.888 178.112 169.184 1.00   209.21 ? 1199 LYS A CB  1 
ATOM   5973  C  CG  . LYS A  1  781  ? 184.782 176.884 169.051 1.00   232.47 ? 1199 LYS A CG  1 
ATOM   5974  C  CD  . LYS A  1  781  ? 185.228 176.713 167.603 1.00   275.26 ? 1199 LYS A CD  1 
ATOM   5975  C  CE  . LYS A  1  781  ? 186.699 176.341 167.462 1.00   300.06 ? 1199 LYS A CE  1 
ATOM   5976  N  NZ  . LYS A  1  781  ? 187.159 176.561 166.062 1.00   312.18 ? 1199 LYS A NZ  1 
ATOM   5977  N  N   . GLY A  1  782  ? 180.810 178.351 170.031 1.00   175.70 ? 1200 GLY A N   1 
ATOM   5978  C  CA  . GLY A  1  782  ? 179.604 177.977 170.781 1.00   177.97 ? 1200 GLY A CA  1 
ATOM   5979  C  C   . GLY A  1  782  ? 179.859 177.514 172.203 1.00   191.24 ? 1200 GLY A C   1 
ATOM   5980  O  O   . GLY A  1  782  ? 178.896 177.358 172.979 1.00   167.22 ? 1200 GLY A O   1 
ATOM   5981  N  N   . HIS A  1  783  ? 181.147 177.307 172.528 1.00   209.44 ? 1201 HIS A N   1 
ATOM   5982  C  CA  . HIS A  1  783  ? 181.623 176.884 173.855 1.00   198.95 ? 1201 HIS A CA  1 
ATOM   5983  C  C   . HIS A  1  783  ? 181.226 177.925 174.901 1.00   194.44 ? 1201 HIS A C   1 
ATOM   5984  O  O   . HIS A  1  783  ? 181.570 179.109 174.802 1.00   151.96 ? 1201 HIS A O   1 
ATOM   5985  C  CB  . HIS A  1  783  ? 183.142 176.697 173.811 1.00   196.25 ? 1201 HIS A CB  1 
ATOM   5986  C  CG  . HIS A  1  783  ? 183.744 176.169 175.074 1.00   198.39 ? 1201 HIS A CG  1 
ATOM   5987  N  ND1 . HIS A  1  783  ? 184.054 176.974 176.149 1.00   182.56 ? 1201 HIS A ND1 1 
ATOM   5988  C  CD2 . HIS A  1  783  ? 184.149 174.922 175.406 1.00   222.74 ? 1201 HIS A CD2 1 
ATOM   5989  C  CE1 . HIS A  1  783  ? 184.607 176.241 177.098 1.00   200.60 ? 1201 HIS A CE1 1 
ATOM   5990  N  NE2 . HIS A  1  783  ? 184.674 174.993 176.676 1.00   235.57 ? 1201 HIS A NE2 1 
ATOM   5991  N  N   . GLU A  1  784  ? 180.493 177.454 175.901 1.00   189.09 ? 1202 GLU A N   1 
ATOM   5992  C  CA  . GLU A  1  784  ? 179.667 178.320 176.732 1.00   171.90 ? 1202 GLU A CA  1 
ATOM   5993  C  C   . GLU A  1  784  ? 180.554 179.309 177.510 1.00   141.40 ? 1202 GLU A C   1 
ATOM   5994  O  O   . GLU A  1  784  ? 180.234 180.486 177.622 1.00   142.82 ? 1202 GLU A O   1 
ATOM   5995  C  CB  . GLU A  1  784  ? 178.710 177.456 177.602 1.00   184.10 ? 1202 GLU A CB  1 
ATOM   5996  C  CG  . GLU A  1  784  ? 179.010 177.334 179.095 1.00   214.61 ? 1202 GLU A CG  1 
ATOM   5997  C  CD  . GLU A  1  784  ? 178.444 178.490 179.931 1.00   242.82 ? 1202 GLU A CD  1 
ATOM   5998  O  OE1 . GLU A  1  784  ? 177.997 179.504 179.349 1.00   239.67 ? 1202 GLU A OE1 1 
ATOM   5999  O  OE2 . GLU A  1  784  ? 178.438 178.387 181.181 1.00   305.29 ? 1202 GLU A OE2 1 
ATOM   6000  N  N   . MET A  1  785  ? 181.696 178.832 177.990 1.00   137.17 ? 1203 MET A N   1 
ATOM   6001  C  CA  . MET A  1  785  ? 182.557 179.660 178.831 1.00   141.57 ? 1203 MET A CA  1 
ATOM   6002  C  C   . MET A  1  785  ? 183.261 180.791 178.116 1.00   136.52 ? 1203 MET A C   1 
ATOM   6003  O  O   . MET A  1  785  ? 183.393 181.854 178.701 1.00   104.23 ? 1203 MET A O   1 
ATOM   6004  C  CB  . MET A  1  785  ? 183.597 178.817 179.522 1.00   161.61 ? 1203 MET A CB  1 
ATOM   6005  C  CG  . MET A  1  785  ? 183.095 178.262 180.805 1.00   170.89 ? 1203 MET A CG  1 
ATOM   6006  S  SD  . MET A  1  785  ? 183.183 179.494 182.135 1.00   172.12 ? 1203 MET A SD  1 
ATOM   6007  C  CE  . MET A  1  785  ? 182.901 178.216 183.352 1.00   202.34 ? 1203 MET A CE  1 
ATOM   6008  N  N   . THR A  1  786  ? 183.711 180.566 176.870 1.00   149.45 ? 1204 THR A N   1 
ATOM   6009  C  CA  . THR A  1  786  ? 184.413 181.600 176.081 1.00   139.47 ? 1204 THR A CA  1 
ATOM   6010  C  C   . THR A  1  786  ? 183.435 182.711 175.809 1.00   128.86 ? 1204 THR A C   1 
ATOM   6011  O  O   . THR A  1  786  ? 183.785 183.880 175.853 1.00   115.38 ? 1204 THR A O   1 
ATOM   6012  C  CB  . THR A  1  786  ? 184.951 181.097 174.717 1.00   140.17 ? 1204 THR A CB  1 
ATOM   6013  O  OG1 . THR A  1  786  ? 184.031 180.152 174.166 1.00   161.81 ? 1204 THR A OG1 1 
ATOM   6014  C  CG2 . THR A  1  786  ? 186.318 180.447 174.856 1.00   147.69 ? 1204 THR A CG2 1 
ATOM   6015  N  N   . SER A  1  787  ? 182.192 182.335 175.538 1.00   143.63 ? 1205 SER A N   1 
ATOM   6016  C  CA  . SER A  1  787  ? 181.152 183.308 175.309 1.00   128.58 ? 1205 SER A CA  1 
ATOM   6017  C  C   . SER A  1  787  ? 181.047 184.208 176.505 1.00   110.67 ? 1205 SER A C   1 
ATOM   6018  O  O   . SER A  1  787  ? 180.995 185.408 176.324 1.00   122.54 ? 1205 SER A O   1 
ATOM   6019  C  CB  . SER A  1  787  ? 179.846 182.610 174.983 1.00   133.05 ? 1205 SER A CB  1 
ATOM   6020  O  OG  . SER A  1  787  ? 180.064 181.787 173.838 1.00   151.78 ? 1205 SER A OG  1 
ATOM   6021  N  N   . ILE A  1  788  ? 181.091 183.627 177.710 1.00   112.57 ? 1206 ILE A N   1 
ATOM   6022  C  CA  . ILE A  1  788  ? 181.043 184.377 178.989 1.00   120.23 ? 1206 ILE A CA  1 
ATOM   6023  C  C   . ILE A  1  788  ? 182.216 185.290 179.176 1.00   107.10 ? 1206 ILE A C   1 
ATOM   6024  O  O   . ILE A  1  788  ? 182.087 186.430 179.610 1.00   123.53 ? 1206 ILE A O   1 
ATOM   6025  C  CB  . ILE A  1  788  ? 180.979 183.432 180.214 1.00   114.33 ? 1206 ILE A CB  1 
ATOM   6026  C  CG1 . ILE A  1  788  ? 179.534 182.980 180.386 1.00   117.04 ? 1206 ILE A CG1 1 
ATOM   6027  C  CG2 . ILE A  1  788  ? 181.504 184.107 181.502 1.00   122.64 ? 1206 ILE A CG2 1 
ATOM   6028  C  CD1 . ILE A  1  788  ? 179.352 181.944 181.458 1.00   144.09 ? 1206 ILE A CD1 1 
ATOM   6029  N  N   . GLY A  1  789  ? 183.370 184.748 178.888 1.00   106.97 ? 1207 GLY A N   1 
ATOM   6030  C  CA  . GLY A  1  789  ? 184.583 185.477 179.121 1.00   123.79 ? 1207 GLY A CA  1 
ATOM   6031  C  C   . GLY A  1  789  ? 184.722 186.619 178.147 1.00   125.37 ? 1207 GLY A C   1 
ATOM   6032  O  O   . GLY A  1  789  ? 185.059 187.731 178.534 1.00   161.56 ? 1207 GLY A O   1 
ATOM   6033  N  N   . LEU A  1  790  ? 184.497 186.335 176.873 1.00   122.41 ? 1208 LEU A N   1 
ATOM   6034  C  CA  . LEU A  1  790  ? 184.609 187.358 175.866 1.00   130.88 ? 1208 LEU A CA  1 
ATOM   6035  C  C   . LEU A  1  790  ? 183.693 188.475 176.176 1.00   137.90 ? 1208 LEU A C   1 
ATOM   6036  O  O   . LEU A  1  790  ? 184.089 189.611 176.042 1.00   177.17 ? 1208 LEU A O   1 
ATOM   6037  C  CB  . LEU A  1  790  ? 184.227 186.859 174.486 1.00   143.76 ? 1208 LEU A CB  1 
ATOM   6038  C  CG  . LEU A  1  790  ? 185.429 186.471 173.663 1.00   144.08 ? 1208 LEU A CG  1 
ATOM   6039  C  CD1 . LEU A  1  790  ? 184.917 185.657 172.498 1.00   150.85 ? 1208 LEU A CD1 1 
ATOM   6040  C  CD2 . LEU A  1  790  ? 186.195 187.713 173.213 1.00   144.28 ? 1208 LEU A CD2 1 
ATOM   6041  N  N   . LEU A  1  791  ? 182.471 188.164 176.587 1.00   121.68 ? 1209 LEU A N   1 
ATOM   6042  C  CA  . LEU A  1  791  ? 181.506 189.208 176.794 1.00   121.80 ? 1209 LEU A CA  1 
ATOM   6043  C  C   . LEU A  1  791  ? 181.873 190.134 177.936 1.00   127.51 ? 1209 LEU A C   1 
ATOM   6044  O  O   . LEU A  1  791  ? 181.909 191.327 177.727 1.00   140.94 ? 1209 LEU A O   1 
ATOM   6045  C  CB  . LEU A  1  791  ? 180.111 188.643 176.929 1.00   116.76 ? 1209 LEU A CB  1 
ATOM   6046  C  CG  . LEU A  1  791  ? 179.645 188.045 175.607 1.00   120.57 ? 1209 LEU A CG  1 
ATOM   6047  C  CD1 . LEU A  1  791  ? 178.134 187.851 175.708 1.00   145.57 ? 1209 LEU A CD1 1 
ATOM   6048  C  CD2 . LEU A  1  791  ? 180.025 188.832 174.354 1.00   110.42 ? 1209 LEU A CD2 1 
ATOM   6049  N  N   . LEU A  1  792  ? 182.181 189.614 179.110 1.00   130.56 ? 1210 LEU A N   1 
ATOM   6050  C  CA  . LEU A  1  792  ? 182.616 190.476 180.204 1.00   139.33 ? 1210 LEU A CA  1 
ATOM   6051  C  C   . LEU A  1  792  ? 183.899 191.190 179.873 1.00   148.96 ? 1210 LEU A C   1 
ATOM   6052  O  O   . LEU A  1  792  ? 184.074 192.347 180.253 1.00   192.35 ? 1210 LEU A O   1 
ATOM   6053  C  CB  . LEU A  1  792  ? 182.815 189.691 181.484 1.00   151.27 ? 1210 LEU A CB  1 
ATOM   6054  C  CG  . LEU A  1  792  ? 181.473 189.242 182.053 1.00   168.92 ? 1210 LEU A CG  1 
ATOM   6055  C  CD1 . LEU A  1  792  ? 181.665 188.082 183.031 1.00   177.31 ? 1210 LEU A CD1 1 
ATOM   6056  C  CD2 . LEU A  1  792  ? 180.744 190.432 182.683 1.00   173.71 ? 1210 LEU A CD2 1 
ATOM   6057  N  N   . GLY A  1  793  ? 184.779 190.518 179.144 1.00   137.10 ? 1211 GLY A N   1 
ATOM   6058  C  CA  . GLY A  1  793  ? 186.045 191.117 178.749 1.00   155.63 ? 1211 GLY A CA  1 
ATOM   6059  C  C   . GLY A  1  793  ? 185.908 192.275 177.765 1.00   144.31 ? 1211 GLY A C   1 
ATOM   6060  O  O   . GLY A  1  793  ? 186.384 193.389 178.000 1.00   146.20 ? 1211 GLY A O   1 
ATOM   6061  N  N   . VAL A  1  794  ? 185.251 191.993 176.655 1.00   133.50 ? 1212 VAL A N   1 
ATOM   6062  C  CA  . VAL A  1  794  ? 184.974 192.956 175.599 1.00   134.33 ? 1212 VAL A CA  1 
ATOM   6063  C  C   . VAL A  1  794  ? 184.406 194.215 176.212 1.00   139.35 ? 1212 VAL A C   1 
ATOM   6064  O  O   . VAL A  1  794  ? 184.897 195.319 175.988 1.00   154.60 ? 1212 VAL A O   1 
ATOM   6065  C  CB  . VAL A  1  794  ? 183.912 192.341 174.628 1.00   158.51 ? 1212 VAL A CB  1 
ATOM   6066  C  CG1 . VAL A  1  794  ? 183.147 193.403 173.846 1.00   171.11 ? 1212 VAL A CG1 1 
ATOM   6067  C  CG2 . VAL A  1  794  ? 184.527 191.277 173.698 1.00   155.42 ? 1212 VAL A CG2 1 
ATOM   6068  N  N   . SER A  1  795  ? 183.362 193.998 177.003 1.00   138.74 ? 1213 SER A N   1 
ATOM   6069  C  CA  . SER A  1  795  ? 182.565 195.041 177.625 1.00   125.47 ? 1213 SER A CA  1 
ATOM   6070  C  C   . SER A  1  795  ? 183.328 195.837 178.625 1.00   122.02 ? 1213 SER A C   1 
ATOM   6071  O  O   . SER A  1  795  ? 183.237 197.051 178.626 1.00   173.96 ? 1213 SER A O   1 
ATOM   6072  C  CB  . SER A  1  795  ? 181.375 194.386 178.298 1.00   117.47 ? 1213 SER A CB  1 
ATOM   6073  O  OG  . SER A  1  795  ? 180.793 193.503 177.333 1.00   133.28 ? 1213 SER A OG  1 
ATOM   6074  N  N   . ALA A  1  796  ? 184.091 195.154 179.471 1.00   122.69 ? 1214 ALA A N   1 
ATOM   6075  C  CA  . ALA A  1  796  ? 184.959 195.813 180.445 1.00   138.20 ? 1214 ALA A CA  1 
ATOM   6076  C  C   . ALA A  1  796  ? 185.998 196.731 179.794 1.00   146.87 ? 1214 ALA A C   1 
ATOM   6077  O  O   . ALA A  1  796  ? 186.397 197.737 180.367 1.00   139.11 ? 1214 ALA A O   1 
ATOM   6078  C  CB  . ALA A  1  796  ? 185.646 194.770 181.308 1.00   138.07 ? 1214 ALA A CB  1 
ATOM   6079  N  N   . ALA A  1  797  ? 186.434 196.386 178.595 1.00   160.33 ? 1215 ALA A N   1 
ATOM   6080  C  CA  . ALA A  1  797  ? 187.326 197.262 177.862 1.00   173.19 ? 1215 ALA A CA  1 
ATOM   6081  C  C   . ALA A  1  797  ? 186.643 198.607 177.559 1.00   169.15 ? 1215 ALA A C   1 
ATOM   6082  O  O   . ALA A  1  797  ? 187.204 199.665 177.838 1.00   182.64 ? 1215 ALA A O   1 
ATOM   6083  C  CB  . ALA A  1  797  ? 187.812 196.577 176.589 1.00   185.23 ? 1215 ALA A CB  1 
ATOM   6084  N  N   . LYS A  1  798  ? 185.426 198.552 177.037 1.00   154.73 ? 1216 LYS A N   1 
ATOM   6085  C  CA  . LYS A  1  798  ? 184.716 199.754 176.660 1.00   167.58 ? 1216 LYS A CA  1 
ATOM   6086  C  C   . LYS A  1  798  ? 184.272 200.531 177.872 1.00   173.34 ? 1216 LYS A C   1 
ATOM   6087  O  O   . LYS A  1  798  ? 184.141 201.728 177.779 1.00   218.79 ? 1216 LYS A O   1 
ATOM   6088  C  CB  . LYS A  1  798  ? 183.570 199.417 175.710 1.00   181.64 ? 1216 LYS A CB  1 
ATOM   6089  C  CG  . LYS A  1  798  ? 183.996 199.502 174.259 1.00   191.68 ? 1216 LYS A CG  1 
ATOM   6090  C  CD  . LYS A  1  798  ? 185.275 198.722 173.958 1.00   199.86 ? 1216 LYS A CD  1 
ATOM   6091  C  CE  . LYS A  1  798  ? 185.938 199.210 172.682 1.00   228.20 ? 1216 LYS A CE  1 
ATOM   6092  N  NZ  . LYS A  1  798  ? 185.187 198.796 171.466 1.00   263.57 ? 1216 LYS A NZ  1 
ATOM   6093  N  N   . LEU A  1  799  ? 184.088 199.850 179.005 1.00   169.92 ? 1217 LEU A N   1 
ATOM   6094  C  CA  . LEU A  1  799  ? 183.847 200.456 180.327 1.00   176.75 ? 1217 LEU A CA  1 
ATOM   6095  C  C   . LEU A  1  799  ? 183.105 201.799 180.336 1.00   176.09 ? 1217 LEU A C   1 
ATOM   6096  O  O   . LEU A  1  799  ? 183.622 202.883 180.728 1.00   147.59 ? 1217 LEU A O   1 
ATOM   6097  C  CB  . LEU A  1  799  ? 185.158 200.597 181.108 1.00   199.96 ? 1217 LEU A CB  1 
ATOM   6098  C  CG  . LEU A  1  799  ? 185.115 200.331 182.623 1.00   201.70 ? 1217 LEU A CG  1 
ATOM   6099  C  CD1 . LEU A  1  799  ? 186.233 201.111 183.318 1.00   222.39 ? 1217 LEU A CD1 1 
ATOM   6100  C  CD2 . LEU A  1  799  ? 183.785 200.634 183.296 1.00   162.75 ? 1217 LEU A CD2 1 
ATOM   6101  N  N   . GLY A  1  800  ? 181.871 201.704 179.880 1.00   169.39 ? 1218 GLY A N   1 
ATOM   6102  C  CA  . GLY A  1  800  ? 180.946 202.836 179.916 1.00   171.27 ? 1218 GLY A CA  1 
ATOM   6103  C  C   . GLY A  1  800  ? 181.184 203.883 178.825 1.00   187.82 ? 1218 GLY A C   1 
ATOM   6104  O  O   . GLY A  1  800  ? 180.678 205.016 178.899 1.00   138.66 ? 1218 GLY A O   1 
ATOM   6105  N  N   . THR A  1  801  ? 181.943 203.507 177.799 1.00   203.90 ? 1219 THR A N   1 
ATOM   6106  C  CA  . THR A  1  801  ? 182.198 204.375 176.666 1.00   193.63 ? 1219 THR A CA  1 
ATOM   6107  C  C   . THR A  1  801  ? 181.046 204.351 175.681 1.00   170.93 ? 1219 THR A C   1 
ATOM   6108  O  O   . THR A  1  801  ? 180.923 205.269 174.900 1.00   169.31 ? 1219 THR A O   1 
ATOM   6109  C  CB  . THR A  1  801  ? 183.498 203.964 175.953 1.00   236.80 ? 1219 THR A CB  1 
ATOM   6110  O  OG1 . THR A  1  801  ? 184.569 204.075 176.894 1.00   312.78 ? 1219 THR A OG1 1 
ATOM   6111  C  CG2 . THR A  1  801  ? 183.814 204.845 174.744 1.00   274.45 ? 1219 THR A CG2 1 
ATOM   6112  N  N   . MET A  1  802  ? 180.199 203.317 175.718 1.00   189.34 ? 1220 MET A N   1 
ATOM   6113  C  CA  . MET A  1  802  ? 179.008 203.184 174.830 1.00   189.24 ? 1220 MET A CA  1 
ATOM   6114  C  C   . MET A  1  802  ? 179.360 202.895 173.393 1.00   176.91 ? 1220 MET A C   1 
ATOM   6115  O  O   . MET A  1  802  ? 179.021 203.687 172.512 1.00   188.02 ? 1220 MET A O   1 
ATOM   6116  C  CB  . MET A  1  802  ? 178.110 204.430 174.764 1.00   213.11 ? 1220 MET A CB  1 
ATOM   6117  C  CG  . MET A  1  802  ? 177.744 205.085 176.054 1.00   252.09 ? 1220 MET A CG  1 
ATOM   6118  S  SD  . MET A  1  802  ? 176.670 206.491 175.707 1.00   285.23 ? 1220 MET A SD  1 
ATOM   6119  C  CE  . MET A  1  802  ? 175.084 205.698 175.452 1.00   272.99 ? 1220 MET A CE  1 
ATOM   6120  N  N   . ASP A  1  803  ? 180.014 201.776 173.126 1.00   162.77 ? 1221 ASP A N   1 
ATOM   6121  C  CA  . ASP A  1  803  ? 180.376 201.465 171.755 1.00   180.86 ? 1221 ASP A CA  1 
ATOM   6122  C  C   . ASP A  1  803  ? 179.214 200.773 171.089 1.00   166.63 ? 1221 ASP A C   1 
ATOM   6123  O  O   . ASP A  1  803  ? 178.698 199.802 171.619 1.00   188.93 ? 1221 ASP A O   1 
ATOM   6124  C  CB  . ASP A  1  803  ? 181.616 200.580 171.681 1.00   216.16 ? 1221 ASP A CB  1 
ATOM   6125  C  CG  . ASP A  1  803  ? 182.192 200.499 170.261 1.00   252.17 ? 1221 ASP A CG  1 
ATOM   6126  O  OD1 . ASP A  1  803  ? 181.420 200.540 169.268 1.00   247.91 ? 1221 ASP A OD1 1 
ATOM   6127  O  OD2 . ASP A  1  803  ? 183.433 200.403 170.144 1.00   313.40 ? 1221 ASP A OD2 1 
ATOM   6128  N  N   . MET A  1  804  ? 178.828 201.257 169.912 1.00   170.82 ? 1222 MET A N   1 
ATOM   6129  C  CA  . MET A  1  804  ? 177.749 200.619 169.170 1.00   204.53 ? 1222 MET A CA  1 
ATOM   6130  C  C   . MET A  1  804  ? 178.116 199.208 168.663 1.00   199.43 ? 1222 MET A C   1 
ATOM   6131  O  O   . MET A  1  804  ? 177.244 198.346 168.549 1.00   208.96 ? 1222 MET A O   1 
ATOM   6132  C  CB  . MET A  1  804  ? 177.287 201.514 168.018 1.00   232.75 ? 1222 MET A CB  1 
ATOM   6133  C  CG  . MET A  1  804  ? 176.076 200.987 167.248 1.00   268.40 ? 1222 MET A CG  1 
ATOM   6134  S  SD  . MET A  1  804  ? 174.655 200.429 168.221 1.00   304.75 ? 1222 MET A SD  1 
ATOM   6135  C  CE  . MET A  1  804  ? 174.346 201.847 169.280 1.00   288.74 ? 1222 MET A CE  1 
ATOM   6136  N  N   . SER A  1  805  ? 179.394 198.976 168.368 1.00   173.87 ? 1223 SER A N   1 
ATOM   6137  C  CA  . SER A  1  805  ? 179.851 197.657 167.905 1.00   187.34 ? 1223 SER A CA  1 
ATOM   6138  C  C   . SER A  1  805  ? 179.680 196.561 168.944 1.00   164.62 ? 1223 SER A C   1 
ATOM   6139  O  O   . SER A  1  805  ? 179.249 195.463 168.645 1.00   191.19 ? 1223 SER A O   1 
ATOM   6140  C  CB  . SER A  1  805  ? 181.317 197.735 167.513 1.00   204.66 ? 1223 SER A CB  1 
ATOM   6141  O  OG  . SER A  1  805  ? 181.512 198.787 166.592 1.00   244.78 ? 1223 SER A OG  1 
ATOM   6142  N  N   . ILE A  1  806  ? 180.038 196.890 170.169 1.00   153.64 ? 1224 ILE A N   1 
ATOM   6143  C  CA  . ILE A  1  806  ? 179.956 195.997 171.313 1.00   142.27 ? 1224 ILE A CA  1 
ATOM   6144  C  C   . ILE A  1  806  ? 178.527 195.838 171.702 1.00   139.18 ? 1224 ILE A C   1 
ATOM   6145  O  O   . ILE A  1  806  ? 178.066 194.721 171.893 1.00   155.62 ? 1224 ILE A O   1 
ATOM   6146  C  CB  . ILE A  1  806  ? 180.767 196.598 172.496 1.00   139.04 ? 1224 ILE A CB  1 
ATOM   6147  C  CG1 . ILE A  1  806  ? 182.274 196.603 172.149 1.00   188.93 ? 1224 ILE A CG1 1 
ATOM   6148  C  CG2 . ILE A  1  806  ? 180.488 195.918 173.810 1.00   120.19 ? 1224 ILE A CG2 1 
ATOM   6149  C  CD1 . ILE A  1  806  ? 182.787 195.559 171.145 1.00   197.08 ? 1224 ILE A CD1 1 
ATOM   6150  N  N   . THR A  1  807  ? 177.838 196.969 171.824 1.00   130.46 ? 1225 THR A N   1 
ATOM   6151  C  CA  . THR A  1  807  ? 176.437 196.995 172.227 1.00   132.66 ? 1225 THR A CA  1 
ATOM   6152  C  C   . THR A  1  807  ? 175.631 196.036 171.416 1.00   129.64 ? 1225 THR A C   1 
ATOM   6153  O  O   . THR A  1  807  ? 174.856 195.263 171.972 1.00   141.22 ? 1225 THR A O   1 
ATOM   6154  C  CB  . THR A  1  807  ? 175.824 198.392 172.046 1.00   143.95 ? 1225 THR A CB  1 
ATOM   6155  O  OG1 . THR A  1  807  ? 176.179 199.194 173.170 1.00   190.58 ? 1225 THR A OG1 1 
ATOM   6156  C  CG2 . THR A  1  807  ? 174.289 198.356 171.940 1.00   152.82 ? 1225 THR A CG2 1 
ATOM   6157  N  N   . ARG A  1  808  ? 175.825 196.126 170.103 1.00   118.96 ? 1226 ARG A N   1 
ATOM   6158  C  CA  . ARG A  1  808  ? 175.103 195.333 169.119 1.00   123.07 ? 1226 ARG A CA  1 
ATOM   6159  C  C   . ARG A  1  808  ? 175.393 193.850 169.301 1.00   122.55 ? 1226 ARG A C   1 
ATOM   6160  O  O   . ARG A  1  808  ? 174.499 193.017 169.212 1.00   152.25 ? 1226 ARG A O   1 
ATOM   6161  C  CB  . ARG A  1  808  ? 175.524 195.800 167.732 1.00   142.94 ? 1226 ARG A CB  1 
ATOM   6162  C  CG  . ARG A  1  808  ? 174.691 195.284 166.575 1.00   171.60 ? 1226 ARG A CG  1 
ATOM   6163  C  CD  . ARG A  1  808  ? 175.369 195.583 165.248 1.00   180.01 ? 1226 ARG A CD  1 
ATOM   6164  N  NE  . ARG A  1  808  ? 175.749 196.993 165.151 1.00   176.82 ? 1226 ARG A NE  1 
ATOM   6165  C  CZ  . ARG A  1  808  ? 176.690 197.472 164.340 1.00   217.91 ? 1226 ARG A CZ  1 
ATOM   6166  N  NH1 . ARG A  1  808  ? 177.384 196.670 163.520 1.00   240.95 ? 1226 ARG A NH1 1 
ATOM   6167  N  NH2 . ARG A  1  808  ? 176.947 198.778 164.349 1.00   219.39 ? 1226 ARG A NH2 1 
ATOM   6168  N  N   . LEU A  1  809  ? 176.648 193.537 169.565 1.00   134.75 ? 1227 LEU A N   1 
ATOM   6169  C  CA  . LEU A  1  809  ? 177.085 192.182 169.880 1.00   138.28 ? 1227 LEU A CA  1 
ATOM   6170  C  C   . LEU A  1  809  ? 176.470 191.609 171.148 1.00   146.08 ? 1227 LEU A C   1 
ATOM   6171  O  O   . LEU A  1  809  ? 176.096 190.460 171.187 1.00   170.72 ? 1227 LEU A O   1 
ATOM   6172  C  CB  . LEU A  1  809  ? 178.585 192.224 170.092 1.00   148.18 ? 1227 LEU A CB  1 
ATOM   6173  C  CG  . LEU A  1  809  ? 179.235 190.964 170.593 1.00   160.44 ? 1227 LEU A CG  1 
ATOM   6174  C  CD1 . LEU A  1  809  ? 178.868 189.814 169.635 1.00   159.93 ? 1227 LEU A CD1 1 
ATOM   6175  C  CD2 . LEU A  1  809  ? 180.733 191.267 170.725 1.00   170.58 ? 1227 LEU A CD2 1 
ATOM   6176  N  N   . LEU A  1  810  ? 176.468 192.380 172.222 1.00   147.41 ? 1228 LEU A N   1 
ATOM   6177  C  CA  . LEU A  1  810  ? 175.845 191.944 173.466 1.00   123.67 ? 1228 LEU A CA  1 
ATOM   6178  C  C   . LEU A  1  810  ? 174.389 191.762 173.237 1.00   121.12 ? 1228 LEU A C   1 
ATOM   6179  O  O   . LEU A  1  810  ? 173.832 190.800 173.686 1.00   145.83 ? 1228 LEU A O   1 
ATOM   6180  C  CB  . LEU A  1  810  ? 175.981 192.997 174.558 1.00   125.75 ? 1228 LEU A CB  1 
ATOM   6181  C  CG  . LEU A  1  810  ? 177.404 193.273 175.047 1.00   128.97 ? 1228 LEU A CG  1 
ATOM   6182  C  CD1 . LEU A  1  810  ? 177.409 194.373 176.123 1.00   103.25 ? 1228 LEU A CD1 1 
ATOM   6183  C  CD2 . LEU A  1  810  ? 178.074 191.961 175.488 1.00   128.82 ? 1228 LEU A CD2 1 
ATOM   6184  N  N   . SER A  1  811  ? 173.773 192.713 172.547 1.00   124.99 ? 1229 SER A N   1 
ATOM   6185  C  CA  . SER A  1  811  ? 172.339 192.687 172.285 1.00   130.02 ? 1229 SER A CA  1 
ATOM   6186  C  C   . SER A  1  811  ? 171.850 191.422 171.623 1.00   112.11 ? 1229 SER A C   1 
ATOM   6187  O  O   . SER A  1  811  ? 170.823 190.912 172.006 1.00   149.43 ? 1229 SER A O   1 
ATOM   6188  C  CB  . SER A  1  811  ? 171.914 193.883 171.454 1.00   146.68 ? 1229 SER A CB  1 
ATOM   6189  O  OG  . SER A  1  811  ? 172.264 195.074 172.140 1.00   168.87 ? 1229 SER A OG  1 
ATOM   6190  N  N   . ILE A  1  812  ? 172.564 190.884 170.660 1.00   107.67 ? 1230 ILE A N   1 
ATOM   6191  C  CA  . ILE A  1  812  ? 172.168 189.578 170.151 1.00   131.68 ? 1230 ILE A CA  1 
ATOM   6192  C  C   . ILE A  1  812  ? 172.081 188.488 171.291 1.00   132.31 ? 1230 ILE A C   1 
ATOM   6193  O  O   . ILE A  1  812  ? 171.199 187.638 171.275 1.00   151.85 ? 1230 ILE A O   1 
ATOM   6194  C  CB  . ILE A  1  812  ? 173.060 189.124 168.972 1.00   138.38 ? 1230 ILE A CB  1 
ATOM   6195  C  CG1 . ILE A  1  812  ? 172.342 188.093 168.103 1.00   165.03 ? 1230 ILE A CG1 1 
ATOM   6196  C  CG2 . ILE A  1  812  ? 174.390 188.598 169.485 1.00   176.08 ? 1230 ILE A CG2 1 
ATOM   6197  C  CD1 . ILE A  1  812  ? 173.017 186.734 167.911 1.00   191.60 ? 1230 ILE A CD1 1 
ATOM   6198  N  N   . HIS A  1  813  ? 172.965 188.539 172.284 1.00   133.31 ? 1231 HIS A N   1 
ATOM   6199  C  CA  . HIS A  1  813  ? 172.953 187.547 173.361 1.00   128.63 ? 1231 HIS A CA  1 
ATOM   6200  C  C   . HIS A  1  813  ? 171.876 187.733 174.396 1.00   133.46 ? 1231 HIS A C   1 
ATOM   6201  O  O   . HIS A  1  813  ? 171.516 186.731 175.000 1.00   202.53 ? 1231 HIS A O   1 
ATOM   6202  C  CB  . HIS A  1  813  ? 174.275 187.483 174.098 1.00   125.48 ? 1231 HIS A CB  1 
ATOM   6203  C  CG  . HIS A  1  813  ? 175.345 186.867 173.296 1.00   129.01 ? 1231 HIS A CG  1 
ATOM   6204  N  ND1 . HIS A  1  813  ? 176.052 187.573 172.354 1.00   145.35 ? 1231 HIS A ND1 1 
ATOM   6205  C  CD2 . HIS A  1  813  ? 175.807 185.601 173.248 1.00   163.55 ? 1231 HIS A CD2 1 
ATOM   6206  C  CE1 . HIS A  1  813  ? 176.919 186.770 171.766 1.00   150.05 ? 1231 HIS A CE1 1 
ATOM   6207  N  NE2 . HIS A  1  813  ? 176.793 185.566 172.293 1.00   165.62 ? 1231 HIS A NE2 1 
ATOM   6208  N  N   . ILE A  1  814  ? 171.364 188.948 174.654 1.00   109.56 ? 1232 ILE A N   1 
ATOM   6209  C  CA  . ILE A  1  814  ? 170.246 189.072 175.639 1.00   129.35 ? 1232 ILE A CA  1 
ATOM   6210  C  C   . ILE A  1  814  ? 168.963 189.228 174.889 1.00   150.98 ? 1232 ILE A C   1 
ATOM   6211  O  O   . ILE A  1  814  ? 168.871 190.040 173.988 1.00   215.74 ? 1232 ILE A O   1 
ATOM   6212  C  CB  . ILE A  1  814  ? 170.371 190.178 176.701 1.00   142.66 ? 1232 ILE A CB  1 
ATOM   6213  C  CG1 . ILE A  1  814  ? 170.050 191.573 176.155 1.00   146.41 ? 1232 ILE A CG1 1 
ATOM   6214  C  CG2 . ILE A  1  814  ? 171.766 190.115 177.296 1.00   177.42 ? 1232 ILE A CG2 1 
ATOM   6215  C  CD1 . ILE A  1  814  ? 170.742 192.719 176.893 1.00   167.29 ? 1232 ILE A CD1 1 
ATOM   6216  N  N   . PRO A  1  815  ? 167.961 188.438 175.237 1.00   172.46 ? 1233 PRO A N   1 
ATOM   6217  C  CA  . PRO A  1  815  ? 166.821 188.376 174.354 1.00   161.49 ? 1233 PRO A CA  1 
ATOM   6218  C  C   . PRO A  1  815  ? 165.909 189.627 174.451 1.00   167.55 ? 1233 PRO A C   1 
ATOM   6219  O  O   . PRO A  1  815  ? 165.106 189.828 173.553 1.00   185.17 ? 1233 PRO A O   1 
ATOM   6220  C  CB  . PRO A  1  815  ? 166.123 187.134 174.819 1.00   173.91 ? 1233 PRO A CB  1 
ATOM   6221  C  CG  . PRO A  1  815  ? 166.307 187.223 176.299 1.00   198.55 ? 1233 PRO A CG  1 
ATOM   6222  C  CD  . PRO A  1  815  ? 167.664 187.831 176.540 1.00   186.55 ? 1233 PRO A CD  1 
ATOM   6223  N  N   . ALA A  1  816  ? 166.055 190.476 175.480 1.00   164.35 ? 1234 ALA A N   1 
ATOM   6224  C  CA  . ALA A  1  816  ? 165.198 191.675 175.603 1.00   166.57 ? 1234 ALA A CA  1 
ATOM   6225  C  C   . ALA A  1  816  ? 165.465 192.763 174.570 1.00   167.85 ? 1234 ALA A C   1 
ATOM   6226  O  O   . ALA A  1  816  ? 164.527 193.369 174.054 1.00   220.93 ? 1234 ALA A O   1 
ATOM   6227  C  CB  . ALA A  1  816  ? 165.282 192.287 176.991 1.00   161.81 ? 1234 ALA A CB  1 
ATOM   6228  N  N   . LEU A  1  817  ? 166.723 193.040 174.271 1.00   145.36 ? 1235 LEU A N   1 
ATOM   6229  C  CA  . LEU A  1  817  ? 167.028 194.133 173.358 1.00   151.08 ? 1235 LEU A CA  1 
ATOM   6230  C  C   . LEU A  1  817  ? 166.522 193.848 171.932 1.00   179.73 ? 1235 LEU A C   1 
ATOM   6231  O  O   . LEU A  1  817  ? 165.804 194.686 171.347 1.00   208.45 ? 1235 LEU A O   1 
ATOM   6232  C  CB  . LEU A  1  817  ? 168.518 194.451 173.379 1.00   144.54 ? 1235 LEU A CB  1 
ATOM   6233  C  CG  . LEU A  1  817  ? 168.957 195.483 174.423 1.00   162.73 ? 1235 LEU A CG  1 
ATOM   6234  C  CD1 . LEU A  1  817  ? 168.299 195.250 175.758 1.00   153.56 ? 1235 LEU A CD1 1 
ATOM   6235  C  CD2 . LEU A  1  817  ? 170.477 195.519 174.581 1.00   189.02 ? 1235 LEU A CD2 1 
ATOM   6236  N  N   . LEU A  1  818  ? 166.883 192.676 171.393 1.00   153.85 ? 1236 LEU A N   1 
ATOM   6237  C  CA  . LEU A  1  818  ? 166.498 192.305 170.030 1.00   165.91 ? 1236 LEU A CA  1 
ATOM   6238  C  C   . LEU A  1  818  ? 165.013 191.960 170.054 1.00   181.92 ? 1236 LEU A C   1 
ATOM   6239  O  O   . LEU A  1  818  ? 164.546 191.485 171.087 1.00   190.32 ? 1236 LEU A O   1 
ATOM   6240  C  CB  . LEU A  1  818  ? 167.374 191.155 169.491 1.00   171.38 ? 1236 LEU A CB  1 
ATOM   6241  C  CG  . LEU A  1  818  ? 167.083 189.653 169.697 1.00   178.59 ? 1236 LEU A CG  1 
ATOM   6242  C  CD1 . LEU A  1  818  ? 167.870 188.739 168.746 1.00   156.40 ? 1236 LEU A CD1 1 
ATOM   6243  C  CD2 . LEU A  1  818  ? 167.366 189.244 171.127 1.00   193.68 ? 1236 LEU A CD2 1 
ATOM   6244  N  N   . PRO A  1  819  ? 164.274 192.192 168.936 1.00   188.93 ? 1237 PRO A N   1 
ATOM   6245  C  CA  . PRO A  1  819  ? 162.797 192.271 168.963 1.00   199.80 ? 1237 PRO A CA  1 
ATOM   6246  C  C   . PRO A  1  819  ? 162.084 191.056 169.525 1.00   216.43 ? 1237 PRO A C   1 
ATOM   6247  O  O   . PRO A  1  819  ? 162.632 189.945 169.482 1.00   233.54 ? 1237 PRO A O   1 
ATOM   6248  C  CB  . PRO A  1  819  ? 162.387 192.385 167.485 1.00   177.53 ? 1237 PRO A CB  1 
ATOM   6249  C  CG  . PRO A  1  819  ? 163.639 192.577 166.745 1.00   178.02 ? 1237 PRO A CG  1 
ATOM   6250  C  CD  . PRO A  1  819  ? 164.753 192.013 167.560 1.00   170.01 ? 1237 PRO A CD  1 
ATOM   6251  N  N   . PRO A  1  820  ? 160.847 191.261 170.008 1.00   220.12 ? 1238 PRO A N   1 
ATOM   6252  C  CA  . PRO A  1  820  ? 160.053 190.147 170.465 1.00   230.01 ? 1238 PRO A CA  1 
ATOM   6253  C  C   . PRO A  1  820  ? 159.540 189.407 169.237 1.00   240.71 ? 1238 PRO A C   1 
ATOM   6254  O  O   . PRO A  1  820  ? 158.976 190.021 168.324 1.00   233.84 ? 1238 PRO A O   1 
ATOM   6255  C  CB  . PRO A  1  820  ? 158.930 190.812 171.251 1.00   238.02 ? 1238 PRO A CB  1 
ATOM   6256  C  CG  . PRO A  1  820  ? 158.752 192.133 170.591 1.00   248.69 ? 1238 PRO A CG  1 
ATOM   6257  C  CD  . PRO A  1  820  ? 160.058 192.504 169.950 1.00   235.00 ? 1238 PRO A CD  1 
ATOM   6258  N  N   . THR A  1  821  ? 159.815 188.113 169.215 1.00   253.63 ? 1239 THR A N   1 
ATOM   6259  C  CA  . THR A  1  821  ? 159.506 187.233 168.097 1.00   257.81 ? 1239 THR A CA  1 
ATOM   6260  C  C   . THR A  1  821  ? 160.008 185.845 168.446 1.00   250.41 ? 1239 THR A C   1 
ATOM   6261  O  O   . THR A  1  821  ? 160.699 185.667 169.450 1.00   246.61 ? 1239 THR A O   1 
ATOM   6262  C  CB  . THR A  1  821  ? 160.206 187.664 166.788 1.00   276.16 ? 1239 THR A CB  1 
ATOM   6263  O  OG1 . THR A  1  821  ? 159.837 186.769 165.731 1.00   332.63 ? 1239 THR A OG1 1 
ATOM   6264  C  CG2 . THR A  1  821  ? 161.730 187.663 166.941 1.00   267.05 ? 1239 THR A CG2 1 
ATOM   6265  N  N   . SER A  1  822  ? 159.672 184.870 167.609 1.00   258.67 ? 1240 SER A N   1 
ATOM   6266  C  CA  . SER A  1  822  ? 160.313 183.557 167.676 1.00   265.50 ? 1240 SER A CA  1 
ATOM   6267  C  C   . SER A  1  822  ? 161.639 183.598 166.924 1.00   280.38 ? 1240 SER A C   1 
ATOM   6268  O  O   . SER A  1  822  ? 161.677 183.565 165.694 1.00   296.47 ? 1240 SER A O   1 
ATOM   6269  C  CB  . SER A  1  822  ? 159.439 182.461 167.090 1.00   260.89 ? 1240 SER A CB  1 
ATOM   6270  O  OG  . SER A  1  822  ? 160.159 181.237 167.078 1.00   258.61 ? 1240 SER A OG  1 
ATOM   6271  N  N   . THR A  1  823  ? 162.717 183.689 167.681 1.00   293.88 ? 1241 THR A N   1 
ATOM   6272  C  CA  . THR A  1  823  ? 164.050 183.626 167.140 1.00   318.35 ? 1241 THR A CA  1 
ATOM   6273  C  C   . THR A  1  823  ? 164.565 182.188 167.203 1.00   301.21 ? 1241 THR A C   1 
ATOM   6274  O  O   . THR A  1  823  ? 165.338 181.778 166.338 1.00   318.80 ? 1241 THR A O   1 
ATOM   6275  C  CB  . THR A  1  823  ? 164.984 184.554 167.937 1.00   366.78 ? 1241 THR A CB  1 
ATOM   6276  O  OG1 . THR A  1  823  ? 164.970 184.183 169.320 1.00   412.48 ? 1241 THR A OG1 1 
ATOM   6277  C  CG2 . THR A  1  823  ? 164.520 185.997 167.827 1.00   371.96 ? 1241 THR A CG2 1 
ATOM   6278  N  N   . GLU A  1  824  ? 164.147 181.420 168.223 1.00   267.31 ? 1242 GLU A N   1 
ATOM   6279  C  CA  . GLU A  1  824  ? 164.744 180.099 168.499 1.00   266.51 ? 1242 GLU A CA  1 
ATOM   6280  C  C   . GLU A  1  824  ? 166.295 180.218 168.502 1.00   260.88 ? 1242 GLU A C   1 
ATOM   6281  O  O   . GLU A  1  824  ? 166.987 179.585 167.711 1.00   312.18 ? 1242 GLU A O   1 
ATOM   6282  C  CB  . GLU A  1  824  ? 164.145 179.044 167.514 1.00   309.09 ? 1242 GLU A CB  1 
ATOM   6283  C  CG  . GLU A  1  824  ? 164.947 177.808 167.036 1.00   331.30 ? 1242 GLU A CG  1 
ATOM   6284  C  CD  . GLU A  1  824  ? 165.232 176.744 168.091 1.00   335.75 ? 1242 GLU A CD  1 
ATOM   6285  O  OE1 . GLU A  1  824  ? 164.804 176.903 169.256 1.00   376.44 ? 1242 GLU A OE1 1 
ATOM   6286  O  OE2 . GLU A  1  824  ? 165.885 175.726 167.736 1.00   275.13 ? 1242 GLU A OE2 1 
ATOM   6287  N  N   . LEU A  1  825  ? 166.831 181.073 169.377 1.00   227.96 ? 1243 LEU A N   1 
ATOM   6288  C  CA  . LEU A  1  825  ? 168.274 181.384 169.379 1.00   206.02 ? 1243 LEU A CA  1 
ATOM   6289  C  C   . LEU A  1  825  ? 168.788 181.078 170.771 1.00   209.43 ? 1243 LEU A C   1 
ATOM   6290  O  O   . LEU A  1  825  ? 168.775 181.899 171.680 1.00   225.43 ? 1243 LEU A O   1 
ATOM   6291  C  CB  . LEU A  1  825  ? 168.563 182.803 168.842 1.00   173.54 ? 1243 LEU A CB  1 
ATOM   6292  C  CG  . LEU A  1  825  ? 168.705 184.093 169.661 1.00   175.20 ? 1243 LEU A CG  1 
ATOM   6293  C  CD1 . LEU A  1  825  ? 168.779 185.246 168.670 1.00   158.22 ? 1243 LEU A CD1 1 
ATOM   6294  C  CD2 . LEU A  1  825  ? 167.631 184.373 170.723 1.00   196.79 ? 1243 LEU A CD2 1 
ATOM   6295  N  N   . ASP A  1  826  ? 169.156 179.815 170.917 1.00   228.02 ? 1244 ASP A N   1 
ATOM   6296  C  CA  . ASP A  1  826  ? 169.674 179.278 172.170 1.00   250.09 ? 1244 ASP A CA  1 
ATOM   6297  C  C   . ASP A  1  826  ? 170.947 179.972 172.633 1.00   218.65 ? 1244 ASP A C   1 
ATOM   6298  O  O   . ASP A  1  826  ? 171.958 179.979 171.937 1.00   232.72 ? 1244 ASP A O   1 
ATOM   6299  C  CB  . ASP A  1  826  ? 169.932 177.758 172.059 1.00   306.69 ? 1244 ASP A CB  1 
ATOM   6300  C  CG  . ASP A  1  826  ? 170.847 177.370 170.878 1.00   334.96 ? 1244 ASP A CG  1 
ATOM   6301  O  OD1 . ASP A  1  826  ? 171.043 178.199 169.955 1.00   335.37 ? 1244 ASP A OD1 1 
ATOM   6302  O  OD2 . ASP A  1  826  ? 171.353 176.223 170.870 1.00   370.21 ? 1244 ASP A OD2 1 
ATOM   6303  N  N   . VAL A  1  827  ? 170.868 180.584 173.802 1.00   174.71 ? 1245 VAL A N   1 
ATOM   6304  C  CA  . VAL A  1  827  ? 172.042 181.080 174.487 1.00   175.24 ? 1245 VAL A CA  1 
ATOM   6305  C  C   . VAL A  1  827  ? 171.946 180.290 175.779 1.00   164.32 ? 1245 VAL A C   1 
ATOM   6306  O  O   . VAL A  1  827  ? 170.842 180.135 176.303 1.00   192.75 ? 1245 VAL A O   1 
ATOM   6307  C  CB  . VAL A  1  827  ? 171.978 182.626 174.706 1.00   180.59 ? 1245 VAL A CB  1 
ATOM   6308  C  CG1 . VAL A  1  827  ? 173.137 183.131 175.548 1.00   170.80 ? 1245 VAL A CG1 1 
ATOM   6309  C  CG2 . VAL A  1  827  ? 171.971 183.381 173.379 1.00   169.64 ? 1245 VAL A CG2 1 
ATOM   6310  N  N   . PRO A  1  828  ? 173.067 179.750 176.285 1.00   149.74 ? 1246 PRO A N   1 
ATOM   6311  C  CA  . PRO A  1  828  ? 173.030 179.185 177.631 1.00   155.67 ? 1246 PRO A CA  1 
ATOM   6312  C  C   . PRO A  1  828  ? 172.640 180.254 178.620 1.00   157.61 ? 1246 PRO A C   1 
ATOM   6313  O  O   . PRO A  1  828  ? 173.142 181.375 178.523 1.00   182.23 ? 1246 PRO A O   1 
ATOM   6314  C  CB  . PRO A  1  828  ? 174.471 178.754 177.883 1.00   172.22 ? 1246 PRO A CB  1 
ATOM   6315  C  CG  . PRO A  1  828  ? 175.063 178.595 176.526 1.00   182.66 ? 1246 PRO A CG  1 
ATOM   6316  C  CD  . PRO A  1  828  ? 174.392 179.622 175.667 1.00   172.01 ? 1246 PRO A CD  1 
ATOM   6317  N  N   . HIS A  1  829  ? 171.761 179.922 179.562 1.00   165.98 ? 1247 HIS A N   1 
ATOM   6318  C  CA  . HIS A  1  829  ? 171.273 180.895 180.544 1.00   170.86 ? 1247 HIS A CA  1 
ATOM   6319  C  C   . HIS A  1  829  ? 172.419 181.605 181.209 1.00   164.76 ? 1247 HIS A C   1 
ATOM   6320  O  O   . HIS A  1  829  ? 172.335 182.789 181.554 1.00   163.71 ? 1247 HIS A O   1 
ATOM   6321  C  CB  . HIS A  1  829  ? 170.466 180.211 181.635 1.00   185.06 ? 1247 HIS A CB  1 
ATOM   6322  C  CG  . HIS A  1  829  ? 170.003 181.153 182.696 1.00   195.88 ? 1247 HIS A CG  1 
ATOM   6323  N  ND1 . HIS A  1  829  ? 170.738 181.409 183.833 1.00   194.56 ? 1247 HIS A ND1 1 
ATOM   6324  C  CD2 . HIS A  1  829  ? 168.903 181.941 182.771 1.00   195.05 ? 1247 HIS A CD2 1 
ATOM   6325  C  CE1 . HIS A  1  829  ? 170.094 182.293 184.576 1.00   199.49 ? 1247 HIS A CE1 1 
ATOM   6326  N  NE2 . HIS A  1  829  ? 168.975 182.625 183.957 1.00   188.46 ? 1247 HIS A NE2 1 
ATOM   6327  N  N   . ASN A  1  830  ? 173.481 180.838 181.406 1.00   145.59 ? 1248 ASN A N   1 
ATOM   6328  C  CA  . ASN A  1  830  ? 174.657 181.343 182.031 1.00   144.84 ? 1248 ASN A CA  1 
ATOM   6329  C  C   . ASN A  1  830  ? 175.288 182.522 181.282 1.00   132.17 ? 1248 ASN A C   1 
ATOM   6330  O  O   . ASN A  1  830  ? 175.751 183.480 181.916 1.00   109.58 ? 1248 ASN A O   1 
ATOM   6331  C  CB  . ASN A  1  830  ? 175.641 180.190 182.204 1.00   152.98 ? 1248 ASN A CB  1 
ATOM   6332  C  CG  . ASN A  1  830  ? 176.277 180.189 183.561 1.00   174.83 ? 1248 ASN A CG  1 
ATOM   6333  O  OD1 . ASN A  1  830  ? 175.945 181.024 184.429 1.00   172.33 ? 1248 ASN A OD1 1 
ATOM   6334  N  ND2 . ASN A  1  830  ? 177.204 179.251 183.767 1.00   192.23 ? 1248 ASN A ND2 1 
ATOM   6335  N  N   . VAL A  1  831  ? 175.280 182.440 179.942 1.00   120.41 ? 1249 VAL A N   1 
ATOM   6336  C  CA  . VAL A  1  831  ? 175.830 183.486 179.063 1.00   112.22 ? 1249 VAL A CA  1 
ATOM   6337  C  C   . VAL A  1  831  ? 175.041 184.741 179.120 1.00   111.44 ? 1249 VAL A C   1 
ATOM   6338  O  O   . VAL A  1  831  ? 175.645 185.820 179.153 1.00   122.74 ? 1249 VAL A O   1 
ATOM   6339  C  CB  . VAL A  1  831  ? 175.871 183.075 177.579 1.00   113.70 ? 1249 VAL A CB  1 
ATOM   6340  C  CG1 . VAL A  1  831  ? 176.213 184.235 176.635 1.00   105.65 ? 1249 VAL A CG1 1 
ATOM   6341  C  CG2 . VAL A  1  831  ? 176.899 181.988 177.410 1.00   147.80 ? 1249 VAL A CG2 1 
ATOM   6342  N  N   . GLN A  1  832  ? 173.718 184.631 179.105 1.00   101.11 ? 1250 GLN A N   1 
ATOM   6343  C  CA  . GLN A  1  832  ? 172.908 185.851 179.164 1.00   115.45 ? 1250 GLN A CA  1 
ATOM   6344  C  C   . GLN A  1  832  ? 173.193 186.606 180.461 1.00   109.75 ? 1250 GLN A C   1 
ATOM   6345  O  O   . GLN A  1  832  ? 173.354 187.814 180.405 1.00   121.74 ? 1250 GLN A O   1 
ATOM   6346  C  CB  . GLN A  1  832  ? 171.411 185.678 178.880 1.00   120.38 ? 1250 GLN A CB  1 
ATOM   6347  C  CG  . GLN A  1  832  ? 170.967 184.251 178.685 1.00   144.40 ? 1250 GLN A CG  1 
ATOM   6348  C  CD  . GLN A  1  832  ? 169.548 184.163 178.232 1.00   180.05 ? 1250 GLN A CD  1 
ATOM   6349  O  OE1 . GLN A  1  832  ? 168.674 183.713 178.978 1.00   232.49 ? 1250 GLN A OE1 1 
ATOM   6350  N  NE2 . GLN A  1  832  ? 169.296 184.596 177.002 1.00   188.00 ? 1250 GLN A NE2 1 
ATOM   6351  N  N   . VAL A  1  833  ? 173.359 185.946 181.604 1.00   101.56 ? 1251 VAL A N   1 
ATOM   6352  C  CA  . VAL A  1  833  ? 173.665 186.761 182.794 1.00   113.69 ? 1251 VAL A CA  1 
ATOM   6353  C  C   . VAL A  1  833  ? 174.946 187.571 182.596 1.00   106.66 ? 1251 VAL A C   1 
ATOM   6354  O  O   . VAL A  1  833  ? 175.031 188.683 183.082 1.00   131.35 ? 1251 VAL A O   1 
ATOM   6355  C  CB  . VAL A  1  833  ? 173.677 185.992 184.118 1.00   131.83 ? 1251 VAL A CB  1 
ATOM   6356  C  CG1 . VAL A  1  833  ? 172.324 185.350 184.335 1.00   157.02 ? 1251 VAL A CG1 1 
ATOM   6357  C  CG2 . VAL A  1  833  ? 174.738 184.918 184.136 1.00   166.07 ? 1251 VAL A CG2 1 
ATOM   6358  N  N   . ALA A  1  834  ? 175.903 187.035 181.842 1.00   110.25 ? 1252 ALA A N   1 
ATOM   6359  C  CA  . ALA A  1  834  ? 177.154 187.737 181.537 1.00   127.40 ? 1252 ALA A CA  1 
ATOM   6360  C  C   . ALA A  1  834  ? 176.870 188.930 180.636 1.00   142.59 ? 1252 ALA A C   1 
ATOM   6361  O  O   . ALA A  1  834  ? 177.261 190.088 180.912 1.00   145.59 ? 1252 ALA A O   1 
ATOM   6362  C  CB  . ALA A  1  834  ? 178.157 186.796 180.852 1.00   119.93 ? 1252 ALA A CB  1 
ATOM   6363  N  N   . ALA A  1  835  ? 176.177 188.618 179.551 1.00   124.10 ? 1253 ALA A N   1 
ATOM   6364  C  CA  . ALA A  1  835  ? 175.826 189.617 178.571 1.00   130.22 ? 1253 ALA A CA  1 
ATOM   6365  C  C   . ALA A  1  835  ? 175.090 190.781 179.206 1.00   126.29 ? 1253 ALA A C   1 
ATOM   6366  O  O   . ALA A  1  835  ? 175.387 191.919 178.870 1.00   137.36 ? 1253 ALA A O   1 
ATOM   6367  C  CB  . ALA A  1  835  ? 175.006 189.000 177.457 1.00   140.81 ? 1253 ALA A CB  1 
ATOM   6368  N  N   . VAL A  1  836  ? 174.185 190.498 180.155 1.00   130.38 ? 1254 VAL A N   1 
ATOM   6369  C  CA  . VAL A  1  836  ? 173.421 191.545 180.861 1.00   118.13 ? 1254 VAL A CA  1 
ATOM   6370  C  C   . VAL A  1  836  ? 174.291 192.442 181.672 1.00   113.36 ? 1254 VAL A C   1 
ATOM   6371  O  O   . VAL A  1  836  ? 174.035 193.643 181.699 1.00   116.67 ? 1254 VAL A O   1 
ATOM   6372  C  CB  . VAL A  1  836  ? 172.489 191.008 181.933 1.00   121.12 ? 1254 VAL A CB  1 
ATOM   6373  C  CG1 . VAL A  1  836  ? 171.783 192.178 182.598 1.00   123.74 ? 1254 VAL A CG1 1 
ATOM   6374  C  CG2 . VAL A  1  836  ? 171.485 190.024 181.357 1.00   142.32 ? 1254 VAL A CG2 1 
ATOM   6375  N  N   . VAL A  1  837  ? 175.279 191.871 182.359 1.00   108.92 ? 1255 VAL A N   1 
ATOM   6376  C  CA  . VAL A  1  837  ? 176.241 192.718 183.080 1.00   126.23 ? 1255 VAL A CA  1 
ATOM   6377  C  C   . VAL A  1  837  ? 177.149 193.442 182.141 1.00   132.40 ? 1255 VAL A C   1 
ATOM   6378  O  O   . VAL A  1  837  ? 177.659 194.529 182.486 1.00   130.14 ? 1255 VAL A O   1 
ATOM   6379  C  CB  . VAL A  1  837  ? 177.247 192.029 183.970 1.00   124.54 ? 1255 VAL A CB  1 
ATOM   6380  C  CG1 . VAL A  1  837  ? 177.464 192.928 185.188 1.00   134.35 ? 1255 VAL A CG1 1 
ATOM   6381  C  CG2 . VAL A  1  837  ? 176.806 190.640 184.356 1.00   133.40 ? 1255 VAL A CG2 1 
ATOM   6382  N  N   . GLY A  1  838  ? 177.414 192.796 181.004 1.00   121.14 ? 1256 GLY A N   1 
ATOM   6383  C  CA  . GLY A  1  838  ? 178.061 193.454 179.891 1.00   124.44 ? 1256 GLY A CA  1 
ATOM   6384  C  C   . GLY A  1  838  ? 177.429 194.804 179.611 1.00   112.94 ? 1256 GLY A C   1 
ATOM   6385  O  O   . GLY A  1  838  ? 178.112 195.840 179.607 1.00   117.58 ? 1256 GLY A O   1 
ATOM   6386  N  N   . ILE A  1  839  ? 176.119 194.802 179.426 1.00   102.99 ? 1257 ILE A N   1 
ATOM   6387  C  CA  . ILE A  1  839  ? 175.437 196.024 179.026 1.00   127.23 ? 1257 ILE A CA  1 
ATOM   6388  C  C   . ILE A  1  839  ? 175.637 197.125 180.043 1.00   122.40 ? 1257 ILE A C   1 
ATOM   6389  O  O   . ILE A  1  839  ? 175.809 198.275 179.675 1.00   136.66 ? 1257 ILE A O   1 
ATOM   6390  C  CB  . ILE A  1  839  ? 173.943 195.805 178.754 1.00   151.04 ? 1257 ILE A CB  1 
ATOM   6391  C  CG1 . ILE A  1  839  ? 173.747 195.044 177.427 1.00   193.39 ? 1257 ILE A CG1 1 
ATOM   6392  C  CG2 . ILE A  1  839  ? 173.204 197.123 178.692 1.00   153.52 ? 1257 ILE A CG2 1 
ATOM   6393  C  CD1 . ILE A  1  839  ? 174.080 195.810 176.145 1.00   187.80 ? 1257 ILE A CD1 1 
ATOM   6394  N  N   . GLY A  1  840  ? 175.626 196.774 181.310 1.00   113.52 ? 1258 GLY A N   1 
ATOM   6395  C  CA  . GLY A  1  840  ? 175.861 197.747 182.330 1.00   124.15 ? 1258 GLY A CA  1 
ATOM   6396  C  C   . GLY A  1  840  ? 177.212 198.383 182.183 1.00   129.84 ? 1258 GLY A C   1 
ATOM   6397  O  O   . GLY A  1  840  ? 177.326 199.617 182.237 1.00   194.96 ? 1258 GLY A O   1 
ATOM   6398  N  N   . LEU A  1  841  ? 178.228 197.548 182.008 1.00   114.50 ? 1259 LEU A N   1 
ATOM   6399  C  CA  . LEU A  1  841  ? 179.597 198.038 181.942 1.00   123.62 ? 1259 LEU A CA  1 
ATOM   6400  C  C   . LEU A  1  841  ? 179.781 198.974 180.768 1.00   136.41 ? 1259 LEU A C   1 
ATOM   6401  O  O   . LEU A  1  841  ? 180.431 200.025 180.904 1.00   147.60 ? 1259 LEU A O   1 
ATOM   6402  C  CB  . LEU A  1  841  ? 180.562 196.889 181.762 1.00   130.99 ? 1259 LEU A CB  1 
ATOM   6403  C  CG  . LEU A  1  841  ? 180.676 195.995 182.971 1.00   140.15 ? 1259 LEU A CG  1 
ATOM   6404  C  CD1 . LEU A  1  841  ? 181.363 194.692 182.582 1.00   147.36 ? 1259 LEU A CD1 1 
ATOM   6405  C  CD2 . LEU A  1  841  ? 181.434 196.756 184.044 1.00   148.41 ? 1259 LEU A CD2 1 
ATOM   6406  N  N   . VAL A  1  842  ? 179.207 198.578 179.625 1.00   111.06 ? 1260 VAL A N   1 
ATOM   6407  C  CA  . VAL A  1  842  ? 179.340 199.323 178.373 1.00   97.15  ? 1260 VAL A CA  1 
ATOM   6408  C  C   . VAL A  1  842  ? 178.645 200.659 178.432 1.00   107.27 ? 1260 VAL A C   1 
ATOM   6409  O  O   . VAL A  1  842  ? 179.096 201.594 177.814 1.00   118.36 ? 1260 VAL A O   1 
ATOM   6410  C  CB  . VAL A  1  842  ? 178.755 198.537 177.210 1.00   104.02 ? 1260 VAL A CB  1 
ATOM   6411  C  CG1 . VAL A  1  842  ? 178.546 199.393 175.987 1.00   135.91 ? 1260 VAL A CG1 1 
ATOM   6412  C  CG2 . VAL A  1  842  ? 179.693 197.436 176.828 1.00   126.48 ? 1260 VAL A CG2 1 
ATOM   6413  N  N   . TYR A  1  843  ? 177.523 200.736 179.136 1.00   117.33 ? 1261 TYR A N   1 
ATOM   6414  C  CA  . TYR A  1  843  ? 176.780 201.968 179.236 1.00   104.49 ? 1261 TYR A CA  1 
ATOM   6415  C  C   . TYR A  1  843  ? 176.954 202.602 180.581 1.00   104.73 ? 1261 TYR A C   1 
ATOM   6416  O  O   . TYR A  1  843  ? 176.173 203.456 180.918 1.00   130.27 ? 1261 TYR A O   1 
ATOM   6417  C  CB  . TYR A  1  843  ? 175.317 201.664 178.985 1.00   114.27 ? 1261 TYR A CB  1 
ATOM   6418  C  CG  . TYR A  1  843  ? 175.010 201.448 177.538 1.00   136.75 ? 1261 TYR A CG  1 
ATOM   6419  C  CD1 . TYR A  1  843  ? 175.280 202.446 176.613 1.00   148.49 ? 1261 TYR A CD1 1 
ATOM   6420  C  CD2 . TYR A  1  843  ? 174.434 200.251 177.087 1.00   128.27 ? 1261 TYR A CD2 1 
ATOM   6421  C  CE1 . TYR A  1  843  ? 174.998 202.278 175.282 1.00   175.40 ? 1261 TYR A CE1 1 
ATOM   6422  C  CE2 . TYR A  1  843  ? 174.138 200.070 175.757 1.00   147.91 ? 1261 TYR A CE2 1 
ATOM   6423  C  CZ  . TYR A  1  843  ? 174.422 201.097 174.859 1.00   185.86 ? 1261 TYR A CZ  1 
ATOM   6424  O  OH  . TYR A  1  843  ? 174.157 200.985 173.519 1.00   221.60 ? 1261 TYR A OH  1 
ATOM   6425  N  N   . GLN A  1  844  ? 177.966 202.220 181.355 1.00   98.62  ? 1262 GLN A N   1 
ATOM   6426  C  CA  . GLN A  1  844  ? 178.047 202.665 182.744 1.00   108.57 ? 1262 GLN A CA  1 
ATOM   6427  C  C   . GLN A  1  844  ? 178.057 204.194 182.866 1.00   136.13 ? 1262 GLN A C   1 
ATOM   6428  O  O   . GLN A  1  844  ? 178.896 204.864 182.252 1.00   178.26 ? 1262 GLN A O   1 
ATOM   6429  C  CB  . GLN A  1  844  ? 179.274 202.086 183.403 1.00   104.20 ? 1262 GLN A CB  1 
ATOM   6430  C  CG  . GLN A  1  844  ? 179.461 202.512 184.845 1.00   121.68 ? 1262 GLN A CG  1 
ATOM   6431  C  CD  . GLN A  1  844  ? 180.545 201.702 185.497 1.00   174.21 ? 1262 GLN A CD  1 
ATOM   6432  O  OE1 . GLN A  1  844  ? 181.488 201.293 184.834 1.00   232.75 ? 1262 GLN A OE1 1 
ATOM   6433  N  NE2 . GLN A  1  844  ? 180.418 201.445 186.788 1.00   200.74 ? 1262 GLN A NE2 1 
ATOM   6434  N  N   . GLY A  1  845  ? 177.112 204.736 183.636 1.00   135.14 ? 1263 GLY A N   1 
ATOM   6435  C  CA  . GLY A  1  845  ? 176.974 206.181 183.827 1.00   146.26 ? 1263 GLY A CA  1 
ATOM   6436  C  C   . GLY A  1  845  ? 176.198 206.914 182.739 1.00   159.76 ? 1263 GLY A C   1 
ATOM   6437  O  O   . GLY A  1  845  ? 175.947 208.123 182.845 1.00   179.00 ? 1263 GLY A O   1 
ATOM   6438  N  N   . THR A  1  846  ? 175.797 206.200 181.698 1.00   151.24 ? 1264 THR A N   1 
ATOM   6439  C  CA  . THR A  1  846  ? 175.217 206.845 180.540 1.00   170.62 ? 1264 THR A CA  1 
ATOM   6440  C  C   . THR A  1  846  ? 173.728 207.101 180.710 1.00   179.04 ? 1264 THR A C   1 
ATOM   6441  O  O   . THR A  1  846  ? 173.165 207.942 180.012 1.00   202.72 ? 1264 THR A O   1 
ATOM   6442  C  CB  . THR A  1  846  ? 175.456 206.001 179.295 1.00   189.68 ? 1264 THR A CB  1 
ATOM   6443  O  OG1 . THR A  1  846  ? 174.950 204.680 179.506 1.00   209.57 ? 1264 THR A OG1 1 
ATOM   6444  C  CG2 . THR A  1  846  ? 176.945 205.919 179.033 1.00   216.67 ? 1264 THR A CG2 1 
ATOM   6445  N  N   . ALA A  1  847  ? 173.095 206.374 181.634 1.00   178.13 ? 1265 ALA A N   1 
ATOM   6446  C  CA  . ALA A  1  847  ? 171.641 206.404 181.861 1.00   160.47 ? 1265 ALA A CA  1 
ATOM   6447  C  C   . ALA A  1  847  ? 170.910 206.343 180.543 1.00   146.93 ? 1265 ALA A C   1 
ATOM   6448  O  O   . ALA A  1  847  ? 169.916 207.033 180.346 1.00   144.75 ? 1265 ALA A O   1 
ATOM   6449  C  CB  . ALA A  1  847  ? 171.210 207.616 182.694 1.00   155.51 ? 1265 ALA A CB  1 
ATOM   6450  N  N   . HIS A  1  848  ? 171.406 205.501 179.639 1.00   154.24 ? 1266 HIS A N   1 
ATOM   6451  C  CA  . HIS A  1  848  ? 170.766 205.332 178.362 1.00   164.91 ? 1266 HIS A CA  1 
ATOM   6452  C  C   . HIS A  1  848  ? 169.299 204.892 178.581 1.00   171.68 ? 1266 HIS A C   1 
ATOM   6453  O  O   . HIS A  1  848  ? 168.965 203.942 179.321 1.00   137.25 ? 1266 HIS A O   1 
ATOM   6454  C  CB  . HIS A  1  848  ? 171.520 204.407 177.402 1.00   156.68 ? 1266 HIS A CB  1 
ATOM   6455  C  CG  . HIS A  1  848  ? 170.871 204.349 176.069 1.00   190.32 ? 1266 HIS A CG  1 
ATOM   6456  N  ND1 . HIS A  1  848  ? 170.937 205.395 175.177 1.00   230.40 ? 1266 HIS A ND1 1 
ATOM   6457  C  CD2 . HIS A  1  848  ? 170.026 203.441 175.529 1.00   236.37 ? 1266 HIS A CD2 1 
ATOM   6458  C  CE1 . HIS A  1  848  ? 170.206 205.106 174.113 1.00   268.49 ? 1266 HIS A CE1 1 
ATOM   6459  N  NE2 . HIS A  1  848  ? 169.646 203.922 174.300 1.00   269.27 ? 1266 HIS A NE2 1 
ATOM   6460  N  N   . ARG A  1  849  ? 168.429 205.671 177.958 1.00   178.99 ? 1267 ARG A N   1 
ATOM   6461  C  CA  . ARG A  1  849  ? 167.011 205.551 178.159 1.00   167.80 ? 1267 ARG A CA  1 
ATOM   6462  C  C   . ARG A  1  849  ? 166.579 204.129 178.026 1.00   131.21 ? 1267 ARG A C   1 
ATOM   6463  O  O   . ARG A  1  849  ? 166.089 203.569 178.967 1.00   133.05 ? 1267 ARG A O   1 
ATOM   6464  C  CB  . ARG A  1  849  ? 166.261 206.430 177.137 1.00   198.28 ? 1267 ARG A CB  1 
ATOM   6465  C  CG  . ARG A  1  849  ? 164.740 206.335 177.169 1.00   202.36 ? 1267 ARG A CG  1 
ATOM   6466  C  CD  . ARG A  1  849  ? 164.226 206.298 178.609 1.00   202.31 ? 1267 ARG A CD  1 
ATOM   6467  N  NE  . ARG A  1  849  ? 162.786 206.390 178.732 1.00   180.44 ? 1267 ARG A NE  1 
ATOM   6468  C  CZ  . ARG A  1  849  ? 161.932 205.480 178.296 1.00   189.49 ? 1267 ARG A CZ  1 
ATOM   6469  N  NH1 . ARG A  1  849  ? 162.330 204.375 177.634 1.00   184.62 ? 1267 ARG A NH1 1 
ATOM   6470  N  NH2 . ARG A  1  849  ? 160.645 205.696 178.512 1.00   213.06 ? 1267 ARG A NH2 1 
ATOM   6471  N  N   . HIS A  1  850  ? 166.805 203.560 176.851 1.00   148.47 ? 1268 HIS A N   1 
ATOM   6472  C  CA  . HIS A  1  850  ? 166.157 202.329 176.471 1.00   154.03 ? 1268 HIS A CA  1 
ATOM   6473  C  C   . HIS A  1  850  ? 166.673 201.107 177.245 1.00   143.43 ? 1268 HIS A C   1 
ATOM   6474  O  O   . HIS A  1  850  ? 165.921 200.189 177.546 1.00   181.36 ? 1268 HIS A O   1 
ATOM   6475  C  CB  . HIS A  1  850  ? 166.215 202.086 174.962 1.00   155.13 ? 1268 HIS A CB  1 
ATOM   6476  C  CG  . HIS A  1  850  ? 165.551 200.809 174.592 1.00   199.18 ? 1268 HIS A CG  1 
ATOM   6477  N  ND1 . HIS A  1  850  ? 166.261 199.677 174.255 1.00   233.25 ? 1268 HIS A ND1 1 
ATOM   6478  C  CD2 . HIS A  1  850  ? 164.254 200.433 174.670 1.00   210.92 ? 1268 HIS A CD2 1 
ATOM   6479  C  CE1 . HIS A  1  850  ? 165.419 198.676 174.058 1.00   227.65 ? 1268 HIS A CE1 1 
ATOM   6480  N  NE2 . HIS A  1  850  ? 164.194 199.109 174.306 1.00   226.05 ? 1268 HIS A NE2 1 
ATOM   6481  N  N   . THR A  1  851  ? 167.945 201.123 177.589 1.00   135.40 ? 1269 THR A N   1 
ATOM   6482  C  CA  . THR A  1  851  ? 168.581 200.056 178.339 1.00   128.22 ? 1269 THR A CA  1 
ATOM   6483  C  C   . THR A  1  851  ? 167.971 199.963 179.760 1.00   129.16 ? 1269 THR A C   1 
ATOM   6484  O  O   . THR A  1  851  ? 167.519 198.901 180.173 1.00   122.11 ? 1269 THR A O   1 
ATOM   6485  C  CB  . THR A  1  851  ? 170.103 200.329 178.360 1.00   137.77 ? 1269 THR A CB  1 
ATOM   6486  O  OG1 . THR A  1  851  ? 170.635 200.122 177.035 1.00   152.54 ? 1269 THR A OG1 1 
ATOM   6487  C  CG2 . THR A  1  851  ? 170.838 199.491 179.405 1.00   128.98 ? 1269 THR A CG2 1 
ATOM   6488  N  N   . ALA A  1  852  ? 167.913 201.067 180.502 1.00   146.73 ? 1270 ALA A N   1 
ATOM   6489  C  CA  . ALA A  1  852  ? 167.269 201.038 181.830 1.00   153.57 ? 1270 ALA A CA  1 
ATOM   6490  C  C   . ALA A  1  852  ? 165.888 200.325 181.754 1.00   145.87 ? 1270 ALA A C   1 
ATOM   6491  O  O   . ALA A  1  852  ? 165.580 199.448 182.569 1.00   153.59 ? 1270 ALA A O   1 
ATOM   6492  C  CB  . ALA A  1  852  ? 167.127 202.452 182.402 1.00   157.09 ? 1270 ALA A CB  1 
ATOM   6493  N  N   . GLU A  1  853  ? 165.097 200.682 180.743 1.00   129.44 ? 1271 GLU A N   1 
ATOM   6494  C  CA  . GLU A  1  853  ? 163.782 200.106 180.510 1.00   132.08 ? 1271 GLU A CA  1 
ATOM   6495  C  C   . GLU A  1  853  ? 163.866 198.579 180.443 1.00   136.61 ? 1271 GLU A C   1 
ATOM   6496  O  O   . GLU A  1  853  ? 163.089 197.917 181.134 1.00   175.54 ? 1271 GLU A O   1 
ATOM   6497  C  CB  . GLU A  1  853  ? 163.107 200.759 179.266 1.00   154.36 ? 1271 GLU A CB  1 
ATOM   6498  C  CG  . GLU A  1  853  ? 162.234 199.884 178.354 1.00   206.26 ? 1271 GLU A CG  1 
ATOM   6499  C  CD  . GLU A  1  853  ? 160.990 199.310 179.028 1.00   260.45 ? 1271 GLU A CD  1 
ATOM   6500  O  OE1 . GLU A  1  853  ? 160.648 199.728 180.155 1.00   327.18 ? 1271 GLU A OE1 1 
ATOM   6501  O  OE2 . GLU A  1  853  ? 160.348 198.423 178.423 1.00   303.02 ? 1271 GLU A OE2 1 
ATOM   6502  N  N   . VAL A  1  854  ? 164.793 198.013 179.665 1.00   111.71 ? 1272 VAL A N   1 
ATOM   6503  C  CA  . VAL A  1  854  ? 164.831 196.544 179.544 1.00   126.13 ? 1272 VAL A CA  1 
ATOM   6504  C  C   . VAL A  1  854  ? 165.404 195.863 180.771 1.00   128.66 ? 1272 VAL A C   1 
ATOM   6505  O  O   . VAL A  1  854  ? 164.990 194.763 181.118 1.00   180.47 ? 1272 VAL A O   1 
ATOM   6506  C  CB  . VAL A  1  854  ? 165.559 195.975 178.315 1.00   136.35 ? 1272 VAL A CB  1 
ATOM   6507  C  CG1 . VAL A  1  854  ? 165.037 196.652 177.054 1.00   175.15 ? 1272 VAL A CG1 1 
ATOM   6508  C  CG2 . VAL A  1  854  ? 167.084 196.050 178.453 1.00   140.85 ? 1272 VAL A CG2 1 
ATOM   6509  N  N   . LEU A  1  855  ? 166.362 196.497 181.411 1.00   117.73 ? 1273 LEU A N   1 
ATOM   6510  C  CA  . LEU A  1  855  ? 166.871 195.951 182.639 1.00   121.18 ? 1273 LEU A CA  1 
ATOM   6511  C  C   . LEU A  1  855  ? 165.737 195.945 183.721 1.00   134.57 ? 1273 LEU A C   1 
ATOM   6512  O  O   . LEU A  1  855  ? 165.680 195.032 184.557 1.00   165.93 ? 1273 LEU A O   1 
ATOM   6513  C  CB  . LEU A  1  855  ? 168.146 196.689 183.052 1.00   112.09 ? 1273 LEU A CB  1 
ATOM   6514  C  CG  . LEU A  1  855  ? 169.484 196.053 182.622 1.00   113.80 ? 1273 LEU A CG  1 
ATOM   6515  C  CD1 . LEU A  1  855  ? 169.463 195.174 181.352 1.00   114.62 ? 1273 LEU A CD1 1 
ATOM   6516  C  CD2 . LEU A  1  855  ? 170.530 197.175 182.514 1.00   119.62 ? 1273 LEU A CD2 1 
ATOM   6517  N  N   . LEU A  1  856  ? 164.817 196.910 183.677 1.00   118.25 ? 1274 LEU A N   1 
ATOM   6518  C  CA  . LEU A  1  856  ? 163.645 196.833 184.537 1.00   121.65 ? 1274 LEU A CA  1 
ATOM   6519  C  C   . LEU A  1  856  ? 162.737 195.700 184.179 1.00   133.57 ? 1274 LEU A C   1 
ATOM   6520  O  O   . LEU A  1  856  ? 162.274 194.980 185.044 1.00   160.20 ? 1274 LEU A O   1 
ATOM   6521  C  CB  . LEU A  1  856  ? 162.856 198.136 184.573 1.00   126.90 ? 1274 LEU A CB  1 
ATOM   6522  C  CG  . LEU A  1  856  ? 163.591 198.996 185.603 1.00   138.97 ? 1274 LEU A CG  1 
ATOM   6523  C  CD1 . LEU A  1  856  ? 163.253 200.476 185.567 1.00   140.63 ? 1274 LEU A CD1 1 
ATOM   6524  C  CD2 . LEU A  1  856  ? 163.383 198.448 187.005 1.00   136.29 ? 1274 LEU A CD2 1 
ATOM   6525  N  N   . ALA A  1  857  ? 162.482 195.504 182.906 1.00   145.31 ? 1275 ALA A N   1 
ATOM   6526  C  CA  . ALA A  1  857  ? 161.712 194.335 182.497 1.00   178.53 ? 1275 ALA A CA  1 
ATOM   6527  C  C   . ALA A  1  857  ? 162.375 193.063 183.039 1.00   171.21 ? 1275 ALA A C   1 
ATOM   6528  O  O   . ALA A  1  857  ? 161.726 192.203 183.651 1.00   204.75 ? 1275 ALA A O   1 
ATOM   6529  C  CB  . ALA A  1  857  ? 161.589 194.270 180.971 1.00   198.63 ? 1275 ALA A CB  1 
ATOM   6530  N  N   . GLU A  1  858  ? 163.676 192.979 182.838 1.00   159.81 ? 1276 GLU A N   1 
ATOM   6531  C  CA  . GLU A  1  858  ? 164.397 191.757 183.117 1.00   175.04 ? 1276 GLU A CA  1 
ATOM   6532  C  C   . GLU A  1  858  ? 164.549 191.458 184.605 1.00   179.01 ? 1276 GLU A C   1 
ATOM   6533  O  O   . GLU A  1  858  ? 164.597 190.286 184.980 1.00   212.21 ? 1276 GLU A O   1 
ATOM   6534  C  CB  . GLU A  1  858  ? 165.766 191.801 182.458 1.00   182.21 ? 1276 GLU A CB  1 
ATOM   6535  C  CG  . GLU A  1  858  ? 165.735 191.453 180.983 1.00   222.19 ? 1276 GLU A CG  1 
ATOM   6536  C  CD  . GLU A  1  858  ? 167.119 191.409 180.361 1.00   285.80 ? 1276 GLU A CD  1 
ATOM   6537  O  OE1 . GLU A  1  858  ? 168.114 191.583 181.100 1.00   332.21 ? 1276 GLU A OE1 1 
ATOM   6538  O  OE2 . GLU A  1  858  ? 167.226 191.162 179.137 1.00   350.57 ? 1276 GLU A OE2 1 
ATOM   6539  N  N   . ILE A  1  859  ? 164.642 192.494 185.443 1.00   154.91 ? 1277 ILE A N   1 
ATOM   6540  C  CA  . ILE A  1  859  ? 164.922 192.309 186.872 1.00   128.44 ? 1277 ILE A CA  1 
ATOM   6541  C  C   . ILE A  1  859  ? 163.801 191.501 187.495 1.00   143.68 ? 1277 ILE A C   1 
ATOM   6542  O  O   . ILE A  1  859  ? 164.043 190.669 188.353 1.00   178.07 ? 1277 ILE A O   1 
ATOM   6543  C  CB  . ILE A  1  859  ? 165.135 193.656 187.579 1.00   123.99 ? 1277 ILE A CB  1 
ATOM   6544  C  CG1 . ILE A  1  859  ? 165.793 193.512 188.927 1.00   129.53 ? 1277 ILE A CG1 1 
ATOM   6545  C  CG2 . ILE A  1  859  ? 163.821 194.364 187.822 1.00   161.46 ? 1277 ILE A CG2 1 
ATOM   6546  C  CD1 . ILE A  1  859  ? 166.178 194.869 189.514 1.00   137.23 ? 1277 ILE A CD1 1 
ATOM   6547  N  N   . GLY A  1  860  ? 162.583 191.686 187.012 1.00   170.70 ? 1278 GLY A N   1 
ATOM   6548  C  CA  . GLY A  1  860  ? 161.465 190.855 187.436 1.00   175.24 ? 1278 GLY A CA  1 
ATOM   6549  C  C   . GLY A  1  860  ? 160.835 190.272 186.210 1.00   151.15 ? 1278 GLY A C   1 
ATOM   6550  O  O   . GLY A  1  860  ? 159.934 190.860 185.625 1.00   164.62 ? 1278 GLY A O   1 
ATOM   6551  N  N   . ARG A  1  861  ? 161.344 189.126 185.796 1.00   132.28 ? 1279 ARG A N   1 
ATOM   6552  C  CA  . ARG A  1  861  ? 160.836 188.428 184.627 1.00   153.39 ? 1279 ARG A CA  1 
ATOM   6553  C  C   . ARG A  1  861  ? 159.887 187.209 184.950 1.00   166.66 ? 1279 ARG A C   1 
ATOM   6554  O  O   . ARG A  1  861  ? 160.039 186.548 185.983 1.00   208.99 ? 1279 ARG A O   1 
ATOM   6555  C  CB  . ARG A  1  861  ? 162.047 187.965 183.849 1.00   161.95 ? 1279 ARG A CB  1 
ATOM   6556  C  CG  . ARG A  1  861  ? 161.800 187.622 182.391 1.00   201.28 ? 1279 ARG A CG  1 
ATOM   6557  C  CD  . ARG A  1  861  ? 162.723 186.501 181.982 1.00   228.88 ? 1279 ARG A CD  1 
ATOM   6558  N  NE  . ARG A  1  861  ? 163.321 186.641 180.658 1.00   258.74 ? 1279 ARG A NE  1 
ATOM   6559  C  CZ  . ARG A  1  861  ? 164.595 186.953 180.404 1.00   277.51 ? 1279 ARG A CZ  1 
ATOM   6560  N  NH1 . ARG A  1  861  ? 165.486 187.180 181.372 1.00   273.40 ? 1279 ARG A NH1 1 
ATOM   6561  N  NH2 . ARG A  1  861  ? 164.997 187.021 179.146 1.00   301.12 ? 1279 ARG A NH2 1 
ATOM   6562  N  N   . PRO A  1  862  ? 158.905 186.905 184.074 1.00   164.54 ? 1280 PRO A N   1 
ATOM   6563  C  CA  . PRO A  1  862  ? 158.184 185.655 184.240 1.00   163.33 ? 1280 PRO A CA  1 
ATOM   6564  C  C   . PRO A  1  862  ? 159.132 184.466 184.247 1.00   154.26 ? 1280 PRO A C   1 
ATOM   6565  O  O   . PRO A  1  862  ? 160.195 184.602 183.682 1.00   147.73 ? 1280 PRO A O   1 
ATOM   6566  C  CB  . PRO A  1  862  ? 157.352 185.579 182.947 1.00   192.62 ? 1280 PRO A CB  1 
ATOM   6567  C  CG  . PRO A  1  862  ? 158.103 186.430 181.970 1.00   187.10 ? 1280 PRO A CG  1 
ATOM   6568  C  CD  . PRO A  1  862  ? 158.415 187.592 182.867 1.00   200.59 ? 1280 PRO A CD  1 
ATOM   6569  N  N   . PRO A  1  863  ? 158.738 183.311 184.839 1.00   162.93 ? 1281 PRO A N   1 
ATOM   6570  C  CA  . PRO A  1  863  ? 159.511 182.060 184.783 1.00   146.71 ? 1281 PRO A CA  1 
ATOM   6571  C  C   . PRO A  1  863  ? 159.749 181.497 183.379 1.00   167.62 ? 1281 PRO A C   1 
ATOM   6572  O  O   . PRO A  1  863  ? 160.789 180.875 183.143 1.00   244.96 ? 1281 PRO A O   1 
ATOM   6573  C  CB  . PRO A  1  863  ? 158.653 181.077 185.546 1.00   164.86 ? 1281 PRO A CB  1 
ATOM   6574  C  CG  . PRO A  1  863  ? 157.782 181.890 186.422 1.00   179.55 ? 1281 PRO A CG  1 
ATOM   6575  C  CD  . PRO A  1  863  ? 157.508 183.130 185.634 1.00   190.80 ? 1281 PRO A CD  1 
ATOM   6576  N  N   . GLY A  1  864  ? 158.811 181.680 182.463 1.00   136.94 ? 1282 GLY A N   1 
ATOM   6577  C  CA  . GLY A  1  864  ? 159.167 181.578 181.052 1.00   161.52 ? 1282 GLY A CA  1 
ATOM   6578  C  C   . GLY A  1  864  ? 157.993 181.369 180.136 1.00   196.32 ? 1282 GLY A C   1 
ATOM   6579  O  O   . GLY A  1  864  ? 156.909 181.921 180.364 1.00   221.08 ? 1282 GLY A O   1 
ATOM   6580  N  N   . PRO A  1  865  ? 158.241 180.648 179.034 1.00   206.65 ? 1283 PRO A N   1 
ATOM   6581  C  CA  . PRO A  1  865  ? 157.278 179.789 178.363 1.00   217.01 ? 1283 PRO A CA  1 
ATOM   6582  C  C   . PRO A  1  865  ? 157.723 178.296 178.473 1.00   230.53 ? 1283 PRO A C   1 
ATOM   6583  O  O   . PRO A  1  865  ? 158.879 177.987 178.180 1.00   243.22 ? 1283 PRO A O   1 
ATOM   6584  C  CB  . PRO A  1  865  ? 157.300 180.323 176.923 1.00   212.46 ? 1283 PRO A CB  1 
ATOM   6585  C  CG  . PRO A  1  865  ? 158.640 180.999 176.767 1.00   218.74 ? 1283 PRO A CG  1 
ATOM   6586  C  CD  . PRO A  1  865  ? 159.322 181.037 178.112 1.00   209.25 ? 1283 PRO A CD  1 
ATOM   6587  N  N   . GLU A  1  866  ? 156.822 177.401 178.903 1.00   224.92 ? 1284 GLU A N   1 
ATOM   6588  C  CA  . GLU A  1  866  ? 157.069 175.937 179.047 1.00   221.35 ? 1284 GLU A CA  1 
ATOM   6589  C  C   . GLU A  1  866  ? 158.393 175.568 179.754 1.00   226.41 ? 1284 GLU A C   1 
ATOM   6590  O  O   . GLU A  1  866  ? 158.666 176.133 180.817 1.00   275.51 ? 1284 GLU A O   1 
ATOM   6591  C  CB  . GLU A  1  866  ? 156.834 175.183 177.719 1.00   249.90 ? 1284 GLU A CB  1 
ATOM   6592  C  CG  . GLU A  1  866  ? 157.674 175.605 176.516 1.00   289.61 ? 1284 GLU A CG  1 
ATOM   6593  C  CD  . GLU A  1  866  ? 157.125 176.805 175.754 1.00   337.10 ? 1284 GLU A CD  1 
ATOM   6594  O  OE1 . GLU A  1  866  ? 155.964 177.216 175.989 1.00   380.16 ? 1284 GLU A OE1 1 
ATOM   6595  O  OE2 . GLU A  1  866  ? 157.870 177.356 174.916 1.00   397.96 ? 1284 GLU A OE2 1 
ATOM   6596  N  N   . MET A  1  867  ? 159.194 174.640 179.216 1.00   216.56 ? 1285 MET A N   1 
ATOM   6597  C  CA  . MET A  1  867  ? 160.448 174.222 179.868 1.00   209.97 ? 1285 MET A CA  1 
ATOM   6598  C  C   . MET A  1  867  ? 161.505 175.325 179.861 1.00   218.96 ? 1285 MET A C   1 
ATOM   6599  O  O   . MET A  1  867  ? 162.400 175.344 180.721 1.00   215.45 ? 1285 MET A O   1 
ATOM   6600  C  CB  . MET A  1  867  ? 161.016 172.967 179.200 1.00   188.71 ? 1285 MET A CB  1 
ATOM   6601  N  N   . GLU A  1  868  ? 161.406 176.240 178.895 1.00   235.91 ? 1286 GLU A N   1 
ATOM   6602  C  CA  . GLU A  1  868  ? 162.388 177.311 178.754 1.00   236.61 ? 1286 GLU A CA  1 
ATOM   6603  C  C   . GLU A  1  868  ? 162.421 178.278 179.934 1.00   236.64 ? 1286 GLU A C   1 
ATOM   6604  O  O   . GLU A  1  868  ? 161.387 178.772 180.399 1.00   206.31 ? 1286 GLU A O   1 
ATOM   6605  C  CB  . GLU A  1  868  ? 162.172 178.116 177.460 1.00   216.38 ? 1286 GLU A CB  1 
ATOM   6606  N  N   . TYR A  1  869  ? 163.636 178.496 180.421 1.00   243.97 ? 1287 TYR A N   1 
ATOM   6607  C  CA  . TYR A  1  869  ? 164.006 179.696 181.141 1.00   243.75 ? 1287 TYR A CA  1 
ATOM   6608  C  C   . TYR A  1  869  ? 163.942 179.569 182.682 1.00   249.28 ? 1287 TYR A C   1 
ATOM   6609  O  O   . TYR A  1  869  ? 164.192 180.540 183.398 1.00   230.69 ? 1287 TYR A O   1 
ATOM   6610  C  CB  . TYR A  1  869  ? 163.237 180.939 180.605 1.00   231.31 ? 1287 TYR A CB  1 
ATOM   6611  C  CG  . TYR A  1  869  ? 163.849 182.183 181.127 1.00   250.67 ? 1287 TYR A CG  1 
ATOM   6612  C  CD1 . TYR A  1  869  ? 163.464 182.677 182.376 1.00   288.46 ? 1287 TYR A CD1 1 
ATOM   6613  C  CD2 . TYR A  1  869  ? 164.880 182.827 180.442 1.00   242.68 ? 1287 TYR A CD2 1 
ATOM   6614  C  CE1 . TYR A  1  869  ? 164.063 183.776 182.926 1.00   298.63 ? 1287 TYR A CE1 1 
ATOM   6615  C  CE2 . TYR A  1  869  ? 165.477 183.958 180.985 1.00   273.00 ? 1287 TYR A CE2 1 
ATOM   6616  C  CZ  . TYR A  1  869  ? 165.062 184.409 182.236 1.00   291.45 ? 1287 TYR A CZ  1 
ATOM   6617  O  OH  . TYR A  1  869  ? 165.579 185.522 182.833 1.00   248.70 ? 1287 TYR A OH  1 
ATOM   6618  N  N   . ALA A  1  870  ? 163.704 178.374 183.213 1.00   233.81 ? 1288 ALA A N   1 
ATOM   6619  C  CA  . ALA A  1  870  ? 163.424 178.241 184.648 1.00   210.92 ? 1288 ALA A CA  1 
ATOM   6620  C  C   . ALA A  1  870  ? 164.587 177.663 185.457 1.00   197.28 ? 1288 ALA A C   1 
ATOM   6621  O  O   . ALA A  1  870  ? 164.382 176.736 186.224 1.00   186.73 ? 1288 ALA A O   1 
ATOM   6622  C  CB  . ALA A  1  870  ? 162.174 177.387 184.823 1.00   205.09 ? 1288 ALA A CB  1 
ATOM   6623  N  N   . THR A  1  871  ? 165.792 178.215 185.307 1.00   211.76 ? 1289 THR A N   1 
ATOM   6624  C  CA  . THR A  1  871  ? 167.020 177.633 185.895 1.00   207.26 ? 1289 THR A CA  1 
ATOM   6625  C  C   . THR A  1  871  ? 167.952 178.731 186.415 1.00   172.61 ? 1289 THR A C   1 
ATOM   6626  O  O   . THR A  1  871  ? 168.420 179.547 185.633 1.00   150.73 ? 1289 THR A O   1 
ATOM   6627  C  CB  . THR A  1  871  ? 167.800 176.800 184.843 1.00   241.99 ? 1289 THR A CB  1 
ATOM   6628  O  OG1 . THR A  1  871  ? 166.928 175.838 184.226 1.00   275.52 ? 1289 THR A OG1 1 
ATOM   6629  C  CG2 . THR A  1  871  ? 169.007 176.077 185.479 1.00   243.48 ? 1289 THR A CG2 1 
ATOM   6630  N  N   . ASP A  1  872  ? 168.234 178.737 187.722 1.00   189.19 ? 1290 ASP A N   1 
ATOM   6631  C  CA  . ASP A  1  872  ? 169.115 179.738 188.370 1.00   176.11 ? 1290 ASP A CA  1 
ATOM   6632  C  C   . ASP A  1  872  ? 168.616 181.157 188.051 1.00   144.22 ? 1290 ASP A C   1 
ATOM   6633  O  O   . ASP A  1  872  ? 169.374 182.047 187.681 1.00   131.09 ? 1290 ASP A O   1 
ATOM   6634  C  CB  . ASP A  1  872  ? 170.592 179.525 187.945 1.00   214.67 ? 1290 ASP A CB  1 
ATOM   6635  C  CG  . ASP A  1  872  ? 171.181 178.169 188.423 1.00   240.93 ? 1290 ASP A CG  1 
ATOM   6636  O  OD1 . ASP A  1  872  ? 170.476 177.136 188.365 1.00   280.29 ? 1290 ASP A OD1 1 
ATOM   6637  O  OD2 . ASP A  1  872  ? 172.370 178.132 188.830 1.00   233.62 ? 1290 ASP A OD2 1 
ATOM   6638  N  N   . ARG A  1  873  ? 167.315 181.359 188.177 1.00   138.67 ? 1291 ARG A N   1 
ATOM   6639  C  CA  . ARG A  1  873  ? 166.746 182.618 187.726 1.00   144.48 ? 1291 ARG A CA  1 
ATOM   6640  C  C   . ARG A  1  873  ? 167.021 183.727 188.713 1.00   107.33 ? 1291 ARG A C   1 
ATOM   6641  O  O   . ARG A  1  873  ? 167.054 184.862 188.320 1.00   106.56 ? 1291 ARG A O   1 
ATOM   6642  C  CB  . ARG A  1  873  ? 165.276 182.487 187.318 1.00   170.82 ? 1291 ARG A CB  1 
ATOM   6643  C  CG  . ARG A  1  873  ? 164.309 182.198 188.420 1.00   160.76 ? 1291 ARG A CG  1 
ATOM   6644  C  CD  . ARG A  1  873  ? 162.948 181.931 187.817 1.00   180.95 ? 1291 ARG A CD  1 
ATOM   6645  N  NE  . ARG A  1  873  ? 161.933 182.499 188.713 1.00   220.78 ? 1291 ARG A NE  1 
ATOM   6646  C  CZ  . ARG A  1  873  ? 161.234 183.628 188.513 1.00   204.32 ? 1291 ARG A CZ  1 
ATOM   6647  N  NH1 . ARG A  1  873  ? 161.392 184.356 187.400 1.00   186.33 ? 1291 ARG A NH1 1 
ATOM   6648  N  NH2 . ARG A  1  873  ? 160.342 184.026 189.447 1.00   165.31 ? 1291 ARG A NH2 1 
ATOM   6649  N  N   . GLU A  1  874  ? 167.290 183.400 189.972 1.00   115.89 ? 1292 GLU A N   1 
ATOM   6650  C  CA  . GLU A  1  874  ? 167.736 184.410 190.980 1.00   120.53 ? 1292 GLU A CA  1 
ATOM   6651  C  C   . GLU A  1  874  ? 169.003 185.078 190.552 1.00   107.89 ? 1292 GLU A C   1 
ATOM   6652  O  O   . GLU A  1  874  ? 169.184 186.237 190.927 1.00   117.23 ? 1292 GLU A O   1 
ATOM   6653  C  CB  . GLU A  1  874  ? 167.895 183.888 192.440 1.00   124.62 ? 1292 GLU A CB  1 
ATOM   6654  C  CG  . GLU A  1  874  ? 168.255 182.393 192.585 1.00   185.85 ? 1292 GLU A CG  1 
ATOM   6655  C  CD  . GLU A  1  874  ? 167.075 181.377 192.444 1.00   216.08 ? 1292 GLU A CD  1 
ATOM   6656  O  OE1 . GLU A  1  874  ? 165.916 181.716 192.794 1.00   287.41 ? 1292 GLU A OE1 1 
ATOM   6657  O  OE2 . GLU A  1  874  ? 167.294 180.215 191.983 1.00   176.21 ? 1292 GLU A OE2 1 
ATOM   6658  N  N   . SER A  1  875  ? 169.871 184.365 189.806 1.00   110.76 ? 1293 SER A N   1 
ATOM   6659  C  CA  . SER A  1  875  ? 171.171 184.918 189.348 1.00   123.82 ? 1293 SER A CA  1 
ATOM   6660  C  C   . SER A  1  875  ? 170.982 185.988 188.324 1.00   111.84 ? 1293 SER A C   1 
ATOM   6661  O  O   . SER A  1  875  ? 171.586 187.055 188.452 1.00   102.54 ? 1293 SER A O   1 
ATOM   6662  C  CB  . SER A  1  875  ? 172.146 183.891 188.738 1.00   134.70 ? 1293 SER A CB  1 
ATOM   6663  O  OG  . SER A  1  875  ? 171.860 183.573 187.382 1.00   143.03 ? 1293 SER A OG  1 
ATOM   6664  N  N   . TYR A  1  876  ? 170.182 185.666 187.303 1.00   99.52  ? 1294 TYR A N   1 
ATOM   6665  C  CA  . TYR A  1  876  ? 169.846 186.620 186.235 1.00   106.87 ? 1294 TYR A CA  1 
ATOM   6666  C  C   . TYR A  1  876  ? 169.336 187.915 186.771 1.00   102.93 ? 1294 TYR A C   1 
ATOM   6667  O  O   . TYR A  1  876  ? 169.675 188.967 186.267 1.00   99.25  ? 1294 TYR A O   1 
ATOM   6668  C  CB  . TYR A  1  876  ? 168.745 186.098 185.324 1.00   125.30 ? 1294 TYR A CB  1 
ATOM   6669  C  CG  . TYR A  1  876  ? 168.592 186.934 184.082 1.00   125.48 ? 1294 TYR A CG  1 
ATOM   6670  C  CD1 . TYR A  1  876  ? 168.029 188.207 184.125 1.00   121.29 ? 1294 TYR A CD1 1 
ATOM   6671  C  CD2 . TYR A  1  876  ? 169.035 186.441 182.862 1.00   137.91 ? 1294 TYR A CD2 1 
ATOM   6672  C  CE1 . TYR A  1  876  ? 167.915 188.956 182.996 1.00   131.17 ? 1294 TYR A CE1 1 
ATOM   6673  C  CE2 . TYR A  1  876  ? 168.919 187.171 181.724 1.00   154.91 ? 1294 TYR A CE2 1 
ATOM   6674  C  CZ  . TYR A  1  876  ? 168.368 188.429 181.794 1.00   173.12 ? 1294 TYR A CZ  1 
ATOM   6675  O  OH  . TYR A  1  876  ? 168.268 189.107 180.610 1.00   235.59 ? 1294 TYR A OH  1 
ATOM   6676  N  N   . SER A  1  877  ? 168.436 187.817 187.727 1.00   104.52 ? 1295 SER A N   1 
ATOM   6677  C  CA  . SER A  1  877  ? 167.838 188.964 188.262 1.00   101.92 ? 1295 SER A CA  1 
ATOM   6678  C  C   . SER A  1  877  ? 168.894 189.791 188.946 1.00   107.02 ? 1295 SER A C   1 
ATOM   6679  O  O   . SER A  1  877  ? 168.884 191.008 188.840 1.00   133.19 ? 1295 SER A O   1 
ATOM   6680  C  CB  . SER A  1  877  ? 166.800 188.587 189.264 1.00   122.83 ? 1295 SER A CB  1 
ATOM   6681  O  OG  . SER A  1  877  ? 166.637 189.682 190.148 1.00   197.87 ? 1295 SER A OG  1 
ATOM   6682  N  N   . LEU A  1  878  ? 169.806 189.171 189.673 1.00   115.77 ? 1296 LEU A N   1 
ATOM   6683  C  CA  . LEU A  1  878  ? 170.820 189.986 190.330 1.00   128.34 ? 1296 LEU A CA  1 
ATOM   6684  C  C   . LEU A  1  878  ? 171.553 190.771 189.250 1.00   121.31 ? 1296 LEU A C   1 
ATOM   6685  O  O   . LEU A  1  878  ? 171.548 192.002 189.260 1.00   102.68 ? 1296 LEU A O   1 
ATOM   6686  C  CB  . LEU A  1  878  ? 171.772 189.148 191.155 1.00   135.31 ? 1296 LEU A CB  1 
ATOM   6687  C  CG  . LEU A  1  878  ? 173.094 189.782 191.624 1.00   152.13 ? 1296 LEU A CG  1 
ATOM   6688  C  CD1 . LEU A  1  878  ? 173.038 191.204 192.160 1.00   129.15 ? 1296 LEU A CD1 1 
ATOM   6689  C  CD2 . LEU A  1  878  ? 173.609 188.864 192.710 1.00   187.13 ? 1296 LEU A CD2 1 
ATOM   6690  N  N   . ALA A  1  879  ? 172.100 190.053 188.275 1.00   133.20 ? 1297 ALA A N   1 
ATOM   6691  C  CA  . ALA A  1  879  ? 172.927 190.649 187.200 1.00   134.53 ? 1297 ALA A CA  1 
ATOM   6692  C  C   . ALA A  1  879  ? 172.257 191.800 186.526 1.00   109.43 ? 1297 ALA A C   1 
ATOM   6693  O  O   . ALA A  1  879  ? 172.880 192.819 186.331 1.00   144.07 ? 1297 ALA A O   1 
ATOM   6694  C  CB  . ALA A  1  879  ? 173.309 189.610 186.151 1.00   159.10 ? 1297 ALA A CB  1 
ATOM   6695  N  N   . ALA A  1  880  ? 170.983 191.643 186.191 1.00   123.62 ? 1298 ALA A N   1 
ATOM   6696  C  CA  . ALA A  1  880  ? 170.193 192.727 185.547 1.00   118.39 ? 1298 ALA A CA  1 
ATOM   6697  C  C   . ALA A  1  880  ? 170.031 193.894 186.455 1.00   104.70 ? 1298 ALA A C   1 
ATOM   6698  O  O   . ALA A  1  880  ? 170.159 195.022 186.030 1.00   118.05 ? 1298 ALA A O   1 
ATOM   6699  C  CB  . ALA A  1  880  ? 168.818 192.246 185.080 1.00   113.69 ? 1298 ALA A CB  1 
ATOM   6700  N  N   . GLY A  1  881  ? 169.788 193.619 187.720 1.00   111.55 ? 1299 GLY A N   1 
ATOM   6701  C  CA  . GLY A  1  881  ? 169.565 194.670 188.679 1.00   124.78 ? 1299 GLY A CA  1 
ATOM   6702  C  C   . GLY A  1  881  ? 170.818 195.484 188.810 1.00   111.80 ? 1299 GLY A C   1 
ATOM   6703  O  O   . GLY A  1  881  ? 170.781 196.709 188.769 1.00   129.85 ? 1299 GLY A O   1 
ATOM   6704  N  N   . LEU A  1  882  ? 171.910 194.753 188.953 1.00   108.41 ? 1300 LEU A N   1 
ATOM   6705  C  CA  . LEU A  1  882  ? 173.242 195.290 189.133 1.00   132.98 ? 1300 LEU A CA  1 
ATOM   6706  C  C   . LEU A  1  882  ? 173.739 196.120 187.956 1.00   143.30 ? 1300 LEU A C   1 
ATOM   6707  O  O   . LEU A  1  882  ? 174.374 197.169 188.148 1.00   155.60 ? 1300 LEU A O   1 
ATOM   6708  C  CB  . LEU A  1  882  ? 174.161 194.109 189.290 1.00   144.32 ? 1300 LEU A CB  1 
ATOM   6709  C  CG  . LEU A  1  882  ? 175.612 194.382 189.504 1.00   161.18 ? 1300 LEU A CG  1 
ATOM   6710  C  CD1 . LEU A  1  882  ? 175.701 195.332 190.703 1.00   164.97 ? 1300 LEU A CD1 1 
ATOM   6711  C  CD2 . LEU A  1  882  ? 176.314 193.032 189.676 1.00   178.56 ? 1300 LEU A CD2 1 
ATOM   6712  N  N   . ALA A  1  883  ? 173.455 195.602 186.755 1.00   126.36 ? 1301 ALA A N   1 
ATOM   6713  C  CA  . ALA A  1  883  ? 173.668 196.297 185.489 1.00   117.11 ? 1301 ALA A CA  1 
ATOM   6714  C  C   . ALA A  1  883  ? 172.858 197.567 185.388 1.00   116.29 ? 1301 ALA A C   1 
ATOM   6715  O  O   . ALA A  1  883  ? 173.342 198.552 184.864 1.00   150.97 ? 1301 ALA A O   1 
ATOM   6716  C  CB  . ALA A  1  883  ? 173.299 195.408 184.317 1.00   121.26 ? 1301 ALA A CB  1 
ATOM   6717  N  N   . LEU A  1  884  ? 171.616 197.540 185.857 1.00   111.48 ? 1302 LEU A N   1 
ATOM   6718  C  CA  . LEU A  1  884  ? 170.784 198.747 185.867 1.00   120.25 ? 1302 LEU A CA  1 
ATOM   6719  C  C   . LEU A  1  884  ? 171.455 199.753 186.766 1.00   111.62 ? 1302 LEU A C   1 
ATOM   6720  O  O   . LEU A  1  884  ? 171.616 200.905 186.428 1.00   113.81 ? 1302 LEU A O   1 
ATOM   6721  C  CB  . LEU A  1  884  ? 169.382 198.445 186.391 1.00   132.71 ? 1302 LEU A CB  1 
ATOM   6722  C  CG  . LEU A  1  884  ? 168.251 199.442 186.159 1.00   131.70 ? 1302 LEU A CG  1 
ATOM   6723  C  CD1 . LEU A  1  884  ? 166.946 198.726 186.486 1.00   140.95 ? 1302 LEU A CD1 1 
ATOM   6724  C  CD2 . LEU A  1  884  ? 168.426 200.676 187.028 1.00   141.41 ? 1302 LEU A CD2 1 
ATOM   6725  N  N   . GLY A  1  885  ? 171.839 199.291 187.934 1.00   120.33 ? 1303 GLY A N   1 
ATOM   6726  C  CA  . GLY A  1  885  ? 172.575 200.095 188.859 1.00   136.99 ? 1303 GLY A CA  1 
ATOM   6727  C  C   . GLY A  1  885  ? 173.691 200.833 188.169 1.00   141.86 ? 1303 GLY A C   1 
ATOM   6728  O  O   . GLY A  1  885  ? 173.765 202.049 188.304 1.00   175.82 ? 1303 GLY A O   1 
ATOM   6729  N  N   . MET A  1  886  ? 174.518 200.126 187.389 1.00   122.38 ? 1304 MET A N   1 
ATOM   6730  C  CA  . MET A  1  886  ? 175.665 200.761 186.726 1.00   123.60 ? 1304 MET A CA  1 
ATOM   6731  C  C   . MET A  1  886  ? 175.276 201.765 185.655 1.00   118.80 ? 1304 MET A C   1 
ATOM   6732  O  O   . MET A  1  886  ? 175.898 202.810 185.559 1.00   126.88 ? 1304 MET A O   1 
ATOM   6733  C  CB  . MET A  1  886  ? 176.586 199.749 186.095 1.00   135.44 ? 1304 MET A CB  1 
ATOM   6734  C  CG  . MET A  1  886  ? 177.283 198.834 187.056 1.00   152.40 ? 1304 MET A CG  1 
ATOM   6735  S  SD  . MET A  1  886  ? 178.161 197.670 186.014 1.00   212.97 ? 1304 MET A SD  1 
ATOM   6736  C  CE  . MET A  1  886  ? 178.062 196.209 187.036 1.00   234.57 ? 1304 MET A CE  1 
ATOM   6737  N  N   . VAL A  1  887  ? 174.287 201.425 184.837 1.00   111.67 ? 1305 VAL A N   1 
ATOM   6738  C  CA  . VAL A  1  887  ? 173.760 202.349 183.814 1.00   121.70 ? 1305 VAL A CA  1 
ATOM   6739  C  C   . VAL A  1  887  ? 173.390 203.703 184.417 1.00   123.39 ? 1305 VAL A C   1 
ATOM   6740  O  O   . VAL A  1  887  ? 173.769 204.739 183.904 1.00   136.55 ? 1305 VAL A O   1 
ATOM   6741  C  CB  . VAL A  1  887  ? 172.507 201.732 183.116 1.00   125.51 ? 1305 VAL A CB  1 
ATOM   6742  C  CG1 . VAL A  1  887  ? 171.672 202.763 182.382 1.00   126.49 ? 1305 VAL A CG1 1 
ATOM   6743  C  CG2 . VAL A  1  887  ? 172.923 200.643 182.141 1.00   137.92 ? 1305 VAL A CG2 1 
ATOM   6744  N  N   . CYS A  1  888  ? 172.620 203.686 185.483 1.00   122.68 ? 1306 CYS A N   1 
ATOM   6745  C  CA  . CYS A  1  888  ? 172.202 204.911 186.125 1.00   136.96 ? 1306 CYS A CA  1 
ATOM   6746  C  C   . CYS A  1  888  ? 173.234 205.411 187.140 1.00   134.56 ? 1306 CYS A C   1 
ATOM   6747  O  O   . CYS A  1  888  ? 173.354 206.603 187.381 1.00   159.66 ? 1306 CYS A O   1 
ATOM   6748  C  CB  . CYS A  1  888  ? 170.821 204.683 186.723 1.00   163.98 ? 1306 CYS A CB  1 
ATOM   6749  S  SG  . CYS A  1  888  ? 169.570 204.270 185.465 1.00   182.36 ? 1306 CYS A SG  1 
ATOM   6750  N  N   . LEU A  1  889  ? 173.994 204.476 187.680 1.00   138.72 ? 1307 LEU A N   1 
ATOM   6751  C  CA  . LEU A  1  889  ? 175.092 204.709 188.597 1.00   143.52 ? 1307 LEU A CA  1 
ATOM   6752  C  C   . LEU A  1  889  ? 175.183 206.069 189.251 1.00   158.20 ? 1307 LEU A C   1 
ATOM   6753  O  O   . LEU A  1  889  ? 175.985 206.965 188.916 1.00   129.79 ? 1307 LEU A O   1 
ATOM   6754  C  CB  . LEU A  1  889  ? 176.406 204.303 187.981 1.00   122.75 ? 1307 LEU A CB  1 
ATOM   6755  C  CG  . LEU A  1  889  ? 177.464 204.147 189.051 1.00   131.30 ? 1307 LEU A CG  1 
ATOM   6756  C  CD1 . LEU A  1  889  ? 177.085 203.083 190.075 1.00   117.68 ? 1307 LEU A CD1 1 
ATOM   6757  C  CD2 . LEU A  1  889  ? 178.761 203.826 188.352 1.00   164.44 ? 1307 LEU A CD2 1 
ATOM   6758  N  N   . GLY A  1  890  ? 174.303 206.179 190.223 1.00   184.81 ? 1308 GLY A N   1 
ATOM   6759  C  CA  . GLY A  1  890  ? 174.332 207.249 191.168 1.00   180.56 ? 1308 GLY A CA  1 
ATOM   6760  C  C   . GLY A  1  890  ? 174.160 208.580 190.501 1.00   179.52 ? 1308 GLY A C   1 
ATOM   6761  O  O   . GLY A  1  890  ? 174.743 209.544 190.961 1.00   158.68 ? 1308 GLY A O   1 
ATOM   6762  N  N   . HIS A  1  891  ? 173.377 208.626 189.416 1.00   201.38 ? 1309 HIS A N   1 
ATOM   6763  C  CA  . HIS A  1  891  ? 172.960 209.885 188.828 1.00   183.32 ? 1309 HIS A CA  1 
ATOM   6764  C  C   . HIS A  1  891  ? 172.231 210.631 189.872 1.00   193.86 ? 1309 HIS A C   1 
ATOM   6765  O  O   . HIS A  1  891  ? 172.562 211.776 190.157 1.00   236.27 ? 1309 HIS A O   1 
ATOM   6766  C  CB  . HIS A  1  891  ? 172.054 209.713 187.622 1.00   168.05 ? 1309 HIS A CB  1 
ATOM   6767  C  CG  . HIS A  1  891  ? 172.810 209.736 186.350 1.00   195.79 ? 1309 HIS A CG  1 
ATOM   6768  N  ND1 . HIS A  1  891  ? 173.762 210.693 186.075 1.00   207.88 ? 1309 HIS A ND1 1 
ATOM   6769  C  CD2 . HIS A  1  891  ? 172.798 208.898 185.294 1.00   222.72 ? 1309 HIS A CD2 1 
ATOM   6770  C  CE1 . HIS A  1  891  ? 174.288 210.452 184.888 1.00   234.20 ? 1309 HIS A CE1 1 
ATOM   6771  N  NE2 . HIS A  1  891  ? 173.717 209.372 184.390 1.00   230.57 ? 1309 HIS A NE2 1 
ATOM   6772  N  N   . GLY A  1  892  ? 171.262 209.951 190.462 1.00   179.23 ? 1310 GLY A N   1 
ATOM   6773  C  CA  . GLY A  1  892  ? 170.492 210.485 191.574 1.00   195.59 ? 1310 GLY A CA  1 
ATOM   6774  C  C   . GLY A  1  892  ? 169.090 210.162 191.189 1.00   184.32 ? 1310 GLY A C   1 
ATOM   6775  O  O   . GLY A  1  892  ? 168.912 209.355 190.275 1.00   135.58 ? 1310 GLY A O   1 
ATOM   6776  N  N   . SER A  1  893  ? 168.135 210.790 191.883 1.00   201.22 ? 1311 SER A N   1 
ATOM   6777  C  CA  . SER A  1  893  ? 166.694 210.765 191.545 1.00   203.14 ? 1311 SER A CA  1 
ATOM   6778  C  C   . SER A  1  893  ? 166.320 211.372 190.195 1.00   198.16 ? 1311 SER A C   1 
ATOM   6779  O  O   . SER A  1  893  ? 165.403 210.874 189.542 1.00   184.29 ? 1311 SER A O   1 
ATOM   6780  C  CB  . SER A  1  893  ? 165.905 211.514 192.622 1.00   223.62 ? 1311 SER A CB  1 
ATOM   6781  O  OG  . SER A  1  893  ? 166.417 212.834 192.778 1.00   258.19 ? 1311 SER A OG  1 
ATOM   6782  N  N   . ASN A  1  894  ? 167.031 212.441 189.818 1.00   205.59 ? 1312 ASN A N   1 
ATOM   6783  C  CA  . ASN A  1  894  ? 166.836 213.227 188.578 1.00   203.25 ? 1312 ASN A CA  1 
ATOM   6784  C  C   . ASN A  1  894  ? 167.712 212.765 187.408 1.00   192.73 ? 1312 ASN A C   1 
ATOM   6785  O  O   . ASN A  1  894  ? 168.871 213.175 187.282 1.00   172.90 ? 1312 ASN A O   1 
ATOM   6786  C  CB  . ASN A  1  894  ? 167.117 214.722 188.857 1.00   214.39 ? 1312 ASN A CB  1 
ATOM   6787  C  CG  . ASN A  1  894  ? 168.444 214.961 189.597 1.00   216.69 ? 1312 ASN A CG  1 
ATOM   6788  O  OD1 . ASN A  1  894  ? 168.459 215.487 190.715 1.00   250.96 ? 1312 ASN A OD1 1 
ATOM   6789  N  ND2 . ASN A  1  894  ? 169.557 214.550 188.987 1.00   178.44 ? 1312 ASN A ND2 1 
ATOM   6790  N  N   . LEU A  1  895  ? 167.148 211.950 186.528 1.00   196.18 ? 1313 LEU A N   1 
ATOM   6791  C  CA  . LEU A  1  895  ? 167.915 211.376 185.428 1.00   200.98 ? 1313 LEU A CA  1 
ATOM   6792  C  C   . LEU A  1  895  ? 167.210 211.600 184.082 1.00   196.82 ? 1313 LEU A C   1 
ATOM   6793  O  O   . LEU A  1  895  ? 166.212 210.950 183.806 1.00   179.66 ? 1313 LEU A O   1 
ATOM   6794  C  CB  . LEU A  1  895  ? 168.240 209.889 185.683 1.00   191.09 ? 1313 LEU A CB  1 
ATOM   6795  C  CG  . LEU A  1  895  ? 167.505 209.039 186.717 1.00   165.69 ? 1313 LEU A CG  1 
ATOM   6796  C  CD1 . LEU A  1  895  ? 166.000 209.053 186.539 1.00   163.92 ? 1313 LEU A CD1 1 
ATOM   6797  C  CD2 . LEU A  1  895  ? 168.021 207.614 186.628 1.00   168.12 ? 1313 LEU A CD2 1 
ATOM   6798  N  N   . ILE A  1  896  ? 167.738 212.545 183.285 1.00   185.49 ? 1314 ILE A N   1 
ATOM   6799  C  CA  . ILE A  1  896  ? 167.366 212.758 181.891 1.00   198.56 ? 1314 ILE A CA  1 
ATOM   6800  C  C   . ILE A  1  896  ? 165.834 212.728 181.744 1.00   215.70 ? 1314 ILE A C   1 
ATOM   6801  O  O   . ILE A  1  896  ? 165.175 213.655 182.209 1.00   230.71 ? 1314 ILE A O   1 
ATOM   6802  C  CB  . ILE A  1  896  ? 168.095 211.756 180.941 1.00   248.99 ? 1314 ILE A CB  1 
ATOM   6803  C  CG1 . ILE A  1  896  ? 169.609 211.686 181.229 1.00   270.21 ? 1314 ILE A CG1 1 
ATOM   6804  C  CG2 . ILE A  1  896  ? 167.861 212.128 179.473 1.00   273.04 ? 1314 ILE A CG2 1 
ATOM   6805  C  CD1 . ILE A  1  896  ? 170.273 210.408 180.729 1.00   273.72 ? 1314 ILE A CD1 1 
ATOM   6806  N  N   . GLY A  1  897  ? 165.272 211.652 181.175 1.00   228.63 ? 1315 GLY A N   1 
ATOM   6807  C  CA  . GLY A  1  897  ? 163.840 211.525 180.942 1.00   228.67 ? 1315 GLY A CA  1 
ATOM   6808  C  C   . GLY A  1  897  ? 163.330 210.143 181.319 1.00   225.69 ? 1315 GLY A C   1 
ATOM   6809  O  O   . GLY A  1  897  ? 162.661 209.477 180.515 1.00   170.93 ? 1315 GLY A O   1 
ATOM   6810  N  N   . MET A  1  898  ? 163.629 209.720 182.548 1.00   230.15 ? 1316 MET A N   1 
ATOM   6811  C  CA  . MET A  1  898  ? 163.046 208.507 183.096 1.00   243.55 ? 1316 MET A CA  1 
ATOM   6812  C  C   . MET A  1  898  ? 161.799 208.815 183.942 1.00   215.93 ? 1316 MET A C   1 
ATOM   6813  O  O   . MET A  1  898  ? 161.329 207.941 184.648 1.00   198.97 ? 1316 MET A O   1 
ATOM   6814  C  CB  . MET A  1  898  ? 164.041 207.728 183.975 1.00   276.18 ? 1316 MET A CB  1 
ATOM   6815  C  CG  . MET A  1  898  ? 165.478 207.626 183.494 1.00   267.75 ? 1316 MET A CG  1 
ATOM   6816  S  SD  . MET A  1  898  ? 165.702 206.794 181.922 1.00   277.71 ? 1316 MET A SD  1 
ATOM   6817  C  CE  . MET A  1  898  ? 167.092 207.763 181.332 1.00   288.31 ? 1316 MET A CE  1 
ATOM   6818  N  N   . SER A  1  899  ? 161.262 210.027 183.895 1.00   210.72 ? 1317 SER A N   1 
ATOM   6819  C  CA  . SER A  1  899  ? 160.074 210.336 184.680 1.00   213.25 ? 1317 SER A CA  1 
ATOM   6820  C  C   . SER A  1  899  ? 158.887 209.484 184.245 1.00   215.55 ? 1317 SER A C   1 
ATOM   6821  O  O   . SER A  1  899  ? 158.116 209.043 185.089 1.00   210.27 ? 1317 SER A O   1 
ATOM   6822  C  CB  . SER A  1  899  ? 159.746 211.821 184.610 1.00   225.73 ? 1317 SER A CB  1 
ATOM   6823  O  OG  . SER A  1  899  ? 160.762 212.551 185.275 1.00   260.03 ? 1317 SER A OG  1 
ATOM   6824  N  N   . ALA A  1  900  ? 158.767 209.241 182.937 1.00   231.47 ? 1318 ALA A N   1 
ATOM   6825  C  CA  . ALA A  1  900  ? 157.747 208.337 182.382 1.00   251.54 ? 1318 ALA A CA  1 
ATOM   6826  C  C   . ALA A  1  900  ? 157.850 206.923 182.975 1.00   259.99 ? 1318 ALA A C   1 
ATOM   6827  O  O   . ALA A  1  900  ? 156.871 206.344 183.464 1.00   283.70 ? 1318 ALA A O   1 
ATOM   6828  C  CB  . ALA A  1  900  ? 157.885 208.282 180.868 1.00   249.89 ? 1318 ALA A CB  1 
ATOM   6829  N  N   . LEU A  1  901  ? 159.063 206.390 182.927 1.00   256.05 ? 1319 LEU A N   1 
ATOM   6830  C  CA  . LEU A  1  901  ? 159.438 205.163 183.635 1.00   232.55 ? 1319 LEU A CA  1 
ATOM   6831  C  C   . LEU A  1  901  ? 159.444 205.530 185.119 1.00   238.59 ? 1319 LEU A C   1 
ATOM   6832  O  O   . LEU A  1  901  ? 159.550 206.710 185.442 1.00   266.82 ? 1319 LEU A O   1 
ATOM   6833  C  CB  . LEU A  1  901  ? 160.849 204.796 183.200 1.00   214.10 ? 1319 LEU A CB  1 
ATOM   6834  C  CG  . LEU A  1  901  ? 161.117 203.405 182.708 1.00   215.26 ? 1319 LEU A CG  1 
ATOM   6835  C  CD1 . LEU A  1  901  ? 162.620 203.329 182.422 1.00   205.20 ? 1319 LEU A CD1 1 
ATOM   6836  C  CD2 . LEU A  1  901  ? 160.637 202.402 183.750 1.00   233.43 ? 1319 LEU A CD2 1 
ATOM   6837  N  N   . ASN A  1  902  ? 159.347 204.602 186.054 1.00   198.27 ? 1320 ASN A N   1 
ATOM   6838  C  CA  . ASN A  1  902  ? 159.487 205.085 187.427 1.00   196.97 ? 1320 ASN A CA  1 
ATOM   6839  C  C   . ASN A  1  902  ? 160.400 204.215 188.203 1.00   169.17 ? 1320 ASN A C   1 
ATOM   6840  O  O   . ASN A  1  902  ? 159.960 203.273 188.853 1.00   195.36 ? 1320 ASN A O   1 
ATOM   6841  C  CB  . ASN A  1  902  ? 158.127 205.302 188.098 1.00   220.26 ? 1320 ASN A CB  1 
ATOM   6842  C  CG  . ASN A  1  902  ? 158.156 206.425 189.142 1.00   257.30 ? 1320 ASN A CG  1 
ATOM   6843  O  OD1 . ASN A  1  902  ? 159.218 206.836 189.637 1.00   196.10 ? 1320 ASN A OD1 1 
ATOM   6844  N  ND2 . ASN A  1  902  ? 156.974 206.931 189.480 1.00   314.28 ? 1320 ASN A ND2 1 
ATOM   6845  N  N   . VAL A  1  903  ? 161.692 204.525 188.110 1.00   140.66 ? 1321 VAL A N   1 
ATOM   6846  C  CA  . VAL A  1  903  ? 162.691 203.587 188.602 1.00   150.81 ? 1321 VAL A CA  1 
ATOM   6847  C  C   . VAL A  1  903  ? 162.714 203.442 190.115 1.00   161.22 ? 1321 VAL A C   1 
ATOM   6848  O  O   . VAL A  1  903  ? 162.833 202.309 190.586 1.00   179.00 ? 1321 VAL A O   1 
ATOM   6849  C  CB  . VAL A  1  903  ? 164.132 203.777 188.049 1.00   162.25 ? 1321 VAL A CB  1 
ATOM   6850  C  CG1 . VAL A  1  903  ? 164.177 203.548 186.543 1.00   147.02 ? 1321 VAL A CG1 1 
ATOM   6851  C  CG2 . VAL A  1  903  ? 164.757 205.119 188.445 1.00   178.98 ? 1321 VAL A CG2 1 
ATOM   6852  N  N   . PRO A  1  904  ? 162.602 204.549 190.888 1.00   155.21 ? 1322 PRO A N   1 
ATOM   6853  C  CA  . PRO A  1  904  ? 162.528 204.258 192.341 1.00   163.72 ? 1322 PRO A CA  1 
ATOM   6854  C  C   . PRO A  1  904  ? 161.232 203.520 192.769 1.00   166.81 ? 1322 PRO A C   1 
ATOM   6855  O  O   . PRO A  1  904  ? 161.297 202.607 193.599 1.00   176.00 ? 1322 PRO A O   1 
ATOM   6856  C  CB  . PRO A  1  904  ? 162.682 205.631 193.010 1.00   149.00 ? 1322 PRO A CB  1 
ATOM   6857  C  CG  . PRO A  1  904  ? 162.505 206.644 191.919 1.00   158.70 ? 1322 PRO A CG  1 
ATOM   6858  C  CD  . PRO A  1  904  ? 162.401 205.975 190.584 1.00   153.24 ? 1322 PRO A CD  1 
ATOM   6859  N  N   . GLU A  1  905  ? 160.093 203.919 192.198 1.00   151.10 ? 1323 GLU A N   1 
ATOM   6860  C  CA  . GLU A  1  905  ? 158.821 203.222 192.376 1.00   146.68 ? 1323 GLU A CA  1 
ATOM   6861  C  C   . GLU A  1  905  ? 158.944 201.727 192.084 1.00   144.91 ? 1323 GLU A C   1 
ATOM   6862  O  O   . GLU A  1  905  ? 158.612 200.881 192.900 1.00   180.40 ? 1323 GLU A O   1 
ATOM   6863  C  CB  . GLU A  1  905  ? 157.781 203.834 191.432 1.00   200.39 ? 1323 GLU A CB  1 
ATOM   6864  C  CG  . GLU A  1  905  ? 156.607 202.945 190.952 1.00   244.16 ? 1323 GLU A CG  1 
ATOM   6865  C  CD  . GLU A  1  905  ? 155.346 203.101 191.778 1.00   290.64 ? 1323 GLU A CD  1 
ATOM   6866  O  OE1 . GLU A  1  905  ? 154.887 204.253 191.953 1.00   341.42 ? 1323 GLU A OE1 1 
ATOM   6867  O  OE2 . GLU A  1  905  ? 154.797 202.075 192.234 1.00   317.53 ? 1323 GLU A OE2 1 
ATOM   6868  N  N   . GLN A  1  906  ? 159.374 201.413 190.882 1.00   147.00 ? 1324 GLN A N   1 
ATOM   6869  C  CA  . GLN A  1  906  ? 159.415 200.036 190.387 1.00   142.78 ? 1324 GLN A CA  1 
ATOM   6870  C  C   . GLN A  1  906  ? 160.299 199.114 191.212 1.00   144.76 ? 1324 GLN A C   1 
ATOM   6871  O  O   . GLN A  1  906  ? 159.958 197.968 191.459 1.00   175.35 ? 1324 GLN A O   1 
ATOM   6872  C  CB  . GLN A  1  906  ? 159.970 200.064 188.974 1.00   153.06 ? 1324 GLN A CB  1 
ATOM   6873  C  CG  . GLN A  1  906  ? 158.961 200.139 187.873 1.00   157.14 ? 1324 GLN A CG  1 
ATOM   6874  C  CD  . GLN A  1  906  ? 158.763 198.754 187.343 1.00   191.42 ? 1324 GLN A CD  1 
ATOM   6875  O  OE1 . GLN A  1  906  ? 158.319 197.877 188.088 1.00   214.01 ? 1324 GLN A OE1 1 
ATOM   6876  N  NE2 . GLN A  1  906  ? 159.167 198.519 186.080 1.00   201.14 ? 1324 GLN A NE2 1 
ATOM   6877  N  N   . LEU A  1  907  ? 161.462 199.618 191.590 1.00   139.05 ? 1325 LEU A N   1 
ATOM   6878  C  CA  . LEU A  1  907  ? 162.396 198.868 192.379 1.00   135.14 ? 1325 LEU A CA  1 
ATOM   6879  C  C   . LEU A  1  907  ? 161.813 198.727 193.763 1.00   144.57 ? 1325 LEU A C   1 
ATOM   6880  O  O   . LEU A  1  907  ? 161.926 197.666 194.340 1.00   164.23 ? 1325 LEU A O   1 
ATOM   6881  C  CB  . LEU A  1  907  ? 163.746 199.581 192.449 1.00   154.95 ? 1325 LEU A CB  1 
ATOM   6882  C  CG  . LEU A  1  907  ? 164.798 199.218 191.401 1.00   157.85 ? 1325 LEU A CG  1 
ATOM   6883  C  CD1 . LEU A  1  907  ? 164.218 198.998 190.025 1.00   164.39 ? 1325 LEU A CD1 1 
ATOM   6884  C  CD2 . LEU A  1  907  ? 165.863 200.300 191.369 1.00   154.12 ? 1325 LEU A CD2 1 
ATOM   6885  N  N   . TYR A  1  908  ? 161.169 199.762 194.304 1.00   131.92 ? 1326 TYR A N   1 
ATOM   6886  C  CA  . TYR A  1  908  ? 160.521 199.615 195.600 1.00   135.50 ? 1326 TYR A CA  1 
ATOM   6887  C  C   . TYR A  1  908  ? 159.616 198.461 195.554 1.00   125.65 ? 1326 TYR A C   1 
ATOM   6888  O  O   . TYR A  1  908  ? 159.662 197.626 196.437 1.00   178.90 ? 1326 TYR A O   1 
ATOM   6889  C  CB  . TYR A  1  908  ? 159.634 200.783 195.993 1.00   161.84 ? 1326 TYR A CB  1 
ATOM   6890  C  CG  . TYR A  1  908  ? 158.964 200.553 197.330 1.00   161.80 ? 1326 TYR A CG  1 
ATOM   6891  C  CD1 . TYR A  1  908  ? 159.734 200.464 198.486 1.00   159.43 ? 1326 TYR A CD1 1 
ATOM   6892  C  CD2 . TYR A  1  908  ? 157.593 200.389 197.438 1.00   173.35 ? 1326 TYR A CD2 1 
ATOM   6893  C  CE1 . TYR A  1  908  ? 159.182 200.245 199.720 1.00   165.56 ? 1326 TYR A CE1 1 
ATOM   6894  C  CE2 . TYR A  1  908  ? 157.010 200.178 198.680 1.00   221.33 ? 1326 TYR A CE2 1 
ATOM   6895  C  CZ  . TYR A  1  908  ? 157.820 200.101 199.820 1.00   218.82 ? 1326 TYR A CZ  1 
ATOM   6896  O  OH  . TYR A  1  908  ? 157.278 199.882 201.070 1.00   258.33 ? 1326 TYR A OH  1 
ATOM   6897  N  N   . GLN A  1  909  ? 158.773 198.419 194.535 1.00   125.61 ? 1327 GLN A N   1 
ATOM   6898  C  CA  . GLN A  1  909  ? 157.841 197.321 194.409 1.00   142.72 ? 1327 GLN A CA  1 
ATOM   6899  C  C   . GLN A  1  909  ? 158.522 195.926 194.260 1.00   130.91 ? 1327 GLN A C   1 
ATOM   6900  O  O   . GLN A  1  909  ? 157.976 194.960 194.773 1.00   181.89 ? 1327 GLN A O   1 
ATOM   6901  C  CB  . GLN A  1  909  ? 156.781 197.572 193.337 1.00   149.08 ? 1327 GLN A CB  1 
ATOM   6902  C  CG  . GLN A  1  909  ? 155.391 197.274 193.877 1.00   185.68 ? 1327 GLN A CG  1 
ATOM   6903  C  CD  . GLN A  1  909  ? 154.368 196.953 192.804 1.00   239.84 ? 1327 GLN A CD  1 
ATOM   6904  O  OE1 . GLN A  1  909  ? 154.670 196.950 191.602 1.00   289.88 ? 1327 GLN A OE1 1 
ATOM   6905  N  NE2 . GLN A  1  909  ? 153.130 196.681 193.237 1.00   245.82 ? 1327 GLN A NE2 1 
ATOM   6906  N  N   . TYR A  1  910  ? 159.696 195.813 193.629 1.00   116.20 ? 1328 TYR A N   1 
ATOM   6907  C  CA  . TYR A  1  910  ? 160.467 194.531 193.639 1.00   124.98 ? 1328 TYR A CA  1 
ATOM   6908  C  C   . TYR A  1  910  ? 161.024 194.141 194.977 1.00   122.64 ? 1328 TYR A C   1 
ATOM   6909  O  O   . TYR A  1  910  ? 161.052 192.988 195.323 1.00   153.13 ? 1328 TYR A O   1 
ATOM   6910  C  CB  . TYR A  1  910  ? 161.649 194.546 192.687 1.00   138.10 ? 1328 TYR A CB  1 
ATOM   6911  C  CG  . TYR A  1  910  ? 161.202 194.487 191.279 1.00   140.27 ? 1328 TYR A CG  1 
ATOM   6912  C  CD1 . TYR A  1  910  ? 160.554 193.382 190.821 1.00   111.61 ? 1328 TYR A CD1 1 
ATOM   6913  C  CD2 . TYR A  1  910  ? 161.394 195.550 190.415 1.00   154.23 ? 1328 TYR A CD2 1 
ATOM   6914  C  CE1 . TYR A  1  910  ? 160.090 193.309 189.548 1.00   129.85 ? 1328 TYR A CE1 1 
ATOM   6915  C  CE2 . TYR A  1  910  ? 160.939 195.483 189.116 1.00   165.57 ? 1328 TYR A CE2 1 
ATOM   6916  C  CZ  . TYR A  1  910  ? 160.289 194.341 188.689 1.00   153.06 ? 1328 TYR A CZ  1 
ATOM   6917  O  OH  . TYR A  1  910  ? 159.812 194.216 187.400 1.00   192.74 ? 1328 TYR A OH  1 
ATOM   6918  N  N   . MET A  1  911  ? 161.503 195.113 195.706 1.00   129.46 ? 1329 MET A N   1 
ATOM   6919  C  CA  . MET A  1  911  ? 161.968 194.916 197.058 1.00   148.52 ? 1329 MET A CA  1 
ATOM   6920  C  C   . MET A  1  911  ? 160.827 194.514 198.063 1.00   156.57 ? 1329 MET A C   1 
ATOM   6921  O  O   . MET A  1  911  ? 160.906 193.519 198.791 1.00   164.15 ? 1329 MET A O   1 
ATOM   6922  C  CB  . MET A  1  911  ? 162.639 196.226 197.442 1.00   148.95 ? 1329 MET A CB  1 
ATOM   6923  C  CG  . MET A  1  911  ? 163.418 196.221 198.720 1.00   187.37 ? 1329 MET A CG  1 
ATOM   6924  S  SD  . MET A  1  911  ? 164.041 197.886 198.970 1.00   215.79 ? 1329 MET A SD  1 
ATOM   6925  C  CE  . MET A  1  911  ? 165.150 197.983 197.571 1.00   207.87 ? 1329 MET A CE  1 
ATOM   6926  N  N   . VAL A  1  912  ? 159.766 195.293 198.102 1.00   147.29 ? 1330 VAL A N   1 
ATOM   6927  C  CA  . VAL A  1  912  ? 158.695 195.023 199.030 1.00   150.53 ? 1330 VAL A CA  1 
ATOM   6928  C  C   . VAL A  1  912  ? 157.784 193.883 198.569 1.00   171.74 ? 1330 VAL A C   1 
ATOM   6929  O  O   . VAL A  1  912  ? 157.164 193.233 199.399 1.00   222.21 ? 1330 VAL A O   1 
ATOM   6930  C  CB  . VAL A  1  912  ? 157.875 196.304 199.300 1.00   210.42 ? 1330 VAL A CB  1 
ATOM   6931  C  CG1 . VAL A  1  912  ? 157.082 196.755 198.054 1.00   237.00 ? 1330 VAL A CG1 1 
ATOM   6932  C  CG2 . VAL A  1  912  ? 156.981 196.121 200.527 1.00   233.38 ? 1330 VAL A CG2 1 
ATOM   6933  N  N   . GLY A  1  913  ? 157.703 193.627 197.264 1.00   175.67 ? 1331 GLY A N   1 
ATOM   6934  C  CA  . GLY A  1  913  ? 156.710 192.685 196.701 1.00   170.33 ? 1331 GLY A CA  1 
ATOM   6935  C  C   . GLY A  1  913  ? 155.366 193.356 196.429 1.00   172.45 ? 1331 GLY A C   1 
ATOM   6936  O  O   . GLY A  1  913  ? 155.130 194.467 196.890 1.00   193.64 ? 1331 GLY A O   1 
ATOM   6937  N  N   . GLY A  1  914  ? 154.472 192.672 195.695 1.00   176.61 ? 1332 GLY A N   1 
ATOM   6938  C  CA  . GLY A  1  914  ? 153.172 193.229 195.151 1.00   183.37 ? 1332 GLY A CA  1 
ATOM   6939  C  C   . GLY A  1  914  ? 153.087 193.072 193.615 1.00   215.60 ? 1332 GLY A C   1 
ATOM   6940  O  O   . GLY A  1  914  ? 154.085 192.678 193.040 1.00   307.87 ? 1332 GLY A O   1 
ATOM   6941  N  N   . HIS A  1  915  ? 151.969 193.351 192.912 1.00   187.22 ? 1333 HIS A N   1 
ATOM   6942  C  CA  . HIS A  1  915  ? 151.993 193.198 191.387 1.00   206.91 ? 1333 HIS A CA  1 
ATOM   6943  C  C   . HIS A  1  915  ? 151.367 194.302 190.486 1.00   233.27 ? 1333 HIS A C   1 
ATOM   6944  O  O   . HIS A  1  915  ? 151.719 194.451 189.278 1.00   175.09 ? 1333 HIS A O   1 
ATOM   6945  C  CB  . HIS A  1  915  ? 151.449 191.829 190.942 1.00   204.89 ? 1333 HIS A CB  1 
ATOM   6946  C  CG  . HIS A  1  915  ? 151.984 191.367 189.608 1.00   244.23 ? 1333 HIS A CG  1 
ATOM   6947  N  ND1 . HIS A  1  915  ? 152.984 190.421 189.493 1.00   260.01 ? 1333 HIS A ND1 1 
ATOM   6948  C  CD2 . HIS A  1  915  ? 151.662 191.718 188.337 1.00   254.63 ? 1333 HIS A CD2 1 
ATOM   6949  C  CE1 . HIS A  1  915  ? 153.251 190.208 188.218 1.00   249.69 ? 1333 HIS A CE1 1 
ATOM   6950  N  NE2 . HIS A  1  915  ? 152.466 190.986 187.495 1.00   253.98 ? 1333 HIS A NE2 1 
ATOM   6951  N  N   . SER A  1  916  ? 151.425 177.848 177.252 1.00   237.45 ? 1347 SER A N   1 
ATOM   6952  C  CA  . SER A  1  916  ? 151.320 177.692 178.705 1.00   268.01 ? 1347 SER A CA  1 
ATOM   6953  C  C   . SER A  1  916  ? 152.227 178.721 179.385 1.00   262.30 ? 1347 SER A C   1 
ATOM   6954  O  O   . SER A  1  916  ? 153.107 179.282 178.721 1.00   249.60 ? 1347 SER A O   1 
ATOM   6955  C  CB  . SER A  1  916  ? 151.691 176.256 179.142 1.00   282.55 ? 1347 SER A CB  1 
ATOM   6956  O  OG  . SER A  1  916  ? 153.057 175.947 178.914 1.00   297.42 ? 1347 SER A OG  1 
ATOM   6957  N  N   . PRO A  1  917  ? 152.019 178.980 180.701 1.00   251.97 ? 1348 PRO A N   1 
ATOM   6958  C  CA  . PRO A  1  917  ? 152.980 179.860 181.375 1.00   233.64 ? 1348 PRO A CA  1 
ATOM   6959  C  C   . PRO A  1  917  ? 154.350 179.174 181.518 1.00   203.16 ? 1348 PRO A C   1 
ATOM   6960  O  O   . PRO A  1  917  ? 155.334 179.662 180.981 1.00   259.74 ? 1348 PRO A O   1 
ATOM   6961  C  CB  . PRO A  1  917  ? 152.320 180.160 182.741 1.00   233.08 ? 1348 PRO A CB  1 
ATOM   6962  C  CG  . PRO A  1  917  ? 150.927 179.618 182.661 1.00   237.00 ? 1348 PRO A CG  1 
ATOM   6963  C  CD  . PRO A  1  917  ? 150.944 178.541 181.616 1.00   242.44 ? 1348 PRO A CD  1 
ATOM   6964  N  N   . SER A  1  918  ? 154.380 178.032 182.198 1.00   170.91 ? 1349 SER A N   1 
ATOM   6965  C  CA  . SER A  1  918  ? 155.612 177.273 182.483 1.00   163.47 ? 1349 SER A CA  1 
ATOM   6966  C  C   . SER A  1  918  ? 155.259 175.971 183.153 1.00   163.81 ? 1349 SER A C   1 
ATOM   6967  O  O   . SER A  1  918  ? 154.133 175.772 183.615 1.00   205.79 ? 1349 SER A O   1 
ATOM   6968  C  CB  . SER A  1  918  ? 156.578 178.027 183.423 1.00   165.28 ? 1349 SER A CB  1 
ATOM   6969  O  OG  . SER A  1  918  ? 156.005 178.283 184.694 1.00   135.09 ? 1349 SER A OG  1 
ATOM   6970  N  N   . TYR A  1  919  ? 156.230 175.095 183.235 1.00   132.03 ? 1350 TYR A N   1 
ATOM   6971  C  CA  . TYR A  1  919  ? 156.006 173.819 183.822 1.00   147.61 ? 1350 TYR A CA  1 
ATOM   6972  C  C   . TYR A  1  919  ? 156.973 173.581 184.949 1.00   148.78 ? 1350 TYR A C   1 
ATOM   6973  O  O   . TYR A  1  919  ? 157.065 172.456 185.436 1.00   209.64 ? 1350 TYR A O   1 
ATOM   6974  C  CB  . TYR A  1  919  ? 156.207 172.731 182.749 1.00   184.39 ? 1350 TYR A CB  1 
ATOM   6975  C  CG  . TYR A  1  919  ? 155.283 172.805 181.553 1.00   176.11 ? 1350 TYR A CG  1 
ATOM   6976  C  CD1 . TYR A  1  919  ? 153.897 172.816 181.725 1.00   186.93 ? 1350 TYR A CD1 1 
ATOM   6977  C  CD2 . TYR A  1  919  ? 155.794 172.833 180.257 1.00   171.36 ? 1350 TYR A CD2 1 
ATOM   6978  C  CE1 . TYR A  1  919  ? 153.046 172.890 180.642 1.00   209.39 ? 1350 TYR A CE1 1 
ATOM   6979  C  CE2 . TYR A  1  919  ? 154.950 172.897 179.167 1.00   197.33 ? 1350 TYR A CE2 1 
ATOM   6980  C  CZ  . TYR A  1  919  ? 153.581 172.926 179.364 1.00   228.34 ? 1350 TYR A CZ  1 
ATOM   6981  O  OH  . TYR A  1  919  ? 152.745 172.989 178.277 1.00   292.06 ? 1350 TYR A OH  1 
ATOM   6982  N  N   . GLN A  1  920  ? 157.729 174.582 185.366 1.00   139.27 ? 1351 GLN A N   1 
ATOM   6983  C  CA  . GLN A  1  920  ? 158.661 174.342 186.450 1.00   149.76 ? 1351 GLN A CA  1 
ATOM   6984  C  C   . GLN A  1  920  ? 158.355 175.291 187.563 1.00   143.72 ? 1351 GLN A C   1 
ATOM   6985  O  O   . GLN A  1  920  ? 157.901 174.894 188.610 1.00   145.25 ? 1351 GLN A O   1 
ATOM   6986  C  CB  . GLN A  1  920  ? 160.096 174.480 185.998 1.00   168.62 ? 1351 GLN A CB  1 
ATOM   6987  C  CG  . GLN A  1  920  ? 160.575 173.271 185.248 1.00   173.12 ? 1351 GLN A CG  1 
ATOM   6988  C  CD  . GLN A  1  920  ? 162.092 173.198 185.125 1.00   234.29 ? 1351 GLN A CD  1 
ATOM   6989  O  OE1 . GLN A  1  920  ? 162.808 173.134 186.131 1.00   260.70 ? 1351 GLN A OE1 1 
ATOM   6990  N  NE2 . GLN A  1  920  ? 162.590 173.187 183.886 1.00   257.01 ? 1351 GLN A NE2 1 
ATOM   6991  N  N   . ILE A  1  921  ? 158.574 176.565 187.355 1.00   130.94 ? 1352 ILE A N   1 
ATOM   6992  C  CA  . ILE A  1  921  ? 158.231 177.470 188.412 1.00   126.91 ? 1352 ILE A CA  1 
ATOM   6993  C  C   . ILE A  1  921  ? 156.723 177.655 188.265 1.00   122.51 ? 1352 ILE A C   1 
ATOM   6994  O  O   . ILE A  1  921  ? 156.184 177.448 187.179 1.00   117.43 ? 1352 ILE A O   1 
ATOM   6995  C  CB  . ILE A  1  921  ? 158.988 178.806 188.336 1.00   142.65 ? 1352 ILE A CB  1 
ATOM   6996  C  CG1 . ILE A  1  921  ? 160.484 178.604 188.034 1.00   171.74 ? 1352 ILE A CG1 1 
ATOM   6997  C  CG2 . ILE A  1  921  ? 158.818 179.604 189.619 1.00   149.68 ? 1352 ILE A CG2 1 
ATOM   6998  C  CD1 . ILE A  1  921  ? 161.224 177.627 188.930 1.00   187.81 ? 1352 ILE A CD1 1 
ATOM   6999  N  N   . LYS A  1  922  ? 156.063 177.964 189.382 1.00   130.48 ? 1353 LYS A N   1 
ATOM   7000  C  CA  . LYS A  1  922  ? 154.701 178.481 189.427 1.00   135.40 ? 1353 LYS A CA  1 
ATOM   7001  C  C   . LYS A  1  922  ? 154.689 179.756 190.281 1.00   150.22 ? 1353 LYS A C   1 
ATOM   7002  O  O   . LYS A  1  922  ? 154.845 179.682 191.499 1.00   155.03 ? 1353 LYS A O   1 
ATOM   7003  C  CB  . LYS A  1  922  ? 153.788 177.426 190.042 1.00   148.15 ? 1353 LYS A CB  1 
ATOM   7004  C  CG  . LYS A  1  922  ? 152.305 177.681 189.864 1.00   177.08 ? 1353 LYS A CG  1 
ATOM   7005  C  CD  . LYS A  1  922  ? 151.530 176.371 189.863 1.00   192.50 ? 1353 LYS A CD  1 
ATOM   7006  C  CE  . LYS A  1  922  ? 150.023 176.594 189.862 1.00   209.41 ? 1353 LYS A CE  1 
ATOM   7007  N  NZ  . LYS A  1  922  ? 149.526 177.031 191.196 1.00   234.09 ? 1353 LYS A NZ  1 
ATOM   7008  N  N   . GLU A  1  923  ? 154.540 180.923 189.651 1.00   164.21 ? 1354 GLU A N   1 
ATOM   7009  C  CA  . GLU A  1  923  ? 154.402 182.174 190.404 1.00   192.86 ? 1354 GLU A CA  1 
ATOM   7010  C  C   . GLU A  1  923  ? 152.974 182.234 190.973 1.00   191.06 ? 1354 GLU A C   1 
ATOM   7011  O  O   . GLU A  1  923  ? 151.996 182.033 190.236 1.00   201.67 ? 1354 GLU A O   1 
ATOM   7012  C  CB  . GLU A  1  923  ? 154.734 183.415 189.520 1.00   266.92 ? 1354 GLU A CB  1 
ATOM   7013  C  CG  . GLU A  1  923  ? 154.271 184.788 190.073 1.00   323.61 ? 1354 GLU A CG  1 
ATOM   7014  C  CD  . GLU A  1  923  ? 154.827 186.055 189.381 1.00   329.15 ? 1354 GLU A CD  1 
ATOM   7015  O  OE1 . GLU A  1  923  ? 156.046 186.111 189.097 1.00   343.31 ? 1354 GLU A OE1 1 
ATOM   7016  O  OE2 . GLU A  1  923  ? 154.043 187.030 189.163 1.00   249.23 ? 1354 GLU A OE2 1 
ATOM   7017  N  N   . GLY A  1  924  ? 152.860 182.504 192.272 1.00   192.03 ? 1355 GLY A N   1 
ATOM   7018  C  CA  . GLY A  1  924  ? 151.550 182.727 192.910 1.00   257.77 ? 1355 GLY A CA  1 
ATOM   7019  C  C   . GLY A  1  924  ? 150.830 184.055 192.622 1.00   288.60 ? 1355 GLY A C   1 
ATOM   7020  O  O   . GLY A  1  924  ? 149.655 184.219 192.980 1.00   346.73 ? 1355 GLY A O   1 
ATOM   7021  N  N   . ASP A  1  925  ? 151.551 185.018 192.043 1.00   260.65 ? 1356 ASP A N   1 
ATOM   7022  C  CA  . ASP A  1  925  ? 151.036 186.323 191.629 1.00   214.04 ? 1356 ASP A CA  1 
ATOM   7023  C  C   . ASP A  1  925  ? 151.190 187.210 192.860 1.00   232.95 ? 1356 ASP A C   1 
ATOM   7024  O  O   . ASP A  1  925  ? 151.429 186.721 193.964 1.00   226.07 ? 1356 ASP A O   1 
ATOM   7025  C  CB  . ASP A  1  925  ? 149.597 186.280 191.098 1.00   176.17 ? 1356 ASP A CB  1 
ATOM   7026  N  N   . THR A  1  926  ? 151.098 188.520 192.663 1.00   274.22 ? 1357 THR A N   1 
ATOM   7027  C  CA  . THR A  1  926  ? 151.522 189.512 193.675 1.00   295.89 ? 1357 THR A CA  1 
ATOM   7028  C  C   . THR A  1  926  ? 153.065 189.690 193.749 1.00   297.93 ? 1357 THR A C   1 
ATOM   7029  O  O   . THR A  1  926  ? 153.572 190.302 194.700 1.00   328.39 ? 1357 THR A O   1 
ATOM   7030  C  CB  . THR A  1  926  ? 150.948 189.204 195.079 1.00   289.40 ? 1357 THR A CB  1 
ATOM   7031  N  N   . LEU A  1  927  ? 153.777 189.151 192.739 1.00   255.26 ? 1358 LEU A N   1 
ATOM   7032  C  CA  . LEU A  1  927  ? 155.255 189.162 192.603 1.00   199.33 ? 1358 LEU A CA  1 
ATOM   7033  C  C   . LEU A  1  927  ? 155.969 188.359 193.639 1.00   211.47 ? 1358 LEU A C   1 
ATOM   7034  O  O   . LEU A  1  927  ? 155.431 188.114 194.725 1.00   268.72 ? 1358 LEU A O   1 
ATOM   7035  C  CB  . LEU A  1  927  ? 155.809 190.567 192.699 1.00   183.65 ? 1358 LEU A CB  1 
ATOM   7036  C  CG  . LEU A  1  927  ? 157.266 190.851 192.435 1.00   156.76 ? 1358 LEU A CG  1 
ATOM   7037  C  CD1 . LEU A  1  927  ? 157.542 190.534 190.969 1.00   180.74 ? 1358 LEU A CD1 1 
ATOM   7038  C  CD2 . LEU A  1  927  ? 157.552 192.304 192.777 1.00   146.31 ? 1358 LEU A CD2 1 
ATOM   7039  N  N   . ASN A  1  928  ? 157.201 187.964 193.330 1.00   176.71 ? 1359 ASN A N   1 
ATOM   7040  C  CA  . ASN A  1  928  ? 158.059 187.393 194.378 1.00   180.50 ? 1359 ASN A CA  1 
ATOM   7041  C  C   . ASN A  1  928  ? 159.332 188.170 194.609 1.00   158.75 ? 1359 ASN A C   1 
ATOM   7042  O  O   . ASN A  1  928  ? 160.025 188.545 193.686 1.00   184.62 ? 1359 ASN A O   1 
ATOM   7043  C  CB  . ASN A  1  928  ? 158.325 185.880 194.176 1.00   164.23 ? 1359 ASN A CB  1 
ATOM   7044  C  CG  . ASN A  1  928  ? 159.502 185.584 193.268 1.00   154.87 ? 1359 ASN A CG  1 
ATOM   7045  O  OD1 . ASN A  1  928  ? 160.280 184.653 193.513 1.00   133.43 ? 1359 ASN A OD1 1 
ATOM   7046  N  ND2 . ASN A  1  928  ? 159.616 186.345 192.197 1.00   172.25 ? 1359 ASN A ND2 1 
ATOM   7047  N  N   . VAL A  1  929  ? 159.621 188.402 195.872 1.00   134.91 ? 1360 VAL A N   1 
ATOM   7048  C  CA  . VAL A  1  929  ? 160.864 188.990 196.251 1.00   134.44 ? 1360 VAL A CA  1 
ATOM   7049  C  C   . VAL A  1  929  ? 162.053 188.052 196.165 1.00   128.75 ? 1360 VAL A C   1 
ATOM   7050  O  O   . VAL A  1  929  ? 163.165 188.533 196.144 1.00   173.95 ? 1360 VAL A O   1 
ATOM   7051  C  CB  . VAL A  1  929  ? 160.800 189.556 197.677 1.00   174.83 ? 1360 VAL A CB  1 
ATOM   7052  C  CG1 . VAL A  1  929  ? 159.871 190.758 197.688 1.00   177.75 ? 1360 VAL A CG1 1 
ATOM   7053  C  CG2 . VAL A  1  929  ? 160.378 188.493 198.710 1.00   214.13 ? 1360 VAL A CG2 1 
ATOM   7054  N  N   . ASP A  1  930  ? 161.856 186.745 196.118 1.00   132.17 ? 1361 ASP A N   1 
ATOM   7055  C  CA  . ASP A  1  930  ? 162.964 185.810 196.342 1.00   147.58 ? 1361 ASP A CA  1 
ATOM   7056  C  C   . ASP A  1  930  ? 164.025 185.992 195.295 1.00   144.96 ? 1361 ASP A C   1 
ATOM   7057  O  O   . ASP A  1  930  ? 165.192 186.228 195.596 1.00   201.16 ? 1361 ASP A O   1 
ATOM   7058  C  CB  . ASP A  1  930  ? 162.440 184.371 196.367 1.00   188.93 ? 1361 ASP A CB  1 
ATOM   7059  C  CG  . ASP A  1  930  ? 161.409 184.143 197.508 1.00   262.02 ? 1361 ASP A CG  1 
ATOM   7060  O  OD1 . ASP A  1  930  ? 160.295 184.715 197.444 1.00   289.95 ? 1361 ASP A OD1 1 
ATOM   7061  O  OD2 . ASP A  1  930  ? 161.710 183.407 198.475 1.00   314.00 ? 1361 ASP A OD2 1 
ATOM   7062  N  N   . VAL A  1  931  ? 163.581 185.964 194.054 1.00   128.19 ? 1362 VAL A N   1 
ATOM   7063  C  CA  . VAL A  1  931  ? 164.430 186.300 192.924 1.00   111.39 ? 1362 VAL A CA  1 
ATOM   7064  C  C   . VAL A  1  931  ? 164.836 187.769 192.892 1.00   133.22 ? 1362 VAL A C   1 
ATOM   7065  O  O   . VAL A  1  931  ? 166.025 188.109 192.730 1.00   182.81 ? 1362 VAL A O   1 
ATOM   7066  C  CB  . VAL A  1  931  ? 163.695 185.984 191.645 1.00   115.88 ? 1362 VAL A CB  1 
ATOM   7067  C  CG1 . VAL A  1  931  ? 164.304 186.672 190.419 1.00   128.11 ? 1362 VAL A CG1 1 
ATOM   7068  C  CG2 . VAL A  1  931  ? 163.630 184.463 191.477 1.00   139.49 ? 1362 VAL A CG2 1 
ATOM   7069  N  N   . THR A  1  932  ? 163.854 188.641 193.041 1.00   113.20 ? 1363 THR A N   1 
ATOM   7070  C  CA  . THR A  1  932  ? 164.070 190.014 192.653 1.00   120.00 ? 1363 THR A CA  1 
ATOM   7071  C  C   . THR A  1  932  ? 164.637 190.901 193.689 1.00   113.31 ? 1363 THR A C   1 
ATOM   7072  O  O   . THR A  1  932  ? 165.138 191.933 193.339 1.00   153.03 ? 1363 THR A O   1 
ATOM   7073  C  CB  . THR A  1  932  ? 162.784 190.657 192.180 1.00   125.96 ? 1363 THR A CB  1 
ATOM   7074  O  OG1 . THR A  1  932  ? 161.949 190.848 193.320 1.00   152.32 ? 1363 THR A OG1 1 
ATOM   7075  C  CG2 . THR A  1  932  ? 162.105 189.727 191.067 1.00   135.36 ? 1363 THR A CG2 1 
ATOM   7076  N  N   . CYS A  1  933  ? 164.533 190.555 194.954 1.00   133.56 ? 1364 CYS A N   1 
ATOM   7077  C  CA  . CYS A  1  933  ? 164.868 191.509 195.995 1.00   148.83 ? 1364 CYS A CA  1 
ATOM   7078  C  C   . CYS A  1  933  ? 166.340 191.815 196.049 1.00   146.02 ? 1364 CYS A C   1 
ATOM   7079  O  O   . CYS A  1  933  ? 166.678 192.963 196.318 1.00   157.05 ? 1364 CYS A O   1 
ATOM   7080  C  CB  . CYS A  1  933  ? 164.409 191.062 197.367 1.00   178.04 ? 1364 CYS A CB  1 
ATOM   7081  S  SG  . CYS A  1  933  ? 164.978 192.193 198.642 1.00   229.04 ? 1364 CYS A SG  1 
ATOM   7082  N  N   . PRO A  1  934  ? 167.222 190.821 195.788 1.00   137.88 ? 1365 PRO A N   1 
ATOM   7083  C  CA  . PRO A  1  934  ? 168.642 191.156 195.801 1.00   132.89 ? 1365 PRO A CA  1 
ATOM   7084  C  C   . PRO A  1  934  ? 169.060 192.078 194.655 1.00   139.59 ? 1365 PRO A C   1 
ATOM   7085  O  O   . PRO A  1  934  ? 169.790 193.033 194.923 1.00   138.29 ? 1365 PRO A O   1 
ATOM   7086  C  CB  . PRO A  1  934  ? 169.328 189.817 195.639 1.00   157.50 ? 1365 PRO A CB  1 
ATOM   7087  C  CG  . PRO A  1  934  ? 168.356 188.984 194.887 1.00   164.66 ? 1365 PRO A CG  1 
ATOM   7088  C  CD  . PRO A  1  934  ? 167.023 189.407 195.439 1.00   140.05 ? 1365 PRO A CD  1 
ATOM   7089  N  N   . GLY A  1  935  ? 168.595 191.818 193.417 1.00   132.89 ? 1366 GLY A N   1 
ATOM   7090  C  CA  . GLY A  1  935  ? 168.811 192.728 192.275 1.00   109.80 ? 1366 GLY A CA  1 
ATOM   7091  C  C   . GLY A  1  935  ? 168.394 194.157 192.611 1.00   114.71 ? 1366 GLY A C   1 
ATOM   7092  O  O   . GLY A  1  935  ? 169.201 195.095 192.579 1.00   136.61 ? 1366 GLY A O   1 
ATOM   7093  N  N   . ALA A  1  936  ? 167.142 194.304 192.989 1.00   99.44  ? 1367 ALA A N   1 
ATOM   7094  C  CA  . ALA A  1  936  ? 166.570 195.591 193.237 1.00   106.47 ? 1367 ALA A CA  1 
ATOM   7095  C  C   . ALA A  1  936  ? 167.210 196.333 194.413 1.00   122.79 ? 1367 ALA A C   1 
ATOM   7096  O  O   . ALA A  1  936  ? 167.374 197.546 194.322 1.00   135.21 ? 1367 ALA A O   1 
ATOM   7097  C  CB  . ALA A  1  936  ? 165.087 195.456 193.455 1.00   129.50 ? 1367 ALA A CB  1 
ATOM   7098  N  N   . THR A  1  937  ? 167.584 195.673 195.507 1.00   120.15 ? 1368 THR A N   1 
ATOM   7099  C  CA  . THR A  1  937  ? 168.227 196.448 196.575 1.00   134.27 ? 1368 THR A CA  1 
ATOM   7100  C  C   . THR A  1  937  ? 169.454 197.058 196.005 1.00   133.40 ? 1368 THR A C   1 
ATOM   7101  O  O   . THR A  1  937  ? 169.673 198.232 196.249 1.00   142.96 ? 1368 THR A O   1 
ATOM   7102  C  CB  . THR A  1  937  ? 168.661 195.685 197.847 1.00   164.51 ? 1368 THR A CB  1 
ATOM   7103  O  OG1 . THR A  1  937  ? 169.654 194.713 197.518 1.00   179.47 ? 1368 THR A OG1 1 
ATOM   7104  C  CG2 . THR A  1  937  ? 167.478 195.039 198.563 1.00   198.61 ? 1368 THR A CG2 1 
ATOM   7105  N  N   . LEU A  1  938  ? 170.221 196.272 195.234 1.00   129.03 ? 1369 LEU A N   1 
ATOM   7106  C  CA  . LEU A  1  938  ? 171.471 196.760 194.646 1.00   141.32 ? 1369 LEU A CA  1 
ATOM   7107  C  C   . LEU A  1  938  ? 171.285 197.920 193.705 1.00   142.71 ? 1369 LEU A C   1 
ATOM   7108  O  O   . LEU A  1  938  ? 172.080 198.857 193.744 1.00   180.02 ? 1369 LEU A O   1 
ATOM   7109  C  CB  . LEU A  1  938  ? 172.263 195.664 193.949 1.00   133.61 ? 1369 LEU A CB  1 
ATOM   7110  C  CG  . LEU A  1  938  ? 173.180 194.932 194.934 1.00   170.18 ? 1369 LEU A CG  1 
ATOM   7111  C  CD1 . LEU A  1  938  ? 174.112 194.027 194.135 1.00   190.48 ? 1369 LEU A CD1 1 
ATOM   7112  C  CD2 . LEU A  1  938  ? 173.973 195.853 195.890 1.00   170.07 ? 1369 LEU A CD2 1 
ATOM   7113  N  N   . ALA A  1  939  ? 170.239 197.876 192.887 1.00   120.19 ? 1370 ALA A N   1 
ATOM   7114  C  CA  . ALA A  1  939  ? 169.966 198.996 191.988 1.00   113.70 ? 1370 ALA A CA  1 
ATOM   7115  C  C   . ALA A  1  939  ? 169.655 200.304 192.746 1.00   119.11 ? 1370 ALA A C   1 
ATOM   7116  O  O   . ALA A  1  939  ? 170.156 201.347 192.349 1.00   130.70 ? 1370 ALA A O   1 
ATOM   7117  C  CB  . ALA A  1  939  ? 168.882 198.653 190.971 1.00   117.30 ? 1370 ALA A CB  1 
ATOM   7118  N  N   . LEU A  1  940  ? 168.890 200.263 193.843 1.00   120.41 ? 1371 LEU A N   1 
ATOM   7119  C  CA  . LEU A  1  940  ? 168.676 201.493 194.635 1.00   130.30 ? 1371 LEU A CA  1 
ATOM   7120  C  C   . LEU A  1  940  ? 169.960 201.985 195.270 1.00   132.83 ? 1371 LEU A C   1 
ATOM   7121  O  O   . LEU A  1  940  ? 170.172 203.173 195.386 1.00   149.05 ? 1371 LEU A O   1 
ATOM   7122  C  CB  . LEU A  1  940  ? 167.629 201.319 195.724 1.00   134.22 ? 1371 LEU A CB  1 
ATOM   7123  C  CG  . LEU A  1  940  ? 166.205 201.153 195.203 1.00   155.35 ? 1371 LEU A CG  1 
ATOM   7124  C  CD1 . LEU A  1  940  ? 165.237 201.211 196.373 1.00   161.74 ? 1371 LEU A CD1 1 
ATOM   7125  C  CD2 . LEU A  1  940  ? 165.811 202.204 194.180 1.00   165.26 ? 1371 LEU A CD2 1 
ATOM   7126  N  N   . ALA A  1  941  ? 170.805 201.060 195.692 1.00   133.14 ? 1372 ALA A N   1 
ATOM   7127  C  CA  . ALA A  1  941  ? 172.123 201.409 196.193 1.00   143.03 ? 1372 ALA A CA  1 
ATOM   7128  C  C   . ALA A  1  941  ? 172.824 202.284 195.162 1.00   145.49 ? 1372 ALA A C   1 
ATOM   7129  O  O   . ALA A  1  941  ? 173.254 203.418 195.438 1.00   162.67 ? 1372 ALA A O   1 
ATOM   7130  C  CB  . ALA A  1  941  ? 172.951 200.138 196.489 1.00   151.09 ? 1372 ALA A CB  1 
ATOM   7131  N  N   . MET A  1  942  ? 172.875 201.768 193.949 1.00   132.73 ? 1373 MET A N   1 
ATOM   7132  C  CA  . MET A  1  942  ? 173.686 202.371 192.923 1.00   136.05 ? 1373 MET A CA  1 
ATOM   7133  C  C   . MET A  1  942  ? 173.119 203.677 192.446 1.00   136.03 ? 1373 MET A C   1 
ATOM   7134  O  O   . MET A  1  942  ? 173.855 204.614 192.271 1.00   171.58 ? 1373 MET A O   1 
ATOM   7135  C  CB  . MET A  1  942  ? 173.781 201.459 191.728 1.00   154.28 ? 1373 MET A CB  1 
ATOM   7136  C  CG  . MET A  1  942  ? 174.433 200.142 192.034 1.00   174.38 ? 1373 MET A CG  1 
ATOM   7137  S  SD  . MET A  1  942  ? 176.200 200.293 191.963 1.00   198.20 ? 1373 MET A SD  1 
ATOM   7138  C  CE  . MET A  1  942  ? 176.447 198.727 191.103 1.00   191.58 ? 1373 MET A CE  1 
ATOM   7139  N  N   . ILE A  1  943  ? 171.822 203.716 192.193 1.00   126.01 ? 1374 ILE A N   1 
ATOM   7140  C  CA  . ILE A  1  943  ? 171.184 204.871 191.602 1.00   114.47 ? 1374 ILE A CA  1 
ATOM   7141  C  C   . ILE A  1  943  ? 171.214 206.049 192.540 1.00   120.48 ? 1374 ILE A C   1 
ATOM   7142  O  O   . ILE A  1  943  ? 171.120 207.190 192.095 1.00   158.21 ? 1374 ILE A O   1 
ATOM   7143  C  CB  . ILE A  1  943  ? 169.743 204.566 191.220 1.00   121.45 ? 1374 ILE A CB  1 
ATOM   7144  C  CG1 . ILE A  1  943  ? 169.733 203.552 190.062 1.00   142.72 ? 1374 ILE A CG1 1 
ATOM   7145  C  CG2 . ILE A  1  943  ? 169.064 205.832 190.766 1.00   135.35 ? 1374 ILE A CG2 1 
ATOM   7146  C  CD1 . ILE A  1  943  ? 168.378 203.261 189.435 1.00   134.19 ? 1374 ILE A CD1 1 
ATOM   7147  N  N   . TYR A  1  944  ? 171.328 205.784 193.833 1.00   115.57 ? 1375 TYR A N   1 
ATOM   7148  C  CA  . TYR A  1  944  ? 171.258 206.836 194.829 1.00   127.36 ? 1375 TYR A CA  1 
ATOM   7149  C  C   . TYR A  1  944  ? 172.483 206.696 195.680 1.00   139.17 ? 1375 TYR A C   1 
ATOM   7150  O  O   . TYR A  1  944  ? 172.407 206.559 196.891 1.00   189.75 ? 1375 TYR A O   1 
ATOM   7151  C  CB  . TYR A  1  944  ? 169.962 206.705 195.668 1.00   121.20 ? 1375 TYR A CB  1 
ATOM   7152  C  CG  . TYR A  1  944  ? 168.760 206.831 194.812 1.00   124.00 ? 1375 TYR A CG  1 
ATOM   7153  C  CD1 . TYR A  1  944  ? 168.265 208.079 194.432 1.00   118.66 ? 1375 TYR A CD1 1 
ATOM   7154  C  CD2 . TYR A  1  944  ? 168.163 205.677 194.290 1.00   155.09 ? 1375 TYR A CD2 1 
ATOM   7155  C  CE1 . TYR A  1  944  ? 167.163 208.176 193.601 1.00   137.37 ? 1375 TYR A CE1 1 
ATOM   7156  C  CE2 . TYR A  1  944  ? 167.068 205.740 193.455 1.00   178.28 ? 1375 TYR A CE2 1 
ATOM   7157  C  CZ  . TYR A  1  944  ? 166.551 206.980 193.098 1.00   188.36 ? 1375 TYR A CZ  1 
ATOM   7158  O  OH  . TYR A  1  944  ? 165.444 206.955 192.254 1.00   170.37 ? 1375 TYR A OH  1 
ATOM   7159  N  N   . LEU A  1  945  ? 173.636 206.731 195.057 1.00   126.63 ? 1376 LEU A N   1 
ATOM   7160  C  CA  . LEU A  1  945  ? 174.863 206.440 195.780 1.00   133.77 ? 1376 LEU A CA  1 
ATOM   7161  C  C   . LEU A  1  945  ? 175.490 207.742 196.216 1.00   115.68 ? 1376 LEU A C   1 
ATOM   7162  O  O   . LEU A  1  945  ? 175.814 208.576 195.401 1.00   149.85 ? 1376 LEU A O   1 
ATOM   7163  C  CB  . LEU A  1  945  ? 175.775 205.652 194.868 1.00   142.93 ? 1376 LEU A CB  1 
ATOM   7164  C  CG  . LEU A  1  945  ? 176.770 204.754 195.551 1.00   157.91 ? 1376 LEU A CG  1 
ATOM   7165  C  CD1 . LEU A  1  945  ? 177.274 203.737 194.523 1.00   169.61 ? 1376 LEU A CD1 1 
ATOM   7166  C  CD2 . LEU A  1  945  ? 177.869 205.605 196.175 1.00   159.74 ? 1376 LEU A CD2 1 
ATOM   7167  N  N   . LYS A  1  946  ? 175.598 207.931 197.509 1.00   124.34 ? 1377 LYS A N   1 
ATOM   7168  C  CA  . LYS A  1  946  ? 176.042 209.208 198.100 1.00   164.77 ? 1377 LYS A CA  1 
ATOM   7169  C  C   . LYS A  1  946  ? 175.032 210.341 197.896 1.00   160.00 ? 1377 LYS A C   1 
ATOM   7170  O  O   . LYS A  1  946  ? 175.306 211.516 198.221 1.00   167.94 ? 1377 LYS A O   1 
ATOM   7171  C  CB  . LYS A  1  946  ? 177.452 209.633 197.634 1.00   169.23 ? 1377 LYS A CB  1 
ATOM   7172  C  CG  . LYS A  1  946  ? 178.556 208.641 197.959 1.00   168.67 ? 1377 LYS A CG  1 
ATOM   7173  C  CD  . LYS A  1  946  ? 179.580 208.593 196.863 1.00   185.07 ? 1377 LYS A CD  1 
ATOM   7174  C  CE  . LYS A  1  946  ? 180.607 207.522 197.111 1.00   179.00 ? 1377 LYS A CE  1 
ATOM   7175  N  NZ  . LYS A  1  946  ? 181.320 207.336 195.821 1.00   215.04 ? 1377 LYS A NZ  1 
ATOM   7176  N  N   . THR A  1  947  ? 173.844 209.983 197.432 1.00   129.15 ? 1378 THR A N   1 
ATOM   7177  C  CA  . THR A  1  947  ? 172.901 210.985 197.111 1.00   156.26 ? 1378 THR A CA  1 
ATOM   7178  C  C   . THR A  1  947  ? 172.270 211.542 198.446 1.00   173.57 ? 1378 THR A C   1 
ATOM   7179  O  O   . THR A  1  947  ? 171.991 212.740 198.545 1.00   218.03 ? 1378 THR A O   1 
ATOM   7180  C  CB  . THR A  1  947  ? 171.954 210.431 196.026 1.00   174.64 ? 1378 THR A CB  1 
ATOM   7181  O  OG1 . THR A  1  947  ? 171.449 211.486 195.200 1.00   217.29 ? 1378 THR A OG1 1 
ATOM   7182  C  CG2 . THR A  1  947  ? 170.835 209.700 196.636 1.00   192.18 ? 1378 THR A CG2 1 
ATOM   7183  N  N   . ASN A  1  948  ? 172.122 210.713 199.482 1.00   176.11 ? 1379 ASN A N   1 
ATOM   7184  C  CA  . ASN A  1  948  ? 171.538 211.122 200.798 1.00   177.87 ? 1379 ASN A CA  1 
ATOM   7185  C  C   . ASN A  1  948  ? 170.044 211.402 200.761 1.00   181.43 ? 1379 ASN A C   1 
ATOM   7186  O  O   . ASN A  1  948  ? 169.555 212.213 201.548 1.00   200.98 ? 1379 ASN A O   1 
ATOM   7187  C  CB  . ASN A  1  948  ? 172.269 212.318 201.465 1.00   171.01 ? 1379 ASN A CB  1 
ATOM   7188  C  CG  . ASN A  1  948  ? 173.744 212.049 201.667 1.00   190.11 ? 1379 ASN A CG  1 
ATOM   7189  O  OD1 . ASN A  1  948  ? 174.462 211.780 200.710 1.00   185.61 ? 1379 ASN A OD1 1 
ATOM   7190  N  ND2 . ASN A  1  948  ? 174.198 212.091 202.915 1.00   200.00 ? 1379 ASN A ND2 1 
ATOM   7191  N  N   . ASN A  1  949  ? 169.332 210.714 199.858 1.00   191.45 ? 1380 ASN A N   1 
ATOM   7192  C  CA  . ASN A  1  949  ? 167.860 210.816 199.735 1.00   177.30 ? 1380 ASN A CA  1 
ATOM   7193  C  C   . ASN A  1  949  ? 167.273 210.160 200.929 1.00   161.79 ? 1380 ASN A C   1 
ATOM   7194  O  O   . ASN A  1  949  ? 167.343 208.960 201.043 1.00   171.35 ? 1380 ASN A O   1 
ATOM   7195  C  CB  . ASN A  1  949  ? 167.298 210.063 198.516 1.00   162.15 ? 1380 ASN A CB  1 
ATOM   7196  C  CG  . ASN A  1  949  ? 167.304 210.896 197.264 1.00   216.89 ? 1380 ASN A CG  1 
ATOM   7197  O  OD1 . ASN A  1  949  ? 168.005 211.911 197.168 1.00   271.43 ? 1380 ASN A OD1 1 
ATOM   7198  N  ND2 . ASN A  1  949  ? 166.519 210.479 196.282 1.00   235.51 ? 1380 ASN A ND2 1 
ATOM   7199  N  N   . ARG A  1  950  ? 166.668 210.909 201.819 1.00   169.39 ? 1381 ARG A N   1 
ATOM   7200  C  CA  . ARG A  1  950  ? 166.154 210.292 203.017 1.00   178.44 ? 1381 ARG A CA  1 
ATOM   7201  C  C   . ARG A  1  950  ? 164.959 209.424 202.670 1.00   169.80 ? 1381 ARG A C   1 
ATOM   7202  O  O   . ARG A  1  950  ? 164.813 208.378 203.258 1.00   192.30 ? 1381 ARG A O   1 
ATOM   7203  C  CB  . ARG A  1  950  ? 165.797 211.339 204.067 1.00   205.36 ? 1381 ARG A CB  1 
ATOM   7204  C  CG  . ARG A  1  950  ? 166.978 212.193 204.491 1.00   207.33 ? 1381 ARG A CG  1 
ATOM   7205  C  CD  . ARG A  1  950  ? 168.092 211.345 205.060 1.00   205.72 ? 1381 ARG A CD  1 
ATOM   7206  N  NE  . ARG A  1  950  ? 169.076 212.197 205.714 1.00   234.58 ? 1381 ARG A NE  1 
ATOM   7207  C  CZ  . ARG A  1  950  ? 169.820 211.847 206.766 1.00   272.87 ? 1381 ARG A CZ  1 
ATOM   7208  N  NH1 . ARG A  1  950  ? 170.685 212.722 207.270 1.00   277.41 ? 1381 ARG A NH1 1 
ATOM   7209  N  NH2 . ARG A  1  950  ? 169.712 210.639 207.328 1.00   295.92 ? 1381 ARG A NH2 1 
ATOM   7210  N  N   . SER A  1  951  ? 164.137 209.858 201.710 1.00   169.95 ? 1382 SER A N   1 
ATOM   7211  C  CA  . SER A  1  951  ? 163.003 209.084 201.175 1.00   198.97 ? 1382 SER A CA  1 
ATOM   7212  C  C   . SER A  1  951  ? 163.334 207.604 200.908 1.00   182.70 ? 1382 SER A C   1 
ATOM   7213  O  O   . SER A  1  951  ? 162.721 206.659 201.476 1.00   192.01 ? 1382 SER A O   1 
ATOM   7214  C  CB  . SER A  1  951  ? 162.543 209.757 199.861 1.00   206.42 ? 1382 SER A CB  1 
ATOM   7215  O  OG  . SER A  1  951  ? 161.642 208.952 199.114 1.00   209.91 ? 1382 SER A OG  1 
ATOM   7216  N  N   . ILE A  1  952  ? 164.325 207.435 200.043 1.00   141.73 ? 1383 ILE A N   1 
ATOM   7217  C  CA  . ILE A  1  952  ? 164.683 206.134 199.537 1.00   134.22 ? 1383 ILE A CA  1 
ATOM   7218  C  C   . ILE A  1  952  ? 165.426 205.398 200.618 1.00   142.27 ? 1383 ILE A C   1 
ATOM   7219  O  O   . ILE A  1  952  ? 165.092 204.266 200.915 1.00   164.56 ? 1383 ILE A O   1 
ATOM   7220  C  CB  . ILE A  1  952  ? 165.510 206.250 198.251 1.00   144.76 ? 1383 ILE A CB  1 
ATOM   7221  C  CG1 . ILE A  1  952  ? 164.659 206.930 197.201 1.00   182.35 ? 1383 ILE A CG1 1 
ATOM   7222  C  CG2 . ILE A  1  952  ? 165.937 204.886 197.696 1.00   137.47 ? 1383 ILE A CG2 1 
ATOM   7223  C  CD1 . ILE A  1  952  ? 165.485 207.510 196.101 1.00   223.21 ? 1383 ILE A CD1 1 
ATOM   7224  N  N   . ALA A  1  953  ? 166.397 206.053 201.245 1.00   137.52 ? 1384 ALA A N   1 
ATOM   7225  C  CA  . ALA A  1  953  ? 167.171 205.407 202.297 1.00   135.69 ? 1384 ALA A CA  1 
ATOM   7226  C  C   . ALA A  1  953  ? 166.285 204.917 203.433 1.00   156.27 ? 1384 ALA A C   1 
ATOM   7227  O  O   . ALA A  1  953  ? 166.509 203.837 203.957 1.00   174.37 ? 1384 ALA A O   1 
ATOM   7228  C  CB  . ALA A  1  953  ? 168.216 206.348 202.842 1.00   138.49 ? 1384 ALA A CB  1 
ATOM   7229  N  N   . ASP A  1  954  ? 165.278 205.697 203.804 1.00   165.51 ? 1385 ASP A N   1 
ATOM   7230  C  CA  . ASP A  1  954  ? 164.440 205.312 204.910 1.00   179.81 ? 1385 ASP A CA  1 
ATOM   7231  C  C   . ASP A  1  954  ? 163.465 204.223 204.531 1.00   163.60 ? 1385 ASP A C   1 
ATOM   7232  O  O   . ASP A  1  954  ? 163.207 203.374 205.389 1.00   201.61 ? 1385 ASP A O   1 
ATOM   7233  C  CB  . ASP A  1  954  ? 163.791 206.522 205.578 1.00   232.13 ? 1385 ASP A CB  1 
ATOM   7234  C  CG  . ASP A  1  954  ? 164.821 207.411 206.306 1.00   270.52 ? 1385 ASP A CG  1 
ATOM   7235  O  OD1 . ASP A  1  954  ? 165.974 207.554 205.822 1.00   284.38 ? 1385 ASP A OD1 1 
ATOM   7236  O  OD2 . ASP A  1  954  ? 164.476 207.958 207.376 1.00   305.12 ? 1385 ASP A OD2 1 
ATOM   7237  N  N   . TRP A  1  955  ? 162.977 204.144 203.285 1.00   139.12 ? 1386 TRP A N   1 
ATOM   7238  C  CA  . TRP A  1  955  ? 162.198 202.921 202.948 1.00   169.24 ? 1386 TRP A CA  1 
ATOM   7239  C  C   . TRP A  1  955  ? 163.106 201.627 202.796 1.00   158.63 ? 1386 TRP A C   1 
ATOM   7240  O  O   . TRP A  1  955  ? 162.702 200.474 203.036 1.00   168.12 ? 1386 TRP A O   1 
ATOM   7241  C  CB  . TRP A  1  955  ? 161.099 203.168 201.870 1.00   168.48 ? 1386 TRP A CB  1 
ATOM   7242  C  CG  . TRP A  1  955  ? 161.452 202.962 200.497 1.00   142.35 ? 1386 TRP A CG  1 
ATOM   7243  C  CD1 . TRP A  1  955  ? 162.221 201.972 199.995 1.00   158.16 ? 1386 TRP A CD1 1 
ATOM   7244  C  CD2 . TRP A  1  955  ? 160.993 203.716 199.394 1.00   130.71 ? 1386 TRP A CD2 1 
ATOM   7245  N  NE1 . TRP A  1  955  ? 162.332 202.091 198.641 1.00   165.07 ? 1386 TRP A NE1 1 
ATOM   7246  C  CE2 . TRP A  1  955  ? 161.592 203.157 198.231 1.00   132.33 ? 1386 TRP A CE2 1 
ATOM   7247  C  CE3 . TRP A  1  955  ? 160.205 204.849 199.272 1.00   145.28 ? 1386 TRP A CE3 1 
ATOM   7248  C  CZ2 . TRP A  1  955  ? 161.429 203.683 196.948 1.00   117.42 ? 1386 TRP A CZ2 1 
ATOM   7249  C  CZ3 . TRP A  1  955  ? 160.024 205.379 197.993 1.00   179.78 ? 1386 TRP A CZ3 1 
ATOM   7250  C  CH2 . TRP A  1  955  ? 160.638 204.777 196.834 1.00   159.22 ? 1386 TRP A CH2 1 
ATOM   7251  N  N   . LEU A  1  956  ? 164.367 201.854 202.496 1.00   146.39 ? 1387 LEU A N   1 
ATOM   7252  C  CA  . LEU A  1  956  ? 165.401 200.801 202.550 1.00   159.44 ? 1387 LEU A CA  1 
ATOM   7253  C  C   . LEU A  1  956  ? 165.796 200.346 203.955 1.00   163.67 ? 1387 LEU A C   1 
ATOM   7254  O  O   . LEU A  1  956  ? 166.644 199.496 204.083 1.00   172.74 ? 1387 LEU A O   1 
ATOM   7255  C  CB  . LEU A  1  956  ? 166.696 201.337 201.883 1.00   153.47 ? 1387 LEU A CB  1 
ATOM   7256  C  CG  . LEU A  1  956  ? 167.495 200.505 200.877 1.00   150.38 ? 1387 LEU A CG  1 
ATOM   7257  C  CD1 . LEU A  1  956  ? 166.732 199.291 200.355 1.00   156.17 ? 1387 LEU A CD1 1 
ATOM   7258  C  CD2 . LEU A  1  956  ? 167.925 201.384 199.701 1.00   131.69 ? 1387 LEU A CD2 1 
ATOM   7259  N  N   . ARG A  1  957  ? 165.240 200.969 204.989 1.00   175.50 ? 1388 ARG A N   1 
ATOM   7260  C  CA  . ARG A  1  957  ? 165.612 200.734 206.379 1.00   163.17 ? 1388 ARG A CA  1 
ATOM   7261  C  C   . ARG A  1  957  ? 165.172 199.359 206.859 1.00   191.85 ? 1388 ARG A C   1 
ATOM   7262  O  O   . ARG A  1  957  ? 164.333 198.689 206.226 1.00   207.74 ? 1388 ARG A O   1 
ATOM   7263  C  CB  . ARG A  1  957  ? 164.966 201.824 207.235 1.00   165.81 ? 1388 ARG A CB  1 
ATOM   7264  C  CG  . ARG A  1  957  ? 165.560 202.002 208.600 1.00   191.88 ? 1388 ARG A CG  1 
ATOM   7265  C  CD  . ARG A  1  957  ? 164.984 203.217 209.329 1.00   207.78 ? 1388 ARG A CD  1 
ATOM   7266  N  NE  . ARG A  1  957  ? 166.050 203.927 210.037 1.00   251.84 ? 1388 ARG A NE  1 
ATOM   7267  C  CZ  . ARG A  1  957  ? 166.781 203.440 211.051 1.00   291.10 ? 1388 ARG A CZ  1 
ATOM   7268  N  NH1 . ARG A  1  957  ? 166.583 202.211 211.542 1.00   302.02 ? 1388 ARG A NH1 1 
ATOM   7269  N  NH2 . ARG A  1  957  ? 167.734 204.197 211.593 1.00   318.28 ? 1388 ARG A NH2 1 
ATOM   7270  N  N   . ALA A  1  958  ? 165.777 198.926 207.970 1.00   202.26 ? 1389 ALA A N   1 
ATOM   7271  C  CA  . ALA A  1  958  ? 165.407 197.667 208.656 1.00   203.75 ? 1389 ALA A CA  1 
ATOM   7272  C  C   . ALA A  1  958  ? 163.967 197.696 209.147 1.00   216.00 ? 1389 ALA A C   1 
ATOM   7273  O  O   . ALA A  1  958  ? 163.451 198.764 209.471 1.00   261.32 ? 1389 ALA A O   1 
ATOM   7274  C  CB  . ALA A  1  958  ? 166.346 197.399 209.823 1.00   181.95 ? 1389 ALA A CB  1 
ATOM   7275  N  N   . PRO A  1  959  ? 163.314 196.526 209.220 1.00   208.68 ? 1390 PRO A N   1 
ATOM   7276  C  CA  . PRO A  1  959  ? 161.857 196.518 209.420 1.00   228.60 ? 1390 PRO A CA  1 
ATOM   7277  C  C   . PRO A  1  959  ? 161.374 197.088 210.761 1.00   266.61 ? 1390 PRO A C   1 
ATOM   7278  O  O   . PRO A  1  959  ? 160.389 197.822 210.778 1.00   316.68 ? 1390 PRO A O   1 
ATOM   7279  C  CB  . PRO A  1  959  ? 161.491 195.049 209.276 1.00   193.34 ? 1390 PRO A CB  1 
ATOM   7280  C  CG  . PRO A  1  959  ? 162.727 194.337 209.641 1.00   181.76 ? 1390 PRO A CG  1 
ATOM   7281  C  CD  . PRO A  1  959  ? 163.864 195.165 209.153 1.00   176.28 ? 1390 PRO A CD  1 
ATOM   7282  N  N   . ASP A  1  960  ? 162.065 196.778 211.853 1.00   265.35 ? 1391 ASP A N   1 
ATOM   7283  C  CA  . ASP A  1  960  ? 161.731 197.302 213.193 1.00   245.35 ? 1391 ASP A CA  1 
ATOM   7284  C  C   . ASP A  1  960  ? 160.408 196.812 213.787 1.00   195.28 ? 1391 ASP A C   1 
ATOM   7285  O  O   . ASP A  1  960  ? 159.841 197.497 214.627 1.00   180.16 ? 1391 ASP A O   1 
ATOM   7286  C  CB  . ASP A  1  960  ? 161.739 198.852 213.252 1.00   271.28 ? 1391 ASP A CB  1 
ATOM   7287  C  CG  . ASP A  1  960  ? 163.045 199.461 212.797 1.00   307.39 ? 1391 ASP A CG  1 
ATOM   7288  O  OD1 . ASP A  1  960  ? 163.801 198.797 212.064 1.00   356.68 ? 1391 ASP A OD1 1 
ATOM   7289  O  OD2 . ASP A  1  960  ? 163.315 200.618 213.185 1.00   327.86 ? 1391 ASP A OD2 1 
ATOM   7290  N  N   . THR A  1  961  ? 159.908 195.650 213.372 1.00   177.57 ? 1392 THR A N   1 
ATOM   7291  C  CA  . THR A  1  961  ? 158.885 194.922 214.170 1.00   182.05 ? 1392 THR A CA  1 
ATOM   7292  C  C   . THR A  1  961  ? 159.129 193.445 214.018 1.00   168.32 ? 1392 THR A C   1 
ATOM   7293  O  O   . THR A  1  961  ? 159.550 193.023 212.943 1.00   206.44 ? 1392 THR A O   1 
ATOM   7294  C  CB  . THR A  1  961  ? 157.435 195.102 213.696 1.00   186.96 ? 1392 THR A CB  1 
ATOM   7295  O  OG1 . THR A  1  961  ? 157.110 194.061 212.758 1.00   168.44 ? 1392 THR A OG1 1 
ATOM   7296  C  CG2 . THR A  1  961  ? 157.195 196.478 213.063 1.00   208.15 ? 1392 THR A CG2 1 
ATOM   7297  N  N   . MET A  1  962  ? 158.822 192.648 215.037 1.00   138.57 ? 1393 MET A N   1 
ATOM   7298  C  CA  . MET A  1  962  ? 159.087 191.196 214.928 1.00   164.09 ? 1393 MET A CA  1 
ATOM   7299  C  C   . MET A  1  962  ? 158.332 190.452 213.759 1.00   164.92 ? 1393 MET A C   1 
ATOM   7300  O  O   . MET A  1  962  ? 158.865 189.516 213.128 1.00   149.54 ? 1393 MET A O   1 
ATOM   7301  C  CB  . MET A  1  962  ? 158.867 190.517 216.286 1.00   157.88 ? 1393 MET A CB  1 
ATOM   7302  N  N   . TYR A  1  963  ? 157.119 190.897 213.461 1.00   157.03 ? 1394 TYR A N   1 
ATOM   7303  C  CA  . TYR A  1  963  ? 156.338 190.315 212.372 1.00   179.21 ? 1394 TYR A CA  1 
ATOM   7304  C  C   . TYR A  1  963  ? 156.820 190.794 210.987 1.00   180.24 ? 1394 TYR A C   1 
ATOM   7305  O  O   . TYR A  1  963  ? 156.624 190.117 209.971 1.00   188.55 ? 1394 TYR A O   1 
ATOM   7306  C  CB  . TYR A  1  963  ? 154.847 190.603 212.594 1.00   187.01 ? 1394 TYR A CB  1 
ATOM   7307  C  CG  . TYR A  1  963  ? 153.984 190.352 211.394 1.00   190.61 ? 1394 TYR A CG  1 
ATOM   7308  C  CD1 . TYR A  1  963  ? 153.852 191.327 210.397 1.00   172.10 ? 1394 TYR A CD1 1 
ATOM   7309  C  CD2 . TYR A  1  963  ? 153.305 189.134 211.240 1.00   205.95 ? 1394 TYR A CD2 1 
ATOM   7310  C  CE1 . TYR A  1  963  ? 153.073 191.099 209.287 1.00   194.12 ? 1394 TYR A CE1 1 
ATOM   7311  C  CE2 . TYR A  1  963  ? 152.507 188.899 210.128 1.00   226.22 ? 1394 TYR A CE2 1 
ATOM   7312  C  CZ  . TYR A  1  963  ? 152.393 189.884 209.152 1.00   227.84 ? 1394 TYR A CZ  1 
ATOM   7313  O  OH  . TYR A  1  963  ? 151.606 189.659 208.044 1.00   241.07 ? 1394 TYR A OH  1 
ATOM   7314  N  N   . LEU A  1  964  ? 157.435 191.965 210.935 1.00   174.42 ? 1395 LEU A N   1 
ATOM   7315  C  CA  . LEU A  1  964  ? 157.982 192.442 209.676 1.00   187.64 ? 1395 LEU A CA  1 
ATOM   7316  C  C   . LEU A  1  964  ? 159.304 191.747 209.359 1.00   180.17 ? 1395 LEU A C   1 
ATOM   7317  O  O   . LEU A  1  964  ? 159.531 191.407 208.210 1.00   165.48 ? 1395 LEU A O   1 
ATOM   7318  C  CB  . LEU A  1  964  ? 158.121 193.958 209.663 1.00   194.26 ? 1395 LEU A CB  1 
ATOM   7319  C  CG  . LEU A  1  964  ? 156.792 194.712 209.633 1.00   212.14 ? 1395 LEU A CG  1 
ATOM   7320  C  CD1 . LEU A  1  964  ? 157.092 196.197 209.465 1.00   227.85 ? 1395 LEU A CD1 1 
ATOM   7321  C  CD2 . LEU A  1  964  ? 155.844 194.205 208.543 1.00   210.38 ? 1395 LEU A CD2 1 
ATOM   7322  N  N   . LEU A  1  965  ? 160.158 191.503 210.355 1.00   159.73 ? 1396 LEU A N   1 
ATOM   7323  C  CA  . LEU A  1  965  ? 161.370 190.738 210.136 1.00   127.91 ? 1396 LEU A CA  1 
ATOM   7324  C  C   . LEU A  1  965  ? 161.021 189.377 209.567 1.00   151.25 ? 1396 LEU A C   1 
ATOM   7325  O  O   . LEU A  1  965  ? 161.842 188.842 208.838 1.00   218.08 ? 1396 LEU A O   1 
ATOM   7326  C  CB  . LEU A  1  965  ? 162.186 190.550 211.407 1.00   135.99 ? 1396 LEU A CB  1 
ATOM   7327  C  CG  . LEU A  1  965  ? 162.933 191.759 211.985 1.00   147.90 ? 1396 LEU A CG  1 
ATOM   7328  C  CD1 . LEU A  1  965  ? 163.295 191.507 213.436 1.00   160.09 ? 1396 LEU A CD1 1 
ATOM   7329  C  CD2 . LEU A  1  965  ? 164.202 192.059 211.218 1.00   169.13 ? 1396 LEU A CD2 1 
ATOM   7330  N  N   . ASP A  1  966  ? 159.846 188.810 209.876 1.00   127.56 ? 1397 ASP A N   1 
ATOM   7331  C  CA  . ASP A  1  966  ? 159.402 187.575 209.184 1.00   150.52 ? 1397 ASP A CA  1 
ATOM   7332  C  C   . ASP A  1  966  ? 159.196 187.737 207.660 1.00   140.87 ? 1397 ASP A C   1 
ATOM   7333  O  O   . ASP A  1  966  ? 159.461 186.808 206.933 1.00   149.90 ? 1397 ASP A O   1 
ATOM   7334  C  CB  . ASP A  1  966  ? 158.143 186.936 209.823 1.00   211.97 ? 1397 ASP A CB  1 
ATOM   7335  C  CG  . ASP A  1  966  ? 158.459 186.082 211.068 1.00   259.45 ? 1397 ASP A CG  1 
ATOM   7336  O  OD1 . ASP A  1  966  ? 159.355 186.486 211.843 1.00   326.58 ? 1397 ASP A OD1 1 
ATOM   7337  O  OD2 . ASP A  1  966  ? 157.802 185.022 211.278 1.00   243.90 ? 1397 ASP A OD2 1 
ATOM   7338  N  N   . PHE A  1  967  ? 158.737 188.886 207.167 1.00   165.26 ? 1398 PHE A N   1 
ATOM   7339  C  CA  . PHE A  1  967  ? 158.697 189.127 205.694 1.00   187.90 ? 1398 PHE A CA  1 
ATOM   7340  C  C   . PHE A  1  967  ? 160.077 189.121 205.032 1.00   179.21 ? 1398 PHE A C   1 
ATOM   7341  O  O   . PHE A  1  967  ? 160.242 188.677 203.886 1.00   177.63 ? 1398 PHE A O   1 
ATOM   7342  C  CB  . PHE A  1  967  ? 158.009 190.462 205.354 1.00   192.61 ? 1398 PHE A CB  1 
ATOM   7343  C  CG  . PHE A  1  967  ? 156.527 190.371 205.327 1.00   198.88 ? 1398 PHE A CG  1 
ATOM   7344  C  CD1 . PHE A  1  967  ? 155.896 189.520 204.419 1.00   198.07 ? 1398 PHE A CD1 1 
ATOM   7345  C  CD2 . PHE A  1  967  ? 155.756 191.112 206.207 1.00   227.84 ? 1398 PHE A CD2 1 
ATOM   7346  C  CE1 . PHE A  1  967  ? 154.521 189.408 204.388 1.00   218.81 ? 1398 PHE A CE1 1 
ATOM   7347  C  CE2 . PHE A  1  967  ? 154.375 191.008 206.181 1.00   264.14 ? 1398 PHE A CE2 1 
ATOM   7348  C  CZ  . PHE A  1  967  ? 153.755 190.155 205.274 1.00   266.81 ? 1398 PHE A CZ  1 
ATOM   7349  N  N   . VAL A  1  968  ? 161.053 189.641 205.759 1.00   176.75 ? 1399 VAL A N   1 
ATOM   7350  C  CA  . VAL A  1  968  ? 162.401 189.795 205.243 1.00   177.60 ? 1399 VAL A CA  1 
ATOM   7351  C  C   . VAL A  1  968  ? 163.240 188.521 205.452 1.00   194.59 ? 1399 VAL A C   1 
ATOM   7352  O  O   . VAL A  1  968  ? 163.487 188.080 206.594 1.00   213.34 ? 1399 VAL A O   1 
ATOM   7353  C  CB  . VAL A  1  968  ? 163.072 191.031 205.884 1.00   170.51 ? 1399 VAL A CB  1 
ATOM   7354  C  CG1 . VAL A  1  968  ? 164.549 191.135 205.547 1.00   165.74 ? 1399 VAL A CG1 1 
ATOM   7355  C  CG2 . VAL A  1  968  ? 162.352 192.277 205.413 1.00   200.47 ? 1399 VAL A CG2 1 
ATOM   7356  N  N   . LYS A  1  969  ? 163.707 187.954 204.336 1.00   164.28 ? 1400 LYS A N   1 
ATOM   7357  C  CA  . LYS A  1  969  ? 164.764 186.946 204.378 1.00   156.98 ? 1400 LYS A CA  1 
ATOM   7358  C  C   . LYS A  1  969  ? 165.998 187.585 205.029 1.00   161.44 ? 1400 LYS A C   1 
ATOM   7359  O  O   . LYS A  1  969  ? 166.376 188.693 204.658 1.00   210.30 ? 1400 LYS A O   1 
ATOM   7360  C  CB  . LYS A  1  969  ? 165.120 186.509 202.968 1.00   156.58 ? 1400 LYS A CB  1 
ATOM   7361  C  CG  . LYS A  1  969  ? 165.369 185.034 202.765 1.00   144.69 ? 1400 LYS A CG  1 
ATOM   7362  C  CD  . LYS A  1  969  ? 164.726 184.699 201.428 1.00   178.66 ? 1400 LYS A CD  1 
ATOM   7363  C  CE  . LYS A  1  969  ? 164.834 183.237 201.073 1.00   224.51 ? 1400 LYS A CE  1 
ATOM   7364  N  NZ  . LYS A  1  969  ? 164.061 182.811 199.866 1.00   249.03 ? 1400 LYS A NZ  1 
ATOM   7365  N  N   . PRO A  1  970  ? 166.615 186.915 206.018 1.00   163.69 ? 1401 PRO A N   1 
ATOM   7366  C  CA  . PRO A  1  970  ? 167.708 187.587 206.722 1.00   152.73 ? 1401 PRO A CA  1 
ATOM   7367  C  C   . PRO A  1  970  ? 168.975 187.746 205.868 1.00   149.89 ? 1401 PRO A C   1 
ATOM   7368  O  O   . PRO A  1  970  ? 169.759 188.635 206.128 1.00   153.06 ? 1401 PRO A O   1 
ATOM   7369  C  CB  . PRO A  1  970  ? 167.951 186.702 207.949 1.00   155.41 ? 1401 PRO A CB  1 
ATOM   7370  C  CG  . PRO A  1  970  ? 167.536 185.356 207.513 1.00   172.76 ? 1401 PRO A CG  1 
ATOM   7371  C  CD  . PRO A  1  970  ? 166.519 185.497 206.402 1.00   183.95 ? 1401 PRO A CD  1 
ATOM   7372  N  N   . GLU A  1  971  ? 169.160 186.910 204.850 1.00   163.88 ? 1402 GLU A N   1 
ATOM   7373  C  CA  . GLU A  1  971  ? 170.202 187.122 203.850 1.00   152.70 ? 1402 GLU A CA  1 
ATOM   7374  C  C   . GLU A  1  971  ? 170.054 188.502 203.128 1.00   151.52 ? 1402 GLU A C   1 
ATOM   7375  O  O   . GLU A  1  971  ? 170.992 189.280 203.096 1.00   150.87 ? 1402 GLU A O   1 
ATOM   7376  C  CB  . GLU A  1  971  ? 170.171 185.958 202.854 1.00   145.45 ? 1402 GLU A CB  1 
ATOM   7377  N  N   . PHE A  1  972  ? 168.871 188.815 202.596 1.00   147.46 ? 1403 PHE A N   1 
ATOM   7378  C  CA  . PHE A  1  972  ? 168.625 190.127 201.944 1.00   130.24 ? 1403 PHE A CA  1 
ATOM   7379  C  C   . PHE A  1  972  ? 168.632 191.293 202.927 1.00   124.01 ? 1403 PHE A C   1 
ATOM   7380  O  O   . PHE A  1  972  ? 168.726 192.450 202.542 1.00   141.11 ? 1403 PHE A O   1 
ATOM   7381  C  CB  . PHE A  1  972  ? 167.307 190.196 201.173 1.00   119.33 ? 1403 PHE A CB  1 
ATOM   7382  C  CG  . PHE A  1  972  ? 167.089 189.068 200.220 1.00   152.65 ? 1403 PHE A CG  1 
ATOM   7383  C  CD1 . PHE A  1  972  ? 168.166 188.407 199.599 1.00   164.60 ? 1403 PHE A CD1 1 
ATOM   7384  C  CD2 . PHE A  1  972  ? 165.772 188.661 199.925 1.00   173.71 ? 1403 PHE A CD2 1 
ATOM   7385  C  CE1 . PHE A  1  972  ? 167.931 187.356 198.724 1.00   185.80 ? 1403 PHE A CE1 1 
ATOM   7386  C  CE2 . PHE A  1  972  ? 165.533 187.620 199.037 1.00   175.68 ? 1403 PHE A CE2 1 
ATOM   7387  C  CZ  . PHE A  1  972  ? 166.615 186.965 198.440 1.00   192.89 ? 1403 PHE A CZ  1 
ATOM   7388  N  N   . LEU A  1  973  ? 168.477 190.994 204.199 1.00   126.48 ? 1404 LEU A N   1 
ATOM   7389  C  CA  . LEU A  1  973  ? 168.677 191.977 205.237 1.00   132.26 ? 1404 LEU A CA  1 
ATOM   7390  C  C   . LEU A  1  973  ? 170.091 192.518 205.187 1.00   129.66 ? 1404 LEU A C   1 
ATOM   7391  O  O   . LEU A  1  973  ? 170.311 193.701 205.423 1.00   138.17 ? 1404 LEU A O   1 
ATOM   7392  C  CB  . LEU A  1  973  ? 168.448 191.351 206.611 1.00   138.23 ? 1404 LEU A CB  1 
ATOM   7393  C  CG  . LEU A  1  973  ? 167.446 192.056 207.492 1.00   136.01 ? 1404 LEU A CG  1 
ATOM   7394  C  CD1 . LEU A  1  973  ? 167.437 191.299 208.803 1.00   135.54 ? 1404 LEU A CD1 1 
ATOM   7395  C  CD2 . LEU A  1  973  ? 167.772 193.534 207.651 1.00   146.27 ? 1404 LEU A CD2 1 
ATOM   7396  N  N   . LEU A  1  974  ? 171.050 191.644 204.911 1.00   137.41 ? 1405 LEU A N   1 
ATOM   7397  C  CA  . LEU A  1  974  ? 172.445 192.056 204.756 1.00   142.39 ? 1405 LEU A CA  1 
ATOM   7398  C  C   . LEU A  1  974  ? 172.599 193.077 203.655 1.00   139.61 ? 1405 LEU A C   1 
ATOM   7399  O  O   . LEU A  1  974  ? 173.000 194.220 203.947 1.00   146.29 ? 1405 LEU A O   1 
ATOM   7400  C  CB  . LEU A  1  974  ? 173.343 190.842 204.507 1.00   132.18 ? 1405 LEU A CB  1 
ATOM   7401  C  CG  . LEU A  1  974  ? 174.788 190.904 204.009 1.00   117.74 ? 1405 LEU A CG  1 
ATOM   7402  C  CD1 . LEU A  1  974  ? 175.483 192.211 204.172 1.00   119.59 ? 1405 LEU A CD1 1 
ATOM   7403  C  CD2 . LEU A  1  974  ? 175.566 189.853 204.772 1.00   142.62 ? 1405 LEU A CD2 1 
ATOM   7404  N  N   . LEU A  1  975  ? 172.308 192.671 202.417 1.00   122.69 ? 1406 LEU A N   1 
ATOM   7405  C  CA  . LEU A  1  975  ? 172.330 193.599 201.285 1.00   123.58 ? 1406 LEU A CA  1 
ATOM   7406  C  C   . LEU A  1  975  ? 171.627 194.889 201.609 1.00   138.13 ? 1406 LEU A C   1 
ATOM   7407  O  O   . LEU A  1  975  ? 172.168 195.948 201.359 1.00   162.90 ? 1406 LEU A O   1 
ATOM   7408  C  CB  . LEU A  1  975  ? 171.604 193.046 200.087 1.00   126.57 ? 1406 LEU A CB  1 
ATOM   7409  C  CG  . LEU A  1  975  ? 172.364 192.080 199.224 1.00   144.56 ? 1406 LEU A CG  1 
ATOM   7410  C  CD1 . LEU A  1  975  ? 171.388 191.233 198.396 1.00   152.94 ? 1406 LEU A CD1 1 
ATOM   7411  C  CD2 . LEU A  1  975  ? 173.335 192.883 198.359 1.00   160.96 ? 1406 LEU A CD2 1 
ATOM   7412  N  N   . ARG A  1  976  ? 170.407 194.800 202.124 1.00   136.93 ? 1407 ARG A N   1 
ATOM   7413  C  CA  . ARG A  1  976  ? 169.599 195.970 202.412 1.00   129.72 ? 1407 ARG A CA  1 
ATOM   7414  C  C   . ARG A  1  976  ? 170.304 196.929 203.421 1.00   123.09 ? 1407 ARG A C   1 
ATOM   7415  O  O   . ARG A  1  976  ? 170.350 198.130 203.224 1.00   122.99 ? 1407 ARG A O   1 
ATOM   7416  C  CB  . ARG A  1  976  ? 168.236 195.486 202.895 1.00   131.67 ? 1407 ARG A CB  1 
ATOM   7417  C  CG  . ARG A  1  976  ? 167.292 196.589 203.299 1.00   153.23 ? 1407 ARG A CG  1 
ATOM   7418  C  CD  . ARG A  1  976  ? 165.928 196.076 203.650 1.00   158.61 ? 1407 ARG A CD  1 
ATOM   7419  N  NE  . ARG A  1  976  ? 165.399 195.268 202.562 1.00   170.61 ? 1407 ARG A NE  1 
ATOM   7420  C  CZ  . ARG A  1  976  ? 164.146 194.836 202.511 1.00   208.12 ? 1407 ARG A CZ  1 
ATOM   7421  N  NH1 . ARG A  1  976  ? 163.266 195.171 203.459 1.00   250.84 ? 1407 ARG A NH1 1 
ATOM   7422  N  NH2 . ARG A  1  976  ? 163.753 194.078 201.489 1.00   196.97 ? 1407 ARG A NH2 1 
ATOM   7423  N  N   . THR A  1  977  ? 170.898 196.396 204.474 1.00   129.65 ? 1408 THR A N   1 
ATOM   7424  C  CA  . THR A  1  977  ? 171.574 197.267 205.417 1.00   131.95 ? 1408 THR A CA  1 
ATOM   7425  C  C   . THR A  1  977  ? 172.678 197.970 204.732 1.00   127.41 ? 1408 THR A C   1 
ATOM   7426  O  O   . THR A  1  977  ? 172.921 199.113 205.034 1.00   139.95 ? 1408 THR A O   1 
ATOM   7427  C  CB  . THR A  1  977  ? 172.307 196.542 206.539 1.00   151.40 ? 1408 THR A CB  1 
ATOM   7428  O  OG1 . THR A  1  977  ? 171.595 195.353 206.909 1.00   163.53 ? 1408 THR A OG1 1 
ATOM   7429  C  CG2 . THR A  1  977  ? 172.508 197.525 207.728 1.00   152.39 ? 1408 THR A CG2 1 
ATOM   7430  N  N   . LEU A  1  978  ? 173.384 197.252 203.864 1.00   125.64 ? 1409 LEU A N   1 
ATOM   7431  C  CA  . LEU A  1  978  ? 174.512 197.775 203.128 1.00   132.35 ? 1409 LEU A CA  1 
ATOM   7432  C  C   . LEU A  1  978  ? 174.039 198.862 202.218 1.00   139.87 ? 1409 LEU A C   1 
ATOM   7433  O  O   . LEU A  1  978  ? 174.645 199.931 202.157 1.00   165.85 ? 1409 LEU A O   1 
ATOM   7434  C  CB  . LEU A  1  978  ? 175.085 196.685 202.276 1.00   129.46 ? 1409 LEU A CB  1 
ATOM   7435  C  CG  . LEU A  1  978  ? 176.374 196.883 201.514 1.00   135.14 ? 1409 LEU A CG  1 
ATOM   7436  C  CD1 . LEU A  1  978  ? 176.448 195.666 200.589 1.00   175.55 ? 1409 LEU A CD1 1 
ATOM   7437  C  CD2 . LEU A  1  978  ? 176.558 198.154 200.710 1.00   133.89 ? 1409 LEU A CD2 1 
ATOM   7438  N  N   . ALA A  1  979  ? 172.971 198.579 201.482 1.00   125.38 ? 1410 ALA A N   1 
ATOM   7439  C  CA  . ALA A  1  979  ? 172.465 199.548 200.508 1.00   133.44 ? 1410 ALA A CA  1 
ATOM   7440  C  C   . ALA A  1  979  ? 172.150 200.865 201.216 1.00   115.52 ? 1410 ALA A C   1 
ATOM   7441  O  O   . ALA A  1  979  ? 172.525 201.941 200.775 1.00   107.06 ? 1410 ALA A O   1 
ATOM   7442  C  CB  . ALA A  1  979  ? 171.242 199.018 199.760 1.00   122.62 ? 1410 ALA A CB  1 
ATOM   7443  N  N   . ARG A  1  980  ? 171.483 200.768 202.344 1.00   113.33 ? 1411 ARG A N   1 
ATOM   7444  C  CA  . ARG A  1  980  ? 171.132 201.958 203.051 1.00   127.50 ? 1411 ARG A CA  1 
ATOM   7445  C  C   . ARG A  1  980  ? 172.375 202.790 203.358 1.00   110.90 ? 1411 ARG A C   1 
ATOM   7446  O  O   . ARG A  1  980  ? 172.389 203.976 203.152 1.00   138.07 ? 1411 ARG A O   1 
ATOM   7447  C  CB  . ARG A  1  980  ? 170.355 201.616 204.313 1.00   149.74 ? 1411 ARG A CB  1 
ATOM   7448  C  CG  . ARG A  1  980  ? 169.671 202.829 204.872 1.00   156.39 ? 1411 ARG A CG  1 
ATOM   7449  C  CD  . ARG A  1  980  ? 168.829 202.527 206.080 1.00   164.82 ? 1411 ARG A CD  1 
ATOM   7450  N  NE  . ARG A  1  980  ? 168.745 203.742 206.869 1.00   176.42 ? 1411 ARG A NE  1 
ATOM   7451  C  CZ  . ARG A  1  980  ? 169.716 204.214 207.648 1.00   194.86 ? 1411 ARG A CZ  1 
ATOM   7452  N  NH1 . ARG A  1  980  ? 170.887 203.552 207.782 1.00   169.92 ? 1411 ARG A NH1 1 
ATOM   7453  N  NH2 . ARG A  1  980  ? 169.507 205.365 208.299 1.00   201.56 ? 1411 ARG A NH2 1 
ATOM   7454  N  N   . CYS A  1  981  ? 173.420 202.153 203.819 1.00   117.74 ? 1412 CYS A N   1 
ATOM   7455  C  CA  . CYS A  1  981  ? 174.596 202.872 204.241 1.00   138.66 ? 1412 CYS A CA  1 
ATOM   7456  C  C   . CYS A  1  981  ? 175.335 203.412 203.036 1.00   136.35 ? 1412 CYS A C   1 
ATOM   7457  O  O   . CYS A  1  981  ? 175.859 204.523 203.117 1.00   155.65 ? 1412 CYS A O   1 
ATOM   7458  C  CB  . CYS A  1  981  ? 175.467 201.969 205.084 1.00   162.09 ? 1412 CYS A CB  1 
ATOM   7459  S  SG  . CYS A  1  981  ? 174.537 201.202 206.424 1.00   225.01 ? 1412 CYS A SG  1 
ATOM   7460  N  N   . LEU A  1  982  ? 175.337 202.697 201.904 1.00   113.26 ? 1413 LEU A N   1 
ATOM   7461  C  CA  . LEU A  1  982  ? 175.898 203.332 200.664 1.00   140.52 ? 1413 LEU A CA  1 
ATOM   7462  C  C   . LEU A  1  982  ? 175.217 204.653 200.327 1.00   142.37 ? 1413 LEU A C   1 
ATOM   7463  O  O   . LEU A  1  982  ? 175.849 205.608 199.940 1.00   163.31 ? 1413 LEU A O   1 
ATOM   7464  C  CB  . LEU A  1  982  ? 175.826 202.458 199.393 1.00   130.91 ? 1413 LEU A CB  1 
ATOM   7465  C  CG  . LEU A  1  982  ? 176.796 201.281 199.227 1.00   152.70 ? 1413 LEU A CG  1 
ATOM   7466  C  CD1 . LEU A  1  982  ? 177.085 201.039 197.748 1.00   143.87 ? 1413 LEU A CD1 1 
ATOM   7467  C  CD2 . LEU A  1  982  ? 178.102 201.430 200.015 1.00   148.35 ? 1413 LEU A CD2 1 
ATOM   7468  N  N   . ILE A  1  983  ? 173.915 204.680 200.483 1.00   138.20 ? 1414 ILE A N   1 
ATOM   7469  C  CA  . ILE A  1  983  ? 173.139 205.844 200.188 1.00   102.90 ? 1414 ILE A CA  1 
ATOM   7470  C  C   . ILE A  1  983  ? 173.426 206.934 201.163 1.00   107.40 ? 1414 ILE A C   1 
ATOM   7471  O  O   . ILE A  1  983  ? 173.498 208.066 200.760 1.00   152.00 ? 1414 ILE A O   1 
ATOM   7472  C  CB  . ILE A  1  983  ? 171.670 205.490 200.274 1.00   104.42 ? 1414 ILE A CB  1 
ATOM   7473  C  CG1 . ILE A  1  983  ? 171.355 204.509 199.133 1.00   101.92 ? 1414 ILE A CG1 1 
ATOM   7474  C  CG2 . ILE A  1  983  ? 170.853 206.754 200.250 1.00   131.75 ? 1414 ILE A CG2 1 
ATOM   7475  C  CD1 . ILE A  1  983  ? 169.907 204.340 198.793 1.00   113.20 ? 1414 ILE A CD1 1 
ATOM   7476  N  N   . LEU A  1  984  ? 173.580 206.619 202.440 1.00   121.71 ? 1415 LEU A N   1 
ATOM   7477  C  CA  . LEU A  1  984  ? 173.920 207.624 203.445 1.00   137.80 ? 1415 LEU A CA  1 
ATOM   7478  C  C   . LEU A  1  984  ? 175.409 207.569 203.644 1.00   152.72 ? 1415 LEU A C   1 
ATOM   7479  O  O   . LEU A  1  984  ? 175.905 207.094 204.667 1.00   213.04 ? 1415 LEU A O   1 
ATOM   7480  C  CB  . LEU A  1  984  ? 173.188 207.322 204.744 1.00   136.88 ? 1415 LEU A CB  1 
ATOM   7481  C  CG  . LEU A  1  984  ? 171.697 207.111 204.580 1.00   160.66 ? 1415 LEU A CG  1 
ATOM   7482  C  CD1 . LEU A  1  984  ? 171.062 206.936 205.953 1.00   185.95 ? 1415 LEU A CD1 1 
ATOM   7483  C  CD2 . LEU A  1  984  ? 171.063 208.282 203.841 1.00   189.35 ? 1415 LEU A CD2 1 
ATOM   7484  N  N   . TRP A  1  985  ? 176.128 208.058 202.655 1.00   130.61 ? 1416 TRP A N   1 
ATOM   7485  C  CA  . TRP A  1  985  ? 177.574 207.937 202.628 1.00   146.27 ? 1416 TRP A CA  1 
ATOM   7486  C  C   . TRP A  1  985  ? 178.226 208.788 203.711 1.00   153.12 ? 1416 TRP A C   1 
ATOM   7487  O  O   . TRP A  1  985  ? 179.145 208.374 204.428 1.00   148.33 ? 1416 TRP A O   1 
ATOM   7488  C  CB  . TRP A  1  985  ? 178.059 208.395 201.260 1.00   159.79 ? 1416 TRP A CB  1 
ATOM   7489  C  CG  . TRP A  1  985  ? 179.443 208.104 201.013 1.00   155.31 ? 1416 TRP A CG  1 
ATOM   7490  C  CD1 . TRP A  1  985  ? 180.491 208.974 201.066 1.00   171.92 ? 1416 TRP A CD1 1 
ATOM   7491  C  CD2 . TRP A  1  985  ? 179.964 206.858 200.641 1.00   131.36 ? 1416 TRP A CD2 1 
ATOM   7492  N  NE1 . TRP A  1  985  ? 181.645 208.316 200.771 1.00   170.41 ? 1416 TRP A NE1 1 
ATOM   7493  C  CE2 . TRP A  1  985  ? 181.344 207.004 200.517 1.00   142.09 ? 1416 TRP A CE2 1 
ATOM   7494  C  CE3 . TRP A  1  985  ? 179.407 205.608 200.453 1.00   151.19 ? 1416 TRP A CE3 1 
ATOM   7495  C  CZ2 . TRP A  1  985  ? 182.164 205.958 200.184 1.00   134.88 ? 1416 TRP A CZ2 1 
ATOM   7496  C  CZ3 . TRP A  1  985  ? 180.232 204.568 200.139 1.00   161.37 ? 1416 TRP A CZ3 1 
ATOM   7497  C  CH2 . TRP A  1  985  ? 181.592 204.750 200.002 1.00   138.28 ? 1416 TRP A CH2 1 
ATOM   7498  N  N   . ASP A  1  986  ? 177.720 209.996 203.816 1.00   156.66 ? 1417 ASP A N   1 
ATOM   7499  C  CA  . ASP A  1  986  ? 178.337 210.958 204.683 1.00   175.47 ? 1417 ASP A CA  1 
ATOM   7500  C  C   . ASP A  1  986  ? 178.148 210.489 206.108 1.00   165.83 ? 1417 ASP A C   1 
ATOM   7501  O  O   . ASP A  1  986  ? 179.042 210.676 206.937 1.00   180.19 ? 1417 ASP A O   1 
ATOM   7502  C  CB  . ASP A  1  986  ? 177.728 212.337 204.459 1.00   209.07 ? 1417 ASP A CB  1 
ATOM   7503  C  CG  . ASP A  1  986  ? 177.736 212.744 202.992 1.00   235.02 ? 1417 ASP A CG  1 
ATOM   7504  O  OD1 . ASP A  1  986  ? 178.366 212.024 202.176 1.00   231.06 ? 1417 ASP A OD1 1 
ATOM   7505  O  OD2 . ASP A  1  986  ? 177.097 213.769 202.664 1.00   281.04 ? 1417 ASP A OD2 1 
ATOM   7506  N  N   . ASP A  1  987  ? 177.005 209.848 206.368 1.00   139.09 ? 1418 ASP A N   1 
ATOM   7507  C  CA  . ASP A  1  987  ? 176.631 209.475 207.712 1.00   142.46 ? 1418 ASP A CA  1 
ATOM   7508  C  C   . ASP A  1  987  ? 177.447 208.321 208.284 1.00   169.02 ? 1418 ASP A C   1 
ATOM   7509  O  O   . ASP A  1  987  ? 177.431 208.154 209.491 1.00   208.37 ? 1418 ASP A O   1 
ATOM   7510  C  CB  . ASP A  1  987  ? 175.140 209.161 207.790 1.00   159.81 ? 1418 ASP A CB  1 
ATOM   7511  N  N   . ILE A  1  988  ? 178.196 207.559 207.475 1.00   173.17 ? 1419 ILE A N   1 
ATOM   7512  C  CA  . ILE A  1  988  ? 179.048 206.481 208.021 1.00   160.00 ? 1419 ILE A CA  1 
ATOM   7513  C  C   . ILE A  1  988  ? 180.150 207.024 208.971 1.00   158.24 ? 1419 ILE A C   1 
ATOM   7514  O  O   . ILE A  1  988  ? 180.845 208.017 208.692 1.00   154.62 ? 1419 ILE A O   1 
ATOM   7515  C  CB  . ILE A  1  988  ? 179.701 205.585 206.937 1.00   146.59 ? 1419 ILE A CB  1 
ATOM   7516  C  CG1 . ILE A  1  988  ? 178.636 204.969 206.001 1.00   154.31 ? 1419 ILE A CG1 1 
ATOM   7517  C  CG2 . ILE A  1  988  ? 180.513 204.464 207.598 1.00   131.94 ? 1419 ILE A CG2 1 
ATOM   7518  C  CD1 . ILE A  1  988  ? 179.158 204.511 204.651 1.00   146.56 ? 1419 ILE A CD1 1 
ATOM   7519  N  N   . LEU A  1  989  ? 180.290 206.357 210.106 1.00   154.97 ? 1420 LEU A N   1 
ATOM   7520  C  CA  . LEU A  1  989  ? 181.356 206.639 211.053 1.00   172.82 ? 1420 LEU A CA  1 
ATOM   7521  C  C   . LEU A  1  989  ? 182.137 205.352 211.268 1.00   183.01 ? 1420 LEU A C   1 
ATOM   7522  O  O   . LEU A  1  989  ? 181.544 204.271 211.344 1.00   167.84 ? 1420 LEU A O   1 
ATOM   7523  C  CB  . LEU A  1  989  ? 180.815 207.062 212.415 1.00   193.35 ? 1420 LEU A CB  1 
ATOM   7524  C  CG  . LEU A  1  989  ? 180.614 208.538 212.700 1.00   194.54 ? 1420 LEU A CG  1 
ATOM   7525  C  CD1 . LEU A  1  989  ? 179.785 209.157 211.578 1.00   175.13 ? 1420 LEU A CD1 1 
ATOM   7526  C  CD2 . LEU A  1  989  ? 179.988 208.718 214.094 1.00   186.93 ? 1420 LEU A CD2 1 
ATOM   7527  N  N   . PRO A  1  990  ? 183.465 205.460 211.418 1.00   177.73 ? 1421 PRO A N   1 
ATOM   7528  C  CA  . PRO A  1  990  ? 184.233 204.251 211.716 1.00   168.68 ? 1421 PRO A CA  1 
ATOM   7529  C  C   . PRO A  1  990  ? 184.010 203.715 213.135 1.00   177.32 ? 1421 PRO A C   1 
ATOM   7530  O  O   . PRO A  1  990  ? 183.960 202.505 213.299 1.00   148.83 ? 1421 PRO A O   1 
ATOM   7531  C  CB  . PRO A  1  990  ? 185.690 204.673 211.505 1.00   179.58 ? 1421 PRO A CB  1 
ATOM   7532  C  CG  . PRO A  1  990  ? 185.663 206.095 211.062 1.00   197.63 ? 1421 PRO A CG  1 
ATOM   7533  C  CD  . PRO A  1  990  ? 184.317 206.658 211.363 1.00   177.61 ? 1421 PRO A CD  1 
ATOM   7534  N  N   . ASN A  1  991  ? 183.855 204.609 214.127 1.00   206.83 ? 1422 ASN A N   1 
ATOM   7535  C  CA  . ASN A  1  991  ? 183.510 204.246 215.522 1.00   204.08 ? 1422 ASN A CA  1 
ATOM   7536  C  C   . ASN A  1  991  ? 182.620 203.010 215.596 1.00   201.72 ? 1422 ASN A C   1 
ATOM   7537  O  O   . ASN A  1  991  ? 181.737 202.831 214.753 1.00   183.83 ? 1422 ASN A O   1 
ATOM   7538  C  CB  . ASN A  1  991  ? 182.810 205.416 216.242 1.00   182.62 ? 1422 ASN A CB  1 
ATOM   7539  N  N   . SER A  1  992  ? 182.876 202.151 216.577 1.00   199.14 ? 1423 SER A N   1 
ATOM   7540  C  CA  . SER A  1  992  ? 182.138 200.883 216.710 1.00   219.88 ? 1423 SER A CA  1 
ATOM   7541  C  C   . SER A  1  992  ? 180.652 201.104 216.945 1.00   217.43 ? 1423 SER A C   1 
ATOM   7542  O  O   . SER A  1  992  ? 179.846 200.294 216.485 1.00   167.64 ? 1423 SER A O   1 
ATOM   7543  C  CB  . SER A  1  992  ? 182.717 200.026 217.835 1.00   232.43 ? 1423 SER A CB  1 
ATOM   7544  O  OG  . SER A  1  992  ? 184.136 200.087 217.834 1.00   244.26 ? 1423 SER A OG  1 
ATOM   7545  N  N   . LYS A  1  993  ? 180.327 202.208 217.642 1.00   219.17 ? 1424 LYS A N   1 
ATOM   7546  C  CA  . LYS A  1  993  ? 178.959 202.718 217.853 1.00   212.29 ? 1424 LYS A CA  1 
ATOM   7547  C  C   . LYS A  1  993  ? 178.075 202.817 216.586 1.00   190.40 ? 1424 LYS A C   1 
ATOM   7548  O  O   . LYS A  1  993  ? 176.921 202.414 216.618 1.00   169.34 ? 1424 LYS A O   1 
ATOM   7549  C  CB  . LYS A  1  993  ? 179.005 204.084 218.573 1.00   214.35 ? 1424 LYS A CB  1 
ATOM   7550  C  CG  . LYS A  1  993  ? 177.640 204.763 218.789 1.00   237.79 ? 1424 LYS A CG  1 
ATOM   7551  C  CD  . LYS A  1  993  ? 176.643 203.900 219.565 1.00   276.06 ? 1424 LYS A CD  1 
ATOM   7552  C  CE  . LYS A  1  993  ? 175.340 203.605 218.807 1.00   287.21 ? 1424 LYS A CE  1 
ATOM   7553  N  NZ  . LYS A  1  993  ? 174.150 203.662 219.691 1.00   289.02 ? 1424 LYS A NZ  1 
ATOM   7554  N  N   . TRP A  1  994  ? 178.592 203.352 215.484 1.00   180.89 ? 1425 TRP A N   1 
ATOM   7555  C  CA  . TRP A  1  994  ? 177.775 203.450 214.258 1.00   161.41 ? 1425 TRP A CA  1 
ATOM   7556  C  C   . TRP A  1  994  ? 177.258 202.067 213.709 1.00   154.74 ? 1425 TRP A C   1 
ATOM   7557  O  O   . TRP A  1  994  ? 176.126 201.960 213.227 1.00   148.60 ? 1425 TRP A O   1 
ATOM   7558  C  CB  . TRP A  1  994  ? 178.526 204.224 213.181 1.00   128.02 ? 1425 TRP A CB  1 
ATOM   7559  C  CG  . TRP A  1  994  ? 177.788 204.295 211.896 1.00   126.59 ? 1425 TRP A CG  1 
ATOM   7560  C  CD1 . TRP A  1  994  ? 176.916 205.250 211.522 1.00   142.88 ? 1425 TRP A CD1 1 
ATOM   7561  C  CD2 . TRP A  1  994  ? 177.842 203.354 210.819 1.00   140.66 ? 1425 TRP A CD2 1 
ATOM   7562  N  NE1 . TRP A  1  994  ? 176.436 204.989 210.260 1.00   152.65 ? 1425 TRP A NE1 1 
ATOM   7563  C  CE2 . TRP A  1  994  ? 176.993 203.825 209.813 1.00   150.12 ? 1425 TRP A CE2 1 
ATOM   7564  C  CE3 . TRP A  1  994  ? 178.535 202.154 210.612 1.00   165.30 ? 1425 TRP A CE3 1 
ATOM   7565  C  CZ2 . TRP A  1  994  ? 176.816 203.147 208.614 1.00   171.97 ? 1425 TRP A CZ2 1 
ATOM   7566  C  CZ3 . TRP A  1  994  ? 178.369 201.480 209.428 1.00   146.34 ? 1425 TRP A CZ3 1 
ATOM   7567  C  CH2 . TRP A  1  994  ? 177.516 201.974 208.440 1.00   170.68 ? 1425 TRP A CH2 1 
ATOM   7568  N  N   . VAL A  1  995  ? 178.074 201.023 213.787 1.00   133.19 ? 1426 VAL A N   1 
ATOM   7569  C  CA  . VAL A  1  995  ? 177.652 199.708 213.337 1.00   153.48 ? 1426 VAL A CA  1 
ATOM   7570  C  C   . VAL A  1  995  ? 176.583 199.147 214.307 1.00   182.64 ? 1426 VAL A C   1 
ATOM   7571  O  O   . VAL A  1  995  ? 175.601 198.532 213.888 1.00   205.27 ? 1426 VAL A O   1 
ATOM   7572  C  CB  . VAL A  1  995  ? 178.878 198.748 213.148 1.00   165.65 ? 1426 VAL A CB  1 
ATOM   7573  C  CG1 . VAL A  1  995  ? 178.462 197.268 213.130 1.00   189.40 ? 1426 VAL A CG1 1 
ATOM   7574  C  CG2 . VAL A  1  995  ? 179.654 199.079 211.867 1.00   143.88 ? 1426 VAL A CG2 1 
ATOM   7575  N  N   . ASP A  1  996  ? 176.790 199.363 215.600 1.00   194.04 ? 1427 ASP A N   1 
ATOM   7576  C  CA  . ASP A  1  996  ? 175.837 198.956 216.634 1.00   207.99 ? 1427 ASP A CA  1 
ATOM   7577  C  C   . ASP A  1  996  ? 174.475 199.587 216.338 1.00   193.04 ? 1427 ASP A C   1 
ATOM   7578  O  O   . ASP A  1  996  ? 173.445 198.940 216.477 1.00   201.92 ? 1427 ASP A O   1 
ATOM   7579  C  CB  . ASP A  1  996  ? 176.328 199.407 218.033 1.00   264.54 ? 1427 ASP A CB  1 
ATOM   7580  C  CG  . ASP A  1  996  ? 177.848 199.170 218.263 1.00   303.62 ? 1427 ASP A CG  1 
ATOM   7581  O  OD1 . ASP A  1  996  ? 178.419 198.259 217.626 1.00   365.77 ? 1427 ASP A OD1 1 
ATOM   7582  O  OD2 . ASP A  1  996  ? 178.478 199.897 219.069 1.00   293.58 ? 1427 ASP A OD2 1 
ATOM   7583  N  N   . SER A  1  997  ? 174.510 200.855 215.921 1.00   199.60 ? 1428 SER A N   1 
ATOM   7584  C  CA  . SER A  1  997  ? 173.319 201.685 215.718 1.00   191.96 ? 1428 SER A CA  1 
ATOM   7585  C  C   . SER A  1  997  ? 172.361 201.125 214.690 1.00   170.44 ? 1428 SER A C   1 
ATOM   7586  O  O   . SER A  1  997  ? 171.156 201.369 214.783 1.00   186.86 ? 1428 SER A O   1 
ATOM   7587  C  CB  . SER A  1  997  ? 173.691 203.130 215.304 1.00   186.36 ? 1428 SER A CB  1 
ATOM   7588  O  OG  . SER A  1  997  ? 173.677 203.305 213.886 1.00   172.44 ? 1428 SER A OG  1 
ATOM   7589  N  N   . ASN A  1  998  ? 172.873 200.395 213.708 1.00   154.59 ? 1429 ASN A N   1 
ATOM   7590  C  CA  . ASN A  1  998  ? 172.016 199.972 212.600 1.00   168.11 ? 1429 ASN A CA  1 
ATOM   7591  C  C   . ASN A  1  998  ? 171.000 198.916 212.954 1.00   163.85 ? 1429 ASN A C   1 
ATOM   7592  O  O   . ASN A  1  998  ? 169.927 198.903 212.374 1.00   173.57 ? 1429 ASN A O   1 
ATOM   7593  C  CB  . ASN A  1  998  ? 172.827 199.560 211.374 1.00   172.24 ? 1429 ASN A CB  1 
ATOM   7594  C  CG  . ASN A  1  998  ? 173.414 200.759 210.660 1.00   187.10 ? 1429 ASN A CG  1 
ATOM   7595  O  OD1 . ASN A  1  998  ? 172.672 201.609 210.154 1.00   195.45 ? 1429 ASN A OD1 1 
ATOM   7596  N  ND2 . ASN A  1  998  ? 174.743 200.856 210.645 1.00   183.45 ? 1429 ASN A ND2 1 
ATOM   7597  N  N   . VAL A  1  999  ? 171.317 198.043 213.903 1.00   175.19 ? 1430 VAL A N   1 
ATOM   7598  C  CA  . VAL A  1  999  ? 170.335 197.059 214.361 1.00   176.69 ? 1430 VAL A CA  1 
ATOM   7599  C  C   . VAL A  1  999  ? 169.126 197.778 215.022 1.00   183.57 ? 1430 VAL A C   1 
ATOM   7600  O  O   . VAL A  1  999  ? 169.331 198.708 215.797 1.00   231.33 ? 1430 VAL A O   1 
ATOM   7601  C  CB  . VAL A  1  999  ? 170.987 195.991 215.273 1.00   174.62 ? 1430 VAL A CB  1 
ATOM   7602  C  CG1 . VAL A  1  999  ? 171.519 196.574 216.585 1.00   198.71 ? 1430 VAL A CG1 1 
ATOM   7603  C  CG2 . VAL A  1  999  ? 169.997 194.888 215.560 1.00   201.06 ? 1430 VAL A CG2 1 
ATOM   7604  N  N   . PRO A  1  1000 ? 167.869 197.393 214.682 1.00   169.57 ? 1431 PRO A N   1 
ATOM   7605  C  CA  . PRO A  1  1000 ? 166.717 198.010 215.337 1.00   175.29 ? 1431 PRO A CA  1 
ATOM   7606  C  C   . PRO A  1  1000 ? 166.488 197.475 216.748 1.00   198.65 ? 1431 PRO A C   1 
ATOM   7607  O  O   . PRO A  1  1000 ? 167.050 196.426 217.119 1.00   182.77 ? 1431 PRO A O   1 
ATOM   7608  C  CB  . PRO A  1  1000 ? 165.564 197.618 214.432 1.00   188.02 ? 1431 PRO A CB  1 
ATOM   7609  C  CG  . PRO A  1  1000 ? 165.975 196.310 213.843 1.00   169.61 ? 1431 PRO A CG  1 
ATOM   7610  C  CD  . PRO A  1  1000 ? 167.435 196.504 213.589 1.00   177.45 ? 1431 PRO A CD  1 
ATOM   7611  N  N   . GLN A  1  1001 ? 165.644 198.173 217.511 1.00   201.16 ? 1432 GLN A N   1 
ATOM   7612  C  CA  . GLN A  1  1001 ? 165.543 197.938 218.956 1.00   208.06 ? 1432 GLN A CA  1 
ATOM   7613  C  C   . GLN A  1  1001 ? 164.961 196.594 219.315 1.00   208.10 ? 1432 GLN A C   1 
ATOM   7614  O  O   . GLN A  1  1001 ? 165.474 195.927 220.222 1.00   224.63 ? 1432 GLN A O   1 
ATOM   7615  C  CB  . GLN A  1  1001 ? 164.785 199.078 219.649 1.00   218.85 ? 1432 GLN A CB  1 
ATOM   7616  C  CG  . GLN A  1  1001 ? 165.547 200.400 219.627 1.00   234.18 ? 1432 GLN A CG  1 
ATOM   7617  C  CD  . GLN A  1  1001 ? 167.020 200.245 220.012 1.00   257.66 ? 1432 GLN A CD  1 
ATOM   7618  O  OE1 . GLN A  1  1001 ? 167.918 200.712 219.307 1.00   270.00 ? 1432 GLN A OE1 1 
ATOM   7619  N  NE2 . GLN A  1  1001 ? 167.269 199.553 221.116 1.00   267.21 ? 1432 GLN A NE2 1 
ATOM   7620  N  N   . ILE A  1  1002 ? 163.934 196.187 218.564 1.00   203.33 ? 1433 ILE A N   1 
ATOM   7621  C  CA  . ILE A  1  1002 ? 163.385 194.797 218.590 1.00   210.30 ? 1433 ILE A CA  1 
ATOM   7622  C  C   . ILE A  1  1002 ? 164.468 193.722 218.753 1.00   210.32 ? 1433 ILE A C   1 
ATOM   7623  O  O   . ILE A  1  1002 ? 164.284 192.737 219.490 1.00   201.27 ? 1433 ILE A O   1 
ATOM   7624  C  CB  . ILE A  1  1002 ? 162.593 194.397 217.297 1.00   203.01 ? 1433 ILE A CB  1 
ATOM   7625  C  CG1 . ILE A  1  1002 ? 161.902 195.584 216.594 1.00   216.19 ? 1433 ILE A CG1 1 
ATOM   7626  C  CG2 . ILE A  1  1002 ? 161.578 193.286 217.599 1.00   195.70 ? 1433 ILE A CG2 1 
ATOM   7627  C  CD1 . ILE A  1  1002 ? 160.944 196.396 217.443 1.00   235.11 ? 1433 ILE A CD1 1 
ATOM   7628  N  N   . ILE A  1  1003 ? 165.577 193.938 218.035 1.00   191.53 ? 1434 ILE A N   1 
ATOM   7629  C  CA  . ILE A  1  1003 ? 166.714 193.037 218.030 1.00   171.12 ? 1434 ILE A CA  1 
ATOM   7630  C  C   . ILE A  1  1003 ? 167.774 193.451 219.055 1.00   189.85 ? 1434 ILE A C   1 
ATOM   7631  O  O   . ILE A  1  1003 ? 168.376 192.563 219.683 1.00   216.52 ? 1434 ILE A O   1 
ATOM   7632  C  CB  . ILE A  1  1003 ? 167.369 192.941 216.637 1.00   146.09 ? 1434 ILE A CB  1 
ATOM   7633  C  CG1 . ILE A  1  1003 ? 166.329 192.667 215.548 1.00   161.92 ? 1434 ILE A CG1 1 
ATOM   7634  C  CG2 . ILE A  1  1003 ? 168.415 191.828 216.624 1.00   157.04 ? 1434 ILE A CG2 1 
ATOM   7635  C  CD1 . ILE A  1  1003 ? 166.849 192.766 214.131 1.00   156.58 ? 1434 ILE A CD1 1 
ATOM   7636  N  N   . ARG A  1  1004 ? 168.027 194.760 219.221 1.00   194.14 ? 1435 ARG A N   1 
ATOM   7637  C  CA  . ARG A  1  1004 ? 169.026 195.223 220.217 1.00   199.63 ? 1435 ARG A CA  1 
ATOM   7638  C  C   . ARG A  1  1004 ? 168.586 194.853 221.644 1.00   229.63 ? 1435 ARG A C   1 
ATOM   7639  O  O   . ARG A  1  1004 ? 169.425 194.444 222.453 1.00   248.96 ? 1435 ARG A O   1 
ATOM   7640  C  CB  . ARG A  1  1004 ? 169.355 196.728 220.097 1.00   172.03 ? 1435 ARG A CB  1 
ATOM   7641  N  N   . GLU A  1  1005 ? 167.279 194.952 221.923 1.00   237.46 ? 1436 GLU A N   1 
ATOM   7642  C  CA  . GLU A  1  1005 ? 166.682 194.499 223.204 1.00   229.23 ? 1436 GLU A CA  1 
ATOM   7643  C  C   . GLU A  1  1005 ? 166.964 193.011 223.534 1.00   240.61 ? 1436 GLU A C   1 
ATOM   7644  O  O   . GLU A  1  1005 ? 167.661 192.681 224.518 1.00   209.85 ? 1436 GLU A O   1 
ATOM   7645  C  CB  . GLU A  1  1005 ? 165.166 194.753 223.202 1.00   193.40 ? 1436 GLU A CB  1 
ATOM   7646  N  N   . ASN A  1  1006 ? 166.436 192.131 222.686 1.00   234.22 ? 1437 ASN A N   1 
ATOM   7647  C  CA  . ASN A  1  1006 ? 166.489 190.678 222.898 1.00   215.75 ? 1437 ASN A CA  1 
ATOM   7648  C  C   . ASN A  1  1006 ? 167.722 189.965 222.226 1.00   220.41 ? 1437 ASN A C   1 
ATOM   7649  O  O   . ASN A  1  1006 ? 168.677 189.432 222.874 1.00   169.30 ? 1437 ASN A O   1 
ATOM   7650  C  CB  . ASN A  1  1006 ? 165.138 190.095 222.429 1.00   139.67 ? 1437 ASN A CB  1 
ATOM   7651  N  N   . LEU A  1  1007 ? 159.611 186.929 218.762 1.00   191.48 ? 1452 LEU A N   1 
ATOM   7652  C  CA  . LEU A  1  1007 ? 159.603 185.825 219.731 1.00   230.11 ? 1452 LEU A CA  1 
ATOM   7653  C  C   . LEU A  1  1007 ? 160.089 184.475 219.115 1.00   257.23 ? 1452 LEU A C   1 
ATOM   7654  O  O   . LEU A  1  1007 ? 159.876 183.402 219.712 1.00   249.80 ? 1452 LEU A O   1 
ATOM   7655  C  CB  . LEU A  1  1007 ? 158.208 185.690 220.397 1.00   200.06 ? 1452 LEU A CB  1 
ATOM   7656  N  N   . ASN A  1  1008 ? 160.742 184.544 217.941 1.00   250.89 ? 1453 ASN A N   1 
ATOM   7657  C  CA  . ASN A  1  1008 ? 161.489 183.416 217.360 1.00   242.33 ? 1453 ASN A CA  1 
ATOM   7658  C  C   . ASN A  1  1008 ? 162.948 183.763 217.444 1.00   227.40 ? 1453 ASN A C   1 
ATOM   7659  O  O   . ASN A  1  1008 ? 163.427 184.644 216.717 1.00   262.58 ? 1453 ASN A O   1 
ATOM   7660  C  CB  . ASN A  1  1008 ? 161.091 183.152 215.907 1.00   244.52 ? 1453 ASN A CB  1 
ATOM   7661  C  CG  . ASN A  1  1008 ? 159.745 182.474 215.792 1.00   260.70 ? 1453 ASN A CG  1 
ATOM   7662  O  OD1 . ASN A  1  1008 ? 158.801 182.844 216.486 1.00   284.82 ? 1453 ASN A OD1 1 
ATOM   7663  N  ND2 . ASN A  1  1008 ? 159.653 181.466 214.928 1.00   267.19 ? 1453 ASN A ND2 1 
ATOM   7664  N  N   . LEU A  1  1009 ? 163.652 183.111 218.362 1.00   214.65 ? 1454 LEU A N   1 
ATOM   7665  C  CA  . LEU A  1  1009 ? 165.018 183.515 218.615 1.00   207.69 ? 1454 LEU A CA  1 
ATOM   7666  C  C   . LEU A  1  1009 ? 165.857 183.257 217.391 1.00   195.96 ? 1454 LEU A C   1 
ATOM   7667  O  O   . LEU A  1  1009 ? 166.800 184.006 217.158 1.00   205.60 ? 1454 LEU A O   1 
ATOM   7668  C  CB  . LEU A  1  1009 ? 165.609 182.881 219.871 1.00   230.57 ? 1454 LEU A CB  1 
ATOM   7669  C  CG  . LEU A  1  1009 ? 165.306 183.688 221.144 1.00   254.06 ? 1454 LEU A CG  1 
ATOM   7670  C  CD1 . LEU A  1  1009 ? 165.903 185.104 221.096 1.00   227.50 ? 1454 LEU A CD1 1 
ATOM   7671  C  CD2 . LEU A  1  1009 ? 163.798 183.712 221.420 1.00   266.15 ? 1454 LEU A CD2 1 
ATOM   7672  N  N   . GLU A  1  1010 ? 165.496 182.270 216.568 1.00   176.21 ? 1455 GLU A N   1 
ATOM   7673  C  CA  . GLU A  1  1010 ? 166.282 182.035 215.356 1.00   188.67 ? 1455 GLU A CA  1 
ATOM   7674  C  C   . GLU A  1  1010 ? 166.198 183.192 214.324 1.00   188.85 ? 1455 GLU A C   1 
ATOM   7675  O  O   . GLU A  1  1010 ? 167.232 183.639 213.804 1.00   183.22 ? 1455 GLU A O   1 
ATOM   7676  C  CB  . GLU A  1  1010 ? 165.996 180.646 214.754 1.00   200.47 ? 1455 GLU A CB  1 
ATOM   7677  C  CG  . GLU A  1  1010 ? 164.773 180.487 213.863 1.00   228.20 ? 1455 GLU A CG  1 
ATOM   7678  C  CD  . GLU A  1  1010 ? 164.872 179.239 212.991 1.00   269.00 ? 1455 GLU A CD  1 
ATOM   7679  O  OE1 . GLU A  1  1010 ? 165.791 179.168 212.135 1.00   248.58 ? 1455 GLU A OE1 1 
ATOM   7680  O  OE2 . GLU A  1  1010 ? 164.026 178.328 213.154 1.00   320.78 ? 1455 GLU A OE2 1 
ATOM   7681  N  N   . THR A  1  1011 ? 164.991 183.687 214.052 1.00   192.86 ? 1456 THR A N   1 
ATOM   7682  C  CA  . THR A  1  1011 ? 164.822 184.822 213.121 1.00   175.73 ? 1456 THR A CA  1 
ATOM   7683  C  C   . THR A  1  1011 ? 165.512 186.066 213.630 1.00   160.98 ? 1456 THR A C   1 
ATOM   7684  O  O   . THR A  1  1011 ? 166.064 186.834 212.849 1.00   229.52 ? 1456 THR A O   1 
ATOM   7685  C  CB  . THR A  1  1011 ? 163.347 185.200 212.889 1.00   192.38 ? 1456 THR A CB  1 
ATOM   7686  O  OG1 . THR A  1  1011 ? 162.641 184.066 212.368 1.00   207.93 ? 1456 THR A OG1 1 
ATOM   7687  C  CG2 . THR A  1  1011 ? 163.211 186.407 211.919 1.00   189.97 ? 1456 THR A CG2 1 
ATOM   7688  N  N   . LEU A  1  1012 ? 165.470 186.260 214.937 1.00   144.41 ? 1457 LEU A N   1 
ATOM   7689  C  CA  . LEU A  1  1012 ? 166.032 187.421 215.556 1.00   142.57 ? 1457 LEU A CA  1 
ATOM   7690  C  C   . LEU A  1  1012 ? 167.541 187.306 215.601 1.00   143.41 ? 1457 LEU A C   1 
ATOM   7691  O  O   . LEU A  1  1012 ? 168.239 188.263 215.289 1.00   152.97 ? 1457 LEU A O   1 
ATOM   7692  C  CB  . LEU A  1  1012 ? 165.475 187.570 216.969 1.00   157.74 ? 1457 LEU A CB  1 
ATOM   7693  C  CG  . LEU A  1  1012 ? 165.523 189.025 217.435 1.00   186.77 ? 1457 LEU A CG  1 
ATOM   7694  C  CD1 . LEU A  1  1012 ? 164.322 189.811 216.890 1.00   169.90 ? 1457 LEU A CD1 1 
ATOM   7695  C  CD2 . LEU A  1  1012 ? 165.632 189.095 218.963 1.00   210.84 ? 1457 LEU A CD2 1 
ATOM   7696  N  N   . SER A  1  1013 ? 168.051 186.141 215.994 1.00   155.86 ? 1458 SER A N   1 
ATOM   7697  C  CA  . SER A  1  1013 ? 169.496 185.981 216.148 1.00   161.25 ? 1458 SER A CA  1 
ATOM   7698  C  C   . SER A  1  1013 ? 170.183 186.110 214.804 1.00   153.58 ? 1458 SER A C   1 
ATOM   7699  O  O   . SER A  1  1013 ? 171.234 186.744 214.711 1.00   174.49 ? 1458 SER A O   1 
ATOM   7700  C  CB  . SER A  1  1013 ? 169.854 184.651 216.796 1.00   175.10 ? 1458 SER A CB  1 
ATOM   7701  O  OG  . SER A  1  1013 ? 171.217 184.669 217.186 1.00   223.43 ? 1458 SER A OG  1 
ATOM   7702  N  N   . GLN A  1  1014 ? 169.578 185.524 213.771 1.00   132.61 ? 1459 GLN A N   1 
ATOM   7703  C  CA  . GLN A  1  1014 ? 170.036 185.720 212.375 1.00   125.96 ? 1459 GLN A CA  1 
ATOM   7704  C  C   . GLN A  1  1014 ? 170.103 187.195 211.950 1.00   120.09 ? 1459 GLN A C   1 
ATOM   7705  O  O   . GLN A  1  1014 ? 171.125 187.680 211.499 1.00   144.47 ? 1459 GLN A O   1 
ATOM   7706  C  CB  . GLN A  1  1014 ? 169.154 184.932 211.395 1.00   107.08 ? 1459 GLN A CB  1 
ATOM   7707  C  CG  . GLN A  1  1014 ? 169.369 183.441 211.542 1.00   127.96 ? 1459 GLN A CG  1 
ATOM   7708  C  CD  . GLN A  1  1014 ? 168.354 182.584 210.804 1.00   174.66 ? 1459 GLN A CD  1 
ATOM   7709  O  OE1 . GLN A  1  1014 ? 167.312 183.076 210.351 1.00   235.24 ? 1459 GLN A OE1 1 
ATOM   7710  N  NE2 . GLN A  1  1014 ? 168.653 181.278 210.676 1.00   182.61 ? 1459 GLN A NE2 1 
ATOM   7711  N  N   . ALA A  1  1015 ? 169.005 187.903 212.094 1.00   119.00 ? 1460 ALA A N   1 
ATOM   7712  C  CA  . ALA A  1  1015 ? 168.945 189.305 211.720 1.00   121.65 ? 1460 ALA A CA  1 
ATOM   7713  C  C   . ALA A  1  1015 ? 170.056 190.142 212.363 1.00   125.05 ? 1460 ALA A C   1 
ATOM   7714  O  O   . ALA A  1  1015 ? 170.585 191.048 211.740 1.00   169.68 ? 1460 ALA A O   1 
ATOM   7715  C  CB  . ALA A  1  1015 ? 167.587 189.891 212.076 1.00   127.60 ? 1460 ALA A CB  1 
ATOM   7716  N  N   . HIS A  1  1016 ? 170.409 189.825 213.596 1.00   123.81 ? 1461 HIS A N   1 
ATOM   7717  C  CA  . HIS A  1  1016 ? 171.399 190.570 214.323 1.00   131.70 ? 1461 HIS A CA  1 
ATOM   7718  C  C   . HIS A  1  1016 ? 172.749 190.428 213.652 1.00   145.98 ? 1461 HIS A C   1 
ATOM   7719  O  O   . HIS A  1  1016 ? 173.436 191.436 213.401 1.00   157.24 ? 1461 HIS A O   1 
ATOM   7720  C  CB  . HIS A  1  1016 ? 171.488 190.042 215.744 1.00   141.26 ? 1461 HIS A CB  1 
ATOM   7721  C  CG  . HIS A  1  1016 ? 172.521 190.739 216.545 1.00   162.28 ? 1461 HIS A CG  1 
ATOM   7722  N  ND1 . HIS A  1  1016 ? 172.615 192.114 216.583 1.00   152.09 ? 1461 HIS A ND1 1 
ATOM   7723  C  CD2 . HIS A  1  1016 ? 173.546 190.263 217.287 1.00   182.15 ? 1461 HIS A CD2 1 
ATOM   7724  C  CE1 . HIS A  1  1016 ? 173.631 192.456 217.353 1.00   183.14 ? 1461 HIS A CE1 1 
ATOM   7725  N  NE2 . HIS A  1  1016 ? 174.215 191.352 217.792 1.00   194.31 ? 1461 HIS A NE2 1 
ATOM   7726  N  N   . VAL A  1  1017 ? 173.114 189.183 213.319 1.00   139.35 ? 1462 VAL A N   1 
ATOM   7727  C  CA  . VAL A  1  1017 ? 174.411 188.930 212.691 1.00   131.36 ? 1462 VAL A CA  1 
ATOM   7728  C  C   . VAL A  1  1017 ? 174.480 189.538 211.312 1.00   129.85 ? 1462 VAL A C   1 
ATOM   7729  O  O   . VAL A  1  1017 ? 175.409 190.288 211.034 1.00   185.17 ? 1462 VAL A O   1 
ATOM   7730  C  CB  . VAL A  1  1017 ? 174.819 187.445 212.638 1.00   122.68 ? 1462 VAL A CB  1 
ATOM   7731  C  CG1 . VAL A  1  1017 ? 174.718 186.829 214.024 1.00   133.23 ? 1462 VAL A CG1 1 
ATOM   7732  C  CG2 . VAL A  1  1017 ? 174.023 186.628 211.621 1.00   134.11 ? 1462 VAL A CG2 1 
ATOM   7733  N  N   . TYR A  1  1018 ? 173.506 189.251 210.461 1.00   113.28 ? 1463 TYR A N   1 
ATOM   7734  C  CA  . TYR A  1  1018 ? 173.528 189.792 209.118 1.00   115.56 ? 1463 TYR A CA  1 
ATOM   7735  C  C   . TYR A  1  1018 ? 173.440 191.317 209.049 1.00   120.93 ? 1463 TYR A C   1 
ATOM   7736  O  O   . TYR A  1  1018 ? 174.012 191.907 208.152 1.00   157.53 ? 1463 TYR A O   1 
ATOM   7737  C  CB  . TYR A  1  1018 ? 172.426 189.231 208.288 1.00   116.22 ? 1463 TYR A CB  1 
ATOM   7738  C  CG  . TYR A  1  1018 ? 172.679 187.863 207.807 1.00   121.61 ? 1463 TYR A CG  1 
ATOM   7739  C  CD1 . TYR A  1  1018 ? 173.630 187.632 206.871 1.00   134.65 ? 1463 TYR A CD1 1 
ATOM   7740  C  CD2 . TYR A  1  1018 ? 171.900 186.819 208.234 1.00   144.35 ? 1463 TYR A CD2 1 
ATOM   7741  C  CE1 . TYR A  1  1018 ? 173.832 186.381 206.374 1.00   171.50 ? 1463 TYR A CE1 1 
ATOM   7742  C  CE2 . TYR A  1  1018 ? 172.088 185.560 207.770 1.00   158.06 ? 1463 TYR A CE2 1 
ATOM   7743  C  CZ  . TYR A  1  1018 ? 173.052 185.339 206.835 1.00   190.75 ? 1463 TYR A CZ  1 
ATOM   7744  O  OH  . TYR A  1  1018 ? 173.223 184.058 206.376 1.00   258.08 ? 1463 TYR A OH  1 
ATOM   7745  N  N   . ILE A  1  1019 ? 172.731 191.959 209.955 1.00   125.86 ? 1464 ILE A N   1 
ATOM   7746  C  CA  . ILE A  1  1019 ? 172.718 193.416 209.985 1.00   127.37 ? 1464 ILE A CA  1 
ATOM   7747  C  C   . ILE A  1  1019 ? 174.095 193.952 210.389 1.00   135.26 ? 1464 ILE A C   1 
ATOM   7748  O  O   . ILE A  1  1019 ? 174.547 194.951 209.810 1.00   170.37 ? 1464 ILE A O   1 
ATOM   7749  C  CB  . ILE A  1  1019 ? 171.592 193.963 210.899 1.00   137.11 ? 1464 ILE A CB  1 
ATOM   7750  C  CG1 . ILE A  1  1019 ? 170.255 193.718 210.218 1.00   127.45 ? 1464 ILE A CG1 1 
ATOM   7751  C  CG2 . ILE A  1  1019 ? 171.734 195.462 211.205 1.00   139.09 ? 1464 ILE A CG2 1 
ATOM   7752  C  CD1 . ILE A  1  1019 ? 169.104 193.814 211.177 1.00   137.04 ? 1464 ILE A CD1 1 
ATOM   7753  N  N   . ILE A  1  1020 ? 174.795 193.340 211.342 1.00   116.04 ? 1465 ILE A N   1 
ATOM   7754  C  CA  . ILE A  1  1020 ? 176.091 193.930 211.645 1.00   131.11 ? 1465 ILE A CA  1 
ATOM   7755  C  C   . ILE A  1  1020 ? 177.024 193.643 210.509 1.00   124.30 ? 1465 ILE A C   1 
ATOM   7756  O  O   . ILE A  1  1020 ? 177.782 194.496 210.128 1.00   134.71 ? 1465 ILE A O   1 
ATOM   7757  C  CB  . ILE A  1  1020 ? 176.719 193.544 212.969 1.00   152.33 ? 1465 ILE A CB  1 
ATOM   7758  C  CG1 . ILE A  1  1020 ? 176.853 192.030 213.103 1.00   174.02 ? 1465 ILE A CG1 1 
ATOM   7759  C  CG2 . ILE A  1  1020 ? 175.898 194.174 214.077 1.00   177.83 ? 1465 ILE A CG2 1 
ATOM   7760  C  CD1 . ILE A  1  1020 ? 177.767 191.612 214.225 1.00   216.48 ? 1465 ILE A CD1 1 
ATOM   7761  N  N   . ALA A  1  1021 ? 176.918 192.469 209.914 1.00   130.66 ? 1466 ALA A N   1 
ATOM   7762  C  CA  . ALA A  1  1021 ? 177.756 192.146 208.758 1.00   146.43 ? 1466 ALA A CA  1 
ATOM   7763  C  C   . ALA A  1  1021 ? 177.577 193.193 207.661 1.00   132.22 ? 1466 ALA A C   1 
ATOM   7764  O  O   . ALA A  1  1021 ? 178.529 193.844 207.260 1.00   156.34 ? 1466 ALA A O   1 
ATOM   7765  C  CB  . ALA A  1  1021 ? 177.483 190.740 208.220 1.00   142.63 ? 1466 ALA A CB  1 
ATOM   7766  N  N   . GLY A  1  1022 ? 176.363 193.379 207.197 1.00   129.21 ? 1467 GLY A N   1 
ATOM   7767  C  CA  . GLY A  1  1022 ? 176.108 194.360 206.170 1.00   121.55 ? 1467 GLY A CA  1 
ATOM   7768  C  C   . GLY A  1  1022 ? 176.597 195.717 206.525 1.00   136.75 ? 1467 GLY A C   1 
ATOM   7769  O  O   . GLY A  1  1022 ? 177.074 196.417 205.652 1.00   187.77 ? 1467 GLY A O   1 
ATOM   7770  N  N   . ALA A  1  1023 ? 176.495 196.103 207.790 1.00   119.74 ? 1468 ALA A N   1 
ATOM   7771  C  CA  . ALA A  1  1023 ? 176.877 197.444 208.148 1.00   134.28 ? 1468 ALA A CA  1 
ATOM   7772  C  C   . ALA A  1  1023 ? 178.419 197.555 208.216 1.00   136.18 ? 1468 ALA A C   1 
ATOM   7773  O  O   . ALA A  1  1023 ? 179.016 198.539 207.780 1.00   147.89 ? 1468 ALA A O   1 
ATOM   7774  C  CB  . ALA A  1  1023 ? 176.209 197.824 209.451 1.00   152.97 ? 1468 ALA A CB  1 
ATOM   7775  N  N   . CYS A  1  1024 ? 179.058 196.516 208.721 1.00   139.66 ? 1469 CYS A N   1 
ATOM   7776  C  CA  . CYS A  1  1024 ? 180.503 196.506 208.825 1.00   150.68 ? 1469 CYS A CA  1 
ATOM   7777  C  C   . CYS A  1  1024 ? 181.081 196.413 207.399 1.00   133.65 ? 1469 CYS A C   1 
ATOM   7778  O  O   . CYS A  1  1024 ? 182.062 197.081 207.072 1.00   153.24 ? 1469 CYS A O   1 
ATOM   7779  C  CB  . CYS A  1  1024 ? 180.956 195.365 209.758 1.00   174.36 ? 1469 CYS A CB  1 
ATOM   7780  S  SG  . CYS A  1  1024 ? 181.041 193.704 209.024 1.00   183.59 ? 1469 CYS A SG  1 
ATOM   7781  N  N   . LEU A  1  1025 ? 180.443 195.622 206.548 1.00   114.54 ? 1470 LEU A N   1 
ATOM   7782  C  CA  . LEU A  1  1025 ? 180.766 195.596 205.122 1.00   121.70 ? 1470 LEU A CA  1 
ATOM   7783  C  C   . LEU A  1  1025 ? 180.667 196.959 204.439 1.00   122.97 ? 1470 LEU A C   1 
ATOM   7784  O  O   . LEU A  1  1025 ? 181.485 197.297 203.582 1.00   138.57 ? 1470 LEU A O   1 
ATOM   7785  C  CB  . LEU A  1  1025 ? 179.892 194.560 204.407 1.00   113.01 ? 1470 LEU A CB  1 
ATOM   7786  C  CG  . LEU A  1  1025 ? 180.152 194.450 202.904 1.00   118.54 ? 1470 LEU A CG  1 
ATOM   7787  C  CD1 . LEU A  1  1025 ? 179.859 193.056 202.344 1.00   124.68 ? 1470 LEU A CD1 1 
ATOM   7788  C  CD2 . LEU A  1  1025 ? 179.348 195.515 202.181 1.00   124.66 ? 1470 LEU A CD2 1 
ATOM   7789  N  N   . SER A  1  1026 ? 179.641 197.708 204.795 1.00   121.53 ? 1471 SER A N   1 
ATOM   7790  C  CA  . SER A  1  1026 ? 179.450 199.041 204.291 1.00   135.55 ? 1471 SER A CA  1 
ATOM   7791  C  C   . SER A  1  1026 ? 180.544 199.954 204.826 1.00   114.98 ? 1471 SER A C   1 
ATOM   7792  O  O   . SER A  1  1026 ? 180.950 200.915 204.175 1.00   139.28 ? 1471 SER A O   1 
ATOM   7793  C  CB  . SER A  1  1026 ? 178.068 199.578 204.684 1.00   163.90 ? 1471 SER A CB  1 
ATOM   7794  O  OG  . SER A  1  1026 ? 177.820 200.786 203.989 1.00   221.87 ? 1471 SER A OG  1 
ATOM   7795  N  N   . LEU A  1  1027 ? 180.989 199.675 206.035 1.00   114.44 ? 1472 LEU A N   1 
ATOM   7796  C  CA  . LEU A  1  1027 ? 182.133 200.368 206.578 1.00   120.55 ? 1472 LEU A CA  1 
ATOM   7797  C  C   . LEU A  1  1027 ? 183.335 200.126 205.680 1.00   117.33 ? 1472 LEU A C   1 
ATOM   7798  O  O   . LEU A  1  1027 ? 183.939 201.070 205.190 1.00   118.18 ? 1472 LEU A O   1 
ATOM   7799  C  CB  . LEU A  1  1027 ? 182.391 199.892 207.986 1.00   128.33 ? 1472 LEU A CB  1 
ATOM   7800  C  CG  . LEU A  1  1027 ? 183.509 200.524 208.753 1.00   137.86 ? 1472 LEU A CG  1 
ATOM   7801  C  CD1 . LEU A  1  1027 ? 183.520 202.035 208.663 1.00   146.06 ? 1472 LEU A CD1 1 
ATOM   7802  C  CD2 . LEU A  1  1027 ? 183.286 200.096 210.183 1.00   164.37 ? 1472 LEU A CD2 1 
ATOM   7803  N  N   . GLY A  1  1028 ? 183.618 198.852 205.410 1.00   125.26 ? 1473 GLY A N   1 
ATOM   7804  C  CA  . GLY A  1  1028 ? 184.573 198.428 204.355 1.00   125.98 ? 1473 GLY A CA  1 
ATOM   7805  C  C   . GLY A  1  1028 ? 184.586 199.281 203.088 1.00   121.78 ? 1473 GLY A C   1 
ATOM   7806  O  O   . GLY A  1  1028 ? 185.591 199.895 202.774 1.00   142.44 ? 1473 GLY A O   1 
ATOM   7807  N  N   . PHE A  1  1029 ? 183.457 199.345 202.385 1.00   117.43 ? 1474 PHE A N   1 
ATOM   7808  C  CA  . PHE A  1  1029 ? 183.340 200.144 201.151 1.00   106.78 ? 1474 PHE A CA  1 
ATOM   7809  C  C   . PHE A  1  1029 ? 183.661 201.574 201.321 1.00   109.51 ? 1474 PHE A C   1 
ATOM   7810  O  O   . PHE A  1  1029 ? 184.170 202.138 200.387 1.00   151.93 ? 1474 PHE A O   1 
ATOM   7811  C  CB  . PHE A  1  1029 ? 181.927 200.174 200.614 1.00   129.06 ? 1474 PHE A CB  1 
ATOM   7812  C  CG  . PHE A  1  1029 ? 181.611 199.061 199.723 1.00   139.23 ? 1474 PHE A CG  1 
ATOM   7813  C  CD1 . PHE A  1  1029 ? 181.304 197.825 200.253 1.00   131.62 ? 1474 PHE A CD1 1 
ATOM   7814  C  CD2 . PHE A  1  1029 ? 181.631 199.239 198.358 1.00   152.41 ? 1474 PHE A CD2 1 
ATOM   7815  C  CE1 . PHE A  1  1029 ? 181.035 196.764 199.431 1.00   139.83 ? 1474 PHE A CE1 1 
ATOM   7816  C  CE2 . PHE A  1  1029 ? 181.335 198.189 197.523 1.00   168.25 ? 1474 PHE A CE2 1 
ATOM   7817  C  CZ  . PHE A  1  1029 ? 181.045 196.947 198.059 1.00   156.39 ? 1474 PHE A CZ  1 
ATOM   7818  N  N   . ARG A  1  1030 ? 183.296 202.196 202.443 1.00   110.57 ? 1475 ARG A N   1 
ATOM   7819  C  CA  . ARG A  1  1030 ? 183.677 203.590 202.634 1.00   126.02 ? 1475 ARG A CA  1 
ATOM   7820  C  C   . ARG A  1  1030 ? 185.188 203.730 202.925 1.00   145.44 ? 1475 ARG A C   1 
ATOM   7821  O  O   . ARG A  1  1030 ? 185.863 204.609 202.391 1.00   169.25 ? 1475 ARG A O   1 
ATOM   7822  C  CB  . ARG A  1  1030 ? 182.872 204.329 203.686 1.00   125.37 ? 1475 ARG A CB  1 
ATOM   7823  C  CG  . ARG A  1  1030 ? 183.518 205.672 203.966 1.00   128.37 ? 1475 ARG A CG  1 
ATOM   7824  C  CD  . ARG A  1  1030 ? 182.576 206.799 204.192 1.00   147.54 ? 1475 ARG A CD  1 
ATOM   7825  N  NE  . ARG A  1  1030 ? 183.360 207.945 204.645 1.00   178.05 ? 1475 ARG A NE  1 
ATOM   7826  C  CZ  . ARG A  1  1030 ? 184.144 208.716 203.883 1.00   182.85 ? 1475 ARG A CZ  1 
ATOM   7827  N  NH1 . ARG A  1  1030 ? 184.273 208.512 202.575 1.00   169.86 ? 1475 ARG A NH1 1 
ATOM   7828  N  NH2 . ARG A  1  1030 ? 184.801 209.729 204.448 1.00   211.56 ? 1475 ARG A NH2 1 
ATOM   7829  N  N   . PHE A  1  1031 ? 185.753 202.850 203.706 1.00   129.75 ? 1476 PHE A N   1 
ATOM   7830  C  CA  . PHE A  1  1031 ? 187.137 203.067 204.046 1.00   132.52 ? 1476 PHE A CA  1 
ATOM   7831  C  C   . PHE A  1  1031 ? 188.066 202.209 203.271 1.00   138.32 ? 1476 PHE A C   1 
ATOM   7832  O  O   . PHE A  1  1031 ? 189.157 201.915 203.748 1.00   142.16 ? 1476 PHE A O   1 
ATOM   7833  C  CB  . PHE A  1  1031 ? 187.293 202.888 205.520 1.00   147.52 ? 1476 PHE A CB  1 
ATOM   7834  C  CG  . PHE A  1  1031 ? 186.593 203.939 206.239 1.00   139.62 ? 1476 PHE A CG  1 
ATOM   7835  C  CD1 . PHE A  1  1031 ? 185.246 203.877 206.357 1.00   135.34 ? 1476 PHE A CD1 1 
ATOM   7836  C  CD2 . PHE A  1  1031 ? 187.251 205.053 206.614 1.00   139.16 ? 1476 PHE A CD2 1 
ATOM   7837  C  CE1 . PHE A  1  1031 ? 184.562 204.856 206.960 1.00   134.49 ? 1476 PHE A CE1 1 
ATOM   7838  C  CE2 . PHE A  1  1031 ? 186.587 206.049 207.227 1.00   168.84 ? 1476 PHE A CE2 1 
ATOM   7839  C  CZ  . PHE A  1  1031 ? 185.232 205.954 207.399 1.00   174.89 ? 1476 PHE A CZ  1 
ATOM   7840  N  N   . ALA A  1  1032 ? 187.654 201.834 202.058 1.00   140.33 ? 1477 ALA A N   1 
ATOM   7841  C  CA  . ALA A  1  1032 ? 188.448 200.906 201.275 1.00   129.75 ? 1477 ALA A CA  1 
ATOM   7842  C  C   . ALA A  1  1032 ? 189.758 201.603 200.921 1.00   117.35 ? 1477 ALA A C   1 
ATOM   7843  O  O   . ALA A  1  1032 ? 189.746 202.735 200.440 1.00   114.89 ? 1477 ALA A O   1 
ATOM   7844  C  CB  . ALA A  1  1032 ? 187.698 200.391 200.040 1.00   128.84 ? 1477 ALA A CB  1 
ATOM   7845  N  N   . GLY A  1  1033 ? 190.871 200.960 201.284 1.00   116.73 ? 1478 GLY A N   1 
ATOM   7846  C  CA  . GLY A  1  1033 ? 192.217 201.432 200.991 1.00   125.67 ? 1478 GLY A CA  1 
ATOM   7847  C  C   . GLY A  1  1033 ? 192.766 202.572 201.854 1.00   142.97 ? 1478 GLY A C   1 
ATOM   7848  O  O   . GLY A  1  1033 ? 193.926 202.974 201.707 1.00   163.51 ? 1478 GLY A O   1 
ATOM   7849  N  N   . SER A  1  1034 ? 191.948 203.121 202.739 1.00   143.55 ? 1479 SER A N   1 
ATOM   7850  C  CA  . SER A  1  1034 ? 192.444 204.023 203.755 1.00   147.93 ? 1479 SER A CA  1 
ATOM   7851  C  C   . SER A  1  1034 ? 193.412 203.311 204.730 1.00   132.72 ? 1479 SER A C   1 
ATOM   7852  O  O   . SER A  1  1034 ? 194.301 203.923 205.288 1.00   151.82 ? 1479 SER A O   1 
ATOM   7853  C  CB  . SER A  1  1034 ? 191.264 204.629 204.510 1.00   155.55 ? 1479 SER A CB  1 
ATOM   7854  O  OG  . SER A  1  1034 ? 190.407 205.325 203.616 1.00   183.48 ? 1479 SER A OG  1 
ATOM   7855  N  N   . GLU A  1  1035 ? 193.257 202.012 204.908 1.00   145.77 ? 1480 GLU A N   1 
ATOM   7856  C  CA  . GLU A  1  1035 ? 193.989 201.281 205.912 1.00   142.12 ? 1480 GLU A CA  1 
ATOM   7857  C  C   . GLU A  1  1035 ? 193.750 202.012 207.188 1.00   137.62 ? 1480 GLU A C   1 
ATOM   7858  O  O   . GLU A  1  1035 ? 194.656 202.192 207.962 1.00   205.29 ? 1480 GLU A O   1 
ATOM   7859  C  CB  . GLU A  1  1035 ? 195.469 201.150 205.529 1.00   185.38 ? 1480 GLU A CB  1 
ATOM   7860  C  CG  . GLU A  1  1035 ? 195.658 200.424 204.187 1.00   260.82 ? 1480 GLU A CG  1 
ATOM   7861  C  CD  . GLU A  1  1035 ? 197.050 200.535 203.565 1.00   323.01 ? 1480 GLU A CD  1 
ATOM   7862  O  OE1 . GLU A  1  1035 ? 197.379 199.648 202.743 1.00   347.15 ? 1480 GLU A OE1 1 
ATOM   7863  O  OE2 . GLU A  1  1035 ? 197.808 201.489 203.866 1.00   356.04 ? 1480 GLU A OE2 1 
ATOM   7864  N  N   . ASN A  1  1036 ? 192.487 202.392 207.415 1.00   144.66 ? 1481 ASN A N   1 
ATOM   7865  C  CA  . ASN A  1  1036 ? 192.097 203.404 208.405 1.00   142.75 ? 1481 ASN A CA  1 
ATOM   7866  C  C   . ASN A  1  1036 ? 192.050 202.873 209.853 1.00   163.98 ? 1481 ASN A C   1 
ATOM   7867  O  O   . ASN A  1  1036 ? 191.634 201.741 210.036 1.00   171.59 ? 1481 ASN A O   1 
ATOM   7868  C  CB  . ASN A  1  1036 ? 190.749 203.935 208.026 1.00   137.59 ? 1481 ASN A CB  1 
ATOM   7869  C  CG  . ASN A  1  1036 ? 190.255 204.953 208.986 1.00   143.48 ? 1481 ASN A CG  1 
ATOM   7870  O  OD1 . ASN A  1  1036 ? 190.172 204.702 210.199 1.00   164.65 ? 1481 ASN A OD1 1 
ATOM   7871  N  ND2 . ASN A  1  1036 ? 189.923 206.115 208.467 1.00   166.06 ? 1481 ASN A ND2 1 
ATOM   7872  N  N   . LEU A  1  1037 ? 192.378 203.680 210.881 1.00   157.11 ? 1482 LEU A N   1 
ATOM   7873  C  CA  . LEU A  1  1037 ? 192.812 203.114 212.174 1.00   163.44 ? 1482 LEU A CA  1 
ATOM   7874  C  C   . LEU A  1  1037 ? 191.606 202.658 212.969 1.00   169.00 ? 1482 LEU A C   1 
ATOM   7875  O  O   . LEU A  1  1037 ? 191.535 201.515 213.464 1.00   183.30 ? 1482 LEU A O   1 
ATOM   7876  C  CB  . LEU A  1  1037 ? 193.662 204.094 212.999 1.00   165.26 ? 1482 LEU A CB  1 
ATOM   7877  C  CG  . LEU A  1  1037 ? 194.849 203.399 213.711 1.00   188.55 ? 1482 LEU A CG  1 
ATOM   7878  C  CD1 . LEU A  1  1037 ? 196.002 204.357 214.014 1.00   208.08 ? 1482 LEU A CD1 1 
ATOM   7879  C  CD2 . LEU A  1  1037 ? 194.423 202.666 214.977 1.00   186.60 ? 1482 LEU A CD2 1 
ATOM   7880  N  N   . SER A  1  1038 ? 190.651 203.562 213.073 1.00   154.12 ? 1483 SER A N   1 
ATOM   7881  C  CA  . SER A  1  1038 ? 189.432 203.276 213.789 1.00   162.77 ? 1483 SER A CA  1 
ATOM   7882  C  C   . SER A  1  1038 ? 188.567 202.203 213.119 1.00   158.57 ? 1483 SER A C   1 
ATOM   7883  O  O   . SER A  1  1038 ? 187.964 201.396 213.833 1.00   190.03 ? 1483 SER A O   1 
ATOM   7884  C  CB  . SER A  1  1038 ? 188.651 204.560 213.994 1.00   178.07 ? 1483 SER A CB  1 
ATOM   7885  O  OG  . SER A  1  1038 ? 188.712 205.338 212.827 1.00   201.75 ? 1483 SER A OG  1 
ATOM   7886  N  N   . ALA A  1  1039 ? 188.525 202.182 211.776 1.00   139.63 ? 1484 ALA A N   1 
ATOM   7887  C  CA  . ALA A  1  1039 ? 187.803 201.118 211.021 1.00   134.94 ? 1484 ALA A CA  1 
ATOM   7888  C  C   . ALA A  1  1039 ? 188.438 199.772 211.321 1.00   147.54 ? 1484 ALA A C   1 
ATOM   7889  O  O   . ALA A  1  1039 ? 187.763 198.764 211.549 1.00   163.70 ? 1484 ALA A O   1 
ATOM   7890  C  CB  . ALA A  1  1039 ? 187.773 201.379 209.506 1.00   108.47 ? 1484 ALA A CB  1 
ATOM   7891  N  N   . PHE A  1  1040 ? 189.758 199.772 211.390 1.00   144.49 ? 1485 PHE A N   1 
ATOM   7892  C  CA  . PHE A  1  1040 ? 190.454 198.518 211.525 1.00   167.63 ? 1485 PHE A CA  1 
ATOM   7893  C  C   . PHE A  1  1040 ? 190.213 197.943 212.899 1.00   166.66 ? 1485 PHE A C   1 
ATOM   7894  O  O   . PHE A  1  1040 ? 189.865 196.776 213.006 1.00   167.36 ? 1485 PHE A O   1 
ATOM   7895  C  CB  . PHE A  1  1040 ? 191.951 198.655 211.270 1.00   179.60 ? 1485 PHE A CB  1 
ATOM   7896  C  CG  . PHE A  1  1040 ? 192.693 197.428 211.638 1.00   170.03 ? 1485 PHE A CG  1 
ATOM   7897  C  CD1 . PHE A  1  1040 ? 192.318 196.205 211.076 1.00   138.38 ? 1485 PHE A CD1 1 
ATOM   7898  C  CD2 . PHE A  1  1040 ? 193.686 197.463 212.608 1.00   191.96 ? 1485 PHE A CD2 1 
ATOM   7899  C  CE1 . PHE A  1  1040 ? 192.952 195.042 211.455 1.00   157.73 ? 1485 PHE A CE1 1 
ATOM   7900  C  CE2 . PHE A  1  1040 ? 194.318 196.298 212.998 1.00   214.49 ? 1485 PHE A CE2 1 
ATOM   7901  C  CZ  . PHE A  1  1040 ? 193.951 195.085 212.416 1.00   201.16 ? 1485 PHE A CZ  1 
ATOM   7902  N  N   . ASN A  1  1041 ? 190.404 198.760 213.936 1.00   173.14 ? 1486 ASN A N   1 
ATOM   7903  C  CA  . ASN A  1  1041 ? 190.231 198.293 215.317 1.00   177.88 ? 1486 ASN A CA  1 
ATOM   7904  C  C   . ASN A  1  1041 ? 188.877 197.733 215.529 1.00   180.61 ? 1486 ASN A C   1 
ATOM   7905  O  O   . ASN A  1  1041 ? 188.709 196.740 216.250 1.00   206.25 ? 1486 ASN A O   1 
ATOM   7906  C  CB  . ASN A  1  1041 ? 190.377 199.434 216.306 1.00   181.19 ? 1486 ASN A CB  1 
ATOM   7907  C  CG  . ASN A  1  1041 ? 191.742 200.053 216.264 1.00   210.61 ? 1486 ASN A CG  1 
ATOM   7908  O  OD1 . ASN A  1  1041 ? 192.726 199.394 215.923 1.00   223.34 ? 1486 ASN A OD1 1 
ATOM   7909  N  ND2 . ASN A  1  1041 ? 191.816 201.333 216.597 1.00   244.02 ? 1486 ASN A ND2 1 
ATOM   7910  N  N   . CYS A  1  1042 ? 187.905 198.389 214.907 1.00   163.51 ? 1487 CYS A N   1 
ATOM   7911  C  CA  . CYS A  1  1042 ? 186.529 198.012 215.092 1.00   172.99 ? 1487 CYS A CA  1 
ATOM   7912  C  C   . CYS A  1  1042 ? 186.096 196.778 214.259 1.00   162.64 ? 1487 CYS A C   1 
ATOM   7913  O  O   . CYS A  1  1042 ? 185.357 195.937 214.778 1.00   176.89 ? 1487 CYS A O   1 
ATOM   7914  C  CB  . CYS A  1  1042 ? 185.626 199.199 214.835 1.00   169.39 ? 1487 CYS A CB  1 
ATOM   7915  S  SG  . CYS A  1  1042 ? 184.959 199.119 213.189 1.00   169.26 ? 1487 CYS A SG  1 
ATOM   7916  N  N   . LEU A  1  1043 ? 186.524 196.660 212.996 1.00   145.74 ? 1488 LEU A N   1 
ATOM   7917  C  CA  . LEU A  1  1043 ? 186.216 195.417 212.230 1.00   135.56 ? 1488 LEU A CA  1 
ATOM   7918  C  C   . LEU A  1  1043 ? 186.985 194.229 212.769 1.00   134.58 ? 1488 LEU A C   1 
ATOM   7919  O  O   . LEU A  1  1043 ? 186.479 193.140 212.732 1.00   145.23 ? 1488 LEU A O   1 
ATOM   7920  C  CB  . LEU A  1  1043 ? 186.432 195.504 210.699 1.00   120.10 ? 1488 LEU A CB  1 
ATOM   7921  C  CG  . LEU A  1  1043 ? 185.592 196.537 209.939 1.00   125.27 ? 1488 LEU A CG  1 
ATOM   7922  C  CD1 . LEU A  1  1043 ? 185.745 196.442 208.423 1.00   108.75 ? 1488 LEU A CD1 1 
ATOM   7923  C  CD2 . LEU A  1  1043 ? 184.125 196.463 210.379 1.00   122.62 ? 1488 LEU A CD2 1 
ATOM   7924  N  N   . HIS A  1  1044 ? 188.197 194.436 213.276 1.00   159.19 ? 1489 HIS A N   1 
ATOM   7925  C  CA  . HIS A  1  1044 ? 188.985 193.350 213.850 1.00   145.45 ? 1489 HIS A CA  1 
ATOM   7926  C  C   . HIS A  1  1044 ? 188.225 192.771 215.016 1.00   161.45 ? 1489 HIS A C   1 
ATOM   7927  O  O   . HIS A  1  1044 ? 188.145 191.558 215.156 1.00   192.01 ? 1489 HIS A O   1 
ATOM   7928  C  CB  . HIS A  1  1044 ? 190.362 193.834 214.303 1.00   154.69 ? 1489 HIS A CB  1 
ATOM   7929  C  CG  . HIS A  1  1044 ? 191.317 192.724 214.529 1.00   172.59 ? 1489 HIS A CG  1 
ATOM   7930  N  ND1 . HIS A  1  1044 ? 191.764 191.919 213.505 1.00   186.37 ? 1489 HIS A ND1 1 
ATOM   7931  C  CD2 . HIS A  1  1044 ? 191.886 192.254 215.657 1.00   199.80 ? 1489 HIS A CD2 1 
ATOM   7932  C  CE1 . HIS A  1  1044 ? 192.582 191.005 213.990 1.00   210.90 ? 1489 HIS A CE1 1 
ATOM   7933  N  NE2 . HIS A  1  1044 ? 192.673 191.187 215.295 1.00   226.51 ? 1489 HIS A NE2 1 
ATOM   7934  N  N   . LYS A  1  1045 ? 187.667 193.668 215.837 1.00   171.39 ? 1490 LYS A N   1 
ATOM   7935  C  CA  . LYS A  1  1045 ? 186.803 193.312 216.957 1.00   176.52 ? 1490 LYS A CA  1 
ATOM   7936  C  C   . LYS A  1  1045 ? 185.693 192.370 216.508 1.00   173.56 ? 1490 LYS A C   1 
ATOM   7937  O  O   . LYS A  1  1045 ? 185.542 191.265 217.067 1.00   197.55 ? 1490 LYS A O   1 
ATOM   7938  C  CB  . LYS A  1  1045 ? 186.229 194.581 217.601 1.00   174.72 ? 1490 LYS A CB  1 
ATOM   7939  C  CG  . LYS A  1  1045 ? 185.005 194.410 218.498 1.00   198.14 ? 1490 LYS A CG  1 
ATOM   7940  C  CD  . LYS A  1  1045 ? 184.401 195.755 218.862 1.00   228.43 ? 1490 LYS A CD  1 
ATOM   7941  C  CE  . LYS A  1  1045 ? 185.253 196.525 219.870 1.00   261.89 ? 1490 LYS A CE  1 
ATOM   7942  N  NZ  . LYS A  1  1045 ? 185.287 197.994 219.591 1.00   282.97 ? 1490 LYS A NZ  1 
ATOM   7943  N  N   . PHE A  1  1046 ? 184.934 192.784 215.494 1.00   150.63 ? 1491 PHE A N   1 
ATOM   7944  C  CA  . PHE A  1  1046 ? 183.823 191.949 215.019 1.00   148.36 ? 1491 PHE A CA  1 
ATOM   7945  C  C   . PHE A  1  1046 ? 184.315 190.626 214.505 1.00   146.14 ? 1491 PHE A C   1 
ATOM   7946  O  O   . PHE A  1  1046 ? 183.658 189.620 214.752 1.00   185.33 ? 1491 PHE A O   1 
ATOM   7947  C  CB  . PHE A  1  1046 ? 182.931 192.611 213.965 1.00   139.14 ? 1491 PHE A CB  1 
ATOM   7948  C  CG  . PHE A  1  1046 ? 182.152 193.741 214.506 1.00   166.82 ? 1491 PHE A CG  1 
ATOM   7949  C  CD1 . PHE A  1  1046 ? 181.192 193.511 215.480 1.00   168.73 ? 1491 PHE A CD1 1 
ATOM   7950  C  CD2 . PHE A  1  1046 ? 182.417 195.042 214.102 1.00   196.21 ? 1491 PHE A CD2 1 
ATOM   7951  C  CE1 . PHE A  1  1046 ? 180.480 194.557 216.022 1.00   191.88 ? 1491 PHE A CE1 1 
ATOM   7952  C  CE2 . PHE A  1  1046 ? 181.715 196.101 214.645 1.00   217.32 ? 1491 PHE A CE2 1 
ATOM   7953  C  CZ  . PHE A  1  1046 ? 180.746 195.857 215.607 1.00   222.70 ? 1491 PHE A CZ  1 
ATOM   7954  N  N   . ALA A  1  1047 ? 185.466 190.593 213.831 1.00   151.75 ? 1492 ALA A N   1 
ATOM   7955  C  CA  . ALA A  1  1047 ? 185.960 189.312 213.316 1.00   149.94 ? 1492 ALA A CA  1 
ATOM   7956  C  C   . ALA A  1  1047 ? 186.427 188.414 214.477 1.00   161.27 ? 1492 ALA A C   1 
ATOM   7957  O  O   . ALA A  1  1047 ? 186.133 187.216 214.470 1.00   223.67 ? 1492 ALA A O   1 
ATOM   7958  C  CB  . ALA A  1  1047 ? 187.011 189.476 212.228 1.00   140.24 ? 1492 ALA A CB  1 
ATOM   7959  N  N   . LYS A  1  1048 ? 187.061 188.977 215.505 1.00   149.95 ? 1493 LYS A N   1 
ATOM   7960  C  CA  . LYS A  1  1048 ? 187.373 188.191 216.704 1.00   173.78 ? 1493 LYS A CA  1 
ATOM   7961  C  C   . LYS A  1  1048 ? 186.097 187.688 217.366 1.00   179.97 ? 1493 LYS A C   1 
ATOM   7962  O  O   . LYS A  1  1048 ? 186.011 186.520 217.765 1.00   219.99 ? 1493 LYS A O   1 
ATOM   7963  C  CB  . LYS A  1  1048 ? 188.151 189.025 217.711 1.00   193.71 ? 1493 LYS A CB  1 
ATOM   7964  C  CG  . LYS A  1  1048 ? 189.576 189.330 217.300 1.00   224.75 ? 1493 LYS A CG  1 
ATOM   7965  C  CD  . LYS A  1  1048 ? 190.129 190.464 218.154 1.00   263.14 ? 1493 LYS A CD  1 
ATOM   7966  C  CE  . LYS A  1  1048 ? 191.586 190.226 218.507 1.00   297.30 ? 1493 LYS A CE  1 
ATOM   7967  N  NZ  . LYS A  1  1048 ? 192.200 191.384 219.212 1.00   313.30 ? 1493 LYS A NZ  1 
ATOM   7968  N  N   . ASP A  1  1049 ? 185.124 188.588 217.479 1.00   159.36 ? 1494 ASP A N   1 
ATOM   7969  C  CA  . ASP A  1  1049 ? 183.816 188.270 218.047 1.00   184.27 ? 1494 ASP A CA  1 
ATOM   7970  C  C   . ASP A  1  1049 ? 183.082 187.187 217.255 1.00   151.20 ? 1494 ASP A C   1 
ATOM   7971  O  O   . ASP A  1  1049 ? 182.476 186.314 217.855 1.00   184.88 ? 1494 ASP A O   1 
ATOM   7972  C  CB  . ASP A  1  1049 ? 182.913 189.522 218.132 1.00   227.73 ? 1494 ASP A CB  1 
ATOM   7973  C  CG  . ASP A  1  1049 ? 183.309 190.487 219.255 1.00   250.15 ? 1494 ASP A CG  1 
ATOM   7974  O  OD1 . ASP A  1  1049 ? 183.634 190.030 220.379 1.00   260.87 ? 1494 ASP A OD1 1 
ATOM   7975  O  OD2 . ASP A  1  1049 ? 183.258 191.715 219.011 1.00   269.89 ? 1494 ASP A OD2 1 
ATOM   7976  N  N   . PHE A  1  1050 ? 183.108 187.264 215.929 1.00   125.35 ? 1495 PHE A N   1 
ATOM   7977  C  CA  . PHE A  1  1050 ? 182.461 186.251 215.072 1.00   153.78 ? 1495 PHE A CA  1 
ATOM   7978  C  C   . PHE A  1  1050 ? 183.127 184.906 215.180 1.00   170.42 ? 1495 PHE A C   1 
ATOM   7979  O  O   . PHE A  1  1050 ? 182.432 183.903 215.184 1.00   217.42 ? 1495 PHE A O   1 
ATOM   7980  C  CB  . PHE A  1  1050 ? 182.425 186.631 213.586 1.00   148.73 ? 1495 PHE A CB  1 
ATOM   7981  C  CG  . PHE A  1  1050 ? 181.206 187.368 213.199 1.00   152.99 ? 1495 PHE A CG  1 
ATOM   7982  C  CD1 . PHE A  1  1050 ? 179.988 186.719 213.191 1.00   172.86 ? 1495 PHE A CD1 1 
ATOM   7983  C  CD2 . PHE A  1  1050 ? 181.268 188.723 212.864 1.00   153.87 ? 1495 PHE A CD2 1 
ATOM   7984  C  CE1 . PHE A  1  1050 ? 178.847 187.415 212.846 1.00   200.88 ? 1495 PHE A CE1 1 
ATOM   7985  C  CE2 . PHE A  1  1050 ? 180.137 189.423 212.503 1.00   154.73 ? 1495 PHE A CE2 1 
ATOM   7986  C  CZ  . PHE A  1  1050 ? 178.921 188.771 212.498 1.00   184.01 ? 1495 PHE A CZ  1 
ATOM   7987  N  N   . MET A  1  1051 ? 184.451 184.864 215.287 1.00   159.66 ? 1496 MET A N   1 
ATOM   7988  C  CA  . MET A  1  1051 ? 185.107 183.579 215.455 1.00   171.66 ? 1496 MET A CA  1 
ATOM   7989  C  C   . MET A  1  1051 ? 184.701 182.912 216.798 1.00   190.44 ? 1496 MET A C   1 
ATOM   7990  O  O   . MET A  1  1051 ? 184.437 181.707 216.839 1.00   211.93 ? 1496 MET A O   1 
ATOM   7991  C  CB  . MET A  1  1051 ? 186.606 183.723 215.239 1.00   176.95 ? 1496 MET A CB  1 
ATOM   7992  C  CG  . MET A  1  1051 ? 186.896 184.259 213.836 1.00   194.54 ? 1496 MET A CG  1 
ATOM   7993  S  SD  . MET A  1  1051 ? 188.304 183.540 212.984 1.00   279.96 ? 1496 MET A SD  1 
ATOM   7994  C  CE  . MET A  1  1051 ? 187.699 181.879 212.694 1.00   284.86 ? 1496 MET A CE  1 
ATOM   7995  N  N   . THR A  1  1052 ? 184.540 183.698 217.855 1.00   194.96 ? 1497 THR A N   1 
ATOM   7996  C  CA  . THR A  1  1052 ? 183.995 183.164 219.116 1.00   188.48 ? 1497 THR A CA  1 
ATOM   7997  C  C   . THR A  1  1052 ? 182.571 182.598 218.995 1.00   181.06 ? 1497 THR A C   1 
ATOM   7998  O  O   . THR A  1  1052 ? 182.247 181.635 219.676 1.00   211.01 ? 1497 THR A O   1 
ATOM   7999  C  CB  . THR A  1  1052 ? 183.950 184.202 220.270 1.00   220.52 ? 1497 THR A CB  1 
ATOM   8000  O  OG1 . THR A  1  1052 ? 182.847 185.118 220.083 1.00   200.33 ? 1497 THR A OG1 1 
ATOM   8001  C  CG2 . THR A  1  1052 ? 185.304 184.946 220.436 1.00   219.80 ? 1497 THR A CG2 1 
ATOM   8002  N  N   . TYR A  1  1053 ? 181.722 183.219 218.171 1.00   176.81 ? 1498 TYR A N   1 
ATOM   8003  C  CA  . TYR A  1  1053 ? 180.330 182.750 217.967 1.00   180.65 ? 1498 TYR A CA  1 
ATOM   8004  C  C   . TYR A  1  1053 ? 180.254 181.352 217.357 1.00   172.49 ? 1498 TYR A C   1 
ATOM   8005  O  O   . TYR A  1  1053 ? 179.343 180.605 217.690 1.00   186.85 ? 1498 TYR A O   1 
ATOM   8006  C  CB  . TYR A  1  1053 ? 179.491 183.707 217.084 1.00   190.69 ? 1498 TYR A CB  1 
ATOM   8007  C  CG  . TYR A  1  1053 ? 178.681 184.753 217.825 1.00   204.74 ? 1498 TYR A CG  1 
ATOM   8008  C  CD1 . TYR A  1  1053 ? 179.296 185.903 218.327 1.00   214.80 ? 1498 TYR A CD1 1 
ATOM   8009  C  CD2 . TYR A  1  1053 ? 177.293 184.612 218.006 1.00   214.09 ? 1498 TYR A CD2 1 
ATOM   8010  C  CE1 . TYR A  1  1053 ? 178.575 186.884 219.000 1.00   230.23 ? 1498 TYR A CE1 1 
ATOM   8011  C  CE2 . TYR A  1  1053 ? 176.556 185.588 218.685 1.00   249.16 ? 1498 TYR A CE2 1 
ATOM   8012  C  CZ  . TYR A  1  1053 ? 177.202 186.731 219.187 1.00   252.30 ? 1498 TYR A CZ  1 
ATOM   8013  O  OH  . TYR A  1  1053 ? 176.503 187.723 219.877 1.00   210.27 ? 1498 TYR A OH  1 
ATOM   8014  N  N   . LEU A  1  1054 ? 181.186 181.020 216.457 1.00   163.60 ? 1499 LEU A N   1 
ATOM   8015  C  CA  . LEU A  1  1054 ? 181.190 179.703 215.793 1.00   171.06 ? 1499 LEU A CA  1 
ATOM   8016  C  C   . LEU A  1  1054 ? 181.482 178.618 216.813 1.00   194.36 ? 1499 LEU A C   1 
ATOM   8017  O  O   . LEU A  1  1054 ? 180.838 177.575 216.834 1.00   203.68 ? 1499 LEU A O   1 
ATOM   8018  C  CB  . LEU A  1  1054 ? 182.249 179.620 214.704 1.00   179.76 ? 1499 LEU A CB  1 
ATOM   8019  C  CG  . LEU A  1  1054 ? 181.988 180.247 213.335 1.00   207.14 ? 1499 LEU A CG  1 
ATOM   8020  C  CD1 . LEU A  1  1054 ? 181.656 181.727 213.403 1.00   230.21 ? 1499 LEU A CD1 1 
ATOM   8021  C  CD2 . LEU A  1  1054 ? 183.229 180.053 212.463 1.00   220.13 ? 1499 LEU A CD2 1 
ATOM   8022  N  N   . SER A  1  1055 ? 182.488 178.872 217.634 1.00   209.02 ? 1500 SER A N   1 
ATOM   8023  C  CA  . SER A  1  1055 ? 182.801 178.003 218.755 1.00   221.88 ? 1500 SER A CA  1 
ATOM   8024  C  C   . SER A  1  1055 ? 181.952 178.334 219.996 1.00   231.95 ? 1500 SER A C   1 
ATOM   8025  O  O   . SER A  1  1055 ? 182.492 178.836 220.978 1.00   283.52 ? 1500 SER A O   1 
ATOM   8026  C  CB  . SER A  1  1055 ? 184.297 178.121 219.090 1.00   242.07 ? 1500 SER A CB  1 
ATOM   8027  O  OG  . SER A  1  1055 ? 184.619 177.417 220.279 1.00   265.37 ? 1500 SER A OG  1 
ATOM   8028  N  N   . ALA A  1  1056 ? 180.649 178.042 219.980 1.00   223.50 ? 1501 ALA A N   1 
ATOM   8029  C  CA  . ALA A  1  1056 ? 179.787 178.268 221.172 1.00   225.86 ? 1501 ALA A CA  1 
ATOM   8030  C  C   . ALA A  1  1056 ? 178.422 177.566 221.044 1.00   245.16 ? 1501 ALA A C   1 
ATOM   8031  O  O   . ALA A  1  1056 ? 178.029 177.172 219.944 1.00   230.32 ? 1501 ALA A O   1 
ATOM   8032  C  CB  . ALA A  1  1056 ? 179.595 179.773 221.438 1.00   179.37 ? 1501 ALA A CB  1 
ATOM   8033  N  N   . PRO A  1  1057 ? 177.706 177.386 222.179 1.00   267.31 ? 1502 PRO A N   1 
ATOM   8034  C  CA  . PRO A  1  1057 ? 176.280 177.049 222.126 1.00   250.77 ? 1502 PRO A CA  1 
ATOM   8035  C  C   . PRO A  1  1057 ? 175.505 178.340 221.912 1.00   248.79 ? 1502 PRO A C   1 
ATOM   8036  O  O   . PRO A  1  1057 ? 175.913 179.385 222.433 1.00   218.30 ? 1502 PRO A O   1 
ATOM   8037  C  CB  . PRO A  1  1057 ? 176.010 176.467 223.507 1.00   259.12 ? 1502 PRO A CB  1 
ATOM   8038  C  CG  . PRO A  1  1057 ? 176.960 177.198 224.398 1.00   282.71 ? 1502 PRO A CG  1 
ATOM   8039  C  CD  . PRO A  1  1057 ? 178.172 177.552 223.570 1.00   277.41 ? 1502 PRO A CD  1 
ATOM   8040  N  N   . ASN A  1  1058 ? 174.393 178.249 221.180 1.00   244.90 ? 1503 ASN A N   1 
ATOM   8041  C  CA  . ASN A  1  1058 ? 173.754 179.389 220.481 1.00   258.13 ? 1503 ASN A CA  1 
ATOM   8042  C  C   . ASN A  1  1058 ? 174.110 179.385 218.973 1.00   244.75 ? 1503 ASN A C   1 
ATOM   8043  O  O   . ASN A  1  1058 ? 173.432 180.026 218.180 1.00   240.47 ? 1503 ASN A O   1 
ATOM   8044  C  CB  . ASN A  1  1058 ? 174.068 180.765 221.126 1.00   268.34 ? 1503 ASN A CB  1 
ATOM   8045  C  CG  . ASN A  1  1058 ? 173.263 181.904 220.523 1.00   289.95 ? 1503 ASN A CG  1 
ATOM   8046  O  OD1 . ASN A  1  1058 ? 173.729 182.585 219.596 1.00   292.50 ? 1503 ASN A OD1 1 
ATOM   8047  N  ND2 . ASN A  1  1058 ? 172.052 182.122 221.042 1.00   280.54 ? 1503 ASN A ND2 1 
ATOM   8048  N  N   . ALA A  1  1059 ? 175.163 178.665 218.581 1.00   224.60 ? 1504 ALA A N   1 
ATOM   8049  C  CA  . ALA A  1  1059 ? 175.500 178.491 217.160 1.00   219.27 ? 1504 ALA A CA  1 
ATOM   8050  C  C   . ALA A  1  1059 ? 174.403 177.756 216.396 1.00   225.53 ? 1504 ALA A C   1 
ATOM   8051  O  O   . ALA A  1  1059 ? 174.059 178.135 215.272 1.00   266.31 ? 1504 ALA A O   1 
ATOM   8052  C  CB  . ALA A  1  1059 ? 176.802 177.725 217.022 1.00   235.26 ? 1504 ALA A CB  1 
ATOM   8053  N  N   . SER A  1  1060 ? 173.877 176.702 217.017 1.00   223.70 ? 1505 SER A N   1 
ATOM   8054  C  CA  . SER A  1  1060 ? 172.797 175.885 216.459 1.00   221.97 ? 1505 SER A CA  1 
ATOM   8055  C  C   . SER A  1  1060 ? 171.635 176.704 215.900 1.00   216.93 ? 1505 SER A C   1 
ATOM   8056  O  O   . SER A  1  1060 ? 171.247 176.527 214.743 1.00   238.66 ? 1505 SER A O   1 
ATOM   8057  C  CB  . SER A  1  1060 ? 172.263 174.935 217.543 1.00   228.26 ? 1505 SER A CB  1 
ATOM   8058  O  OG  . SER A  1  1060 ? 171.965 175.636 218.748 1.00   219.73 ? 1505 SER A OG  1 
ATOM   8059  N  N   . VAL A  1  1061 ? 171.109 177.608 216.724 1.00   209.04 ? 1506 VAL A N   1 
ATOM   8060  C  CA  . VAL A  1  1061 ? 169.882 178.357 216.385 1.00   195.32 ? 1506 VAL A CA  1 
ATOM   8061  C  C   . VAL A  1  1061 ? 170.113 179.381 215.282 1.00   192.66 ? 1506 VAL A C   1 
ATOM   8062  O  O   . VAL A  1  1061 ? 169.342 179.405 214.322 1.00   232.31 ? 1506 VAL A O   1 
ATOM   8063  C  CB  . VAL A  1  1061 ? 169.174 179.036 217.594 1.00   196.21 ? 1506 VAL A CB  1 
ATOM   8064  C  CG1 . VAL A  1  1061 ? 168.584 177.977 218.526 1.00   210.08 ? 1506 VAL A CG1 1 
ATOM   8065  C  CG2 . VAL A  1  1061 ? 170.074 180.031 218.340 1.00   171.62 ? 1506 VAL A CG2 1 
ATOM   8066  N  N   . THR A  1  1062 ? 171.184 180.178 215.397 1.00   159.68 ? 1507 THR A N   1 
ATOM   8067  C  CA  . THR A  1  1062 ? 171.541 181.179 214.379 1.00   162.12 ? 1507 THR A CA  1 
ATOM   8068  C  C   . THR A  1  1062 ? 171.944 180.540 213.026 1.00   176.74 ? 1507 THR A C   1 
ATOM   8069  O  O   . THR A  1  1062 ? 171.837 181.193 211.990 1.00   214.90 ? 1507 THR A O   1 
ATOM   8070  C  CB  . THR A  1  1062 ? 172.618 182.178 214.885 1.00   171.16 ? 1507 THR A CB  1 
ATOM   8071  O  OG1 . THR A  1  1062 ? 172.887 183.156 213.875 1.00   181.93 ? 1507 THR A OG1 1 
ATOM   8072  C  CG2 . THR A  1  1062 ? 173.928 181.500 215.231 1.00   189.77 ? 1507 THR A CG2 1 
ATOM   8073  N  N   . GLY A  1  1063 ? 172.350 179.271 213.033 1.00   200.00 ? 1508 GLY A N   1 
ATOM   8074  C  CA  . GLY A  1  1063 ? 172.679 178.549 211.803 1.00   189.61 ? 1508 GLY A CA  1 
ATOM   8075  C  C   . GLY A  1  1063 ? 174.189 178.557 211.703 1.00   197.96 ? 1508 GLY A C   1 
ATOM   8076  O  O   . GLY A  1  1063 ? 174.789 179.635 211.700 1.00   216.70 ? 1508 GLY A O   1 
ATOM   8077  N  N   . PRO A  1  1064 ? 174.814 177.363 211.649 1.00   185.99 ? 1509 PRO A N   1 
ATOM   8078  C  CA  . PRO A  1  1064 ? 176.264 177.299 211.461 1.00   184.49 ? 1509 PRO A CA  1 
ATOM   8079  C  C   . PRO A  1  1064 ? 176.684 177.945 210.140 1.00   180.18 ? 1509 PRO A C   1 
ATOM   8080  O  O   . PRO A  1  1064 ? 177.687 178.644 210.073 1.00   188.85 ? 1509 PRO A O   1 
ATOM   8081  C  CB  . PRO A  1  1064 ? 176.544 175.794 211.425 1.00   200.11 ? 1509 PRO A CB  1 
ATOM   8082  C  CG  . PRO A  1  1064 ? 175.396 175.167 212.136 1.00   199.21 ? 1509 PRO A CG  1 
ATOM   8083  C  CD  . PRO A  1  1064 ? 174.222 176.018 211.793 1.00   189.80 ? 1509 PRO A CD  1 
ATOM   8084  N  N   . HIS A  1  1065 ? 175.894 177.675 209.106 1.00   171.88 ? 1510 HIS A N   1 
ATOM   8085  C  CA  . HIS A  1  1065 ? 176.094 178.234 207.781 1.00   159.53 ? 1510 HIS A CA  1 
ATOM   8086  C  C   . HIS A  1  1065 ? 175.870 179.753 207.747 1.00   147.40 ? 1510 HIS A C   1 
ATOM   8087  O  O   . HIS A  1  1065 ? 176.620 180.459 207.104 1.00   175.55 ? 1510 HIS A O   1 
ATOM   8088  C  CB  . HIS A  1  1065 ? 175.152 177.528 206.811 1.00   169.58 ? 1510 HIS A CB  1 
ATOM   8089  C  CG  . HIS A  1  1065 ? 175.381 177.863 205.371 1.00   177.02 ? 1510 HIS A CG  1 
ATOM   8090  N  ND1 . HIS A  1  1065 ? 174.827 178.976 204.768 1.00   167.20 ? 1510 HIS A ND1 1 
ATOM   8091  C  CD2 . HIS A  1  1065 ? 176.067 177.210 204.402 1.00   187.46 ? 1510 HIS A CD2 1 
ATOM   8092  C  CE1 . HIS A  1  1065 ? 175.174 178.999 203.492 1.00   183.81 ? 1510 HIS A CE1 1 
ATOM   8093  N  NE2 . HIS A  1  1065 ? 175.926 177.940 203.244 1.00   195.34 ? 1510 HIS A NE2 1 
ATOM   8094  N  N   . ASN A  1  1066 ? 174.865 180.269 208.444 1.00   155.71 ? 1511 ASN A N   1 
ATOM   8095  C  CA  . ASN A  1  1066 ? 174.621 181.725 208.435 1.00   143.89 ? 1511 ASN A CA  1 
ATOM   8096  C  C   . ASN A  1  1066 ? 175.768 182.433 209.077 1.00   127.67 ? 1511 ASN A C   1 
ATOM   8097  O  O   . ASN A  1  1066 ? 176.106 183.518 208.670 1.00   183.20 ? 1511 ASN A O   1 
ATOM   8098  C  CB  . ASN A  1  1066 ? 173.342 182.143 209.184 1.00   157.38 ? 1511 ASN A CB  1 
ATOM   8099  C  CG  . ASN A  1  1066 ? 172.054 181.570 208.576 1.00   181.39 ? 1511 ASN A CG  1 
ATOM   8100  O  OD1 . ASN A  1  1066 ? 170.969 182.067 208.852 1.00   202.69 ? 1511 ASN A OD1 1 
ATOM   8101  N  ND2 . ASN A  1  1066 ? 172.166 180.521 207.766 1.00   202.20 ? 1511 ASN A ND2 1 
ATOM   8102  N  N   . LEU A  1  1067 ? 176.351 181.823 210.099 1.00   126.61 ? 1512 LEU A N   1 
ATOM   8103  C  CA  . LEU A  1  1067 ? 177.530 182.373 210.740 1.00   143.91 ? 1512 LEU A CA  1 
ATOM   8104  C  C   . LEU A  1  1067 ? 178.770 182.466 209.867 1.00   158.28 ? 1512 LEU A C   1 
ATOM   8105  O  O   . LEU A  1  1067 ? 179.495 183.472 209.931 1.00   173.87 ? 1512 LEU A O   1 
ATOM   8106  C  CB  . LEU A  1  1067 ? 177.857 181.579 211.966 1.00   142.78 ? 1512 LEU A CB  1 
ATOM   8107  C  CG  . LEU A  1  1067 ? 176.842 181.924 213.026 1.00   152.78 ? 1512 LEU A CG  1 
ATOM   8108  C  CD1 . LEU A  1  1067 ? 177.113 180.972 214.182 1.00   207.20 ? 1512 LEU A CD1 1 
ATOM   8109  C  CD2 . LEU A  1  1067 ? 176.946 183.401 213.434 1.00   155.85 ? 1512 LEU A CD2 1 
ATOM   8110  N  N   . GLU A  1  1068 ? 179.006 181.455 209.037 1.00   148.71 ? 1513 GLU A N   1 
ATOM   8111  C  CA  . GLU A  1  1068 ? 180.107 181.562 208.077 1.00   159.92 ? 1513 GLU A CA  1 
ATOM   8112  C  C   . GLU A  1  1068 ? 179.903 182.709 207.094 1.00   141.55 ? 1513 GLU A C   1 
ATOM   8113  O  O   . GLU A  1  1068 ? 180.837 183.454 206.836 1.00   170.01 ? 1513 GLU A O   1 
ATOM   8114  C  CB  . GLU A  1  1068 ? 180.327 180.284 207.272 1.00   189.52 ? 1513 GLU A CB  1 
ATOM   8115  C  CG  . GLU A  1  1068 ? 180.567 179.005 208.056 1.00   247.20 ? 1513 GLU A CG  1 
ATOM   8116  C  CD  . GLU A  1  1068 ? 181.802 179.039 208.930 1.00   305.65 ? 1513 GLU A CD  1 
ATOM   8117  O  OE1 . GLU A  1  1068 ? 182.089 180.085 209.554 1.00   345.72 ? 1513 GLU A OE1 1 
ATOM   8118  O  OE2 . GLU A  1  1068 ? 182.481 177.994 209.015 1.00   352.99 ? 1513 GLU A OE2 1 
ATOM   8119  N  N   . THR A  1  1069 ? 178.694 182.855 206.560 1.00   115.23 ? 1514 THR A N   1 
ATOM   8120  C  CA  . THR A  1  1069 ? 178.403 183.865 205.550 1.00   129.20 ? 1514 THR A CA  1 
ATOM   8121  C  C   . THR A  1  1069 ? 178.629 185.244 206.100 1.00   127.09 ? 1514 THR A C   1 
ATOM   8122  O  O   . THR A  1  1069 ? 179.236 186.059 205.439 1.00   158.89 ? 1514 THR A O   1 
ATOM   8123  C  CB  . THR A  1  1069 ? 176.946 183.819 205.010 1.00   161.97 ? 1514 THR A CB  1 
ATOM   8124  O  OG1 . THR A  1  1069 ? 176.662 182.556 204.391 1.00   193.11 ? 1514 THR A OG1 1 
ATOM   8125  C  CG2 . THR A  1  1069 ? 176.698 184.937 203.968 1.00   172.37 ? 1514 THR A CG2 1 
ATOM   8126  N  N   . CYS A  1  1070 ? 178.142 185.533 207.291 1.00   144.00 ? 1515 CYS A N   1 
ATOM   8127  C  CA  . CYS A  1  1070 ? 178.332 186.862 207.839 1.00   157.43 ? 1515 CYS A CA  1 
ATOM   8128  C  C   . CYS A  1  1070 ? 179.808 187.071 208.269 1.00   148.19 ? 1515 CYS A C   1 
ATOM   8129  O  O   . CYS A  1  1070 ? 180.289 188.200 208.240 1.00   136.91 ? 1515 CYS A O   1 
ATOM   8130  C  CB  . CYS A  1  1070 ? 177.340 187.126 208.966 1.00   174.13 ? 1515 CYS A CB  1 
ATOM   8131  S  SG  . CYS A  1  1070 ? 177.347 185.825 210.208 1.00   256.94 ? 1515 CYS A SG  1 
ATOM   8132  N  N   . LEU A  1  1071 ? 180.514 185.993 208.638 1.00   124.97 ? 1516 LEU A N   1 
ATOM   8133  C  CA  . LEU A  1  1071 ? 181.955 186.082 208.911 1.00   130.16 ? 1516 LEU A CA  1 
ATOM   8134  C  C   . LEU A  1  1071 ? 182.771 186.369 207.676 1.00   130.39 ? 1516 LEU A C   1 
ATOM   8135  O  O   . LEU A  1  1071 ? 183.722 187.139 207.711 1.00   141.35 ? 1516 LEU A O   1 
ATOM   8136  C  CB  . LEU A  1  1071 ? 182.520 184.799 209.477 1.00   137.39 ? 1516 LEU A CB  1 
ATOM   8137  C  CG  . LEU A  1  1071 ? 184.066 184.721 209.497 1.00   143.24 ? 1516 LEU A CG  1 
ATOM   8138  C  CD1 . LEU A  1  1071 ? 184.811 185.765 210.397 1.00   106.62 ? 1516 LEU A CD1 1 
ATOM   8139  C  CD2 . LEU A  1  1071 ? 184.373 183.269 209.852 1.00   160.82 ? 1516 LEU A CD2 1 
ATOM   8140  N  N   . SER A  1  1072 ? 182.472 185.655 206.605 1.00   136.75 ? 1517 SER A N   1 
ATOM   8141  C  CA  . SER A  1  1072 ? 183.138 185.881 205.318 1.00   146.80 ? 1517 SER A CA  1 
ATOM   8142  C  C   . SER A  1  1072 ? 183.002 187.314 204.872 1.00   132.14 ? 1517 SER A C   1 
ATOM   8143  O  O   . SER A  1  1072 ? 183.928 187.893 204.311 1.00   157.01 ? 1517 SER A O   1 
ATOM   8144  C  CB  . SER A  1  1072 ? 182.540 184.980 204.237 1.00   148.18 ? 1517 SER A CB  1 
ATOM   8145  O  OG  . SER A  1  1072 ? 182.848 183.629 204.525 1.00   189.62 ? 1517 SER A OG  1 
ATOM   8146  N  N   . VAL A  1  1073 ? 181.832 187.869 205.146 1.00   118.62 ? 1518 VAL A N   1 
ATOM   8147  C  CA  . VAL A  1  1073 ? 181.490 189.195 204.721 1.00   112.32 ? 1518 VAL A CA  1 
ATOM   8148  C  C   . VAL A  1  1073 ? 182.250 190.185 205.557 1.00   98.36  ? 1518 VAL A C   1 
ATOM   8149  O  O   . VAL A  1  1073 ? 182.885 191.047 204.983 1.00   118.90 ? 1518 VAL A O   1 
ATOM   8150  C  CB  . VAL A  1  1073 ? 179.949 189.406 204.712 1.00   128.63 ? 1518 VAL A CB  1 
ATOM   8151  C  CG1 . VAL A  1  1073 ? 179.551 190.826 205.055 1.00   143.24 ? 1518 VAL A CG1 1 
ATOM   8152  C  CG2 . VAL A  1  1073 ? 179.386 189.026 203.339 1.00   132.22 ? 1518 VAL A CG2 1 
ATOM   8153  N  N   . VAL A  1  1074 ? 182.206 190.088 206.883 1.00   106.03 ? 1519 VAL A N   1 
ATOM   8154  C  CA  . VAL A  1  1074 ? 183.005 191.019 207.729 1.00   114.71 ? 1519 VAL A CA  1 
ATOM   8155  C  C   . VAL A  1  1074 ? 184.517 190.949 207.441 1.00   128.24 ? 1519 VAL A C   1 
ATOM   8156  O  O   . VAL A  1  1074 ? 185.213 191.959 207.445 1.00   134.79 ? 1519 VAL A O   1 
ATOM   8157  C  CB  . VAL A  1  1074 ? 182.805 190.807 209.237 1.00   118.76 ? 1519 VAL A CB  1 
ATOM   8158  C  CG1 . VAL A  1  1074 ? 183.145 189.401 209.684 1.00   140.30 ? 1519 VAL A CG1 1 
ATOM   8159  C  CG2 . VAL A  1  1074 ? 183.682 191.751 210.033 1.00   132.83 ? 1519 VAL A CG2 1 
ATOM   8160  N  N   . LEU A  1  1075 ? 185.011 189.748 207.193 1.00   131.71 ? 1520 LEU A N   1 
ATOM   8161  C  CA  . LEU A  1  1075 ? 186.410 189.545 206.905 1.00   125.79 ? 1520 LEU A CA  1 
ATOM   8162  C  C   . LEU A  1  1075 ? 186.835 190.205 205.598 1.00   112.42 ? 1520 LEU A C   1 
ATOM   8163  O  O   . LEU A  1  1075 ? 187.892 190.793 205.537 1.00   129.35 ? 1520 LEU A O   1 
ATOM   8164  C  CB  . LEU A  1  1075 ? 186.677 188.057 206.811 1.00   141.02 ? 1520 LEU A CB  1 
ATOM   8165  C  CG  . LEU A  1  1075 ? 188.128 187.689 206.569 1.00   166.29 ? 1520 LEU A CG  1 
ATOM   8166  C  CD1 . LEU A  1  1075 ? 189.046 188.224 207.682 1.00   157.64 ? 1520 LEU A CD1 1 
ATOM   8167  C  CD2 . LEU A  1  1075 ? 188.169 186.175 206.400 1.00   175.58 ? 1520 LEU A CD2 1 
ATOM   8168  N  N   . LEU A  1  1076 ? 186.032 190.077 204.546 1.00   126.46 ? 1521 LEU A N   1 
ATOM   8169  C  CA  . LEU A  1  1076 ? 186.298 190.771 203.272 1.00   119.11 ? 1521 LEU A CA  1 
ATOM   8170  C  C   . LEU A  1  1076 ? 186.318 192.237 203.463 1.00   115.66 ? 1521 LEU A C   1 
ATOM   8171  O  O   . LEU A  1  1076 ? 187.107 192.902 202.849 1.00   138.65 ? 1521 LEU A O   1 
ATOM   8172  C  CB  . LEU A  1  1076 ? 185.220 190.535 202.231 1.00   134.55 ? 1521 LEU A CB  1 
ATOM   8173  C  CG  . LEU A  1  1076 ? 185.397 189.278 201.416 1.00   151.19 ? 1521 LEU A CG  1 
ATOM   8174  C  CD1 . LEU A  1  1076 ? 184.129 189.017 200.601 1.00   165.81 ? 1521 LEU A CD1 1 
ATOM   8175  C  CD2 . LEU A  1  1076 ? 186.636 189.448 200.550 1.00   154.58 ? 1521 LEU A CD2 1 
ATOM   8176  N  N   . SER A  1  1077 ? 185.430 192.751 204.300 1.00   122.89 ? 1522 SER A N   1 
ATOM   8177  C  CA  . SER A  1  1077 ? 185.392 194.176 204.613 1.00   129.70 ? 1522 SER A CA  1 
ATOM   8178  C  C   . SER A  1  1077 ? 186.672 194.599 205.287 1.00   115.19 ? 1522 SER A C   1 
ATOM   8179  O  O   . SER A  1  1077 ? 187.244 195.639 204.982 1.00   107.29 ? 1522 SER A O   1 
ATOM   8180  C  CB  . SER A  1  1077 ? 184.235 194.487 205.557 1.00   141.08 ? 1522 SER A CB  1 
ATOM   8181  O  OG  . SER A  1  1077 ? 183.033 193.955 205.060 1.00   161.04 ? 1522 SER A OG  1 
ATOM   8182  N  N   . LEU A  1  1078 ? 187.087 193.775 206.228 1.00   105.23 ? 1523 LEU A N   1 
ATOM   8183  C  CA  . LEU A  1  1078 ? 188.289 194.005 207.005 1.00   124.44 ? 1523 LEU A CA  1 
ATOM   8184  C  C   . LEU A  1  1078 ? 189.500 194.131 206.113 1.00   116.41 ? 1523 LEU A C   1 
ATOM   8185  O  O   . LEU A  1  1078 ? 190.328 195.009 206.282 1.00   143.27 ? 1523 LEU A O   1 
ATOM   8186  C  CB  . LEU A  1  1078 ? 188.482 192.817 207.921 1.00   142.49 ? 1523 LEU A CB  1 
ATOM   8187  C  CG  . LEU A  1  1078 ? 189.208 193.056 209.206 1.00   151.41 ? 1523 LEU A CG  1 
ATOM   8188  C  CD1 . LEU A  1  1078 ? 189.340 191.683 209.858 1.00   168.95 ? 1523 LEU A CD1 1 
ATOM   8189  C  CD2 . LEU A  1  1078 ? 190.545 193.736 208.978 1.00   142.63 ? 1523 LEU A CD2 1 
ATOM   8190  N  N   . ALA A  1  1079 ? 189.602 193.232 205.154 1.00   127.76 ? 1524 ALA A N   1 
ATOM   8191  C  CA  . ALA A  1  1079 ? 190.664 193.289 204.162 1.00   122.60 ? 1524 ALA A CA  1 
ATOM   8192  C  C   . ALA A  1  1079 ? 190.503 194.509 203.297 1.00   112.47 ? 1524 ALA A C   1 
ATOM   8193  O  O   . ALA A  1  1079 ? 191.421 195.300 203.167 1.00   134.88 ? 1524 ALA A O   1 
ATOM   8194  C  CB  . ALA A  1  1079 ? 190.657 192.036 203.285 1.00   118.99 ? 1524 ALA A CB  1 
ATOM   8195  N  N   . MET A  1  1080 ? 189.318 194.636 202.728 1.00   98.13  ? 1525 MET A N   1 
ATOM   8196  C  CA  . MET A  1  1080 ? 188.959 195.698 201.810 1.00   105.16 ? 1525 MET A CA  1 
ATOM   8197  C  C   . MET A  1  1080 ? 189.156 197.077 202.415 1.00   109.82 ? 1525 MET A C   1 
ATOM   8198  O  O   . MET A  1  1080 ? 189.438 197.947 201.647 1.00   98.11  ? 1525 MET A O   1 
ATOM   8199  C  CB  . MET A  1  1080 ? 187.500 195.513 201.386 1.00   131.63 ? 1525 MET A CB  1 
ATOM   8200  C  CG  . MET A  1  1080 ? 186.936 196.364 200.268 1.00   136.87 ? 1525 MET A CG  1 
ATOM   8201  S  SD  . MET A  1  1080 ? 185.115 196.311 200.281 1.00   184.77 ? 1525 MET A SD  1 
ATOM   8202  C  CE  . MET A  1  1080 ? 184.662 194.653 200.804 1.00   174.05 ? 1525 MET A CE  1 
ATOM   8203  N  N   . VAL A  1  1081 ? 189.036 197.290 203.749 1.00   124.89 ? 1526 VAL A N   1 
ATOM   8204  C  CA  . VAL A  1  1081 ? 189.417 198.613 204.370 1.00   129.58 ? 1526 VAL A CA  1 
ATOM   8205  C  C   . VAL A  1  1081 ? 190.882 198.832 204.320 1.00   114.36 ? 1526 VAL A C   1 
ATOM   8206  O  O   . VAL A  1  1081 ? 191.309 199.964 204.246 1.00   158.44 ? 1526 VAL A O   1 
ATOM   8207  C  CB  . VAL A  1  1081 ? 189.118 198.894 205.884 1.00   140.54 ? 1526 VAL A CB  1 
ATOM   8208  C  CG1 . VAL A  1  1081 ? 187.651 198.730 206.217 1.00   177.96 ? 1526 VAL A CG1 1 
ATOM   8209  C  CG2 . VAL A  1  1081 ? 190.010 198.105 206.853 1.00   139.65 ? 1526 VAL A CG2 1 
ATOM   8210  N  N   . MET A  1  1082 ? 191.636 197.758 204.465 1.00   107.08 ? 1527 MET A N   1 
ATOM   8211  C  CA  . MET A  1  1082 ? 193.057 197.869 204.459 1.00   134.92 ? 1527 MET A CA  1 
ATOM   8212  C  C   . MET A  1  1082 ? 193.601 196.912 203.454 1.00   149.07 ? 1527 MET A C   1 
ATOM   8213  O  O   . MET A  1  1082 ? 194.364 196.007 203.773 1.00   150.67 ? 1527 MET A O   1 
ATOM   8214  C  CB  . MET A  1  1082 ? 193.634 197.671 205.846 1.00   150.81 ? 1527 MET A CB  1 
ATOM   8215  C  CG  . MET A  1  1082 ? 193.234 196.438 206.599 1.00   159.29 ? 1527 MET A CG  1 
ATOM   8216  S  SD  . MET A  1  1082 ? 194.483 196.273 207.888 1.00   231.40 ? 1527 MET A SD  1 
ATOM   8217  C  CE  . MET A  1  1082 ? 194.464 197.864 208.744 1.00   218.09 ? 1527 MET A CE  1 
ATOM   8218  N  N   . ALA A  1  1083 ? 193.156 197.143 202.217 1.00   179.17 ? 1528 ALA A N   1 
ATOM   8219  C  CA  . ALA A  1  1083 ? 193.533 196.346 201.050 1.00   168.84 ? 1528 ALA A CA  1 
ATOM   8220  C  C   . ALA A  1  1083 ? 194.782 196.956 200.517 1.00   155.21 ? 1528 ALA A C   1 
ATOM   8221  O  O   . ALA A  1  1083 ? 194.853 198.175 200.283 1.00   165.40 ? 1528 ALA A O   1 
ATOM   8222  C  CB  . ALA A  1  1083 ? 192.454 196.346 199.954 1.00   146.88 ? 1528 ALA A CB  1 
ATOM   8223  N  N   . GLY A  1  1084 ? 195.770 196.097 200.344 1.00   130.31 ? 1529 GLY A N   1 
ATOM   8224  C  CA  . GLY A  1  1084 ? 196.923 196.438 199.581 1.00   135.52 ? 1529 GLY A CA  1 
ATOM   8225  C  C   . GLY A  1  1084 ? 198.170 196.252 200.371 1.00   148.86 ? 1529 GLY A C   1 
ATOM   8226  O  O   . GLY A  1  1084 ? 199.169 195.848 199.783 1.00   182.85 ? 1529 GLY A O   1 
ATOM   8227  N  N   . SER A  1  1085 ? 198.142 196.545 201.683 1.00   144.02 ? 1530 SER A N   1 
ATOM   8228  C  CA  . SER A  1  1085 ? 199.322 196.294 202.542 1.00   154.64 ? 1530 SER A CA  1 
ATOM   8229  C  C   . SER A  1  1085 ? 198.939 195.198 203.479 1.00   139.82 ? 1530 SER A C   1 
ATOM   8230  O  O   . SER A  1  1085 ? 198.217 195.461 204.437 1.00   137.51 ? 1530 SER A O   1 
ATOM   8231  C  CB  . SER A  1  1085 ? 199.670 197.501 203.372 1.00   181.99 ? 1530 SER A CB  1 
ATOM   8232  O  OG  . SER A  1  1085 ? 198.590 197.758 204.252 1.00   211.52 ? 1530 SER A OG  1 
ATOM   8233  N  N   . GLY A  1  1086 ? 199.389 193.978 203.172 1.00   136.32 ? 1531 GLY A N   1 
ATOM   8234  C  CA  . GLY A  1  1086 ? 198.937 192.782 203.842 1.00   114.53 ? 1531 GLY A CA  1 
ATOM   8235  C  C   . GLY A  1  1086 ? 199.399 192.947 205.250 1.00   137.86 ? 1531 GLY A C   1 
ATOM   8236  O  O   . GLY A  1  1086 ? 200.470 193.490 205.500 1.00   172.17 ? 1531 GLY A O   1 
ATOM   8237  N  N   . ASN A  1  1087 ? 198.551 192.550 206.169 1.00   135.22 ? 1532 ASN A N   1 
ATOM   8238  C  CA  . ASN A  1  1087 ? 198.721 192.916 207.551 1.00   152.26 ? 1532 ASN A CA  1 
ATOM   8239  C  C   . ASN A  1  1087 ? 198.782 191.682 208.400 1.00   141.51 ? 1532 ASN A C   1 
ATOM   8240  O  O   . ASN A  1  1087 ? 197.781 191.025 208.514 1.00   137.26 ? 1532 ASN A O   1 
ATOM   8241  C  CB  . ASN A  1  1087 ? 197.522 193.764 207.932 1.00   146.18 ? 1532 ASN A CB  1 
ATOM   8242  C  CG  . ASN A  1  1087 ? 197.828 194.709 209.030 1.00   166.26 ? 1532 ASN A CG  1 
ATOM   8243  O  OD1 . ASN A  1  1087 ? 198.938 195.257 209.123 1.00   162.09 ? 1532 ASN A OD1 1 
ATOM   8244  N  ND2 . ASN A  1  1087 ? 196.846 194.916 209.885 1.00   192.79 ? 1532 ASN A ND2 1 
ATOM   8245  N  N   . LEU A  1  1088 ? 199.918 191.367 209.021 1.00   154.23 ? 1533 LEU A N   1 
ATOM   8246  C  CA  . LEU A  1  1088 ? 200.011 190.129 209.766 1.00   164.01 ? 1533 LEU A CA  1 
ATOM   8247  C  C   . LEU A  1  1088 ? 198.752 189.912 210.631 1.00   179.97 ? 1533 LEU A C   1 
ATOM   8248  O  O   . LEU A  1  1088 ? 198.374 188.762 210.820 1.00   203.14 ? 1533 LEU A O   1 
ATOM   8249  C  CB  . LEU A  1  1088 ? 201.300 190.031 210.569 1.00   179.19 ? 1533 LEU A CB  1 
ATOM   8250  C  CG  . LEU A  1  1088 ? 201.679 191.179 211.515 1.00   224.07 ? 1533 LEU A CG  1 
ATOM   8251  C  CD1 . LEU A  1  1088 ? 200.739 191.347 212.714 1.00   231.74 ? 1533 LEU A CD1 1 
ATOM   8252  C  CD2 . LEU A  1  1088 ? 203.116 190.954 211.982 1.00   258.93 ? 1533 LEU A CD2 1 
ATOM   8253  N  N   . LYS A  1  1089 ? 198.078 190.992 211.085 1.00   149.94 ? 1534 LYS A N   1 
ATOM   8254  C  CA  . LYS A  1  1089 ? 196.811 190.860 211.833 1.00   148.27 ? 1534 LYS A CA  1 
ATOM   8255  C  C   . LYS A  1  1089 ? 195.723 190.211 211.036 1.00   137.61 ? 1534 LYS A C   1 
ATOM   8256  O  O   . LYS A  1  1089 ? 195.108 189.218 211.464 1.00   169.78 ? 1534 LYS A O   1 
ATOM   8257  C  CB  . LYS A  1  1089 ? 196.299 192.215 212.288 1.00   158.83 ? 1534 LYS A CB  1 
ATOM   8258  C  CG  . LYS A  1  1089 ? 196.953 192.705 213.560 1.00   176.25 ? 1534 LYS A CG  1 
ATOM   8259  C  CD  . LYS A  1  1089 ? 196.335 192.023 214.769 1.00   185.61 ? 1534 LYS A CD  1 
ATOM   8260  C  CE  . LYS A  1  1089 ? 197.246 192.127 215.980 1.00   227.20 ? 1534 LYS A CE  1 
ATOM   8261  N  NZ  . LYS A  1  1089 ? 198.596 191.520 215.766 1.00   239.72 ? 1534 LYS A NZ  1 
ATOM   8262  N  N   . VAL A  1  1090 ? 195.463 190.792 209.879 1.00   122.74 ? 1535 VAL A N   1 
ATOM   8263  C  CA  . VAL A  1  1090 ? 194.396 190.266 209.016 1.00   124.45 ? 1535 VAL A CA  1 
ATOM   8264  C  C   . VAL A  1  1090 ? 194.783 188.925 208.444 1.00   111.92 ? 1535 VAL A C   1 
ATOM   8265  O  O   . VAL A  1  1090 ? 193.977 188.041 208.371 1.00   155.51 ? 1535 VAL A O   1 
ATOM   8266  C  CB  . VAL A  1  1090 ? 194.058 191.193 207.833 1.00   119.96 ? 1535 VAL A CB  1 
ATOM   8267  C  CG1 . VAL A  1  1090 ? 192.776 190.729 207.123 1.00   104.25 ? 1535 VAL A CG1 1 
ATOM   8268  C  CG2 . VAL A  1  1090 ? 193.951 192.639 208.311 1.00   136.89 ? 1535 VAL A CG2 1 
ATOM   8269  N  N   . LEU A  1  1091 ? 196.024 188.801 208.023 1.00   120.16 ? 1536 LEU A N   1 
ATOM   8270  C  CA  . LEU A  1  1091 ? 196.515 187.622 207.351 1.00   113.11 ? 1536 LEU A CA  1 
ATOM   8271  C  C   . LEU A  1  1091 ? 196.532 186.461 208.293 1.00   125.66 ? 1536 LEU A C   1 
ATOM   8272  O  O   . LEU A  1  1091 ? 196.207 185.370 207.866 1.00   152.08 ? 1536 LEU A O   1 
ATOM   8273  C  CB  . LEU A  1  1091 ? 197.919 187.866 206.879 1.00   116.36 ? 1536 LEU A CB  1 
ATOM   8274  C  CG  . LEU A  1  1091 ? 198.713 186.924 206.003 1.00   113.38 ? 1536 LEU A CG  1 
ATOM   8275  C  CD1 . LEU A  1  1091 ? 200.161 187.352 206.263 1.00   115.74 ? 1536 LEU A CD1 1 
ATOM   8276  C  CD2 . LEU A  1  1091 ? 198.531 185.425 206.240 1.00   117.69 ? 1536 LEU A CD2 1 
ATOM   8277  N  N   . GLN A  1  1092 ? 196.903 186.652 209.561 1.00   124.40 ? 1537 GLN A N   1 
ATOM   8278  C  CA  . GLN A  1  1092 ? 196.885 185.497 210.451 1.00   140.00 ? 1537 GLN A CA  1 
ATOM   8279  C  C   . GLN A  1  1092 ? 195.459 185.013 210.574 1.00   131.50 ? 1537 GLN A C   1 
ATOM   8280  O  O   . GLN A  1  1092 ? 195.184 183.808 210.547 1.00   154.49 ? 1537 GLN A O   1 
ATOM   8281  C  CB  . GLN A  1  1092 ? 197.558 185.714 211.786 1.00   145.24 ? 1537 GLN A CB  1 
ATOM   8282  C  CG  . GLN A  1  1092 ? 196.991 186.793 212.651 1.00   160.05 ? 1537 GLN A CG  1 
ATOM   8283  C  CD  . GLN A  1  1092 ? 198.049 187.389 213.580 1.00   195.76 ? 1537 GLN A CD  1 
ATOM   8284  O  OE1 . GLN A  1  1092 ? 199.268 187.233 213.372 1.00   150.39 ? 1537 GLN A OE1 1 
ATOM   8285  N  NE2 . GLN A  1  1092 ? 197.583 188.083 214.617 1.00   232.10 ? 1537 GLN A NE2 1 
ATOM   8286  N  N   . LEU A  1  1093 ? 194.550 185.959 210.605 1.00   118.17 ? 1538 LEU A N   1 
ATOM   8287  C  CA  . LEU A  1  1093 ? 193.130 185.625 210.604 1.00   154.25 ? 1538 LEU A CA  1 
ATOM   8288  C  C   . LEU A  1  1093 ? 192.670 184.803 209.336 1.00   128.80 ? 1538 LEU A C   1 
ATOM   8289  O  O   . LEU A  1  1093 ? 191.907 183.854 209.434 1.00   132.51 ? 1538 LEU A O   1 
ATOM   8290  C  CB  . LEU A  1  1093 ? 192.366 186.933 210.745 1.00   159.03 ? 1538 LEU A CB  1 
ATOM   8291  C  CG  . LEU A  1  1093 ? 191.056 186.927 211.463 1.00   161.80 ? 1538 LEU A CG  1 
ATOM   8292  C  CD1 . LEU A  1  1093 ? 190.526 188.342 211.276 1.00   166.39 ? 1538 LEU A CD1 1 
ATOM   8293  C  CD2 . LEU A  1  1093 ? 190.123 185.853 210.892 1.00   161.15 ? 1538 LEU A CD2 1 
ATOM   8294  N  N   . CYS A  1  1094 ? 193.144 185.220 208.170 1.00   129.38 ? 1539 CYS A N   1 
ATOM   8295  C  CA  . CYS A  1  1094 ? 192.879 184.560 206.890 1.00   138.25 ? 1539 CYS A CA  1 
ATOM   8296  C  C   . CYS A  1  1094 ? 193.502 183.186 206.866 1.00   139.34 ? 1539 CYS A C   1 
ATOM   8297  O  O   . CYS A  1  1094 ? 192.931 182.280 206.285 1.00   140.61 ? 1539 CYS A O   1 
ATOM   8298  C  CB  . CYS A  1  1094 ? 193.466 185.343 205.685 1.00   165.15 ? 1539 CYS A CB  1 
ATOM   8299  S  SG  . CYS A  1  1094 ? 192.612 186.855 205.130 1.00   215.94 ? 1539 CYS A SG  1 
ATOM   8300  N  N   . ARG A  1  1095 ? 194.699 183.037 207.443 1.00   147.38 ? 1540 ARG A N   1 
ATOM   8301  C  CA  . ARG A  1  1095 ? 195.399 181.732 207.448 1.00   134.23 ? 1540 ARG A CA  1 
ATOM   8302  C  C   . ARG A  1  1095 ? 194.542 180.778 208.207 1.00   129.95 ? 1540 ARG A C   1 
ATOM   8303  O  O   . ARG A  1  1095 ? 194.146 179.751 207.682 1.00   141.10 ? 1540 ARG A O   1 
ATOM   8304  C  CB  . ARG A  1  1095 ? 196.800 181.769 208.110 1.00   128.86 ? 1540 ARG A CB  1 
ATOM   8305  C  CG  . ARG A  1  1095 ? 197.657 180.478 208.011 1.00   130.39 ? 1540 ARG A CG  1 
ATOM   8306  C  CD  . ARG A  1  1095 ? 198.545 180.230 209.245 1.00   152.94 ? 1540 ARG A CD  1 
ATOM   8307  N  NE  . ARG A  1  1095 ? 200.051 180.318 209.176 1.00   183.38 ? 1540 ARG A NE  1 
ATOM   8308  C  CZ  . ARG A  1  1095 ? 200.891 181.413 209.152 1.00   178.70 ? 1540 ARG A CZ  1 
ATOM   8309  N  NH1 . ARG A  1  1095 ? 200.560 182.738 209.056 1.00   129.78 ? 1540 ARG A NH1 1 
ATOM   8310  N  NH2 . ARG A  1  1095 ? 202.192 181.170 209.213 1.00   153.01 ? 1540 ARG A NH2 1 
ATOM   8311  N  N   . PHE A  1  1096 ? 194.228 181.155 209.434 1.00   127.21 ? 1541 PHE A N   1 
ATOM   8312  C  CA  . PHE A  1  1096 ? 193.433 180.344 210.329 1.00   134.59 ? 1541 PHE A CA  1 
ATOM   8313  C  C   . PHE A  1  1096 ? 192.240 179.680 209.682 1.00   136.72 ? 1541 PHE A C   1 
ATOM   8314  O  O   . PHE A  1  1096 ? 192.008 178.494 209.902 1.00   187.11 ? 1541 PHE A O   1 
ATOM   8315  C  CB  . PHE A  1  1096 ? 192.946 181.230 211.453 1.00   138.97 ? 1541 PHE A CB  1 
ATOM   8316  C  CG  . PHE A  1  1096 ? 192.181 180.520 212.499 1.00   142.63 ? 1541 PHE A CG  1 
ATOM   8317  C  CD1 . PHE A  1  1096 ? 192.548 179.257 212.926 1.00   150.23 ? 1541 PHE A CD1 1 
ATOM   8318  C  CD2 . PHE A  1  1096 ? 191.128 181.147 213.110 1.00   174.92 ? 1541 PHE A CD2 1 
ATOM   8319  C  CE1 . PHE A  1  1096 ? 191.842 178.617 213.920 1.00   183.13 ? 1541 PHE A CE1 1 
ATOM   8320  C  CE2 . PHE A  1  1096 ? 190.419 180.515 214.116 1.00   207.42 ? 1541 PHE A CE2 1 
ATOM   8321  C  CZ  . PHE A  1  1096 ? 190.775 179.249 214.522 1.00   195.10 ? 1541 PHE A CZ  1 
ATOM   8322  N  N   . LEU A  1  1097 ? 191.505 180.439 208.880 1.00   133.09 ? 1542 LEU A N   1 
ATOM   8323  C  CA  . LEU A  1  1097 ? 190.305 179.924 208.205 1.00   143.42 ? 1542 LEU A CA  1 
ATOM   8324  C  C   . LEU A  1  1097 ? 190.642 178.992 207.063 1.00   150.00 ? 1542 LEU A C   1 
ATOM   8325  O  O   . LEU A  1  1097 ? 189.973 177.980 206.846 1.00   160.37 ? 1542 LEU A O   1 
ATOM   8326  C  CB  . LEU A  1  1097 ? 189.502 181.063 207.629 1.00   139.80 ? 1542 LEU A CB  1 
ATOM   8327  C  CG  . LEU A  1  1097 ? 188.944 181.954 208.703 1.00   148.77 ? 1542 LEU A CG  1 
ATOM   8328  C  CD1 . LEU A  1  1097 ? 188.583 183.292 208.075 1.00   155.74 ? 1542 LEU A CD1 1 
ATOM   8329  C  CD2 . LEU A  1  1097 ? 187.771 181.235 209.367 1.00   166.01 ? 1542 LEU A CD2 1 
ATOM   8330  N  N   . HIS A  1  1098 ? 191.672 179.371 206.320 1.00   145.23 ? 1543 HIS A N   1 
ATOM   8331  C  CA  . HIS A  1  1098 ? 192.173 178.597 205.201 1.00   141.81 ? 1543 HIS A CA  1 
ATOM   8332  C  C   . HIS A  1  1098 ? 192.574 177.205 205.696 1.00   139.61 ? 1543 HIS A C   1 
ATOM   8333  O  O   . HIS A  1  1098 ? 192.339 176.216 205.020 1.00   133.64 ? 1543 HIS A O   1 
ATOM   8334  C  CB  . HIS A  1  1098 ? 193.328 179.383 204.539 1.00   152.53 ? 1543 HIS A CB  1 
ATOM   8335  C  CG  . HIS A  1  1098 ? 194.317 178.548 203.783 1.00   159.89 ? 1543 HIS A CG  1 
ATOM   8336  N  ND1 . HIS A  1  1098 ? 195.643 178.461 204.141 1.00   158.09 ? 1543 HIS A ND1 1 
ATOM   8337  C  CD2 . HIS A  1  1098 ? 194.190 177.810 202.663 1.00   167.70 ? 1543 HIS A CD2 1 
ATOM   8338  C  CE1 . HIS A  1  1098 ? 196.283 177.682 203.292 1.00   163.39 ? 1543 HIS A CE1 1 
ATOM   8339  N  NE2 . HIS A  1  1098 ? 195.422 177.267 202.386 1.00   168.20 ? 1543 HIS A NE2 1 
ATOM   8340  N  N   . MET A  1  1099 ? 193.140 177.133 206.895 1.00   148.16 ? 1544 MET A N   1 
ATOM   8341  C  CA  . MET A  1  1099 ? 193.596 175.868 207.450 1.00   164.11 ? 1544 MET A CA  1 
ATOM   8342  C  C   . MET A  1  1099 ? 192.400 174.964 207.842 1.00   163.58 ? 1544 MET A C   1 
ATOM   8343  O  O   . MET A  1  1099 ? 192.498 173.730 207.737 1.00   159.53 ? 1544 MET A O   1 
ATOM   8344  C  CB  . MET A  1  1099 ? 194.542 176.118 208.632 1.00   181.14 ? 1544 MET A CB  1 
ATOM   8345  C  CG  . MET A  1  1099 ? 195.709 177.066 208.321 1.00   212.94 ? 1544 MET A CG  1 
ATOM   8346  S  SD  . MET A  1  1099 ? 197.374 176.465 208.665 1.00   281.23 ? 1544 MET A SD  1 
ATOM   8347  C  CE  . MET A  1  1099 ? 197.532 176.679 210.442 1.00   284.38 ? 1544 MET A CE  1 
ATOM   8348  N  N   . LYS A  1  1100 ? 191.288 175.578 208.255 1.00   154.85 ? 1545 LYS A N   1 
ATOM   8349  C  CA  . LYS A  1  1100 ? 190.115 174.852 208.752 1.00   178.03 ? 1545 LYS A CA  1 
ATOM   8350  C  C   . LYS A  1  1100 ? 189.560 173.826 207.790 1.00   191.64 ? 1545 LYS A C   1 
ATOM   8351  O  O   . LYS A  1  1100 ? 189.404 172.668 208.172 1.00   247.06 ? 1545 LYS A O   1 
ATOM   8352  C  CB  . LYS A  1  1100 ? 188.998 175.795 209.219 1.00   183.23 ? 1545 LYS A CB  1 
ATOM   8353  C  CG  . LYS A  1  1100 ? 189.239 176.301 210.641 1.00   210.80 ? 1545 LYS A CG  1 
ATOM   8354  C  CD  . LYS A  1  1100 ? 188.424 177.536 210.986 1.00   227.34 ? 1545 LYS A CD  1 
ATOM   8355  C  CE  . LYS A  1  1100 ? 186.964 177.198 211.222 1.00   238.58 ? 1545 LYS A CE  1 
ATOM   8356  N  NZ  . LYS A  1  1100 ? 186.114 178.423 211.222 1.00   244.67 ? 1545 LYS A NZ  1 
ATOM   8357  N  N   . THR A  1  1101 ? 189.288 174.210 206.553 1.00   181.67 ? 1546 THR A N   1 
ATOM   8358  C  CA  . THR A  1  1101 ? 188.689 173.259 205.581 1.00   223.85 ? 1546 THR A CA  1 
ATOM   8359  C  C   . THR A  1  1101 ? 187.515 172.510 206.257 1.00   231.83 ? 1546 THR A C   1 
ATOM   8360  O  O   . THR A  1  1101 ? 186.697 173.152 206.934 1.00   256.36 ? 1546 THR A O   1 
ATOM   8361  C  CB  . THR A  1  1101 ? 189.698 172.245 204.925 1.00   231.00 ? 1546 THR A CB  1 
ATOM   8362  O  OG1 . THR A  1  1101 ? 189.728 171.018 205.663 1.00   239.66 ? 1546 THR A OG1 1 
ATOM   8363  C  CG2 . THR A  1  1101 ? 191.122 172.796 204.798 1.00   242.38 ? 1546 THR A CG2 1 
ATOM   8364  N  N   . GLY A  1  1102 ? 187.421 171.184 206.087 1.00   200.66 ? 1547 GLY A N   1 
ATOM   8365  C  CA  . GLY A  1  1102 ? 186.503 170.385 206.889 1.00   203.59 ? 1547 GLY A CA  1 
ATOM   8366  C  C   . GLY A  1  1102 ? 185.048 170.520 206.461 1.00   216.00 ? 1547 GLY A C   1 
ATOM   8367  O  O   . GLY A  1  1102 ? 184.762 170.662 205.252 1.00   206.30 ? 1547 GLY A O   1 
ATOM   8368  N  N   . GLY A  1  1103 ? 184.138 170.468 207.449 1.00   183.64 ? 1548 GLY A N   1 
ATOM   8369  C  CA  . GLY A  1  1103 ? 182.690 170.413 207.199 1.00   196.78 ? 1548 GLY A CA  1 
ATOM   8370  C  C   . GLY A  1  1103 ? 182.025 171.734 207.537 1.00   218.74 ? 1548 GLY A C   1 
ATOM   8371  O  O   . GLY A  1  1103 ? 182.412 172.394 208.511 1.00   250.94 ? 1548 GLY A O   1 
ATOM   8372  N  N   . GLU A  1  1104 ? 181.024 172.119 206.736 1.00   200.35 ? 1549 GLU A N   1 
ATOM   8373  C  CA  . GLU A  1  1104 ? 180.399 173.457 206.797 1.00   207.81 ? 1549 GLU A CA  1 
ATOM   8374  C  C   . GLU A  1  1104 ? 181.294 174.594 206.263 1.00   215.71 ? 1549 GLU A C   1 
ATOM   8375  O  O   . GLU A  1  1104 ? 180.986 175.767 206.478 1.00   227.93 ? 1549 GLU A O   1 
ATOM   8376  C  CB  . GLU A  1  1104 ? 179.917 173.794 208.219 1.00   210.15 ? 1549 GLU A CB  1 
ATOM   8377  N  N   . MET A  1  1105 ? 182.389 174.232 205.581 1.00   213.54 ? 1550 MET A N   1 
ATOM   8378  C  CA  . MET A  1  1105 ? 183.273 175.165 204.869 1.00   178.93 ? 1550 MET A CA  1 
ATOM   8379  C  C   . MET A  1  1105 ? 183.299 174.608 203.440 1.00   191.61 ? 1550 MET A C   1 
ATOM   8380  O  O   . MET A  1  1105 ? 184.179 173.851 202.995 1.00   201.35 ? 1550 MET A O   1 
ATOM   8381  C  CB  . MET A  1  1105 ? 184.668 175.252 205.502 1.00   168.77 ? 1550 MET A CB  1 
ATOM   8382  C  CG  . MET A  1  1105 ? 185.329 176.599 205.372 1.00   194.92 ? 1550 MET A CG  1 
ATOM   8383  S  SD  . MET A  1  1105 ? 184.624 177.791 206.535 1.00   273.20 ? 1550 MET A SD  1 
ATOM   8384  C  CE  . MET A  1  1105 ? 185.321 177.226 208.090 1.00   271.62 ? 1550 MET A CE  1 
ATOM   8385  N  N   . ASN A  1  1106 ? 182.232 174.943 202.754 1.00   185.62 ? 1551 ASN A N   1 
ATOM   8386  C  CA  . ASN A  1  1106 ? 182.093 174.667 201.354 1.00   166.26 ? 1551 ASN A CA  1 
ATOM   8387  C  C   . ASN A  1  1106 ? 183.075 175.460 200.478 1.00   161.21 ? 1551 ASN A C   1 
ATOM   8388  O  O   . ASN A  1  1106 ? 183.815 176.366 200.915 1.00   161.56 ? 1551 ASN A O   1 
ATOM   8389  C  CB  . ASN A  1  1106 ? 180.664 175.020 200.945 1.00   163.05 ? 1551 ASN A CB  1 
ATOM   8390  C  CG  . ASN A  1  1106 ? 180.371 176.516 201.090 1.00   177.62 ? 1551 ASN A CG  1 
ATOM   8391  O  OD1 . ASN A  1  1106 ? 180.946 177.191 201.943 1.00   141.56 ? 1551 ASN A OD1 1 
ATOM   8392  N  ND2 . ASN A  1  1106 ? 179.488 177.040 200.247 1.00   207.61 ? 1551 ASN A ND2 1 
ATOM   8393  N  N   . TYR A  1  1107 ? 183.035 175.091 199.213 1.00   139.41 ? 1552 TYR A N   1 
ATOM   8394  C  CA  . TYR A  1  1107 ? 183.710 175.809 198.164 1.00   134.87 ? 1552 TYR A CA  1 
ATOM   8395  C  C   . TYR A  1  1107 ? 183.598 177.338 198.261 1.00   125.52 ? 1552 TYR A C   1 
ATOM   8396  O  O   . TYR A  1  1107 ? 184.555 178.095 198.143 1.00   121.06 ? 1552 TYR A O   1 
ATOM   8397  C  CB  . TYR A  1  1107 ? 183.096 175.391 196.833 1.00   117.78 ? 1552 TYR A CB  1 
ATOM   8398  C  CG  . TYR A  1  1107 ? 183.627 176.199 195.678 1.00   122.25 ? 1552 TYR A CG  1 
ATOM   8399  C  CD1 . TYR A  1  1107 ? 184.976 176.339 195.462 1.00   114.19 ? 1552 TYR A CD1 1 
ATOM   8400  C  CD2 . TYR A  1  1107 ? 182.785 176.842 194.828 1.00   144.94 ? 1552 TYR A CD2 1 
ATOM   8401  C  CE1 . TYR A  1  1107 ? 185.460 177.104 194.440 1.00   110.85 ? 1552 TYR A CE1 1 
ATOM   8402  C  CE2 . TYR A  1  1107 ? 183.274 177.581 193.779 1.00   145.28 ? 1552 TYR A CE2 1 
ATOM   8403  C  CZ  . TYR A  1  1107 ? 184.617 177.696 193.598 1.00   126.46 ? 1552 TYR A CZ  1 
ATOM   8404  O  OH  . TYR A  1  1107 ? 185.110 178.428 192.558 1.00   169.60 ? 1552 TYR A OH  1 
ATOM   8405  N  N   . GLY A  1  1108 ? 182.383 177.782 198.409 1.00   131.71 ? 1553 GLY A N   1 
ATOM   8406  C  CA  . GLY A  1  1108 ? 182.133 179.190 198.398 1.00   144.03 ? 1553 GLY A CA  1 
ATOM   8407  C  C   . GLY A  1  1108 ? 182.921 179.906 199.459 1.00   120.91 ? 1553 GLY A C   1 
ATOM   8408  O  O   . GLY A  1  1108 ? 183.520 180.922 199.160 1.00   142.50 ? 1553 GLY A O   1 
ATOM   8409  N  N   . PHE A  1  1109 ? 182.927 179.400 200.690 1.00   112.28 ? 1554 PHE A N   1 
ATOM   8410  C  CA  . PHE A  1  1109 ? 183.495 180.194 201.752 1.00   108.13 ? 1554 PHE A CA  1 
ATOM   8411  C  C   . PHE A  1  1109 ? 184.947 180.221 201.608 1.00   119.69 ? 1554 PHE A C   1 
ATOM   8412  O  O   . PHE A  1  1109 ? 185.541 181.290 201.825 1.00   138.16 ? 1554 PHE A O   1 
ATOM   8413  C  CB  . PHE A  1  1109 ? 183.121 179.744 203.140 1.00   123.98 ? 1554 PHE A CB  1 
ATOM   8414  C  CG  . PHE A  1  1109 ? 181.679 179.892 203.424 1.00   132.88 ? 1554 PHE A CG  1 
ATOM   8415  C  CD1 . PHE A  1  1109 ? 180.952 180.964 202.895 1.00   133.64 ? 1554 PHE A CD1 1 
ATOM   8416  C  CD2 . PHE A  1  1109 ? 181.039 178.959 204.185 1.00   142.85 ? 1554 PHE A CD2 1 
ATOM   8417  C  CE1 . PHE A  1  1109 ? 179.617 181.084 203.119 1.00   138.72 ? 1554 PHE A CE1 1 
ATOM   8418  C  CE2 . PHE A  1  1109 ? 179.697 179.064 204.405 1.00   162.32 ? 1554 PHE A CE2 1 
ATOM   8419  C  CZ  . PHE A  1  1109 ? 178.987 180.135 203.880 1.00   160.86 ? 1554 PHE A CZ  1 
ATOM   8420  N  N   . HIS A  1  1110 ? 185.536 179.100 201.201 1.00   117.06 ? 1555 HIS A N   1 
ATOM   8421  C  CA  . HIS A  1  1110 ? 186.955 179.139 200.892 1.00   121.99 ? 1555 HIS A CA  1 
ATOM   8422  C  C   . HIS A  1  1110 ? 187.297 180.283 199.964 1.00   125.69 ? 1555 HIS A C   1 
ATOM   8423  O  O   . HIS A  1  1110 ? 188.137 181.114 200.270 1.00   150.77 ? 1555 HIS A O   1 
ATOM   8424  C  CB  . HIS A  1  1110 ? 187.373 177.870 200.265 1.00   111.96 ? 1555 HIS A CB  1 
ATOM   8425  C  CG  . HIS A  1  1110 ? 187.663 176.837 201.261 1.00   126.70 ? 1555 HIS A CG  1 
ATOM   8426  N  ND1 . HIS A  1  1110 ? 187.335 175.512 201.078 1.00   137.16 ? 1555 HIS A ND1 1 
ATOM   8427  C  CD2 . HIS A  1  1110 ? 188.228 176.941 202.481 1.00   131.39 ? 1555 HIS A CD2 1 
ATOM   8428  C  CE1 . HIS A  1  1110 ? 187.719 174.831 202.141 1.00   155.51 ? 1555 HIS A CE1 1 
ATOM   8429  N  NE2 . HIS A  1  1110 ? 188.249 175.679 203.008 1.00   159.35 ? 1555 HIS A NE2 1 
ATOM   8430  N  N   . LEU A  1  1111 ? 186.587 180.329 198.851 1.00   117.28 ? 1556 LEU A N   1 
ATOM   8431  C  CA  . LEU A  1  1111 ? 186.749 181.373 197.849 1.00   112.04 ? 1556 LEU A CA  1 
ATOM   8432  C  C   . LEU A  1  1111 ? 186.695 182.747 198.481 1.00   115.49 ? 1556 LEU A C   1 
ATOM   8433  O  O   . LEU A  1  1111 ? 187.537 183.584 198.192 1.00   177.35 ? 1556 LEU A O   1 
ATOM   8434  C  CB  . LEU A  1  1111 ? 185.698 181.142 196.747 1.00   122.10 ? 1556 LEU A CB  1 
ATOM   8435  C  CG  . LEU A  1  1111 ? 185.272 182.101 195.656 1.00   119.30 ? 1556 LEU A CG  1 
ATOM   8436  C  CD1 . LEU A  1  1111 ? 186.308 183.164 195.380 1.00   133.59 ? 1556 LEU A CD1 1 
ATOM   8437  C  CD2 . LEU A  1  1111 ? 184.949 181.281 194.403 1.00   112.37 ? 1556 LEU A CD2 1 
ATOM   8438  N  N   . ALA A  1  1112 ? 185.782 182.960 199.398 1.00   100.02 ? 1557 ALA A N   1 
ATOM   8439  C  CA  . ALA A  1  1112 ? 185.635 184.253 199.987 1.00   108.14 ? 1557 ALA A CA  1 
ATOM   8440  C  C   . ALA A  1  1112 ? 186.746 184.632 200.935 1.00   117.79 ? 1557 ALA A C   1 
ATOM   8441  O  O   . ALA A  1  1112 ? 187.075 185.809 201.001 1.00   131.20 ? 1557 ALA A O   1 
ATOM   8442  C  CB  . ALA A  1  1112 ? 184.336 184.306 200.731 1.00   153.34 ? 1557 ALA A CB  1 
ATOM   8443  N  N   . HIS A  1  1113 ? 187.274 183.674 201.707 1.00   117.78 ? 1558 HIS A N   1 
ATOM   8444  C  CA  . HIS A  1  1113 ? 188.440 183.956 202.573 1.00   124.00 ? 1558 HIS A CA  1 
ATOM   8445  C  C   . HIS A  1  1113 ? 189.687 184.229 201.730 1.00   125.40 ? 1558 HIS A C   1 
ATOM   8446  O  O   . HIS A  1  1113 ? 190.498 185.074 202.073 1.00   139.52 ? 1558 HIS A O   1 
ATOM   8447  C  CB  . HIS A  1  1113 ? 188.804 182.810 203.484 1.00   126.46 ? 1558 HIS A CB  1 
ATOM   8448  C  CG  . HIS A  1  1113 ? 187.672 182.271 204.271 1.00   145.45 ? 1558 HIS A CG  1 
ATOM   8449  N  ND1 . HIS A  1  1113 ? 187.488 180.915 204.455 1.00   158.11 ? 1558 HIS A ND1 1 
ATOM   8450  C  CD2 . HIS A  1  1113 ? 186.658 182.888 204.918 1.00   157.65 ? 1558 HIS A CD2 1 
ATOM   8451  C  CE1 . HIS A  1  1113 ? 186.412 180.724 205.199 1.00   165.16 ? 1558 HIS A CE1 1 
ATOM   8452  N  NE2 . HIS A  1  1113 ? 185.889 181.905 205.493 1.00   172.14 ? 1558 HIS A NE2 1 
ATOM   8453  N  N   . HIS A  1  1114 ? 189.849 183.501 200.634 1.00   114.76 ? 1559 HIS A N   1 
ATOM   8454  C  CA  . HIS A  1  1114 ? 190.976 183.731 199.744 1.00   116.11 ? 1559 HIS A CA  1 
ATOM   8455  C  C   . HIS A  1  1114 ? 190.863 185.096 199.069 1.00   120.69 ? 1559 HIS A C   1 
ATOM   8456  O  O   . HIS A  1  1114 ? 191.821 185.881 199.066 1.00   130.31 ? 1559 HIS A O   1 
ATOM   8457  C  CB  . HIS A  1  1114 ? 191.188 182.536 198.789 1.00   111.16 ? 1559 HIS A CB  1 
ATOM   8458  C  CG  . HIS A  1  1114 ? 191.568 181.327 199.554 1.00   131.10 ? 1559 HIS A CG  1 
ATOM   8459  N  ND1 . HIS A  1  1114 ? 192.623 181.352 200.430 1.00   156.31 ? 1559 HIS A ND1 1 
ATOM   8460  C  CD2 . HIS A  1  1114 ? 190.919 180.160 199.779 1.00   162.61 ? 1559 HIS A CD2 1 
ATOM   8461  C  CE1 . HIS A  1  1114 ? 192.675 180.207 201.079 1.00   184.94 ? 1559 HIS A CE1 1 
ATOM   8462  N  NE2 . HIS A  1  1114 ? 191.649 179.461 200.706 1.00   160.55 ? 1559 HIS A NE2 1 
ATOM   8463  N  N   . MET A  1  1115 ? 189.685 185.414 198.566 1.00   117.75 ? 1560 MET A N   1 
ATOM   8464  C  CA  . MET A  1  1115 ? 189.436 186.753 198.056 1.00   118.08 ? 1560 MET A CA  1 
ATOM   8465  C  C   . MET A  1  1115 ? 189.817 187.845 199.088 1.00   122.88 ? 1560 MET A C   1 
ATOM   8466  O  O   . MET A  1  1115 ? 190.199 188.946 198.710 1.00   132.13 ? 1560 MET A O   1 
ATOM   8467  C  CB  . MET A  1  1115 ? 187.985 186.922 197.588 1.00   117.02 ? 1560 MET A CB  1 
ATOM   8468  C  CG  . MET A  1  1115 ? 187.831 187.142 196.099 1.00   131.78 ? 1560 MET A CG  1 
ATOM   8469  S  SD  . MET A  1  1115 ? 186.276 187.952 195.668 1.00   192.90 ? 1560 MET A SD  1 
ATOM   8470  C  CE  . MET A  1  1115 ? 185.090 186.695 196.200 1.00   198.71 ? 1560 MET A CE  1 
ATOM   8471  N  N   . ALA A  1  1116 ? 189.687 187.551 200.382 1.00   127.44 ? 1561 ALA A N   1 
ATOM   8472  C  CA  . ALA A  1  1116 ? 190.145 188.481 201.426 1.00   130.18 ? 1561 ALA A CA  1 
ATOM   8473  C  C   . ALA A  1  1116 ? 191.632 188.567 201.383 1.00   113.42 ? 1561 ALA A C   1 
ATOM   8474  O  O   . ALA A  1  1116 ? 192.205 189.639 201.422 1.00   106.83 ? 1561 ALA A O   1 
ATOM   8475  C  CB  . ALA A  1  1116 ? 189.707 188.045 202.820 1.00   142.70 ? 1561 ALA A CB  1 
ATOM   8476  N  N   . LEU A  1  1117 ? 192.244 187.407 201.301 1.00   120.68 ? 1562 LEU A N   1 
ATOM   8477  C  CA  . LEU A  1  1117 ? 193.688 187.294 201.336 1.00   134.30 ? 1562 LEU A CA  1 
ATOM   8478  C  C   . LEU A  1  1117 ? 194.325 188.014 200.171 1.00   128.59 ? 1562 LEU A C   1 
ATOM   8479  O  O   . LEU A  1  1117 ? 195.296 188.733 200.345 1.00   120.17 ? 1562 LEU A O   1 
ATOM   8480  C  CB  . LEU A  1  1117 ? 194.079 185.819 201.306 1.00   138.60 ? 1562 LEU A CB  1 
ATOM   8481  C  CG  . LEU A  1  1117 ? 195.296 185.383 202.096 1.00   136.26 ? 1562 LEU A CG  1 
ATOM   8482  C  CD1 . LEU A  1  1117 ? 195.940 184.305 201.233 1.00   140.07 ? 1562 LEU A CD1 1 
ATOM   8483  C  CD2 . LEU A  1  1117 ? 196.280 186.511 202.478 1.00   126.72 ? 1562 LEU A CD2 1 
ATOM   8484  N  N   . GLY A  1  1118 ? 193.776 187.794 198.983 1.00   124.18 ? 1563 GLY A N   1 
ATOM   8485  C  CA  . GLY A  1  1118 ? 194.120 188.589 197.826 1.00   141.91 ? 1563 GLY A CA  1 
ATOM   8486  C  C   . GLY A  1  1118 ? 194.071 190.114 198.015 1.00   132.17 ? 1563 GLY A C   1 
ATOM   8487  O  O   . GLY A  1  1118 ? 195.031 190.804 197.671 1.00   127.99 ? 1563 GLY A O   1 
ATOM   8488  N  N   . LEU A  1  1119 ? 192.968 190.641 198.542 1.00   109.10 ? 1564 LEU A N   1 
ATOM   8489  C  CA  . LEU A  1  1119 ? 192.847 192.067 198.726 1.00   105.04 ? 1564 LEU A CA  1 
ATOM   8490  C  C   . LEU A  1  1119 ? 193.966 192.626 199.607 1.00   130.43 ? 1564 LEU A C   1 
ATOM   8491  O  O   . LEU A  1  1119 ? 194.474 193.724 199.321 1.00   172.71 ? 1564 LEU A O   1 
ATOM   8492  C  CB  . LEU A  1  1119 ? 191.495 192.422 199.318 1.00   117.61 ? 1564 LEU A CB  1 
ATOM   8493  C  CG  . LEU A  1  1119 ? 190.464 193.041 198.378 1.00   139.92 ? 1564 LEU A CG  1 
ATOM   8494  C  CD1 . LEU A  1  1119 ? 190.345 192.235 197.122 1.00   134.13 ? 1564 LEU A CD1 1 
ATOM   8495  C  CD2 . LEU A  1  1119 ? 189.090 193.141 199.030 1.00   159.17 ? 1564 LEU A CD2 1 
ATOM   8496  N  N   . LEU A  1  1120 ? 194.349 191.895 200.665 1.00   106.99 ? 1565 LEU A N   1 
ATOM   8497  C  CA  . LEU A  1  1120 ? 195.466 192.328 201.500 1.00   98.41  ? 1565 LEU A CA  1 
ATOM   8498  C  C   . LEU A  1  1120 ? 196.745 192.527 200.715 1.00   117.31 ? 1565 LEU A C   1 
ATOM   8499  O  O   . LEU A  1  1120 ? 197.424 193.508 200.943 1.00   158.27 ? 1565 LEU A O   1 
ATOM   8500  C  CB  . LEU A  1  1120 ? 195.791 191.312 202.534 1.00   95.03  ? 1565 LEU A CB  1 
ATOM   8501  C  CG  . LEU A  1  1120 ? 194.827 191.226 203.655 1.00   108.25 ? 1565 LEU A CG  1 
ATOM   8502  C  CD1 . LEU A  1  1120 ? 195.362 190.163 204.606 1.00   123.70 ? 1565 LEU A CD1 1 
ATOM   8503  C  CD2 . LEU A  1  1120 ? 194.651 192.576 204.330 1.00   113.75 ? 1565 LEU A CD2 1 
ATOM   8504  N  N   . PHE A  1  1121 ? 197.086 191.600 199.819 1.00   108.02 ? 1566 PHE A N   1 
ATOM   8505  C  CA  . PHE A  1  1121 ? 198.308 191.702 199.020 1.00   104.83 ? 1566 PHE A CA  1 
ATOM   8506  C  C   . PHE A  1  1121 ? 197.944 191.941 197.584 1.00   119.49 ? 1566 PHE A C   1 
ATOM   8507  O  O   . PHE A  1  1121 ? 198.575 191.397 196.665 1.00   133.73 ? 1566 PHE A O   1 
ATOM   8508  C  CB  . PHE A  1  1121 ? 199.150 190.431 199.119 1.00   112.80 ? 1566 PHE A CB  1 
ATOM   8509  C  CG  . PHE A  1  1121 ? 199.498 190.094 200.502 1.00   118.03 ? 1566 PHE A CG  1 
ATOM   8510  C  CD1 . PHE A  1  1121 ? 200.505 190.775 201.132 1.00   113.15 ? 1566 PHE A CD1 1 
ATOM   8511  C  CD2 . PHE A  1  1121 ? 198.740 189.163 201.209 1.00   126.02 ? 1566 PHE A CD2 1 
ATOM   8512  C  CE1 . PHE A  1  1121 ? 200.806 190.501 202.431 1.00   123.58 ? 1566 PHE A CE1 1 
ATOM   8513  C  CE2 . PHE A  1  1121 ? 199.006 188.899 202.521 1.00   116.96 ? 1566 PHE A CE2 1 
ATOM   8514  C  CZ  . PHE A  1  1121 ? 200.049 189.568 203.131 1.00   132.80 ? 1566 PHE A CZ  1 
ATOM   8515  N  N   . LEU A  1  1122 ? 196.947 192.793 197.377 1.00   124.07 ? 1567 LEU A N   1 
ATOM   8516  C  CA  . LEU A  1  1122 ? 196.499 193.107 196.041 1.00   114.83 ? 1567 LEU A CA  1 
ATOM   8517  C  C   . LEU A  1  1122 ? 197.636 193.738 195.255 1.00   121.11 ? 1567 LEU A C   1 
ATOM   8518  O  O   . LEU A  1  1122 ? 198.210 194.738 195.705 1.00   102.43 ? 1567 LEU A O   1 
ATOM   8519  C  CB  . LEU A  1  1122 ? 195.332 194.066 196.112 1.00   108.43 ? 1567 LEU A CB  1 
ATOM   8520  C  CG  . LEU A  1  1122 ? 194.770 194.450 194.757 1.00   112.19 ? 1567 LEU A CG  1 
ATOM   8521  C  CD1 . LEU A  1  1122 ? 194.216 193.224 194.039 1.00   117.19 ? 1567 LEU A CD1 1 
ATOM   8522  C  CD2 . LEU A  1  1122 ? 193.708 195.523 194.917 1.00   129.61 ? 1567 LEU A CD2 1 
ATOM   8523  N  N   . GLY A  1  1123 ? 197.943 193.122 194.107 1.00   121.01 ? 1568 GLY A N   1 
ATOM   8524  C  CA  . GLY A  1  1123 ? 198.965 193.584 193.172 1.00   106.67 ? 1568 GLY A CA  1 
ATOM   8525  C  C   . GLY A  1  1123 ? 200.357 193.427 193.735 1.00   128.25 ? 1568 GLY A C   1 
ATOM   8526  O  O   . GLY A  1  1123 ? 201.239 194.250 193.460 1.00   172.19 ? 1568 GLY A O   1 
ATOM   8527  N  N   . GLY A  1  1124 ? 200.570 192.393 194.544 1.00   149.03 ? 1569 GLY A N   1 
ATOM   8528  C  CA  . GLY A  1  1124 ? 201.817 192.266 195.305 1.00   152.94 ? 1569 GLY A CA  1 
ATOM   8529  C  C   . GLY A  1  1124 ? 202.178 193.567 196.004 1.00   125.29 ? 1569 GLY A C   1 
ATOM   8530  O  O   . GLY A  1  1124 ? 203.289 194.071 195.860 1.00   150.53 ? 1569 GLY A O   1 
ATOM   8531  N  N   . GLY A  1  1125 ? 201.209 194.130 196.702 1.00   99.63  ? 1570 GLY A N   1 
ATOM   8532  C  CA  . GLY A  1  1125 ? 201.405 195.373 197.426 1.00   122.41 ? 1570 GLY A CA  1 
ATOM   8533  C  C   . GLY A  1  1125 ? 201.479 196.687 196.640 1.00   128.25 ? 1570 GLY A C   1 
ATOM   8534  O  O   . GLY A  1  1125 ? 201.713 197.766 197.247 1.00   121.22 ? 1570 GLY A O   1 
ATOM   8535  N  N   . ARG A  1  1126 ? 201.276 196.608 195.323 1.00   104.96 ? 1571 ARG A N   1 
ATOM   8536