data_5A63
# 
_entry.id   5A63 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.314 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5A63         
PDBE  EBI-64164    
WWPDB D_1290064164 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2016-12-28 
_pdbx_database_PDB_obs_spr.pdb_id           5A63 
_pdbx_database_PDB_obs_spr.replace_pdb_id   4UPC 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.db_id          EMD-3061 
_pdbx_database_related.content_type   'associated EM volume' 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5A63 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-06-24 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bai, X.'         1 
'Yan, C.'         2 
'Yang, G.'        3 
'Lu, P.'          4 
'Ma, D.'          5 
'Sun, L.'         6 
'Zhou, R.'        7 
'Scheres, S.H.W.' 8 
'Shi, Y.'         9 
# 
_citation.id                        primary 
_citation.title                     'An Atomic Structure of Human Gamma-Secretase' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            525 
_citation.page_first                212 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26280335 
_citation.pdbx_database_id_DOI      10.1038/NATURE14892 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bai, X.'         1 ? 
primary 'Yan, C.'         2 ? 
primary 'Yang, G.'        3 ? 
primary 'Lu, P.'          4 ? 
primary 'Ma, D.'          5 ? 
primary 'Sun, L.'         6 ? 
primary 'Zhou, R.'        7 ? 
primary 'Scheres, S.H.W.' 8 ? 
primary 'Shi, Y.'         9 ? 
# 
_cell.entry_id           5A63 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5A63 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Nicastrin                              78483.570 1  ?        ? ? ? 
2 polymer     man Presenilin-1                           52713.535 1  3.4.23.- ? ? ? 
3 polymer     man 'Gamma-secretase subunit APH-1A'       29017.943 1  ?        ? ? ? 
4 polymer     man 'Gamma-secretase subunit PEN-2'        12038.029 1  ?        ? ? ? 
5 non-polymer man N-ACETYL-D-GLUCOSAMINE                 221.208   17 ?        ? ? ? 
6 non-polymer man BETA-D-MANNOSE                         180.156   3  ?        ? ? ? 
7 non-polymer syn 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE 790.145   2  ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 'PS-1,Protein S182'                                 
3 'APH-1a,Aph-1alpha,Presenilin-stabilization factor' 
4 'Presenilin enhancer protein 2'                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCR
EIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLAT
LEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQW
SSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
;
;MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCR
EIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLAT
LEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQW
SSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
;
A ? 
2 'polypeptide(L)' no no 
;MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK
HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST
ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
;
;MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK
HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST
ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
;
B ? 
3 'polypeptide(L)' no no 
;MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSV
LLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTS
AFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
;
;MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSV
LLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTS
AFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
;
C ? 
4 'polypeptide(L)' no no 
;MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQI
YRPRWGALGDYLSFTIPLGTP
;
;MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQI
YRPRWGALGDYLSFTIPLGTP
;
D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   THR n 
1 4   ALA n 
1 5   GLY n 
1 6   GLY n 
1 7   GLY n 
1 8   SER n 
1 9   GLY n 
1 10  ALA n 
1 11  ASP n 
1 12  PRO n 
1 13  GLY n 
1 14  SER n 
1 15  ARG n 
1 16  GLY n 
1 17  LEU n 
1 18  LEU n 
1 19  ARG n 
1 20  LEU n 
1 21  LEU n 
1 22  SER n 
1 23  PHE n 
1 24  CYS n 
1 25  VAL n 
1 26  LEU n 
1 27  LEU n 
1 28  ALA n 
1 29  GLY n 
1 30  LEU n 
1 31  CYS n 
1 32  ARG n 
1 33  GLY n 
1 34  ASN n 
1 35  SER n 
1 36  VAL n 
1 37  GLU n 
1 38  ARG n 
1 39  LYS n 
1 40  ILE n 
1 41  TYR n 
1 42  ILE n 
1 43  PRO n 
1 44  LEU n 
1 45  ASN n 
1 46  LYS n 
1 47  THR n 
1 48  ALA n 
1 49  PRO n 
1 50  CYS n 
1 51  VAL n 
1 52  ARG n 
1 53  LEU n 
1 54  LEU n 
1 55  ASN n 
1 56  ALA n 
1 57  THR n 
1 58  HIS n 
1 59  GLN n 
1 60  ILE n 
1 61  GLY n 
1 62  CYS n 
1 63  GLN n 
1 64  SER n 
1 65  SER n 
1 66  ILE n 
1 67  SER n 
1 68  GLY n 
1 69  ASP n 
1 70  THR n 
1 71  GLY n 
1 72  VAL n 
1 73  ILE n 
1 74  HIS n 
1 75  VAL n 
1 76  VAL n 
1 77  GLU n 
1 78  LYS n 
1 79  GLU n 
1 80  GLU n 
1 81  ASP n 
1 82  LEU n 
1 83  GLN n 
1 84  TRP n 
1 85  VAL n 
1 86  LEU n 
1 87  THR n 
1 88  ASP n 
1 89  GLY n 
1 90  PRO n 
1 91  ASN n 
1 92  PRO n 
1 93  PRO n 
1 94  TYR n 
1 95  MET n 
1 96  VAL n 
1 97  LEU n 
1 98  LEU n 
1 99  GLU n 
1 100 SER n 
1 101 LYS n 
1 102 HIS n 
1 103 PHE n 
1 104 THR n 
1 105 ARG n 
1 106 ASP n 
1 107 LEU n 
1 108 MET n 
1 109 GLU n 
1 110 LYS n 
1 111 LEU n 
1 112 LYS n 
1 113 GLY n 
1 114 ARG n 
1 115 THR n 
1 116 SER n 
1 117 ARG n 
1 118 ILE n 
1 119 ALA n 
1 120 GLY n 
1 121 LEU n 
1 122 ALA n 
1 123 VAL n 
1 124 SER n 
1 125 LEU n 
1 126 THR n 
1 127 LYS n 
1 128 PRO n 
1 129 SER n 
1 130 PRO n 
1 131 ALA n 
1 132 SER n 
1 133 GLY n 
1 134 PHE n 
1 135 SER n 
1 136 PRO n 
1 137 SER n 
1 138 VAL n 
1 139 GLN n 
1 140 CYS n 
1 141 PRO n 
1 142 ASN n 
1 143 ASP n 
1 144 GLY n 
1 145 PHE n 
1 146 GLY n 
1 147 VAL n 
1 148 TYR n 
1 149 SER n 
1 150 ASN n 
1 151 SER n 
1 152 TYR n 
1 153 GLY n 
1 154 PRO n 
1 155 GLU n 
1 156 PHE n 
1 157 ALA n 
1 158 HIS n 
1 159 CYS n 
1 160 ARG n 
1 161 GLU n 
1 162 ILE n 
1 163 GLN n 
1 164 TRP n 
1 165 ASN n 
1 166 SER n 
1 167 LEU n 
1 168 GLY n 
1 169 ASN n 
1 170 GLY n 
1 171 LEU n 
1 172 ALA n 
1 173 TYR n 
1 174 GLU n 
1 175 ASP n 
1 176 PHE n 
1 177 SER n 
1 178 PHE n 
1 179 PRO n 
1 180 ILE n 
1 181 PHE n 
1 182 LEU n 
1 183 LEU n 
1 184 GLU n 
1 185 ASP n 
1 186 GLU n 
1 187 ASN n 
1 188 GLU n 
1 189 THR n 
1 190 LYS n 
1 191 VAL n 
1 192 ILE n 
1 193 LYS n 
1 194 GLN n 
1 195 CYS n 
1 196 TYR n 
1 197 GLN n 
1 198 ASP n 
1 199 HIS n 
1 200 ASN n 
1 201 LEU n 
1 202 SER n 
1 203 GLN n 
1 204 ASN n 
1 205 GLY n 
1 206 SER n 
1 207 ALA n 
1 208 PRO n 
1 209 THR n 
1 210 PHE n 
1 211 PRO n 
1 212 LEU n 
1 213 CYS n 
1 214 ALA n 
1 215 MET n 
1 216 GLN n 
1 217 LEU n 
1 218 PHE n 
1 219 SER n 
1 220 HIS n 
1 221 MET n 
1 222 HIS n 
1 223 ALA n 
1 224 VAL n 
1 225 ILE n 
1 226 SER n 
1 227 THR n 
1 228 ALA n 
1 229 THR n 
1 230 CYS n 
1 231 MET n 
1 232 ARG n 
1 233 ARG n 
1 234 SER n 
1 235 SER n 
1 236 ILE n 
1 237 GLN n 
1 238 SER n 
1 239 THR n 
1 240 PHE n 
1 241 SER n 
1 242 ILE n 
1 243 ASN n 
1 244 PRO n 
1 245 GLU n 
1 246 ILE n 
1 247 VAL n 
1 248 CYS n 
1 249 ASP n 
1 250 PRO n 
1 251 LEU n 
1 252 SER n 
1 253 ASP n 
1 254 TYR n 
1 255 ASN n 
1 256 VAL n 
1 257 TRP n 
1 258 SER n 
1 259 MET n 
1 260 LEU n 
1 261 LYS n 
1 262 PRO n 
1 263 ILE n 
1 264 ASN n 
1 265 THR n 
1 266 THR n 
1 267 GLY n 
1 268 THR n 
1 269 LEU n 
1 270 LYS n 
1 271 PRO n 
1 272 ASP n 
1 273 ASP n 
1 274 ARG n 
1 275 VAL n 
1 276 VAL n 
1 277 VAL n 
1 278 ALA n 
1 279 ALA n 
1 280 THR n 
1 281 ARG n 
1 282 LEU n 
1 283 ASP n 
1 284 SER n 
1 285 ARG n 
1 286 SER n 
1 287 PHE n 
1 288 PHE n 
1 289 TRP n 
1 290 ASN n 
1 291 VAL n 
1 292 ALA n 
1 293 PRO n 
1 294 GLY n 
1 295 ALA n 
1 296 GLU n 
1 297 SER n 
1 298 ALA n 
1 299 VAL n 
1 300 ALA n 
1 301 SER n 
1 302 PHE n 
1 303 VAL n 
1 304 THR n 
1 305 GLN n 
1 306 LEU n 
1 307 ALA n 
1 308 ALA n 
1 309 ALA n 
1 310 GLU n 
1 311 ALA n 
1 312 LEU n 
1 313 GLN n 
1 314 LYS n 
1 315 ALA n 
1 316 PRO n 
1 317 ASP n 
1 318 VAL n 
1 319 THR n 
1 320 THR n 
1 321 LEU n 
1 322 PRO n 
1 323 ARG n 
1 324 ASN n 
1 325 VAL n 
1 326 MET n 
1 327 PHE n 
1 328 VAL n 
1 329 PHE n 
1 330 PHE n 
1 331 GLN n 
1 332 GLY n 
1 333 GLU n 
1 334 THR n 
1 335 PHE n 
1 336 ASP n 
1 337 TYR n 
1 338 ILE n 
1 339 GLY n 
1 340 SER n 
1 341 SER n 
1 342 ARG n 
1 343 MET n 
1 344 VAL n 
1 345 TYR n 
1 346 ASP n 
1 347 MET n 
1 348 GLU n 
1 349 LYS n 
1 350 GLY n 
1 351 LYS n 
1 352 PHE n 
1 353 PRO n 
1 354 VAL n 
1 355 GLN n 
1 356 LEU n 
1 357 GLU n 
1 358 ASN n 
1 359 VAL n 
1 360 ASP n 
1 361 SER n 
1 362 PHE n 
1 363 VAL n 
1 364 GLU n 
1 365 LEU n 
1 366 GLY n 
1 367 GLN n 
1 368 VAL n 
1 369 ALA n 
1 370 LEU n 
1 371 ARG n 
1 372 THR n 
1 373 SER n 
1 374 LEU n 
1 375 GLU n 
1 376 LEU n 
1 377 TRP n 
1 378 MET n 
1 379 HIS n 
1 380 THR n 
1 381 ASP n 
1 382 PRO n 
1 383 VAL n 
1 384 SER n 
1 385 GLN n 
1 386 LYS n 
1 387 ASN n 
1 388 GLU n 
1 389 SER n 
1 390 VAL n 
1 391 ARG n 
1 392 ASN n 
1 393 GLN n 
1 394 VAL n 
1 395 GLU n 
1 396 ASP n 
1 397 LEU n 
1 398 LEU n 
1 399 ALA n 
1 400 THR n 
1 401 LEU n 
1 402 GLU n 
1 403 LYS n 
1 404 SER n 
1 405 GLY n 
1 406 ALA n 
1 407 GLY n 
1 408 VAL n 
1 409 PRO n 
1 410 ALA n 
1 411 VAL n 
1 412 ILE n 
1 413 LEU n 
1 414 ARG n 
1 415 ARG n 
1 416 PRO n 
1 417 ASN n 
1 418 GLN n 
1 419 SER n 
1 420 GLN n 
1 421 PRO n 
1 422 LEU n 
1 423 PRO n 
1 424 PRO n 
1 425 SER n 
1 426 SER n 
1 427 LEU n 
1 428 GLN n 
1 429 ARG n 
1 430 PHE n 
1 431 LEU n 
1 432 ARG n 
1 433 ALA n 
1 434 ARG n 
1 435 ASN n 
1 436 ILE n 
1 437 SER n 
1 438 GLY n 
1 439 VAL n 
1 440 VAL n 
1 441 LEU n 
1 442 ALA n 
1 443 ASP n 
1 444 HIS n 
1 445 SER n 
1 446 GLY n 
1 447 ALA n 
1 448 PHE n 
1 449 HIS n 
1 450 ASN n 
1 451 LYS n 
1 452 TYR n 
1 453 TYR n 
1 454 GLN n 
1 455 SER n 
1 456 ILE n 
1 457 TYR n 
1 458 ASP n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 ASN n 
1 463 ILE n 
1 464 ASN n 
1 465 VAL n 
1 466 SER n 
1 467 TYR n 
1 468 PRO n 
1 469 GLU n 
1 470 TRP n 
1 471 LEU n 
1 472 SER n 
1 473 PRO n 
1 474 GLU n 
1 475 GLU n 
1 476 ASP n 
1 477 LEU n 
1 478 ASN n 
1 479 PHE n 
1 480 VAL n 
1 481 THR n 
1 482 ASP n 
1 483 THR n 
1 484 ALA n 
1 485 LYS n 
1 486 ALA n 
1 487 LEU n 
1 488 ALA n 
1 489 ASP n 
1 490 VAL n 
1 491 ALA n 
1 492 THR n 
1 493 VAL n 
1 494 LEU n 
1 495 GLY n 
1 496 ARG n 
1 497 ALA n 
1 498 LEU n 
1 499 TYR n 
1 500 GLU n 
1 501 LEU n 
1 502 ALA n 
1 503 GLY n 
1 504 GLY n 
1 505 THR n 
1 506 ASN n 
1 507 PHE n 
1 508 SER n 
1 509 ASP n 
1 510 THR n 
1 511 VAL n 
1 512 GLN n 
1 513 ALA n 
1 514 ASP n 
1 515 PRO n 
1 516 GLN n 
1 517 THR n 
1 518 VAL n 
1 519 THR n 
1 520 ARG n 
1 521 LEU n 
1 522 LEU n 
1 523 TYR n 
1 524 GLY n 
1 525 PHE n 
1 526 LEU n 
1 527 ILE n 
1 528 LYS n 
1 529 ALA n 
1 530 ASN n 
1 531 ASN n 
1 532 SER n 
1 533 TRP n 
1 534 PHE n 
1 535 GLN n 
1 536 SER n 
1 537 ILE n 
1 538 LEU n 
1 539 ARG n 
1 540 GLN n 
1 541 ASP n 
1 542 LEU n 
1 543 ARG n 
1 544 SER n 
1 545 TYR n 
1 546 LEU n 
1 547 GLY n 
1 548 ASP n 
1 549 GLY n 
1 550 PRO n 
1 551 LEU n 
1 552 GLN n 
1 553 HIS n 
1 554 TYR n 
1 555 ILE n 
1 556 ALA n 
1 557 VAL n 
1 558 SER n 
1 559 SER n 
1 560 PRO n 
1 561 THR n 
1 562 ASN n 
1 563 THR n 
1 564 THR n 
1 565 TYR n 
1 566 VAL n 
1 567 VAL n 
1 568 GLN n 
1 569 TYR n 
1 570 ALA n 
1 571 LEU n 
1 572 ALA n 
1 573 ASN n 
1 574 LEU n 
1 575 THR n 
1 576 GLY n 
1 577 THR n 
1 578 VAL n 
1 579 VAL n 
1 580 ASN n 
1 581 LEU n 
1 582 THR n 
1 583 ARG n 
1 584 GLU n 
1 585 GLN n 
1 586 CYS n 
1 587 GLN n 
1 588 ASP n 
1 589 PRO n 
1 590 SER n 
1 591 LYS n 
1 592 VAL n 
1 593 PRO n 
1 594 SER n 
1 595 GLU n 
1 596 ASN n 
1 597 LYS n 
1 598 ASP n 
1 599 LEU n 
1 600 TYR n 
1 601 GLU n 
1 602 TYR n 
1 603 SER n 
1 604 TRP n 
1 605 VAL n 
1 606 GLN n 
1 607 GLY n 
1 608 PRO n 
1 609 LEU n 
1 610 HIS n 
1 611 SER n 
1 612 ASN n 
1 613 GLU n 
1 614 THR n 
1 615 ASP n 
1 616 ARG n 
1 617 LEU n 
1 618 PRO n 
1 619 ARG n 
1 620 CYS n 
1 621 VAL n 
1 622 ARG n 
1 623 SER n 
1 624 THR n 
1 625 ALA n 
1 626 ARG n 
1 627 LEU n 
1 628 ALA n 
1 629 ARG n 
1 630 ALA n 
1 631 LEU n 
1 632 SER n 
1 633 PRO n 
1 634 ALA n 
1 635 PHE n 
1 636 GLU n 
1 637 LEU n 
1 638 SER n 
1 639 GLN n 
1 640 TRP n 
1 641 SER n 
1 642 SER n 
1 643 THR n 
1 644 GLU n 
1 645 TYR n 
1 646 SER n 
1 647 THR n 
1 648 TRP n 
1 649 THR n 
1 650 GLU n 
1 651 SER n 
1 652 ARG n 
1 653 TRP n 
1 654 LYS n 
1 655 ASP n 
1 656 ILE n 
1 657 ARG n 
1 658 ALA n 
1 659 ARG n 
1 660 ILE n 
1 661 PHE n 
1 662 LEU n 
1 663 ILE n 
1 664 ALA n 
1 665 SER n 
1 666 LYS n 
1 667 GLU n 
1 668 LEU n 
1 669 GLU n 
1 670 LEU n 
1 671 ILE n 
1 672 THR n 
1 673 LEU n 
1 674 THR n 
1 675 VAL n 
1 676 GLY n 
1 677 PHE n 
1 678 GLY n 
1 679 ILE n 
1 680 LEU n 
1 681 ILE n 
1 682 PHE n 
1 683 SER n 
1 684 LEU n 
1 685 ILE n 
1 686 VAL n 
1 687 THR n 
1 688 TYR n 
1 689 CYS n 
1 690 ILE n 
1 691 ASN n 
1 692 ALA n 
1 693 LYS n 
1 694 ALA n 
1 695 ASP n 
1 696 VAL n 
1 697 LEU n 
1 698 PHE n 
1 699 ILE n 
1 700 ALA n 
1 701 PRO n 
1 702 ARG n 
1 703 GLU n 
1 704 PRO n 
1 705 GLY n 
1 706 ALA n 
1 707 VAL n 
1 708 SER n 
1 709 TYR n 
2 1   MET n 
2 2   THR n 
2 3   GLU n 
2 4   LEU n 
2 5   PRO n 
2 6   ALA n 
2 7   PRO n 
2 8   LEU n 
2 9   SER n 
2 10  TYR n 
2 11  PHE n 
2 12  GLN n 
2 13  ASN n 
2 14  ALA n 
2 15  GLN n 
2 16  MET n 
2 17  SER n 
2 18  GLU n 
2 19  ASP n 
2 20  ASN n 
2 21  HIS n 
2 22  LEU n 
2 23  SER n 
2 24  ASN n 
2 25  THR n 
2 26  VAL n 
2 27  ARG n 
2 28  SER n 
2 29  GLN n 
2 30  ASN n 
2 31  ASP n 
2 32  ASN n 
2 33  ARG n 
2 34  GLU n 
2 35  ARG n 
2 36  GLN n 
2 37  GLU n 
2 38  HIS n 
2 39  ASN n 
2 40  ASP n 
2 41  ARG n 
2 42  ARG n 
2 43  SER n 
2 44  LEU n 
2 45  GLY n 
2 46  HIS n 
2 47  PRO n 
2 48  GLU n 
2 49  PRO n 
2 50  LEU n 
2 51  SER n 
2 52  ASN n 
2 53  GLY n 
2 54  ARG n 
2 55  PRO n 
2 56  GLN n 
2 57  GLY n 
2 58  ASN n 
2 59  SER n 
2 60  ARG n 
2 61  GLN n 
2 62  VAL n 
2 63  VAL n 
2 64  GLU n 
2 65  GLN n 
2 66  ASP n 
2 67  GLU n 
2 68  GLU n 
2 69  GLU n 
2 70  ASP n 
2 71  GLU n 
2 72  GLU n 
2 73  LEU n 
2 74  THR n 
2 75  LEU n 
2 76  LYS n 
2 77  TYR n 
2 78  GLY n 
2 79  ALA n 
2 80  LYS n 
2 81  HIS n 
2 82  VAL n 
2 83  ILE n 
2 84  MET n 
2 85  LEU n 
2 86  PHE n 
2 87  VAL n 
2 88  PRO n 
2 89  VAL n 
2 90  THR n 
2 91  LEU n 
2 92  CYS n 
2 93  MET n 
2 94  VAL n 
2 95  VAL n 
2 96  VAL n 
2 97  VAL n 
2 98  ALA n 
2 99  THR n 
2 100 ILE n 
2 101 LYS n 
2 102 SER n 
2 103 VAL n 
2 104 SER n 
2 105 PHE n 
2 106 TYR n 
2 107 THR n 
2 108 ARG n 
2 109 LYS n 
2 110 ASP n 
2 111 GLY n 
2 112 GLN n 
2 113 LEU n 
2 114 ILE n 
2 115 TYR n 
2 116 THR n 
2 117 PRO n 
2 118 PHE n 
2 119 THR n 
2 120 GLU n 
2 121 ASP n 
2 122 THR n 
2 123 GLU n 
2 124 THR n 
2 125 VAL n 
2 126 GLY n 
2 127 GLN n 
2 128 ARG n 
2 129 ALA n 
2 130 LEU n 
2 131 HIS n 
2 132 SER n 
2 133 ILE n 
2 134 LEU n 
2 135 ASN n 
2 136 ALA n 
2 137 ALA n 
2 138 ILE n 
2 139 MET n 
2 140 ILE n 
2 141 SER n 
2 142 VAL n 
2 143 ILE n 
2 144 VAL n 
2 145 VAL n 
2 146 MET n 
2 147 THR n 
2 148 ILE n 
2 149 LEU n 
2 150 LEU n 
2 151 VAL n 
2 152 VAL n 
2 153 LEU n 
2 154 TYR n 
2 155 LYS n 
2 156 TYR n 
2 157 ARG n 
2 158 CYS n 
2 159 TYR n 
2 160 LYS n 
2 161 VAL n 
2 162 ILE n 
2 163 HIS n 
2 164 ALA n 
2 165 TRP n 
2 166 LEU n 
2 167 ILE n 
2 168 ILE n 
2 169 SER n 
2 170 SER n 
2 171 LEU n 
2 172 LEU n 
2 173 LEU n 
2 174 LEU n 
2 175 PHE n 
2 176 PHE n 
2 177 PHE n 
2 178 SER n 
2 179 PHE n 
2 180 ILE n 
2 181 TYR n 
2 182 LEU n 
2 183 GLY n 
2 184 GLU n 
2 185 VAL n 
2 186 PHE n 
2 187 LYS n 
2 188 THR n 
2 189 TYR n 
2 190 ASN n 
2 191 VAL n 
2 192 ALA n 
2 193 VAL n 
2 194 ASP n 
2 195 TYR n 
2 196 ILE n 
2 197 THR n 
2 198 VAL n 
2 199 ALA n 
2 200 LEU n 
2 201 LEU n 
2 202 ILE n 
2 203 TRP n 
2 204 ASN n 
2 205 PHE n 
2 206 GLY n 
2 207 VAL n 
2 208 VAL n 
2 209 GLY n 
2 210 MET n 
2 211 ILE n 
2 212 SER n 
2 213 ILE n 
2 214 HIS n 
2 215 TRP n 
2 216 LYS n 
2 217 GLY n 
2 218 PRO n 
2 219 LEU n 
2 220 ARG n 
2 221 LEU n 
2 222 GLN n 
2 223 GLN n 
2 224 ALA n 
2 225 TYR n 
2 226 LEU n 
2 227 ILE n 
2 228 MET n 
2 229 ILE n 
2 230 SER n 
2 231 ALA n 
2 232 LEU n 
2 233 MET n 
2 234 ALA n 
2 235 LEU n 
2 236 VAL n 
2 237 PHE n 
2 238 ILE n 
2 239 LYS n 
2 240 TYR n 
2 241 LEU n 
2 242 PRO n 
2 243 GLU n 
2 244 TRP n 
2 245 THR n 
2 246 ALA n 
2 247 TRP n 
2 248 LEU n 
2 249 ILE n 
2 250 LEU n 
2 251 ALA n 
2 252 VAL n 
2 253 ILE n 
2 254 SER n 
2 255 VAL n 
2 256 TYR n 
2 257 ASP n 
2 258 LEU n 
2 259 VAL n 
2 260 ALA n 
2 261 VAL n 
2 262 LEU n 
2 263 CYS n 
2 264 PRO n 
2 265 LYS n 
2 266 GLY n 
2 267 PRO n 
2 268 LEU n 
2 269 ARG n 
2 270 MET n 
2 271 LEU n 
2 272 VAL n 
2 273 GLU n 
2 274 THR n 
2 275 ALA n 
2 276 GLN n 
2 277 GLU n 
2 278 ARG n 
2 279 ASN n 
2 280 GLU n 
2 281 THR n 
2 282 LEU n 
2 283 PHE n 
2 284 PRO n 
2 285 ALA n 
2 286 LEU n 
2 287 ILE n 
2 288 TYR n 
2 289 SER n 
2 290 SER n 
2 291 THR n 
2 292 MET n 
2 293 VAL n 
2 294 TRP n 
2 295 LEU n 
2 296 VAL n 
2 297 ASN n 
2 298 MET n 
2 299 ALA n 
2 300 GLU n 
2 301 GLY n 
2 302 ASP n 
2 303 PRO n 
2 304 GLU n 
2 305 ALA n 
2 306 GLN n 
2 307 ARG n 
2 308 ARG n 
2 309 VAL n 
2 310 SER n 
2 311 LYS n 
2 312 ASN n 
2 313 SER n 
2 314 LYS n 
2 315 TYR n 
2 316 ASN n 
2 317 ALA n 
2 318 GLU n 
2 319 SER n 
2 320 THR n 
2 321 GLU n 
2 322 ARG n 
2 323 GLU n 
2 324 SER n 
2 325 GLN n 
2 326 ASP n 
2 327 THR n 
2 328 VAL n 
2 329 ALA n 
2 330 GLU n 
2 331 ASN n 
2 332 ASP n 
2 333 ASP n 
2 334 GLY n 
2 335 GLY n 
2 336 PHE n 
2 337 SER n 
2 338 GLU n 
2 339 GLU n 
2 340 TRP n 
2 341 GLU n 
2 342 ALA n 
2 343 GLN n 
2 344 ARG n 
2 345 ASP n 
2 346 SER n 
2 347 HIS n 
2 348 LEU n 
2 349 GLY n 
2 350 PRO n 
2 351 HIS n 
2 352 ARG n 
2 353 SER n 
2 354 THR n 
2 355 PRO n 
2 356 GLU n 
2 357 SER n 
2 358 ARG n 
2 359 ALA n 
2 360 ALA n 
2 361 VAL n 
2 362 GLN n 
2 363 GLU n 
2 364 LEU n 
2 365 SER n 
2 366 SER n 
2 367 SER n 
2 368 ILE n 
2 369 LEU n 
2 370 ALA n 
2 371 GLY n 
2 372 GLU n 
2 373 ASP n 
2 374 PRO n 
2 375 GLU n 
2 376 GLU n 
2 377 ARG n 
2 378 GLY n 
2 379 VAL n 
2 380 LYS n 
2 381 LEU n 
2 382 GLY n 
2 383 LEU n 
2 384 GLY n 
2 385 ASP n 
2 386 PHE n 
2 387 ILE n 
2 388 PHE n 
2 389 TYR n 
2 390 SER n 
2 391 VAL n 
2 392 LEU n 
2 393 VAL n 
2 394 GLY n 
2 395 LYS n 
2 396 ALA n 
2 397 SER n 
2 398 ALA n 
2 399 THR n 
2 400 ALA n 
2 401 SER n 
2 402 GLY n 
2 403 ASP n 
2 404 TRP n 
2 405 ASN n 
2 406 THR n 
2 407 THR n 
2 408 ILE n 
2 409 ALA n 
2 410 CYS n 
2 411 PHE n 
2 412 VAL n 
2 413 ALA n 
2 414 ILE n 
2 415 LEU n 
2 416 ILE n 
2 417 GLY n 
2 418 LEU n 
2 419 CYS n 
2 420 LEU n 
2 421 THR n 
2 422 LEU n 
2 423 LEU n 
2 424 LEU n 
2 425 LEU n 
2 426 ALA n 
2 427 ILE n 
2 428 PHE n 
2 429 LYS n 
2 430 LYS n 
2 431 ALA n 
2 432 LEU n 
2 433 PRO n 
2 434 ALA n 
2 435 LEU n 
2 436 PRO n 
2 437 ILE n 
2 438 SER n 
2 439 ILE n 
2 440 THR n 
2 441 PHE n 
2 442 GLY n 
2 443 LEU n 
2 444 VAL n 
2 445 PHE n 
2 446 TYR n 
2 447 PHE n 
2 448 ALA n 
2 449 THR n 
2 450 ASP n 
2 451 TYR n 
2 452 LEU n 
2 453 VAL n 
2 454 GLN n 
2 455 PRO n 
2 456 PHE n 
2 457 MET n 
2 458 ASP n 
2 459 GLN n 
2 460 LEU n 
2 461 ALA n 
2 462 PHE n 
2 463 HIS n 
2 464 GLN n 
2 465 PHE n 
2 466 TYR n 
2 467 ILE n 
3 1   MET n 
3 2   GLY n 
3 3   ALA n 
3 4   ALA n 
3 5   VAL n 
3 6   PHE n 
3 7   PHE n 
3 8   GLY n 
3 9   CYS n 
3 10  THR n 
3 11  PHE n 
3 12  VAL n 
3 13  ALA n 
3 14  PHE n 
3 15  GLY n 
3 16  PRO n 
3 17  ALA n 
3 18  PHE n 
3 19  ALA n 
3 20  LEU n 
3 21  PHE n 
3 22  LEU n 
3 23  ILE n 
3 24  THR n 
3 25  VAL n 
3 26  ALA n 
3 27  GLY n 
3 28  ASP n 
3 29  PRO n 
3 30  LEU n 
3 31  ARG n 
3 32  VAL n 
3 33  ILE n 
3 34  ILE n 
3 35  LEU n 
3 36  VAL n 
3 37  ALA n 
3 38  GLY n 
3 39  ALA n 
3 40  PHE n 
3 41  PHE n 
3 42  TRP n 
3 43  LEU n 
3 44  VAL n 
3 45  SER n 
3 46  LEU n 
3 47  LEU n 
3 48  LEU n 
3 49  ALA n 
3 50  SER n 
3 51  VAL n 
3 52  VAL n 
3 53  TRP n 
3 54  PHE n 
3 55  ILE n 
3 56  LEU n 
3 57  VAL n 
3 58  HIS n 
3 59  VAL n 
3 60  THR n 
3 61  ASP n 
3 62  ARG n 
3 63  SER n 
3 64  ASP n 
3 65  ALA n 
3 66  ARG n 
3 67  LEU n 
3 68  GLN n 
3 69  TYR n 
3 70  GLY n 
3 71  LEU n 
3 72  LEU n 
3 73  ILE n 
3 74  PHE n 
3 75  GLY n 
3 76  ALA n 
3 77  ALA n 
3 78  VAL n 
3 79  SER n 
3 80  VAL n 
3 81  LEU n 
3 82  LEU n 
3 83  GLN n 
3 84  GLU n 
3 85  VAL n 
3 86  PHE n 
3 87  ARG n 
3 88  PHE n 
3 89  ALA n 
3 90  TYR n 
3 91  TYR n 
3 92  LYS n 
3 93  LEU n 
3 94  LEU n 
3 95  LYS n 
3 96  LYS n 
3 97  ALA n 
3 98  ASP n 
3 99  GLU n 
3 100 GLY n 
3 101 LEU n 
3 102 ALA n 
3 103 SER n 
3 104 LEU n 
3 105 SER n 
3 106 GLU n 
3 107 ASP n 
3 108 GLY n 
3 109 ARG n 
3 110 SER n 
3 111 PRO n 
3 112 ILE n 
3 113 SER n 
3 114 ILE n 
3 115 ARG n 
3 116 GLN n 
3 117 MET n 
3 118 ALA n 
3 119 TYR n 
3 120 VAL n 
3 121 SER n 
3 122 GLY n 
3 123 LEU n 
3 124 SER n 
3 125 PHE n 
3 126 GLY n 
3 127 ILE n 
3 128 ILE n 
3 129 SER n 
3 130 GLY n 
3 131 VAL n 
3 132 PHE n 
3 133 SER n 
3 134 VAL n 
3 135 ILE n 
3 136 ASN n 
3 137 ILE n 
3 138 LEU n 
3 139 ALA n 
3 140 ASP n 
3 141 ALA n 
3 142 LEU n 
3 143 GLY n 
3 144 PRO n 
3 145 GLY n 
3 146 VAL n 
3 147 VAL n 
3 148 GLY n 
3 149 ILE n 
3 150 HIS n 
3 151 GLY n 
3 152 ASP n 
3 153 SER n 
3 154 PRO n 
3 155 TYR n 
3 156 TYR n 
3 157 PHE n 
3 158 LEU n 
3 159 THR n 
3 160 SER n 
3 161 ALA n 
3 162 PHE n 
3 163 LEU n 
3 164 THR n 
3 165 ALA n 
3 166 ALA n 
3 167 ILE n 
3 168 ILE n 
3 169 LEU n 
3 170 LEU n 
3 171 HIS n 
3 172 THR n 
3 173 PHE n 
3 174 TRP n 
3 175 GLY n 
3 176 VAL n 
3 177 VAL n 
3 178 PHE n 
3 179 PHE n 
3 180 ASP n 
3 181 ALA n 
3 182 CYS n 
3 183 GLU n 
3 184 ARG n 
3 185 ARG n 
3 186 ARG n 
3 187 TYR n 
3 188 TRP n 
3 189 ALA n 
3 190 LEU n 
3 191 GLY n 
3 192 LEU n 
3 193 VAL n 
3 194 VAL n 
3 195 GLY n 
3 196 SER n 
3 197 HIS n 
3 198 LEU n 
3 199 LEU n 
3 200 THR n 
3 201 SER n 
3 202 GLY n 
3 203 LEU n 
3 204 THR n 
3 205 PHE n 
3 206 LEU n 
3 207 ASN n 
3 208 PRO n 
3 209 TRP n 
3 210 TYR n 
3 211 GLU n 
3 212 ALA n 
3 213 SER n 
3 214 LEU n 
3 215 LEU n 
3 216 PRO n 
3 217 ILE n 
3 218 TYR n 
3 219 ALA n 
3 220 VAL n 
3 221 THR n 
3 222 VAL n 
3 223 SER n 
3 224 MET n 
3 225 GLY n 
3 226 LEU n 
3 227 TRP n 
3 228 ALA n 
3 229 PHE n 
3 230 ILE n 
3 231 THR n 
3 232 ALA n 
3 233 GLY n 
3 234 GLY n 
3 235 SER n 
3 236 LEU n 
3 237 ARG n 
3 238 SER n 
3 239 ILE n 
3 240 GLN n 
3 241 ARG n 
3 242 SER n 
3 243 LEU n 
3 244 LEU n 
3 245 CYS n 
3 246 ARG n 
3 247 ARG n 
3 248 GLN n 
3 249 GLU n 
3 250 ASP n 
3 251 SER n 
3 252 ARG n 
3 253 VAL n 
3 254 MET n 
3 255 VAL n 
3 256 TYR n 
3 257 SER n 
3 258 ALA n 
3 259 LEU n 
3 260 ARG n 
3 261 ILE n 
3 262 PRO n 
3 263 PRO n 
3 264 GLU n 
3 265 ASP n 
4 1   MET n 
4 2   ASN n 
4 3   LEU n 
4 4   GLU n 
4 5   ARG n 
4 6   VAL n 
4 7   SER n 
4 8   ASN n 
4 9   GLU n 
4 10  GLU n 
4 11  LYS n 
4 12  LEU n 
4 13  ASN n 
4 14  LEU n 
4 15  CYS n 
4 16  ARG n 
4 17  LYS n 
4 18  TYR n 
4 19  TYR n 
4 20  LEU n 
4 21  GLY n 
4 22  GLY n 
4 23  PHE n 
4 24  ALA n 
4 25  PHE n 
4 26  LEU n 
4 27  PRO n 
4 28  PHE n 
4 29  LEU n 
4 30  TRP n 
4 31  LEU n 
4 32  VAL n 
4 33  ASN n 
4 34  ILE n 
4 35  PHE n 
4 36  TRP n 
4 37  PHE n 
4 38  PHE n 
4 39  ARG n 
4 40  GLU n 
4 41  ALA n 
4 42  PHE n 
4 43  LEU n 
4 44  VAL n 
4 45  PRO n 
4 46  ALA n 
4 47  TYR n 
4 48  THR n 
4 49  GLU n 
4 50  GLN n 
4 51  SER n 
4 52  GLN n 
4 53  ILE n 
4 54  LYS n 
4 55  GLY n 
4 56  TYR n 
4 57  VAL n 
4 58  TRP n 
4 59  ARG n 
4 60  SER n 
4 61  ALA n 
4 62  VAL n 
4 63  GLY n 
4 64  PHE n 
4 65  LEU n 
4 66  PHE n 
4 67  TRP n 
4 68  VAL n 
4 69  ILE n 
4 70  VAL n 
4 71  LEU n 
4 72  THR n 
4 73  SER n 
4 74  TRP n 
4 75  ILE n 
4 76  THR n 
4 77  ILE n 
4 78  PHE n 
4 79  GLN n 
4 80  ILE n 
4 81  TYR n 
4 82  ARG n 
4 83  PRO n 
4 84  ARG n 
4 85  TRP n 
4 86  GLY n 
4 87  ALA n 
4 88  LEU n 
4 89  GLY n 
4 90  ASP n 
4 91  TYR n 
4 92  LEU n 
4 93  SER n 
4 94  PHE n 
4 95  THR n 
4 96  ILE n 
4 97  PRO n 
4 98  LEU n 
4 99  GLY n 
4 100 THR n 
4 101 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 709 Human ? 'NCSTN, KIAA0253, UNQ1874/PRO4317'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? 'HEK 293F' ? 
? ? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'HEK 293F' ? ? ? ? ? PLASMID PMLINK ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 467 Human ? 'PSEN1, AD3, PS1, PSNL1'             ? ? ? ? ? ? 'Homo sapiens' 9606 ? 'HEK 293F' ? 
? ? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'HEK 293F' ? ? ? ? ? PLASMID PMLINK ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 265 Human ? 'APH1A, PSF, CGI-78, UNQ579/PRO1141' ? ? ? ? ? ? 'Homo sapiens' 9606 ? 'HEK 293F' ? 
? ? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'HEK 293F' ? ? ? ? ? PLASMID PMLINK ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 101 Human ? 'PSENEN, PEN2, MDS033'               ? ? ? ? ? ? 'Homo sapiens' 9606 ? 'HEK 293F' ? 
? ? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'HEK 293F' ? ? ? ? ? PLASMID PMLINK ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NICA_HUMAN  Q92542 ? 1 
;MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCR
EIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLAT
LEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQW
SSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
;
1 
2 UNP PSN1_HUMAN  P49768 ? 2 
;MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK
HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST
ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
;
1 
3 UNP APH1A_HUMAN Q96BI3 ? 3 
;MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSV
LLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTS
AFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
;
1 
4 UNP PEN2_HUMAN  Q9NZ42 ? 4 
;MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQI
YRPRWGALGDYLSFTIPLGTP
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5A63 A 1 ? 709 ? Q92542 1 ? 709 ? 1 709 
2 2 5A63 B 1 ? 467 ? P49768 1 ? 467 ? 1 467 
3 3 5A63 C 1 ? 265 ? Q96BI3 1 ? 265 ? 1 265 
4 4 5A63 D 1 ? 101 ? Q9NZ42 1 ? 101 ? 1 101 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ?                        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                        'C4 H7 N O4'     133.103 
BMA D-saccharide        . BETA-D-MANNOSE                         ?                        'C6 H12 O6'      180.156 
CYS 'L-peptide linking' y CYSTEINE                               ?                        'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                        'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ?                        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                        'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                             ?                        'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                        'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                             ?                        'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                 ?                        'C8 H15 N O6'    221.208 
PC1 non-polymer         . 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE 3-SN-PHOSPHATIDYLCHOLINE 'C44 H88 N O8 P' 790.145 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ?                        'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ?                        'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ?                        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                        'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                        'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ?                        'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5A63 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 5A63 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            3.40 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9646 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         357 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               10003 
_refine_hist.d_res_high                       3.40 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  5A63 
_struct.title                     'Cryo-EM structure of the human gamma-secretase complex at 3.4 angstrom resolution.' 
_struct.pdbx_descriptor           
'NICASTRIN, PRESENILIN-1 (E.C.3.4.23.-), GAMMA-SECRETASE SUBUNIT APH-1A, GAMMA-SECRETASE SUBUNIT PEN-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5A63 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, CRYO-EM, HUMAN GAMMA-SECRETASE, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
V N N 5 ? 
W N N 5 ? 
X N N 5 ? 
Y N N 7 ? 
Z N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 34  ? ILE A 40  ? ASN A 34  ILE A 40  1 ? 7  
HELX_P HELX_P2  2  LYS A 78  ? THR A 87  ? LYS A 78  THR A 87  1 ? 10 
HELX_P HELX_P3  3  THR A 104 ? ARG A 114 ? THR A 104 ARG A 114 1 ? 11 
HELX_P HELX_P4  4  GLY A 153 ? ALA A 157 ? GLY A 153 ALA A 157 5 ? 5  
HELX_P HELX_P5  5  ASP A 185 ? ASN A 200 ? ASP A 185 ASN A 200 1 ? 16 
HELX_P HELX_P6  6  SER A 226 ? PHE A 240 ? SER A 226 PHE A 240 1 ? 15 
HELX_P HELX_P7  7  ALA A 298 ? ALA A 315 ? ALA A 298 ALA A 315 1 ? 18 
HELX_P HELX_P8  8  GLY A 339 ? GLY A 350 ? GLY A 339 GLY A 350 1 ? 12 
HELX_P HELX_P9  9  ASP A 381 ? ASN A 387 ? ASP A 381 ASN A 387 1 ? 7  
HELX_P HELX_P10 10 ASN A 387 ? GLY A 407 ? ASN A 387 GLY A 407 1 ? 21 
HELX_P HELX_P11 11 SER A 425 ? ARG A 434 ? SER A 425 ARG A 434 1 ? 10 
HELX_P HELX_P12 12 THR A 459 ? ASN A 464 ? THR A 459 ASN A 464 1 ? 6  
HELX_P HELX_P13 13 GLU A 474 ? PHE A 479 ? GLU A 474 PHE A 479 1 ? 6  
HELX_P HELX_P14 14 THR A 481 ? GLY A 503 ? THR A 481 GLY A 503 1 ? 23 
HELX_P HELX_P15 15 ASP A 514 ? ILE A 527 ? ASP A 514 ILE A 527 1 ? 14 
HELX_P HELX_P16 16 PHE A 534 ? LEU A 538 ? PHE A 534 LEU A 538 5 ? 5  
HELX_P HELX_P17 17 ASP A 541 ? LEU A 546 ? ASP A 541 LEU A 546 5 ? 6  
HELX_P HELX_P18 18 THR A 561 ? GLY A 576 ? THR A 561 GLY A 576 1 ? 16 
HELX_P HELX_P19 19 THR A 582 ? ASP A 588 ? THR A 582 ASP A 588 1 ? 7  
HELX_P HELX_P20 20 SER A 632 ? LEU A 637 ? SER A 632 LEU A 637 1 ? 6  
HELX_P HELX_P21 21 SER A 665 ? LYS A 693 ? SER A 665 LYS A 693 1 ? 29 
HELX_P HELX_P22 22 LYS A 693 ? PHE A 698 ? LYS A 693 PHE A 698 1 ? 6  
HELX_P HELX_P23 23 GLY B 78  ? SER B 104 ? GLY B 78  SER B 104 1 ? 27 
HELX_P HELX_P24 24 PHE B 105 ? ARG B 108 ? PHE B 105 ARG B 108 5 ? 4  
HELX_P HELX_P25 25 ILE B 167 ? ASN B 190 ? ILE B 167 ASN B 190 1 ? 24 
HELX_P HELX_P26 26 TYR B 195 ? TRP B 215 ? TYR B 195 TRP B 215 1 ? 21 
HELX_P HELX_P27 27 PRO B 218 ? LEU B 241 ? PRO B 218 LEU B 241 1 ? 24 
HELX_P HELX_P28 28 PRO B 242 ? ALA B 260 ? PRO B 242 ALA B 260 1 ? 19 
HELX_P HELX_P29 29 GLY B 382 ? THR B 399 ? GLY B 382 THR B 399 1 ? 18 
HELX_P HELX_P30 30 TRP B 404 ? PHE B 428 ? TRP B 404 PHE B 428 1 ? 25 
HELX_P HELX_P31 31 LEU B 435 ? LEU B 452 ? LEU B 435 LEU B 452 1 ? 18 
HELX_P HELX_P32 32 LEU B 452 ? GLN B 464 ? LEU B 452 GLN B 464 1 ? 13 
HELX_P HELX_P33 33 GLY C 2   ? THR C 24  ? GLY C 2   THR C 24  1 ? 23 
HELX_P HELX_P34 34 ASP C 28  ? ASP C 61  ? ASP C 28  ASP C 61  1 ? 34 
HELX_P HELX_P35 35 ASP C 64  ? SER C 103 ? ASP C 64  SER C 103 1 ? 40 
HELX_P HELX_P36 36 SER C 113 ? LEU C 142 ? SER C 113 LEU C 142 1 ? 30 
HELX_P HELX_P37 37 TYR C 155 ? ARG C 185 ? TYR C 155 ARG C 185 1 ? 31 
HELX_P HELX_P38 38 ARG C 186 ? LEU C 206 ? ARG C 186 LEU C 206 1 ? 21 
HELX_P HELX_P39 39 TRP C 209 ? ALA C 232 ? TRP C 209 ALA C 232 1 ? 24 
HELX_P HELX_P40 40 SER C 235 ? LEU C 243 ? SER C 235 LEU C 243 1 ? 9  
HELX_P HELX_P41 41 ASN D 2   ? VAL D 6   ? ASN D 2   VAL D 6   5 ? 5  
HELX_P HELX_P42 42 SER D 7   ? GLY D 22  ? SER D 7   GLY D 22  1 ? 16 
HELX_P HELX_P43 43 LEU D 26  ? TRP D 36  ? LEU D 26  TRP D 36  1 ? 11 
HELX_P HELX_P44 44 PHE D 37  ? VAL D 44  ? PHE D 37  VAL D 44  1 ? 8  
HELX_P HELX_P45 45 GLU D 49  ? TRP D 85  ? GLU D 49  TRP D 85  1 ? 37 
HELX_P HELX_P46 46 GLY D 86  ? LEU D 92  ? GLY D 86  LEU D 92  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 50  SG  ? ? ? 1_555 A CYS 62  SG ? ? A CYS 50   A CYS 62   1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf2  disulf ?    ? A CYS 140 SG  ? ? ? 1_555 A CYS 159 SG ? ? A CYS 140  A CYS 159  1_555 ? ? ? ? ? ? ? 2.542 ? 
disulf3  disulf ?    ? A CYS 195 SG  ? ? ? 1_555 A CYS 213 SG ? ? A CYS 195  A CYS 213  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf4  disulf ?    ? A CYS 230 SG  ? ? ? 1_555 A CYS 248 SG ? ? A CYS 230  A CYS 248  1_555 ? ? ? ? ? ? ? 1.863 ? 
covale1  covale one  ? A ASN 45  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 45   A NAG 1699 1_555 ? ? ? ? ? ? ? 1.441 ? 
covale2  covale one  ? A ASN 55  ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 55   A NAG 1701 1_555 ? ? ? ? ? ? ? 1.477 ? 
covale3  covale one  ? A ASN 187 ND2 ? ? ? 1_555 X NAG .   C1 ? ? A ASN 187  A NAG 1715 1_555 ? ? ? ? ? ? ? 1.643 ? 
covale4  covale one  ? A ASN 264 ND2 ? ? ? 1_555 W NAG .   C1 ? ? A ASN 264  A NAG 1714 1_555 ? ? ? ? ? ? ? 1.633 ? 
covale5  covale one  ? A ASN 387 ND2 ? ? ? 1_555 N NAG .   C1 ? ? A ASN 387  A NAG 1705 1_555 ? ? ? ? ? ? ? 1.604 ? 
covale6  covale one  ? A ASN 435 ND2 ? ? ? 1_555 L NAG .   C1 ? ? A ASN 435  A NAG 1703 1_555 ? ? ? ? ? ? ? 1.662 ? 
covale7  covale one  ? A ASN 464 ND2 ? ? ? 1_555 U NAG .   C1 ? ? A ASN 464  A NAG 1712 1_555 ? ? ? ? ? ? ? 1.550 ? 
covale8  covale one  ? A ASN 506 ND2 ? ? ? 1_555 V NAG .   C1 ? ? A ASN 506  A NAG 1713 1_555 ? ? ? ? ? ? ? 1.512 ? 
covale9  covale one  ? A ASN 530 ND2 ? ? ? 1_555 Q NAG .   C1 ? ? A ASN 530  A NAG 1708 1_555 ? ? ? ? ? ? ? 1.545 ? 
covale10 covale one  ? A ASN 562 ND2 ? ? ? 1_555 S NAG .   C1 ? ? A ASN 562  A NAG 1710 1_555 ? ? ? ? ? ? ? 1.622 ? 
covale11 covale one  ? A ASN 573 ND2 ? ? ? 1_555 O NAG .   C1 ? ? A ASN 573  A NAG 1706 1_555 ? ? ? ? ? ? ? 1.547 ? 
covale12 covale both ? E NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? A NAG 1699 A NAG 1700 1_555 ? ? ? ? ? ? ? 1.444 ? 
covale13 covale both ? G NAG .   O4  ? ? ? 1_555 H NAG .   C1 ? ? A NAG 1701 A NAG 1702 1_555 ? ? ? ? ? ? ? 1.442 ? 
covale14 covale both ? H NAG .   O4  ? ? ? 1_555 I BMA .   C1 ? ? A NAG 1702 A BMA 1716 1_555 ? ? ? ? ? ? ? 1.442 ? 
covale15 covale both ? L NAG .   O4  ? ? ? 1_555 M NAG .   C1 ? ? A NAG 1703 A NAG 1704 1_555 ? ? ? ? ? ? ? 1.441 ? 
covale16 covale both ? O NAG .   O4  ? ? ? 1_555 P NAG .   C1 ? ? A NAG 1706 A NAG 1707 1_555 ? ? ? ? ? ? ? 1.433 ? 
covale17 covale both ? Q NAG .   O4  ? ? ? 1_555 R NAG .   C1 ? ? A NAG 1708 A NAG 1709 1_555 ? ? ? ? ? ? ? 1.445 ? 
covale18 covale both ? S NAG .   O4  ? ? ? 1_555 T NAG .   C1 ? ? A NAG 1710 A NAG 1711 1_555 ? ? ? ? ? ? ? 1.446 ? 
covale19 covale one  ? I BMA .   O6  ? ? ? 1_555 J BMA .   C1 ? ? A BMA 1716 A BMA 1717 1_555 ? ? ? ? ? ? ? 1.446 ? 
covale20 covale one  ? I BMA .   O3  ? ? ? 1_555 K BMA .   C1 ? ? A BMA 1716 A BMA 1718 1_555 ? ? ? ? ? ? ? 1.443 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 5 ? 
AD ? 8 ? 
AE ? 3 ? 
BA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? anti-parallel 
AD 3 4 ? parallel      
AD 4 5 ? parallel      
AD 5 6 ? parallel      
AD 6 7 ? anti-parallel 
AD 7 8 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 41  ? LEU A 44  ? TYR A 41  LEU A 44  
AA 2 ARG A 657 ? ALA A 664 ? ARG A 657 ALA A 664 
AA 3 PRO A 211 ? PHE A 218 ? PRO A 211 PHE A 218 
AA 4 THR A 70  ? VAL A 76  ? THR A 70  VAL A 76  
AA 5 TYR A 94  ? LEU A 98  ? TYR A 94  LEU A 98  
AB 1 THR A 47  ? PRO A 49  ? THR A 47  PRO A 49  
AB 2 ILE A 180 ? LEU A 183 ? ILE A 180 LEU A 183 
AB 3 LEU A 121 ? SER A 124 ? LEU A 121 SER A 124 
AC 1 ASP A 175 ? PHE A 176 ? ASP A 175 PHE A 176 
AC 2 GLN A 59  ? CYS A 62  ? GLN A 59  CYS A 62  
AC 3 LEU A 53  ? LEU A 54  ? LEU A 53  LEU A 54  
AC 4 THR A 649 ? SER A 651 ? THR A 649 SER A 651 
AC 5 CYS A 248 ? PRO A 250 ? CYS A 248 PRO A 250 
AD 1 ILE A 412 ? ARG A 414 ? ILE A 412 ARG A 414 
AD 2 GLU A 375 ? HIS A 379 ? GLU A 375 HIS A 379 
AD 3 GLY A 438 ? ALA A 442 ? GLY A 438 ALA A 442 
AD 4 VAL A 359 ? GLY A 366 ? VAL A 359 GLY A 366 
AD 5 VAL A 275 ? ARG A 281 ? VAL A 275 ARG A 281 
AD 6 ASN A 324 ? PHE A 330 ? ASN A 324 PHE A 330 
AD 7 ASP A 253 ? MET A 259 ? ASP A 253 MET A 259 
AD 8 LEU A 627 ? ALA A 630 ? LEU A 627 ALA A 630 
AE 1 THR A 577 ? VAL A 579 ? THR A 577 VAL A 579 
AE 2 ARG A 619 ? SER A 623 ? ARG A 619 SER A 623 
AE 3 GLU A 601 ? VAL A 605 ? GLU A 601 VAL A 605 
BA 1 VAL B 193 ? ASP B 194 ? VAL B 193 ASP B 194 
BA 2 SER D 93  ? THR D 95  ? SER D 93  THR D 95  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 44  ? N LEU A 44  O ALA A 658 ? O ALA A 658 
AA 2 3 N ILE A 663 ? N ILE A 663 O LEU A 212 ? O LEU A 212 
AA 3 4 N MET A 215 ? N MET A 215 O GLY A 71  ? O GLY A 71  
AA 4 5 N HIS A 74  ? N HIS A 74  O MET A 95  ? O MET A 95  
AB 1 2 O ALA A 48  ? O ALA A 48  N LEU A 182 ? N LEU A 182 
AB 2 3 N PHE A 181 ? N PHE A 181 O LEU A 121 ? O LEU A 121 
AC 1 2 N PHE A 176 ? N PHE A 176 O GLY A 61  ? O GLY A 61  
AC 2 3 N ILE A 60  ? N ILE A 60  O LEU A 53  ? O LEU A 53  
AC 3 4 N LEU A 54  ? N LEU A 54  O THR A 649 ? O THR A 649 
AC 4 5 N GLU A 650 ? N GLU A 650 O ASP A 249 ? O ASP A 249 
AD 1 2 N ARG A 414 ? N ARG A 414 O LEU A 376 ? O LEU A 376 
AD 2 3 N HIS A 379 ? N HIS A 379 O VAL A 440 ? O VAL A 440 
AD 3 4 N VAL A 439 ? N VAL A 439 O PHE A 362 ? O PHE A 362 
AD 4 5 N ASP A 360 ? N ASP A 360 O VAL A 275 ? O VAL A 275 
AD 5 6 N VAL A 276 ? N VAL A 276 O ASN A 324 ? O ASN A 324 
AD 6 7 N PHE A 329 ? N PHE A 329 O VAL A 256 ? O VAL A 256 
AD 7 8 N ASN A 255 ? N ASN A 255 O ALA A 628 ? O ALA A 628 
AE 1 2 N VAL A 579 ? N VAL A 579 O CYS A 620 ? O CYS A 620 
AE 2 3 N SER A 623 ? N SER A 623 O GLU A 601 ? O GLU A 601 
BA 1 2 O VAL B 193 ? O VAL B 193 N PHE D 94  ? N PHE D 94  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE PC1 B 1468'                                                      
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE PC1 C 1245'                                                      
AC3 Software ? ? ? ? 3 'Binding site for Poly-Saccharide residues NAG A1699 through NAG A1700 bound to ASN A 45'  
AC4 Software ? ? ? ? 6 'Binding site for Poly-Saccharide residues NAG A1701 through BMA A1718 bound to ASN A 55'  
AC5 Software ? ? ? ? 2 'Binding site for Mono-Saccharide NAG A1715 bound to ASN A 187'                            
AC6 Software ? ? ? ? 5 'Binding site for Mono-Saccharide NAG A1714 bound to ASN A 264'                            
AC7 Software ? ? ? ? 2 'Binding site for Mono-Saccharide NAG A1705 bound to ASN A 387'                            
AC8 Software ? ? ? ? 6 'Binding site for Poly-Saccharide residues NAG A1703 through NAG A1704 bound to ASN A 435' 
AC9 Software ? ? ? ? 1 'Binding site for Mono-Saccharide NAG A1712 bound to ASN A 464'                            
BC1 Software ? ? ? ? 1 'Binding site for Mono-Saccharide NAG A1713 bound to ASN A 506'                            
BC2 Software ? ? ? ? 1 'Binding site for Poly-Saccharide residues NAG A1708 through NAG A1709 bound to ASN A 530' 
BC3 Software ? ? ? ? 2 'Binding site for Poly-Saccharide residues NAG A1710 through NAG A1711 bound to ASN A 562' 
BC4 Software ? ? ? ? 7 'Binding site for Poly-Saccharide residues NAG A1706 through NAG A1707 bound to ASN A 573' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 VAL B 94  ? VAL B 94  . ? 1_555 ? 
2  AC1 9 ALA B 98  ? ALA B 98  . ? 1_555 ? 
3  AC1 9 LYS B 101 ? LYS B 101 . ? 1_555 ? 
4  AC1 9 TRP B 404 ? TRP B 404 . ? 1_555 ? 
5  AC1 9 PHE B 411 ? PHE B 411 . ? 1_555 ? 
6  AC1 9 PHE C 6   ? PHE C 6   . ? 1_555 ? 
7  AC1 9 ILE C 135 ? ILE C 135 . ? 1_555 ? 
8  AC1 9 ALA C 139 ? ALA C 139 . ? 1_555 ? 
9  AC1 9 LEU C 142 ? LEU C 142 . ? 1_555 ? 
10 AC2 9 ILE A 690 ? ILE A 690 . ? 1_555 ? 
11 AC2 9 PHE A 698 ? PHE A 698 . ? 1_555 ? 
12 AC2 9 THR C 24  ? THR C 24  . ? 1_555 ? 
13 AC2 9 ARG C 31  ? ARG C 31  . ? 1_555 ? 
14 AC2 9 ARG C 115 ? ARG C 115 . ? 1_555 ? 
15 AC2 9 GLN C 116 ? GLN C 116 . ? 1_555 ? 
16 AC2 9 TYR C 119 ? TYR C 119 . ? 1_555 ? 
17 AC2 9 LEU C 169 ? LEU C 169 . ? 1_555 ? 
18 AC2 9 PHE C 173 ? PHE C 173 . ? 1_555 ? 
19 AC3 3 PRO A 43  ? PRO A 43  . ? 1_555 ? 
20 AC3 3 ASN A 45  ? ASN A 45  . ? 1_555 ? 
21 AC3 3 GLU A 188 ? GLU A 188 . ? 1_555 ? 
22 AC4 6 ASN A 55  ? ASN A 55  . ? 1_555 ? 
23 AC4 6 ALA A 56  ? ALA A 56  . ? 1_555 ? 
24 AC4 6 HIS A 58  ? HIS A 58  . ? 1_555 ? 
25 AC4 6 PHE A 145 ? PHE A 145 . ? 1_555 ? 
26 AC4 6 TYR A 173 ? TYR A 173 . ? 1_555 ? 
27 AC4 6 GLU A 174 ? GLU A 174 . ? 1_555 ? 
28 AC5 2 ASP A 185 ? ASP A 185 . ? 1_555 ? 
29 AC5 2 ASN A 187 ? ASN A 187 . ? 1_555 ? 
30 AC6 5 ASN A 264 ? ASN A 264 . ? 1_555 ? 
31 AC6 5 THR A 266 ? THR A 266 . ? 1_555 ? 
32 AC6 5 GLY A 267 ? GLY A 267 . ? 1_555 ? 
33 AC6 5 ASN A 596 ? ASN A 596 . ? 1_555 ? 
34 AC6 5 ASP A 598 ? ASP A 598 . ? 1_555 ? 
35 AC7 2 ASN A 387 ? ASN A 387 . ? 1_555 ? 
36 AC7 2 VAL A 390 ? VAL A 390 . ? 1_555 ? 
37 AC8 6 TYR A 152 ? TYR A 152 . ? 1_555 ? 
38 AC8 6 VAL A 383 ? VAL A 383 . ? 1_555 ? 
39 AC8 6 LYS A 386 ? LYS A 386 . ? 1_555 ? 
40 AC8 6 ASN A 387 ? ASN A 387 . ? 1_555 ? 
41 AC8 6 ARG A 432 ? ARG A 432 . ? 1_555 ? 
42 AC8 6 ASN A 435 ? ASN A 435 . ? 1_555 ? 
43 AC9 1 ASN A 464 ? ASN A 464 . ? 1_555 ? 
44 BC1 1 ASN A 506 ? ASN A 506 . ? 1_555 ? 
45 BC2 1 ASN A 530 ? ASN A 530 . ? 1_555 ? 
46 BC3 2 GLN A 552 ? GLN A 552 . ? 1_555 ? 
47 BC3 2 ASN A 562 ? ASN A 562 . ? 1_555 ? 
48 BC4 7 ARG A 520 ? ARG A 520 . ? 1_555 ? 
49 BC4 7 TRP A 533 ? TRP A 533 . ? 1_555 ? 
50 BC4 7 ASN A 573 ? ASN A 573 . ? 1_555 ? 
51 BC4 7 GLY A 576 ? GLY A 576 . ? 1_555 ? 
52 BC4 7 VAL A 578 ? VAL A 578 . ? 1_555 ? 
53 BC4 7 ARG A 619 ? ARG A 619 . ? 1_555 ? 
54 BC4 7 VAL A 621 ? VAL A 621 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5A63 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5A63 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ASN A 1 34  ? 114.908 125.321 134.979 1.00 396.56 ? 34   ASN A N   1 
ATOM   2     C CA  . ASN A 1 34  ? 115.119 124.177 135.921 1.00 393.38 ? 34   ASN A CA  1 
ATOM   3     C C   . ASN A 1 34  ? 114.711 124.557 137.345 1.00 362.18 ? 34   ASN A C   1 
ATOM   4     O O   . ASN A 1 34  ? 115.345 125.414 137.959 1.00 359.12 ? 34   ASN A O   1 
ATOM   5     C CB  . ASN A 1 34  ? 116.591 123.731 135.921 1.00 391.53 ? 34   ASN A CB  1 
ATOM   6     C CG  . ASN A 1 34  ? 117.125 123.410 134.531 1.00 386.41 ? 34   ASN A CG  1 
ATOM   7     O OD1 . ASN A 1 34  ? 118.255 123.770 134.197 1.00 361.52 ? 34   ASN A OD1 1 
ATOM   8     N ND2 . ASN A 1 34  ? 116.323 122.728 133.720 1.00 390.20 ? 34   ASN A ND2 1 
ATOM   9     N N   . SER A 1 35  ? 113.667 123.914 137.869 1.00 351.09 ? 35   SER A N   1 
ATOM   10    C CA  . SER A 1 35  ? 113.176 124.192 139.230 1.00 372.14 ? 35   SER A CA  1 
ATOM   11    C C   . SER A 1 35  ? 114.224 123.902 140.328 1.00 368.63 ? 35   SER A C   1 
ATOM   12    O O   . SER A 1 35  ? 114.182 124.481 141.425 1.00 391.42 ? 35   SER A O   1 
ATOM   13    C CB  . SER A 1 35  ? 111.896 123.398 139.510 1.00 381.49 ? 35   SER A CB  1 
ATOM   14    O OG  . SER A 1 35  ? 112.155 122.005 139.570 1.00 389.51 ? 35   SER A OG  1 
ATOM   15    N N   . VAL A 1 36  ? 115.169 123.016 140.022 1.00 320.12 ? 36   VAL A N   1 
ATOM   16    C CA  . VAL A 1 36  ? 116.258 122.771 140.937 1.00 314.03 ? 36   VAL A CA  1 
ATOM   17    C C   . VAL A 1 36  ? 117.093 124.007 141.170 1.00 314.47 ? 36   VAL A C   1 
ATOM   18    O O   . VAL A 1 36  ? 117.596 124.140 142.274 1.00 334.15 ? 36   VAL A O   1 
ATOM   19    C CB  . VAL A 1 36  ? 117.022 121.471 140.587 1.00 309.11 ? 36   VAL A CB  1 
ATOM   20    C CG1 . VAL A 1 36  ? 118.223 121.268 141.497 1.00 326.93 ? 36   VAL A CG1 1 
ATOM   21    C CG2 . VAL A 1 36  ? 116.074 120.284 140.724 1.00 315.67 ? 36   VAL A CG2 1 
ATOM   22    N N   . GLU A 1 37  ? 117.126 124.969 140.250 1.00 303.17 ? 37   GLU A N   1 
ATOM   23    C CA  . GLU A 1 37  ? 117.709 126.278 140.564 1.00 308.81 ? 37   GLU A CA  1 
ATOM   24    C C   . GLU A 1 37  ? 116.926 126.952 141.690 1.00 292.76 ? 37   GLU A C   1 
ATOM   25    O O   . GLU A 1 37  ? 117.525 127.515 142.601 1.00 300.94 ? 37   GLU A O   1 
ATOM   26    C CB  . GLU A 1 37  ? 117.726 127.209 139.342 1.00 332.25 ? 37   GLU A CB  1 
ATOM   27    C CG  . GLU A 1 37  ? 118.615 126.768 138.182 1.00 354.73 ? 37   GLU A CG  1 
ATOM   28    C CD  . GLU A 1 37  ? 120.098 126.792 138.515 1.00 361.95 ? 37   GLU A CD  1 
ATOM   29    O OE1 . GLU A 1 37  ? 120.605 127.867 138.902 1.00 371.74 ? 37   GLU A OE1 1 
ATOM   30    O OE2 . GLU A 1 37  ? 120.763 125.741 138.375 1.00 348.78 ? 37   GLU A OE2 1 
ATOM   31    N N   . ARG A 1 38  ? 115.608 126.839 141.632 1.00 312.69 ? 38   ARG A N   1 
ATOM   32    C CA  . ARG A 1 38  ? 114.769 127.394 142.700 1.00 309.57 ? 38   ARG A CA  1 
ATOM   33    C C   . ARG A 1 38  ? 115.060 126.722 144.021 1.00 270.34 ? 38   ARG A C   1 
ATOM   34    O O   . ARG A 1 38  ? 115.154 127.418 145.037 1.00 282.95 ? 38   ARG A O   1 
ATOM   35    C CB  . ARG A 1 38  ? 113.270 127.345 142.373 1.00 335.95 ? 38   ARG A CB  1 
ATOM   36    C CG  . ARG A 1 38  ? 112.884 128.155 141.144 1.00 354.29 ? 38   ARG A CG  1 
ATOM   37    C CD  . ARG A 1 38  ? 111.392 128.439 141.095 1.00 361.45 ? 38   ARG A CD  1 
ATOM   38    N NE  . ARG A 1 38  ? 111.029 129.252 139.934 1.00 382.30 ? 38   ARG A NE  1 
ATOM   39    C CZ  . ARG A 1 38  ? 109.811 129.740 139.687 1.00 429.39 ? 38   ARG A CZ  1 
ATOM   40    N NH1 . ARG A 1 38  ? 108.792 129.510 140.519 1.00 444.31 ? 38   ARG A NH1 1 
ATOM   41    N NH2 . ARG A 1 38  ? 109.607 130.470 138.591 1.00 452.24 ? 38   ARG A NH2 1 
ATOM   42    N N   . LYS A 1 39  ? 115.240 125.405 143.979 1.00 287.94 ? 39   LYS A N   1 
ATOM   43    C CA  . LYS A 1 39  ? 115.590 124.619 145.169 1.00 311.16 ? 39   LYS A CA  1 
ATOM   44    C C   . LYS A 1 39  ? 116.882 125.138 145.784 1.00 285.22 ? 39   LYS A C   1 
ATOM   45    O O   . LYS A 1 39  ? 116.964 125.322 147.007 1.00 293.85 ? 39   LYS A O   1 
ATOM   46    C CB  . LYS A 1 39  ? 115.747 123.124 144.818 1.00 331.19 ? 39   LYS A CB  1 
ATOM   47    C CG  . LYS A 1 39  ? 115.006 122.158 145.727 1.00 326.40 ? 39   LYS A CG  1 
ATOM   48    C CD  . LYS A 1 39  ? 113.543 122.030 145.326 1.00 326.45 ? 39   LYS A CD  1 
ATOM   49    C CE  . LYS A 1 39  ? 112.817 120.948 146.112 1.00 326.03 ? 39   LYS A CE  1 
ATOM   50    N NZ  . LYS A 1 39  ? 113.418 119.595 145.939 1.00 311.75 ? 39   LYS A NZ  1 
ATOM   51    N N   . ILE A 1 40  ? 117.864 125.371 144.918 1.00 273.87 ? 40   ILE A N   1 
ATOM   52    C CA  . ILE A 1 40  ? 119.240 125.670 145.349 1.00 278.04 ? 40   ILE A CA  1 
ATOM   53    C C   . ILE A 1 40  ? 119.523 127.126 145.710 1.00 272.30 ? 40   ILE A C   1 
ATOM   54    O O   . ILE A 1 40  ? 119.971 127.418 146.806 1.00 278.25 ? 40   ILE A O   1 
ATOM   55    C CB  . ILE A 1 40  ? 120.281 125.315 144.261 1.00 280.37 ? 40   ILE A CB  1 
ATOM   56    C CG1 . ILE A 1 40  ? 120.318 123.815 144.009 1.00 297.12 ? 40   ILE A CG1 1 
ATOM   57    C CG2 . ILE A 1 40  ? 121.686 125.759 144.672 1.00 290.09 ? 40   ILE A CG2 1 
ATOM   58    C CD1 . ILE A 1 40  ? 121.071 123.454 142.753 1.00 307.49 ? 40   ILE A CD1 1 
ATOM   59    N N   . TYR A 1 41  ? 119.295 128.008 144.736 1.00 281.02 ? 41   TYR A N   1 
ATOM   60    C CA  . TYR A 1 41  ? 119.779 129.398 144.752 1.00 273.49 ? 41   TYR A CA  1 
ATOM   61    C C   . TYR A 1 41  ? 118.683 130.410 145.080 1.00 268.66 ? 41   TYR A C   1 
ATOM   62    O O   . TYR A 1 41  ? 117.625 130.405 144.453 1.00 282.33 ? 41   TYR A O   1 
ATOM   63    C CB  . TYR A 1 41  ? 120.343 129.763 143.373 1.00 268.79 ? 41   TYR A CB  1 
ATOM   64    C CG  . TYR A 1 41  ? 121.481 128.893 142.931 1.00 250.70 ? 41   TYR A CG  1 
ATOM   65    C CD1 . TYR A 1 41  ? 122.749 129.086 143.436 1.00 269.72 ? 41   TYR A CD1 1 
ATOM   66    C CD2 . TYR A 1 41  ? 121.289 127.869 142.017 1.00 283.07 ? 41   TYR A CD2 1 
ATOM   67    C CE1 . TYR A 1 41  ? 123.813 128.288 143.046 1.00 278.07 ? 41   TYR A CE1 1 
ATOM   68    C CE2 . TYR A 1 41  ? 122.343 127.058 141.617 1.00 296.84 ? 41   TYR A CE2 1 
ATOM   69    C CZ  . TYR A 1 41  ? 123.604 127.276 142.135 1.00 284.96 ? 41   TYR A CZ  1 
ATOM   70    O OH  . TYR A 1 41  ? 124.654 126.483 141.745 1.00 299.81 ? 41   TYR A OH  1 
ATOM   71    N N   . ILE A 1 42  ? 118.952 131.277 146.051 1.00 273.77 ? 42   ILE A N   1 
ATOM   72    C CA  . ILE A 1 42  ? 118.125 132.447 146.316 1.00 276.03 ? 42   ILE A CA  1 
ATOM   73    C C   . ILE A 1 42  ? 118.845 133.638 145.690 1.00 266.29 ? 42   ILE A C   1 
ATOM   74    O O   . ILE A 1 42  ? 119.965 133.958 146.106 1.00 271.92 ? 42   ILE A O   1 
ATOM   75    C CB  . ILE A 1 42  ? 117.941 132.675 147.827 1.00 285.22 ? 42   ILE A CB  1 
ATOM   76    C CG1 . ILE A 1 42  ? 116.989 131.628 148.398 1.00 307.52 ? 42   ILE A CG1 1 
ATOM   77    C CG2 . ILE A 1 42  ? 117.426 134.085 148.111 1.00 298.51 ? 42   ILE A CG2 1 
ATOM   78    C CD1 . ILE A 1 42  ? 116.875 131.670 149.911 1.00 338.01 ? 42   ILE A CD1 1 
ATOM   79    N N   . PRO A 1 43  ? 118.229 134.286 144.682 1.00 254.38 ? 43   PRO A N   1 
ATOM   80    C CA  . PRO A 1 43  ? 118.848 135.486 144.128 1.00 276.98 ? 43   PRO A CA  1 
ATOM   81    C C   . PRO A 1 43  ? 118.662 136.710 145.008 1.00 274.94 ? 43   PRO A C   1 
ATOM   82    O O   . PRO A 1 43  ? 117.623 136.846 145.655 1.00 285.49 ? 43   PRO A O   1 
ATOM   83    C CB  . PRO A 1 43  ? 118.115 135.681 142.796 1.00 297.58 ? 43   PRO A CB  1 
ATOM   84    C CG  . PRO A 1 43  ? 117.563 134.344 142.465 1.00 296.21 ? 43   PRO A CG  1 
ATOM   85    C CD  . PRO A 1 43  ? 117.163 133.795 143.797 1.00 293.95 ? 43   PRO A CD  1 
ATOM   86    N N   . LEU A 1 44  ? 119.676 137.576 145.026 1.00 285.53 ? 44   LEU A N   1 
ATOM   87    C CA  . LEU A 1 44  ? 119.614 138.864 145.711 1.00 289.27 ? 44   LEU A CA  1 
ATOM   88    C C   . LEU A 1 44  ? 119.235 139.908 144.674 1.00 317.95 ? 44   LEU A C   1 
ATOM   89    O O   . LEU A 1 44  ? 119.930 140.062 143.667 1.00 355.32 ? 44   LEU A O   1 
ATOM   90    C CB  . LEU A 1 44  ? 120.964 139.204 146.341 1.00 274.63 ? 44   LEU A CB  1 
ATOM   91    C CG  . LEU A 1 44  ? 121.495 138.172 147.341 1.00 285.96 ? 44   LEU A CG  1 
ATOM   92    C CD1 . LEU A 1 44  ? 122.891 138.546 147.825 1.00 286.98 ? 44   LEU A CD1 1 
ATOM   93    C CD2 . LEU A 1 44  ? 120.534 138.008 148.514 1.00 287.47 ? 44   LEU A CD2 1 
ATOM   94    N N   . ASN A 1 45  ? 118.141 140.623 144.924 1.00 307.52 ? 45   ASN A N   1 
ATOM   95    C CA  . ASN A 1 45  ? 117.506 141.454 143.905 1.00 311.03 ? 45   ASN A CA  1 
ATOM   96    C C   . ASN A 1 45  ? 117.964 142.903 143.936 1.00 315.98 ? 45   ASN A C   1 
ATOM   97    O O   . ASN A 1 45  ? 118.542 143.392 142.961 1.00 310.37 ? 45   ASN A O   1 
ATOM   98    C CB  . ASN A 1 45  ? 115.990 141.371 144.050 1.00 332.74 ? 45   ASN A CB  1 
ATOM   99    C CG  . ASN A 1 45  ? 115.477 139.954 143.895 1.00 329.95 ? 45   ASN A CG  1 
ATOM   100   O OD1 . ASN A 1 45  ? 115.598 139.364 142.819 1.00 332.80 ? 45   ASN A OD1 1 
ATOM   101   N ND2 . ASN A 1 45  ? 114.908 139.396 144.969 1.00 323.00 ? 45   ASN A ND2 1 
ATOM   102   N N   . LYS A 1 46  ? 117.711 143.583 145.054 1.00 327.66 ? 46   LYS A N   1 
ATOM   103   C CA  . LYS A 1 46  ? 118.060 144.998 145.197 1.00 334.31 ? 46   LYS A CA  1 
ATOM   104   C C   . LYS A 1 46  ? 119.528 145.086 145.608 1.00 309.78 ? 46   LYS A C   1 
ATOM   105   O O   . LYS A 1 46  ? 119.863 145.140 146.793 1.00 283.49 ? 46   LYS A O   1 
ATOM   106   C CB  . LYS A 1 46  ? 117.141 145.710 146.201 1.00 351.19 ? 46   LYS A CB  1 
ATOM   107   C CG  . LYS A 1 46  ? 115.646 145.510 145.969 1.00 380.27 ? 46   LYS A CG  1 
ATOM   108   C CD  . LYS A 1 46  ? 115.173 146.038 144.621 1.00 410.85 ? 46   LYS A CD  1 
ATOM   109   C CE  . LYS A 1 46  ? 113.711 145.695 144.373 1.00 433.65 ? 46   LYS A CE  1 
ATOM   110   N NZ  . LYS A 1 46  ? 112.794 146.261 145.403 1.00 445.68 ? 46   LYS A NZ  1 
ATOM   111   N N   . THR A 1 47  ? 120.396 145.052 144.599 1.00 313.29 ? 47   THR A N   1 
ATOM   112   C CA  . THR A 1 47  ? 121.843 145.093 144.791 1.00 317.43 ? 47   THR A CA  1 
ATOM   113   C C   . THR A 1 47  ? 122.448 146.205 143.965 1.00 323.28 ? 47   THR A C   1 
ATOM   114   O O   . THR A 1 47  ? 121.799 146.760 143.072 1.00 357.98 ? 47   THR A O   1 
ATOM   115   C CB  . THR A 1 47  ? 122.510 143.763 144.389 1.00 318.62 ? 47   THR A CB  1 
ATOM   116   O OG1 . THR A 1 47  ? 121.999 143.322 143.123 1.00 306.54 ? 47   THR A OG1 1 
ATOM   117   C CG2 . THR A 1 47  ? 122.240 142.702 145.442 1.00 339.41 ? 47   THR A CG2 1 
ATOM   118   N N   . ALA A 1 48  ? 123.695 146.531 144.283 1.00 295.94 ? 48   ALA A N   1 
ATOM   119   C CA  . ALA A 1 48  ? 124.463 147.488 143.506 1.00 301.17 ? 48   ALA A CA  1 
ATOM   120   C C   . ALA A 1 48  ? 125.951 147.172 143.629 1.00 265.50 ? 48   ALA A C   1 
ATOM   121   O O   . ALA A 1 48  ? 126.538 147.364 144.697 1.00 260.03 ? 48   ALA A O   1 
ATOM   122   C CB  . ALA A 1 48  ? 124.163 148.911 143.959 1.00 331.73 ? 48   ALA A CB  1 
ATOM   123   N N   . PRO A 1 49  ? 126.569 146.693 142.540 1.00 245.34 ? 49   PRO A N   1 
ATOM   124   C CA  . PRO A 1 49  ? 127.981 146.384 142.586 1.00 251.46 ? 49   PRO A CA  1 
ATOM   125   C C   . PRO A 1 49  ? 128.881 147.625 142.580 1.00 251.22 ? 49   PRO A C   1 
ATOM   126   O O   . PRO A 1 49  ? 128.471 148.735 142.167 1.00 305.83 ? 49   PRO A O   1 
ATOM   127   C CB  . PRO A 1 49  ? 128.190 145.593 141.301 1.00 268.92 ? 49   PRO A CB  1 
ATOM   128   C CG  . PRO A 1 49  ? 127.246 146.227 140.349 1.00 285.18 ? 49   PRO A CG  1 
ATOM   129   C CD  . PRO A 1 49  ? 126.040 146.605 141.170 1.00 275.35 ? 49   PRO A CD  1 
ATOM   130   N N   . CYS A 1 50  ? 130.097 147.416 143.069 1.00 279.38 ? 50   CYS A N   1 
ATOM   131   C CA  . CYS A 1 50  ? 131.224 148.310 142.836 1.00 291.90 ? 50   CYS A CA  1 
ATOM   132   C C   . CYS A 1 50  ? 131.808 147.898 141.490 1.00 284.06 ? 50   CYS A C   1 
ATOM   133   O O   . CYS A 1 50  ? 131.966 146.708 141.209 1.00 297.55 ? 50   CYS A O   1 
ATOM   134   C CB  . CYS A 1 50  ? 132.247 148.166 143.961 1.00 315.96 ? 50   CYS A CB  1 
ATOM   135   S SG  . CYS A 1 50  ? 133.882 148.833 143.620 1.00 325.48 ? 50   CYS A SG  1 
ATOM   136   N N   . VAL A 1 51  ? 132.133 148.894 140.676 1.00 284.56 ? 51   VAL A N   1 
ATOM   137   C CA  . VAL A 1 51  ? 132.292 148.724 139.237 1.00 268.04 ? 51   VAL A CA  1 
ATOM   138   C C   . VAL A 1 51  ? 133.584 149.384 138.772 1.00 274.31 ? 51   VAL A C   1 
ATOM   139   O O   . VAL A 1 51  ? 133.954 150.453 139.258 1.00 313.95 ? 51   VAL A O   1 
ATOM   140   C CB  . VAL A 1 51  ? 131.052 149.331 138.532 1.00 288.34 ? 51   VAL A CB  1 
ATOM   141   C CG1 . VAL A 1 51  ? 131.339 149.810 137.115 1.00 292.77 ? 51   VAL A CG1 1 
ATOM   142   C CG2 . VAL A 1 51  ? 129.915 148.320 138.533 1.00 305.38 ? 51   VAL A CG2 1 
ATOM   143   N N   . ARG A 1 52  ? 134.234 148.762 137.794 1.00 276.03 ? 52   ARG A N   1 
ATOM   144   C CA  . ARG A 1 52  ? 135.563 149.174 137.351 1.00 277.43 ? 52   ARG A CA  1 
ATOM   145   C C   . ARG A 1 52  ? 135.501 150.406 136.465 1.00 266.59 ? 52   ARG A C   1 
ATOM   146   O O   . ARG A 1 52  ? 134.904 150.379 135.388 1.00 278.41 ? 52   ARG A O   1 
ATOM   147   C CB  . ARG A 1 52  ? 136.248 148.031 136.609 1.00 299.95 ? 52   ARG A CB  1 
ATOM   148   C CG  . ARG A 1 52  ? 137.617 148.350 136.032 1.00 295.93 ? 52   ARG A CG  1 
ATOM   149   C CD  . ARG A 1 52  ? 138.470 147.093 135.950 1.00 280.82 ? 52   ARG A CD  1 
ATOM   150   N NE  . ARG A 1 52  ? 138.883 146.640 137.277 1.00 279.44 ? 52   ARG A NE  1 
ATOM   151   C CZ  . ARG A 1 52  ? 139.605 145.549 137.524 1.00 318.56 ? 52   ARG A CZ  1 
ATOM   152   N NH1 . ARG A 1 52  ? 140.020 144.760 136.530 1.00 326.51 ? 52   ARG A NH1 1 
ATOM   153   N NH2 . ARG A 1 52  ? 139.924 145.244 138.782 1.00 332.92 ? 52   ARG A NH2 1 
ATOM   154   N N   . LEU A 1 53  ? 136.115 151.483 136.946 1.00 270.38 ? 53   LEU A N   1 
ATOM   155   C CA  . LEU A 1 53  ? 136.252 152.727 136.198 1.00 279.05 ? 53   LEU A CA  1 
ATOM   156   C C   . LEU A 1 53  ? 137.728 152.955 135.946 1.00 271.99 ? 53   LEU A C   1 
ATOM   157   O O   . LEU A 1 53  ? 138.554 152.587 136.768 1.00 272.40 ? 53   LEU A O   1 
ATOM   158   C CB  . LEU A 1 53  ? 135.661 153.893 136.987 1.00 290.31 ? 53   LEU A CB  1 
ATOM   159   C CG  . LEU A 1 53  ? 134.218 154.253 136.658 1.00 294.59 ? 53   LEU A CG  1 
ATOM   160   C CD1 . LEU A 1 53  ? 133.315 153.031 136.738 1.00 321.41 ? 53   LEU A CD1 1 
ATOM   161   C CD2 . LEU A 1 53  ? 133.746 155.359 137.588 1.00 293.62 ? 53   LEU A CD2 1 
ATOM   162   N N   . LEU A 1 54  ? 138.058 153.570 134.817 1.00 269.52 ? 54   LEU A N   1 
ATOM   163   C CA  . LEU A 1 54  ? 139.445 153.621 134.372 1.00 265.08 ? 54   LEU A CA  1 
ATOM   164   C C   . LEU A 1 54  ? 139.884 155.028 134.022 1.00 275.14 ? 54   LEU A C   1 
ATOM   165   O O   . LEU A 1 54  ? 139.172 155.761 133.349 1.00 272.83 ? 54   LEU A O   1 
ATOM   166   C CB  . LEU A 1 54  ? 139.627 152.747 133.143 1.00 289.78 ? 54   LEU A CB  1 
ATOM   167   C CG  . LEU A 1 54  ? 138.881 151.416 133.086 1.00 279.28 ? 54   LEU A CG  1 
ATOM   168   C CD1 . LEU A 1 54  ? 138.924 150.872 131.672 1.00 272.85 ? 54   LEU A CD1 1 
ATOM   169   C CD2 . LEU A 1 54  ? 139.468 150.432 134.088 1.00 302.55 ? 54   LEU A CD2 1 
ATOM   170   N N   . ASN A 1 55  ? 141.096 155.354 134.445 1.00 291.82 ? 55   ASN A N   1 
ATOM   171   C CA  . ASN A 1 55  ? 141.721 156.643 134.228 1.00 270.45 ? 55   ASN A CA  1 
ATOM   172   C C   . ASN A 1 55  ? 142.827 156.415 133.211 1.00 285.48 ? 55   ASN A C   1 
ATOM   173   O O   . ASN A 1 55  ? 143.138 155.270 132.876 1.00 300.03 ? 55   ASN A O   1 
ATOM   174   C CB  . ASN A 1 55  ? 142.350 157.099 135.554 1.00 291.09 ? 55   ASN A CB  1 
ATOM   175   C CG  . ASN A 1 55  ? 141.975 158.518 135.951 1.00 321.81 ? 55   ASN A CG  1 
ATOM   176   O OD1 . ASN A 1 55  ? 141.258 159.219 135.232 1.00 339.80 ? 55   ASN A OD1 1 
ATOM   177   N ND2 . ASN A 1 55  ? 142.460 158.957 137.140 1.00 325.32 ? 55   ASN A ND2 1 
ATOM   178   N N   . ALA A 1 56  ? 143.446 157.495 132.745 1.00 308.03 ? 56   ALA A N   1 
ATOM   179   C CA  . ALA A 1 56  ? 144.654 157.412 131.910 1.00 310.56 ? 56   ALA A CA  1 
ATOM   180   C C   . ALA A 1 56  ? 145.644 156.384 132.450 1.00 312.87 ? 56   ALA A C   1 
ATOM   181   O O   . ALA A 1 56  ? 146.139 155.540 131.702 1.00 339.87 ? 56   ALA A O   1 
ATOM   182   C CB  . ALA A 1 56  ? 145.326 158.769 131.821 1.00 331.34 ? 56   ALA A CB  1 
ATOM   183   N N   . THR A 1 57  ? 145.903 156.459 133.754 1.00 300.39 ? 57   THR A N   1 
ATOM   184   C CA  . THR A 1 57  ? 146.890 155.619 134.414 1.00 316.46 ? 57   THR A CA  1 
ATOM   185   C C   . THR A 1 57  ? 146.237 154.409 135.086 1.00 308.69 ? 57   THR A C   1 
ATOM   186   O O   . THR A 1 57  ? 146.417 153.280 134.633 1.00 342.96 ? 57   THR A O   1 
ATOM   187   C CB  . THR A 1 57  ? 147.704 156.441 135.439 1.00 338.12 ? 57   THR A CB  1 
ATOM   188   O OG1 . THR A 1 57  ? 148.239 157.608 134.802 1.00 348.18 ? 57   THR A OG1 1 
ATOM   189   C CG2 . THR A 1 57  ? 148.853 155.617 136.020 1.00 367.84 ? 57   THR A CG2 1 
ATOM   190   N N   . HIS A 1 58  ? 145.575 154.633 136.203 1.00 307.41 ? 58   HIS A N   1 
ATOM   191   C CA  . HIS A 1 58  ? 145.028 153.542 136.982 1.00 313.98 ? 58   HIS A CA  1 
ATOM   192   C C   . HIS A 1 58  ? 143.640 153.150 136.573 1.00 300.87 ? 58   HIS A C   1 
ATOM   193   O O   . HIS A 1 58  ? 143.049 153.737 135.677 1.00 288.07 ? 58   HIS A O   1 
ATOM   194   C CB  . HIS A 1 58  ? 144.997 153.893 138.459 1.00 332.62 ? 58   HIS A CB  1 
ATOM   195   C CG  . HIS A 1 58  ? 146.281 154.443 138.975 1.00 334.86 ? 58   HIS A CG  1 
ATOM   196   N ND1 . HIS A 1 58  ? 147.101 155.248 138.218 1.00 328.03 ? 58   HIS A ND1 1 
ATOM   197   C CD2 . HIS A 1 58  ? 146.880 154.316 140.179 1.00 364.31 ? 58   HIS A CD2 1 
ATOM   198   C CE1 . HIS A 1 58  ? 148.156 155.589 138.933 1.00 368.40 ? 58   HIS A CE1 1 
ATOM   199   N NE2 . HIS A 1 58  ? 148.045 155.039 140.128 1.00 380.79 ? 58   HIS A NE2 1 
ATOM   200   N N   . GLN A 1 59  ? 143.150 152.132 137.259 1.00 295.11 ? 59   GLN A N   1 
ATOM   201   C CA  . GLN A 1 59  ? 141.760 151.756 137.281 1.00 294.76 ? 59   GLN A CA  1 
ATOM   202   C C   . GLN A 1 59  ? 141.444 151.806 138.762 1.00 290.12 ? 59   GLN A C   1 
ATOM   203   O O   . GLN A 1 59  ? 142.346 151.669 139.569 1.00 300.54 ? 59   GLN A O   1 
ATOM   204   C CB  . GLN A 1 59  ? 141.564 150.367 136.660 1.00 302.88 ? 59   GLN A CB  1 
ATOM   205   C CG  . GLN A 1 59  ? 141.283 149.210 137.603 1.00 292.91 ? 59   GLN A CG  1 
ATOM   206   C CD  . GLN A 1 59  ? 142.388 148.181 137.618 1.00 307.63 ? 59   GLN A CD  1 
ATOM   207   O OE1 . GLN A 1 59  ? 142.782 147.662 136.580 1.00 289.74 ? 59   GLN A OE1 1 
ATOM   208   N NE2 . GLN A 1 59  ? 142.886 147.872 138.804 1.00 335.79 ? 59   GLN A NE2 1 
ATOM   209   N N   . ILE A 1 60  ? 140.188 152.070 139.096 1.00 282.39 ? 60   ILE A N   1 
ATOM   210   C CA  . ILE A 1 60  ? 139.690 152.131 140.458 1.00 279.21 ? 60   ILE A CA  1 
ATOM   211   C C   . ILE A 1 60  ? 138.477 151.264 140.291 1.00 291.13 ? 60   ILE A C   1 
ATOM   212   O O   . ILE A 1 60  ? 138.027 151.133 139.177 1.00 300.47 ? 60   ILE A O   1 
ATOM   213   C CB  . ILE A 1 60  ? 139.224 153.535 140.788 1.00 274.17 ? 60   ILE A CB  1 
ATOM   214   C CG1 . ILE A 1 60  ? 138.324 154.049 139.681 1.00 291.08 ? 60   ILE A CG1 1 
ATOM   215   C CG2 . ILE A 1 60  ? 140.419 154.451 140.913 1.00 298.61 ? 60   ILE A CG2 1 
ATOM   216   C CD1 . ILE A 1 60  ? 136.982 154.537 140.165 1.00 309.93 ? 60   ILE A CD1 1 
ATOM   217   N N   . GLY A 1 61  ? 137.960 150.632 141.339 1.00 293.86 ? 61   GLY A N   1 
ATOM   218   C CA  . GLY A 1 61  ? 136.784 149.801 141.155 1.00 295.35 ? 61   GLY A CA  1 
ATOM   219   C C   . GLY A 1 61  ? 136.811 148.510 141.899 1.00 296.09 ? 61   GLY A C   1 
ATOM   220   O O   . GLY A 1 61  ? 137.433 148.385 142.924 1.00 290.65 ? 61   GLY A O   1 
ATOM   221   N N   . CYS A 1 62  ? 136.069 147.552 141.389 1.00 301.41 ? 62   CYS A N   1 
ATOM   222   C CA  . CYS A 1 62  ? 136.086 146.188 141.916 1.00 305.95 ? 62   CYS A CA  1 
ATOM   223   C C   . CYS A 1 62  ? 135.812 145.174 140.819 1.00 307.54 ? 62   CYS A C   1 
ATOM   224   O O   . CYS A 1 62  ? 135.151 145.500 139.829 1.00 307.98 ? 62   CYS A O   1 
ATOM   225   C CB  . CYS A 1 62  ? 135.030 146.056 143.009 1.00 296.25 ? 62   CYS A CB  1 
ATOM   226   S SG  . CYS A 1 62  ? 135.124 147.347 144.269 1.00 311.97 ? 62   CYS A SG  1 
ATOM   227   N N   . GLN A 1 63  ? 136.309 143.949 141.003 1.00 310.32 ? 63   GLN A N   1 
ATOM   228   C CA  . GLN A 1 63  ? 136.172 142.898 139.991 1.00 319.60 ? 63   GLN A CA  1 
ATOM   229   C C   . GLN A 1 63  ? 135.937 141.517 140.589 1.00 317.10 ? 63   GLN A C   1 
ATOM   230   O O   . GLN A 1 63  ? 136.742 141.030 141.382 1.00 305.05 ? 63   GLN A O   1 
ATOM   231   C CB  . GLN A 1 63  ? 137.413 142.848 139.100 1.00 313.16 ? 63   GLN A CB  1 
ATOM   232   C CG  . GLN A 1 63  ? 137.145 142.304 137.705 1.00 291.80 ? 63   GLN A CG  1 
ATOM   233   C CD  . GLN A 1 63  ? 138.371 141.689 137.051 1.00 334.36 ? 63   GLN A CD  1 
ATOM   234   O OE1 . GLN A 1 63  ? 139.503 142.139 137.256 1.00 339.73 ? 63   GLN A OE1 1 
ATOM   235   N NE2 . GLN A 1 63  ? 138.149 140.656 136.248 1.00 343.12 ? 63   GLN A NE2 1 
ATOM   236   N N   . SER A 1 64  ? 134.817 140.906 140.206 1.00 323.74 ? 64   SER A N   1 
ATOM   237   C CA  . SER A 1 64  ? 134.620 139.472 140.372 1.00 311.70 ? 64   SER A CA  1 
ATOM   238   C C   . SER A 1 64  ? 135.391 138.753 139.285 1.00 313.11 ? 64   SER A C   1 
ATOM   239   O O   . SER A 1 64  ? 135.580 139.295 138.199 1.00 329.83 ? 64   SER A O   1 
ATOM   240   C CB  . SER A 1 64  ? 133.142 139.110 140.244 1.00 310.64 ? 64   SER A CB  1 
ATOM   241   O OG  . SER A 1 64  ? 132.945 137.712 140.397 1.00 330.41 ? 64   SER A OG  1 
ATOM   242   N N   . SER A 1 65  ? 135.828 137.533 139.577 1.00 312.97 ? 65   SER A N   1 
ATOM   243   C CA  . SER A 1 65  ? 136.402 136.664 138.557 1.00 327.49 ? 65   SER A CA  1 
ATOM   244   C C   . SER A 1 65  ? 135.293 136.246 137.604 1.00 299.49 ? 65   SER A C   1 
ATOM   245   O O   . SER A 1 65  ? 134.138 136.102 138.018 1.00 287.50 ? 65   SER A O   1 
ATOM   246   C CB  . SER A 1 65  ? 137.042 135.426 139.189 1.00 360.17 ? 65   SER A CB  1 
ATOM   247   O OG  . SER A 1 65  ? 137.664 134.615 138.205 1.00 378.06 ? 65   SER A OG  1 
ATOM   248   N N   . ILE A 1 66  ? 135.641 136.084 136.328 1.00 297.24 ? 66   ILE A N   1 
ATOM   249   C CA  . ILE A 1 66  ? 134.693 135.601 135.316 1.00 286.23 ? 66   ILE A CA  1 
ATOM   250   C C   . ILE A 1 66  ? 134.058 134.313 135.819 1.00 289.81 ? 66   ILE A C   1 
ATOM   251   O O   . ILE A 1 66  ? 134.758 133.417 136.302 1.00 308.20 ? 66   ILE A O   1 
ATOM   252   C CB  . ILE A 1 66  ? 135.369 135.397 133.932 1.00 313.26 ? 66   ILE A CB  1 
ATOM   253   C CG1 . ILE A 1 66  ? 134.354 134.984 132.855 1.00 324.88 ? 66   ILE A CG1 1 
ATOM   254   C CG2 . ILE A 1 66  ? 136.492 134.361 133.996 1.00 344.02 ? 66   ILE A CG2 1 
ATOM   255   C CD1 . ILE A 1 66  ? 133.403 136.073 132.417 1.00 345.44 ? 66   ILE A CD1 1 
ATOM   256   N N   . SER A 1 67  ? 132.733 134.241 135.724 1.00 317.23 ? 67   SER A N   1 
ATOM   257   C CA  . SER A 1 67  ? 131.947 133.174 136.357 1.00 361.42 ? 67   SER A CA  1 
ATOM   258   C C   . SER A 1 67  ? 132.189 133.117 137.873 1.00 328.61 ? 67   SER A C   1 
ATOM   259   O O   . SER A 1 67  ? 132.934 132.270 138.380 1.00 302.59 ? 67   SER A O   1 
ATOM   260   C CB  . SER A 1 67  ? 132.184 131.806 135.685 1.00 389.41 ? 67   SER A CB  1 
ATOM   261   O OG  . SER A 1 67  ? 133.433 131.229 136.034 1.00 402.91 ? 67   SER A OG  1 
ATOM   262   N N   . GLY A 1 68  ? 131.576 134.068 138.569 1.00 299.69 ? 68   GLY A N   1 
ATOM   263   C CA  . GLY A 1 68  ? 131.498 134.053 140.024 1.00 306.81 ? 68   GLY A CA  1 
ATOM   264   C C   . GLY A 1 68  ? 132.728 134.445 140.824 1.00 298.09 ? 68   GLY A C   1 
ATOM   265   O O   . GLY A 1 68  ? 133.863 134.222 140.402 1.00 319.49 ? 68   GLY A O   1 
ATOM   266   N N   . ASP A 1 69  ? 132.477 135.067 141.976 1.00 274.63 ? 69   ASP A N   1 
ATOM   267   C CA  . ASP A 1 69  ? 133.339 134.946 143.149 1.00 285.68 ? 69   ASP A CA  1 
ATOM   268   C C   . ASP A 1 69  ? 132.448 134.368 144.246 1.00 297.98 ? 69   ASP A C   1 
ATOM   269   O O   . ASP A 1 69  ? 131.638 135.089 144.828 1.00 330.86 ? 69   ASP A O   1 
ATOM   270   C CB  . ASP A 1 69  ? 133.918 136.302 143.578 1.00 303.34 ? 69   ASP A CB  1 
ATOM   271   C CG  . ASP A 1 69  ? 135.373 136.491 143.161 1.00 319.63 ? 69   ASP A CG  1 
ATOM   272   O OD1 . ASP A 1 69  ? 135.761 136.040 142.060 1.00 327.87 ? 69   ASP A OD1 1 
ATOM   273   O OD2 . ASP A 1 69  ? 136.128 137.115 143.937 1.00 313.44 ? 69   ASP A OD2 1 
ATOM   274   N N   . THR A 1 70  ? 132.573 133.067 144.498 1.00 300.84 ? 70   THR A N   1 
ATOM   275   C CA  . THR A 1 70  ? 131.752 132.389 145.512 1.00 304.42 ? 70   THR A CA  1 
ATOM   276   C C   . THR A 1 70  ? 132.499 132.227 146.824 1.00 295.06 ? 70   THR A C   1 
ATOM   277   O O   . THR A 1 70  ? 133.717 132.034 146.839 1.00 307.48 ? 70   THR A O   1 
ATOM   278   C CB  . THR A 1 70  ? 131.234 131.009 145.047 1.00 332.38 ? 70   THR A CB  1 
ATOM   279   O OG1 . THR A 1 70  ? 130.562 130.362 146.137 1.00 334.46 ? 70   THR A OG1 1 
ATOM   280   C CG2 . THR A 1 70  ? 132.364 130.100 144.539 1.00 357.40 ? 70   THR A CG2 1 
ATOM   281   N N   . GLY A 1 71  ? 131.753 132.294 147.921 1.00 282.32 ? 71   GLY A N   1 
ATOM   282   C CA  . GLY A 1 71  ? 132.341 132.205 149.247 1.00 276.11 ? 71   GLY A CA  1 
ATOM   283   C C   . GLY A 1 71  ? 131.322 132.096 150.358 1.00 259.95 ? 71   GLY A C   1 
ATOM   284   O O   . GLY A 1 71  ? 130.206 132.588 150.235 1.00 274.52 ? 71   GLY A O   1 
ATOM   285   N N   . VAL A 1 72  ? 131.716 131.433 151.438 1.00 271.23 ? 72   VAL A N   1 
ATOM   286   C CA  . VAL A 1 72  ? 130.835 131.219 152.594 1.00 274.64 ? 72   VAL A CA  1 
ATOM   287   C C   . VAL A 1 72  ? 130.608 132.541 153.321 1.00 269.60 ? 72   VAL A C   1 
ATOM   288   O O   . VAL A 1 72  ? 131.564 133.267 153.595 1.00 266.71 ? 72   VAL A O   1 
ATOM   289   C CB  . VAL A 1 72  ? 131.357 130.110 153.550 1.00 293.01 ? 72   VAL A CB  1 
ATOM   290   C CG1 . VAL A 1 72  ? 132.855 130.233 153.806 1.00 320.65 ? 72   VAL A CG1 1 
ATOM   291   C CG2 . VAL A 1 72  ? 130.587 130.101 154.871 1.00 333.54 ? 72   VAL A CG2 1 
ATOM   292   N N   . ILE A 1 73  ? 129.341 132.849 153.606 1.00 267.73 ? 73   ILE A N   1 
ATOM   293   C CA  . ILE A 1 73  ? 128.966 134.161 154.150 1.00 267.01 ? 73   ILE A CA  1 
ATOM   294   C C   . ILE A 1 73  ? 129.441 134.281 155.588 1.00 278.61 ? 73   ILE A C   1 
ATOM   295   O O   . ILE A 1 73  ? 129.445 133.294 156.329 1.00 298.66 ? 73   ILE A O   1 
ATOM   296   C CB  . ILE A 1 73  ? 127.443 134.475 154.048 1.00 282.30 ? 73   ILE A CB  1 
ATOM   297   C CG1 . ILE A 1 73  ? 126.603 133.566 154.953 1.00 337.04 ? 73   ILE A CG1 1 
ATOM   298   C CG2 . ILE A 1 73  ? 126.964 134.352 152.605 1.00 289.55 ? 73   ILE A CG2 1 
ATOM   299   C CD1 . ILE A 1 73  ? 125.111 133.792 154.856 1.00 358.17 ? 73   ILE A CD1 1 
ATOM   300   N N   . HIS A 1 74  ? 129.869 135.484 155.962 1.00 288.47 ? 74   HIS A N   1 
ATOM   301   C CA  . HIS A 1 74  ? 130.298 135.765 157.324 1.00 290.82 ? 74   HIS A CA  1 
ATOM   302   C C   . HIS A 1 74  ? 129.919 137.179 157.734 1.00 295.47 ? 74   HIS A C   1 
ATOM   303   O O   . HIS A 1 74  ? 130.542 138.152 157.303 1.00 316.08 ? 74   HIS A O   1 
ATOM   304   C CB  . HIS A 1 74  ? 131.799 135.555 157.479 1.00 296.94 ? 74   HIS A CB  1 
ATOM   305   C CG  . HIS A 1 74  ? 132.250 135.586 158.903 1.00 318.81 ? 74   HIS A CG  1 
ATOM   306   N ND1 . HIS A 1 74  ? 131.934 134.588 159.798 1.00 314.70 ? 74   HIS A ND1 1 
ATOM   307   C CD2 . HIS A 1 74  ? 132.957 136.507 159.597 1.00 322.21 ? 74   HIS A CD2 1 
ATOM   308   C CE1 . HIS A 1 74  ? 132.437 134.888 160.981 1.00 333.01 ? 74   HIS A CE1 1 
ATOM   309   N NE2 . HIS A 1 74  ? 133.066 136.046 160.885 1.00 335.07 ? 74   HIS A NE2 1 
ATOM   310   N N   . VAL A 1 75  ? 128.883 137.292 158.558 1.00 296.01 ? 75   VAL A N   1 
ATOM   311   C CA  . VAL A 1 75  ? 128.442 138.603 159.024 1.00 301.61 ? 75   VAL A CA  1 
ATOM   312   C C   . VAL A 1 75  ? 129.473 139.153 160.012 1.00 295.05 ? 75   VAL A C   1 
ATOM   313   O O   . VAL A 1 75  ? 129.963 138.430 160.883 1.00 319.06 ? 75   VAL A O   1 
ATOM   314   C CB  . VAL A 1 75  ? 127.010 138.583 159.616 1.00 318.80 ? 75   VAL A CB  1 
ATOM   315   C CG1 . VAL A 1 75  ? 126.032 137.997 158.602 1.00 324.41 ? 75   VAL A CG1 1 
ATOM   316   C CG2 . VAL A 1 75  ? 126.944 137.834 160.945 1.00 341.90 ? 75   VAL A CG2 1 
ATOM   317   N N   . VAL A 1 76  ? 129.823 140.421 159.830 1.00 300.45 ? 76   VAL A N   1 
ATOM   318   C CA  . VAL A 1 76  ? 130.823 141.095 160.639 1.00 316.81 ? 76   VAL A CA  1 
ATOM   319   C C   . VAL A 1 76  ? 130.101 142.151 161.463 1.00 327.88 ? 76   VAL A C   1 
ATOM   320   O O   . VAL A 1 76  ? 129.433 143.024 160.901 1.00 347.88 ? 76   VAL A O   1 
ATOM   321   C CB  . VAL A 1 76  ? 131.883 141.780 159.749 1.00 336.17 ? 76   VAL A CB  1 
ATOM   322   C CG1 . VAL A 1 76  ? 132.939 142.483 160.599 1.00 358.26 ? 76   VAL A CG1 1 
ATOM   323   C CG2 . VAL A 1 76  ? 132.528 140.773 158.801 1.00 330.35 ? 76   VAL A CG2 1 
ATOM   324   N N   . GLU A 1 77  ? 130.218 142.055 162.786 1.00 315.00 ? 77   GLU A N   1 
ATOM   325   C CA  . GLU A 1 77  ? 129.685 143.069 163.700 1.00 330.07 ? 77   GLU A CA  1 
ATOM   326   C C   . GLU A 1 77  ? 130.755 143.634 164.649 1.00 334.41 ? 77   GLU A C   1 
ATOM   327   O O   . GLU A 1 77  ? 130.423 144.341 165.603 1.00 342.29 ? 77   GLU A O   1 
ATOM   328   C CB  . GLU A 1 77  ? 128.513 142.479 164.490 1.00 356.94 ? 77   GLU A CB  1 
ATOM   329   C CG  . GLU A 1 77  ? 127.432 141.866 163.603 1.00 395.83 ? 77   GLU A CG  1 
ATOM   330   C CD  . GLU A 1 77  ? 126.136 141.567 164.339 1.00 422.69 ? 77   GLU A CD  1 
ATOM   331   O OE1 . GLU A 1 77  ? 126.171 141.353 165.571 1.00 442.59 ? 77   GLU A OE1 1 
ATOM   332   O OE2 . GLU A 1 77  ? 125.076 141.537 163.677 1.00 406.56 ? 77   GLU A OE2 1 
ATOM   333   N N   . LYS A 1 78  ? 132.029 143.352 164.358 1.00 338.60 ? 78   LYS A N   1 
ATOM   334   C CA  . LYS A 1 78  ? 133.161 143.712 165.226 1.00 361.37 ? 78   LYS A CA  1 
ATOM   335   C C   . LYS A 1 78  ? 134.492 143.249 164.613 1.00 372.76 ? 78   LYS A C   1 
ATOM   336   O O   . LYS A 1 78  ? 134.512 142.540 163.605 1.00 384.27 ? 78   LYS A O   1 
ATOM   337   C CB  . LYS A 1 78  ? 133.000 143.116 166.639 1.00 379.58 ? 78   LYS A CB  1 
ATOM   338   C CG  . LYS A 1 78  ? 132.778 141.610 166.678 1.00 390.25 ? 78   LYS A CG  1 
ATOM   339   C CD  . LYS A 1 78  ? 132.228 141.147 168.021 1.00 417.52 ? 78   LYS A CD  1 
ATOM   340   C CE  . LYS A 1 78  ? 130.730 141.394 168.143 1.00 421.12 ? 78   LYS A CE  1 
ATOM   341   N NZ  . LYS A 1 78  ? 130.176 140.874 169.424 1.00 429.54 ? 78   LYS A NZ  1 
ATOM   342   N N   . GLU A 1 79  ? 135.593 143.664 165.237 1.00 385.06 ? 79   GLU A N   1 
ATOM   343   C CA  . GLU A 1 79  ? 136.929 143.313 164.819 1.00 400.87 ? 79   GLU A CA  1 
ATOM   344   C C   . GLU A 1 79  ? 137.212 141.849 165.006 1.00 403.20 ? 79   GLU A C   1 
ATOM   345   O O   . GLU A 1 79  ? 137.984 141.319 164.209 1.00 404.85 ? 79   GLU A O   1 
ATOM   346   C CB  . GLU A 1 79  ? 137.990 144.156 165.552 1.00 443.20 ? 79   GLU A CB  1 
ATOM   347   C CG  . GLU A 1 79  ? 138.296 145.499 164.896 1.00 454.52 ? 79   GLU A CG  1 
ATOM   348   C CD  . GLU A 1 79  ? 137.095 146.426 164.807 1.00 457.74 ? 79   GLU A CD  1 
ATOM   349   O OE1 . GLU A 1 79  ? 136.312 146.497 165.779 1.00 476.06 ? 79   GLU A OE1 1 
ATOM   350   O OE2 . GLU A 1 79  ? 136.939 147.095 163.763 1.00 451.86 ? 79   GLU A OE2 1 
ATOM   351   N N   . GLU A 1 80  ? 136.616 141.221 166.028 1.00 405.42 ? 80   GLU A N   1 
ATOM   352   C CA  . GLU A 1 80  ? 136.822 139.814 166.309 1.00 420.54 ? 80   GLU A CA  1 
ATOM   353   C C   . GLU A 1 80  ? 136.434 138.963 165.098 1.00 398.76 ? 80   GLU A C   1 
ATOM   354   O O   . GLU A 1 80  ? 137.178 138.053 164.694 1.00 394.00 ? 80   GLU A O   1 
ATOM   355   C CB  . GLU A 1 80  ? 136.027 139.364 167.546 1.00 448.11 ? 80   GLU A CB  1 
ATOM   356   C CG  . GLU A 1 80  ? 136.454 140.006 168.866 1.00 475.08 ? 80   GLU A CG  1 
ATOM   357   C CD  . GLU A 1 80  ? 137.900 139.725 169.244 1.00 491.03 ? 80   GLU A CD  1 
ATOM   358   O OE1 . GLU A 1 80  ? 138.384 138.599 169.000 1.00 500.00 ? 80   GLU A OE1 1 
ATOM   359   O OE2 . GLU A 1 80  ? 138.555 140.636 169.794 1.00 485.14 ? 80   GLU A OE2 1 
ATOM   360   N N   . ASP A 1 81  ? 135.271 139.294 164.548 1.00 367.98 ? 81   ASP A N   1 
ATOM   361   C CA  . ASP A 1 81  ? 134.724 138.603 163.379 1.00 342.24 ? 81   ASP A CA  1 
ATOM   362   C C   . ASP A 1 81  ? 135.704 138.688 162.210 1.00 314.45 ? 81   ASP A C   1 
ATOM   363   O O   . ASP A 1 81  ? 135.988 137.685 161.535 1.00 334.80 ? 81   ASP A O   1 
ATOM   364   C CB  . ASP A 1 81  ? 133.377 139.209 162.968 1.00 354.95 ? 81   ASP A CB  1 
ATOM   365   C CG  . ASP A 1 81  ? 132.281 138.968 163.999 1.00 394.23 ? 81   ASP A CG  1 
ATOM   366   O OD1 . ASP A 1 81  ? 132.604 138.770 165.191 1.00 399.10 ? 81   ASP A OD1 1 
ATOM   367   O OD2 . ASP A 1 81  ? 131.091 138.984 163.616 1.00 407.39 ? 81   ASP A OD2 1 
ATOM   368   N N   . LEU A 1 82  ? 136.196 139.901 162.006 1.00 315.53 ? 82   LEU A N   1 
ATOM   369   C CA  . LEU A 1 82  ? 137.153 140.198 160.932 1.00 329.21 ? 82   LEU A CA  1 
ATOM   370   C C   . LEU A 1 82  ? 138.400 139.338 161.089 1.00 322.09 ? 82   LEU A C   1 
ATOM   371   O O   . LEU A 1 82  ? 138.889 138.741 160.118 1.00 314.63 ? 82   LEU A O   1 
ATOM   372   C CB  . LEU A 1 82  ? 137.497 141.687 160.887 1.00 346.65 ? 82   LEU A CB  1 
ATOM   373   C CG  . LEU A 1 82  ? 137.858 142.213 159.499 1.00 360.60 ? 82   LEU A CG  1 
ATOM   374   C CD1 . LEU A 1 82  ? 136.662 142.134 158.553 1.00 353.85 ? 82   LEU A CD1 1 
ATOM   375   C CD2 . LEU A 1 82  ? 138.373 143.642 159.603 1.00 375.77 ? 82   LEU A CD2 1 
ATOM   376   N N   . GLN A 1 83  ? 138.884 139.293 162.321 1.00 346.71 ? 83   GLN A N   1 
ATOM   377   C CA  . GLN A 1 83  ? 140.076 138.519 162.685 1.00 365.10 ? 83   GLN A CA  1 
ATOM   378   C C   . GLN A 1 83  ? 139.873 137.049 162.334 1.00 348.86 ? 83   GLN A C   1 
ATOM   379   O O   . GLN A 1 83  ? 140.748 136.407 161.738 1.00 331.20 ? 83   GLN A O   1 
ATOM   380   C CB  . GLN A 1 83  ? 140.398 138.671 164.178 1.00 386.94 ? 83   GLN A CB  1 
ATOM   381   C CG  . GLN A 1 83  ? 141.744 138.104 164.604 1.00 399.60 ? 83   GLN A CG  1 
ATOM   382   C CD  . GLN A 1 83  ? 141.982 138.229 166.099 1.00 412.23 ? 83   GLN A CD  1 
ATOM   383   O OE1 . GLN A 1 83  ? 141.690 139.263 166.704 1.00 411.86 ? 83   GLN A OE1 1 
ATOM   384   N NE2 . GLN A 1 83  ? 142.520 137.175 166.703 1.00 423.23 ? 83   GLN A NE2 1 
ATOM   385   N N   . TRP A 1 84  ? 138.705 136.554 162.722 1.00 361.73 ? 84   TRP A N   1 
ATOM   386   C CA  . TRP A 1 84  ? 138.307 135.161 162.481 1.00 376.60 ? 84   TRP A CA  1 
ATOM   387   C C   . TRP A 1 84  ? 138.346 134.857 160.986 1.00 343.36 ? 84   TRP A C   1 
ATOM   388   O O   . TRP A 1 84  ? 138.889 133.828 160.555 1.00 344.53 ? 84   TRP A O   1 
ATOM   389   C CB  . TRP A 1 84  ? 136.891 134.854 163.026 1.00 395.20 ? 84   TRP A CB  1 
ATOM   390   C CG  . TRP A 1 84  ? 136.118 133.783 162.238 1.00 386.74 ? 84   TRP A CG  1 
ATOM   391   C CD1 . TRP A 1 84  ? 135.451 133.950 161.051 1.00 360.96 ? 84   TRP A CD1 1 
ATOM   392   C CD2 . TRP A 1 84  ? 135.947 132.405 162.594 1.00 377.64 ? 84   TRP A CD2 1 
ATOM   393   N NE1 . TRP A 1 84  ? 134.886 132.768 160.649 1.00 359.75 ? 84   TRP A NE1 1 
ATOM   394   C CE2 . TRP A 1 84  ? 135.171 131.802 161.576 1.00 354.59 ? 84   TRP A CE2 1 
ATOM   395   C CE3 . TRP A 1 84  ? 136.375 131.619 163.673 1.00 389.35 ? 84   TRP A CE3 1 
ATOM   396   C CZ2 . TRP A 1 84  ? 134.812 130.454 161.606 1.00 368.04 ? 84   TRP A CZ2 1 
ATOM   397   C CZ3 . TRP A 1 84  ? 136.018 130.274 163.702 1.00 398.76 ? 84   TRP A CZ3 1 
ATOM   398   C CH2 . TRP A 1 84  ? 135.242 129.707 162.673 1.00 401.60 ? 84   TRP A CH2 1 
ATOM   399   N N   . VAL A 1 85  ? 137.759 135.778 160.232 1.00 316.02 ? 85   VAL A N   1 
ATOM   400   C CA  . VAL A 1 85  ? 137.676 135.676 158.771 1.00 329.33 ? 85   VAL A CA  1 
ATOM   401   C C   . VAL A 1 85  ? 139.070 135.577 158.176 1.00 315.80 ? 85   VAL A C   1 
ATOM   402   O O   . VAL A 1 85  ? 139.353 134.711 157.315 1.00 331.76 ? 85   VAL A O   1 
ATOM   403   C CB  . VAL A 1 85  ? 136.784 136.798 158.120 1.00 336.06 ? 85   VAL A CB  1 
ATOM   404   C CG1 . VAL A 1 85  ? 137.555 137.753 157.206 1.00 348.13 ? 85   VAL A CG1 1 
ATOM   405   C CG2 . VAL A 1 85  ? 135.659 136.175 157.309 1.00 327.08 ? 85   VAL A CG2 1 
ATOM   406   N N   . LEU A 1 86  ? 139.945 136.454 158.665 1.00 321.59 ? 86   LEU A N   1 
ATOM   407   C CA  . LEU A 1 86  ? 141.355 136.483 158.239 1.00 334.43 ? 86   LEU A CA  1 
ATOM   408   C C   . LEU A 1 86  ? 142.197 135.269 158.775 1.00 346.59 ? 86   LEU A C   1 
ATOM   409   O O   . LEU A 1 86  ? 142.677 134.405 157.988 1.00 337.75 ? 86   LEU A O   1 
ATOM   410   C CB  . LEU A 1 86  ? 142.039 137.824 158.572 1.00 356.41 ? 86   LEU A CB  1 
ATOM   411   C CG  . LEU A 1 86  ? 141.825 139.078 157.687 1.00 366.19 ? 86   LEU A CG  1 
ATOM   412   C CD1 . LEU A 1 86  ? 141.401 138.735 156.261 1.00 377.52 ? 86   LEU A CD1 1 
ATOM   413   C CD2 . LEU A 1 86  ? 140.849 140.096 158.274 1.00 347.17 ? 86   LEU A CD2 1 
ATOM   414   N N   . THR A 1 87  ? 142.435 135.234 160.087 1.00 364.87 ? 87   THR A N   1 
ATOM   415   C CA  . THR A 1 87  ? 143.424 134.308 160.671 1.00 386.14 ? 87   THR A CA  1 
ATOM   416   C C   . THR A 1 87  ? 142.857 132.927 161.033 1.00 380.90 ? 87   THR A C   1 
ATOM   417   O O   . THR A 1 87  ? 143.530 131.915 160.824 1.00 389.02 ? 87   THR A O   1 
ATOM   418   C CB  . THR A 1 87  ? 144.172 134.941 161.879 1.00 425.33 ? 87   THR A CB  1 
ATOM   419   O OG1 . THR A 1 87  ? 145.399 134.235 162.106 1.00 437.93 ? 87   THR A OG1 1 
ATOM   420   C CG2 . THR A 1 87  ? 143.341 134.933 163.169 1.00 436.48 ? 87   THR A CG2 1 
ATOM   421   N N   . ASP A 1 88  ? 141.631 132.889 161.558 1.00 374.62 ? 88   ASP A N   1 
ATOM   422   C CA  . ASP A 1 88  ? 140.966 131.634 161.927 1.00 370.19 ? 88   ASP A CA  1 
ATOM   423   C C   . ASP A 1 88  ? 140.310 131.078 160.646 1.00 362.87 ? 88   ASP A C   1 
ATOM   424   O O   . ASP A 1 88  ? 141.013 130.917 159.647 1.00 377.43 ? 88   ASP A O   1 
ATOM   425   C CB  . ASP A 1 88  ? 139.988 131.885 163.090 1.00 384.13 ? 88   ASP A CB  1 
ATOM   426   C CG  . ASP A 1 88  ? 139.644 130.618 163.868 1.00 409.61 ? 88   ASP A CG  1 
ATOM   427   O OD1 . ASP A 1 88  ? 139.621 129.518 163.273 1.00 418.51 ? 88   ASP A OD1 1 
ATOM   428   O OD2 . ASP A 1 88  ? 139.382 130.730 165.084 1.00 429.99 ? 88   ASP A OD2 1 
ATOM   429   N N   . GLY A 1 89  ? 139.007 130.779 160.649 1.00 353.41 ? 89   GLY A N   1 
ATOM   430   C CA  . GLY A 1 89  ? 138.277 130.496 159.413 1.00 354.92 ? 89   GLY A CA  1 
ATOM   431   C C   . GLY A 1 89  ? 138.647 129.173 158.751 1.00 352.67 ? 89   GLY A C   1 
ATOM   432   O O   . GLY A 1 89  ? 139.650 129.094 158.041 1.00 354.11 ? 89   GLY A O   1 
ATOM   433   N N   . PRO A 1 90  ? 137.834 128.123 158.964 1.00 327.45 ? 90   PRO A N   1 
ATOM   434   C CA  . PRO A 1 90  ? 138.082 126.849 158.287 1.00 318.00 ? 90   PRO A CA  1 
ATOM   435   C C   . PRO A 1 90  ? 137.937 126.859 156.763 1.00 310.40 ? 90   PRO A C   1 
ATOM   436   O O   . PRO A 1 90  ? 138.460 125.961 156.104 1.00 343.19 ? 90   PRO A O   1 
ATOM   437   C CB  . PRO A 1 90  ? 137.019 125.923 158.891 1.00 344.85 ? 90   PRO A CB  1 
ATOM   438   C CG  . PRO A 1 90  ? 136.696 126.524 160.210 1.00 349.71 ? 90   PRO A CG  1 
ATOM   439   C CD  . PRO A 1 90  ? 136.772 127.999 159.978 1.00 345.35 ? 90   PRO A CD  1 
ATOM   440   N N   . ASN A 1 91  ? 137.241 127.856 156.215 1.00 311.54 ? 91   ASN A N   1 
ATOM   441   C CA  . ASN A 1 91  ? 136.780 127.840 154.828 1.00 313.99 ? 91   ASN A CA  1 
ATOM   442   C C   . ASN A 1 91  ? 137.214 129.115 154.066 1.00 298.64 ? 91   ASN A C   1 
ATOM   443   O O   . ASN A 1 91  ? 136.378 129.949 153.725 1.00 282.59 ? 91   ASN A O   1 
ATOM   444   C CB  . ASN A 1 91  ? 135.262 127.675 154.850 1.00 312.22 ? 91   ASN A CB  1 
ATOM   445   C CG  . ASN A 1 91  ? 134.802 126.724 155.941 1.00 302.88 ? 91   ASN A CG  1 
ATOM   446   O OD1 . ASN A 1 91  ? 135.082 125.528 155.895 1.00 305.65 ? 91   ASN A OD1 1 
ATOM   447   N ND2 . ASN A 1 91  ? 134.127 127.262 156.950 1.00 303.47 ? 91   ASN A ND2 1 
ATOM   448   N N   . PRO A 1 92  ? 138.527 129.246 153.772 1.00 319.23 ? 92   PRO A N   1 
ATOM   449   C CA  . PRO A 1 92  ? 139.200 130.483 153.343 1.00 315.70 ? 92   PRO A CA  1 
ATOM   450   C C   . PRO A 1 92  ? 138.451 131.492 152.464 1.00 321.95 ? 92   PRO A C   1 
ATOM   451   O O   . PRO A 1 92  ? 138.404 132.666 152.842 1.00 362.07 ? 92   PRO A O   1 
ATOM   452   C CB  . PRO A 1 92  ? 140.457 129.976 152.627 1.00 370.99 ? 92   PRO A CB  1 
ATOM   453   C CG  . PRO A 1 92  ? 140.747 128.655 153.250 1.00 400.80 ? 92   PRO A CG  1 
ATOM   454   C CD  . PRO A 1 92  ? 139.496 128.141 153.911 1.00 373.64 ? 92   PRO A CD  1 
ATOM   455   N N   . PRO A 1 93  ? 137.823 131.128 151.347 1.00 317.11 ? 93   PRO A N   1 
ATOM   456   C CA  . PRO A 1 93  ? 137.186 132.167 150.520 1.00 293.24 ? 93   PRO A CA  1 
ATOM   457   C C   . PRO A 1 93  ? 135.910 132.416 151.273 1.00 302.90 ? 93   PRO A C   1 
ATOM   458   O O   . PRO A 1 93  ? 134.919 131.697 151.139 1.00 311.82 ? 93   PRO A O   1 
ATOM   459   C CB  . PRO A 1 93  ? 136.900 131.427 149.240 1.00 306.53 ? 93   PRO A CB  1 
ATOM   460   C CG  . PRO A 1 93  ? 136.599 130.037 149.703 1.00 347.21 ? 93   PRO A CG  1 
ATOM   461   C CD  . PRO A 1 93  ? 137.289 129.803 151.023 1.00 317.54 ? 93   PRO A CD  1 
ATOM   462   N N   . TYR A 1 94  ? 135.986 133.451 152.101 1.00 299.22 ? 94   TYR A N   1 
ATOM   463   C CA  . TYR A 1 94  ? 135.023 133.786 153.128 1.00 289.19 ? 94   TYR A CA  1 
ATOM   464   C C   . TYR A 1 94  ? 134.524 135.143 152.655 1.00 289.78 ? 94   TYR A C   1 
ATOM   465   O O   . TYR A 1 94  ? 135.329 136.022 152.300 1.00 300.57 ? 94   TYR A O   1 
ATOM   466   C CB  . TYR A 1 94  ? 135.749 133.994 154.433 1.00 285.80 ? 94   TYR A CB  1 
ATOM   467   C CG  . TYR A 1 94  ? 135.400 132.971 155.436 1.00 273.47 ? 94   TYR A CG  1 
ATOM   468   C CD1 . TYR A 1 94  ? 134.101 132.578 155.599 1.00 298.48 ? 94   TYR A CD1 1 
ATOM   469   C CD2 . TYR A 1 94  ? 136.360 132.384 156.210 1.00 273.97 ? 94   TYR A CD2 1 
ATOM   470   C CE1 . TYR A 1 94  ? 133.758 131.626 156.522 1.00 299.18 ? 94   TYR A CE1 1 
ATOM   471   C CE2 . TYR A 1 94  ? 136.031 131.432 157.136 1.00 306.80 ? 94   TYR A CE2 1 
ATOM   472   C CZ  . TYR A 1 94  ? 134.723 131.058 157.284 1.00 295.10 ? 94   TYR A CZ  1 
ATOM   473   O OH  . TYR A 1 94  ? 134.375 130.106 158.208 1.00 316.34 ? 94   TYR A OH  1 
ATOM   474   N N   . MET A 1 95  ? 133.205 135.313 152.687 1.00 291.05 ? 95   MET A N   1 
ATOM   475   C CA  . MET A 1 95  ? 132.566 136.565 152.307 1.00 304.88 ? 95   MET A CA  1 
ATOM   476   C C   . MET A 1 95  ? 132.009 137.256 153.547 1.00 305.94 ? 95   MET A C   1 
ATOM   477   O O   . MET A 1 95  ? 131.296 136.650 154.348 1.00 335.28 ? 95   MET A O   1 
ATOM   478   C CB  . MET A 1 95  ? 131.447 136.312 151.296 1.00 303.65 ? 95   MET A CB  1 
ATOM   479   C CG  . MET A 1 95  ? 131.516 137.193 150.060 1.00 310.14 ? 95   MET A CG  1 
ATOM   480   S SD  . MET A 1 95  ? 130.299 136.737 148.810 1.00 364.53 ? 95   MET A SD  1 
ATOM   481   C CE  . MET A 1 95  ? 129.473 138.305 148.554 1.00 376.64 ? 95   MET A CE  1 
ATOM   482   N N   . VAL A 1 96  ? 132.352 138.529 153.696 1.00 274.81 ? 96   VAL A N   1 
ATOM   483   C CA  . VAL A 1 96  ? 132.011 139.310 154.877 1.00 274.50 ? 96   VAL A CA  1 
ATOM   484   C C   . VAL A 1 96  ? 130.838 140.200 154.557 1.00 283.68 ? 96   VAL A C   1 
ATOM   485   O O   . VAL A 1 96  ? 130.910 140.986 153.641 1.00 284.16 ? 96   VAL A O   1 
ATOM   486   C CB  . VAL A 1 96  ? 133.179 140.199 155.273 1.00 281.01 ? 96   VAL A CB  1 
ATOM   487   C CG1 . VAL A 1 96  ? 134.234 139.388 155.987 1.00 307.01 ? 96   VAL A CG1 1 
ATOM   488   C CG2 . VAL A 1 96  ? 133.777 140.829 154.035 1.00 301.18 ? 96   VAL A CG2 1 
ATOM   489   N N   . LEU A 1 97  ? 129.752 140.095 155.311 1.00 278.66 ? 97   LEU A N   1 
ATOM   490   C CA  . LEU A 1 97  ? 128.673 141.047 155.159 1.00 272.70 ? 97   LEU A CA  1 
ATOM   491   C C   . LEU A 1 97  ? 128.811 142.094 156.277 1.00 277.70 ? 97   LEU A C   1 
ATOM   492   O O   . LEU A 1 97  ? 128.303 141.896 157.354 1.00 317.78 ? 97   LEU A O   1 
ATOM   493   C CB  . LEU A 1 97  ? 127.340 140.335 155.310 1.00 282.07 ? 97   LEU A CB  1 
ATOM   494   C CG  . LEU A 1 97  ? 126.135 140.932 154.594 1.00 312.88 ? 97   LEU A CG  1 
ATOM   495   C CD1 . LEU A 1 97  ? 125.435 139.851 153.797 1.00 316.71 ? 97   LEU A CD1 1 
ATOM   496   C CD2 . LEU A 1 97  ? 125.168 141.531 155.592 1.00 336.12 ? 97   LEU A CD2 1 
ATOM   497   N N   . LEU A 1 98  ? 129.459 143.222 155.999 1.00 284.26 ? 98   LEU A N   1 
ATOM   498   C CA  . LEU A 1 98  ? 129.541 144.401 156.852 1.00 290.97 ? 98   LEU A CA  1 
ATOM   499   C C   . LEU A 1 98  ? 128.212 145.154 156.815 1.00 304.54 ? 98   LEU A C   1 
ATOM   500   O O   . LEU A 1 98  ? 127.518 145.148 155.795 1.00 279.37 ? 98   LEU A O   1 
ATOM   501   C CB  . LEU A 1 98  ? 130.639 145.347 156.356 1.00 301.26 ? 98   LEU A CB  1 
ATOM   502   C CG  . LEU A 1 98  ? 132.039 144.794 156.076 1.00 328.75 ? 98   LEU A CG  1 
ATOM   503   C CD1 . LEU A 1 98  ? 132.911 145.891 155.485 1.00 339.81 ? 98   LEU A CD1 1 
ATOM   504   C CD2 . LEU A 1 98  ? 132.662 144.193 157.328 1.00 347.18 ? 98   LEU A CD2 1 
ATOM   505   N N   . GLU A 1 99  ? 127.855 145.790 157.928 1.00 317.05 ? 99   GLU A N   1 
ATOM   506   C CA  . GLU A 1 99  ? 126.931 146.923 157.887 1.00 317.42 ? 99   GLU A CA  1 
ATOM   507   C C   . GLU A 1 99  ? 127.764 148.109 157.426 1.00 327.20 ? 99   GLU A C   1 
ATOM   508   O O   . GLU A 1 99  ? 128.972 148.164 157.677 1.00 360.32 ? 99   GLU A O   1 
ATOM   509   C CB  . GLU A 1 99  ? 126.293 147.204 159.250 1.00 336.66 ? 99   GLU A CB  1 
ATOM   510   C CG  . GLU A 1 99  ? 125.268 146.165 159.693 1.00 364.98 ? 99   GLU A CG  1 
ATOM   511   C CD  . GLU A 1 99  ? 123.972 146.202 158.890 1.00 383.12 ? 99   GLU A CD  1 
ATOM   512   O OE1 . GLU A 1 99  ? 123.452 147.308 158.624 1.00 402.18 ? 99   GLU A OE1 1 
ATOM   513   O OE2 . GLU A 1 99  ? 123.462 145.117 158.536 1.00 370.53 ? 99   GLU A OE2 1 
ATOM   514   N N   . SER A 1 100 ? 127.122 149.058 156.757 1.00 310.49 ? 100  SER A N   1 
ATOM   515   C CA  . SER A 1 100 ? 127.833 150.140 156.077 1.00 310.54 ? 100  SER A CA  1 
ATOM   516   C C   . SER A 1 100 ? 128.484 151.143 157.045 1.00 324.88 ? 100  SER A C   1 
ATOM   517   O O   . SER A 1 100 ? 129.373 151.901 156.648 1.00 323.56 ? 100  SER A O   1 
ATOM   518   C CB  . SER A 1 100 ? 126.896 150.845 155.094 1.00 330.62 ? 100  SER A CB  1 
ATOM   519   O OG  . SER A 1 100 ? 127.632 151.486 154.068 1.00 362.51 ? 100  SER A OG  1 
ATOM   520   N N   . LYS A 1 101 ? 128.058 151.115 158.299 1.00 344.66 ? 101  LYS A N   1 
ATOM   521   C CA  . LYS A 1 101 ? 128.706 151.899 159.332 1.00 357.10 ? 101  LYS A CA  1 
ATOM   522   C C   . LYS A 1 101 ? 130.128 151.401 159.483 1.00 346.60 ? 101  LYS A C   1 
ATOM   523   O O   . LYS A 1 101 ? 131.057 152.177 159.642 1.00 356.27 ? 101  LYS A O   1 
ATOM   524   C CB  . LYS A 1 101 ? 127.969 151.745 160.657 1.00 371.77 ? 101  LYS A CB  1 
ATOM   525   C CG  . LYS A 1 101 ? 126.496 151.415 160.517 1.00 389.92 ? 101  LYS A CG  1 
ATOM   526   C CD  . LYS A 1 101 ? 125.904 151.001 161.851 1.00 412.36 ? 101  LYS A CD  1 
ATOM   527   C CE  . LYS A 1 101 ? 126.771 149.961 162.537 1.00 411.05 ? 101  LYS A CE  1 
ATOM   528   N NZ  . LYS A 1 101 ? 125.969 149.071 163.420 1.00 419.08 ? 101  LYS A NZ  1 
ATOM   529   N N   . HIS A 1 102 ? 130.275 150.088 159.435 1.00 332.89 ? 102  HIS A N   1 
ATOM   530   C CA  . HIS A 1 102 ? 131.559 149.418 159.559 1.00 335.53 ? 102  HIS A CA  1 
ATOM   531   C C   . HIS A 1 102 ? 132.521 149.709 158.435 1.00 322.30 ? 102  HIS A C   1 
ATOM   532   O O   . HIS A 1 102 ? 133.730 149.701 158.627 1.00 319.52 ? 102  HIS A O   1 
ATOM   533   C CB  . HIS A 1 102 ? 131.360 147.919 159.661 1.00 362.07 ? 102  HIS A CB  1 
ATOM   534   C CG  . HIS A 1 102 ? 131.111 147.450 161.052 1.00 383.89 ? 102  HIS A CG  1 
ATOM   535   N ND1 . HIS A 1 102 ? 129.844 147.261 161.553 1.00 388.82 ? 102  HIS A ND1 1 
ATOM   536   C CD2 . HIS A 1 102 ? 131.965 147.154 162.057 1.00 400.47 ? 102  HIS A CD2 1 
ATOM   537   C CE1 . HIS A 1 102 ? 129.927 146.860 162.808 1.00 406.45 ? 102  HIS A CE1 1 
ATOM   538   N NE2 . HIS A 1 102 ? 131.204 146.785 163.137 1.00 411.44 ? 102  HIS A NE2 1 
ATOM   539   N N   . PHE A 1 103 ? 131.981 149.958 157.255 1.00 324.03 ? 103  PHE A N   1 
ATOM   540   C CA  . PHE A 1 103 ? 132.701 149.816 156.010 1.00 319.90 ? 103  PHE A CA  1 
ATOM   541   C C   . PHE A 1 103 ? 133.594 151.027 155.857 1.00 300.52 ? 103  PHE A C   1 
ATOM   542   O O   . PHE A 1 103 ? 133.387 151.876 155.017 1.00 324.47 ? 103  PHE A O   1 
ATOM   543   C CB  . PHE A 1 103 ? 131.654 149.749 154.901 1.00 328.34 ? 103  PHE A CB  1 
ATOM   544   C CG  . PHE A 1 103 ? 132.179 149.977 153.521 1.00 332.80 ? 103  PHE A CG  1 
ATOM   545   C CD1 . PHE A 1 103 ? 133.267 149.284 153.052 1.00 322.08 ? 103  PHE A CD1 1 
ATOM   546   C CD2 . PHE A 1 103 ? 131.542 150.865 152.678 1.00 326.65 ? 103  PHE A CD2 1 
ATOM   547   C CE1 . PHE A 1 103 ? 133.728 149.486 151.771 1.00 315.23 ? 103  PHE A CE1 1 
ATOM   548   C CE2 . PHE A 1 103 ? 131.993 151.073 151.398 1.00 314.56 ? 103  PHE A CE2 1 
ATOM   549   C CZ  . PHE A 1 103 ? 133.093 150.381 150.945 1.00 321.76 ? 103  PHE A CZ  1 
ATOM   550   N N   . THR A 1 104 ? 134.602 151.062 156.718 1.00 291.59 ? 104  THR A N   1 
ATOM   551   C CA  . THR A 1 104 ? 135.570 152.142 156.833 1.00 318.15 ? 104  THR A CA  1 
ATOM   552   C C   . THR A 1 104 ? 136.746 151.949 155.892 1.00 298.83 ? 104  THR A C   1 
ATOM   553   O O   . THR A 1 104 ? 136.760 151.033 155.092 1.00 303.38 ? 104  THR A O   1 
ATOM   554   C CB  . THR A 1 104 ? 136.069 152.276 158.289 1.00 360.55 ? 104  THR A CB  1 
ATOM   555   O OG1 . THR A 1 104 ? 135.118 151.718 159.209 1.00 382.68 ? 104  THR A OG1 1 
ATOM   556   C CG2 . THR A 1 104 ? 136.314 153.741 158.635 1.00 393.25 ? 104  THR A CG2 1 
ATOM   557   N N   . ARG A 1 105 ? 137.720 152.845 156.000 1.00 297.42 ? 105  ARG A N   1 
ATOM   558   C CA  . ARG A 1 105 ? 138.929 152.808 155.170 1.00 308.67 ? 105  ARG A CA  1 
ATOM   559   C C   . ARG A 1 105 ? 139.887 151.765 155.737 1.00 331.12 ? 105  ARG A C   1 
ATOM   560   O O   . ARG A 1 105 ? 140.456 150.951 154.991 1.00 336.81 ? 105  ARG A O   1 
ATOM   561   C CB  . ARG A 1 105 ? 139.628 154.175 155.171 1.00 342.95 ? 105  ARG A CB  1 
ATOM   562   C CG  . ARG A 1 105 ? 140.872 154.293 154.288 1.00 342.02 ? 105  ARG A CG  1 
ATOM   563   C CD  . ARG A 1 105 ? 140.541 154.080 152.822 1.00 337.85 ? 105  ARG A CD  1 
ATOM   564   N NE  . ARG A 1 105 ? 141.514 154.702 151.923 1.00 332.62 ? 105  ARG A NE  1 
ATOM   565   C CZ  . ARG A 1 105 ? 142.626 154.132 151.453 1.00 343.27 ? 105  ARG A CZ  1 
ATOM   566   N NH1 . ARG A 1 105 ? 142.976 152.888 151.788 1.00 360.17 ? 105  ARG A NH1 1 
ATOM   567   N NH2 . ARG A 1 105 ? 143.413 154.825 150.632 1.00 361.11 ? 105  ARG A NH2 1 
ATOM   568   N N   . ASP A 1 106 ? 140.106 151.884 157.043 1.00 365.12 ? 106  ASP A N   1 
ATOM   569   C CA  . ASP A 1 106 ? 141.077 151.063 157.761 1.00 385.03 ? 106  ASP A CA  1 
ATOM   570   C C   . ASP A 1 106 ? 140.750 149.584 157.594 1.00 353.55 ? 106  ASP A C   1 
ATOM   571   O O   . ASP A 1 106 ? 141.624 148.753 157.293 1.00 335.69 ? 106  ASP A O   1 
ATOM   572   C CB  . ASP A 1 106 ? 141.084 151.413 159.257 1.00 407.70 ? 106  ASP A CB  1 
ATOM   573   C CG  . ASP A 1 106 ? 141.514 152.850 159.530 1.00 434.44 ? 106  ASP A CG  1 
ATOM   574   O OD1 . ASP A 1 106 ? 142.520 153.304 158.942 1.00 449.35 ? 106  ASP A OD1 1 
ATOM   575   O OD2 . ASP A 1 106 ? 140.843 153.525 160.339 1.00 440.97 ? 106  ASP A OD2 1 
ATOM   576   N N   . LEU A 1 107 ? 139.467 149.298 157.802 1.00 330.89 ? 107  LEU A N   1 
ATOM   577   C CA  . LEU A 1 107 ? 138.938 147.925 157.699 1.00 321.23 ? 107  LEU A CA  1 
ATOM   578   C C   . LEU A 1 107 ? 139.202 147.370 156.310 1.00 285.39 ? 107  LEU A C   1 
ATOM   579   O O   . LEU A 1 107 ? 139.660 146.227 156.163 1.00 307.08 ? 107  LEU A O   1 
ATOM   580   C CB  . LEU A 1 107 ? 137.428 147.862 158.020 1.00 333.94 ? 107  LEU A CB  1 
ATOM   581   C CG  . LEU A 1 107 ? 136.435 146.983 157.221 1.00 329.98 ? 107  LEU A CG  1 
ATOM   582   C CD1 . LEU A 1 107 ? 136.794 145.500 157.173 1.00 326.44 ? 107  LEU A CD1 1 
ATOM   583   C CD2 . LEU A 1 107 ? 135.024 147.191 157.774 1.00 347.78 ? 107  LEU A CD2 1 
ATOM   584   N N   . MET A 1 108 ? 138.904 148.203 155.318 1.00 311.28 ? 108  MET A N   1 
ATOM   585   C CA  . MET A 1 108 ? 139.086 147.846 153.906 1.00 322.51 ? 108  MET A CA  1 
ATOM   586   C C   . MET A 1 108 ? 140.543 147.488 153.638 1.00 319.98 ? 108  MET A C   1 
ATOM   587   O O   . MET A 1 108 ? 140.839 146.474 152.990 1.00 329.37 ? 108  MET A O   1 
ATOM   588   C CB  . MET A 1 108 ? 138.617 148.958 152.979 1.00 334.30 ? 108  MET A CB  1 
ATOM   589   C CG  . MET A 1 108 ? 138.231 148.435 151.621 1.00 338.59 ? 108  MET A CG  1 
ATOM   590   S SD  . MET A 1 108 ? 136.759 147.414 151.724 1.00 337.06 ? 108  MET A SD  1 
ATOM   591   C CE  . MET A 1 108 ? 136.563 147.043 149.988 1.00 347.73 ? 108  MET A CE  1 
ATOM   592   N N   . GLU A 1 109 ? 141.419 148.339 154.153 1.00 311.95 ? 109  GLU A N   1 
ATOM   593   C CA  . GLU A 1 109 ? 142.870 148.175 154.007 1.00 338.74 ? 109  GLU A CA  1 
ATOM   594   C C   . GLU A 1 109 ? 143.304 146.831 154.584 1.00 343.07 ? 109  GLU A C   1 
ATOM   595   O O   . GLU A 1 109 ? 144.071 146.085 153.956 1.00 341.62 ? 109  GLU A O   1 
ATOM   596   C CB  . GLU A 1 109 ? 143.630 149.335 154.668 1.00 373.94 ? 109  GLU A CB  1 
ATOM   597   C CG  . GLU A 1 109 ? 145.040 149.550 154.124 1.00 412.63 ? 109  GLU A CG  1 
ATOM   598   C CD  . GLU A 1 109 ? 145.087 150.326 152.812 1.00 424.13 ? 109  GLU A CD  1 
ATOM   599   O OE1 . GLU A 1 109 ? 144.078 150.364 152.073 1.00 419.58 ? 109  GLU A OE1 1 
ATOM   600   O OE2 . GLU A 1 109 ? 146.153 150.905 152.512 1.00 443.05 ? 109  GLU A OE2 1 
ATOM   601   N N   . LYS A 1 110 ? 142.797 146.521 155.774 1.00 346.11 ? 110  LYS A N   1 
ATOM   602   C CA  . LYS A 1 110 ? 143.135 145.290 156.470 1.00 336.52 ? 110  LYS A CA  1 
ATOM   603   C C   . LYS A 1 110 ? 142.684 144.106 155.657 1.00 325.47 ? 110  LYS A C   1 
ATOM   604   O O   . LYS A 1 110 ? 143.403 143.133 155.507 1.00 331.29 ? 110  LYS A O   1 
ATOM   605   C CB  . LYS A 1 110 ? 142.402 145.242 157.802 1.00 350.85 ? 110  LYS A CB  1 
ATOM   606   C CG  . LYS A 1 110 ? 143.243 145.590 159.011 1.00 382.26 ? 110  LYS A CG  1 
ATOM   607   C CD  . LYS A 1 110 ? 142.481 145.290 160.292 1.00 390.81 ? 110  LYS A CD  1 
ATOM   608   C CE  . LYS A 1 110 ? 141.245 146.163 160.417 1.00 386.65 ? 110  LYS A CE  1 
ATOM   609   N NZ  . LYS A 1 110 ? 140.127 145.465 161.103 1.00 364.77 ? 110  LYS A NZ  1 
ATOM   610   N N   . LEU A 1 111 ? 141.479 144.209 155.121 1.00 329.63 ? 111  LEU A N   1 
ATOM   611   C CA  . LEU A 1 111 ? 140.896 143.158 154.280 1.00 324.91 ? 111  LEU A CA  1 
ATOM   612   C C   . LEU A 1 111 ? 141.806 142.883 153.081 1.00 313.86 ? 111  LEU A C   1 
ATOM   613   O O   . LEU A 1 111 ? 142.103 141.723 152.754 1.00 328.31 ? 111  LEU A O   1 
ATOM   614   C CB  . LEU A 1 111 ? 139.485 143.584 153.867 1.00 319.10 ? 111  LEU A CB  1 
ATOM   615   C CG  . LEU A 1 111 ? 138.451 142.485 153.656 1.00 343.93 ? 111  LEU A CG  1 
ATOM   616   C CD1 . LEU A 1 111 ? 137.242 142.678 154.565 1.00 343.27 ? 111  LEU A CD1 1 
ATOM   617   C CD2 . LEU A 1 111 ? 138.051 142.466 152.195 1.00 360.96 ? 111  LEU A CD2 1 
ATOM   618   N N   . LYS A 1 112 ? 142.239 143.952 152.419 1.00 333.19 ? 112  LYS A N   1 
ATOM   619   C CA  . LYS A 1 112 ? 143.099 143.830 151.248 1.00 360.01 ? 112  LYS A CA  1 
ATOM   620   C C   . LYS A 1 112 ? 144.424 143.182 151.624 1.00 374.44 ? 112  LYS A C   1 
ATOM   621   O O   . LYS A 1 112 ? 144.950 142.343 150.892 1.00 359.23 ? 112  LYS A O   1 
ATOM   622   C CB  . LYS A 1 112 ? 143.343 145.201 150.616 1.00 397.59 ? 112  LYS A CB  1 
ATOM   623   C CG  . LYS A 1 112 ? 142.610 145.418 149.302 1.00 411.75 ? 112  LYS A CG  1 
ATOM   624   C CD  . LYS A 1 112 ? 142.683 146.871 148.863 1.00 428.94 ? 112  LYS A CD  1 
ATOM   625   C CE  . LYS A 1 112 ? 144.104 147.403 148.945 1.00 450.73 ? 112  LYS A CE  1 
ATOM   626   N NZ  . LYS A 1 112 ? 144.152 148.774 149.525 1.00 450.11 ? 112  LYS A NZ  1 
ATOM   627   N N   . GLY A 1 113 ? 144.957 143.575 152.776 1.00 398.00 ? 113  GLY A N   1 
ATOM   628   C CA  . GLY A 1 113 ? 146.199 142.994 153.292 1.00 397.90 ? 113  GLY A CA  1 
ATOM   629   C C   . GLY A 1 113 ? 146.278 141.469 153.315 1.00 390.75 ? 113  GLY A C   1 
ATOM   630   O O   . GLY A 1 113 ? 147.375 140.910 153.267 1.00 397.52 ? 113  GLY A O   1 
ATOM   631   N N   . ARG A 1 114 ? 145.121 140.806 153.399 1.00 375.32 ? 114  ARG A N   1 
ATOM   632   C CA  . ARG A 1 114 ? 144.993 139.368 153.136 1.00 358.13 ? 114  ARG A CA  1 
ATOM   633   C C   . ARG A 1 114 ? 143.893 139.139 152.092 1.00 328.85 ? 114  ARG A C   1 
ATOM   634   O O   . ARG A 1 114 ? 142.916 138.433 152.343 1.00 302.07 ? 114  ARG A O   1 
ATOM   635   C CB  . ARG A 1 114 ? 144.678 138.617 154.432 1.00 362.50 ? 114  ARG A CB  1 
ATOM   636   C CG  . ARG A 1 114 ? 145.788 138.667 155.464 1.00 380.59 ? 114  ARG A CG  1 
ATOM   637   C CD  . ARG A 1 114 ? 145.398 137.911 156.724 1.00 409.41 ? 114  ARG A CD  1 
ATOM   638   N NE  . ARG A 1 114 ? 146.551 137.630 157.581 1.00 450.84 ? 114  ARG A NE  1 
ATOM   639   C CZ  . ARG A 1 114 ? 147.471 136.686 157.362 1.00 473.82 ? 114  ARG A CZ  1 
ATOM   640   N NH1 . ARG A 1 114 ? 147.414 135.893 156.288 1.00 480.56 ? 114  ARG A NH1 1 
ATOM   641   N NH2 . ARG A 1 114 ? 148.473 136.535 158.226 1.00 479.36 ? 114  ARG A NH2 1 
ATOM   642   N N   . THR A 1 115 ? 144.063 139.750 150.921 1.00 345.92 ? 115  THR A N   1 
ATOM   643   C CA  . THR A 1 115 ? 143.017 139.751 149.886 1.00 373.58 ? 115  THR A CA  1 
ATOM   644   C C   . THR A 1 115 ? 142.736 138.382 149.265 1.00 333.01 ? 115  THR A C   1 
ATOM   645   O O   . THR A 1 115 ? 141.589 138.079 148.952 1.00 316.33 ? 115  THR A O   1 
ATOM   646   C CB  . THR A 1 115 ? 143.302 140.763 148.744 1.00 425.56 ? 115  THR A CB  1 
ATOM   647   O OG1 . THR A 1 115 ? 142.151 140.865 147.900 1.00 444.22 ? 115  THR A OG1 1 
ATOM   648   C CG2 . THR A 1 115 ? 144.523 140.363 147.897 1.00 439.41 ? 115  THR A CG2 1 
ATOM   649   N N   . SER A 1 116 ? 143.777 137.573 149.078 1.00 341.74 ? 116  SER A N   1 
ATOM   650   C CA  . SER A 1 116 ? 143.643 136.261 148.432 1.00 353.44 ? 116  SER A CA  1 
ATOM   651   C C   . SER A 1 116 ? 142.698 135.326 149.187 1.00 317.29 ? 116  SER A C   1 
ATOM   652   O O   . SER A 1 116 ? 142.048 134.475 148.582 1.00 287.02 ? 116  SER A O   1 
ATOM   653   C CB  . SER A 1 116 ? 145.016 135.597 148.285 1.00 390.75 ? 116  SER A CB  1 
ATOM   654   O OG  . SER A 1 116 ? 145.911 136.428 147.565 1.00 402.80 ? 116  SER A OG  1 
ATOM   655   N N   . ARG A 1 117 ? 142.640 135.493 150.507 1.00 334.49 ? 117  ARG A N   1 
ATOM   656   C CA  . ARG A 1 117 ? 141.734 134.735 151.362 1.00 341.61 ? 117  ARG A CA  1 
ATOM   657   C C   . ARG A 1 117 ? 140.266 135.093 151.108 1.00 338.35 ? 117  ARG A C   1 
ATOM   658   O O   . ARG A 1 117 ? 139.507 134.254 150.647 1.00 368.60 ? 117  ARG A O   1 
ATOM   659   C CB  . ARG A 1 117 ? 142.100 134.960 152.828 1.00 333.20 ? 117  ARG A CB  1 
ATOM   660   C CG  . ARG A 1 117 ? 141.296 134.125 153.796 1.00 334.72 ? 117  ARG A CG  1 
ATOM   661   C CD  . ARG A 1 117 ? 141.937 134.129 155.166 1.00 337.48 ? 117  ARG A CD  1 
ATOM   662   N NE  . ARG A 1 117 ? 141.269 133.182 156.054 1.00 327.03 ? 117  ARG A NE  1 
ATOM   663   C CZ  . ARG A 1 117 ? 141.471 131.864 156.067 1.00 325.14 ? 117  ARG A CZ  1 
ATOM   664   N NH1 . ARG A 1 117 ? 142.347 131.280 155.244 1.00 342.39 ? 117  ARG A NH1 1 
ATOM   665   N NH2 . ARG A 1 117 ? 140.783 131.113 156.916 1.00 319.59 ? 117  ARG A NH2 1 
ATOM   666   N N   . ILE A 1 118 ? 139.885 136.336 151.389 1.00 329.04 ? 118  ILE A N   1 
ATOM   667   C CA  . ILE A 1 118 ? 138.503 136.802 151.202 1.00 306.93 ? 118  ILE A CA  1 
ATOM   668   C C   . ILE A 1 118 ? 138.091 136.862 149.728 1.00 315.25 ? 118  ILE A C   1 
ATOM   669   O O   . ILE A 1 118 ? 138.940 137.024 148.846 1.00 321.96 ? 118  ILE A O   1 
ATOM   670   C CB  . ILE A 1 118 ? 138.298 138.193 151.849 1.00 318.71 ? 118  ILE A CB  1 
ATOM   671   C CG1 . ILE A 1 118 ? 136.809 138.502 152.007 1.00 339.91 ? 118  ILE A CG1 1 
ATOM   672   C CG2 . ILE A 1 118 ? 139.006 139.299 151.065 1.00 308.52 ? 118  ILE A CG2 1 
ATOM   673   C CD1 . ILE A 1 118 ? 136.512 139.474 153.120 1.00 357.90 ? 118  ILE A CD1 1 
ATOM   674   N N   . ALA A 1 119 ? 136.793 136.720 149.467 1.00 303.93 ? 119  ALA A N   1 
ATOM   675   C CA  . ALA A 1 119 ? 136.263 136.812 148.104 1.00 305.34 ? 119  ALA A CA  1 
ATOM   676   C C   . ALA A 1 119 ? 134.907 137.478 148.095 1.00 295.84 ? 119  ALA A C   1 
ATOM   677   O O   . ALA A 1 119 ? 133.902 136.852 147.776 1.00 285.46 ? 119  ALA A O   1 
ATOM   678   C CB  . ALA A 1 119 ? 136.187 135.434 147.464 1.00 332.60 ? 119  ALA A CB  1 
ATOM   679   N N   . GLY A 1 120 ? 134.960 138.774 148.348 1.00 321.31 ? 120  GLY A N   1 
ATOM   680   C CA  . GLY A 1 120 ? 133.890 139.708 148.108 1.00 331.64 ? 120  GLY A CA  1 
ATOM   681   C C   . GLY A 1 120 ? 133.141 140.003 149.364 1.00 297.65 ? 120  GLY A C   1 
ATOM   682   O O   . GLY A 1 120 ? 133.017 139.151 150.216 1.00 292.56 ? 120  GLY A O   1 
ATOM   683   N N   . LEU A 1 121 ? 132.623 141.211 149.465 1.00 288.16 ? 121  LEU A N   1 
ATOM   684   C CA  . LEU A 1 121 ? 131.766 141.539 150.567 1.00 287.50 ? 121  LEU A CA  1 
ATOM   685   C C   . LEU A 1 121 ? 130.604 142.333 150.064 1.00 282.10 ? 121  LEU A C   1 
ATOM   686   O O   . LEU A 1 121 ? 130.733 143.098 149.135 1.00 270.28 ? 121  LEU A O   1 
ATOM   687   C CB  . LEU A 1 121 ? 132.519 142.310 151.642 1.00 289.69 ? 121  LEU A CB  1 
ATOM   688   C CG  . LEU A 1 121 ? 133.153 143.650 151.328 1.00 311.18 ? 121  LEU A CG  1 
ATOM   689   C CD1 . LEU A 1 121 ? 132.945 144.543 152.530 1.00 320.30 ? 121  LEU A CD1 1 
ATOM   690   C CD2 . LEU A 1 121 ? 134.635 143.426 151.123 1.00 314.87 ? 121  LEU A CD2 1 
ATOM   691   N N   . ALA A 1 122 ? 129.462 142.140 150.692 1.00 293.84 ? 122  ALA A N   1 
ATOM   692   C CA  . ALA A 1 122 ? 128.300 142.917 150.390 1.00 293.38 ? 122  ALA A CA  1 
ATOM   693   C C   . ALA A 1 122 ? 128.085 143.687 151.653 1.00 293.42 ? 122  ALA A C   1 
ATOM   694   O O   . ALA A 1 122 ? 128.048 143.108 152.721 1.00 289.71 ? 122  ALA A O   1 
ATOM   695   C CB  . ALA A 1 122 ? 127.125 142.008 150.122 1.00 314.34 ? 122  ALA A CB  1 
ATOM   696   N N   . VAL A 1 123 ? 127.962 144.998 151.547 1.00 305.34 ? 123  VAL A N   1 
ATOM   697   C CA  . VAL A 1 123 ? 127.841 145.815 152.727 1.00 284.97 ? 123  VAL A CA  1 
ATOM   698   C C   . VAL A 1 123 ? 126.401 146.186 152.913 1.00 281.91 ? 123  VAL A C   1 
ATOM   699   O O   . VAL A 1 123 ? 125.858 146.943 152.135 1.00 292.99 ? 123  VAL A O   1 
ATOM   700   C CB  . VAL A 1 123 ? 128.598 147.123 152.531 1.00 292.02 ? 123  VAL A CB  1 
ATOM   701   C CG1 . VAL A 1 123 ? 130.083 146.897 152.682 1.00 324.81 ? 123  VAL A CG1 1 
ATOM   702   C CG2 . VAL A 1 123 ? 128.296 147.678 151.158 1.00 310.24 ? 123  VAL A CG2 1 
ATOM   703   N N   . SER A 1 124 ? 125.788 145.697 153.977 1.00 275.16 ? 124  SER A N   1 
ATOM   704   C CA  . SER A 1 124 ? 124.396 146.005 154.206 1.00 305.62 ? 124  SER A CA  1 
ATOM   705   C C   . SER A 1 124 ? 124.285 147.491 154.437 1.00 310.67 ? 124  SER A C   1 
ATOM   706   O O   . SER A 1 124 ? 125.068 148.057 155.182 1.00 313.78 ? 124  SER A O   1 
ATOM   707   C CB  . SER A 1 124 ? 123.890 145.250 155.427 1.00 333.62 ? 124  SER A CB  1 
ATOM   708   O OG  . SER A 1 124 ? 122.765 145.887 155.995 1.00 347.84 ? 124  SER A OG  1 
ATOM   709   N N   . LEU A 1 125 ? 123.300 148.124 153.821 1.00 321.75 ? 125  LEU A N   1 
ATOM   710   C CA  . LEU A 1 125 ? 123.112 149.556 153.987 1.00 319.90 ? 125  LEU A CA  1 
ATOM   711   C C   . LEU A 1 125 ? 122.621 149.872 155.383 1.00 337.26 ? 125  LEU A C   1 
ATOM   712   O O   . LEU A 1 125 ? 121.848 149.109 155.950 1.00 352.94 ? 125  LEU A O   1 
ATOM   713   C CB  . LEU A 1 125 ? 122.106 150.074 152.974 1.00 322.36 ? 125  LEU A CB  1 
ATOM   714   C CG  . LEU A 1 125 ? 122.117 151.588 152.854 1.00 344.96 ? 125  LEU A CG  1 
ATOM   715   C CD1 . LEU A 1 125 ? 123.544 152.065 152.695 1.00 346.74 ? 125  LEU A CD1 1 
ATOM   716   C CD2 . LEU A 1 125 ? 121.276 152.029 151.673 1.00 382.23 ? 125  LEU A CD2 1 
ATOM   717   N N   . THR A 1 126 ? 123.043 151.002 155.939 1.00 338.49 ? 126  THR A N   1 
ATOM   718   C CA  . THR A 1 126 ? 122.562 151.390 157.256 1.00 353.92 ? 126  THR A CA  1 
ATOM   719   C C   . THR A 1 126 ? 121.641 152.590 157.169 1.00 360.54 ? 126  THR A C   1 
ATOM   720   O O   . THR A 1 126 ? 122.000 153.621 156.624 1.00 358.58 ? 126  THR A O   1 
ATOM   721   C CB  . THR A 1 126 ? 123.710 151.722 158.212 1.00 358.78 ? 126  THR A CB  1 
ATOM   722   O OG1 . THR A 1 126 ? 124.933 151.206 157.682 1.00 351.84 ? 126  THR A OG1 1 
ATOM   723   C CG2 . THR A 1 126 ? 123.459 151.101 159.569 1.00 360.59 ? 126  THR A CG2 1 
ATOM   724   N N   . LYS A 1 127 ? 120.451 152.442 157.730 1.00 379.14 ? 127  LYS A N   1 
ATOM   725   C CA  . LYS A 1 127 ? 119.413 153.485 157.704 1.00 403.13 ? 127  LYS A CA  1 
ATOM   726   C C   . LYS A 1 127 ? 119.683 154.716 158.592 1.00 405.27 ? 127  LYS A C   1 
ATOM   727   O O   . LYS A 1 127 ? 119.458 155.842 158.141 1.00 427.71 ? 127  LYS A O   1 
ATOM   728   C CB  . LYS A 1 127 ? 118.035 152.890 158.034 1.00 435.76 ? 127  LYS A CB  1 
ATOM   729   C CG  . LYS A 1 127 ? 117.491 151.951 156.966 1.00 461.50 ? 127  LYS A CG  1 
ATOM   730   C CD  . LYS A 1 127 ? 116.931 152.709 155.769 1.00 483.06 ? 127  LYS A CD  1 
ATOM   731   C CE  . LYS A 1 127 ? 116.560 151.769 154.631 1.00 500.00 ? 127  LYS A CE  1 
ATOM   732   N NZ  . LYS A 1 127 ? 115.481 150.810 155.002 1.00 500.00 ? 127  LYS A NZ  1 
ATOM   733   N N   . PRO A 1 128 ? 120.139 154.517 159.851 1.00 393.18 ? 128  PRO A N   1 
ATOM   734   C CA  . PRO A 1 128 ? 120.515 155.684 160.669 1.00 382.19 ? 128  PRO A CA  1 
ATOM   735   C C   . PRO A 1 128 ? 121.650 156.554 160.109 1.00 369.62 ? 128  PRO A C   1 
ATOM   736   O O   . PRO A 1 128 ? 121.688 157.749 160.409 1.00 379.12 ? 128  PRO A O   1 
ATOM   737   C CB  . PRO A 1 128 ? 120.938 155.058 162.014 1.00 390.71 ? 128  PRO A CB  1 
ATOM   738   C CG  . PRO A 1 128 ? 121.094 153.598 161.751 1.00 393.46 ? 128  PRO A CG  1 
ATOM   739   C CD  . PRO A 1 128 ? 120.098 153.297 160.676 1.00 401.53 ? 128  PRO A CD  1 
ATOM   740   N N   . SER A 1 129 ? 122.566 155.957 159.358 1.00 353.26 ? 129  SER A N   1 
ATOM   741   C CA  . SER A 1 129 ? 123.670 156.685 158.745 1.00 336.78 ? 129  SER A CA  1 
ATOM   742   C C   . SER A 1 129 ? 124.822 156.698 159.723 1.00 332.36 ? 129  SER A C   1 
ATOM   743   O O   . SER A 1 129 ? 124.585 156.639 160.929 1.00 356.25 ? 129  SER A O   1 
ATOM   744   C CB  . SER A 1 129 ? 123.256 158.114 158.425 1.00 327.15 ? 129  SER A CB  1 
ATOM   745   O OG  . SER A 1 129 ? 123.057 158.285 157.038 1.00 312.88 ? 129  SER A OG  1 
ATOM   746   N N   . PRO A 1 130 ? 126.052 156.812 159.251 1.00 325.85 ? 130  PRO A N   1 
ATOM   747   C CA  . PRO A 1 130 ? 127.170 156.899 160.188 1.00 342.98 ? 130  PRO A CA  1 
ATOM   748   C C   . PRO A 1 130 ? 127.155 158.304 160.738 1.00 336.67 ? 130  PRO A C   1 
ATOM   749   O O   . PRO A 1 130 ? 127.249 159.246 159.971 1.00 357.68 ? 130  PRO A O   1 
ATOM   750   C CB  . PRO A 1 130 ? 128.392 156.722 159.296 1.00 347.42 ? 130  PRO A CB  1 
ATOM   751   C CG  . PRO A 1 130 ? 127.883 156.084 158.057 1.00 348.52 ? 130  PRO A CG  1 
ATOM   752   C CD  . PRO A 1 130 ? 126.506 156.626 157.872 1.00 325.35 ? 130  PRO A CD  1 
ATOM   753   N N   . ALA A 1 131 ? 127.046 158.454 162.048 1.00 344.56 ? 131  ALA A N   1 
ATOM   754   C CA  . ALA A 1 131 ? 126.817 159.775 162.596 1.00 363.42 ? 131  ALA A CA  1 
ATOM   755   C C   . ALA A 1 131 ? 127.972 160.706 162.291 1.00 369.47 ? 131  ALA A C   1 
ATOM   756   O O   . ALA A 1 131 ? 127.766 161.844 161.891 1.00 360.75 ? 131  ALA A O   1 
ATOM   757   C CB  . ALA A 1 131 ? 126.580 159.692 164.093 1.00 381.79 ? 131  ALA A CB  1 
ATOM   758   N N   . SER A 1 132 ? 129.192 160.213 162.458 1.00 384.18 ? 132  SER A N   1 
ATOM   759   C CA  . SER A 1 132 ? 130.371 161.021 162.196 1.00 373.65 ? 132  SER A CA  1 
ATOM   760   C C   . SER A 1 132 ? 130.408 161.368 160.730 1.00 360.75 ? 132  SER A C   1 
ATOM   761   O O   . SER A 1 132 ? 130.785 162.467 160.347 1.00 378.88 ? 132  SER A O   1 
ATOM   762   C CB  . SER A 1 132 ? 131.640 160.306 162.633 1.00 396.69 ? 132  SER A CB  1 
ATOM   763   O OG  . SER A 1 132 ? 131.985 160.699 163.948 1.00 409.91 ? 132  SER A OG  1 
ATOM   764   N N   . GLY A 1 133 ? 130.003 160.405 159.918 1.00 359.29 ? 133  GLY A N   1 
ATOM   765   C CA  . GLY A 1 133 ? 129.885 160.572 158.484 1.00 348.32 ? 133  GLY A CA  1 
ATOM   766   C C   . GLY A 1 133 ? 130.917 159.824 157.674 1.00 327.79 ? 133  GLY A C   1 
ATOM   767   O O   . GLY A 1 133 ? 132.040 159.618 158.104 1.00 331.95 ? 133  GLY A O   1 
ATOM   768   N N   . PHE A 1 134 ? 130.506 159.438 156.475 1.00 318.04 ? 134  PHE A N   1 
ATOM   769   C CA  . PHE A 1 134 ? 131.313 158.672 155.532 1.00 326.74 ? 134  PHE A CA  1 
ATOM   770   C C   . PHE A 1 134 ? 131.317 159.385 154.186 1.00 290.31 ? 134  PHE A C   1 
ATOM   771   O O   . PHE A 1 134 ? 130.277 159.845 153.743 1.00 278.03 ? 134  PHE A O   1 
ATOM   772   C CB  . PHE A 1 134 ? 130.717 157.270 155.360 1.00 332.18 ? 134  PHE A CB  1 
ATOM   773   C CG  . PHE A 1 134 ? 131.396 156.447 154.300 1.00 339.65 ? 134  PHE A CG  1 
ATOM   774   C CD1 . PHE A 1 134 ? 130.996 156.529 152.969 1.00 311.85 ? 134  PHE A CD1 1 
ATOM   775   C CD2 . PHE A 1 134 ? 132.445 155.595 154.632 1.00 351.57 ? 134  PHE A CD2 1 
ATOM   776   C CE1 . PHE A 1 134 ? 131.625 155.775 151.994 1.00 338.28 ? 134  PHE A CE1 1 
ATOM   777   C CE2 . PHE A 1 134 ? 133.077 154.837 153.659 1.00 334.57 ? 134  PHE A CE2 1 
ATOM   778   C CZ  . PHE A 1 134 ? 132.667 154.926 152.340 1.00 341.96 ? 134  PHE A CZ  1 
ATOM   779   N N   . SER A 1 135 ? 132.477 159.453 153.535 1.00 286.69 ? 135  SER A N   1 
ATOM   780   C CA  . SER A 1 135 ? 132.560 159.930 152.150 1.00 288.87 ? 135  SER A CA  1 
ATOM   781   C C   . SER A 1 135 ? 133.713 159.266 151.408 1.00 272.17 ? 135  SER A C   1 
ATOM   782   O O   . SER A 1 135 ? 134.867 159.563 151.696 1.00 306.34 ? 135  SER A O   1 
ATOM   783   C CB  . SER A 1 135 ? 132.733 161.448 152.094 1.00 297.32 ? 135  SER A CB  1 
ATOM   784   O OG  . SER A 1 135 ? 133.201 161.856 150.814 1.00 274.69 ? 135  SER A OG  1 
ATOM   785   N N   . PRO A 1 136 ? 133.406 158.426 150.405 1.00 259.29 ? 136  PRO A N   1 
ATOM   786   C CA  . PRO A 1 136 ? 134.423 157.606 149.769 1.00 266.47 ? 136  PRO A CA  1 
ATOM   787   C C   . PRO A 1 136 ? 135.396 158.381 148.889 1.00 277.47 ? 136  PRO A C   1 
ATOM   788   O O   . PRO A 1 136 ? 136.426 157.820 148.494 1.00 282.75 ? 136  PRO A O   1 
ATOM   789   C CB  . PRO A 1 136 ? 133.591 156.675 148.898 1.00 281.77 ? 136  PRO A CB  1 
ATOM   790   C CG  . PRO A 1 136 ? 132.490 157.555 148.428 1.00 283.69 ? 136  PRO A CG  1 
ATOM   791   C CD  . PRO A 1 136 ? 132.158 158.413 149.620 1.00 291.55 ? 136  PRO A CD  1 
ATOM   792   N N   . SER A 1 137 ? 135.076 159.637 148.571 1.00 272.44 ? 137  SER A N   1 
ATOM   793   C CA  . SER A 1 137 ? 135.901 160.423 147.675 1.00 293.64 ? 137  SER A CA  1 
ATOM   794   C C   . SER A 1 137 ? 137.234 160.766 148.307 1.00 302.32 ? 137  SER A C   1 
ATOM   795   O O   . SER A 1 137 ? 137.378 160.779 149.534 1.00 310.76 ? 137  SER A O   1 
ATOM   796   C CB  . SER A 1 137 ? 135.194 161.710 147.259 1.00 312.91 ? 137  SER A CB  1 
ATOM   797   O OG  . SER A 1 137 ? 135.942 162.403 146.270 1.00 318.99 ? 137  SER A OG  1 
ATOM   798   N N   . VAL A 1 138 ? 138.204 161.036 147.440 1.00 298.74 ? 138  VAL A N   1 
ATOM   799   C CA  . VAL A 1 138 ? 139.510 161.500 147.855 1.00 291.75 ? 138  VAL A CA  1 
ATOM   800   C C   . VAL A 1 138 ? 139.385 162.873 148.526 1.00 307.10 ? 138  VAL A C   1 
ATOM   801   O O   . VAL A 1 138 ? 138.525 163.681 148.160 1.00 285.06 ? 138  VAL A O   1 
ATOM   802   C CB  . VAL A 1 138 ? 140.501 161.540 146.666 1.00 333.99 ? 138  VAL A CB  1 
ATOM   803   C CG1 . VAL A 1 138 ? 140.173 162.671 145.692 1.00 354.63 ? 138  VAL A CG1 1 
ATOM   804   C CG2 . VAL A 1 138 ? 141.938 161.649 147.163 1.00 376.13 ? 138  VAL A CG2 1 
ATOM   805   N N   . GLN A 1 139 ? 140.254 163.101 149.511 1.00 339.49 ? 139  GLN A N   1 
ATOM   806   C CA  . GLN A 1 139 ? 140.284 164.322 150.340 1.00 338.64 ? 139  GLN A CA  1 
ATOM   807   C C   . GLN A 1 139 ? 140.215 165.642 149.538 1.00 328.82 ? 139  GLN A C   1 
ATOM   808   O O   . GLN A 1 139 ? 139.559 166.597 149.964 1.00 290.27 ? 139  GLN A O   1 
ATOM   809   C CB  . GLN A 1 139 ? 141.557 164.321 151.210 1.00 357.14 ? 139  GLN A CB  1 
ATOM   810   C CG  . GLN A 1 139 ? 141.399 164.965 152.577 1.00 363.61 ? 139  GLN A CG  1 
ATOM   811   C CD  . GLN A 1 139 ? 141.035 163.976 153.664 1.00 376.02 ? 139  GLN A CD  1 
ATOM   812   O OE1 . GLN A 1 139 ? 139.899 163.938 154.130 1.00 404.54 ? 139  GLN A OE1 1 
ATOM   813   N NE2 . GLN A 1 139 ? 142.004 163.165 154.073 1.00 390.60 ? 139  GLN A NE2 1 
ATOM   814   N N   . CYS A 1 140 ? 140.898 165.679 148.392 1.00 325.12 ? 140  CYS A N   1 
ATOM   815   C CA  . CYS A 1 140 ? 140.923 166.849 147.510 1.00 334.14 ? 140  CYS A CA  1 
ATOM   816   C C   . CYS A 1 140 ? 140.423 166.459 146.113 1.00 328.39 ? 140  CYS A C   1 
ATOM   817   O O   . CYS A 1 140 ? 141.194 165.938 145.301 1.00 343.97 ? 140  CYS A O   1 
ATOM   818   C CB  . CYS A 1 140 ? 142.347 167.402 147.431 1.00 362.56 ? 140  CYS A CB  1 
ATOM   819   S SG  . CYS A 1 140 ? 142.438 169.165 147.061 1.00 364.31 ? 140  CYS A SG  1 
ATOM   820   N N   . PRO A 1 141 ? 139.129 166.700 145.824 1.00 310.64 ? 141  PRO A N   1 
ATOM   821   C CA  . PRO A 1 141 ? 138.556 166.208 144.566 1.00 325.82 ? 141  PRO A CA  1 
ATOM   822   C C   . PRO A 1 141 ? 138.968 167.018 143.337 1.00 301.57 ? 141  PRO A C   1 
ATOM   823   O O   . PRO A 1 141 ? 139.036 168.247 143.402 1.00 301.32 ? 141  PRO A O   1 
ATOM   824   C CB  . PRO A 1 141 ? 137.046 166.290 144.809 1.00 333.77 ? 141  PRO A CB  1 
ATOM   825   C CG  . PRO A 1 141 ? 136.889 167.370 145.809 1.00 316.37 ? 141  PRO A CG  1 
ATOM   826   C CD  . PRO A 1 141 ? 138.118 167.365 146.665 1.00 306.50 ? 141  PRO A CD  1 
ATOM   827   N N   . ASN A 1 142 ? 139.236 166.311 142.237 1.00 311.21 ? 142  ASN A N   1 
ATOM   828   C CA  . ASN A 1 142 ? 139.734 166.898 140.986 1.00 328.58 ? 142  ASN A CA  1 
ATOM   829   C C   . ASN A 1 142 ? 140.977 167.770 141.193 1.00 344.22 ? 142  ASN A C   1 
ATOM   830   O O   . ASN A 1 142 ? 141.056 168.888 140.675 1.00 347.30 ? 142  ASN A O   1 
ATOM   831   C CB  . ASN A 1 142 ? 138.634 167.707 140.272 1.00 338.71 ? 142  ASN A CB  1 
ATOM   832   C CG  . ASN A 1 142 ? 137.353 166.917 140.034 1.00 345.18 ? 142  ASN A CG  1 
ATOM   833   O OD1 . ASN A 1 142 ? 136.288 167.507 139.856 1.00 329.91 ? 142  ASN A OD1 1 
ATOM   834   N ND2 . ASN A 1 142 ? 137.447 165.590 140.015 1.00 369.19 ? 142  ASN A ND2 1 
ATOM   835   N N   . ASP A 1 143 ? 141.941 167.252 141.957 1.00 372.01 ? 143  ASP A N   1 
ATOM   836   C CA  . ASP A 1 143 ? 143.151 168.015 142.309 1.00 388.56 ? 143  ASP A CA  1 
ATOM   837   C C   . ASP A 1 143 ? 144.092 168.222 141.116 1.00 364.59 ? 143  ASP A C   1 
ATOM   838   O O   . ASP A 1 143 ? 144.715 169.280 140.989 1.00 352.64 ? 143  ASP A O   1 
ATOM   839   C CB  . ASP A 1 143 ? 143.900 167.375 143.496 1.00 404.41 ? 143  ASP A CB  1 
ATOM   840   C CG  . ASP A 1 143 ? 144.518 166.023 143.159 1.00 438.79 ? 143  ASP A CG  1 
ATOM   841   O OD1 . ASP A 1 143 ? 143.900 165.249 142.396 1.00 464.62 ? 143  ASP A OD1 1 
ATOM   842   O OD2 . ASP A 1 143 ? 145.622 165.733 143.670 1.00 446.20 ? 143  ASP A OD2 1 
ATOM   843   N N   . GLY A 1 144 ? 144.181 167.217 140.247 1.00 346.43 ? 144  GLY A N   1 
ATOM   844   C CA  . GLY A 1 144 ? 144.994 167.305 139.038 1.00 349.74 ? 144  GLY A CA  1 
ATOM   845   C C   . GLY A 1 144 ? 144.382 168.126 137.918 1.00 330.58 ? 144  GLY A C   1 
ATOM   846   O O   . GLY A 1 144 ? 145.097 168.564 137.013 1.00 353.31 ? 144  GLY A O   1 
ATOM   847   N N   . PHE A 1 145 ? 143.069 168.340 137.975 1.00 309.46 ? 145  PHE A N   1 
ATOM   848   C CA  . PHE A 1 145 ? 142.316 168.932 136.867 1.00 313.58 ? 145  PHE A CA  1 
ATOM   849   C C   . PHE A 1 145 ? 141.748 170.320 137.138 1.00 310.17 ? 145  PHE A C   1 
ATOM   850   O O   . PHE A 1 145 ? 141.082 170.895 136.274 1.00 306.52 ? 145  PHE A O   1 
ATOM   851   C CB  . PHE A 1 145 ? 141.223 167.952 136.450 1.00 316.16 ? 145  PHE A CB  1 
ATOM   852   C CG  . PHE A 1 145 ? 141.767 166.744 135.765 1.00 309.09 ? 145  PHE A CG  1 
ATOM   853   C CD1 . PHE A 1 145 ? 142.257 165.682 136.504 1.00 310.32 ? 145  PHE A CD1 1 
ATOM   854   C CD2 . PHE A 1 145 ? 141.829 166.683 134.385 1.00 306.52 ? 145  PHE A CD2 1 
ATOM   855   C CE1 . PHE A 1 145 ? 142.780 164.571 135.876 1.00 325.52 ? 145  PHE A CE1 1 
ATOM   856   C CE2 . PHE A 1 145 ? 142.350 165.576 133.751 1.00 303.23 ? 145  PHE A CE2 1 
ATOM   857   C CZ  . PHE A 1 145 ? 142.829 164.515 134.495 1.00 322.37 ? 145  PHE A CZ  1 
ATOM   858   N N   . GLY A 1 146 ? 142.027 170.870 138.317 1.00 330.33 ? 146  GLY A N   1 
ATOM   859   C CA  . GLY A 1 146 ? 141.742 172.271 138.590 1.00 340.62 ? 146  GLY A CA  1 
ATOM   860   C C   . GLY A 1 146 ? 142.732 173.161 137.867 1.00 329.05 ? 146  GLY A C   1 
ATOM   861   O O   . GLY A 1 146 ? 143.615 172.684 137.146 1.00 331.09 ? 146  GLY A O   1 
ATOM   862   N N   . VAL A 1 147 ? 142.530 174.464 137.968 1.00 320.00 ? 147  VAL A N   1 
ATOM   863   C CA  . VAL A 1 147 ? 143.492 175.389 137.417 1.00 331.26 ? 147  VAL A CA  1 
ATOM   864   C C   . VAL A 1 147 ? 144.769 175.238 138.195 1.00 330.24 ? 147  VAL A C   1 
ATOM   865   O O   . VAL A 1 147 ? 145.859 175.242 137.643 1.00 352.23 ? 147  VAL A O   1 
ATOM   866   C CB  . VAL A 1 147 ? 143.051 176.851 137.539 1.00 353.13 ? 147  VAL A CB  1 
ATOM   867   C CG1 . VAL A 1 147 ? 142.433 177.335 136.241 1.00 375.65 ? 147  VAL A CG1 1 
ATOM   868   C CG2 . VAL A 1 147 ? 142.126 177.050 138.726 1.00 355.07 ? 147  VAL A CG2 1 
ATOM   869   N N   . TYR A 1 148 ? 144.630 175.103 139.501 1.00 294.93 ? 148  TYR A N   1 
ATOM   870   C CA  . TYR A 1 148 ? 145.792 175.173 140.347 1.00 313.06 ? 148  TYR A CA  1 
ATOM   871   C C   . TYR A 1 148 ? 146.745 174.058 140.034 1.00 334.36 ? 148  TYR A C   1 
ATOM   872   O O   . TYR A 1 148 ? 146.355 172.917 139.867 1.00 344.00 ? 148  TYR A O   1 
ATOM   873   C CB  . TYR A 1 148 ? 145.377 175.167 141.808 1.00 315.39 ? 148  TYR A CB  1 
ATOM   874   C CG  . TYR A 1 148 ? 144.515 176.351 142.158 1.00 303.76 ? 148  TYR A CG  1 
ATOM   875   C CD1 . TYR A 1 148 ? 144.597 177.525 141.431 1.00 319.31 ? 148  TYR A CD1 1 
ATOM   876   C CD2 . TYR A 1 148 ? 143.615 176.294 143.196 1.00 326.57 ? 148  TYR A CD2 1 
ATOM   877   C CE1 . TYR A 1 148 ? 143.817 178.609 141.736 1.00 327.98 ? 148  TYR A CE1 1 
ATOM   878   C CE2 . TYR A 1 148 ? 142.825 177.376 143.507 1.00 328.39 ? 148  TYR A CE2 1 
ATOM   879   C CZ  . TYR A 1 148 ? 142.935 178.527 142.772 1.00 330.08 ? 148  TYR A CZ  1 
ATOM   880   O OH  . TYR A 1 148 ? 142.162 179.614 143.071 1.00 321.17 ? 148  TYR A OH  1 
ATOM   881   N N   . SER A 1 149 ? 148.012 174.414 139.950 1.00 368.66 ? 149  SER A N   1 
ATOM   882   C CA  . SER A 1 149 ? 149.053 173.485 139.579 1.00 398.58 ? 149  SER A CA  1 
ATOM   883   C C   . SER A 1 149 ? 150.330 174.066 140.114 1.00 389.91 ? 149  SER A C   1 
ATOM   884   O O   . SER A 1 149 ? 150.355 175.213 140.547 1.00 366.77 ? 149  SER A O   1 
ATOM   885   C CB  . SER A 1 149 ? 149.138 173.344 138.065 1.00 409.00 ? 149  SER A CB  1 
ATOM   886   O OG  . SER A 1 149 ? 148.186 174.169 137.430 1.00 420.49 ? 149  SER A OG  1 
ATOM   887   N N   . ASN A 1 150 ? 151.399 173.292 140.075 1.00 398.88 ? 150  ASN A N   1 
ATOM   888   C CA  . ASN A 1 150 ? 152.659 173.793 140.572 1.00 407.10 ? 150  ASN A CA  1 
ATOM   889   C C   . ASN A 1 150 ? 152.997 175.018 139.752 1.00 406.20 ? 150  ASN A C   1 
ATOM   890   O O   . ASN A 1 150 ? 153.513 176.004 140.268 1.00 424.40 ? 150  ASN A O   1 
ATOM   891   C CB  . ASN A 1 150 ? 153.751 172.743 140.420 1.00 415.58 ? 150  ASN A CB  1 
ATOM   892   C CG  . ASN A 1 150 ? 153.230 171.337 140.598 1.00 410.97 ? 150  ASN A CG  1 
ATOM   893   O OD1 . ASN A 1 150 ? 153.469 170.700 141.621 1.00 406.34 ? 150  ASN A OD1 1 
ATOM   894   N ND2 . ASN A 1 150 ? 152.510 170.845 139.600 1.00 416.21 ? 150  ASN A ND2 1 
ATOM   895   N N   . SER A 1 151 ? 152.684 174.955 138.467 1.00 395.22 ? 151  SER A N   1 
ATOM   896   C CA  . SER A 1 151 ? 153.008 176.033 137.558 1.00 406.83 ? 151  SER A CA  1 
ATOM   897   C C   . SER A 1 151 ? 152.329 177.350 137.917 1.00 399.49 ? 151  SER A C   1 
ATOM   898   O O   . SER A 1 151 ? 152.936 178.412 137.827 1.00 401.79 ? 151  SER A O   1 
ATOM   899   C CB  . SER A 1 151 ? 152.618 175.635 136.138 1.00 428.67 ? 151  SER A CB  1 
ATOM   900   O OG  . SER A 1 151 ? 151.256 175.926 135.886 1.00 458.25 ? 151  SER A OG  1 
ATOM   901   N N   . TYR A 1 152 ? 151.072 177.277 138.331 1.00 384.96 ? 152  TYR A N   1 
ATOM   902   C CA  . TYR A 1 152 ? 150.204 178.444 138.387 1.00 368.69 ? 152  TYR A CA  1 
ATOM   903   C C   . TYR A 1 152 ? 150.002 178.949 139.810 1.00 363.57 ? 152  TYR A C   1 
ATOM   904   O O   . TYR A 1 152 ? 150.717 179.831 140.275 1.00 379.58 ? 152  TYR A O   1 
ATOM   905   C CB  . TYR A 1 152 ? 148.871 178.017 137.780 1.00 352.64 ? 152  TYR A CB  1 
ATOM   906   C CG  . TYR A 1 152 ? 147.734 178.989 137.857 1.00 346.21 ? 152  TYR A CG  1 
ATOM   907   C CD1 . TYR A 1 152 ? 147.299 179.492 139.066 1.00 341.10 ? 152  TYR A CD1 1 
ATOM   908   C CD2 . TYR A 1 152 ? 147.056 179.359 136.714 1.00 372.86 ? 152  TYR A CD2 1 
ATOM   909   C CE1 . TYR A 1 152 ? 146.233 180.368 139.127 1.00 347.76 ? 152  TYR A CE1 1 
ATOM   910   C CE2 . TYR A 1 152 ? 145.993 180.232 136.763 1.00 381.57 ? 152  TYR A CE2 1 
ATOM   911   C CZ  . TYR A 1 152 ? 145.585 180.732 137.970 1.00 365.90 ? 152  TYR A CZ  1 
ATOM   912   O OH  . TYR A 1 152 ? 144.525 181.600 138.006 1.00 344.11 ? 152  TYR A OH  1 
ATOM   913   N N   . GLY A 1 153 ? 149.048 178.361 140.509 1.00 348.96 ? 153  GLY A N   1 
ATOM   914   C CA  . GLY A 1 153 ? 148.841 178.605 141.934 1.00 350.37 ? 153  GLY A CA  1 
ATOM   915   C C   . GLY A 1 153 ? 149.591 177.575 142.758 1.00 348.98 ? 153  GLY A C   1 
ATOM   916   O O   . GLY A 1 153 ? 148.967 176.662 143.297 1.00 355.76 ? 153  GLY A O   1 
ATOM   917   N N   . PRO A 1 154 ? 150.936 177.705 142.861 1.00 366.93 ? 154  PRO A N   1 
ATOM   918   C CA  . PRO A 1 154 ? 151.737 176.782 143.685 1.00 364.05 ? 154  PRO A CA  1 
ATOM   919   C C   . PRO A 1 154 ? 151.375 176.784 145.175 1.00 357.73 ? 154  PRO A C   1 
ATOM   920   O O   . PRO A 1 154 ? 151.538 175.762 145.846 1.00 354.99 ? 154  PRO A O   1 
ATOM   921   C CB  . PRO A 1 154 ? 153.175 177.282 143.488 1.00 387.50 ? 154  PRO A CB  1 
ATOM   922   C CG  . PRO A 1 154 ? 153.146 178.063 142.224 1.00 392.86 ? 154  PRO A CG  1 
ATOM   923   C CD  . PRO A 1 154 ? 151.793 178.700 142.188 1.00 380.22 ? 154  PRO A CD  1 
ATOM   924   N N   . GLU A 1 155 ? 150.873 177.907 145.675 1.00 364.63 ? 155  GLU A N   1 
ATOM   925   C CA  . GLU A 1 155 ? 150.362 177.969 147.039 1.00 388.44 ? 155  GLU A CA  1 
ATOM   926   C C   . GLU A 1 155 ? 149.156 177.042 147.194 1.00 383.36 ? 155  GLU A C   1 
ATOM   927   O O   . GLU A 1 155 ? 148.997 176.372 148.214 1.00 367.88 ? 155  GLU A O   1 
ATOM   928   C CB  . GLU A 1 155 ? 149.976 179.403 147.404 1.00 419.08 ? 155  GLU A CB  1 
ATOM   929   C CG  . GLU A 1 155 ? 149.408 180.207 146.245 1.00 449.24 ? 155  GLU A CG  1 
ATOM   930   C CD  . GLU A 1 155 ? 150.045 181.578 146.120 1.00 473.46 ? 155  GLU A CD  1 
ATOM   931   O OE1 . GLU A 1 155 ? 151.177 181.757 146.616 1.00 483.49 ? 155  GLU A OE1 1 
ATOM   932   O OE2 . GLU A 1 155 ? 149.412 182.476 145.526 1.00 476.79 ? 155  GLU A OE2 1 
ATOM   933   N N   . PHE A 1 156 ? 148.376 176.929 146.135 1.00 376.27 ? 156  PHE A N   1 
ATOM   934   C CA  . PHE A 1 156 ? 147.181 176.106 146.144 1.00 363.17 ? 156  PHE A CA  1 
ATOM   935   C C   . PHE A 1 156 ? 147.321 174.901 145.236 1.00 347.53 ? 156  PHE A C   1 
ATOM   936   O O   . PHE A 1 156 ? 146.346 174.428 144.678 1.00 352.75 ? 156  PHE A O   1 
ATOM   937   C CB  . PHE A 1 156 ? 145.991 176.948 145.735 1.00 356.57 ? 156  PHE A CB  1 
ATOM   938   C CG  . PHE A 1 156 ? 146.044 178.338 146.272 1.00 358.12 ? 156  PHE A CG  1 
ATOM   939   C CD1 . PHE A 1 156 ? 146.733 179.322 145.594 1.00 383.28 ? 156  PHE A CD1 1 
ATOM   940   C CD2 . PHE A 1 156 ? 145.431 178.649 147.463 1.00 346.68 ? 156  PHE A CD2 1 
ATOM   941   C CE1 . PHE A 1 156 ? 146.791 180.606 146.088 1.00 409.43 ? 156  PHE A CE1 1 
ATOM   942   C CE2 . PHE A 1 156 ? 145.485 179.927 147.968 1.00 376.26 ? 156  PHE A CE2 1 
ATOM   943   C CZ  . PHE A 1 156 ? 146.166 180.910 147.279 1.00 405.27 ? 156  PHE A CZ  1 
ATOM   944   N N   . ALA A 1 157 ? 148.542 174.428 145.047 1.00 351.82 ? 157  ALA A N   1 
ATOM   945   C CA  . ALA A 1 157 ? 148.807 173.492 143.973 1.00 353.85 ? 157  ALA A CA  1 
ATOM   946   C C   . ALA A 1 157 ? 148.010 172.203 144.078 1.00 375.95 ? 157  ALA A C   1 
ATOM   947   O O   . ALA A 1 157 ? 147.466 171.738 143.087 1.00 395.68 ? 157  ALA A O   1 
ATOM   948   C CB  . ALA A 1 157 ? 150.292 173.183 143.920 1.00 386.95 ? 157  ALA A CB  1 
ATOM   949   N N   . HIS A 1 158 ? 147.928 171.624 145.267 1.00 355.64 ? 158  HIS A N   1 
ATOM   950   C CA  . HIS A 1 158 ? 147.026 170.509 145.489 1.00 340.69 ? 158  HIS A CA  1 
ATOM   951   C C   . HIS A 1 158 ? 146.376 170.703 146.830 1.00 324.76 ? 158  HIS A C   1 
ATOM   952   O O   . HIS A 1 158 ? 146.513 169.883 147.725 1.00 327.42 ? 158  HIS A O   1 
ATOM   953   C CB  . HIS A 1 158 ? 147.776 169.187 145.441 1.00 352.49 ? 158  HIS A CB  1 
ATOM   954   C CG  . HIS A 1 158 ? 148.314 168.857 144.089 1.00 384.99 ? 158  HIS A CG  1 
ATOM   955   N ND1 . HIS A 1 158 ? 148.995 169.772 143.320 1.00 395.70 ? 158  HIS A ND1 1 
ATOM   956   C CD2 . HIS A 1 158 ? 148.259 167.718 143.361 1.00 408.23 ? 158  HIS A CD2 1 
ATOM   957   C CE1 . HIS A 1 158 ? 149.344 169.211 142.176 1.00 407.51 ? 158  HIS A CE1 1 
ATOM   958   N NE2 . HIS A 1 158 ? 148.908 167.965 142.175 1.00 414.57 ? 158  HIS A NE2 1 
ATOM   959   N N   . CYS A 1 159 ? 145.691 171.822 146.976 1.00 344.69 ? 159  CYS A N   1 
ATOM   960   C CA  . CYS A 1 159 ? 144.978 172.098 148.201 1.00 369.02 ? 159  CYS A CA  1 
ATOM   961   C C   . CYS A 1 159 ? 145.923 171.944 149.382 1.00 390.46 ? 159  CYS A C   1 
ATOM   962   O O   . CYS A 1 159 ? 145.538 171.424 150.425 1.00 371.69 ? 159  CYS A O   1 
ATOM   963   C CB  . CYS A 1 159 ? 143.742 171.208 148.342 1.00 379.39 ? 159  CYS A CB  1 
ATOM   964   S SG  . CYS A 1 159 ? 144.050 169.556 148.987 1.00 367.68 ? 159  CYS A SG  1 
ATOM   965   N N   . ARG A 1 160 ? 147.163 172.396 149.230 1.00 398.35 ? 160  ARG A N   1 
ATOM   966   C CA  . ARG A 1 160 ? 148.044 172.467 150.394 1.00 391.98 ? 160  ARG A CA  1 
ATOM   967   C C   . ARG A 1 160 ? 147.336 173.180 151.551 1.00 373.75 ? 160  ARG A C   1 
ATOM   968   O O   . ARG A 1 160 ? 147.545 172.833 152.715 1.00 379.58 ? 160  ARG A O   1 
ATOM   969   C CB  . ARG A 1 160 ? 149.336 173.213 150.034 1.00 401.32 ? 160  ARG A CB  1 
ATOM   970   C CG  . ARG A 1 160 ? 150.396 173.243 151.129 1.00 410.80 ? 160  ARG A CG  1 
ATOM   971   C CD  . ARG A 1 160 ? 151.565 174.135 150.741 1.00 413.56 ? 160  ARG A CD  1 
ATOM   972   N NE  . ARG A 1 160 ? 152.312 173.608 149.597 1.00 423.10 ? 160  ARG A NE  1 
ATOM   973   C CZ  . ARG A 1 160 ? 153.343 174.218 149.005 1.00 427.18 ? 160  ARG A CZ  1 
ATOM   974   N NH1 . ARG A 1 160 ? 153.783 175.403 149.433 1.00 441.19 ? 160  ARG A NH1 1 
ATOM   975   N NH2 . ARG A 1 160 ? 153.943 173.636 147.969 1.00 426.62 ? 160  ARG A NH2 1 
ATOM   976   N N   . GLU A 1 161 ? 146.515 174.170 151.215 1.00 360.87 ? 161  GLU A N   1 
ATOM   977   C CA  . GLU A 1 161 ? 145.742 174.921 152.202 1.00 361.71 ? 161  GLU A CA  1 
ATOM   978   C C   . GLU A 1 161 ? 144.582 174.279 152.994 1.00 371.31 ? 161  GLU A C   1 
ATOM   979   O O   . GLU A 1 161 ? 144.508 174.455 154.207 1.00 375.72 ? 161  GLU A O   1 
ATOM   980   C CB  . GLU A 1 161 ? 145.227 176.202 151.551 1.00 358.78 ? 161  GLU A CB  1 
ATOM   981   C CG  . GLU A 1 161 ? 145.138 177.371 152.510 1.00 394.05 ? 161  GLU A CG  1 
ATOM   982   C CD  . GLU A 1 161 ? 146.496 177.820 153.007 1.00 404.47 ? 161  GLU A CD  1 
ATOM   983   O OE1 . GLU A 1 161 ? 147.149 178.625 152.312 1.00 412.05 ? 161  GLU A OE1 1 
ATOM   984   O OE2 . GLU A 1 161 ? 146.909 177.370 154.096 1.00 406.74 ? 161  GLU A OE2 1 
ATOM   985   N N   . ILE A 1 162 ? 143.673 173.559 152.335 1.00 384.10 ? 162  ILE A N   1 
ATOM   986   C CA  . ILE A 1 162 ? 142.411 173.187 153.001 1.00 395.49 ? 162  ILE A CA  1 
ATOM   987   C C   . ILE A 1 162 ? 141.908 171.746 153.040 1.00 388.96 ? 162  ILE A C   1 
ATOM   988   O O   . ILE A 1 162 ? 141.465 171.271 154.082 1.00 403.20 ? 162  ILE A O   1 
ATOM   989   C CB  . ILE A 1 162 ? 141.249 174.045 152.502 1.00 393.87 ? 162  ILE A CB  1 
ATOM   990   C CG1 . ILE A 1 162 ? 141.402 174.288 151.009 1.00 369.93 ? 162  ILE A CG1 1 
ATOM   991   C CG2 . ILE A 1 162 ? 141.187 175.342 153.291 1.00 400.44 ? 162  ILE A CG2 1 
ATOM   992   C CD1 . ILE A 1 162 ? 140.594 175.455 150.504 1.00 392.05 ? 162  ILE A CD1 1 
ATOM   993   N N   . GLN A 1 163 ? 141.938 171.068 151.904 1.00 356.28 ? 163  GLN A N   1 
ATOM   994   C CA  . GLN A 1 163 ? 141.255 169.793 151.755 1.00 356.92 ? 163  GLN A CA  1 
ATOM   995   C C   . GLN A 1 163 ? 139.774 170.031 151.908 1.00 329.57 ? 163  GLN A C   1 
ATOM   996   O O   . GLN A 1 163 ? 139.268 170.096 153.018 1.00 304.74 ? 163  GLN A O   1 
ATOM   997   C CB  . GLN A 1 163 ? 141.669 168.858 152.878 1.00 359.46 ? 163  GLN A CB  1 
ATOM   998   C CG  . GLN A 1 163 ? 142.546 167.710 152.449 1.00 355.83 ? 163  GLN A CG  1 
ATOM   999   C CD  . GLN A 1 163 ? 144.003 168.017 152.658 1.00 365.49 ? 163  GLN A CD  1 
ATOM   1000  O OE1 . GLN A 1 163 ? 144.861 167.491 151.957 1.00 362.68 ? 163  GLN A OE1 1 
ATOM   1001  N NE2 . GLN A 1 163 ? 144.294 168.879 153.626 1.00 382.36 ? 163  GLN A NE2 1 
ATOM   1002  N N   . TRP A 1 164 ? 139.075 170.144 150.789 1.00 301.49 ? 164  TRP A N   1 
ATOM   1003  C CA  . TRP A 1 164 ? 137.661 170.421 150.832 1.00 281.05 ? 164  TRP A CA  1 
ATOM   1004  C C   . TRP A 1 164 ? 136.821 169.321 151.405 1.00 284.95 ? 164  TRP A C   1 
ATOM   1005  O O   . TRP A 1 164 ? 135.970 169.569 152.241 1.00 307.43 ? 164  TRP A O   1 
ATOM   1006  C CB  . TRP A 1 164 ? 137.180 170.711 149.442 1.00 284.21 ? 164  TRP A CB  1 
ATOM   1007  C CG  . TRP A 1 164 ? 137.933 171.776 148.829 1.00 283.90 ? 164  TRP A CG  1 
ATOM   1008  C CD1 . TRP A 1 164 ? 138.893 171.654 147.897 1.00 309.04 ? 164  TRP A CD1 1 
ATOM   1009  C CD2 . TRP A 1 164 ? 137.797 173.161 149.096 1.00 284.57 ? 164  TRP A CD2 1 
ATOM   1010  N NE1 . TRP A 1 164 ? 139.370 172.883 147.551 1.00 325.48 ? 164  TRP A NE1 1 
ATOM   1011  C CE2 . TRP A 1 164 ? 138.707 173.829 148.280 1.00 294.10 ? 164  TRP A CE2 1 
ATOM   1012  C CE3 . TRP A 1 164 ? 136.980 173.903 149.941 1.00 289.42 ? 164  TRP A CE3 1 
ATOM   1013  C CZ2 . TRP A 1 164 ? 138.827 175.197 148.279 1.00 300.46 ? 164  TRP A CZ2 1 
ATOM   1014  C CZ3 . TRP A 1 164 ? 137.106 175.253 149.947 1.00 296.90 ? 164  TRP A CZ3 1 
ATOM   1015  C CH2 . TRP A 1 164 ? 138.022 175.892 149.127 1.00 306.12 ? 164  TRP A CH2 1 
ATOM   1016  N N   . ASN A 1 165 ? 137.063 168.093 150.983 1.00 307.58 ? 165  ASN A N   1 
ATOM   1017  C CA  . ASN A 1 165 ? 136.300 166.984 151.546 1.00 308.20 ? 165  ASN A CA  1 
ATOM   1018  C C   . ASN A 1 165 ? 137.114 166.393 152.697 1.00 315.21 ? 165  ASN A C   1 
ATOM   1019  O O   . ASN A 1 165 ? 137.684 165.304 152.589 1.00 314.77 ? 165  ASN A O   1 
ATOM   1020  C CB  . ASN A 1 165 ? 135.972 165.942 150.468 1.00 291.78 ? 165  ASN A CB  1 
ATOM   1021  C CG  . ASN A 1 165 ? 135.091 164.818 150.986 1.00 310.41 ? 165  ASN A CG  1 
ATOM   1022  O OD1 . ASN A 1 165 ? 134.326 164.992 151.939 1.00 309.66 ? 165  ASN A OD1 1 
ATOM   1023  N ND2 . ASN A 1 165 ? 135.195 163.650 150.359 1.00 333.03 ? 165  ASN A ND2 1 
ATOM   1024  N N   . SER A 1 166 ? 137.151 167.132 153.805 1.00 322.65 ? 166  SER A N   1 
ATOM   1025  C CA  . SER A 1 166 ? 138.001 166.805 154.952 1.00 353.91 ? 166  SER A CA  1 
ATOM   1026  C C   . SER A 1 166 ? 137.597 165.515 155.673 1.00 356.10 ? 166  SER A C   1 
ATOM   1027  O O   . SER A 1 166 ? 138.380 164.972 156.456 1.00 378.83 ? 166  SER A O   1 
ATOM   1028  C CB  . SER A 1 166 ? 138.012 167.965 155.952 1.00 388.39 ? 166  SER A CB  1 
ATOM   1029  O OG  . SER A 1 166 ? 136.702 168.248 156.418 1.00 410.35 ? 166  SER A OG  1 
ATOM   1030  N N   . LEU A 1 167 ? 136.384 165.035 155.405 1.00 337.76 ? 167  LEU A N   1 
ATOM   1031  C CA  . LEU A 1 167 ? 135.909 163.755 155.911 1.00 339.65 ? 167  LEU A CA  1 
ATOM   1032  C C   . LEU A 1 167 ? 136.059 162.649 154.850 1.00 334.53 ? 167  LEU A C   1 
ATOM   1033  O O   . LEU A 1 167 ? 135.307 161.668 154.856 1.00 339.16 ? 167  LEU A O   1 
ATOM   1034  C CB  . LEU A 1 167 ? 134.444 163.919 156.339 1.00 356.52 ? 167  LEU A CB  1 
ATOM   1035  C CG  . LEU A 1 167 ? 133.861 163.004 157.413 1.00 386.69 ? 167  LEU A CG  1 
ATOM   1036  C CD1 . LEU A 1 167 ? 134.640 163.096 158.720 1.00 417.06 ? 167  LEU A CD1 1 
ATOM   1037  C CD2 . LEU A 1 167 ? 132.398 163.368 157.625 1.00 392.01 ? 167  LEU A CD2 1 
ATOM   1038  N N   . GLY A 1 168 ? 137.049 162.795 153.964 1.00 329.65 ? 168  GLY A N   1 
ATOM   1039  C CA  . GLY A 1 168 ? 137.238 161.896 152.828 1.00 330.74 ? 168  GLY A CA  1 
ATOM   1040  C C   . GLY A 1 168 ? 137.908 160.586 153.201 1.00 326.15 ? 168  GLY A C   1 
ATOM   1041  O O   . GLY A 1 168 ? 138.717 160.527 154.131 1.00 338.67 ? 168  GLY A O   1 
ATOM   1042  N N   . ASN A 1 169 ? 137.560 159.539 152.458 1.00 316.31 ? 169  ASN A N   1 
ATOM   1043  C CA  . ASN A 1 169 ? 138.021 158.174 152.717 1.00 301.66 ? 169  ASN A CA  1 
ATOM   1044  C C   . ASN A 1 169 ? 139.133 157.756 151.765 1.00 287.66 ? 169  ASN A C   1 
ATOM   1045  O O   . ASN A 1 169 ? 140.085 157.097 152.177 1.00 323.46 ? 169  ASN A O   1 
ATOM   1046  C CB  . ASN A 1 169 ? 136.836 157.200 152.587 1.00 296.28 ? 169  ASN A CB  1 
ATOM   1047  C CG  . ASN A 1 169 ? 136.798 156.159 153.686 1.00 328.12 ? 169  ASN A CG  1 
ATOM   1048  O OD1 . ASN A 1 169 ? 136.988 156.464 154.866 1.00 340.87 ? 169  ASN A OD1 1 
ATOM   1049  N ND2 . ASN A 1 169 ? 136.505 154.924 153.308 1.00 346.71 ? 169  ASN A ND2 1 
ATOM   1050  N N   . GLY A 1 170 ? 139.011 158.151 150.500 1.00 295.96 ? 170  GLY A N   1 
ATOM   1051  C CA  . GLY A 1 170 ? 139.932 157.732 149.450 1.00 316.62 ? 170  GLY A CA  1 
ATOM   1052  C C   . GLY A 1 170 ? 139.588 156.359 148.908 1.00 309.18 ? 170  GLY A C   1 
ATOM   1053  O O   . GLY A 1 170 ? 140.409 155.733 148.231 1.00 334.93 ? 170  GLY A O   1 
ATOM   1054  N N   . LEU A 1 171 ? 138.361 155.911 149.167 1.00 291.22 ? 171  LEU A N   1 
ATOM   1055  C CA  . LEU A 1 171 ? 137.971 154.524 148.936 1.00 282.15 ? 171  LEU A CA  1 
ATOM   1056  C C   . LEU A 1 171 ? 137.460 154.324 147.520 1.00 285.75 ? 171  LEU A C   1 
ATOM   1057  O O   . LEU A 1 171 ? 137.835 153.353 146.863 1.00 304.27 ? 171  LEU A O   1 
ATOM   1058  C CB  . LEU A 1 171 ? 136.903 154.105 149.945 1.00 289.21 ? 171  LEU A CB  1 
ATOM   1059  C CG  . LEU A 1 171 ? 136.907 152.637 150.372 1.00 313.84 ? 171  LEU A CG  1 
ATOM   1060  C CD1 . LEU A 1 171 ? 138.129 152.332 151.226 1.00 313.92 ? 171  LEU A CD1 1 
ATOM   1061  C CD2 . LEU A 1 171 ? 135.637 152.268 151.135 1.00 321.43 ? 171  LEU A CD2 1 
ATOM   1062  N N   . ALA A 1 172 ? 136.615 155.247 147.057 1.00 295.28 ? 172  ALA A N   1 
ATOM   1063  C CA  . ALA A 1 172 ? 136.006 155.180 145.717 1.00 302.86 ? 172  ALA A CA  1 
ATOM   1064  C C   . ALA A 1 172 ? 137.025 155.053 144.600 1.00 306.10 ? 172  ALA A C   1 
ATOM   1065  O O   . ALA A 1 172 ? 136.752 154.396 143.597 1.00 344.51 ? 172  ALA A O   1 
ATOM   1066  C CB  . ALA A 1 172 ? 135.119 156.392 145.457 1.00 321.30 ? 172  ALA A CB  1 
ATOM   1067  N N   . TYR A 1 173 ? 138.190 155.674 144.781 1.00 302.57 ? 173  TYR A N   1 
ATOM   1068  C CA  . TYR A 1 173 ? 139.248 155.670 143.772 1.00 306.51 ? 173  TYR A CA  1 
ATOM   1069  C C   . TYR A 1 173 ? 140.374 154.662 144.053 1.00 301.25 ? 173  TYR A C   1 
ATOM   1070  O O   . TYR A 1 173 ? 141.499 154.844 143.585 1.00 325.04 ? 173  TYR A O   1 
ATOM   1071  C CB  . TYR A 1 173 ? 139.792 157.093 143.615 1.00 312.28 ? 173  TYR A CB  1 
ATOM   1072  C CG  . TYR A 1 173 ? 138.704 158.081 143.272 1.00 303.93 ? 173  TYR A CG  1 
ATOM   1073  C CD1 . TYR A 1 173 ? 138.229 158.190 141.970 1.00 316.95 ? 173  TYR A CD1 1 
ATOM   1074  C CD2 . TYR A 1 173 ? 138.125 158.881 144.254 1.00 322.90 ? 173  TYR A CD2 1 
ATOM   1075  C CE1 . TYR A 1 173 ? 137.217 159.083 141.648 1.00 357.79 ? 173  TYR A CE1 1 
ATOM   1076  C CE2 . TYR A 1 173 ? 137.112 159.779 143.945 1.00 345.45 ? 173  TYR A CE2 1 
ATOM   1077  C CZ  . TYR A 1 173 ? 136.661 159.877 142.641 1.00 370.64 ? 173  TYR A CZ  1 
ATOM   1078  O OH  . TYR A 1 173 ? 135.658 160.766 142.326 1.00 388.47 ? 173  TYR A OH  1 
ATOM   1079  N N   . GLU A 1 174 ? 140.057 153.597 144.791 1.00 304.34 ? 174  GLU A N   1 
ATOM   1080  C CA  . GLU A 1 174 ? 140.988 152.502 145.067 1.00 309.78 ? 174  GLU A CA  1 
ATOM   1081  C C   . GLU A 1 174 ? 140.490 151.255 144.333 1.00 320.22 ? 174  GLU A C   1 
ATOM   1082  O O   . GLU A 1 174 ? 139.281 151.008 144.276 1.00 312.33 ? 174  GLU A O   1 
ATOM   1083  C CB  . GLU A 1 174 ? 141.040 152.230 146.577 1.00 329.80 ? 174  GLU A CB  1 
ATOM   1084  C CG  . GLU A 1 174 ? 142.437 151.996 147.145 1.00 350.98 ? 174  GLU A CG  1 
ATOM   1085  C CD  . GLU A 1 174 ? 143.143 153.276 147.579 1.00 363.55 ? 174  GLU A CD  1 
ATOM   1086  O OE1 . GLU A 1 174 ? 142.864 154.355 147.010 1.00 379.66 ? 174  GLU A OE1 1 
ATOM   1087  O OE2 . GLU A 1 174 ? 143.988 153.202 148.496 1.00 350.13 ? 174  GLU A OE2 1 
ATOM   1088  N N   . ASP A 1 175 ? 141.417 150.502 143.751 1.00 329.02 ? 175  ASP A N   1 
ATOM   1089  C CA  . ASP A 1 175 ? 141.110 149.206 143.153 1.00 327.56 ? 175  ASP A CA  1 
ATOM   1090  C C   . ASP A 1 175 ? 140.898 148.125 144.214 1.00 303.79 ? 175  ASP A C   1 
ATOM   1091  O O   . ASP A 1 175 ? 141.511 148.167 145.281 1.00 290.63 ? 175  ASP A O   1 
ATOM   1092  C CB  . ASP A 1 175 ? 142.222 148.785 142.189 1.00 359.39 ? 175  ASP A CB  1 
ATOM   1093  C CG  . ASP A 1 175 ? 143.587 148.766 142.847 1.00 384.45 ? 175  ASP A CG  1 
ATOM   1094  O OD1 . ASP A 1 175 ? 143.654 148.918 144.085 1.00 387.42 ? 175  ASP A OD1 1 
ATOM   1095  O OD2 . ASP A 1 175 ? 144.594 148.598 142.127 1.00 399.76 ? 175  ASP A OD2 1 
ATOM   1096  N N   . PHE A 1 176 ? 140.041 147.154 143.913 1.00 309.52 ? 176  PHE A N   1 
ATOM   1097  C CA  . PHE A 1 176 ? 139.870 145.973 144.780 1.00 308.74 ? 176  PHE A CA  1 
ATOM   1098  C C   . PHE A 1 176 ? 139.815 144.690 143.962 1.00 314.74 ? 176  PHE A C   1 
ATOM   1099  O O   . PHE A 1 176 ? 139.137 144.630 142.935 1.00 338.66 ? 176  PHE A O   1 
ATOM   1100  C CB  . PHE A 1 176 ? 138.607 146.109 145.631 1.00 290.04 ? 176  PHE A CB  1 
ATOM   1101  C CG  . PHE A 1 176 ? 138.648 147.274 146.566 1.00 293.10 ? 176  PHE A CG  1 
ATOM   1102  C CD1 . PHE A 1 176 ? 139.425 147.220 147.711 1.00 313.08 ? 176  PHE A CD1 1 
ATOM   1103  C CD2 . PHE A 1 176 ? 137.948 148.439 146.288 1.00 309.66 ? 176  PHE A CD2 1 
ATOM   1104  C CE1 . PHE A 1 176 ? 139.492 148.299 148.573 1.00 324.84 ? 176  PHE A CE1 1 
ATOM   1105  C CE2 . PHE A 1 176 ? 138.006 149.522 147.148 1.00 325.63 ? 176  PHE A CE2 1 
ATOM   1106  C CZ  . PHE A 1 176 ? 138.778 149.451 148.295 1.00 334.74 ? 176  PHE A CZ  1 
ATOM   1107  N N   . SER A 1 177 ? 140.524 143.664 144.427 1.00 315.69 ? 177  SER A N   1 
ATOM   1108  C CA  . SER A 1 177 ? 140.588 142.381 143.723 1.00 334.45 ? 177  SER A CA  1 
ATOM   1109  C C   . SER A 1 177 ? 139.319 141.546 143.889 1.00 312.48 ? 177  SER A C   1 
ATOM   1110  O O   . SER A 1 177 ? 139.097 140.604 143.128 1.00 348.29 ? 177  SER A O   1 
ATOM   1111  C CB  . SER A 1 177 ? 141.798 141.570 144.193 1.00 363.18 ? 177  SER A CB  1 
ATOM   1112  O OG  . SER A 1 177 ? 141.590 141.038 145.489 1.00 359.58 ? 177  SER A OG  1 
ATOM   1113  N N   . PHE A 1 178 ? 138.504 141.891 144.884 1.00 279.45 ? 178  PHE A N   1 
ATOM   1114  C CA  . PHE A 1 178 ? 137.261 141.180 145.188 1.00 280.15 ? 178  PHE A CA  1 
ATOM   1115  C C   . PHE A 1 178 ? 136.117 142.120 144.907 1.00 275.42 ? 178  PHE A C   1 
ATOM   1116  O O   . PHE A 1 178 ? 136.340 143.325 144.790 1.00 336.69 ? 178  PHE A O   1 
ATOM   1117  C CB  . PHE A 1 178 ? 137.206 140.735 146.649 1.00 288.70 ? 178  PHE A CB  1 
ATOM   1118  C CG  . PHE A 1 178 ? 137.590 141.804 147.623 1.00 283.68 ? 178  PHE A CG  1 
ATOM   1119  C CD1 . PHE A 1 178 ? 136.643 142.679 148.123 1.00 270.55 ? 178  PHE A CD1 1 
ATOM   1120  C CD2 . PHE A 1 178 ? 138.915 141.942 148.030 1.00 309.56 ? 178  PHE A CD2 1 
ATOM   1121  C CE1 . PHE A 1 178 ? 137.006 143.673 149.016 1.00 298.18 ? 178  PHE A CE1 1 
ATOM   1122  C CE2 . PHE A 1 178 ? 139.285 142.934 148.921 1.00 321.56 ? 178  PHE A CE2 1 
ATOM   1123  C CZ  . PHE A 1 178 ? 138.328 143.807 149.409 1.00 321.74 ? 178  PHE A CZ  1 
ATOM   1124  N N   . PRO A 1 179 ? 134.890 141.591 144.794 1.00 268.67 ? 179  PRO A N   1 
ATOM   1125  C CA  . PRO A 1 179 ? 133.794 142.519 144.560 1.00 303.80 ? 179  PRO A CA  1 
ATOM   1126  C C   . PRO A 1 179 ? 133.272 143.098 145.858 1.00 286.09 ? 179  PRO A C   1 
ATOM   1127  O O   . PRO A 1 179 ? 133.486 142.523 146.919 1.00 264.43 ? 179  PRO A O   1 
ATOM   1128  C CB  . PRO A 1 179 ? 132.720 141.646 143.898 1.00 300.94 ? 179  PRO A CB  1 
ATOM   1129  C CG  . PRO A 1 179 ? 133.375 140.350 143.601 1.00 282.01 ? 179  PRO A CG  1 
ATOM   1130  C CD  . PRO A 1 179 ? 134.435 140.205 144.642 1.00 279.30 ? 179  PRO A CD  1 
ATOM   1131  N N   . ILE A 1 180 ? 132.616 144.246 145.765 1.00 278.55 ? 180  ILE A N   1 
ATOM   1132  C CA  . ILE A 1 180 ? 131.822 144.758 146.862 1.00 278.32 ? 180  ILE A CA  1 
ATOM   1133  C C   . ILE A 1 180 ? 130.460 145.058 146.282 1.00 263.77 ? 180  ILE A C   1 
ATOM   1134  O O   . ILE A 1 180 ? 130.334 145.929 145.430 1.00 301.71 ? 180  ILE A O   1 
ATOM   1135  C CB  . ILE A 1 180 ? 132.437 146.014 147.516 1.00 272.57 ? 180  ILE A CB  1 
ATOM   1136  C CG1 . ILE A 1 180 ? 133.813 145.694 148.097 1.00 289.37 ? 180  ILE A CG1 1 
ATOM   1137  C CG2 . ILE A 1 180 ? 131.552 146.530 148.651 1.00 306.03 ? 180  ILE A CG2 1 
ATOM   1138  C CD1 . ILE A 1 180 ? 134.970 146.003 147.190 1.00 314.74 ? 180  ILE A CD1 1 
ATOM   1139  N N   . PHE A 1 181 ? 129.455 144.315 146.732 1.00 248.25 ? 181  PHE A N   1 
ATOM   1140  C CA  . PHE A 1 181 ? 128.066 144.632 146.426 1.00 263.63 ? 181  PHE A CA  1 
ATOM   1141  C C   . PHE A 1 181 ? 127.505 145.452 147.579 1.00 274.00 ? 181  PHE A C   1 
ATOM   1142  O O   . PHE A 1 181 ? 128.010 145.387 148.698 1.00 274.07 ? 181  PHE A O   1 
ATOM   1143  C CB  . PHE A 1 181 ? 127.233 143.358 146.189 1.00 266.97 ? 181  PHE A CB  1 
ATOM   1144  C CG  . PHE A 1 181 ? 127.350 142.795 144.787 1.00 272.39 ? 181  PHE A CG  1 
ATOM   1145  C CD1 . PHE A 1 181 ? 128.589 142.725 144.132 1.00 279.53 ? 181  PHE A CD1 1 
ATOM   1146  C CD2 . PHE A 1 181 ? 126.218 142.345 144.109 1.00 287.69 ? 181  PHE A CD2 1 
ATOM   1147  C CE1 . PHE A 1 181 ? 128.688 142.207 142.839 1.00 303.12 ? 181  PHE A CE1 1 
ATOM   1148  C CE2 . PHE A 1 181 ? 126.316 141.891 142.814 1.00 318.75 ? 181  PHE A CE2 1 
ATOM   1149  C CZ  . PHE A 1 181 ? 127.551 141.816 142.177 1.00 302.42 ? 181  PHE A CZ  1 
ATOM   1150  N N   . LEU A 1 182 ? 126.460 146.215 147.318 1.00 307.47 ? 182  LEU A N   1 
ATOM   1151  C CA  . LEU A 1 182 ? 125.806 146.945 148.385 1.00 298.35 ? 182  LEU A CA  1 
ATOM   1152  C C   . LEU A 1 182 ? 124.404 146.435 148.461 1.00 280.05 ? 182  LEU A C   1 
ATOM   1153  O O   . LEU A 1 182 ? 123.711 146.432 147.467 1.00 284.10 ? 182  LEU A O   1 
ATOM   1154  C CB  . LEU A 1 182 ? 125.769 148.434 148.079 1.00 299.69 ? 182  LEU A CB  1 
ATOM   1155  C CG  . LEU A 1 182 ? 124.780 149.226 148.923 1.00 304.67 ? 182  LEU A CG  1 
ATOM   1156  C CD1 . LEU A 1 182 ? 125.512 149.924 150.048 1.00 318.31 ? 182  LEU A CD1 1 
ATOM   1157  C CD2 . LEU A 1 182 ? 124.002 150.216 148.091 1.00 319.84 ? 182  LEU A CD2 1 
ATOM   1158  N N   . LEU A 1 183 ? 123.966 146.027 149.640 1.00 282.08 ? 183  LEU A N   1 
ATOM   1159  C CA  . LEU A 1 183 ? 122.621 145.521 149.768 1.00 303.62 ? 183  LEU A CA  1 
ATOM   1160  C C   . LEU A 1 183 ? 121.675 146.666 150.089 1.00 308.19 ? 183  LEU A C   1 
ATOM   1161  O O   . LEU A 1 183 ? 121.550 147.085 151.232 1.00 294.76 ? 183  LEU A O   1 
ATOM   1162  C CB  . LEU A 1 183 ? 122.582 144.467 150.859 1.00 314.12 ? 183  LEU A CB  1 
ATOM   1163  C CG  . LEU A 1 183 ? 123.424 143.244 150.525 1.00 310.36 ? 183  LEU A CG  1 
ATOM   1164  C CD1 . LEU A 1 183 ? 123.132 142.122 151.491 1.00 324.43 ? 183  LEU A CD1 1 
ATOM   1165  C CD2 . LEU A 1 183 ? 123.151 142.793 149.109 1.00 304.03 ? 183  LEU A CD2 1 
ATOM   1166  N N   . GLU A 1 184 ? 121.013 147.159 149.051 1.00 333.45 ? 184  GLU A N   1 
ATOM   1167  C CA  . GLU A 1 184 ? 120.140 148.320 149.133 1.00 340.34 ? 184  GLU A CA  1 
ATOM   1168  C C   . GLU A 1 184 ? 118.919 148.105 150.004 1.00 349.13 ? 184  GLU A C   1 
ATOM   1169  O O   . GLU A 1 184 ? 118.498 149.000 150.728 1.00 367.80 ? 184  GLU A O   1 
ATOM   1170  C CB  . GLU A 1 184 ? 119.723 148.773 147.736 1.00 354.10 ? 184  GLU A CB  1 
ATOM   1171  C CG  . GLU A 1 184 ? 120.586 149.897 147.192 1.00 370.71 ? 184  GLU A CG  1 
ATOM   1172  C CD  . GLU A 1 184 ? 120.405 150.127 145.704 1.00 382.52 ? 184  GLU A CD  1 
ATOM   1173  O OE1 . GLU A 1 184 ? 120.410 149.145 144.940 1.00 363.63 ? 184  GLU A OE1 1 
ATOM   1174  O OE2 . GLU A 1 184 ? 120.266 151.296 145.291 1.00 393.33 ? 184  GLU A OE2 1 
ATOM   1175  N N   . ASP A 1 185 ? 118.348 146.912 149.924 1.00 358.50 ? 185  ASP A N   1 
ATOM   1176  C CA  . ASP A 1 185 ? 117.116 146.611 150.633 1.00 365.08 ? 185  ASP A CA  1 
ATOM   1177  C C   . ASP A 1 185 ? 117.391 145.903 151.930 1.00 339.02 ? 185  ASP A C   1 
ATOM   1178  O O   . ASP A 1 185 ? 118.263 145.062 152.005 1.00 276.43 ? 185  ASP A O   1 
ATOM   1179  C CB  . ASP A 1 185 ? 116.192 145.749 149.780 1.00 381.08 ? 185  ASP A CB  1 
ATOM   1180  C CG  . ASP A 1 185 ? 114.851 145.511 150.440 1.00 378.54 ? 185  ASP A CG  1 
ATOM   1181  O OD1 . ASP A 1 185 ? 114.826 145.112 151.624 1.00 396.18 ? 185  ASP A OD1 1 
ATOM   1182  O OD2 . ASP A 1 185 ? 113.816 145.724 149.777 1.00 369.33 ? 185  ASP A OD2 1 
ATOM   1183  N N   . GLU A 1 186 ? 116.638 146.268 152.957 1.00 354.84 ? 186  GLU A N   1 
ATOM   1184  C CA  . GLU A 1 186 ? 116.739 145.634 154.258 1.00 362.34 ? 186  GLU A CA  1 
ATOM   1185  C C   . GLU A 1 186 ? 116.357 144.168 154.229 1.00 352.55 ? 186  GLU A C   1 
ATOM   1186  O O   . GLU A 1 186 ? 116.936 143.366 154.943 1.00 366.00 ? 186  GLU A O   1 
ATOM   1187  C CB  . GLU A 1 186 ? 115.887 146.349 155.291 1.00 394.35 ? 186  GLU A CB  1 
ATOM   1188  C CG  . GLU A 1 186 ? 115.887 145.648 156.636 1.00 418.96 ? 186  GLU A CG  1 
ATOM   1189  C CD  . GLU A 1 186 ? 117.282 145.465 157.201 1.00 443.63 ? 186  GLU A CD  1 
ATOM   1190  O OE1 . GLU A 1 186 ? 118.170 145.002 156.463 1.00 455.66 ? 186  GLU A OE1 1 
ATOM   1191  O OE2 . GLU A 1 186 ? 117.494 145.784 158.388 1.00 443.62 ? 186  GLU A OE2 1 
ATOM   1192  N N   . ASN A 1 187 ? 115.359 143.816 153.435 1.00 341.71 ? 187  ASN A N   1 
ATOM   1193  C CA  . ASN A 1 187 ? 114.878 142.448 153.450 1.00 352.57 ? 187  ASN A CA  1 
ATOM   1194  C C   . ASN A 1 187 ? 115.948 141.436 153.051 1.00 323.64 ? 187  ASN A C   1 
ATOM   1195  O O   . ASN A 1 187 ? 116.079 140.404 153.686 1.00 342.11 ? 187  ASN A O   1 
ATOM   1196  C CB  . ASN A 1 187 ? 113.661 142.309 152.545 1.00 374.35 ? 187  ASN A CB  1 
ATOM   1197  C CG  . ASN A 1 187 ? 112.376 142.692 153.244 1.00 400.71 ? 187  ASN A CG  1 
ATOM   1198  O OD1 . ASN A 1 187 ? 112.363 142.916 154.452 1.00 405.45 ? 187  ASN A OD1 1 
ATOM   1199  N ND2 . ASN A 1 187 ? 111.287 142.771 152.490 1.00 422.41 ? 187  ASN A ND2 1 
ATOM   1200  N N   . GLU A 1 188 ? 116.728 141.736 152.023 1.00 314.84 ? 188  GLU A N   1 
ATOM   1201  C CA  . GLU A 1 188 ? 117.751 140.808 151.559 1.00 322.23 ? 188  GLU A CA  1 
ATOM   1202  C C   . GLU A 1 188 ? 118.824 140.560 152.592 1.00 290.39 ? 188  GLU A C   1 
ATOM   1203  O O   . GLU A 1 188 ? 119.260 139.445 152.793 1.00 320.68 ? 188  GLU A O   1 
ATOM   1204  C CB  . GLU A 1 188 ? 118.407 141.334 150.294 1.00 360.65 ? 188  GLU A CB  1 
ATOM   1205  C CG  . GLU A 1 188 ? 117.496 141.322 149.087 1.00 381.43 ? 188  GLU A CG  1 
ATOM   1206  C CD  . GLU A 1 188 ? 117.484 142.654 148.380 1.00 385.25 ? 188  GLU A CD  1 
ATOM   1207  O OE1 . GLU A 1 188 ? 118.574 143.127 148.002 1.00 374.40 ? 188  GLU A OE1 1 
ATOM   1208  O OE2 . GLU A 1 188 ? 116.389 143.227 148.217 1.00 392.47 ? 188  GLU A OE2 1 
ATOM   1209  N N   . THR A 1 189 ? 119.247 141.620 153.241 1.00 277.82 ? 189  THR A N   1 
ATOM   1210  C CA  . THR A 1 189 ? 120.267 141.559 154.299 1.00 305.59 ? 189  THR A CA  1 
ATOM   1211  C C   . THR A 1 189 ? 119.811 140.636 155.415 1.00 314.99 ? 189  THR A C   1 
ATOM   1212  O O   . THR A 1 189 ? 120.580 139.788 155.892 1.00 336.20 ? 189  THR A O   1 
ATOM   1213  C CB  . THR A 1 189 ? 120.646 142.925 154.916 1.00 316.51 ? 189  THR A CB  1 
ATOM   1214  O OG1 . THR A 1 189 ? 119.531 143.476 155.626 1.00 334.28 ? 189  THR A OG1 1 
ATOM   1215  C CG2 . THR A 1 189 ? 121.142 143.914 153.852 1.00 345.41 ? 189  THR A CG2 1 
ATOM   1216  N N   . LYS A 1 190 ? 118.559 140.824 155.806 1.00 330.42 ? 190  LYS A N   1 
ATOM   1217  C CA  . LYS A 1 190 ? 117.925 140.035 156.871 1.00 344.03 ? 190  LYS A CA  1 
ATOM   1218  C C   . LYS A 1 190 ? 117.965 138.556 156.518 1.00 326.21 ? 190  LYS A C   1 
ATOM   1219  O O   . LYS A 1 190 ? 118.323 137.713 157.350 1.00 310.89 ? 190  LYS A O   1 
ATOM   1220  C CB  . LYS A 1 190 ? 116.475 140.495 157.097 1.00 362.20 ? 190  LYS A CB  1 
ATOM   1221  C CG  . LYS A 1 190 ? 115.851 140.032 158.408 1.00 392.71 ? 190  LYS A CG  1 
ATOM   1222  C CD  . LYS A 1 190 ? 114.977 138.797 158.247 1.00 391.52 ? 190  LYS A CD  1 
ATOM   1223  C CE  . LYS A 1 190 ? 114.332 138.415 159.572 1.00 394.30 ? 190  LYS A CE  1 
ATOM   1224  N NZ  . LYS A 1 190 ? 113.231 137.424 159.414 1.00 415.32 ? 190  LYS A NZ  1 
ATOM   1225  N N   . VAL A 1 191 ? 117.589 138.280 155.276 1.00 330.29 ? 191  VAL A N   1 
ATOM   1226  C CA  . VAL A 1 191 ? 117.551 136.915 154.736 1.00 326.17 ? 191  VAL A CA  1 
ATOM   1227  C C   . VAL A 1 191 ? 118.937 136.276 154.840 1.00 303.98 ? 191  VAL A C   1 
ATOM   1228  O O   . VAL A 1 191 ? 119.078 135.123 155.292 1.00 335.09 ? 191  VAL A O   1 
ATOM   1229  C CB  . VAL A 1 191 ? 117.036 136.892 153.267 1.00 324.52 ? 191  VAL A CB  1 
ATOM   1230  C CG1 . VAL A 1 191 ? 117.359 135.581 152.557 1.00 327.16 ? 191  VAL A CG1 1 
ATOM   1231  C CG2 . VAL A 1 191 ? 115.536 137.152 153.233 1.00 351.29 ? 191  VAL A CG2 1 
ATOM   1232  N N   . ILE A 1 192 ? 119.926 137.056 154.417 1.00 291.83 ? 192  ILE A N   1 
ATOM   1233  C CA  . ILE A 1 192 ? 121.325 136.623 154.422 1.00 281.24 ? 192  ILE A CA  1 
ATOM   1234  C C   . ILE A 1 192 ? 121.752 136.256 155.848 1.00 294.02 ? 192  ILE A C   1 
ATOM   1235  O O   . ILE A 1 192 ? 122.378 135.208 156.076 1.00 295.96 ? 192  ILE A O   1 
ATOM   1236  C CB  . ILE A 1 192 ? 122.294 137.629 153.743 1.00 298.93 ? 192  ILE A CB  1 
ATOM   1237  C CG1 . ILE A 1 192 ? 121.971 137.773 152.252 1.00 295.25 ? 192  ILE A CG1 1 
ATOM   1238  C CG2 . ILE A 1 192 ? 123.741 137.160 153.861 1.00 298.02 ? 192  ILE A CG2 1 
ATOM   1239  C CD1 . ILE A 1 192 ? 122.385 139.103 151.668 1.00 311.38 ? 192  ILE A CD1 1 
ATOM   1240  N N   . LYS A 1 193 ? 121.392 137.138 156.771 1.00 302.10 ? 193  LYS A N   1 
ATOM   1241  C CA  . LYS A 1 193 ? 121.705 136.968 158.191 1.00 320.04 ? 193  LYS A CA  1 
ATOM   1242  C C   . LYS A 1 193 ? 121.112 135.669 158.712 1.00 330.50 ? 193  LYS A C   1 
ATOM   1243  O O   . LYS A 1 193 ? 121.782 134.900 159.409 1.00 324.99 ? 193  LYS A O   1 
ATOM   1244  C CB  . LYS A 1 193 ? 121.267 138.181 159.020 1.00 358.13 ? 193  LYS A CB  1 
ATOM   1245  C CG  . LYS A 1 193 ? 122.198 139.374 158.864 1.00 366.13 ? 193  LYS A CG  1 
ATOM   1246  C CD  . LYS A 1 193 ? 121.630 140.626 159.511 1.00 383.59 ? 193  LYS A CD  1 
ATOM   1247  C CE  . LYS A 1 193 ? 122.557 141.816 159.318 1.00 384.71 ? 193  LYS A CE  1 
ATOM   1248  N NZ  . LYS A 1 193 ? 121.900 143.104 159.675 1.00 391.95 ? 193  LYS A NZ  1 
ATOM   1249  N N   . GLN A 1 194 ? 119.855 135.455 158.351 1.00 341.50 ? 194  GLN A N   1 
ATOM   1250  C CA  . GLN A 1 194 ? 119.101 134.255 158.745 1.00 352.70 ? 194  GLN A CA  1 
ATOM   1251  C C   . GLN A 1 194 ? 119.823 133.007 158.260 1.00 338.91 ? 194  GLN A C   1 
ATOM   1252  O O   . GLN A 1 194 ? 119.999 132.038 159.017 1.00 344.78 ? 194  GLN A O   1 
ATOM   1253  C CB  . GLN A 1 194 ? 117.659 134.258 158.212 1.00 363.28 ? 194  GLN A CB  1 
ATOM   1254  C CG  . GLN A 1 194 ? 116.636 134.853 159.166 1.00 389.86 ? 194  GLN A CG  1 
ATOM   1255  C CD  . GLN A 1 194 ? 115.206 134.531 158.765 1.00 425.08 ? 194  GLN A CD  1 
ATOM   1256  O OE1 . GLN A 1 194 ? 114.896 134.385 157.581 1.00 434.12 ? 194  GLN A OE1 1 
ATOM   1257  N NE2 . GLN A 1 194 ? 114.326 134.418 159.754 1.00 444.61 ? 194  GLN A NE2 1 
ATOM   1258  N N   . CYS A 1 195 ? 120.228 133.065 156.996 1.00 341.32 ? 195  CYS A N   1 
ATOM   1259  C CA  . CYS A 1 195 ? 120.941 131.962 156.343 1.00 311.42 ? 195  CYS A CA  1 
ATOM   1260  C C   . CYS A 1 195 ? 122.221 131.637 157.107 1.00 295.25 ? 195  CYS A C   1 
ATOM   1261  O O   . CYS A 1 195 ? 122.523 130.467 157.379 1.00 342.61 ? 195  CYS A O   1 
ATOM   1262  C CB  . CYS A 1 195 ? 121.254 132.242 154.878 1.00 335.02 ? 195  CYS A CB  1 
ATOM   1263  S SG  . CYS A 1 195 ? 121.695 130.725 154.004 1.00 360.24 ? 195  CYS A SG  1 
ATOM   1264  N N   . TYR A 1 196 ? 122.943 132.698 157.438 1.00 270.63 ? 196  TYR A N   1 
ATOM   1265  C CA  . TYR A 1 196 ? 124.205 132.607 158.180 1.00 291.00 ? 196  TYR A CA  1 
ATOM   1266  C C   . TYR A 1 196 ? 123.984 131.903 159.512 1.00 315.32 ? 196  TYR A C   1 
ATOM   1267  O O   . TYR A 1 196 ? 124.735 130.998 159.899 1.00 333.78 ? 196  TYR A O   1 
ATOM   1268  C CB  . TYR A 1 196 ? 124.804 133.994 158.421 1.00 295.89 ? 196  TYR A CB  1 
ATOM   1269  C CG  . TYR A 1 196 ? 125.960 134.039 159.394 1.00 295.70 ? 196  TYR A CG  1 
ATOM   1270  C CD1 . TYR A 1 196 ? 127.257 133.738 158.982 1.00 312.48 ? 196  TYR A CD1 1 
ATOM   1271  C CD2 . TYR A 1 196 ? 125.763 134.416 160.723 1.00 315.89 ? 196  TYR A CD2 1 
ATOM   1272  C CE1 . TYR A 1 196 ? 128.324 133.795 159.869 1.00 331.72 ? 196  TYR A CE1 1 
ATOM   1273  C CE2 . TYR A 1 196 ? 126.824 134.475 161.619 1.00 335.12 ? 196  TYR A CE2 1 
ATOM   1274  C CZ  . TYR A 1 196 ? 128.104 134.165 161.188 1.00 334.12 ? 196  TYR A CZ  1 
ATOM   1275  O OH  . TYR A 1 196 ? 129.159 134.224 162.071 1.00 326.06 ? 196  TYR A OH  1 
ATOM   1276  N N   . GLN A 1 197 ? 122.930 132.340 160.190 1.00 317.32 ? 197  GLN A N   1 
ATOM   1277  C CA  . GLN A 1 197 ? 122.537 131.813 161.500 1.00 338.25 ? 197  GLN A CA  1 
ATOM   1278  C C   . GLN A 1 197 ? 121.949 130.403 161.435 1.00 331.25 ? 197  GLN A C   1 
ATOM   1279  O O   . GLN A 1 197 ? 122.072 129.641 162.390 1.00 344.08 ? 197  GLN A O   1 
ATOM   1280  C CB  . GLN A 1 197 ? 121.533 132.767 162.181 1.00 357.70 ? 197  GLN A CB  1 
ATOM   1281  C CG  . GLN A 1 197 ? 121.792 132.998 163.663 1.00 374.66 ? 197  GLN A CG  1 
ATOM   1282  C CD  . GLN A 1 197 ? 123.010 133.872 163.929 1.00 386.64 ? 197  GLN A CD  1 
ATOM   1283  O OE1 . GLN A 1 197 ? 123.313 134.793 163.167 1.00 375.48 ? 197  GLN A OE1 1 
ATOM   1284  N NE2 . GLN A 1 197 ? 123.712 133.591 165.024 1.00 403.95 ? 197  GLN A NE2 1 
ATOM   1285  N N   . ASP A 1 198 ? 121.295 130.061 160.329 1.00 316.22 ? 198  ASP A N   1 
ATOM   1286  C CA  . ASP A 1 198 ? 120.813 128.695 160.120 1.00 321.86 ? 198  ASP A CA  1 
ATOM   1287  C C   . ASP A 1 198 ? 121.932 127.690 159.835 1.00 313.24 ? 198  ASP A C   1 
ATOM   1288  O O   . ASP A 1 198 ? 121.674 126.483 159.850 1.00 331.01 ? 198  ASP A O   1 
ATOM   1289  C CB  . ASP A 1 198 ? 119.776 128.643 158.982 1.00 361.23 ? 198  ASP A CB  1 
ATOM   1290  C CG  . ASP A 1 198 ? 118.417 129.203 159.392 1.00 395.20 ? 198  ASP A CG  1 
ATOM   1291  O OD1 . ASP A 1 198 ? 118.339 129.985 160.366 1.00 409.68 ? 198  ASP A OD1 1 
ATOM   1292  O OD2 . ASP A 1 198 ? 117.416 128.854 158.728 1.00 409.81 ? 198  ASP A OD2 1 
ATOM   1293  N N   . HIS A 1 199 ? 123.159 128.161 159.579 1.00 311.46 ? 199  HIS A N   1 
ATOM   1294  C CA  . HIS A 1 199 ? 124.247 127.277 159.150 1.00 321.29 ? 199  HIS A CA  1 
ATOM   1295  C C   . HIS A 1 199 ? 125.627 127.530 159.786 1.00 318.90 ? 199  HIS A C   1 
ATOM   1296  O O   . HIS A 1 199 ? 126.123 126.681 160.533 1.00 333.08 ? 199  HIS A O   1 
ATOM   1297  C CB  . HIS A 1 199 ? 124.315 127.296 157.620 1.00 296.29 ? 199  HIS A CB  1 
ATOM   1298  C CG  . HIS A 1 199 ? 123.020 126.906 156.975 1.00 306.43 ? 199  HIS A CG  1 
ATOM   1299  N ND1 . HIS A 1 199 ? 122.429 125.679 157.189 1.00 324.10 ? 199  HIS A ND1 1 
ATOM   1300  C CD2 . HIS A 1 199 ? 122.174 127.594 156.174 1.00 299.80 ? 199  HIS A CD2 1 
ATOM   1301  C CE1 . HIS A 1 199 ? 121.289 125.619 156.525 1.00 322.27 ? 199  HIS A CE1 1 
ATOM   1302  N NE2 . HIS A 1 199 ? 121.110 126.768 155.900 1.00 309.44 ? 199  HIS A NE2 1 
ATOM   1303  N N   . ASN A 1 200 ? 126.222 128.692 159.542 1.00 293.41 ? 200  ASN A N   1 
ATOM   1304  C CA  . ASN A 1 200 ? 127.686 128.839 159.660 1.00 316.74 ? 200  ASN A CA  1 
ATOM   1305  C C   . ASN A 1 200 ? 128.301 129.162 161.039 1.00 324.55 ? 200  ASN A C   1 
ATOM   1306  O O   . ASN A 1 200 ? 129.471 129.554 161.103 1.00 330.35 ? 200  ASN A O   1 
ATOM   1307  C CB  . ASN A 1 200 ? 128.176 129.873 158.641 1.00 325.94 ? 200  ASN A CB  1 
ATOM   1308  C CG  . ASN A 1 200 ? 127.596 129.647 157.264 1.00 319.07 ? 200  ASN A CG  1 
ATOM   1309  O OD1 . ASN A 1 200 ? 127.976 128.726 156.559 1.00 317.48 ? 200  ASN A OD1 1 
ATOM   1310  N ND2 . ASN A 1 200 ? 126.653 130.479 156.889 1.00 325.14 ? 200  ASN A ND2 1 
ATOM   1311  N N   . LEU A 1 201 ? 127.560 128.983 162.132 1.00 334.79 ? 201  LEU A N   1 
ATOM   1312  C CA  . LEU A 1 201 ? 128.121 129.245 163.464 1.00 353.57 ? 201  LEU A CA  1 
ATOM   1313  C C   . LEU A 1 201 ? 129.007 128.090 163.915 1.00 357.73 ? 201  LEU A C   1 
ATOM   1314  O O   . LEU A 1 201 ? 128.633 126.925 163.765 1.00 372.93 ? 201  LEU A O   1 
ATOM   1315  C CB  . LEU A 1 201 ? 127.028 129.462 164.515 1.00 379.05 ? 201  LEU A CB  1 
ATOM   1316  C CG  . LEU A 1 201 ? 125.954 130.549 164.335 1.00 384.08 ? 201  LEU A CG  1 
ATOM   1317  C CD1 . LEU A 1 201 ? 126.443 131.723 163.492 1.00 368.14 ? 201  LEU A CD1 1 
ATOM   1318  C CD2 . LEU A 1 201 ? 124.663 129.982 163.762 1.00 375.59 ? 201  LEU A CD2 1 
ATOM   1319  N N   . SER A 1 202 ? 130.173 128.419 164.468 1.00 384.40 ? 202  SER A N   1 
ATOM   1320  C CA  . SER A 1 202 ? 131.044 127.427 165.099 1.00 401.91 ? 202  SER A CA  1 
ATOM   1321  C C   . SER A 1 202 ? 130.454 127.064 166.462 1.00 402.02 ? 202  SER A C   1 
ATOM   1322  O O   . SER A 1 202 ? 130.646 127.788 167.443 1.00 398.28 ? 202  SER A O   1 
ATOM   1323  C CB  . SER A 1 202 ? 132.471 127.967 165.252 1.00 406.60 ? 202  SER A CB  1 
ATOM   1324  O OG  . SER A 1 202 ? 132.489 129.177 165.993 1.00 415.94 ? 202  SER A OG  1 
ATOM   1325  N N   . GLN A 1 203 ? 129.729 125.946 166.508 1.00 397.93 ? 203  GLN A N   1 
ATOM   1326  C CA  . GLN A 1 203 ? 129.007 125.532 167.711 1.00 398.17 ? 203  GLN A CA  1 
ATOM   1327  C C   . GLN A 1 203 ? 129.962 124.957 168.756 1.00 401.83 ? 203  GLN A C   1 
ATOM   1328  O O   . GLN A 1 203 ? 130.825 124.136 168.431 1.00 380.69 ? 203  GLN A O   1 
ATOM   1329  C CB  . GLN A 1 203 ? 127.923 124.501 167.370 1.00 415.69 ? 203  GLN A CB  1 
ATOM   1330  C CG  . GLN A 1 203 ? 126.849 124.986 166.403 1.00 412.69 ? 203  GLN A CG  1 
ATOM   1331  C CD  . GLN A 1 203 ? 125.918 126.022 167.011 1.00 419.77 ? 203  GLN A CD  1 
ATOM   1332  O OE1 . GLN A 1 203 ? 126.301 127.174 167.221 1.00 413.64 ? 203  GLN A OE1 1 
ATOM   1333  N NE2 . GLN A 1 203 ? 124.681 125.620 167.282 1.00 430.07 ? 203  GLN A NE2 1 
ATOM   1334  N N   . ASN A 1 204 ? 129.796 125.411 170.002 1.00 411.21 ? 204  ASN A N   1 
ATOM   1335  C CA  . ASN A 1 204 ? 130.643 125.024 171.143 1.00 417.94 ? 204  ASN A CA  1 
ATOM   1336  C C   . ASN A 1 204 ? 132.133 125.389 170.997 1.00 413.65 ? 204  ASN A C   1 
ATOM   1337  O O   . ASN A 1 204 ? 132.988 124.786 171.653 1.00 416.49 ? 204  ASN A O   1 
ATOM   1338  C CB  . ASN A 1 204 ? 130.483 123.525 171.459 1.00 432.76 ? 204  ASN A CB  1 
ATOM   1339  C CG  . ASN A 1 204 ? 129.029 123.090 171.553 1.00 448.77 ? 204  ASN A CG  1 
ATOM   1340  O OD1 . ASN A 1 204 ? 128.115 123.917 171.585 1.00 446.73 ? 204  ASN A OD1 1 
ATOM   1341  N ND2 . ASN A 1 204 ? 128.810 121.780 171.599 1.00 458.84 ? 204  ASN A ND2 1 
ATOM   1342  N N   . GLY A 1 205 ? 132.431 126.392 170.166 1.00 416.37 ? 205  GLY A N   1 
ATOM   1343  C CA  . GLY A 1 205 ? 133.805 126.823 169.904 1.00 407.68 ? 205  GLY A CA  1 
ATOM   1344  C C   . GLY A 1 205 ? 134.680 125.753 169.277 1.00 394.81 ? 205  GLY A C   1 
ATOM   1345  O O   . GLY A 1 205 ? 135.658 125.316 169.889 1.00 411.18 ? 205  GLY A O   1 
ATOM   1346  N N   . SER A 1 206 ? 134.324 125.328 168.064 1.00 396.44 ? 206  SER A N   1 
ATOM   1347  C CA  . SER A 1 206 ? 135.087 124.307 167.336 1.00 416.58 ? 206  SER A CA  1 
ATOM   1348  C C   . SER A 1 206 ? 135.076 124.540 165.821 1.00 399.08 ? 206  SER A C   1 
ATOM   1349  O O   . SER A 1 206 ? 136.069 125.022 165.270 1.00 420.64 ? 206  SER A O   1 
ATOM   1350  C CB  . SER A 1 206 ? 134.578 122.901 167.684 1.00 436.43 ? 206  SER A CB  1 
ATOM   1351  O OG  . SER A 1 206 ? 134.990 122.521 168.986 1.00 434.50 ? 206  SER A OG  1 
ATOM   1352  N N   . ALA A 1 207 ? 133.967 124.211 165.155 1.00 372.89 ? 207  ALA A N   1 
ATOM   1353  C CA  . ALA A 1 207 ? 133.885 124.309 163.691 1.00 362.92 ? 207  ALA A CA  1 
ATOM   1354  C C   . ALA A 1 207 ? 132.440 124.266 163.180 1.00 339.17 ? 207  ALA A C   1 
ATOM   1355  O O   . ALA A 1 207 ? 131.570 123.697 163.845 1.00 333.15 ? 207  ALA A O   1 
ATOM   1356  C CB  . ALA A 1 207 ? 134.702 123.198 163.044 1.00 375.06 ? 207  ALA A CB  1 
ATOM   1357  N N   . PRO A 1 208 ? 132.184 124.851 161.989 1.00 324.89 ? 208  PRO A N   1 
ATOM   1358  C CA  . PRO A 1 208 ? 130.828 124.935 161.451 1.00 327.56 ? 208  PRO A CA  1 
ATOM   1359  C C   . PRO A 1 208 ? 130.432 123.732 160.583 1.00 317.97 ? 208  PRO A C   1 
ATOM   1360  O O   . PRO A 1 208 ? 131.191 123.328 159.698 1.00 294.06 ? 208  PRO A O   1 
ATOM   1361  C CB  . PRO A 1 208 ? 130.885 126.206 160.610 1.00 320.95 ? 208  PRO A CB  1 
ATOM   1362  C CG  . PRO A 1 208 ? 132.279 126.227 160.087 1.00 326.59 ? 208  PRO A CG  1 
ATOM   1363  C CD  . PRO A 1 208 ? 133.149 125.505 161.084 1.00 316.38 ? 208  PRO A CD  1 
ATOM   1364  N N   . THR A 1 209 ? 129.249 123.177 160.855 1.00 330.10 ? 209  THR A N   1 
ATOM   1365  C CA  . THR A 1 209 ? 128.694 122.052 160.092 1.00 329.97 ? 209  THR A CA  1 
ATOM   1366  C C   . THR A 1 209 ? 128.649 122.388 158.606 1.00 306.72 ? 209  THR A C   1 
ATOM   1367  O O   . THR A 1 209 ? 128.207 123.473 158.225 1.00 340.34 ? 209  THR A O   1 
ATOM   1368  C CB  . THR A 1 209 ? 127.286 121.647 160.599 1.00 358.92 ? 209  THR A CB  1 
ATOM   1369  O OG1 . THR A 1 209 ? 126.843 120.470 159.910 1.00 385.38 ? 209  THR A OG1 1 
ATOM   1370  C CG2 . THR A 1 209 ? 126.250 122.772 160.409 1.00 362.10 ? 209  THR A CG2 1 
ATOM   1371  N N   . PHE A 1 210 ? 129.100 121.454 157.771 1.00 303.60 ? 210  PHE A N   1 
ATOM   1372  C CA  . PHE A 1 210 ? 129.482 121.785 156.396 1.00 316.16 ? 210  PHE A CA  1 
ATOM   1373  C C   . PHE A 1 210 ? 128.413 121.541 155.318 1.00 307.81 ? 210  PHE A C   1 
ATOM   1374  O O   . PHE A 1 210 ? 128.707 120.971 154.260 1.00 330.86 ? 210  PHE A O   1 
ATOM   1375  C CB  . PHE A 1 210 ? 130.808 121.090 156.038 1.00 331.18 ? 210  PHE A CB  1 
ATOM   1376  C CG  . PHE A 1 210 ? 131.738 121.925 155.180 1.00 318.61 ? 210  PHE A CG  1 
ATOM   1377  C CD1 . PHE A 1 210 ? 131.267 122.709 154.117 1.00 292.08 ? 210  PHE A CD1 1 
ATOM   1378  C CD2 . PHE A 1 210 ? 133.108 121.905 155.427 1.00 346.31 ? 210  PHE A CD2 1 
ATOM   1379  C CE1 . PHE A 1 210 ? 132.138 123.462 153.346 1.00 336.94 ? 210  PHE A CE1 1 
ATOM   1380  C CE2 . PHE A 1 210 ? 133.983 122.653 154.651 1.00 383.07 ? 210  PHE A CE2 1 
ATOM   1381  C CZ  . PHE A 1 210 ? 133.498 123.432 153.610 1.00 371.89 ? 210  PHE A CZ  1 
ATOM   1382  N N   . PRO A 1 211 ? 127.160 121.925 155.597 1.00 300.32 ? 211  PRO A N   1 
ATOM   1383  C CA  . PRO A 1 211 ? 126.352 122.498 154.519 1.00 320.52 ? 211  PRO A CA  1 
ATOM   1384  C C   . PRO A 1 211 ? 126.260 124.014 154.763 1.00 331.18 ? 211  PRO A C   1 
ATOM   1385  O O   . PRO A 1 211 ? 125.235 124.533 155.212 1.00 343.79 ? 211  PRO A O   1 
ATOM   1386  C CB  . PRO A 1 211 ? 125.010 121.744 154.619 1.00 299.86 ? 211  PRO A CB  1 
ATOM   1387  C CG  . PRO A 1 211 ? 125.107 120.885 155.846 1.00 315.41 ? 211  PRO A CG  1 
ATOM   1388  C CD  . PRO A 1 211 ? 126.307 121.327 156.632 1.00 287.14 ? 211  PRO A CD  1 
ATOM   1389  N N   . LEU A 1 212 ? 127.373 124.694 154.480 1.00 319.03 ? 212  LEU A N   1 
ATOM   1390  C CA  . LEU A 1 212 ? 127.538 126.130 154.737 1.00 293.23 ? 212  LEU A CA  1 
ATOM   1391  C C   . LEU A 1 212 ? 126.774 126.991 153.736 1.00 295.26 ? 212  LEU A C   1 
ATOM   1392  O O   . LEU A 1 212 ? 126.752 126.682 152.553 1.00 278.81 ? 212  LEU A O   1 
ATOM   1393  C CB  . LEU A 1 212 ? 129.014 126.520 154.643 1.00 286.31 ? 212  LEU A CB  1 
ATOM   1394  C CG  . LEU A 1 212 ? 130.004 125.883 155.617 1.00 307.47 ? 212  LEU A CG  1 
ATOM   1395  C CD1 . LEU A 1 212 ? 131.443 126.208 155.220 1.00 309.39 ? 212  LEU A CD1 1 
ATOM   1396  C CD2 . LEU A 1 212 ? 129.745 126.307 157.053 1.00 315.98 ? 212  LEU A CD2 1 
ATOM   1397  N N   . CYS A 1 213 ? 126.165 128.071 154.225 1.00 296.36 ? 213  CYS A N   1 
ATOM   1398  C CA  . CYS A 1 213 ? 125.547 129.093 153.375 1.00 273.34 ? 213  CYS A CA  1 
ATOM   1399  C C   . CYS A 1 213 ? 126.651 129.938 152.766 1.00 263.58 ? 213  CYS A C   1 
ATOM   1400  O O   . CYS A 1 213 ? 127.696 130.119 153.378 1.00 267.60 ? 213  CYS A O   1 
ATOM   1401  C CB  . CYS A 1 213 ? 124.628 129.984 154.202 1.00 304.95 ? 213  CYS A CB  1 
ATOM   1402  S SG  . CYS A 1 213 ? 123.555 131.058 153.243 1.00 350.63 ? 213  CYS A SG  1 
ATOM   1403  N N   . ALA A 1 214 ? 126.415 130.458 151.566 1.00 274.66 ? 214  ALA A N   1 
ATOM   1404  C CA  . ALA A 1 214 ? 127.484 131.038 150.748 1.00 282.42 ? 214  ALA A CA  1 
ATOM   1405  C C   . ALA A 1 214 ? 126.944 131.872 149.597 1.00 301.99 ? 214  ALA A C   1 
ATOM   1406  O O   . ALA A 1 214 ? 126.030 131.456 148.877 1.00 290.92 ? 214  ALA A O   1 
ATOM   1407  C CB  . ALA A 1 214 ? 128.384 129.945 150.195 1.00 295.47 ? 214  ALA A CB  1 
ATOM   1408  N N   . MET A 1 215 ? 127.558 133.022 149.391 1.00 302.66 ? 215  MET A N   1 
ATOM   1409  C CA  . MET A 1 215 ? 127.080 134.013 148.461 1.00 273.57 ? 215  MET A CA  1 
ATOM   1410  C C   . MET A 1 215 ? 128.045 134.142 147.329 1.00 248.08 ? 215  MET A C   1 
ATOM   1411  O O   . MET A 1 215 ? 129.232 134.217 147.553 1.00 278.84 ? 215  MET A O   1 
ATOM   1412  C CB  . MET A 1 215 ? 127.030 135.339 149.173 1.00 283.09 ? 215  MET A CB  1 
ATOM   1413  C CG  . MET A 1 215 ? 126.416 136.448 148.364 1.00 307.28 ? 215  MET A CG  1 
ATOM   1414  S SD  . MET A 1 215 ? 125.973 137.716 149.534 1.00 326.00 ? 215  MET A SD  1 
ATOM   1415  C CE  . MET A 1 215 ? 127.529 137.898 150.390 1.00 334.11 ? 215  MET A CE  1 
ATOM   1416  N N   . GLN A 1 216 ? 127.553 134.160 146.107 1.00 272.78 ? 216  GLN A N   1 
ATOM   1417  C CA  . GLN A 1 216 ? 128.436 134.277 144.969 1.00 273.30 ? 216  GLN A CA  1 
ATOM   1418  C C   . GLN A 1 216 ? 128.031 135.529 144.246 1.00 267.38 ? 216  GLN A C   1 
ATOM   1419  O O   . GLN A 1 216 ? 126.868 135.726 144.017 1.00 302.96 ? 216  GLN A O   1 
ATOM   1420  C CB  . GLN A 1 216 ? 128.267 133.054 144.081 1.00 297.34 ? 216  GLN A CB  1 
ATOM   1421  C CG  . GLN A 1 216 ? 128.609 133.253 142.624 1.00 295.31 ? 216  GLN A CG  1 
ATOM   1422  C CD  . GLN A 1 216 ? 128.129 132.110 141.770 1.00 306.81 ? 216  GLN A CD  1 
ATOM   1423  O OE1 . GLN A 1 216 ? 126.949 132.003 141.462 1.00 274.41 ? 216  GLN A OE1 1 
ATOM   1424  N NE2 . GLN A 1 216 ? 129.042 131.247 141.386 1.00 328.53 ? 216  GLN A NE2 1 
ATOM   1425  N N   . LEU A 1 217 ? 128.972 136.395 143.909 1.00 274.79 ? 217  LEU A N   1 
ATOM   1426  C CA  . LEU A 1 217 ? 128.619 137.633 143.240 1.00 283.70 ? 217  LEU A CA  1 
ATOM   1427  C C   . LEU A 1 217 ? 129.253 137.736 141.878 1.00 264.26 ? 217  LEU A C   1 
ATOM   1428  O O   . LEU A 1 217 ? 130.447 137.553 141.748 1.00 258.43 ? 217  LEU A O   1 
ATOM   1429  C CB  . LEU A 1 217 ? 129.061 138.819 144.079 1.00 299.65 ? 217  LEU A CB  1 
ATOM   1430  C CG  . LEU A 1 217 ? 128.995 138.676 145.592 1.00 319.33 ? 217  LEU A CG  1 
ATOM   1431  C CD1 . LEU A 1 217 ? 130.392 138.505 146.146 1.00 314.93 ? 217  LEU A CD1 1 
ATOM   1432  C CD2 . LEU A 1 217 ? 128.355 139.907 146.192 1.00 328.82 ? 217  LEU A CD2 1 
ATOM   1433  N N   . PHE A 1 218 ? 128.482 137.959 140.828 1.00 265.11 ? 218  PHE A N   1 
ATOM   1434  C CA  . PHE A 1 218 ? 129.122 138.000 139.529 1.00 299.95 ? 218  PHE A CA  1 
ATOM   1435  C C   . PHE A 1 218 ? 129.380 139.420 139.131 1.00 285.74 ? 218  PHE A C   1 
ATOM   1436  O O   . PHE A 1 218 ? 128.491 140.122 138.673 1.00 292.46 ? 218  PHE A O   1 
ATOM   1437  C CB  . PHE A 1 218 ? 128.260 137.340 138.469 1.00 332.66 ? 218  PHE A CB  1 
ATOM   1438  C CG  . PHE A 1 218 ? 128.089 135.876 138.667 1.00 307.59 ? 218  PHE A CG  1 
ATOM   1439  C CD1 . PHE A 1 218 ? 129.175 135.074 138.905 1.00 312.93 ? 218  PHE A CD1 1 
ATOM   1440  C CD2 . PHE A 1 218 ? 126.840 135.309 138.617 1.00 330.76 ? 218  PHE A CD2 1 
ATOM   1441  C CE1 . PHE A 1 218 ? 129.024 133.726 139.093 1.00 325.87 ? 218  PHE A CE1 1 
ATOM   1442  C CE2 . PHE A 1 218 ? 126.675 133.962 138.802 1.00 347.29 ? 218  PHE A CE2 1 
ATOM   1443  C CZ  . PHE A 1 218 ? 127.771 133.167 139.042 1.00 344.56 ? 218  PHE A CZ  1 
ATOM   1444  N N   . SER A 1 219 ? 130.622 139.829 139.272 1.00 283.11 ? 219  SER A N   1 
ATOM   1445  C CA  . SER A 1 219 ? 131.002 141.160 138.893 1.00 279.26 ? 219  SER A CA  1 
ATOM   1446  C C   . SER A 1 219 ? 132.253 141.017 138.076 1.00 262.86 ? 219  SER A C   1 
ATOM   1447  O O   . SER A 1 219 ? 133.335 141.358 138.527 1.00 272.32 ? 219  SER A O   1 
ATOM   1448  C CB  . SER A 1 219 ? 131.260 141.991 140.140 1.00 290.17 ? 219  SER A CB  1 
ATOM   1449  O OG  . SER A 1 219 ? 131.779 143.250 139.801 1.00 284.39 ? 219  SER A OG  1 
ATOM   1450  N N   . HIS A 1 220 ? 132.115 140.494 136.869 1.00 281.60 ? 220  HIS A N   1 
ATOM   1451  C CA  . HIS A 1 220 ? 133.279 140.299 136.039 1.00 283.26 ? 220  HIS A CA  1 
ATOM   1452  C C   . HIS A 1 220 ? 133.385 141.480 135.134 1.00 272.88 ? 220  HIS A C   1 
ATOM   1453  O O   . HIS A 1 220 ? 132.435 141.819 134.446 1.00 280.90 ? 220  HIS A O   1 
ATOM   1454  C CB  . HIS A 1 220 ? 133.164 139.049 135.194 1.00 313.89 ? 220  HIS A CB  1 
ATOM   1455  C CG  . HIS A 1 220 ? 134.393 138.765 134.397 1.00 280.61 ? 220  HIS A CG  1 
ATOM   1456  N ND1 . HIS A 1 220 ? 134.373 138.578 133.034 1.00 270.09 ? 220  HIS A ND1 1 
ATOM   1457  C CD2 . HIS A 1 220 ? 135.688 138.661 134.773 1.00 281.94 ? 220  HIS A CD2 1 
ATOM   1458  C CE1 . HIS A 1 220 ? 135.602 138.364 132.607 1.00 299.76 ? 220  HIS A CE1 1 
ATOM   1459  N NE2 . HIS A 1 220 ? 136.418 138.409 133.643 1.00 283.52 ? 220  HIS A NE2 1 
ATOM   1460  N N   . MET A 1 221 ? 134.548 142.109 135.125 1.00 297.67 ? 221  MET A N   1 
ATOM   1461  C CA  . MET A 1 221 ? 134.717 143.314 134.356 1.00 301.36 ? 221  MET A CA  1 
ATOM   1462  C C   . MET A 1 221 ? 135.612 143.092 133.167 1.00 285.46 ? 221  MET A C   1 
ATOM   1463  O O   . MET A 1 221 ? 136.758 142.737 133.320 1.00 312.69 ? 221  MET A O   1 
ATOM   1464  C CB  . MET A 1 221 ? 135.349 144.377 135.238 1.00 316.25 ? 221  MET A CB  1 
ATOM   1465  C CG  . MET A 1 221 ? 134.495 144.786 136.417 1.00 321.94 ? 221  MET A CG  1 
ATOM   1466  S SD  . MET A 1 221 ? 132.966 145.534 135.861 1.00 304.74 ? 221  MET A SD  1 
ATOM   1467  C CE  . MET A 1 221 ? 132.076 145.625 137.403 1.00 302.78 ? 221  MET A CE  1 
ATOM   1468  N N   . HIS A 1 222 ? 135.083 143.316 131.978 1.00 263.24 ? 222  HIS A N   1 
ATOM   1469  C CA  . HIS A 1 222 ? 135.912 143.394 130.803 1.00 264.08 ? 222  HIS A CA  1 
ATOM   1470  C C   . HIS A 1 222 ? 136.756 144.642 130.931 1.00 293.62 ? 222  HIS A C   1 
ATOM   1471  O O   . HIS A 1 222 ? 136.353 145.607 131.563 1.00 321.45 ? 222  HIS A O   1 
ATOM   1472  C CB  . HIS A 1 222 ? 135.064 143.500 129.551 1.00 291.97 ? 222  HIS A CB  1 
ATOM   1473  C CG  . HIS A 1 222 ? 133.891 142.585 129.545 1.00 277.90 ? 222  HIS A CG  1 
ATOM   1474  N ND1 . HIS A 1 222 ? 132.962 142.575 128.530 1.00 289.60 ? 222  HIS A ND1 1 
ATOM   1475  C CD2 . HIS A 1 222 ? 133.494 141.645 130.431 1.00 271.18 ? 222  HIS A CD2 1 
ATOM   1476  C CE1 . HIS A 1 222 ? 132.041 141.667 128.792 1.00 308.25 ? 222  HIS A CE1 1 
ATOM   1477  N NE2 . HIS A 1 222 ? 132.339 141.091 129.942 1.00 304.68 ? 222  HIS A NE2 1 
ATOM   1478  N N   . ALA A 1 223 ? 137.952 144.583 130.371 1.00 297.23 ? 223  ALA A N   1 
ATOM   1479  C CA  . ALA A 1 223 ? 138.890 145.696 130.301 1.00 286.65 ? 223  ALA A CA  1 
ATOM   1480  C C   . ALA A 1 223 ? 139.764 145.685 131.529 1.00 287.29 ? 223  ALA A C   1 
ATOM   1481  O O   . ALA A 1 223 ? 139.313 145.365 132.613 1.00 283.73 ? 223  ALA A O   1 
ATOM   1482  C CB  . ALA A 1 223 ? 138.174 147.026 130.164 1.00 286.18 ? 223  ALA A CB  1 
ATOM   1483  N N   . VAL A 1 224 ? 141.010 146.085 131.363 1.00 276.45 ? 224  VAL A N   1 
ATOM   1484  C CA  . VAL A 1 224 ? 141.945 146.000 132.453 1.00 305.35 ? 224  VAL A CA  1 
ATOM   1485  C C   . VAL A 1 224 ? 143.133 146.892 132.269 1.00 310.12 ? 224  VAL A C   1 
ATOM   1486  O O   . VAL A 1 224 ? 143.406 147.378 131.188 1.00 320.39 ? 224  VAL A O   1 
ATOM   1487  C CB  . VAL A 1 224 ? 142.449 144.583 132.646 1.00 341.28 ? 224  VAL A CB  1 
ATOM   1488  C CG1 . VAL A 1 224 ? 141.368 143.745 133.299 1.00 380.40 ? 224  VAL A CG1 1 
ATOM   1489  C CG2 . VAL A 1 224 ? 142.862 144.007 131.309 1.00 359.39 ? 224  VAL A CG2 1 
ATOM   1490  N N   . ILE A 1 225 ? 143.844 147.074 133.361 1.00 305.34 ? 225  ILE A N   1 
ATOM   1491  C CA  . ILE A 1 225 ? 145.003 147.989 133.451 1.00 333.75 ? 225  ILE A CA  1 
ATOM   1492  C C   . ILE A 1 225 ? 144.692 149.489 133.587 1.00 326.04 ? 225  ILE A C   1 
ATOM   1493  O O   . ILE A 1 225 ? 144.920 150.075 134.647 1.00 347.46 ? 225  ILE A O   1 
ATOM   1494  C CB  . ILE A 1 225 ? 145.971 147.764 132.249 1.00 363.57 ? 225  ILE A CB  1 
ATOM   1495  C CG1 . ILE A 1 225 ? 146.526 146.330 132.248 1.00 390.07 ? 225  ILE A CG1 1 
ATOM   1496  C CG2 . ILE A 1 225 ? 147.118 148.780 132.243 1.00 393.97 ? 225  ILE A CG2 1 
ATOM   1497  C CD1 . ILE A 1 225 ? 147.371 145.956 133.454 1.00 403.70 ? 225  ILE A CD1 1 
ATOM   1498  N N   . SER A 1 226 ? 144.207 150.095 132.502 1.00 306.53 ? 226  SER A N   1 
ATOM   1499  C CA  . SER A 1 226 ? 143.929 151.527 132.439 1.00 294.12 ? 226  SER A CA  1 
ATOM   1500  C C   . SER A 1 226 ? 142.770 151.806 131.494 1.00 291.71 ? 226  SER A C   1 
ATOM   1501  O O   . SER A 1 226 ? 142.102 150.888 131.029 1.00 283.23 ? 226  SER A O   1 
ATOM   1502  C CB  . SER A 1 226 ? 145.163 152.279 131.940 1.00 305.11 ? 226  SER A CB  1 
ATOM   1503  O OG  . SER A 1 226 ? 145.221 152.296 130.519 1.00 299.27 ? 226  SER A OG  1 
ATOM   1504  N N   . THR A 1 227 ? 142.524 153.087 131.234 1.00 310.88 ? 227  THR A N   1 
ATOM   1505  C CA  . THR A 1 227 ? 141.638 153.480 130.160 1.00 301.25 ? 227  THR A CA  1 
ATOM   1506  C C   . THR A 1 227 ? 142.363 153.463 128.837 1.00 309.20 ? 227  THR A C   1 
ATOM   1507  O O   . THR A 1 227 ? 141.711 153.355 127.849 1.00 336.41 ? 227  THR A O   1 
ATOM   1508  C CB  . THR A 1 227 ? 141.014 154.885 130.337 1.00 311.10 ? 227  THR A CB  1 
ATOM   1509  O OG1 . THR A 1 227 ? 139.945 155.043 129.396 1.00 279.17 ? 227  THR A OG1 1 
ATOM   1510  C CG2 . THR A 1 227 ? 142.024 156.005 130.092 1.00 328.77 ? 227  THR A CG2 1 
ATOM   1511  N N   . ALA A 1 228 ? 143.675 153.703 128.801 1.00 313.49 ? 228  ALA A N   1 
ATOM   1512  C CA  . ALA A 1 228 ? 144.383 153.795 127.552 1.00 341.68 ? 228  ALA A CA  1 
ATOM   1513  C C   . ALA A 1 228 ? 144.356 152.451 126.848 1.00 334.83 ? 228  ALA A C   1 
ATOM   1514  O O   . ALA A 1 228 ? 144.041 152.324 125.618 1.00 298.23 ? 228  ALA A O   1 
ATOM   1515  C CB  . ALA A 1 228 ? 145.818 154.234 127.790 1.00 353.69 ? 228  ALA A CB  1 
ATOM   1516  N N   . THR A 1 229 ? 144.742 151.431 127.615 1.00 325.26 ? 229  THR A N   1 
ATOM   1517  C CA  . THR A 1 229 ? 144.772 150.038 127.131 1.00 325.08 ? 229  THR A CA  1 
ATOM   1518  C C   . THR A 1 229 ? 143.357 149.638 126.682 1.00 288.25 ? 229  THR A C   1 
ATOM   1519  O O   . THR A 1 229 ? 143.181 149.051 125.598 1.00 304.37 ? 229  THR A O   1 
ATOM   1520  C CB  . THR A 1 229 ? 145.263 149.053 128.215 1.00 330.95 ? 229  THR A CB  1 
ATOM   1521  O OG1 . THR A 1 229 ? 144.334 149.024 129.305 1.00 330.55 ? 229  THR A OG1 1 
ATOM   1522  C CG2 . THR A 1 229 ? 146.656 149.445 128.732 1.00 335.05 ? 229  THR A CG2 1 
ATOM   1523  N N   . CYS A 1 230 ? 142.392 149.972 127.538 1.00 292.23 ? 230  CYS A N   1 
ATOM   1524  C CA  . CYS A 1 230 ? 141.012 149.564 127.354 1.00 306.00 ? 230  CYS A CA  1 
ATOM   1525  C C   . CYS A 1 230 ? 140.467 150.143 126.059 1.00 298.80 ? 230  CYS A C   1 
ATOM   1526  O O   . CYS A 1 230 ? 139.842 149.450 125.219 1.00 311.61 ? 230  CYS A O   1 
ATOM   1527  C CB  . CYS A 1 230 ? 140.190 150.042 128.533 1.00 307.73 ? 230  CYS A CB  1 
ATOM   1528  S SG  . CYS A 1 230 ? 138.467 149.604 128.390 1.00 330.84 ? 230  CYS A SG  1 
ATOM   1529  N N   . MET A 1 231 ? 140.687 151.443 125.919 1.00 312.92 ? 231  MET A N   1 
ATOM   1530  C CA  . MET A 1 231 ? 140.259 152.205 124.728 1.00 324.59 ? 231  MET A CA  1 
ATOM   1531  C C   . MET A 1 231 ? 140.904 151.608 123.490 1.00 325.01 ? 231  MET A C   1 
ATOM   1532  O O   . MET A 1 231 ? 140.209 151.404 122.469 1.00 311.90 ? 231  MET A O   1 
ATOM   1533  C CB  . MET A 1 231 ? 140.558 153.699 124.856 1.00 335.46 ? 231  MET A CB  1 
ATOM   1534  C CG  . MET A 1 231 ? 139.491 154.472 125.618 1.00 332.60 ? 231  MET A CG  1 
ATOM   1535  S SD  . MET A 1 231 ? 138.040 154.825 124.597 1.00 329.61 ? 231  MET A SD  1 
ATOM   1536  C CE  . MET A 1 231 ? 136.903 153.532 125.085 1.00 350.51 ? 231  MET A CE  1 
ATOM   1537  N N   . ARG A 1 232 ? 142.193 151.318 123.594 1.00 328.25 ? 232  ARG A N   1 
ATOM   1538  C CA  . ARG A 1 232 ? 142.982 150.781 122.492 1.00 330.44 ? 232  ARG A CA  1 
ATOM   1539  C C   . ARG A 1 232 ? 142.460 149.448 121.972 1.00 306.32 ? 232  ARG A C   1 
ATOM   1540  O O   . ARG A 1 232 ? 142.215 149.290 120.760 1.00 289.72 ? 232  ARG A O   1 
ATOM   1541  C CB  . ARG A 1 232 ? 144.444 150.619 122.920 1.00 324.03 ? 232  ARG A CB  1 
ATOM   1542  C CG  . ARG A 1 232 ? 145.344 149.885 121.936 1.00 322.01 ? 232  ARG A CG  1 
ATOM   1543  C CD  . ARG A 1 232 ? 146.747 149.795 122.501 1.00 327.49 ? 232  ARG A CD  1 
ATOM   1544  N NE  . ARG A 1 232 ? 146.768 148.986 123.720 1.00 311.55 ? 232  ARG A NE  1 
ATOM   1545  C CZ  . ARG A 1 232 ? 147.666 149.081 124.701 1.00 338.92 ? 232  ARG A CZ  1 
ATOM   1546  N NH1 . ARG A 1 232 ? 148.670 149.962 124.653 1.00 349.13 ? 232  ARG A NH1 1 
ATOM   1547  N NH2 . ARG A 1 232 ? 147.558 148.276 125.757 1.00 355.48 ? 232  ARG A NH2 1 
ATOM   1548  N N   . ARG A 1 233 ? 142.363 148.487 122.898 1.00 292.31 ? 233  ARG A N   1 
ATOM   1549  C CA  . ARG A 1 233 ? 141.942 147.128 122.544 1.00 307.60 ? 233  ARG A CA  1 
ATOM   1550  C C   . ARG A 1 233 ? 140.546 147.149 121.940 1.00 287.10 ? 233  ARG A C   1 
ATOM   1551  O O   . ARG A 1 233 ? 140.309 146.484 120.918 1.00 336.68 ? 233  ARG A O   1 
ATOM   1552  C CB  . ARG A 1 233 ? 142.164 146.083 123.642 1.00 302.07 ? 233  ARG A CB  1 
ATOM   1553  C CG  . ARG A 1 233 ? 141.324 146.151 124.888 1.00 303.70 ? 233  ARG A CG  1 
ATOM   1554  C CD  . ARG A 1 233 ? 141.697 144.994 125.816 1.00 300.15 ? 233  ARG A CD  1 
ATOM   1555  N NE  . ARG A 1 233 ? 143.116 145.006 126.206 1.00 297.40 ? 233  ARG A NE  1 
ATOM   1556  C CZ  . ARG A 1 233 ? 143.672 144.191 127.108 1.00 312.84 ? 233  ARG A CZ  1 
ATOM   1557  N NH1 . ARG A 1 233 ? 142.947 143.278 127.763 1.00 306.58 ? 233  ARG A NH1 1 
ATOM   1558  N NH2 . ARG A 1 233 ? 144.971 144.302 127.380 1.00 303.15 ? 233  ARG A NH2 1 
ATOM   1559  N N   . SER A 1 234 ? 139.667 147.924 122.565 1.00 273.93 ? 234  SER A N   1 
ATOM   1560  C CA  . SER A 1 234 ? 138.284 148.077 122.106 1.00 315.55 ? 234  SER A CA  1 
ATOM   1561  C C   . SER A 1 234 ? 138.259 148.603 120.674 1.00 316.50 ? 234  SER A C   1 
ATOM   1562  O O   . SER A 1 234 ? 137.524 148.086 119.817 1.00 325.28 ? 234  SER A O   1 
ATOM   1563  C CB  . SER A 1 234 ? 137.520 149.038 123.013 1.00 327.75 ? 234  SER A CB  1 
ATOM   1564  O OG  . SER A 1 234 ? 136.162 149.118 122.626 1.00 312.58 ? 234  SER A OG  1 
ATOM   1565  N N   . SER A 1 235 ? 139.073 149.625 120.455 1.00 318.60 ? 235  SER A N   1 
ATOM   1566  C CA  . SER A 1 235 ? 139.199 150.274 119.145 1.00 341.44 ? 235  SER A CA  1 
ATOM   1567  C C   . SER A 1 235 ? 139.623 149.258 118.094 1.00 340.68 ? 235  SER A C   1 
ATOM   1568  O O   . SER A 1 235 ? 139.051 149.199 116.995 1.00 341.13 ? 235  SER A O   1 
ATOM   1569  C CB  . SER A 1 235 ? 140.169 151.461 119.184 1.00 350.91 ? 235  SER A CB  1 
ATOM   1570  O OG  . SER A 1 235 ? 141.509 151.045 119.354 1.00 344.02 ? 235  SER A OG  1 
ATOM   1571  N N   . ILE A 1 236 ? 140.626 148.475 118.466 1.00 323.71 ? 236  ILE A N   1 
ATOM   1572  C CA  . ILE A 1 236 ? 141.187 147.428 117.602 1.00 311.75 ? 236  ILE A CA  1 
ATOM   1573  C C   . ILE A 1 236 ? 140.093 146.441 117.203 1.00 305.04 ? 236  ILE A C   1 
ATOM   1574  O O   . ILE A 1 236 ? 139.957 146.079 116.022 1.00 331.23 ? 236  ILE A O   1 
ATOM   1575  C CB  . ILE A 1 236 ? 142.375 146.715 118.313 1.00 328.56 ? 236  ILE A CB  1 
ATOM   1576  C CG1 . ILE A 1 236 ? 143.650 147.550 118.155 1.00 322.40 ? 236  ILE A CG1 1 
ATOM   1577  C CG2 . ILE A 1 236 ? 142.609 145.292 117.804 1.00 362.24 ? 236  ILE A CG2 1 
ATOM   1578  C CD1 . ILE A 1 236 ? 144.705 147.264 119.202 1.00 325.82 ? 236  ILE A CD1 1 
ATOM   1579  N N   . GLN A 1 237 ? 139.323 145.992 118.190 1.00 291.06 ? 237  GLN A N   1 
ATOM   1580  C CA  . GLN A 1 237 ? 138.256 145.029 117.951 1.00 340.07 ? 237  GLN A CA  1 
ATOM   1581  C C   . GLN A 1 237 ? 137.201 145.620 117.026 1.00 355.53 ? 237  GLN A C   1 
ATOM   1582  O O   . GLN A 1 237 ? 136.688 144.942 116.136 1.00 364.98 ? 237  GLN A O   1 
ATOM   1583  C CB  . GLN A 1 237 ? 137.616 144.597 119.272 1.00 353.60 ? 237  GLN A CB  1 
ATOM   1584  C CG  . GLN A 1 237 ? 138.618 144.240 120.358 1.00 361.29 ? 237  GLN A CG  1 
ATOM   1585  C CD  . GLN A 1 237 ? 139.295 142.907 120.112 1.00 363.82 ? 237  GLN A CD  1 
ATOM   1586  O OE1 . GLN A 1 237 ? 138.692 141.849 120.292 1.00 361.05 ? 237  GLN A OE1 1 
ATOM   1587  N NE2 . GLN A 1 237 ? 140.555 142.951 119.697 1.00 368.58 ? 237  GLN A NE2 1 
ATOM   1588  N N   . SER A 1 238 ? 136.884 146.892 117.243 1.00 359.13 ? 238  SER A N   1 
ATOM   1589  C CA  . SER A 1 238 ? 135.922 147.602 116.396 1.00 367.50 ? 238  SER A CA  1 
ATOM   1590  C C   . SER A 1 238 ? 136.390 147.598 114.952 1.00 382.70 ? 238  SER A C   1 
ATOM   1591  O O   . SER A 1 238 ? 135.612 147.305 114.021 1.00 391.88 ? 238  SER A O   1 
ATOM   1592  C CB  . SER A 1 238 ? 135.666 149.031 116.895 1.00 375.27 ? 238  SER A CB  1 
ATOM   1593  O OG  . SER A 1 238 ? 136.777 149.881 116.683 1.00 367.09 ? 238  SER A OG  1 
ATOM   1594  N N   . THR A 1 239 ? 137.674 147.905 114.785 1.00 371.08 ? 239  THR A N   1 
ATOM   1595  C CA  . THR A 1 239 ? 138.319 147.935 113.467 1.00 364.01 ? 239  THR A CA  1 
ATOM   1596  C C   . THR A 1 239 ? 138.426 146.530 112.827 1.00 355.82 ? 239  THR A C   1 
ATOM   1597  O O   . THR A 1 239 ? 137.886 146.275 111.715 1.00 362.86 ? 239  THR A O   1 
ATOM   1598  C CB  . THR A 1 239 ? 139.713 148.600 113.489 1.00 370.67 ? 239  THR A CB  1 
ATOM   1599  O OG1 . THR A 1 239 ? 140.590 147.874 114.355 1.00 373.10 ? 239  THR A OG1 1 
ATOM   1600  C CG2 . THR A 1 239 ? 139.623 150.062 113.944 1.00 389.60 ? 239  THR A CG2 1 
ATOM   1601  N N   . PHE A 1 240 ? 139.161 145.644 113.495 1.00 328.85 ? 240  PHE A N   1 
ATOM   1602  C CA  . PHE A 1 240 ? 139.646 144.415 112.864 1.00 332.96 ? 240  PHE A CA  1 
ATOM   1603  C C   . PHE A 1 240 ? 138.804 143.173 113.147 1.00 334.34 ? 240  PHE A C   1 
ATOM   1604  O O   . PHE A 1 240 ? 138.537 142.389 112.230 1.00 338.62 ? 240  PHE A O   1 
ATOM   1605  C CB  . PHE A 1 240 ? 141.109 144.174 113.248 1.00 332.83 ? 240  PHE A CB  1 
ATOM   1606  C CG  . PHE A 1 240 ? 142.031 145.311 112.880 1.00 352.66 ? 240  PHE A CG  1 
ATOM   1607  C CD1 . PHE A 1 240 ? 142.041 145.837 111.586 1.00 374.34 ? 240  PHE A CD1 1 
ATOM   1608  C CD2 . PHE A 1 240 ? 142.905 145.848 113.819 1.00 373.45 ? 240  PHE A CD2 1 
ATOM   1609  C CE1 . PHE A 1 240 ? 142.891 146.881 111.247 1.00 385.21 ? 240  PHE A CE1 1 
ATOM   1610  C CE2 . PHE A 1 240 ? 143.758 146.891 113.486 1.00 396.01 ? 240  PHE A CE2 1 
ATOM   1611  C CZ  . PHE A 1 240 ? 143.752 147.408 112.198 1.00 405.79 ? 240  PHE A CZ  1 
ATOM   1612  N N   . SER A 1 241 ? 138.385 142.991 114.396 1.00 320.82 ? 241  SER A N   1 
ATOM   1613  C CA  . SER A 1 241 ? 137.651 141.787 114.781 1.00 346.12 ? 241  SER A CA  1 
ATOM   1614  C C   . SER A 1 241 ? 136.195 141.848 114.324 1.00 348.37 ? 241  SER A C   1 
ATOM   1615  O O   . SER A 1 241 ? 135.558 142.897 114.408 1.00 334.12 ? 241  SER A O   1 
ATOM   1616  C CB  . SER A 1 241 ? 137.712 141.579 116.295 1.00 374.09 ? 241  SER A CB  1 
ATOM   1617  O OG  . SER A 1 241 ? 137.089 140.362 116.676 1.00 381.15 ? 241  SER A OG  1 
ATOM   1618  N N   . ILE A 1 242 ? 135.687 140.717 113.834 1.00 374.81 ? 242  ILE A N   1 
ATOM   1619  C CA  . ILE A 1 242 ? 134.259 140.551 113.557 1.00 379.58 ? 242  ILE A CA  1 
ATOM   1620  C C   . ILE A 1 242 ? 133.620 140.179 114.888 1.00 378.79 ? 242  ILE A C   1 
ATOM   1621  O O   . ILE A 1 242 ? 134.193 139.393 115.650 1.00 354.13 ? 242  ILE A O   1 
ATOM   1622  C CB  . ILE A 1 242 ? 133.976 139.450 112.502 1.00 407.04 ? 242  ILE A CB  1 
ATOM   1623  C CG1 . ILE A 1 242 ? 134.786 139.685 111.212 1.00 425.59 ? 242  ILE A CG1 1 
ATOM   1624  C CG2 . ILE A 1 242 ? 132.480 139.362 112.198 1.00 402.89 ? 242  ILE A CG2 1 
ATOM   1625  C CD1 . ILE A 1 242 ? 134.612 141.053 110.580 1.00 439.16 ? 242  ILE A CD1 1 
ATOM   1626  N N   . ASN A 1 243 ? 132.436 140.736 115.150 1.00 401.90 ? 243  ASN A N   1 
ATOM   1627  C CA  . ASN A 1 243 ? 131.822 140.733 116.485 1.00 407.74 ? 243  ASN A CA  1 
ATOM   1628  C C   . ASN A 1 243 ? 132.783 141.379 117.495 1.00 401.89 ? 243  ASN A C   1 
ATOM   1629  O O   . ASN A 1 243 ? 133.431 140.677 118.278 1.00 408.76 ? 243  ASN A O   1 
ATOM   1630  C CB  . ASN A 1 243 ? 131.401 139.321 116.923 1.00 415.24 ? 243  ASN A CB  1 
ATOM   1631  C CG  . ASN A 1 243 ? 130.390 138.694 115.982 1.00 416.30 ? 243  ASN A CG  1 
ATOM   1632  O OD1 . ASN A 1 243 ? 129.384 139.313 115.629 1.00 427.88 ? 243  ASN A OD1 1 
ATOM   1633  N ND2 . ASN A 1 243 ? 130.648 137.456 115.574 1.00 408.28 ? 243  ASN A ND2 1 
ATOM   1634  N N   . PRO A 1 244 ? 132.892 142.724 117.460 1.00 374.20 ? 244  PRO A N   1 
ATOM   1635  C CA  . PRO A 1 244 ? 133.909 143.430 118.235 1.00 348.22 ? 244  PRO A CA  1 
ATOM   1636  C C   . PRO A 1 244 ? 133.579 143.461 119.724 1.00 352.66 ? 244  PRO A C   1 
ATOM   1637  O O   . PRO A 1 244 ? 132.502 143.931 120.106 1.00 354.58 ? 244  PRO A O   1 
ATOM   1638  C CB  . PRO A 1 244 ? 133.869 144.840 117.645 1.00 339.91 ? 244  PRO A CB  1 
ATOM   1639  C CG  . PRO A 1 244 ? 132.463 145.020 117.200 1.00 359.16 ? 244  PRO A CG  1 
ATOM   1640  C CD  . PRO A 1 244 ? 131.974 143.661 116.781 1.00 364.59 ? 244  PRO A CD  1 
ATOM   1641  N N   . GLU A 1 245 ? 134.486 142.942 120.550 1.00 342.77 ? 245  GLU A N   1 
ATOM   1642  C CA  . GLU A 1 245 ? 134.321 143.018 122.001 1.00 342.38 ? 245  GLU A CA  1 
ATOM   1643  C C   . GLU A 1 245 ? 134.674 144.426 122.451 1.00 340.35 ? 245  GLU A C   1 
ATOM   1644  O O   . GLU A 1 245 ? 135.834 144.723 122.756 1.00 339.45 ? 245  GLU A O   1 
ATOM   1645  C CB  . GLU A 1 245 ? 135.163 141.969 122.741 1.00 352.98 ? 245  GLU A CB  1 
ATOM   1646  C CG  . GLU A 1 245 ? 134.466 140.626 122.905 1.00 383.25 ? 245  GLU A CG  1 
ATOM   1647  C CD  . GLU A 1 245 ? 135.112 139.753 123.967 1.00 408.91 ? 245  GLU A CD  1 
ATOM   1648  O OE1 . GLU A 1 245 ? 136.360 139.679 124.004 1.00 427.34 ? 245  GLU A OE1 1 
ATOM   1649  O OE2 . GLU A 1 245 ? 134.370 139.124 124.753 1.00 398.29 ? 245  GLU A OE2 1 
ATOM   1650  N N   . ILE A 1 246 ? 133.685 145.291 122.643 1.00 334.15 ? 246  ILE A N   1 
ATOM   1651  C CA  . ILE A 1 246 ? 134.004 146.643 123.087 1.00 308.83 ? 246  ILE A CA  1 
ATOM   1652  C C   . ILE A 1 246 ? 134.162 146.667 124.590 1.00 292.34 ? 246  ILE A C   1 
ATOM   1653  O O   . ILE A 1 246 ? 133.191 146.732 125.312 1.00 327.65 ? 246  ILE A O   1 
ATOM   1654  C CB  . ILE A 1 246 ? 132.862 147.603 122.762 1.00 324.65 ? 246  ILE A CB  1 
ATOM   1655  C CG1 . ILE A 1 246 ? 132.584 147.606 121.266 1.00 375.21 ? 246  ILE A CG1 1 
ATOM   1656  C CG2 . ILE A 1 246 ? 133.177 148.998 123.271 1.00 316.37 ? 246  ILE A CG2 1 
ATOM   1657  C CD1 . ILE A 1 246 ? 133.460 148.548 120.469 1.00 390.67 ? 246  ILE A CD1 1 
ATOM   1658  N N   . VAL A 1 247 ? 135.394 146.622 125.057 1.00 269.74 ? 247  VAL A N   1 
ATOM   1659  C CA  . VAL A 1 247 ? 135.669 146.602 126.476 1.00 267.47 ? 247  VAL A CA  1 
ATOM   1660  C C   . VAL A 1 247 ? 135.306 147.861 127.269 1.00 304.01 ? 247  VAL A C   1 
ATOM   1661  O O   . VAL A 1 247 ? 134.845 147.765 128.387 1.00 344.61 ? 247  VAL A O   1 
ATOM   1662  C CB  . VAL A 1 247 ? 137.118 146.202 126.737 1.00 304.21 ? 247  VAL A CB  1 
ATOM   1663  C CG1 . VAL A 1 247 ? 138.027 147.393 126.543 1.00 326.19 ? 247  VAL A CG1 1 
ATOM   1664  C CG2 . VAL A 1 247 ? 137.261 145.616 128.126 1.00 314.71 ? 247  VAL A CG2 1 
ATOM   1665  N N   . CYS A 1 248 ? 135.535 149.040 126.702 1.00 291.69 ? 248  CYS A N   1 
ATOM   1666  C CA  . CYS A 1 248 ? 135.410 150.307 127.425 1.00 285.10 ? 248  CYS A CA  1 
ATOM   1667  C C   . CYS A 1 248 ? 134.402 151.244 126.817 1.00 311.08 ? 248  CYS A C   1 
ATOM   1668  O O   . CYS A 1 248 ? 134.344 151.382 125.606 1.00 349.80 ? 248  CYS A O   1 
ATOM   1669  C CB  . CYS A 1 248 ? 136.729 151.043 127.369 1.00 287.73 ? 248  CYS A CB  1 
ATOM   1670  S SG  . CYS A 1 248 ? 137.587 151.153 128.934 1.00 315.44 ? 248  CYS A SG  1 
ATOM   1671  N N   . ASP A 1 249 ? 133.627 151.919 127.649 1.00 310.71 ? 249  ASP A N   1 
ATOM   1672  C CA  . ASP A 1 249 ? 132.726 152.951 127.167 1.00 296.06 ? 249  ASP A CA  1 
ATOM   1673  C C   . ASP A 1 249 ? 133.084 154.278 127.814 1.00 293.99 ? 249  ASP A C   1 
ATOM   1674  O O   . ASP A 1 249 ? 133.215 154.340 129.023 1.00 289.96 ? 249  ASP A O   1 
ATOM   1675  C CB  . ASP A 1 249 ? 131.298 152.581 127.526 1.00 329.32 ? 249  ASP A CB  1 
ATOM   1676  C CG  . ASP A 1 249 ? 130.604 151.807 126.430 1.00 350.08 ? 249  ASP A CG  1 
ATOM   1677  O OD1 . ASP A 1 249 ? 130.699 150.560 126.415 1.00 345.62 ? 249  ASP A OD1 1 
ATOM   1678  O OD2 . ASP A 1 249 ? 129.951 152.445 125.580 1.00 365.79 ? 249  ASP A OD2 1 
ATOM   1679  N N   . PRO A 1 250 ? 133.244 155.347 127.045 1.00 287.86 ? 250  PRO A N   1 
ATOM   1680  C CA  . PRO A 1 250 ? 133.618 156.610 127.692 1.00 264.62 ? 250  PRO A CA  1 
ATOM   1681  C C   . PRO A 1 250 ? 132.498 157.107 128.560 1.00 288.09 ? 250  PRO A C   1 
ATOM   1682  O O   . PRO A 1 250 ? 131.343 156.934 128.226 1.00 318.80 ? 250  PRO A O   1 
ATOM   1683  C CB  . PRO A 1 250 ? 133.812 157.572 126.531 1.00 313.59 ? 250  PRO A CB  1 
ATOM   1684  C CG  . PRO A 1 250 ? 134.152 156.725 125.386 1.00 337.24 ? 250  PRO A CG  1 
ATOM   1685  C CD  . PRO A 1 250 ? 133.126 155.672 125.546 1.00 340.44 ? 250  PRO A CD  1 
ATOM   1686  N N   . LEU A 1 251 ? 132.850 157.731 129.668 1.00 290.41 ? 251  LEU A N   1 
ATOM   1687  C CA  . LEU A 1 251 ? 131.901 158.235 130.651 1.00 281.68 ? 251  LEU A CA  1 
ATOM   1688  C C   . LEU A 1 251 ? 131.433 159.582 130.119 1.00 291.37 ? 251  LEU A C   1 
ATOM   1689  O O   . LEU A 1 251 ? 132.228 160.524 130.040 1.00 314.00 ? 251  LEU A O   1 
ATOM   1690  C CB  . LEU A 1 251 ? 132.601 158.368 132.011 1.00 291.84 ? 251  LEU A CB  1 
ATOM   1691  C CG  . LEU A 1 251 ? 131.816 158.191 133.300 1.00 298.08 ? 251  LEU A CG  1 
ATOM   1692  C CD1 . LEU A 1 251 ? 131.316 156.764 133.471 1.00 297.56 ? 251  LEU A CD1 1 
ATOM   1693  C CD2 . LEU A 1 251 ? 132.713 158.569 134.464 1.00 313.33 ? 251  LEU A CD2 1 
ATOM   1694  N N   . SER A 1 252 ? 130.163 159.661 129.718 1.00 281.08 ? 252  SER A N   1 
ATOM   1695  C CA  . SER A 1 252 ? 129.686 160.776 128.893 1.00 280.33 ? 252  SER A CA  1 
ATOM   1696  C C   . SER A 1 252 ? 128.179 160.962 128.913 1.00 297.63 ? 252  SER A C   1 
ATOM   1697  O O   . SER A 1 252 ? 127.433 159.985 129.004 1.00 321.18 ? 252  SER A O   1 
ATOM   1698  C CB  . SER A 1 252 ? 130.079 160.517 127.441 1.00 311.93 ? 252  SER A CB  1 
ATOM   1699  O OG  . SER A 1 252 ? 129.292 159.478 126.874 1.00 325.03 ? 252  SER A OG  1 
ATOM   1700  N N   . ASP A 1 253 ? 127.749 162.218 128.794 1.00 296.31 ? 253  ASP A N   1 
ATOM   1701  C CA  . ASP A 1 253 ? 126.346 162.572 128.497 1.00 320.77 ? 253  ASP A CA  1 
ATOM   1702  C C   . ASP A 1 253 ? 126.257 164.067 128.166 1.00 309.94 ? 253  ASP A C   1 
ATOM   1703  O O   . ASP A 1 253 ? 127.286 164.724 128.033 1.00 298.93 ? 253  ASP A O   1 
ATOM   1704  C CB  . ASP A 1 253 ? 125.392 162.166 129.636 1.00 337.28 ? 253  ASP A CB  1 
ATOM   1705  C CG  . ASP A 1 253 ? 125.940 162.478 130.996 1.00 409.94 ? 253  ASP A CG  1 
ATOM   1706  O OD1 . ASP A 1 253 ? 126.885 163.292 131.097 1.00 429.75 ? 253  ASP A OD1 1 
ATOM   1707  O OD2 . ASP A 1 253 ? 125.420 161.905 131.975 1.00 456.41 ? 253  ASP A OD2 1 
ATOM   1708  N N   . TYR A 1 254 ? 125.048 164.599 128.012 1.00 304.47 ? 254  TYR A N   1 
ATOM   1709  C CA  . TYR A 1 254 ? 124.870 165.987 127.591 1.00 300.87 ? 254  TYR A CA  1 
ATOM   1710  C C   . TYR A 1 254 ? 124.784 166.969 128.762 1.00 281.85 ? 254  TYR A C   1 
ATOM   1711  O O   . TYR A 1 254 ? 124.157 166.685 129.780 1.00 293.61 ? 254  TYR A O   1 
ATOM   1712  C CB  . TYR A 1 254 ? 123.623 166.104 126.726 1.00 306.31 ? 254  TYR A CB  1 
ATOM   1713  C CG  . TYR A 1 254 ? 123.757 165.421 125.385 1.00 321.30 ? 254  TYR A CG  1 
ATOM   1714  C CD1 . TYR A 1 254 ? 123.563 164.049 125.257 1.00 307.62 ? 254  TYR A CD1 1 
ATOM   1715  C CD2 . TYR A 1 254 ? 124.090 166.147 124.240 1.00 356.03 ? 254  TYR A CD2 1 
ATOM   1716  C CE1 . TYR A 1 254 ? 123.687 163.417 124.025 1.00 338.20 ? 254  TYR A CE1 1 
ATOM   1717  C CE2 . TYR A 1 254 ? 124.218 165.525 123.005 1.00 369.12 ? 254  TYR A CE2 1 
ATOM   1718  C CZ  . TYR A 1 254 ? 124.016 164.156 122.903 1.00 366.38 ? 254  TYR A CZ  1 
ATOM   1719  O OH  . TYR A 1 254 ? 124.140 163.528 121.686 1.00 382.26 ? 254  TYR A OH  1 
ATOM   1720  N N   . ASN A 1 255 ? 125.440 168.116 128.606 1.00 278.37 ? 255  ASN A N   1 
ATOM   1721  C CA  . ASN A 1 255 ? 125.249 169.260 129.486 1.00 274.55 ? 255  ASN A CA  1 
ATOM   1722  C C   . ASN A 1 255 ? 123.980 169.947 129.048 1.00 267.87 ? 255  ASN A C   1 
ATOM   1723  O O   . ASN A 1 255 ? 123.871 170.319 127.873 1.00 292.45 ? 255  ASN A O   1 
ATOM   1724  C CB  . ASN A 1 255 ? 126.402 170.269 129.360 1.00 284.97 ? 255  ASN A CB  1 
ATOM   1725  C CG  . ASN A 1 255 ? 127.748 169.688 129.749 1.00 303.41 ? 255  ASN A CG  1 
ATOM   1726  O OD1 . ASN A 1 255 ? 127.834 168.763 130.561 1.00 329.34 ? 255  ASN A OD1 1 
ATOM   1727  N ND2 . ASN A 1 255 ? 128.814 170.232 129.167 1.00 283.80 ? 255  ASN A ND2 1 
ATOM   1728  N N   . VAL A 1 256 ? 123.025 170.118 129.965 1.00 263.56 ? 256  VAL A N   1 
ATOM   1729  C CA  . VAL A 1 256 ? 121.848 170.934 129.656 1.00 253.45 ? 256  VAL A CA  1 
ATOM   1730  C C   . VAL A 1 256 ? 122.276 172.361 129.826 1.00 252.49 ? 256  VAL A C   1 
ATOM   1731  O O   . VAL A 1 256 ? 123.285 172.655 130.471 1.00 297.37 ? 256  VAL A O   1 
ATOM   1732  C CB  . VAL A 1 256 ? 120.558 170.617 130.457 1.00 288.50 ? 256  VAL A CB  1 
ATOM   1733  C CG1 . VAL A 1 256 ? 120.442 169.128 130.755 1.00 315.31 ? 256  VAL A CG1 1 
ATOM   1734  C CG2 . VAL A 1 256 ? 120.422 171.443 131.728 1.00 311.64 ? 256  VAL A CG2 1 
ATOM   1735  N N   . TRP A 1 257 ? 121.458 173.247 129.285 1.00 282.07 ? 257  TRP A N   1 
ATOM   1736  C CA  . TRP A 1 257 ? 121.949 174.485 128.721 1.00 278.33 ? 257  TRP A CA  1 
ATOM   1737  C C   . TRP A 1 257 ? 120.764 175.400 128.505 1.00 280.90 ? 257  TRP A C   1 
ATOM   1738  O O   . TRP A 1 257 ? 119.647 174.922 128.311 1.00 298.69 ? 257  TRP A O   1 
ATOM   1739  C CB  . TRP A 1 257 ? 122.562 174.121 127.379 1.00 293.45 ? 257  TRP A CB  1 
ATOM   1740  C CG  . TRP A 1 257 ? 123.494 175.058 126.863 1.00 316.00 ? 257  TRP A CG  1 
ATOM   1741  C CD1 . TRP A 1 257 ? 124.768 175.218 127.263 1.00 357.24 ? 257  TRP A CD1 1 
ATOM   1742  C CD2 . TRP A 1 257 ? 123.282 175.960 125.783 1.00 333.57 ? 257  TRP A CD2 1 
ATOM   1743  N NE1 . TRP A 1 257 ? 125.373 176.188 126.517 1.00 385.03 ? 257  TRP A NE1 1 
ATOM   1744  C CE2 . TRP A 1 257 ? 124.479 176.665 125.594 1.00 357.74 ? 257  TRP A CE2 1 
ATOM   1745  C CE3 . TRP A 1 257 ? 122.189 176.254 124.967 1.00 347.75 ? 257  TRP A CE3 1 
ATOM   1746  C CZ2 . TRP A 1 257 ? 124.618 177.651 124.615 1.00 350.76 ? 257  TRP A CZ2 1 
ATOM   1747  C CZ3 . TRP A 1 257 ? 122.326 177.229 123.999 1.00 355.06 ? 257  TRP A CZ3 1 
ATOM   1748  C CH2 . TRP A 1 257 ? 123.532 177.913 123.828 1.00 347.99 ? 257  TRP A CH2 1 
ATOM   1749  N N   . SER A 1 258 ? 120.997 176.704 128.527 1.00 278.92 ? 258  SER A N   1 
ATOM   1750  C CA  . SER A 1 258 ? 119.910 177.670 128.353 1.00 281.65 ? 258  SER A CA  1 
ATOM   1751  C C   . SER A 1 258 ? 120.437 179.082 128.195 1.00 290.91 ? 258  SER A C   1 
ATOM   1752  O O   . SER A 1 258 ? 121.614 179.357 128.434 1.00 326.24 ? 258  SER A O   1 
ATOM   1753  C CB  . SER A 1 258 ? 118.919 177.594 129.531 1.00 286.96 ? 258  SER A CB  1 
ATOM   1754  O OG  . SER A 1 258 ? 118.151 178.776 129.690 1.00 303.67 ? 258  SER A OG  1 
ATOM   1755  N N   . MET A 1 259 ? 119.539 179.970 127.797 1.00 298.56 ? 259  MET A N   1 
ATOM   1756  C CA  . MET A 1 259 ? 119.873 181.359 127.559 1.00 309.48 ? 259  MET A CA  1 
ATOM   1757  C C   . MET A 1 259 ? 118.641 182.201 127.865 1.00 304.37 ? 259  MET A C   1 
ATOM   1758  O O   . MET A 1 259 ? 117.540 181.880 127.409 1.00 289.23 ? 259  MET A O   1 
ATOM   1759  C CB  . MET A 1 259 ? 120.317 181.535 126.104 1.00 321.16 ? 259  MET A CB  1 
ATOM   1760  C CG  . MET A 1 259 ? 121.433 182.546 125.909 1.00 324.56 ? 259  MET A CG  1 
ATOM   1761  S SD  . MET A 1 259 ? 123.033 182.058 126.576 1.00 346.48 ? 259  MET A SD  1 
ATOM   1762  C CE  . MET A 1 259 ? 123.341 180.514 125.730 1.00 345.00 ? 259  MET A CE  1 
ATOM   1763  N N   . LEU A 1 260 ? 118.831 183.263 128.646 1.00 318.76 ? 260  LEU A N   1 
ATOM   1764  C CA  . LEU A 1 260 ? 117.720 184.105 129.093 1.00 326.60 ? 260  LEU A CA  1 
ATOM   1765  C C   . LEU A 1 260 ? 117.075 184.826 127.909 1.00 321.38 ? 260  LEU A C   1 
ATOM   1766  O O   . LEU A 1 260 ? 115.866 184.698 127.692 1.00 295.24 ? 260  LEU A O   1 
ATOM   1767  C CB  . LEU A 1 260 ? 118.199 185.095 130.158 1.00 336.79 ? 260  LEU A CB  1 
ATOM   1768  C CG  . LEU A 1 260 ? 117.199 186.105 130.716 1.00 345.98 ? 260  LEU A CG  1 
ATOM   1769  C CD1 . LEU A 1 260 ? 115.917 185.418 131.172 1.00 351.72 ? 260  LEU A CD1 1 
ATOM   1770  C CD2 . LEU A 1 260 ? 117.846 186.894 131.843 1.00 343.52 ? 260  LEU A CD2 1 
ATOM   1771  N N   . LYS A 1 261 ? 117.895 185.472 127.088 1.00 333.62 ? 261  LYS A N   1 
ATOM   1772  C CA  . LYS A 1 261 ? 117.454 185.985 125.796 1.00 346.67 ? 261  LYS A CA  1 
ATOM   1773  C C   . LYS A 1 261 ? 118.020 185.064 124.726 1.00 340.87 ? 261  LYS A C   1 
ATOM   1774  O O   . LYS A 1 261 ? 119.228 184.867 124.661 1.00 337.97 ? 261  LYS A O   1 
ATOM   1775  C CB  . LYS A 1 261 ? 117.983 187.394 125.570 1.00 346.09 ? 261  LYS A CB  1 
ATOM   1776  C CG  . LYS A 1 261 ? 117.426 188.435 126.517 1.00 360.50 ? 261  LYS A CG  1 
ATOM   1777  C CD  . LYS A 1 261 ? 117.695 189.833 125.993 1.00 384.67 ? 261  LYS A CD  1 
ATOM   1778  C CE  . LYS A 1 261 ? 119.118 190.274 126.294 1.00 387.55 ? 261  LYS A CE  1 
ATOM   1779  N NZ  . LYS A 1 261 ? 119.934 190.432 125.059 1.00 382.43 ? 261  LYS A NZ  1 
ATOM   1780  N N   . PRO A 1 262 ? 117.154 184.507 123.887 1.00 333.99 ? 262  PRO A N   1 
ATOM   1781  C CA  . PRO A 1 262 ? 117.548 183.439 122.972 1.00 321.53 ? 262  PRO A CA  1 
ATOM   1782  C C   . PRO A 1 262 ? 118.603 183.914 121.968 1.00 329.10 ? 262  PRO A C   1 
ATOM   1783  O O   . PRO A 1 262 ? 118.562 185.071 121.536 1.00 330.85 ? 262  PRO A O   1 
ATOM   1784  C CB  . PRO A 1 262 ? 116.240 183.100 122.266 1.00 344.31 ? 262  PRO A CB  1 
ATOM   1785  C CG  . PRO A 1 262 ? 115.502 184.394 122.234 1.00 343.25 ? 262  PRO A CG  1 
ATOM   1786  C CD  . PRO A 1 262 ? 115.872 185.122 123.490 1.00 335.38 ? 262  PRO A CD  1 
ATOM   1787  N N   . ILE A 1 263 ? 119.527 183.023 121.604 1.00 331.82 ? 263  ILE A N   1 
ATOM   1788  C CA  . ILE A 1 263 ? 120.649 183.367 120.713 1.00 338.62 ? 263  ILE A CA  1 
ATOM   1789  C C   . ILE A 1 263 ? 120.586 182.609 119.384 1.00 335.12 ? 263  ILE A C   1 
ATOM   1790  O O   . ILE A 1 263 ? 119.794 181.678 119.222 1.00 309.54 ? 263  ILE A O   1 
ATOM   1791  C CB  . ILE A 1 263 ? 122.024 183.169 121.397 1.00 343.91 ? 263  ILE A CB  1 
ATOM   1792  C CG1 . ILE A 1 263 ? 122.202 181.736 121.918 1.00 344.04 ? 263  ILE A CG1 1 
ATOM   1793  C CG2 . ILE A 1 263 ? 122.197 184.178 122.524 1.00 349.38 ? 263  ILE A CG2 1 
ATOM   1794  C CD1 . ILE A 1 263 ? 123.647 181.366 122.184 1.00 352.98 ? 263  ILE A CD1 1 
ATOM   1795  N N   . ASN A 1 264 ? 121.431 183.010 118.442 1.00 355.58 ? 264  ASN A N   1 
ATOM   1796  C CA  . ASN A 1 264 ? 121.336 182.523 117.074 1.00 373.33 ? 264  ASN A CA  1 
ATOM   1797  C C   . ASN A 1 264 ? 121.510 181.016 116.996 1.00 354.61 ? 264  ASN A C   1 
ATOM   1798  O O   . ASN A 1 264 ? 120.817 180.341 116.235 1.00 357.42 ? 264  ASN A O   1 
ATOM   1799  C CB  . ASN A 1 264 ? 122.368 183.218 116.184 1.00 397.23 ? 264  ASN A CB  1 
ATOM   1800  C CG  . ASN A 1 264 ? 121.821 183.557 114.811 1.00 402.46 ? 264  ASN A CG  1 
ATOM   1801  O OD1 . ASN A 1 264 ? 121.662 184.727 114.465 1.00 385.93 ? 264  ASN A OD1 1 
ATOM   1802  N ND2 . ASN A 1 264 ? 121.529 182.530 114.021 1.00 401.22 ? 264  ASN A ND2 1 
ATOM   1803  N N   . THR A 1 265 ? 122.436 180.488 117.787 1.00 348.04 ? 265  THR A N   1 
ATOM   1804  C CA  . THR A 1 265 ? 122.669 179.027 117.811 1.00 358.62 ? 265  THR A CA  1 
ATOM   1805  C C   . THR A 1 265 ? 123.603 178.467 116.719 1.00 378.14 ? 265  THR A C   1 
ATOM   1806  O O   . THR A 1 265 ? 124.626 177.856 117.040 1.00 378.68 ? 265  THR A O   1 
ATOM   1807  C CB  . THR A 1 265 ? 121.340 178.237 117.768 1.00 358.71 ? 265  THR A CB  1 
ATOM   1808  O OG1 . THR A 1 265 ? 120.362 178.889 118.585 1.00 372.43 ? 265  THR A OG1 1 
ATOM   1809  C CG2 . THR A 1 265 ? 121.540 176.802 118.253 1.00 365.62 ? 265  THR A CG2 1 
ATOM   1810  N N   . THR A 1 266 ? 123.222 178.645 115.451 1.00 386.12 ? 266  THR A N   1 
ATOM   1811  C CA  . THR A 1 266 ? 123.972 178.156 114.283 1.00 410.31 ? 266  THR A CA  1 
ATOM   1812  C C   . THR A 1 266 ? 125.478 178.402 114.362 1.00 418.17 ? 266  THR A C   1 
ATOM   1813  O O   . THR A 1 266 ? 126.269 177.499 114.082 1.00 433.29 ? 266  THR A O   1 
ATOM   1814  C CB  . THR A 1 266 ? 123.448 178.808 112.981 1.00 438.74 ? 266  THR A CB  1 
ATOM   1815  O OG1 . THR A 1 266 ? 122.031 178.621 112.885 1.00 449.87 ? 266  THR A OG1 1 
ATOM   1816  C CG2 . THR A 1 266 ? 124.119 178.205 111.740 1.00 457.04 ? 266  THR A CG2 1 
ATOM   1817  N N   . GLY A 1 267 ? 125.840 179.624 114.746 1.00 419.31 ? 267  GLY A N   1 
ATOM   1818  C CA  . GLY A 1 267 ? 127.210 180.106 114.718 1.00 415.39 ? 267  GLY A CA  1 
ATOM   1819  C C   . GLY A 1 267 ? 127.594 180.931 115.932 1.00 403.25 ? 267  GLY A C   1 
ATOM   1820  O O   . GLY A 1 267 ? 126.734 181.433 116.647 1.00 391.93 ? 267  GLY A O   1 
ATOM   1821  N N   . THR A 1 268 ? 128.892 181.131 116.119 1.00 400.17 ? 268  THR A N   1 
ATOM   1822  C CA  . THR A 1 268 ? 129.432 181.701 117.348 1.00 387.24 ? 268  THR A CA  1 
ATOM   1823  C C   . THR A 1 268 ? 128.945 183.119 117.626 1.00 366.18 ? 268  THR A C   1 
ATOM   1824  O O   . THR A 1 268 ? 128.687 183.902 116.717 1.00 362.49 ? 268  THR A O   1 
ATOM   1825  C CB  . THR A 1 268 ? 130.978 181.655 117.350 1.00 403.05 ? 268  THR A CB  1 
ATOM   1826  O OG1 . THR A 1 268 ? 131.409 180.295 117.465 1.00 404.69 ? 268  THR A OG1 1 
ATOM   1827  C CG2 . THR A 1 268 ? 131.575 182.461 118.506 1.00 412.24 ? 268  THR A CG2 1 
ATOM   1828  N N   . LEU A 1 269 ? 128.820 183.416 118.915 1.00 369.91 ? 269  LEU A N   1 
ATOM   1829  C CA  . LEU A 1 269 ? 128.326 184.693 119.403 1.00 366.71 ? 269  LEU A CA  1 
ATOM   1830  C C   . LEU A 1 269 ? 129.251 185.821 119.016 1.00 370.29 ? 269  LEU A C   1 
ATOM   1831  O O   . LEU A 1 269 ? 130.461 185.642 118.937 1.00 369.02 ? 269  LEU A O   1 
ATOM   1832  C CB  . LEU A 1 269 ? 128.215 184.658 120.922 1.00 366.01 ? 269  LEU A CB  1 
ATOM   1833  C CG  . LEU A 1 269 ? 126.805 184.635 121.497 1.00 358.67 ? 269  LEU A CG  1 
ATOM   1834  C CD1 . LEU A 1 269 ? 126.816 185.171 122.916 1.00 357.45 ? 269  LEU A CD1 1 
ATOM   1835  C CD2 . LEU A 1 269 ? 125.853 185.433 120.622 1.00 349.09 ? 269  LEU A CD2 1 
ATOM   1836  N N   . LYS A 1 270 ? 128.698 186.993 118.710 1.00 372.47 ? 270  LYS A N   1 
ATOM   1837  C CA  . LYS A 1 270 ? 129.520 188.123 118.260 1.00 381.42 ? 270  LYS A CA  1 
ATOM   1838  C C   . LYS A 1 270 ? 130.453 188.550 119.386 1.00 368.99 ? 270  LYS A C   1 
ATOM   1839  O O   . LYS A 1 270 ? 130.059 188.503 120.551 1.00 350.03 ? 270  LYS A O   1 
ATOM   1840  C CB  . LYS A 1 270 ? 128.637 189.295 117.830 1.00 387.72 ? 270  LYS A CB  1 
ATOM   1841  C CG  . LYS A 1 270 ? 129.405 190.467 117.241 1.00 389.53 ? 270  LYS A CG  1 
ATOM   1842  C CD  . LYS A 1 270 ? 128.970 190.750 115.812 1.00 417.42 ? 270  LYS A CD  1 
ATOM   1843  C CE  . LYS A 1 270 ? 128.383 192.145 115.679 1.00 442.70 ? 270  LYS A CE  1 
ATOM   1844  N NZ  . LYS A 1 270 ? 128.593 192.709 114.317 1.00 452.75 ? 270  LYS A NZ  1 
ATOM   1845  N N   . PRO A 1 271 ? 131.688 188.950 119.076 1.00 376.82 ? 271  PRO A N   1 
ATOM   1846  C CA  . PRO A 1 271 ? 132.613 189.195 120.198 1.00 383.29 ? 271  PRO A CA  1 
ATOM   1847  C C   . PRO A 1 271 ? 132.180 190.314 121.141 1.00 377.88 ? 271  PRO A C   1 
ATOM   1848  O O   . PRO A 1 271 ? 132.350 190.189 122.350 1.00 346.68 ? 271  PRO A O   1 
ATOM   1849  C CB  . PRO A 1 271 ? 133.931 189.576 119.513 1.00 379.74 ? 271  PRO A CB  1 
ATOM   1850  C CG  . PRO A 1 271 ? 133.876 188.927 118.188 1.00 373.11 ? 271  PRO A CG  1 
ATOM   1851  C CD  . PRO A 1 271 ? 132.482 189.244 117.785 1.00 375.72 ? 271  PRO A CD  1 
ATOM   1852  N N   . ASP A 1 272 ? 131.656 191.405 120.599 1.00 395.82 ? 272  ASP A N   1 
ATOM   1853  C CA  . ASP A 1 272 ? 131.302 192.549 121.430 1.00 401.93 ? 272  ASP A CA  1 
ATOM   1854  C C   . ASP A 1 272 ? 130.205 192.227 122.444 1.00 384.71 ? 272  ASP A C   1 
ATOM   1855  O O   . ASP A 1 272 ? 130.299 192.601 123.609 1.00 374.11 ? 272  ASP A O   1 
ATOM   1856  C CB  . ASP A 1 272 ? 130.900 193.729 120.552 1.00 415.92 ? 272  ASP A CB  1 
ATOM   1857  C CG  . ASP A 1 272 ? 132.092 194.378 119.878 1.00 425.75 ? 272  ASP A CG  1 
ATOM   1858  O OD1 . ASP A 1 272 ? 133.230 194.137 120.327 1.00 423.43 ? 272  ASP A OD1 1 
ATOM   1859  O OD2 . ASP A 1 272 ? 131.892 195.126 118.900 1.00 429.00 ? 272  ASP A OD2 1 
ATOM   1860  N N   . ASP A 1 273 ? 129.184 191.508 121.997 1.00 385.26 ? 273  ASP A N   1 
ATOM   1861  C CA  . ASP A 1 273 ? 128.168 190.951 122.876 1.00 374.83 ? 273  ASP A CA  1 
ATOM   1862  C C   . ASP A 1 273 ? 128.835 190.170 124.003 1.00 350.13 ? 273  ASP A C   1 
ATOM   1863  O O   . ASP A 1 273 ? 129.856 189.515 123.795 1.00 342.39 ? 273  ASP A O   1 
ATOM   1864  C CB  . ASP A 1 273 ? 127.218 190.043 122.093 1.00 382.93 ? 273  ASP A CB  1 
ATOM   1865  C CG  . ASP A 1 273 ? 125.760 190.369 122.345 1.00 406.25 ? 273  ASP A CG  1 
ATOM   1866  O OD1 . ASP A 1 273 ? 125.478 191.172 123.260 1.00 427.35 ? 273  ASP A OD1 1 
ATOM   1867  O OD2 . ASP A 1 273 ? 124.894 189.823 121.629 1.00 411.42 ? 273  ASP A OD2 1 
ATOM   1868  N N   . ARG A 1 274 ? 128.253 190.241 125.194 1.00 347.35 ? 274  ARG A N   1 
ATOM   1869  C CA  . ARG A 1 274 ? 128.780 189.530 126.351 1.00 345.44 ? 274  ARG A CA  1 
ATOM   1870  C C   . ARG A 1 274 ? 127.663 188.814 127.105 1.00 323.17 ? 274  ARG A C   1 
ATOM   1871  O O   . ARG A 1 274 ? 126.524 189.279 127.134 1.00 293.81 ? 274  ARG A O   1 
ATOM   1872  C CB  . ARG A 1 274 ? 129.512 190.495 127.286 1.00 357.16 ? 274  ARG A CB  1 
ATOM   1873  C CG  . ARG A 1 274 ? 130.713 191.179 126.654 1.00 371.02 ? 274  ARG A CG  1 
ATOM   1874  C CD  . ARG A 1 274 ? 131.994 190.845 127.400 1.00 384.72 ? 274  ARG A CD  1 
ATOM   1875  N NE  . ARG A 1 274 ? 133.160 190.867 126.521 1.00 407.49 ? 274  ARG A NE  1 
ATOM   1876  C CZ  . ARG A 1 274 ? 134.412 191.005 126.945 1.00 419.03 ? 274  ARG A CZ  1 
ATOM   1877  N NH1 . ARG A 1 274 ? 134.666 191.134 128.240 1.00 419.54 ? 274  ARG A NH1 1 
ATOM   1878  N NH2 . ARG A 1 274 ? 135.412 191.014 126.074 1.00 427.89 ? 274  ARG A NH2 1 
ATOM   1879  N N   . VAL A 1 275 ? 127.999 187.682 127.713 1.00 332.14 ? 275  VAL A N   1 
ATOM   1880  C CA  . VAL A 1 275 ? 127.026 186.891 128.474 1.00 347.87 ? 275  VAL A CA  1 
ATOM   1881  C C   . VAL A 1 275 ? 127.471 186.625 129.907 1.00 327.30 ? 275  VAL A C   1 
ATOM   1882  O O   . VAL A 1 275 ? 128.646 186.761 130.238 1.00 317.81 ? 275  VAL A O   1 
ATOM   1883  C CB  . VAL A 1 275 ? 126.675 185.554 127.775 1.00 348.36 ? 275  VAL A CB  1 
ATOM   1884  C CG1 . VAL A 1 275 ? 126.130 185.808 126.371 1.00 372.64 ? 275  VAL A CG1 1 
ATOM   1885  C CG2 . VAL A 1 275 ? 127.863 184.612 127.727 1.00 338.99 ? 275  VAL A CG2 1 
ATOM   1886  N N   . VAL A 1 276 ? 126.523 186.246 130.753 1.00 328.15 ? 276  VAL A N   1 
ATOM   1887  C CA  . VAL A 1 276 ? 126.805 185.912 132.137 1.00 317.43 ? 276  VAL A CA  1 
ATOM   1888  C C   . VAL A 1 276 ? 126.470 184.456 132.318 1.00 296.73 ? 276  VAL A C   1 
ATOM   1889  O O   . VAL A 1 276 ? 125.392 184.029 131.943 1.00 304.37 ? 276  VAL A O   1 
ATOM   1890  C CB  . VAL A 1 276 ? 125.900 186.693 133.079 1.00 329.82 ? 276  VAL A CB  1 
ATOM   1891  C CG1 . VAL A 1 276 ? 126.128 186.255 134.509 1.00 305.20 ? 276  VAL A CG1 1 
ATOM   1892  C CG2 . VAL A 1 276 ? 126.140 188.175 132.921 1.00 356.05 ? 276  VAL A CG2 1 
ATOM   1893  N N   . VAL A 1 277 ? 127.377 183.685 132.890 1.00 270.02 ? 277  VAL A N   1 
ATOM   1894  C CA  . VAL A 1 277 ? 127.161 182.263 132.971 1.00 260.97 ? 277  VAL A CA  1 
ATOM   1895  C C   . VAL A 1 277 ? 126.870 181.853 134.387 1.00 265.41 ? 277  VAL A C   1 
ATOM   1896  O O   . VAL A 1 277 ? 127.636 182.153 135.273 1.00 292.52 ? 277  VAL A O   1 
ATOM   1897  C CB  . VAL A 1 277 ? 128.415 181.523 132.537 1.00 287.14 ? 277  VAL A CB  1 
ATOM   1898  C CG1 . VAL A 1 277 ? 128.171 180.032 132.544 1.00 298.78 ? 277  VAL A CG1 1 
ATOM   1899  C CG2 . VAL A 1 277 ? 128.848 181.993 131.170 1.00 286.03 ? 277  VAL A CG2 1 
ATOM   1900  N N   . ALA A 1 278 ? 125.766 181.160 134.611 1.00 280.93 ? 278  ALA A N   1 
ATOM   1901  C CA  . ALA A 1 278 ? 125.527 180.578 135.915 1.00 288.81 ? 278  ALA A CA  1 
ATOM   1902  C C   . ALA A 1 278 ? 125.536 179.078 135.764 1.00 276.23 ? 278  ALA A C   1 
ATOM   1903  O O   . ALA A 1 278 ? 124.604 178.517 135.230 1.00 290.69 ? 278  ALA A O   1 
ATOM   1904  C CB  . ALA A 1 278 ? 124.186 181.033 136.431 1.00 288.67 ? 278  ALA A CB  1 
ATOM   1905  N N   . ALA A 1 279 ? 126.554 178.416 136.283 1.00 267.41 ? 279  ALA A N   1 
ATOM   1906  C CA  . ALA A 1 279 ? 126.758 177.018 135.971 1.00 264.89 ? 279  ALA A CA  1 
ATOM   1907  C C   . ALA A 1 279 ? 126.882 176.168 137.204 1.00 267.92 ? 279  ALA A C   1 
ATOM   1908  O O   . ALA A 1 279 ? 127.566 176.549 138.130 1.00 307.67 ? 279  ALA A O   1 
ATOM   1909  C CB  . ALA A 1 279 ? 128.000 176.866 135.127 1.00 295.16 ? 279  ALA A CB  1 
ATOM   1910  N N   . THR A 1 280 ? 126.236 175.008 137.205 1.00 274.92 ? 280  THR A N   1 
ATOM   1911  C CA  . THR A 1 280 ? 126.324 174.086 138.324 1.00 282.20 ? 280  THR A CA  1 
ATOM   1912  C C   . THR A 1 280 ? 126.503 172.662 137.873 1.00 281.31 ? 280  THR A C   1 
ATOM   1913  O O   . THR A 1 280 ? 126.017 172.294 136.824 1.00 267.19 ? 280  THR A O   1 
ATOM   1914  C CB  . THR A 1 280 ? 125.040 174.120 139.115 1.00 321.74 ? 280  THR A CB  1 
ATOM   1915  O OG1 . THR A 1 280 ? 124.266 175.238 138.680 1.00 326.61 ? 280  THR A OG1 1 
ATOM   1916  C CG2 . THR A 1 280 ? 125.356 174.263 140.577 1.00 347.79 ? 280  THR A CG2 1 
ATOM   1917  N N   . ARG A 1 281 ? 127.186 171.847 138.667 1.00 315.69 ? 281  ARG A N   1 
ATOM   1918  C CA  . ARG A 1 281 ? 127.361 170.446 138.315 1.00 312.03 ? 281  ARG A CA  1 
ATOM   1919  C C   . ARG A 1 281 ? 126.024 169.759 138.409 1.00 259.02 ? 281  ARG A C   1 
ATOM   1920  O O   . ARG A 1 281 ? 125.211 170.125 139.222 1.00 268.18 ? 281  ARG A O   1 
ATOM   1921  C CB  . ARG A 1 281 ? 128.411 169.762 139.188 1.00 326.53 ? 281  ARG A CB  1 
ATOM   1922  C CG  . ARG A 1 281 ? 127.897 169.204 140.490 1.00 319.66 ? 281  ARG A CG  1 
ATOM   1923  C CD  . ARG A 1 281 ? 128.436 169.991 141.667 1.00 338.76 ? 281  ARG A CD  1 
ATOM   1924  N NE  . ARG A 1 281 ? 129.754 169.547 142.095 1.00 359.40 ? 281  ARG A NE  1 
ATOM   1925  C CZ  . ARG A 1 281 ? 130.122 168.278 142.200 1.00 382.10 ? 281  ARG A CZ  1 
ATOM   1926  N NH1 . ARG A 1 281 ? 129.272 167.313 141.897 1.00 393.49 ? 281  ARG A NH1 1 
ATOM   1927  N NH2 . ARG A 1 281 ? 131.344 167.974 142.609 1.00 378.71 ? 281  ARG A NH2 1 
ATOM   1928  N N   . LEU A 1 282 ? 125.791 168.785 137.545 1.00 276.62 ? 282  LEU A N   1 
ATOM   1929  C CA  . LEU A 1 282 ? 124.506 168.129 137.456 1.00 283.51 ? 282  LEU A CA  1 
ATOM   1930  C C   . LEU A 1 282 ? 124.632 166.737 137.993 1.00 278.71 ? 282  LEU A C   1 
ATOM   1931  O O   . LEU A 1 282 ? 123.790 165.899 137.730 1.00 267.11 ? 282  LEU A O   1 
ATOM   1932  C CB  . LEU A 1 282 ? 124.058 168.045 136.009 1.00 289.22 ? 282  LEU A CB  1 
ATOM   1933  C CG  . LEU A 1 282 ? 122.590 168.256 135.706 1.00 281.54 ? 282  LEU A CG  1 
ATOM   1934  C CD1 . LEU A 1 282 ? 122.269 169.712 135.943 1.00 296.77 ? 282  LEU A CD1 1 
ATOM   1935  C CD2 . LEU A 1 282 ? 122.338 167.912 134.257 1.00 284.90 ? 282  LEU A CD2 1 
ATOM   1936  N N   . ASP A 1 283 ? 125.721 166.447 138.682 1.00 294.36 ? 283  ASP A N   1 
ATOM   1937  C CA  . ASP A 1 283 ? 126.011 165.043 138.930 1.00 310.79 ? 283  ASP A CA  1 
ATOM   1938  C C   . ASP A 1 283 ? 126.755 164.773 140.233 1.00 304.10 ? 283  ASP A C   1 
ATOM   1939  O O   . ASP A 1 283 ? 127.377 165.656 140.825 1.00 303.41 ? 283  ASP A O   1 
ATOM   1940  C CB  . ASP A 1 283 ? 126.882 164.519 137.803 1.00 320.06 ? 283  ASP A CB  1 
ATOM   1941  C CG  . ASP A 1 283 ? 128.226 165.201 137.768 1.00 339.88 ? 283  ASP A CG  1 
ATOM   1942  O OD1 . ASP A 1 283 ? 128.322 166.282 137.152 1.00 372.81 ? 283  ASP A OD1 1 
ATOM   1943  O OD2 . ASP A 1 283 ? 129.180 164.677 138.373 1.00 318.48 ? 283  ASP A OD2 1 
ATOM   1944  N N   . SER A 1 284 ? 126.714 163.506 140.621 1.00 304.43 ? 284  SER A N   1 
ATOM   1945  C CA  . SER A 1 284 ? 127.408 162.997 141.784 1.00 286.48 ? 284  SER A CA  1 
ATOM   1946  C C   . SER A 1 284 ? 127.815 161.563 141.478 1.00 272.66 ? 284  SER A C   1 
ATOM   1947  O O   . SER A 1 284 ? 127.662 161.087 140.349 1.00 276.13 ? 284  SER A O   1 
ATOM   1948  C CB  . SER A 1 284 ? 126.476 163.034 142.988 1.00 310.53 ? 284  SER A CB  1 
ATOM   1949  O OG  . SER A 1 284 ? 125.380 162.156 142.792 1.00 331.97 ? 284  SER A OG  1 
ATOM   1950  N N   . ARG A 1 285 ? 128.343 160.877 142.488 1.00 257.37 ? 285  ARG A N   1 
ATOM   1951  C CA  . ARG A 1 285 ? 128.808 159.497 142.388 1.00 251.47 ? 285  ARG A CA  1 
ATOM   1952  C C   . ARG A 1 285 ? 128.824 158.906 143.788 1.00 256.29 ? 285  ARG A C   1 
ATOM   1953  O O   . ARG A 1 285 ? 128.742 159.639 144.749 1.00 294.05 ? 285  ARG A O   1 
ATOM   1954  C CB  . ARG A 1 285 ? 130.220 159.466 141.829 1.00 259.91 ? 285  ARG A CB  1 
ATOM   1955  C CG  . ARG A 1 285 ? 131.237 160.055 142.787 1.00 276.21 ? 285  ARG A CG  1 
ATOM   1956  C CD  . ARG A 1 285 ? 132.616 159.436 142.666 1.00 291.94 ? 285  ARG A CD  1 
ATOM   1957  N NE  . ARG A 1 285 ? 132.554 157.988 142.581 1.00 306.32 ? 285  ARG A NE  1 
ATOM   1958  C CZ  . ARG A 1 285 ? 133.205 157.280 141.674 1.00 299.38 ? 285  ARG A CZ  1 
ATOM   1959  N NH1 . ARG A 1 285 ? 133.968 157.900 140.795 1.00 297.12 ? 285  ARG A NH1 1 
ATOM   1960  N NH2 . ARG A 1 285 ? 133.102 155.964 141.650 1.00 293.97 ? 285  ARG A NH2 1 
ATOM   1961  N N   . SER A 1 286 ? 128.933 157.597 143.922 1.00 244.89 ? 286  SER A N   1 
ATOM   1962  C CA  . SER A 1 286 ? 129.175 156.980 145.208 1.00 245.93 ? 286  SER A CA  1 
ATOM   1963  C C   . SER A 1 286 ? 130.288 155.950 145.037 1.00 262.86 ? 286  SER A C   1 
ATOM   1964  O O   . SER A 1 286 ? 130.957 155.909 144.004 1.00 274.93 ? 286  SER A O   1 
ATOM   1965  C CB  . SER A 1 286 ? 127.893 156.330 145.728 1.00 268.59 ? 286  SER A CB  1 
ATOM   1966  O OG  . SER A 1 286 ? 127.594 155.136 145.026 1.00 283.23 ? 286  SER A OG  1 
ATOM   1967  N N   . PHE A 1 287 ? 130.459 155.109 146.029 1.00 276.46 ? 287  PHE A N   1 
ATOM   1968  C CA  . PHE A 1 287 ? 131.277 153.949 145.850 1.00 276.07 ? 287  PHE A CA  1 
ATOM   1969  C C   . PHE A 1 287 ? 130.626 153.024 144.835 1.00 269.71 ? 287  PHE A C   1 
ATOM   1970  O O   . PHE A 1 287 ? 131.291 152.492 143.967 1.00 313.37 ? 287  PHE A O   1 
ATOM   1971  C CB  . PHE A 1 287 ? 131.421 153.239 147.174 1.00 296.65 ? 287  PHE A CB  1 
ATOM   1972  C CG  . PHE A 1 287 ? 132.643 152.410 147.274 1.00 297.40 ? 287  PHE A CG  1 
ATOM   1973  C CD1 . PHE A 1 287 ? 132.895 151.434 146.351 1.00 302.04 ? 287  PHE A CD1 1 
ATOM   1974  C CD2 . PHE A 1 287 ? 133.527 152.601 148.299 1.00 290.05 ? 287  PHE A CD2 1 
ATOM   1975  C CE1 . PHE A 1 287 ? 134.021 150.661 146.437 1.00 331.13 ? 287  PHE A CE1 1 
ATOM   1976  C CE2 . PHE A 1 287 ? 134.657 151.833 148.398 1.00 314.77 ? 287  PHE A CE2 1 
ATOM   1977  C CZ  . PHE A 1 287 ? 134.906 150.861 147.460 1.00 334.72 ? 287  PHE A CZ  1 
ATOM   1978  N N   . PHE A 1 288 ? 129.313 152.861 144.939 1.00 258.48 ? 288  PHE A N   1 
ATOM   1979  C CA  . PHE A 1 288 ? 128.570 151.852 144.191 1.00 278.34 ? 288  PHE A CA  1 
ATOM   1980  C C   . PHE A 1 288 ? 127.970 152.347 142.895 1.00 274.08 ? 288  PHE A C   1 
ATOM   1981  O O   . PHE A 1 288 ? 127.730 153.522 142.737 1.00 291.34 ? 288  PHE A O   1 
ATOM   1982  C CB  . PHE A 1 288 ? 127.525 151.237 145.098 1.00 290.75 ? 288  PHE A CB  1 
ATOM   1983  C CG  . PHE A 1 288 ? 128.084 150.809 146.402 1.00 279.42 ? 288  PHE A CG  1 
ATOM   1984  C CD1 . PHE A 1 288 ? 128.923 149.732 146.471 1.00 290.85 ? 288  PHE A CD1 1 
ATOM   1985  C CD2 . PHE A 1 288 ? 127.812 151.507 147.542 1.00 274.78 ? 288  PHE A CD2 1 
ATOM   1986  C CE1 . PHE A 1 288 ? 129.467 149.339 147.660 1.00 312.96 ? 288  PHE A CE1 1 
ATOM   1987  C CE2 . PHE A 1 288 ? 128.353 151.124 148.743 1.00 297.81 ? 288  PHE A CE2 1 
ATOM   1988  C CZ  . PHE A 1 288 ? 129.181 150.033 148.802 1.00 297.49 ? 288  PHE A CZ  1 
ATOM   1989  N N   . TRP A 1 289 ? 127.727 151.448 141.956 1.00 270.57 ? 289  TRP A N   1 
ATOM   1990  C CA  . TRP A 1 289 ? 127.613 151.886 140.589 1.00 297.97 ? 289  TRP A CA  1 
ATOM   1991  C C   . TRP A 1 289 ? 126.491 152.870 140.280 1.00 321.96 ? 289  TRP A C   1 
ATOM   1992  O O   . TRP A 1 289 ? 126.754 153.877 139.634 1.00 347.16 ? 289  TRP A O   1 
ATOM   1993  C CB  . TRP A 1 289 ? 127.537 150.677 139.651 1.00 282.51 ? 289  TRP A CB  1 
ATOM   1994  C CG  . TRP A 1 289 ? 127.203 151.017 138.248 1.00 285.31 ? 289  TRP A CG  1 
ATOM   1995  C CD1 . TRP A 1 289 ? 127.824 151.921 137.468 1.00 276.89 ? 289  TRP A CD1 1 
ATOM   1996  C CD2 . TRP A 1 289 ? 126.111 150.512 137.495 1.00 276.36 ? 289  TRP A CD2 1 
ATOM   1997  N NE1 . TRP A 1 289 ? 127.212 151.990 136.251 1.00 302.88 ? 289  TRP A NE1 1 
ATOM   1998  C CE2 . TRP A 1 289 ? 126.151 151.131 136.247 1.00 269.57 ? 289  TRP A CE2 1 
ATOM   1999  C CE3 . TRP A 1 289 ? 125.116 149.579 137.752 1.00 305.24 ? 289  TRP A CE3 1 
ATOM   2000  C CZ2 . TRP A 1 289 ? 125.237 150.854 135.264 1.00 301.39 ? 289  TRP A CZ2 1 
ATOM   2001  C CZ3 . TRP A 1 289 ? 124.217 149.307 136.783 1.00 326.90 ? 289  TRP A CZ3 1 
ATOM   2002  C CH2 . TRP A 1 289 ? 124.278 149.936 135.548 1.00 342.20 ? 289  TRP A CH2 1 
ATOM   2003  N N   . ASN A 1 290 ? 125.270 152.610 140.723 1.00 317.07 ? 290  ASN A N   1 
ATOM   2004  C CA  . ASN A 1 290 ? 124.186 153.526 140.385 1.00 312.81 ? 290  ASN A CA  1 
ATOM   2005  C C   . ASN A 1 290 ? 123.496 154.194 141.536 1.00 300.21 ? 290  ASN A C   1 
ATOM   2006  O O   . ASN A 1 290 ? 122.562 154.946 141.338 1.00 312.29 ? 290  ASN A O   1 
ATOM   2007  C CB  . ASN A 1 290 ? 123.176 152.891 139.453 1.00 346.80 ? 290  ASN A CB  1 
ATOM   2008  C CG  . ASN A 1 290 ? 122.895 153.763 138.262 1.00 374.64 ? 290  ASN A CG  1 
ATOM   2009  O OD1 . ASN A 1 290 ? 123.546 154.782 138.078 1.00 379.09 ? 290  ASN A OD1 1 
ATOM   2010  N ND2 . ASN A 1 290 ? 121.924 153.376 137.447 1.00 389.62 ? 290  ASN A ND2 1 
ATOM   2011  N N   . VAL A 1 291 ? 123.957 153.923 142.740 1.00 301.72 ? 291  VAL A N   1 
ATOM   2012  C CA  . VAL A 1 291 ? 123.397 154.584 143.886 1.00 292.79 ? 291  VAL A CA  1 
ATOM   2013  C C   . VAL A 1 291 ? 124.218 155.846 144.022 1.00 269.98 ? 291  VAL A C   1 
ATOM   2014  O O   . VAL A 1 291 ? 125.206 155.853 144.727 1.00 301.54 ? 291  VAL A O   1 
ATOM   2015  C CB  . VAL A 1 291 ? 123.520 153.717 145.141 1.00 316.03 ? 291  VAL A CB  1 
ATOM   2016  C CG1 . VAL A 1 291 ? 122.545 154.192 146.202 1.00 323.12 ? 291  VAL A CG1 1 
ATOM   2017  C CG2 . VAL A 1 291 ? 123.234 152.273 144.790 1.00 327.69 ? 291  VAL A CG2 1 
ATOM   2018  N N   . ALA A 1 292 ? 123.795 156.900 143.351 1.00 276.59 ? 292  ALA A N   1 
ATOM   2019  C CA  . ALA A 1 292 ? 124.425 158.204 143.435 1.00 277.95 ? 292  ALA A CA  1 
ATOM   2020  C C   . ALA A 1 292 ? 123.376 159.276 143.766 1.00 280.64 ? 292  ALA A C   1 
ATOM   2021  O O   . ALA A 1 292 ? 122.883 159.960 142.898 1.00 322.63 ? 292  ALA A O   1 
ATOM   2022  C CB  . ALA A 1 292 ? 125.155 158.516 142.140 1.00 287.53 ? 292  ALA A CB  1 
ATOM   2023  N N   . PRO A 1 293 ? 122.990 159.332 145.119 1.00 270.68 ? 293  PRO A N   1 
ATOM   2024  C CA  . PRO A 1 293 ? 121.809 160.178 145.361 1.00 291.87 ? 293  PRO A CA  1 
ATOM   2025  C C   . PRO A 1 293 ? 121.995 161.665 145.238 1.00 270.32 ? 293  PRO A C   1 
ATOM   2026  O O   . PRO A 1 293 ? 121.009 162.352 145.043 1.00 278.37 ? 293  PRO A O   1 
ATOM   2027  C CB  . PRO A 1 293 ? 121.340 159.772 146.748 1.00 309.16 ? 293  PRO A CB  1 
ATOM   2028  C CG  . PRO A 1 293 ? 122.570 159.468 147.470 1.00 311.15 ? 293  PRO A CG  1 
ATOM   2029  C CD  . PRO A 1 293 ? 123.420 158.763 146.493 1.00 304.37 ? 293  PRO A CD  1 
ATOM   2030  N N   . GLY A 1 294 ? 123.213 162.149 145.445 1.00 271.66 ? 294  GLY A N   1 
ATOM   2031  C CA  . GLY A 1 294 ? 123.620 163.471 145.019 1.00 267.05 ? 294  GLY A CA  1 
ATOM   2032  C C   . GLY A 1 294 ? 122.926 164.661 145.623 1.00 271.81 ? 294  GLY A C   1 
ATOM   2033  O O   . GLY A 1 294 ? 122.994 165.767 145.028 1.00 289.45 ? 294  GLY A O   1 
ATOM   2034  N N   . ALA A 1 295 ? 122.418 164.516 146.822 1.00 266.94 ? 295  ALA A N   1 
ATOM   2035  C CA  . ALA A 1 295 ? 121.581 165.550 147.442 1.00 279.59 ? 295  ALA A CA  1 
ATOM   2036  C C   . ALA A 1 295 ? 122.258 166.918 147.576 1.00 296.30 ? 295  ALA A C   1 
ATOM   2037  O O   . ALA A 1 295 ? 121.847 167.870 146.905 1.00 311.71 ? 295  ALA A O   1 
ATOM   2038  C CB  . ALA A 1 295 ? 121.057 165.078 148.784 1.00 284.92 ? 295  ALA A CB  1 
ATOM   2039  N N   . GLU A 1 296 ? 123.206 167.039 148.511 1.00 281.46 ? 296  GLU A N   1 
ATOM   2040  C CA  . GLU A 1 296 ? 124.057 168.236 148.667 1.00 303.34 ? 296  GLU A CA  1 
ATOM   2041  C C   . GLU A 1 296 ? 125.106 168.534 147.571 1.00 308.10 ? 296  GLU A C   1 
ATOM   2042  O O   . GLU A 1 296 ? 125.255 169.675 147.134 1.00 326.60 ? 296  GLU A O   1 
ATOM   2043  C CB  . GLU A 1 296 ? 124.742 168.215 150.037 1.00 307.97 ? 296  GLU A CB  1 
ATOM   2044  C CG  . GLU A 1 296 ? 124.592 169.507 150.825 1.00 368.11 ? 296  GLU A CG  1 
ATOM   2045  C CD  . GLU A 1 296 ? 125.727 170.479 150.572 1.00 400.18 ? 296  GLU A CD  1 
ATOM   2046  O OE1 . GLU A 1 296 ? 126.881 170.023 150.424 1.00 408.21 ? 296  GLU A OE1 1 
ATOM   2047  O OE2 . GLU A 1 296 ? 125.467 171.699 150.522 1.00 414.18 ? 296  GLU A OE2 1 
ATOM   2048  N N   . SER A 1 297 ? 125.822 167.495 147.143 1.00 303.25 ? 297  SER A N   1 
ATOM   2049  C CA  . SER A 1 297 ? 126.858 167.568 146.115 1.00 297.69 ? 297  SER A CA  1 
ATOM   2050  C C   . SER A 1 297 ? 126.369 168.133 144.787 1.00 302.20 ? 297  SER A C   1 
ATOM   2051  O O   . SER A 1 297 ? 127.043 168.978 144.190 1.00 331.29 ? 297  SER A O   1 
ATOM   2052  C CB  . SER A 1 297 ? 127.482 166.184 145.896 1.00 316.37 ? 297  SER A CB  1 
ATOM   2053  O OG  . SER A 1 297 ? 126.488 165.179 145.794 1.00 311.82 ? 297  SER A OG  1 
ATOM   2054  N N   . ALA A 1 298 ? 125.196 167.680 144.344 1.00 281.69 ? 298  ALA A N   1 
ATOM   2055  C CA  . ALA A 1 298 ? 124.673 168.031 143.016 1.00 291.30 ? 298  ALA A CA  1 
ATOM   2056  C C   . ALA A 1 298 ? 123.269 168.631 143.023 1.00 281.34 ? 298  ALA A C   1 
ATOM   2057  O O   . ALA A 1 298 ? 123.060 169.712 142.485 1.00 282.70 ? 298  ALA A O   1 
ATOM   2058  C CB  . ALA A 1 298 ? 124.705 166.802 142.108 1.00 297.03 ? 298  ALA A CB  1 
ATOM   2059  N N   . VAL A 1 299 ? 122.376 167.876 143.644 1.00 286.65 ? 299  VAL A N   1 
ATOM   2060  C CA  . VAL A 1 299 ? 120.982 168.186 143.656 1.00 288.51 ? 299  VAL A CA  1 
ATOM   2061  C C   . VAL A 1 299 ? 120.671 169.472 144.361 1.00 284.50 ? 299  VAL A C   1 
ATOM   2062  O O   . VAL A 1 299 ? 119.845 170.220 143.865 1.00 289.40 ? 299  VAL A O   1 
ATOM   2063  C CB  . VAL A 1 299 ? 120.175 167.072 144.308 1.00 298.60 ? 299  VAL A CB  1 
ATOM   2064  C CG1 . VAL A 1 299 ? 118.701 167.408 144.248 1.00 308.24 ? 299  VAL A CG1 1 
ATOM   2065  C CG2 . VAL A 1 299 ? 120.437 165.773 143.588 1.00 320.19 ? 299  VAL A CG2 1 
ATOM   2066  N N   . ALA A 1 300 ? 121.221 169.669 145.547 1.00 288.83 ? 300  ALA A N   1 
ATOM   2067  C CA  . ALA A 1 300 ? 120.976 170.906 146.241 1.00 286.32 ? 300  ALA A CA  1 
ATOM   2068  C C   . ALA A 1 300 ? 121.603 172.055 145.491 1.00 280.10 ? 300  ALA A C   1 
ATOM   2069  O O   . ALA A 1 300 ? 120.985 173.083 145.300 1.00 271.33 ? 300  ALA A O   1 
ATOM   2070  C CB  . ALA A 1 300 ? 121.529 170.832 147.642 1.00 289.99 ? 300  ALA A CB  1 
ATOM   2071  N N   . SER A 1 301 ? 122.840 171.879 145.063 1.00 281.39 ? 301  SER A N   1 
ATOM   2072  C CA  . SER A 1 301 ? 123.523 172.944 144.360 1.00 271.29 ? 301  SER A CA  1 
ATOM   2073  C C   . SER A 1 301 ? 122.951 173.265 142.997 1.00 260.76 ? 301  SER A C   1 
ATOM   2074  O O   . SER A 1 301 ? 122.814 174.415 142.656 1.00 300.28 ? 301  SER A O   1 
ATOM   2075  C CB  . SER A 1 301 ? 125.012 172.650 144.259 1.00 312.08 ? 301  SER A CB  1 
ATOM   2076  O OG  . SER A 1 301 ? 125.314 171.958 143.068 1.00 344.10 ? 301  SER A OG  1 
ATOM   2077  N N   . PHE A 1 302 ? 122.656 172.254 142.193 1.00 273.77 ? 302  PHE A N   1 
ATOM   2078  C CA  . PHE A 1 302 ? 121.995 172.514 140.915 1.00 280.32 ? 302  PHE A CA  1 
ATOM   2079  C C   . PHE A 1 302 ? 120.541 172.948 140.970 1.00 283.15 ? 302  PHE A C   1 
ATOM   2080  O O   . PHE A 1 302 ? 120.121 173.795 140.198 1.00 298.83 ? 302  PHE A O   1 
ATOM   2081  C CB  . PHE A 1 302 ? 122.306 171.485 139.835 1.00 287.23 ? 302  PHE A CB  1 
ATOM   2082  C CG  . PHE A 1 302 ? 121.449 170.273 139.864 1.00 318.29 ? 302  PHE A CG  1 
ATOM   2083  C CD1 . PHE A 1 302 ? 120.107 170.357 139.622 1.00 323.20 ? 302  PHE A CD1 1 
ATOM   2084  C CD2 . PHE A 1 302 ? 122.011 169.034 140.079 1.00 342.18 ? 302  PHE A CD2 1 
ATOM   2085  C CE1 . PHE A 1 302 ? 119.331 169.221 139.621 1.00 320.42 ? 302  PHE A CE1 1 
ATOM   2086  C CE2 . PHE A 1 302 ? 121.245 167.897 140.083 1.00 351.95 ? 302  PHE A CE2 1 
ATOM   2087  C CZ  . PHE A 1 302 ? 119.903 167.990 139.855 1.00 338.38 ? 302  PHE A CZ  1 
ATOM   2088  N N   . VAL A 1 303 ? 119.775 172.387 141.892 1.00 281.01 ? 303  VAL A N   1 
ATOM   2089  C CA  . VAL A 1 303 ? 118.381 172.767 141.996 1.00 282.32 ? 303  VAL A CA  1 
ATOM   2090  C C   . VAL A 1 303 ? 118.265 174.242 142.312 1.00 275.45 ? 303  VAL A C   1 
ATOM   2091  O O   . VAL A 1 303 ? 117.428 174.923 141.748 1.00 314.65 ? 303  VAL A O   1 
ATOM   2092  C CB  . VAL A 1 303 ? 117.662 172.005 143.099 1.00 300.80 ? 303  VAL A CB  1 
ATOM   2093  C CG1 . VAL A 1 303 ? 116.218 172.444 143.165 1.00 318.14 ? 303  VAL A CG1 1 
ATOM   2094  C CG2 . VAL A 1 303 ? 117.751 170.516 142.853 1.00 294.15 ? 303  VAL A CG2 1 
ATOM   2095  N N   . THR A 1 304 ? 119.107 174.752 143.199 1.00 270.42 ? 304  THR A N   1 
ATOM   2096  C CA  . THR A 1 304 ? 119.064 176.175 143.490 1.00 296.36 ? 304  THR A CA  1 
ATOM   2097  C C   . THR A 1 304 ? 119.400 176.904 142.214 1.00 290.20 ? 304  THR A C   1 
ATOM   2098  O O   . THR A 1 304 ? 118.791 177.903 141.871 1.00 314.56 ? 304  THR A O   1 
ATOM   2099  C CB  . THR A 1 304 ? 120.019 176.586 144.616 1.00 297.51 ? 304  THR A CB  1 
ATOM   2100  O OG1 . THR A 1 304 ? 121.330 176.801 144.097 1.00 336.31 ? 304  THR A OG1 1 
ATOM   2101  C CG2 . THR A 1 304 ? 120.076 175.517 145.672 1.00 323.40 ? 304  THR A CG2 1 
ATOM   2102  N N   . GLN A 1 305 ? 120.371 176.369 141.497 1.00 281.14 ? 305  GLN A N   1 
ATOM   2103  C CA  . GLN A 1 305 ? 120.879 177.012 140.306 1.00 285.57 ? 305  GLN A CA  1 
ATOM   2104  C C   . GLN A 1 305 ? 119.738 177.106 139.332 1.00 301.13 ? 305  GLN A C   1 
ATOM   2105  O O   . GLN A 1 305 ? 119.610 178.061 138.595 1.00 339.61 ? 305  GLN A O   1 
ATOM   2106  C CB  . GLN A 1 305 ? 122.048 176.190 139.754 1.00 301.52 ? 305  GLN A CB  1 
ATOM   2107  C CG  . GLN A 1 305 ? 122.170 176.090 138.249 1.00 306.34 ? 305  GLN A CG  1 
ATOM   2108  C CD  . GLN A 1 305 ? 122.666 177.365 137.647 1.00 315.62 ? 305  GLN A CD  1 
ATOM   2109  O OE1 . GLN A 1 305 ? 121.936 178.339 137.580 1.00 318.56 ? 305  GLN A OE1 1 
ATOM   2110  N NE2 . GLN A 1 305 ? 123.915 177.375 137.216 1.00 314.89 ? 305  GLN A NE2 1 
ATOM   2111  N N   . LEU A 1 306 ? 118.993 176.012 139.303 1.00 288.09 ? 306  LEU A N   1 
ATOM   2112  C CA  . LEU A 1 306 ? 117.828 175.797 138.465 1.00 278.27 ? 306  LEU A CA  1 
ATOM   2113  C C   . LEU A 1 306 ? 116.656 176.685 138.798 1.00 301.94 ? 306  LEU A C   1 
ATOM   2114  O O   . LEU A 1 306 ? 115.954 177.140 137.913 1.00 326.93 ? 306  LEU A O   1 
ATOM   2115  C CB  . LEU A 1 306 ? 117.399 174.340 138.563 1.00 287.84 ? 306  LEU A CB  1 
ATOM   2116  C CG  . LEU A 1 306 ? 117.067 173.734 137.216 1.00 291.13 ? 306  LEU A CG  1 
ATOM   2117  C CD1 . LEU A 1 306 ? 116.571 172.313 137.382 1.00 274.46 ? 306  LEU A CD1 1 
ATOM   2118  C CD2 . LEU A 1 306 ? 115.993 174.612 136.625 1.00 305.46 ? 306  LEU A CD2 1 
ATOM   2119  N N   . ALA A 1 307 ? 116.440 176.905 140.086 1.00 282.39 ? 307  ALA A N   1 
ATOM   2120  C CA  . ALA A 1 307 ? 115.341 177.731 140.556 1.00 298.74 ? 307  ALA A CA  1 
ATOM   2121  C C   . ALA A 1 307 ? 115.520 179.137 140.039 1.00 298.92 ? 307  ALA A C   1 
ATOM   2122  O O   . ALA A 1 307 ? 114.554 179.814 139.714 1.00 319.90 ? 307  ALA A O   1 
ATOM   2123  C CB  . ALA A 1 307 ? 115.270 177.729 142.067 1.00 305.00 ? 307  ALA A CB  1 
ATOM   2124  N N   . ALA A 1 308 ? 116.767 179.572 139.962 1.00 274.71 ? 308  ALA A N   1 
ATOM   2125  C CA  . ALA A 1 308 ? 117.081 180.944 139.624 1.00 305.80 ? 308  ALA A CA  1 
ATOM   2126  C C   . ALA A 1 308 ? 116.535 181.328 138.259 1.00 306.73 ? 308  ALA A C   1 
ATOM   2127  O O   . ALA A 1 308 ? 116.055 182.443 138.079 1.00 313.16 ? 308  ALA A O   1 
ATOM   2128  C CB  . ALA A 1 308 ? 118.579 181.158 139.661 1.00 315.20 ? 308  ALA A CB  1 
ATOM   2129  N N   . ALA A 1 309 ? 116.589 180.420 137.297 1.00 288.60 ? 309  ALA A N   1 
ATOM   2130  C CA  . ALA A 1 309 ? 116.157 180.758 135.951 1.00 297.75 ? 309  ALA A CA  1 
ATOM   2131  C C   . ALA A 1 309 ? 114.685 181.160 135.920 1.00 323.66 ? 309  ALA A C   1 
ATOM   2132  O O   . ALA A 1 309 ? 114.301 182.137 135.279 1.00 357.83 ? 309  ALA A O   1 
ATOM   2133  C CB  . ALA A 1 309 ? 116.392 179.583 135.032 1.00 321.85 ? 309  ALA A CB  1 
ATOM   2134  N N   . GLU A 1 310 ? 113.870 180.422 136.647 1.00 305.80 ? 310  GLU A N   1 
ATOM   2135  C CA  . GLU A 1 310 ? 112.424 180.653 136.709 1.00 320.00 ? 310  GLU A CA  1 
ATOM   2136  C C   . GLU A 1 310 ? 112.143 182.113 137.074 1.00 316.91 ? 310  GLU A C   1 
ATOM   2137  O O   . GLU A 1 310 ? 111.313 182.786 136.443 1.00 332.42 ? 310  GLU A O   1 
ATOM   2138  C CB  . GLU A 1 310 ? 111.770 179.684 137.718 1.00 340.52 ? 310  GLU A CB  1 
ATOM   2139  C CG  . GLU A 1 310 ? 110.346 180.002 138.192 1.00 376.45 ? 310  GLU A CG  1 
ATOM   2140  C CD  . GLU A 1 310 ? 109.283 179.950 137.100 1.00 392.90 ? 310  GLU A CD  1 
ATOM   2141  O OE1 . GLU A 1 310 ? 109.574 179.508 135.971 1.00 377.03 ? 310  GLU A OE1 1 
ATOM   2142  O OE2 . GLU A 1 310 ? 108.132 180.347 137.382 1.00 393.99 ? 310  GLU A OE2 1 
ATOM   2143  N N   . ALA A 1 311 ? 112.806 182.536 138.144 1.00 299.66 ? 311  ALA A N   1 
ATOM   2144  C CA  . ALA A 1 311 ? 112.705 183.881 138.661 1.00 319.53 ? 311  ALA A CA  1 
ATOM   2145  C C   . ALA A 1 311 ? 113.240 184.890 137.677 1.00 320.29 ? 311  ALA A C   1 
ATOM   2146  O O   . ALA A 1 311 ? 112.651 185.940 137.479 1.00 347.40 ? 311  ALA A O   1 
ATOM   2147  C CB  . ALA A 1 311 ? 113.456 183.987 139.972 1.00 336.78 ? 311  ALA A CB  1 
ATOM   2148  N N   . LEU A 1 312 ? 114.367 184.580 137.061 1.00 286.99 ? 312  LEU A N   1 
ATOM   2149  C CA  . LEU A 1 312 ? 114.925 185.491 136.087 1.00 301.21 ? 312  LEU A CA  1 
ATOM   2150  C C   . LEU A 1 312 ? 114.007 185.639 134.887 1.00 314.95 ? 312  LEU A C   1 
ATOM   2151  O O   . LEU A 1 312 ? 113.784 186.736 134.409 1.00 356.08 ? 312  LEU A O   1 
ATOM   2152  C CB  . LEU A 1 312 ? 116.298 185.021 135.649 1.00 299.53 ? 312  LEU A CB  1 
ATOM   2153  C CG  . LEU A 1 312 ? 117.335 186.129 135.684 1.00 317.94 ? 312  LEU A CG  1 
ATOM   2154  C CD1 . LEU A 1 312 ? 118.692 185.523 135.962 1.00 330.09 ? 312  LEU A CD1 1 
ATOM   2155  C CD2 . LEU A 1 312 ? 117.355 186.865 134.360 1.00 345.74 ? 312  LEU A CD2 1 
ATOM   2156  N N   . GLN A 1 313 ? 113.452 184.537 134.409 1.00 309.51 ? 313  GLN A N   1 
ATOM   2157  C CA  . GLN A 1 313 ? 112.599 184.602 133.237 1.00 329.47 ? 313  GLN A CA  1 
ATOM   2158  C C   . GLN A 1 313 ? 111.381 185.444 133.534 1.00 339.22 ? 313  GLN A C   1 
ATOM   2159  O O   . GLN A 1 313 ? 110.949 186.254 132.725 1.00 336.63 ? 313  GLN A O   1 
ATOM   2160  C CB  . GLN A 1 313 ? 112.143 183.210 132.833 1.00 337.13 ? 313  GLN A CB  1 
ATOM   2161  C CG  . GLN A 1 313 ? 111.917 183.064 131.340 1.00 351.99 ? 313  GLN A CG  1 
ATOM   2162  C CD  . GLN A 1 313 ? 113.178 183.280 130.526 1.00 353.74 ? 313  GLN A CD  1 
ATOM   2163  O OE1 . GLN A 1 313 ? 113.125 183.408 129.306 1.00 365.77 ? 313  GLN A OE1 1 
ATOM   2164  N NE2 . GLN A 1 313 ? 114.319 183.318 131.195 1.00 345.86 ? 313  GLN A NE2 1 
ATOM   2165  N N   . LYS A 1 314 ? 110.838 185.244 134.722 1.00 350.87 ? 314  LYS A N   1 
ATOM   2166  C CA  . LYS A 1 314 ? 109.589 185.908 135.148 1.00 368.39 ? 314  LYS A CA  1 
ATOM   2167  C C   . LYS A 1 314 ? 109.698 187.431 135.362 1.00 372.51 ? 314  LYS A C   1 
ATOM   2168  O O   . LYS A 1 314 ? 108.669 188.100 135.508 1.00 384.43 ? 314  LYS A O   1 
ATOM   2169  C CB  . LYS A 1 314 ? 109.000 185.246 136.409 1.00 362.81 ? 314  LYS A CB  1 
ATOM   2170  C CG  . LYS A 1 314 ? 108.209 183.974 136.138 1.00 362.80 ? 314  LYS A CG  1 
ATOM   2171  C CD  . LYS A 1 314 ? 107.318 183.594 137.313 1.00 363.68 ? 314  LYS A CD  1 
ATOM   2172  C CE  . LYS A 1 314 ? 108.113 183.313 138.578 1.00 365.26 ? 314  LYS A CE  1 
ATOM   2173  N NZ  . LYS A 1 314 ? 107.298 182.586 139.589 1.00 383.00 ? 314  LYS A NZ  1 
ATOM   2174  N N   . ALA A 1 315 ? 110.918 187.974 135.396 1.00 351.00 ? 315  ALA A N   1 
ATOM   2175  C CA  . ALA A 1 315 ? 111.119 189.426 135.327 1.00 360.72 ? 315  ALA A CA  1 
ATOM   2176  C C   . ALA A 1 315 ? 110.606 189.977 133.986 1.00 364.61 ? 315  ALA A C   1 
ATOM   2177  O O   . ALA A 1 315 ? 110.742 189.310 132.957 1.00 337.31 ? 315  ALA A O   1 
ATOM   2178  C CB  . ALA A 1 315 ? 112.588 189.781 135.515 1.00 352.77 ? 315  ALA A CB  1 
ATOM   2179  N N   . PRO A 1 316 ? 110.011 191.188 133.995 1.00 388.34 ? 316  PRO A N   1 
ATOM   2180  C CA  . PRO A 1 316 ? 109.416 191.733 132.771 1.00 397.40 ? 316  PRO A CA  1 
ATOM   2181  C C   . PRO A 1 316 ? 110.432 192.244 131.743 1.00 401.36 ? 316  PRO A C   1 
ATOM   2182  O O   . PRO A 1 316 ? 110.264 191.988 130.548 1.00 401.04 ? 316  PRO A O   1 
ATOM   2183  C CB  . PRO A 1 316 ? 108.541 192.879 133.289 1.00 400.99 ? 316  PRO A CB  1 
ATOM   2184  C CG  . PRO A 1 316 ? 109.217 193.332 134.532 1.00 396.61 ? 316  PRO A CG  1 
ATOM   2185  C CD  . PRO A 1 316 ? 109.856 192.113 135.136 1.00 391.85 ? 316  PRO A CD  1 
ATOM   2186  N N   . ASP A 1 317 ? 111.479 192.933 132.203 1.00 401.56 ? 317  ASP A N   1 
ATOM   2187  C CA  . ASP A 1 317 ? 112.422 193.631 131.319 1.00 413.88 ? 317  ASP A CA  1 
ATOM   2188  C C   . ASP A 1 317 ? 113.604 192.730 130.926 1.00 403.38 ? 317  ASP A C   1 
ATOM   2189  O O   . ASP A 1 317 ? 114.773 193.078 131.127 1.00 403.55 ? 317  ASP A O   1 
ATOM   2190  C CB  . ASP A 1 317 ? 112.900 194.923 132.001 1.00 441.09 ? 317  ASP A CB  1 
ATOM   2191  C CG  . ASP A 1 317 ? 113.497 195.922 131.024 1.00 463.54 ? 317  ASP A CG  1 
ATOM   2192  O OD1 . ASP A 1 317 ? 112.757 196.410 130.144 1.00 463.14 ? 317  ASP A OD1 1 
ATOM   2193  O OD2 . ASP A 1 317 ? 114.702 196.230 131.147 1.00 478.07 ? 317  ASP A OD2 1 
ATOM   2194  N N   . VAL A 1 318 ? 113.280 191.578 130.341 1.00 393.62 ? 318  VAL A N   1 
ATOM   2195  C CA  . VAL A 1 318 ? 114.271 190.571 129.949 1.00 389.39 ? 318  VAL A CA  1 
ATOM   2196  C C   . VAL A 1 318 ? 114.805 190.869 128.548 1.00 390.69 ? 318  VAL A C   1 
ATOM   2197  O O   . VAL A 1 318 ? 116.016 190.839 128.329 1.00 399.80 ? 318  VAL A O   1 
ATOM   2198  C CB  . VAL A 1 318 ? 113.674 189.139 130.021 1.00 382.18 ? 318  VAL A CB  1 
ATOM   2199  C CG1 . VAL A 1 318 ? 114.519 188.124 129.256 1.00 384.99 ? 318  VAL A CG1 1 
ATOM   2200  C CG2 . VAL A 1 318 ? 113.517 188.709 131.475 1.00 373.09 ? 318  VAL A CG2 1 
ATOM   2201  N N   . THR A 1 319 ? 113.896 191.142 127.613 1.00 395.31 ? 319  THR A N   1 
ATOM   2202  C CA  . THR A 1 319 ? 114.252 191.371 126.207 1.00 407.14 ? 319  THR A CA  1 
ATOM   2203  C C   . THR A 1 319 ? 115.213 192.547 126.010 1.00 399.27 ? 319  THR A C   1 
ATOM   2204  O O   . THR A 1 319 ? 116.115 192.473 125.173 1.00 381.91 ? 319  THR A O   1 
ATOM   2205  C CB  . THR A 1 319 ? 112.996 191.598 125.336 1.00 427.67 ? 319  THR A CB  1 
ATOM   2206  O OG1 . THR A 1 319 ? 112.161 192.595 125.939 1.00 437.34 ? 319  THR A OG1 1 
ATOM   2207  C CG2 . THR A 1 319 ? 112.206 190.302 125.180 1.00 430.96 ? 319  THR A CG2 1 
ATOM   2208  N N   . THR A 1 320 ? 115.011 193.618 126.780 1.00 410.12 ? 320  THR A N   1 
ATOM   2209  C CA  . THR A 1 320 ? 115.874 194.800 126.737 1.00 418.77 ? 320  THR A CA  1 
ATOM   2210  C C   . THR A 1 320 ? 116.867 194.802 127.902 1.00 411.76 ? 320  THR A C   1 
ATOM   2211  O O   . THR A 1 320 ? 116.610 195.388 128.958 1.00 417.39 ? 320  THR A O   1 
ATOM   2212  C CB  . THR A 1 320 ? 115.048 196.104 126.749 1.00 434.70 ? 320  THR A CB  1 
ATOM   2213  O OG1 . THR A 1 320 ? 114.162 196.106 127.875 1.00 451.03 ? 320  THR A OG1 1 
ATOM   2214  C CG2 . THR A 1 320 ? 114.235 196.236 125.468 1.00 429.96 ? 320  THR A CG2 1 
ATOM   2215  N N   . LEU A 1 321 ? 117.990 194.116 127.693 1.00 394.52 ? 321  LEU A N   1 
ATOM   2216  C CA  . LEU A 1 321 ? 119.158 194.172 128.582 1.00 371.47 ? 321  LEU A CA  1 
ATOM   2217  C C   . LEU A 1 321 ? 120.420 194.283 127.726 1.00 357.92 ? 321  LEU A C   1 
ATOM   2218  O O   . LEU A 1 321 ? 120.387 193.937 126.540 1.00 358.67 ? 321  LEU A O   1 
ATOM   2219  C CB  . LEU A 1 321 ? 119.248 192.921 129.457 1.00 358.91 ? 321  LEU A CB  1 
ATOM   2220  C CG  . LEU A 1 321 ? 118.092 192.645 130.423 1.00 369.59 ? 321  LEU A CG  1 
ATOM   2221  C CD1 . LEU A 1 321 ? 118.179 191.235 130.993 1.00 348.64 ? 321  LEU A CD1 1 
ATOM   2222  C CD2 . LEU A 1 321 ? 118.074 193.674 131.544 1.00 376.61 ? 321  LEU A CD2 1 
ATOM   2223  N N   . PRO A 1 322 ? 121.530 194.782 128.306 1.00 364.05 ? 322  PRO A N   1 
ATOM   2224  C CA  . PRO A 1 322 ? 122.798 194.727 127.566 1.00 376.52 ? 322  PRO A CA  1 
ATOM   2225  C C   . PRO A 1 322 ? 123.353 193.307 127.426 1.00 365.82 ? 322  PRO A C   1 
ATOM   2226  O O   . PRO A 1 322 ? 123.597 192.850 126.304 1.00 359.41 ? 322  PRO A O   1 
ATOM   2227  C CB  . PRO A 1 322 ? 123.749 195.611 128.394 1.00 391.62 ? 322  PRO A CB  1 
ATOM   2228  C CG  . PRO A 1 322 ? 123.062 195.869 129.689 1.00 385.10 ? 322  PRO A CG  1 
ATOM   2229  C CD  . PRO A 1 322 ? 121.594 195.733 129.429 1.00 380.17 ? 322  PRO A CD  1 
ATOM   2230  N N   . ARG A 1 323 ? 123.534 192.625 128.555 1.00 347.92 ? 323  ARG A N   1 
ATOM   2231  C CA  . ARG A 1 323 ? 124.135 191.289 128.576 1.00 347.92 ? 323  ARG A CA  1 
ATOM   2232  C C   . ARG A 1 323 ? 123.075 190.208 128.734 1.00 325.17 ? 323  ARG A C   1 
ATOM   2233  O O   . ARG A 1 323 ? 121.959 190.476 129.181 1.00 320.72 ? 323  ARG A O   1 
ATOM   2234  C CB  . ARG A 1 323 ? 125.162 191.180 129.704 1.00 365.61 ? 323  ARG A CB  1 
ATOM   2235  C CG  . ARG A 1 323 ? 126.242 192.254 129.683 1.00 367.62 ? 323  ARG A CG  1 
ATOM   2236  C CD  . ARG A 1 323 ? 127.097 192.213 130.940 1.00 373.70 ? 323  ARG A CD  1 
ATOM   2237  N NE  . ARG A 1 323 ? 127.690 193.514 131.250 1.00 388.09 ? 323  ARG A NE  1 
ATOM   2238  C CZ  . ARG A 1 323 ? 127.035 194.564 131.755 1.00 386.10 ? 323  ARG A CZ  1 
ATOM   2239  N NH1 . ARG A 1 323 ? 125.726 194.509 132.014 1.00 372.65 ? 323  ARG A NH1 1 
ATOM   2240  N NH2 . ARG A 1 323 ? 127.697 195.694 131.995 1.00 400.02 ? 323  ARG A NH2 1 
ATOM   2241  N N   . ASN A 1 324 ? 123.344 189.075 128.123 1.00 322.87 ? 324  ASN A N   1 
ATOM   2242  C CA  . ASN A 1 324 ? 122.425 187.975 128.166 1.00 310.60 ? 324  ASN A CA  1 
ATOM   2243  C C   . ASN A 1 324 ? 122.830 187.218 129.375 1.00 296.58 ? 324  ASN A C   1 
ATOM   2244  O O   . ASN A 1 324 ? 123.815 187.569 129.961 1.00 304.60 ? 324  ASN A O   1 
ATOM   2245  C CB  . ASN A 1 324 ? 122.551 187.114 126.937 1.00 317.28 ? 324  ASN A CB  1 
ATOM   2246  C CG  . ASN A 1 324 ? 121.555 186.004 126.945 1.00 325.62 ? 324  ASN A CG  1 
ATOM   2247  O OD1 . ASN A 1 324 ? 121.293 185.432 127.996 1.00 297.71 ? 324  ASN A OD1 1 
ATOM   2248  N ND2 . ASN A 1 324 ? 120.964 185.711 125.796 1.00 331.61 ? 324  ASN A ND2 1 
ATOM   2249  N N   . VAL A 1 325 ? 122.054 186.240 129.806 1.00 310.09 ? 325  VAL A N   1 
ATOM   2250  C CA  . VAL A 1 325 ? 122.497 185.365 130.879 1.00 317.67 ? 325  VAL A CA  1 
ATOM   2251  C C   . VAL A 1 325 ? 122.351 183.969 130.352 1.00 295.10 ? 325  VAL A C   1 
ATOM   2252  O O   . VAL A 1 325 ? 121.317 183.657 129.838 1.00 301.64 ? 325  VAL A O   1 
ATOM   2253  C CB  . VAL A 1 325 ? 121.605 185.500 132.110 1.00 331.16 ? 325  VAL A CB  1 
ATOM   2254  C CG1 . VAL A 1 325 ? 121.962 184.453 133.139 1.00 325.56 ? 325  VAL A CG1 1 
ATOM   2255  C CG2 . VAL A 1 325 ? 121.737 186.883 132.704 1.00 347.44 ? 325  VAL A CG2 1 
ATOM   2256  N N   . MET A 1 326 ? 123.362 183.126 130.471 1.00 298.23 ? 326  MET A N   1 
ATOM   2257  C CA  . MET A 1 326 ? 123.221 181.754 130.010 1.00 293.66 ? 326  MET A CA  1 
ATOM   2258  C C   . MET A 1 326 ? 123.403 180.846 131.198 1.00 282.48 ? 326  MET A C   1 
ATOM   2259  O O   . MET A 1 326 ? 124.337 181.025 131.934 1.00 299.66 ? 326  MET A O   1 
ATOM   2260  C CB  . MET A 1 326 ? 124.211 181.443 128.881 1.00 313.87 ? 326  MET A CB  1 
ATOM   2261  C CG  . MET A 1 326 ? 125.522 180.806 129.293 1.00 316.71 ? 326  MET A CG  1 
ATOM   2262  S SD  . MET A 1 326 ? 125.781 179.218 128.499 1.00 297.42 ? 326  MET A SD  1 
ATOM   2263  C CE  . MET A 1 326 ? 127.564 179.154 128.444 1.00 308.92 ? 326  MET A CE  1 
ATOM   2264  N N   . PHE A 1 327 ? 122.510 179.887 131.382 1.00 270.59 ? 327  PHE A N   1 
ATOM   2265  C CA  . PHE A 1 327 ? 122.543 179.013 132.532 1.00 279.93 ? 327  PHE A CA  1 
ATOM   2266  C C   . PHE A 1 327 ? 123.019 177.682 132.066 1.00 298.02 ? 327  PHE A C   1 
ATOM   2267  O O   . PHE A 1 327 ? 122.554 177.212 131.058 1.00 317.13 ? 327  PHE A O   1 
ATOM   2268  C CB  . PHE A 1 327 ? 121.135 178.770 133.057 1.00 284.35 ? 327  PHE A CB  1 
ATOM   2269  C CG  . PHE A 1 327 ? 120.450 179.986 133.570 1.00 292.58 ? 327  PHE A CG  1 
ATOM   2270  C CD1 . PHE A 1 327 ? 120.617 180.385 134.867 1.00 305.38 ? 327  PHE A CD1 1 
ATOM   2271  C CD2 . PHE A 1 327 ? 119.612 180.707 132.759 1.00 329.90 ? 327  PHE A CD2 1 
ATOM   2272  C CE1 . PHE A 1 327 ? 119.985 181.502 135.346 1.00 304.07 ? 327  PHE A CE1 1 
ATOM   2273  C CE2 . PHE A 1 327 ? 118.967 181.827 133.226 1.00 320.89 ? 327  PHE A CE2 1 
ATOM   2274  C CZ  . PHE A 1 327 ? 119.155 182.225 134.525 1.00 316.16 ? 327  PHE A CZ  1 
ATOM   2275  N N   . VAL A 1 328 ? 123.917 177.049 132.799 1.00 283.99 ? 328  VAL A N   1 
ATOM   2276  C CA  . VAL A 1 328 ? 124.467 175.803 132.330 1.00 274.10 ? 328  VAL A CA  1 
ATOM   2277  C C   . VAL A 1 328 ? 124.397 174.725 133.362 1.00 257.75 ? 328  VAL A C   1 
ATOM   2278  O O   . VAL A 1 328 ? 124.372 174.962 134.541 1.00 304.73 ? 328  VAL A O   1 
ATOM   2279  C CB  . VAL A 1 328 ? 125.900 176.006 131.872 1.00 290.90 ? 328  VAL A CB  1 
ATOM   2280  C CG1 . VAL A 1 328 ? 126.712 176.560 133.019 1.00 312.63 ? 328  VAL A CG1 1 
ATOM   2281  C CG2 . VAL A 1 328 ? 126.475 174.705 131.378 1.00 290.21 ? 328  VAL A CG2 1 
ATOM   2282  N N   . PHE A 1 329 ? 124.319 173.501 132.933 1.00 263.47 ? 329  PHE A N   1 
ATOM   2283  C CA  . PHE A 1 329 ? 124.318 172.456 133.938 1.00 274.03 ? 329  PHE A CA  1 
ATOM   2284  C C   . PHE A 1 329 ? 125.305 171.405 133.472 1.00 273.32 ? 329  PHE A C   1 
ATOM   2285  O O   . PHE A 1 329 ? 125.031 170.643 132.547 1.00 281.95 ? 329  PHE A O   1 
ATOM   2286  C CB  . PHE A 1 329 ? 122.925 171.871 134.114 1.00 270.17 ? 329  PHE A CB  1 
ATOM   2287  C CG  . PHE A 1 329 ? 121.896 172.871 134.587 1.00 286.62 ? 329  PHE A CG  1 
ATOM   2288  C CD1 . PHE A 1 329 ? 121.493 173.936 133.776 1.00 297.46 ? 329  PHE A CD1 1 
ATOM   2289  C CD2 . PHE A 1 329 ? 121.314 172.742 135.841 1.00 278.92 ? 329  PHE A CD2 1 
ATOM   2290  C CE1 . PHE A 1 329 ? 120.549 174.846 134.211 1.00 300.12 ? 329  PHE A CE1 1 
ATOM   2291  C CE2 . PHE A 1 329 ? 120.365 173.647 136.277 1.00 288.94 ? 329  PHE A CE2 1 
ATOM   2292  C CZ  . PHE A 1 329 ? 119.982 174.699 135.463 1.00 307.64 ? 329  PHE A CZ  1 
ATOM   2293  N N   . PHE A 1 330 ? 126.468 171.402 134.113 1.00 276.04 ? 330  PHE A N   1 
ATOM   2294  C CA  . PHE A 1 330 ? 127.576 170.558 133.723 1.00 274.35 ? 330  PHE A CA  1 
ATOM   2295  C C   . PHE A 1 330 ? 127.415 169.155 134.281 1.00 282.22 ? 330  PHE A C   1 
ATOM   2296  O O   . PHE A 1 330 ? 127.621 168.911 135.473 1.00 321.31 ? 330  PHE A O   1 
ATOM   2297  C CB  . PHE A 1 330 ? 128.880 171.175 134.195 1.00 302.68 ? 330  PHE A CB  1 
ATOM   2298  C CG  . PHE A 1 330 ? 129.200 172.470 133.523 1.00 295.64 ? 330  PHE A CG  1 
ATOM   2299  C CD1 . PHE A 1 330 ? 129.669 172.475 132.226 1.00 288.78 ? 330  PHE A CD1 1 
ATOM   2300  C CD2 . PHE A 1 330 ? 129.025 173.680 134.173 1.00 299.64 ? 330  PHE A CD2 1 
ATOM   2301  C CE1 . PHE A 1 330 ? 129.975 173.656 131.592 1.00 306.35 ? 330  PHE A CE1 1 
ATOM   2302  C CE2 . PHE A 1 330 ? 129.329 174.868 133.533 1.00 295.65 ? 330  PHE A CE2 1 
ATOM   2303  C CZ  . PHE A 1 330 ? 129.809 174.856 132.245 1.00 301.83 ? 330  PHE A CZ  1 
ATOM   2304  N N   . GLN A 1 331 ? 127.011 168.247 133.404 1.00 296.64 ? 331  GLN A N   1 
ATOM   2305  C CA  . GLN A 1 331 ? 126.846 166.846 133.731 1.00 296.18 ? 331  GLN A CA  1 
ATOM   2306  C C   . GLN A 1 331 ? 128.216 166.197 133.525 1.00 276.56 ? 331  GLN A C   1 
ATOM   2307  O O   . GLN A 1 331 ? 128.603 165.883 132.400 1.00 280.08 ? 331  GLN A O   1 
ATOM   2308  C CB  . GLN A 1 331 ? 125.757 166.245 132.826 1.00 293.21 ? 331  GLN A CB  1 
ATOM   2309  C CG  . GLN A 1 331 ? 125.299 164.840 133.171 1.00 292.43 ? 331  GLN A CG  1 
ATOM   2310  C CD  . GLN A 1 331 ? 124.266 164.769 134.272 1.00 323.47 ? 331  GLN A CD  1 
ATOM   2311  O OE1 . GLN A 1 331 ? 124.521 164.216 135.342 1.00 341.30 ? 331  GLN A OE1 1 
ATOM   2312  N NE2 . GLN A 1 331 ? 123.076 165.295 134.002 1.00 331.49 ? 331  GLN A NE2 1 
ATOM   2313  N N   . GLY A 1 332 ? 128.955 166.042 134.619 1.00 265.27 ? 332  GLY A N   1 
ATOM   2314  C CA  . GLY A 1 332 ? 130.301 165.461 134.582 1.00 291.58 ? 332  GLY A CA  1 
ATOM   2315  C C   . GLY A 1 332 ? 131.193 165.682 135.796 1.00 282.84 ? 332  GLY A C   1 
ATOM   2316  O O   . GLY A 1 332 ? 131.929 164.785 136.203 1.00 286.16 ? 332  GLY A O   1 
ATOM   2317  N N   . GLU A 1 333 ? 131.120 166.889 136.347 1.00 267.58 ? 333  GLU A N   1 
ATOM   2318  C CA  . GLU A 1 333 ? 131.987 167.395 137.420 1.00 280.96 ? 333  GLU A CA  1 
ATOM   2319  C C   . GLU A 1 333 ? 132.539 166.458 138.505 1.00 282.88 ? 333  GLU A C   1 
ATOM   2320  O O   . GLU A 1 333 ? 133.628 166.720 139.018 1.00 309.53 ? 333  GLU A O   1 
ATOM   2321  C CB  . GLU A 1 333 ? 131.279 168.577 138.119 1.00 329.27 ? 333  GLU A CB  1 
ATOM   2322  C CG  . GLU A 1 333 ? 131.681 169.971 137.650 1.00 347.05 ? 333  GLU A CG  1 
ATOM   2323  C CD  . GLU A 1 333 ? 131.698 170.162 136.142 1.00 352.17 ? 333  GLU A CD  1 
ATOM   2324  O OE1 . GLU A 1 333 ? 131.213 169.296 135.386 1.00 359.50 ? 333  GLU A OE1 1 
ATOM   2325  O OE2 . GLU A 1 333 ? 132.213 171.206 135.716 1.00 360.06 ? 333  GLU A OE2 1 
ATOM   2326  N N   . THR A 1 334 ? 131.813 165.409 138.887 1.00 279.90 ? 334  THR A N   1 
ATOM   2327  C CA  . THR A 1 334 ? 132.326 164.477 139.900 1.00 285.39 ? 334  THR A CA  1 
ATOM   2328  C C   . THR A 1 334 ? 133.556 163.727 139.391 1.00 274.69 ? 334  THR A C   1 
ATOM   2329  O O   . THR A 1 334 ? 134.443 163.381 140.170 1.00 305.16 ? 334  THR A O   1 
ATOM   2330  C CB  . THR A 1 334 ? 131.251 163.496 140.421 1.00 313.85 ? 334  THR A CB  1 
ATOM   2331  O OG1 . THR A 1 334 ? 131.728 162.872 141.616 1.00 335.61 ? 334  THR A OG1 1 
ATOM   2332  C CG2 . THR A 1 334 ? 130.906 162.418 139.408 1.00 318.73 ? 334  THR A CG2 1 
ATOM   2333  N N   . PHE A 1 335 ? 133.587 163.483 138.085 1.00 299.45 ? 335  PHE A N   1 
ATOM   2334  C CA  . PHE A 1 335 ? 134.789 163.043 137.384 1.00 310.90 ? 335  PHE A CA  1 
ATOM   2335  C C   . PHE A 1 335 ? 135.431 164.289 136.824 1.00 292.24 ? 335  PHE A C   1 
ATOM   2336  O O   . PHE A 1 335 ? 134.817 165.350 136.843 1.00 314.84 ? 335  PHE A O   1 
ATOM   2337  C CB  . PHE A 1 335 ? 134.423 162.014 136.323 1.00 301.13 ? 335  PHE A CB  1 
ATOM   2338  C CG  . PHE A 1 335 ? 133.809 160.794 136.916 1.00 296.99 ? 335  PHE A CG  1 
ATOM   2339  C CD1 . PHE A 1 335 ? 134.608 159.778 137.410 1.00 308.41 ? 335  PHE A CD1 1 
ATOM   2340  C CD2 . PHE A 1 335 ? 132.440 160.705 137.075 1.00 282.95 ? 335  PHE A CD2 1 
ATOM   2341  C CE1 . PHE A 1 335 ? 134.046 158.668 138.001 1.00 308.26 ? 335  PHE A CE1 1 
ATOM   2342  C CE2 . PHE A 1 335 ? 131.866 159.598 137.676 1.00 290.47 ? 335  PHE A CE2 1 
ATOM   2343  C CZ  . PHE A 1 335 ? 132.671 158.577 138.139 1.00 292.00 ? 335  PHE A CZ  1 
ATOM   2344  N N   . ASP A 1 336 ? 136.651 164.177 136.323 1.00 257.18 ? 336  ASP A N   1 
ATOM   2345  C CA  . ASP A 1 336 ? 137.546 165.333 136.278 1.00 292.45 ? 336  ASP A CA  1 
ATOM   2346  C C   . ASP A 1 336 ? 137.081 166.448 135.331 1.00 290.97 ? 336  ASP A C   1 
ATOM   2347  O O   . ASP A 1 336 ? 137.709 166.733 134.311 1.00 297.48 ? 336  ASP A O   1 
ATOM   2348  C CB  . ASP A 1 336 ? 138.983 164.881 135.978 1.00 323.98 ? 336  ASP A CB  1 
ATOM   2349  C CG  . ASP A 1 336 ? 139.571 163.985 137.078 1.00 335.75 ? 336  ASP A CG  1 
ATOM   2350  O OD1 . ASP A 1 336 ? 139.351 164.260 138.278 1.00 345.53 ? 336  ASP A OD1 1 
ATOM   2351  O OD2 . ASP A 1 336 ? 140.265 163.002 136.737 1.00 332.06 ? 336  ASP A OD2 1 
ATOM   2352  N N   . TYR A 1 337 ? 135.986 167.099 135.728 1.00 292.06 ? 337  TYR A N   1 
ATOM   2353  C CA  . TYR A 1 337 ? 135.305 168.118 134.936 1.00 286.06 ? 337  TYR A CA  1 
ATOM   2354  C C   . TYR A 1 337 ? 135.005 167.657 133.503 1.00 275.56 ? 337  TYR A C   1 
ATOM   2355  O O   . TYR A 1 337 ? 135.230 168.395 132.549 1.00 291.39 ? 337  TYR A O   1 
ATOM   2356  C CB  . TYR A 1 337 ? 136.143 169.399 134.937 1.00 296.26 ? 337  TYR A CB  1 
ATOM   2357  C CG  . TYR A 1 337 ? 136.539 169.860 136.315 1.00 292.00 ? 337  TYR A CG  1 
ATOM   2358  C CD1 . TYR A 1 337 ? 135.582 170.315 137.217 1.00 289.16 ? 337  TYR A CD1 1 
ATOM   2359  C CD2 . TYR A 1 337 ? 137.871 169.841 136.723 1.00 318.95 ? 337  TYR A CD2 1 
ATOM   2360  C CE1 . TYR A 1 337 ? 135.940 170.738 138.489 1.00 287.72 ? 337  TYR A CE1 1 
ATOM   2361  C CE2 . TYR A 1 337 ? 138.239 170.269 137.991 1.00 305.73 ? 337  TYR A CE2 1 
ATOM   2362  C CZ  . TYR A 1 337 ? 137.274 170.715 138.868 1.00 288.29 ? 337  TYR A CZ  1 
ATOM   2363  O OH  . TYR A 1 337 ? 137.647 171.133 140.121 1.00 312.43 ? 337  TYR A OH  1 
ATOM   2364  N N   . ILE A 1 338 ? 134.473 166.446 133.357 1.00 277.54 ? 338  ILE A N   1 
ATOM   2365  C CA  . ILE A 1 338 ? 134.297 165.855 132.017 1.00 283.55 ? 338  ILE A CA  1 
ATOM   2366  C C   . ILE A 1 338 ? 133.217 166.590 131.214 1.00 260.62 ? 338  ILE A C   1 
ATOM   2367  O O   . ILE A 1 338 ? 133.177 166.487 129.992 1.00 263.45 ? 338  ILE A O   1 
ATOM   2368  C CB  . ILE A 1 338 ? 134.068 164.309 132.042 1.00 298.44 ? 338  ILE A CB  1 
ATOM   2369  C CG1 . ILE A 1 338 ? 132.621 163.933 132.357 1.00 288.26 ? 338  ILE A CG1 1 
ATOM   2370  C CG2 . ILE A 1 338 ? 135.011 163.623 133.031 1.00 338.03 ? 338  ILE A CG2 1 
ATOM   2371  C CD1 . ILE A 1 338 ? 131.695 163.901 131.158 1.00 330.11 ? 338  ILE A CD1 1 
ATOM   2372  N N   . GLY A 1 339 ? 132.348 167.316 131.914 1.00 274.88 ? 339  GLY A N   1 
ATOM   2373  C CA  . GLY A 1 339 ? 131.372 168.183 131.290 1.00 281.65 ? 339  GLY A CA  1 
ATOM   2374  C C   . GLY A 1 339 ? 131.980 169.513 130.906 1.00 284.95 ? 339  GLY A C   1 
ATOM   2375  O O   . GLY A 1 339 ? 131.965 169.894 129.734 1.00 293.02 ? 339  GLY A O   1 
ATOM   2376  N N   . SER A 1 340 ? 132.520 170.217 131.898 1.00 289.38 ? 340  SER A N   1 
ATOM   2377  C CA  . SER A 1 340 ? 132.903 171.603 131.723 1.00 298.42 ? 340  SER A CA  1 
ATOM   2378  C C   . SER A 1 340 ? 134.139 171.760 130.896 1.00 270.15 ? 340  SER A C   1 
ATOM   2379  O O   . SER A 1 340 ? 134.191 172.730 130.134 1.00 284.73 ? 340  SER A O   1 
ATOM   2380  C CB  . SER A 1 340 ? 133.047 172.333 133.054 1.00 290.91 ? 340  SER A CB  1 
ATOM   2381  O OG  . SER A 1 340 ? 134.012 171.718 133.876 1.00 316.62 ? 340  SER A OG  1 
ATOM   2382  N N   . SER A 1 341 ? 135.072 170.817 130.971 1.00 281.62 ? 341  SER A N   1 
ATOM   2383  C CA  . SER A 1 341 ? 136.264 170.858 130.134 1.00 288.83 ? 341  SER A CA  1 
ATOM   2384  C C   . SER A 1 341 ? 135.890 170.772 128.655 1.00 269.50 ? 341  SER A C   1 
ATOM   2385  O O   . SER A 1 341 ? 136.469 171.467 127.821 1.00 298.27 ? 341  SER A O   1 
ATOM   2386  C CB  . SER A 1 341 ? 137.219 169.722 130.504 1.00 305.41 ? 341  SER A CB  1 
ATOM   2387  O OG  . SER A 1 341 ? 138.244 169.582 129.535 1.00 292.83 ? 341  SER A OG  1 
ATOM   2388  N N   . ARG A 1 342 ? 134.919 169.920 128.335 1.00 281.35 ? 342  ARG A N   1 
ATOM   2389  C CA  . ARG A 1 342 ? 134.448 169.785 126.959 1.00 296.92 ? 342  ARG A CA  1 
ATOM   2390  C C   . ARG A 1 342 ? 133.820 171.087 126.468 1.00 290.67 ? 342  ARG A C   1 
ATOM   2391  O O   . ARG A 1 342 ? 134.029 171.504 125.329 1.00 301.75 ? 342  ARG A O   1 
ATOM   2392  C CB  . ARG A 1 342 ? 133.441 168.639 126.846 1.00 300.08 ? 342  ARG A CB  1 
ATOM   2393  C CG  . ARG A 1 342 ? 132.620 168.657 125.567 1.00 300.18 ? 342  ARG A CG  1 
ATOM   2394  C CD  . ARG A 1 342 ? 133.509 168.811 124.343 1.00 310.30 ? 342  ARG A CD  1 
ATOM   2395  N NE  . ARG A 1 342 ? 133.612 167.569 123.583 1.00 321.30 ? 342  ARG A NE  1 
ATOM   2396  C CZ  . ARG A 1 342 ? 132.888 167.291 122.503 1.00 342.04 ? 342  ARG A CZ  1 
ATOM   2397  N NH1 . ARG A 1 342 ? 132.003 168.169 122.052 1.00 328.55 ? 342  ARG A NH1 1 
ATOM   2398  N NH2 . ARG A 1 342 ? 133.049 166.135 121.874 1.00 366.94 ? 342  ARG A NH2 1 
ATOM   2399  N N   . MET A 1 343 ? 133.053 171.723 127.347 1.00 285.77 ? 343  MET A N   1 
ATOM   2400  C CA  . MET A 1 343 ? 132.413 173.014 127.062 1.00 308.86 ? 343  MET A CA  1 
ATOM   2401  C C   . MET A 1 343 ? 133.467 174.062 126.737 1.00 308.56 ? 343  MET A C   1 
ATOM   2402  O O   . MET A 1 343 ? 133.336 174.810 125.756 1.00 334.24 ? 343  MET A O   1 
ATOM   2403  C CB  . MET A 1 343 ? 131.518 173.502 128.210 1.00 320.67 ? 343  MET A CB  1 
ATOM   2404  C CG  . MET A 1 343 ? 130.022 173.347 127.932 1.00 347.06 ? 343  MET A CG  1 
ATOM   2405  S SD  . MET A 1 343 ? 129.045 174.826 128.256 1.00 333.10 ? 343  MET A SD  1 
ATOM   2406  C CE  . MET A 1 343 ? 129.793 175.978 127.117 1.00 349.04 ? 343  MET A CE  1 
ATOM   2407  N N   . VAL A 1 344 ? 134.493 174.084 127.576 1.00 313.42 ? 344  VAL A N   1 
ATOM   2408  C CA  . VAL A 1 344 ? 135.614 175.022 127.438 1.00 304.62 ? 344  VAL A CA  1 
ATOM   2409  C C   . VAL A 1 344 ? 136.277 174.843 126.073 1.00 319.75 ? 344  VAL A C   1 
ATOM   2410  O O   . VAL A 1 344 ? 136.554 175.821 125.365 1.00 366.60 ? 344  VAL A O   1 
ATOM   2411  C CB  . VAL A 1 344 ? 136.642 174.897 128.588 1.00 311.15 ? 344  VAL A CB  1 
ATOM   2412  C CG1 . VAL A 1 344 ? 137.910 175.689 128.291 1.00 331.64 ? 344  VAL A CG1 1 
ATOM   2413  C CG2 . VAL A 1 344 ? 136.029 175.364 129.899 1.00 325.07 ? 344  VAL A CG2 1 
ATOM   2414  N N   . TYR A 1 345 ? 136.514 173.582 125.744 1.00 305.67 ? 345  TYR A N   1 
ATOM   2415  C CA  . TYR A 1 345 ? 137.144 173.188 124.479 1.00 305.04 ? 345  TYR A CA  1 
ATOM   2416  C C   . TYR A 1 345 ? 136.324 173.716 123.302 1.00 305.42 ? 345  TYR A C   1 
ATOM   2417  O O   . TYR A 1 345 ? 136.870 174.298 122.349 1.00 345.96 ? 345  TYR A O   1 
ATOM   2418  C CB  . TYR A 1 345 ? 137.272 171.649 124.464 1.00 318.58 ? 345  TYR A CB  1 
ATOM   2419  C CG  . TYR A 1 345 ? 137.614 170.985 123.153 1.00 307.68 ? 345  TYR A CG  1 
ATOM   2420  C CD1 . TYR A 1 345 ? 136.623 170.741 122.199 1.00 321.49 ? 345  TYR A CD1 1 
ATOM   2421  C CD2 . TYR A 1 345 ? 138.914 170.549 122.885 1.00 298.10 ? 345  TYR A CD2 1 
ATOM   2422  C CE1 . TYR A 1 345 ? 136.920 170.121 120.996 1.00 350.67 ? 345  TYR A CE1 1 
ATOM   2423  C CE2 . TYR A 1 345 ? 139.222 169.924 121.685 1.00 336.98 ? 345  TYR A CE2 1 
ATOM   2424  C CZ  . TYR A 1 345 ? 138.216 169.711 120.739 1.00 357.63 ? 345  TYR A CZ  1 
ATOM   2425  O OH  . TYR A 1 345 ? 138.492 169.097 119.538 1.00 358.05 ? 345  TYR A OH  1 
ATOM   2426  N N   . ASP A 1 346 ? 135.021 173.498 123.407 1.00 284.59 ? 346  ASP A N   1 
ATOM   2427  C CA  . ASP A 1 346 ? 134.061 173.922 122.385 1.00 312.67 ? 346  ASP A CA  1 
ATOM   2428  C C   . ASP A 1 346 ? 134.136 175.428 122.179 1.00 319.48 ? 346  ASP A C   1 
ATOM   2429  O O   . ASP A 1 346 ? 134.188 175.907 121.031 1.00 369.87 ? 346  ASP A O   1 
ATOM   2430  C CB  . ASP A 1 346 ? 132.630 173.472 122.706 1.00 350.47 ? 346  ASP A CB  1 
ATOM   2431  C CG  . ASP A 1 346 ? 132.438 171.956 122.587 1.00 369.19 ? 346  ASP A CG  1 
ATOM   2432  O OD1 . ASP A 1 346 ? 133.041 171.321 121.692 1.00 346.38 ? 346  ASP A OD1 1 
ATOM   2433  O OD2 . ASP A 1 346 ? 131.658 171.401 123.392 1.00 386.35 ? 346  ASP A OD2 1 
ATOM   2434  N N   . MET A 1 347 ? 134.065 176.173 123.272 1.00 313.00 ? 347  MET A N   1 
ATOM   2435  C CA  . MET A 1 347 ? 134.133 177.616 123.161 1.00 337.52 ? 347  MET A CA  1 
ATOM   2436  C C   . MET A 1 347 ? 135.488 178.033 122.633 1.00 328.11 ? 347  MET A C   1 
ATOM   2437  O O   . MET A 1 347 ? 135.581 178.854 121.732 1.00 362.52 ? 347  MET A O   1 
ATOM   2438  C CB  . MET A 1 347 ? 133.877 178.282 124.507 1.00 342.18 ? 347  MET A CB  1 
ATOM   2439  C CG  . MET A 1 347 ? 133.144 177.422 125.515 1.00 372.47 ? 347  MET A CG  1 
ATOM   2440  S SD  . MET A 1 347 ? 131.530 178.090 125.925 1.00 374.05 ? 347  MET A SD  1 
ATOM   2441  C CE  . MET A 1 347 ? 131.920 179.088 127.357 1.00 342.66 ? 347  MET A CE  1 
ATOM   2442  N N   . GLU A 1 348 ? 136.540 177.441 123.174 1.00 317.63 ? 348  GLU A N   1 
ATOM   2443  C CA  . GLU A 1 348 ? 137.884 177.779 122.747 1.00 346.42 ? 348  GLU A CA  1 
ATOM   2444  C C   . GLU A 1 348 ? 138.109 177.403 121.297 1.00 352.28 ? 348  GLU A C   1 
ATOM   2445  O O   . GLU A 1 348 ? 138.660 178.174 120.522 1.00 372.00 ? 348  GLU A O   1 
ATOM   2446  C CB  . GLU A 1 348 ? 138.887 177.029 123.599 1.00 362.87 ? 348  GLU A CB  1 
ATOM   2447  C CG  . GLU A 1 348 ? 139.588 177.873 124.636 1.00 380.80 ? 348  GLU A CG  1 
ATOM   2448  C CD  . GLU A 1 348 ? 140.973 177.351 124.925 1.00 410.74 ? 348  GLU A CD  1 
ATOM   2449  O OE1 . GLU A 1 348 ? 141.890 177.669 124.145 1.00 413.72 ? 348  GLU A OE1 1 
ATOM   2450  O OE2 . GLU A 1 348 ? 141.142 176.611 125.916 1.00 431.94 ? 348  GLU A OE2 1 
ATOM   2451  N N   . LYS A 1 349 ? 137.670 176.208 120.933 1.00 349.24 ? 349  LYS A N   1 
ATOM   2452  C CA  . LYS A 1 349 ? 137.762 175.741 119.559 1.00 373.35 ? 349  LYS A CA  1 
ATOM   2453  C C   . LYS A 1 349 ? 136.895 176.584 118.663 1.00 348.84 ? 349  LYS A C   1 
ATOM   2454  O O   . LYS A 1 349 ? 137.203 176.802 117.500 1.00 337.85 ? 349  LYS A O   1 
ATOM   2455  C CB  . LYS A 1 349 ? 137.383 174.265 119.436 1.00 390.51 ? 349  LYS A CB  1 
ATOM   2456  C CG  . LYS A 1 349 ? 138.402 173.290 120.014 1.00 404.49 ? 349  LYS A CG  1 
ATOM   2457  C CD  . LYS A 1 349 ? 139.826 173.825 120.006 1.00 417.50 ? 349  LYS A CD  1 
ATOM   2458  C CE  . LYS A 1 349 ? 140.760 172.929 120.797 1.00 435.36 ? 349  LYS A CE  1 
ATOM   2459  N NZ  . LYS A 1 349 ? 141.463 173.669 121.878 1.00 444.32 ? 349  LYS A NZ  1 
ATOM   2460  N N   . GLY A 1 350 ? 135.768 177.000 119.214 1.00 338.80 ? 350  GLY A N   1 
ATOM   2461  C CA  . GLY A 1 350 ? 134.694 177.622 118.444 1.00 349.73 ? 350  GLY A CA  1 
ATOM   2462  C C   . GLY A 1 350 ? 133.807 176.663 117.672 1.00 347.14 ? 350  GLY A C   1 
ATOM   2463  O O   . GLY A 1 350 ? 133.564 176.864 116.479 1.00 358.94 ? 350  GLY A O   1 
ATOM   2464  N N   . LYS A 1 351 ? 133.333 175.619 118.350 1.00 356.84 ? 351  LYS A N   1 
ATOM   2465  C CA  . LYS A 1 351 ? 132.295 174.729 117.817 1.00 372.32 ? 351  LYS A CA  1 
ATOM   2466  C C   . LYS A 1 351 ? 131.037 174.868 118.676 1.00 355.33 ? 351  LYS A C   1 
ATOM   2467  O O   . LYS A 1 351 ? 130.380 173.875 119.007 1.00 352.11 ? 351  LYS A O   1 
ATOM   2468  C CB  . LYS A 1 351 ? 132.783 173.272 117.796 1.00 385.82 ? 351  LYS A CB  1 
ATOM   2469  C CG  . LYS A 1 351 ? 133.873 172.976 116.774 1.00 405.69 ? 351  LYS A CG  1 
ATOM   2470  C CD  . LYS A 1 351 ? 135.278 173.020 117.361 1.00 420.87 ? 351  LYS A CD  1 
ATOM   2471  C CE  . LYS A 1 351 ? 136.286 172.441 116.377 1.00 449.91 ? 351  LYS A CE  1 
ATOM   2472  N NZ  . LYS A 1 351 ? 137.664 172.305 116.927 1.00 462.62 ? 351  LYS A NZ  1 
ATOM   2473  N N   . PHE A 1 352 ? 130.694 176.114 119.007 1.00 343.96 ? 352  PHE A N   1 
ATOM   2474  C CA  . PHE A 1 352 ? 129.684 176.410 120.027 1.00 346.09 ? 352  PHE A CA  1 
ATOM   2475  C C   . PHE A 1 352 ? 129.437 177.932 120.122 1.00 335.09 ? 352  PHE A C   1 
ATOM   2476  O O   . PHE A 1 352 ? 130.388 178.706 119.984 1.00 345.56 ? 352  PHE A O   1 
ATOM   2477  C CB  . PHE A 1 352 ? 130.159 175.841 121.369 1.00 346.17 ? 352  PHE A CB  1 
ATOM   2478  C CG  . PHE A 1 352 ? 129.361 176.292 122.543 1.00 335.65 ? 352  PHE A CG  1 
ATOM   2479  C CD1 . PHE A 1 352 ? 128.250 175.572 122.969 1.00 325.85 ? 352  PHE A CD1 1 
ATOM   2480  C CD2 . PHE A 1 352 ? 129.725 177.434 123.232 1.00 329.62 ? 352  PHE A CD2 1 
ATOM   2481  C CE1 . PHE A 1 352 ? 127.513 175.999 124.058 1.00 317.67 ? 352  PHE A CE1 1 
ATOM   2482  C CE2 . PHE A 1 352 ? 128.996 177.859 124.317 1.00 333.04 ? 352  PHE A CE2 1 
ATOM   2483  C CZ  . PHE A 1 352 ? 127.893 177.151 124.728 1.00 314.26 ? 352  PHE A CZ  1 
ATOM   2484  N N   . PRO A 1 353 ? 128.172 178.365 120.366 1.00 305.11 ? 353  PRO A N   1 
ATOM   2485  C CA  . PRO A 1 353 ? 127.834 179.799 120.302 1.00 298.91 ? 353  PRO A CA  1 
ATOM   2486  C C   . PRO A 1 353 ? 128.611 180.728 121.237 1.00 296.88 ? 353  PRO A C   1 
ATOM   2487  O O   . PRO A 1 353 ? 129.428 181.512 120.753 1.00 308.70 ? 353  PRO A O   1 
ATOM   2488  C CB  . PRO A 1 353 ? 126.326 179.832 120.618 1.00 296.19 ? 353  PRO A CB  1 
ATOM   2489  C CG  . PRO A 1 353 ? 126.007 178.490 121.180 1.00 310.17 ? 353  PRO A CG  1 
ATOM   2490  C CD  . PRO A 1 353 ? 126.947 177.557 120.490 1.00 311.11 ? 353  PRO A CD  1 
ATOM   2491  N N   . VAL A 1 354 ? 128.361 180.648 122.545 1.00 299.24 ? 354  VAL A N   1 
ATOM   2492  C CA  . VAL A 1 354 ? 129.002 181.544 123.508 1.00 292.18 ? 354  VAL A CA  1 
ATOM   2493  C C   . VAL A 1 354 ? 130.493 181.245 123.534 1.00 299.26 ? 354  VAL A C   1 
ATOM   2494  O O   . VAL A 1 354 ? 130.925 180.272 124.135 1.00 321.33 ? 354  VAL A O   1 
ATOM   2495  C CB  . VAL A 1 354 ? 128.402 181.410 124.931 1.00 306.74 ? 354  VAL A CB  1 
ATOM   2496  C CG1 . VAL A 1 354 ? 129.226 182.180 125.957 1.00 308.70 ? 354  VAL A CG1 1 
ATOM   2497  C CG2 . VAL A 1 354 ? 126.955 181.884 124.957 1.00 323.55 ? 354  VAL A CG2 1 
ATOM   2498  N N   . GLN A 1 355 ? 131.262 182.105 122.872 1.00 326.78 ? 355  GLN A N   1 
ATOM   2499  C CA  . GLN A 1 355 ? 132.719 182.039 122.879 1.00 327.98 ? 355  GLN A CA  1 
ATOM   2500  C C   . GLN A 1 355 ? 133.279 182.449 124.238 1.00 313.01 ? 355  GLN A C   1 
ATOM   2501  O O   . GLN A 1 355 ? 132.671 183.246 124.954 1.00 265.08 ? 355  GLN A O   1 
ATOM   2502  C CB  . GLN A 1 355 ? 133.302 182.928 121.779 1.00 362.48 ? 355  GLN A CB  1 
ATOM   2503  C CG  . GLN A 1 355 ? 133.340 182.274 120.407 1.00 401.85 ? 355  GLN A CG  1 
ATOM   2504  C CD  . GLN A 1 355 ? 134.433 182.840 119.522 1.00 453.48 ? 355  GLN A CD  1 
ATOM   2505  O OE1 . GLN A 1 355 ? 134.159 183.557 118.559 1.00 468.28 ? 355  GLN A OE1 1 
ATOM   2506  N NE2 . GLN A 1 355 ? 135.681 182.520 119.844 1.00 473.24 ? 355  GLN A NE2 1 
ATOM   2507  N N   . LEU A 1 356 ? 134.436 181.899 124.589 1.00 308.96 ? 356  LEU A N   1 
ATOM   2508  C CA  . LEU A 1 356 ? 135.049 182.164 125.872 1.00 301.19 ? 356  LEU A CA  1 
ATOM   2509  C C   . LEU A 1 356 ? 135.217 183.646 126.078 1.00 324.90 ? 356  LEU A C   1 
ATOM   2510  O O   . LEU A 1 356 ? 135.112 184.135 127.190 1.00 339.36 ? 356  LEU A O   1 
ATOM   2511  C CB  . LEU A 1 356 ? 136.382 181.456 125.996 1.00 324.42 ? 356  LEU A CB  1 
ATOM   2512  C CG  . LEU A 1 356 ? 136.609 180.751 127.329 1.00 364.47 ? 356  LEU A CG  1 
ATOM   2513  C CD1 . LEU A 1 356 ? 135.328 180.145 127.868 1.00 365.80 ? 356  LEU A CD1 1 
ATOM   2514  C CD2 . LEU A 1 356 ? 137.665 179.673 127.172 1.00 389.84 ? 356  LEU A CD2 1 
ATOM   2515  N N   . GLU A 1 357 ? 135.421 184.373 124.990 1.00 346.52 ? 357  GLU A N   1 
ATOM   2516  C CA  . GLU A 1 357 ? 135.602 185.810 125.082 1.00 354.08 ? 357  GLU A CA  1 
ATOM   2517  C C   . GLU A 1 357 ? 134.349 186.432 125.680 1.00 337.62 ? 357  GLU A C   1 
ATOM   2518  O O   . GLU A 1 357 ? 134.427 187.384 126.457 1.00 354.80 ? 357  GLU A O   1 
ATOM   2519  C CB  . GLU A 1 357 ? 135.881 186.407 123.702 1.00 392.30 ? 357  GLU A CB  1 
ATOM   2520  C CG  . GLU A 1 357 ? 136.773 187.637 123.727 1.00 429.13 ? 357  GLU A CG  1 
ATOM   2521  C CD  . GLU A 1 357 ? 137.210 188.069 122.341 1.00 467.01 ? 357  GLU A CD  1 
ATOM   2522  O OE1 . GLU A 1 357 ? 136.331 188.328 121.493 1.00 486.68 ? 357  GLU A OE1 1 
ATOM   2523  O OE2 . GLU A 1 357 ? 138.433 188.149 122.100 1.00 469.55 ? 357  GLU A OE2 1 
ATOM   2524  N N   . ASN A 1 358 ? 133.191 185.897 125.306 1.00 326.91 ? 358  ASN A N   1 
ATOM   2525  C CA  . ASN A 1 358 ? 131.927 186.501 125.684 1.00 323.31 ? 358  ASN A CA  1 
ATOM   2526  C C   . ASN A 1 358 ? 131.643 186.579 127.170 1.00 326.33 ? 358  ASN A C   1 
ATOM   2527  O O   . ASN A 1 358 ? 131.105 187.579 127.625 1.00 348.87 ? 358  ASN A O   1 
ATOM   2528  C CB  . ASN A 1 358 ? 130.766 185.814 124.986 1.00 326.33 ? 358  ASN A CB  1 
ATOM   2529  C CG  . ASN A 1 358 ? 130.723 186.115 123.515 1.00 336.04 ? 358  ASN A CG  1 
ATOM   2530  O OD1 . ASN A 1 358 ? 131.758 186.259 122.878 1.00 320.97 ? 358  ASN A OD1 1 
ATOM   2531  N ND2 . ASN A 1 358 ? 129.527 186.207 122.964 1.00 342.00 ? 358  ASN A ND2 1 
ATOM   2532  N N   . VAL A 1 359 ? 131.991 185.555 127.938 1.00 316.36 ? 359  VAL A N   1 
ATOM   2533  C CA  . VAL A 1 359 ? 131.576 185.534 129.330 1.00 336.57 ? 359  VAL A CA  1 
ATOM   2534  C C   . VAL A 1 359 ? 132.103 186.792 130.010 1.00 348.54 ? 359  VAL A C   1 
ATOM   2535  O O   . VAL A 1 359 ? 133.286 187.098 129.932 1.00 349.54 ? 359  VAL A O   1 
ATOM   2536  C CB  . VAL A 1 359 ? 132.162 184.304 130.048 1.00 323.30 ? 359  VAL A CB  1 
ATOM   2537  C CG1 . VAL A 1 359 ? 131.948 184.392 131.546 1.00 331.45 ? 359  VAL A CG1 1 
ATOM   2538  C CG2 . VAL A 1 359 ? 131.559 183.028 129.502 1.00 310.23 ? 359  VAL A CG2 1 
ATOM   2539  N N   . ASP A 1 360 ? 131.190 187.568 130.592 1.00 337.70 ? 360  ASP A N   1 
ATOM   2540  C CA  . ASP A 1 360 ? 131.550 188.757 131.363 1.00 367.63 ? 360  ASP A CA  1 
ATOM   2541  C C   . ASP A 1 360 ? 131.631 188.454 132.858 1.00 368.25 ? 360  ASP A C   1 
ATOM   2542  O O   . ASP A 1 360 ? 132.378 189.093 133.598 1.00 390.38 ? 360  ASP A O   1 
ATOM   2543  C CB  . ASP A 1 360 ? 130.547 189.884 131.109 1.00 391.71 ? 360  ASP A CB  1 
ATOM   2544  C CG  . ASP A 1 360 ? 131.190 191.256 131.151 1.00 413.80 ? 360  ASP A CG  1 
ATOM   2545  O OD1 . ASP A 1 360 ? 131.525 191.724 132.260 1.00 413.78 ? 360  ASP A OD1 1 
ATOM   2546  O OD2 . ASP A 1 360 ? 131.361 191.868 130.075 1.00 410.49 ? 360  ASP A OD2 1 
ATOM   2547  N N   . SER A 1 361 ? 130.851 187.466 133.285 1.00 340.76 ? 361  SER A N   1 
ATOM   2548  C CA  . SER A 1 361 ? 130.835 187.002 134.668 1.00 341.10 ? 361  SER A CA  1 
ATOM   2549  C C   . SER A 1 361 ? 130.307 185.570 134.776 1.00 322.10 ? 361  SER A C   1 
ATOM   2550  O O   . SER A 1 361 ? 129.337 185.194 134.109 1.00 318.53 ? 361  SER A O   1 
ATOM   2551  C CB  . SER A 1 361 ? 129.988 187.944 135.521 1.00 354.19 ? 361  SER A CB  1 
ATOM   2552  O OG  . SER A 1 361 ? 128.764 188.228 134.875 1.00 360.43 ? 361  SER A OG  1 
ATOM   2553  N N   . PHE A 1 362 ? 130.959 184.794 135.638 1.00 300.92 ? 362  PHE A N   1 
ATOM   2554  C CA  . PHE A 1 362 ? 130.687 183.376 135.811 1.00 290.15 ? 362  PHE A CA  1 
ATOM   2555  C C   . PHE A 1 362 ? 130.287 183.135 137.258 1.00 287.62 ? 362  PHE A C   1 
ATOM   2556  O O   . PHE A 1 362 ? 130.965 183.598 138.183 1.00 305.73 ? 362  PHE A O   1 
ATOM   2557  C CB  . PHE A 1 362 ? 131.944 182.585 135.479 1.00 292.37 ? 362  PHE A CB  1 
ATOM   2558  C CG  . PHE A 1 362 ? 131.705 181.128 135.226 1.00 298.40 ? 362  PHE A CG  1 
ATOM   2559  C CD1 . PHE A 1 362 ? 131.594 180.228 136.291 1.00 320.13 ? 362  PHE A CD1 1 
ATOM   2560  C CD2 . PHE A 1 362 ? 131.628 180.641 133.925 1.00 285.58 ? 362  PHE A CD2 1 
ATOM   2561  C CE1 . PHE A 1 362 ? 131.399 178.872 136.061 1.00 320.78 ? 362  PHE A CE1 1 
ATOM   2562  C CE2 . PHE A 1 362 ? 131.427 179.288 133.690 1.00 326.42 ? 362  PHE A CE2 1 
ATOM   2563  C CZ  . PHE A 1 362 ? 131.315 178.401 134.757 1.00 327.95 ? 362  PHE A CZ  1 
ATOM   2564  N N   . VAL A 1 363 ? 129.158 182.469 137.446 1.00 284.92 ? 363  VAL A N   1 
ATOM   2565  C CA  . VAL A 1 363 ? 128.693 182.111 138.765 1.00 276.01 ? 363  VAL A CA  1 
ATOM   2566  C C   . VAL A 1 363 ? 128.411 180.617 138.848 1.00 297.22 ? 363  VAL A C   1 
ATOM   2567  O O   . VAL A 1 363 ? 127.529 180.103 138.164 1.00 321.11 ? 363  VAL A O   1 
ATOM   2568  C CB  . VAL A 1 363 ? 127.405 182.865 139.059 1.00 288.70 ? 363  VAL A CB  1 
ATOM   2569  C CG1 . VAL A 1 363 ? 127.011 182.687 140.502 1.00 327.07 ? 363  VAL A CG1 1 
ATOM   2570  C CG2 . VAL A 1 363 ? 127.583 184.328 138.730 1.00 297.17 ? 363  VAL A CG2 1 
ATOM   2571  N N   . GLU A 1 364 ? 129.175 179.917 139.674 1.00 285.66 ? 364  GLU A N   1 
ATOM   2572  C CA  . GLU A 1 364 ? 128.903 178.514 139.922 1.00 278.87 ? 364  GLU A CA  1 
ATOM   2573  C C   . GLU A 1 364 ? 128.601 178.340 141.398 1.00 289.63 ? 364  GLU A C   1 
ATOM   2574  O O   . GLU A 1 364 ? 129.392 178.746 142.250 1.00 296.57 ? 364  GLU A O   1 
ATOM   2575  C CB  . GLU A 1 364 ? 130.101 177.653 139.521 1.00 310.20 ? 364  GLU A CB  1 
ATOM   2576  C CG  . GLU A 1 364 ? 129.771 176.555 138.523 1.00 354.20 ? 364  GLU A CG  1 
ATOM   2577  C CD  . GLU A 1 364 ? 130.374 175.218 138.907 1.00 368.17 ? 364  GLU A CD  1 
ATOM   2578  O OE1 . GLU A 1 364 ? 131.615 175.133 139.014 1.00 369.75 ? 364  GLU A OE1 1 
ATOM   2579  O OE2 . GLU A 1 364 ? 129.606 174.252 139.103 1.00 353.21 ? 364  GLU A OE2 1 
ATOM   2580  N N   . LEU A 1 365 ? 127.463 177.732 141.709 1.00 309.87 ? 365  LEU A N   1 
ATOM   2581  C CA  . LEU A 1 365 ? 127.142 177.474 143.091 1.00 312.78 ? 365  LEU A CA  1 
ATOM   2582  C C   . LEU A 1 365 ? 127.575 176.068 143.437 1.00 304.69 ? 365  LEU A C   1 
ATOM   2583  O O   . LEU A 1 365 ? 127.130 175.097 142.826 1.00 298.07 ? 365  LEU A O   1 
ATOM   2584  C CB  . LEU A 1 365 ? 125.649 177.611 143.369 1.00 311.06 ? 365  LEU A CB  1 
ATOM   2585  C CG  . LEU A 1 365 ? 124.697 178.171 142.336 1.00 309.05 ? 365  LEU A CG  1 
ATOM   2586  C CD1 . LEU A 1 365 ? 124.802 177.365 141.067 1.00 318.70 ? 365  LEU A CD1 1 
ATOM   2587  C CD2 . LEU A 1 365 ? 123.294 178.081 142.896 1.00 336.80 ? 365  LEU A CD2 1 
ATOM   2588  N N   . GLY A 1 366 ? 128.446 175.969 144.433 1.00 320.62 ? 366  GLY A N   1 
ATOM   2589  C CA  . GLY A 1 366 ? 128.771 174.694 145.038 1.00 333.00 ? 366  GLY A CA  1 
ATOM   2590  C C   . GLY A 1 366 ? 128.098 174.459 146.387 1.00 319.06 ? 366  GLY A C   1 
ATOM   2591  O O   . GLY A 1 366 ? 128.221 175.278 147.281 1.00 327.79 ? 366  GLY A O   1 
ATOM   2592  N N   . GLN A 1 367 ? 127.437 173.312 146.561 1.00 298.90 ? 367  GLN A N   1 
ATOM   2593  C CA  . GLN A 1 367 ? 126.997 172.831 147.891 1.00 336.36 ? 367  GLN A CA  1 
ATOM   2594  C C   . GLN A 1 367 ? 126.133 173.737 148.803 1.00 331.58 ? 367  GLN A C   1 
ATOM   2595  O O   . GLN A 1 367 ? 126.481 173.961 149.963 1.00 340.43 ? 367  GLN A O   1 
ATOM   2596  C CB  . GLN A 1 367 ? 128.208 172.321 148.682 1.00 359.00 ? 367  GLN A CB  1 
ATOM   2597  C CG  . GLN A 1 367 ? 129.325 171.763 147.816 1.00 355.49 ? 367  GLN A CG  1 
ATOM   2598  C CD  . GLN A 1 367 ? 129.325 170.247 147.770 1.00 326.61 ? 367  GLN A CD  1 
ATOM   2599  O OE1 . GLN A 1 367 ? 129.921 169.641 146.880 1.00 302.78 ? 367  GLN A OE1 1 
ATOM   2600  N NE2 . GLN A 1 367 ? 128.653 169.626 148.733 1.00 339.28 ? 367  GLN A NE2 1 
ATOM   2601  N N   . VAL A 1 368 ? 125.098 174.305 148.207 1.00 319.26 ? 368  VAL A N   1 
ATOM   2602  C CA  . VAL A 1 368 ? 124.260 175.322 148.804 1.00 289.95 ? 368  VAL A CA  1 
ATOM   2603  C C   . VAL A 1 368 ? 123.441 174.911 150.015 1.00 297.14 ? 368  VAL A C   1 
ATOM   2604  O O   . VAL A 1 368 ? 123.170 175.732 150.868 1.00 341.57 ? 368  VAL A O   1 
ATOM   2605  C CB  . VAL A 1 368 ? 123.371 175.979 147.743 1.00 312.83 ? 368  VAL A CB  1 
ATOM   2606  C CG1 . VAL A 1 368 ? 122.455 177.013 148.362 1.00 318.79 ? 368  VAL A CG1 1 
ATOM   2607  C CG2 . VAL A 1 368 ? 124.249 176.643 146.708 1.00 325.86 ? 368  VAL A CG2 1 
ATOM   2608  N N   . ALA A 1 369 ? 122.981 173.677 150.072 1.00 298.45 ? 369  ALA A N   1 
ATOM   2609  C CA  . ALA A 1 369 ? 121.897 173.350 150.983 1.00 312.61 ? 369  ALA A CA  1 
ATOM   2610  C C   . ALA A 1 369 ? 122.128 173.583 152.478 1.00 325.25 ? 369  ALA A C   1 
ATOM   2611  O O   . ALA A 1 369 ? 121.219 174.029 153.158 1.00 332.10 ? 369  ALA A O   1 
ATOM   2612  C CB  . ALA A 1 369 ? 121.464 171.917 150.758 1.00 306.06 ? 369  ALA A CB  1 
ATOM   2613  N N   . LEU A 1 370 ? 123.297 173.237 153.004 1.00 324.52 ? 370  LEU A N   1 
ATOM   2614  C CA  . LEU A 1 370 ? 123.506 173.252 154.458 1.00 331.58 ? 370  LEU A CA  1 
ATOM   2615  C C   . LEU A 1 370 ? 123.516 174.567 155.281 1.00 345.18 ? 370  LEU A C   1 
ATOM   2616  O O   . LEU A 1 370 ? 122.840 174.648 156.298 1.00 364.17 ? 370  LEU A O   1 
ATOM   2617  C CB  . LEU A 1 370 ? 124.754 172.437 154.772 1.00 339.21 ? 370  LEU A CB  1 
ATOM   2618  C CG  . LEU A 1 370 ? 124.861 171.188 153.899 1.00 338.16 ? 370  LEU A CG  1 
ATOM   2619  C CD1 . LEU A 1 370 ? 126.216 170.523 154.053 1.00 336.09 ? 370  LEU A CD1 1 
ATOM   2620  C CD2 . LEU A 1 370 ? 123.739 170.218 154.206 1.00 326.97 ? 370  LEU A CD2 1 
ATOM   2621  N N   . ARG A 1 371 ? 124.253 175.588 154.855 1.00 339.62 ? 371  ARG A N   1 
ATOM   2622  C CA  . ARG A 1 371 ? 124.193 176.921 155.483 1.00 355.50 ? 371  ARG A CA  1 
ATOM   2623  C C   . ARG A 1 371 ? 124.210 176.983 157.035 1.00 373.25 ? 371  ARG A C   1 
ATOM   2624  O O   . ARG A 1 371 ? 123.160 176.850 157.651 1.00 388.40 ? 371  ARG A O   1 
ATOM   2625  C CB  . ARG A 1 371 ? 122.986 177.670 154.932 1.00 358.57 ? 371  ARG A CB  1 
ATOM   2626  C CG  . ARG A 1 371 ? 122.865 177.562 153.426 1.00 353.53 ? 371  ARG A CG  1 
ATOM   2627  C CD  . ARG A 1 371 ? 123.315 178.842 152.756 1.00 331.84 ? 371  ARG A CD  1 
ATOM   2628  N NE  . ARG A 1 371 ? 122.192 179.652 152.310 1.00 326.09 ? 371  ARG A NE  1 
ATOM   2629  C CZ  . ARG A 1 371 ? 121.089 179.868 153.015 1.00 336.06 ? 371  ARG A CZ  1 
ATOM   2630  N NH1 . ARG A 1 371 ? 120.943 179.331 154.211 1.00 356.67 ? 371  ARG A NH1 1 
ATOM   2631  N NH2 . ARG A 1 371 ? 120.127 180.626 152.523 1.00 341.74 ? 371  ARG A NH2 1 
ATOM   2632  N N   . THR A 1 372 ? 125.376 177.177 157.659 1.00 373.11 ? 372  THR A N   1 
ATOM   2633  C CA  . THR A 1 372 ? 125.488 177.181 159.136 1.00 396.40 ? 372  THR A CA  1 
ATOM   2634  C C   . THR A 1 372 ? 124.875 178.298 160.026 1.00 415.62 ? 372  THR A C   1 
ATOM   2635  O O   . THR A 1 372 ? 124.193 177.995 161.002 1.00 437.76 ? 372  THR A O   1 
ATOM   2636  C CB  . THR A 1 372 ? 126.952 177.029 159.557 1.00 419.46 ? 372  THR A CB  1 
ATOM   2637  O OG1 . THR A 1 372 ? 127.685 178.183 159.135 1.00 419.33 ? 372  THR A OG1 1 
ATOM   2638  C CG2 . THR A 1 372 ? 127.551 175.794 158.918 1.00 437.32 ? 372  THR A CG2 1 
ATOM   2639  N N   . SER A 1 373 ? 125.085 179.570 159.693 1.00 402.06 ? 373  SER A N   1 
ATOM   2640  C CA  . SER A 1 373 ? 124.331 180.667 160.302 1.00 395.27 ? 373  SER A CA  1 
ATOM   2641  C C   . SER A 1 373 ? 123.695 181.460 159.163 1.00 372.43 ? 373  SER A C   1 
ATOM   2642  O O   . SER A 1 373 ? 123.854 182.680 159.060 1.00 372.14 ? 373  SER A O   1 
ATOM   2643  C CB  . SER A 1 373 ? 125.254 181.545 161.152 1.00 408.29 ? 373  SER A CB  1 
ATOM   2644  O OG  . SER A 1 373 ? 124.529 182.578 161.797 1.00 427.79 ? 373  SER A OG  1 
ATOM   2645  N N   . LEU A 1 374 ? 122.976 180.728 158.309 1.00 349.10 ? 374  LEU A N   1 
ATOM   2646  C CA  . LEU A 1 374 ? 122.460 181.219 157.023 1.00 350.73 ? 374  LEU A CA  1 
ATOM   2647  C C   . LEU A 1 374 ? 123.540 181.660 156.022 1.00 321.68 ? 374  LEU A C   1 
ATOM   2648  O O   . LEU A 1 374 ? 123.209 182.213 154.968 1.00 287.30 ? 374  LEU A O   1 
ATOM   2649  C CB  . LEU A 1 374 ? 121.437 182.350 157.223 1.00 363.29 ? 374  LEU A CB  1 
ATOM   2650  C CG  . LEU A 1 374 ? 120.401 182.175 158.335 1.00 387.57 ? 374  LEU A CG  1 
ATOM   2651  C CD1 . LEU A 1 374 ? 119.398 183.318 158.284 1.00 401.15 ? 374  LEU A CD1 1 
ATOM   2652  C CD2 . LEU A 1 374 ? 119.694 180.829 158.239 1.00 389.20 ? 374  LEU A CD2 1 
ATOM   2653  N N   . GLU A 1 375 ? 124.792 181.527 156.438 1.00 305.53 ? 375  GLU A N   1 
ATOM   2654  C CA  . GLU A 1 375 ? 125.899 182.135 155.732 1.00 326.25 ? 375  GLU A CA  1 
ATOM   2655  C C   . GLU A 1 375 ? 126.095 181.533 154.359 1.00 315.58 ? 375  GLU A C   1 
ATOM   2656  O O   . GLU A 1 375 ? 126.035 180.317 154.181 1.00 353.56 ? 375  GLU A O   1 
ATOM   2657  C CB  . GLU A 1 375 ? 127.188 182.003 156.547 1.00 346.42 ? 375  GLU A CB  1 
ATOM   2658  C CG  . GLU A 1 375 ? 127.103 182.598 157.944 1.00 377.03 ? 375  GLU A CG  1 
ATOM   2659  C CD  . GLU A 1 375 ? 128.047 183.769 158.137 1.00 400.94 ? 375  GLU A CD  1 
ATOM   2660  O OE1 . GLU A 1 375 ? 127.786 184.846 157.561 1.00 410.76 ? 375  GLU A OE1 1 
ATOM   2661  O OE2 . GLU A 1 375 ? 129.049 183.612 158.865 1.00 411.13 ? 375  GLU A OE2 1 
ATOM   2662  N N   . LEU A 1 376 ? 126.350 182.400 153.391 1.00 298.34 ? 376  LEU A N   1 
ATOM   2663  C CA  . LEU A 1 376 ? 126.807 181.959 152.106 1.00 310.29 ? 376  LEU A CA  1 
ATOM   2664  C C   . LEU A 1 376 ? 128.126 182.598 151.877 1.00 276.92 ? 376  LEU A C   1 
ATOM   2665  O O   . LEU A 1 376 ? 128.294 183.789 152.148 1.00 320.05 ? 376  LEU A O   1 
ATOM   2666  C CB  . LEU A 1 376 ? 125.835 182.396 151.018 1.00 328.47 ? 376  LEU A CB  1 
ATOM   2667  C CG  . LEU A 1 376 ? 125.540 181.436 149.873 1.00 306.47 ? 376  LEU A CG  1 
ATOM   2668  C CD1 . LEU A 1 376 ? 124.759 180.248 150.389 1.00 317.88 ? 376  LEU A CD1 1 
ATOM   2669  C CD2 . LEU A 1 376 ? 124.751 182.126 148.780 1.00 321.59 ? 376  LEU A CD2 1 
ATOM   2670  N N   . TRP A 1 377 ? 129.060 181.830 151.379 1.00 271.85 ? 377  TRP A N   1 
ATOM   2671  C CA  . TRP A 1 377 ? 130.365 182.356 151.197 1.00 298.84 ? 377  TRP A CA  1 
ATOM   2672  C C   . TRP A 1 377 ? 130.581 182.339 149.736 1.00 279.64 ? 377  TRP A C   1 
ATOM   2673  O O   . TRP A 1 377 ? 130.011 181.519 149.059 1.00 317.68 ? 377  TRP A O   1 
ATOM   2674  C CB  . TRP A 1 377 ? 131.371 181.442 151.856 1.00 319.74 ? 377  TRP A CB  1 
ATOM   2675  C CG  . TRP A 1 377 ? 131.149 181.296 153.300 1.00 318.78 ? 377  TRP A CG  1 
ATOM   2676  C CD1 . TRP A 1 377 ? 130.247 180.491 153.907 1.00 338.68 ? 377  TRP A CD1 1 
ATOM   2677  C CD2 . TRP A 1 377 ? 131.843 181.981 154.335 1.00 324.28 ? 377  TRP A CD2 1 
ATOM   2678  N NE1 . TRP A 1 377 ? 130.334 180.626 155.265 1.00 349.27 ? 377  TRP A NE1 1 
ATOM   2679  C CE2 . TRP A 1 377 ? 131.312 181.539 155.553 1.00 349.18 ? 377  TRP A CE2 1 
ATOM   2680  C CE3 . TRP A 1 377 ? 132.868 182.926 154.350 1.00 342.48 ? 377  TRP A CE3 1 
ATOM   2681  C CZ2 . TRP A 1 377 ? 131.764 182.006 156.774 1.00 374.48 ? 377  TRP A CZ2 1 
ATOM   2682  C CZ3 . TRP A 1 377 ? 133.319 183.388 155.559 1.00 374.89 ? 377  TRP A CZ3 1 
ATOM   2683  C CH2 . TRP A 1 377 ? 132.769 182.929 156.758 1.00 383.29 ? 377  TRP A CH2 1 
ATOM   2684  N N   . MET A 1 378 ? 131.379 183.286 149.257 1.00 280.13 ? 378  MET A N   1 
ATOM   2685  C CA  . MET A 1 378 ? 131.770 183.348 147.862 1.00 298.12 ? 378  MET A CA  1 
ATOM   2686  C C   . MET A 1 378 ? 133.281 183.201 147.798 1.00 299.40 ? 378  MET A C   1 
ATOM   2687  O O   . MET A 1 378 ? 134.016 183.908 148.487 1.00 306.25 ? 378  MET A O   1 
ATOM   2688  C CB  . MET A 1 378 ? 131.339 184.676 147.238 1.00 301.06 ? 378  MET A CB  1 
ATOM   2689  C CG  . MET A 1 378 ? 130.008 185.200 147.753 1.00 312.73 ? 378  MET A CG  1 
ATOM   2690  S SD  . MET A 1 378 ? 130.193 186.647 148.812 1.00 351.98 ? 378  MET A SD  1 
ATOM   2691  C CE  . MET A 1 378 ? 131.160 187.720 147.754 1.00 367.63 ? 378  MET A CE  1 
ATOM   2692  N N   . HIS A 1 379 ? 133.739 182.273 146.969 1.00 298.87 ? 379  HIS A N   1 
ATOM   2693  C CA  . HIS A 1 379 ? 135.157 181.982 146.851 1.00 300.94 ? 379  HIS A CA  1 
ATOM   2694  C C   . HIS A 1 379 ? 135.614 182.566 145.544 1.00 312.25 ? 379  HIS A C   1 
ATOM   2695  O O   . HIS A 1 379 ? 134.928 182.452 144.565 1.00 328.66 ? 379  HIS A O   1 
ATOM   2696  C CB  . HIS A 1 379 ? 135.375 180.484 146.856 1.00 300.40 ? 379  HIS A CB  1 
ATOM   2697  C CG  . HIS A 1 379 ? 134.694 179.792 147.985 1.00 299.01 ? 379  HIS A CG  1 
ATOM   2698  N ND1 . HIS A 1 379 ? 135.338 179.485 149.160 1.00 298.07 ? 379  HIS A ND1 1 
ATOM   2699  C CD2 . HIS A 1 379 ? 133.420 179.366 148.129 1.00 282.13 ? 379  HIS A CD2 1 
ATOM   2700  C CE1 . HIS A 1 379 ? 134.490 178.897 149.980 1.00 311.02 ? 379  HIS A CE1 1 
ATOM   2701  N NE2 . HIS A 1 379 ? 133.320 178.811 149.378 1.00 298.70 ? 379  HIS A NE2 1 
ATOM   2702  N N   . THR A 1 380 ? 136.758 183.223 145.526 1.00 321.57 ? 380  THR A N   1 
ATOM   2703  C CA  . THR A 1 380 ? 137.232 183.835 144.299 1.00 330.90 ? 380  THR A CA  1 
ATOM   2704  C C   . THR A 1 380 ? 138.662 183.387 144.049 1.00 327.25 ? 380  THR A C   1 
ATOM   2705  O O   . THR A 1 380 ? 139.360 182.956 144.944 1.00 340.11 ? 380  THR A O   1 
ATOM   2706  C CB  . THR A 1 380 ? 137.153 185.352 144.387 1.00 344.72 ? 380  THR A CB  1 
ATOM   2707  O OG1 . THR A 1 380 ? 137.371 185.747 145.744 1.00 367.95 ? 380  THR A OG1 1 
ATOM   2708  C CG2 . THR A 1 380 ? 135.781 185.818 143.968 1.00 338.69 ? 380  THR A CG2 1 
ATOM   2709  N N   . ASP A 1 381 ? 139.107 183.435 142.815 1.00 319.95 ? 381  ASP A N   1 
ATOM   2710  C CA  . ASP A 1 381 ? 140.452 182.941 142.536 1.00 322.95 ? 381  ASP A CA  1 
ATOM   2711  C C   . ASP A 1 381 ? 141.493 184.013 142.926 1.00 334.13 ? 381  ASP A C   1 
ATOM   2712  O O   . ASP A 1 381 ? 141.378 185.149 142.479 1.00 348.76 ? 381  ASP A O   1 
ATOM   2713  C CB  . ASP A 1 381 ? 140.559 182.600 141.056 1.00 327.23 ? 381  ASP A CB  1 
ATOM   2714  C CG  . ASP A 1 381 ? 141.919 182.071 140.670 1.00 326.30 ? 381  ASP A CG  1 
ATOM   2715  O OD1 . ASP A 1 381 ? 142.487 181.254 141.422 1.00 323.21 ? 381  ASP A OD1 1 
ATOM   2716  O OD2 . ASP A 1 381 ? 142.415 182.481 139.601 1.00 329.35 ? 381  ASP A OD2 1 
ATOM   2717  N N   . PRO A 1 382 ? 142.493 183.662 143.770 1.00 332.38 ? 382  PRO A N   1 
ATOM   2718  C CA  . PRO A 1 382 ? 143.579 184.534 144.180 1.00 346.34 ? 382  PRO A CA  1 
ATOM   2719  C C   . PRO A 1 382 ? 144.421 184.971 143.007 1.00 336.20 ? 382  PRO A C   1 
ATOM   2720  O O   . PRO A 1 382 ? 144.812 186.146 142.957 1.00 348.48 ? 382  PRO A O   1 
ATOM   2721  C CB  . PRO A 1 382 ? 144.402 183.651 145.117 1.00 368.46 ? 382  PRO A CB  1 
ATOM   2722  C CG  . PRO A 1 382 ? 143.397 182.764 145.738 1.00 348.91 ? 382  PRO A CG  1 
ATOM   2723  C CD  . PRO A 1 382 ? 142.392 182.492 144.665 1.00 329.95 ? 382  PRO A CD  1 
ATOM   2724  N N   . VAL A 1 383 ? 144.648 184.052 142.067 1.00 311.22 ? 383  VAL A N   1 
ATOM   2725  C CA  . VAL A 1 383 ? 145.409 184.351 140.854 1.00 316.90 ? 383  VAL A CA  1 
ATOM   2726  C C   . VAL A 1 383 ? 144.728 185.482 140.076 1.00 312.89 ? 383  VAL A C   1 
ATOM   2727  O O   . VAL A 1 383 ? 145.395 186.426 139.625 1.00 331.04 ? 383  VAL A O   1 
ATOM   2728  C CB  . VAL A 1 383 ? 145.690 183.083 140.015 1.00 342.40 ? 383  VAL A CB  1 
ATOM   2729  C CG1 . VAL A 1 383 ? 146.306 183.438 138.667 1.00 372.70 ? 383  VAL A CG1 1 
ATOM   2730  C CG2 . VAL A 1 383 ? 146.611 182.148 140.795 1.00 346.28 ? 383  VAL A CG2 1 
ATOM   2731  N N   . SER A 1 384 ? 143.415 185.355 139.951 1.00 316.31 ? 384  SER A N   1 
ATOM   2732  C CA  . SER A 1 384 ? 142.596 186.340 139.239 1.00 348.99 ? 384  SER A CA  1 
ATOM   2733  C C   . SER A 1 384 ? 142.745 187.715 139.890 1.00 343.06 ? 384  SER A C   1 
ATOM   2734  O O   . SER A 1 384 ? 142.939 188.730 139.198 1.00 346.63 ? 384  SER A O   1 
ATOM   2735  C CB  . SER A 1 384 ? 141.133 185.892 139.165 1.00 367.06 ? 384  SER A CB  1 
ATOM   2736  O OG  . SER A 1 384 ? 141.009 184.735 138.354 1.00 348.31 ? 384  SER A OG  1 
ATOM   2737  N N   . GLN A 1 385 ? 142.665 187.706 141.214 1.00 351.95 ? 385  GLN A N   1 
ATOM   2738  C CA  . GLN A 1 385 ? 142.792 188.922 142.025 1.00 374.81 ? 385  GLN A CA  1 
ATOM   2739  C C   . GLN A 1 385 ? 144.128 189.595 141.761 1.00 388.41 ? 385  GLN A C   1 
ATOM   2740  O O   . GLN A 1 385 ? 144.185 190.815 141.578 1.00 403.93 ? 385  GLN A O   1 
ATOM   2741  C CB  . GLN A 1 385 ? 142.659 188.635 143.534 1.00 385.50 ? 385  GLN A CB  1 
ATOM   2742  C CG  . GLN A 1 385 ? 141.374 187.957 144.025 1.00 382.36 ? 385  GLN A CG  1 
ATOM   2743  C CD  . GLN A 1 385 ? 140.134 188.283 143.207 1.00 346.97 ? 385  GLN A CD  1 
ATOM   2744  O OE1 . GLN A 1 385 ? 139.959 187.788 142.093 1.00 270.86 ? 385  GLN A OE1 1 
ATOM   2745  N NE2 . GLN A 1 385 ? 139.259 189.111 143.767 1.00 355.65 ? 385  GLN A NE2 1 
ATOM   2746  N N   . LYS A 1 386 ? 145.177 188.771 141.752 1.00 386.76 ? 386  LYS A N   1 
ATOM   2747  C CA  . LYS A 1 386 ? 146.539 189.235 141.468 1.00 396.75 ? 386  LYS A CA  1 
ATOM   2748  C C   . LYS A 1 386 ? 146.601 190.083 140.163 1.00 382.04 ? 386  LYS A C   1 
ATOM   2749  O O   . LYS A 1 386 ? 147.262 191.089 140.177 1.00 395.58 ? 386  LYS A O   1 
ATOM   2750  C CB  . LYS A 1 386 ? 147.558 188.087 141.450 1.00 405.74 ? 386  LYS A CB  1 
ATOM   2751  C CG  . LYS A 1 386 ? 147.934 187.599 142.843 1.00 418.09 ? 386  LYS A CG  1 
ATOM   2752  C CD  . LYS A 1 386 ? 148.785 186.338 142.808 1.00 437.75 ? 386  LYS A CD  1 
ATOM   2753  C CE  . LYS A 1 386 ? 150.198 186.619 142.321 1.00 455.02 ? 386  LYS A CE  1 
ATOM   2754  N NZ  . LYS A 1 386 ? 151.085 185.434 142.478 1.00 457.77 ? 386  LYS A NZ  1 
ATOM   2755  N N   . ASN A 1 387 ? 145.823 189.739 139.139 1.00 368.14 ? 387  ASN A N   1 
ATOM   2756  C CA  . ASN A 1 387 ? 145.595 190.640 138.001 1.00 378.85 ? 387  ASN A CA  1 
ATOM   2757  C C   . ASN A 1 387 ? 144.751 191.848 138.434 1.00 387.38 ? 387  ASN A C   1 
ATOM   2758  O O   . ASN A 1 387 ? 143.949 191.732 139.361 1.00 408.61 ? 387  ASN A O   1 
ATOM   2759  C CB  . ASN A 1 387 ? 144.913 189.897 136.852 1.00 390.22 ? 387  ASN A CB  1 
ATOM   2760  C CG  . ASN A 1 387 ? 145.730 189.923 135.575 1.00 395.34 ? 387  ASN A CG  1 
ATOM   2761  O OD1 . ASN A 1 387 ? 146.336 188.922 135.192 1.00 377.77 ? 387  ASN A OD1 1 
ATOM   2762  N ND2 . ASN A 1 387 ? 145.750 191.071 134.909 1.00 402.64 ? 387  ASN A ND2 1 
ATOM   2763  N N   . GLU A 1 388 ? 144.929 193.006 137.792 1.00 390.95 ? 388  GLU A N   1 
ATOM   2764  C CA  . GLU A 1 388 ? 144.282 194.244 138.296 1.00 397.32 ? 388  GLU A CA  1 
ATOM   2765  C C   . GLU A 1 388 ? 142.859 194.505 137.828 1.00 382.88 ? 388  GLU A C   1 
ATOM   2766  O O   . GLU A 1 388 ? 141.942 194.586 138.663 1.00 369.41 ? 388  GLU A O   1 
ATOM   2767  C CB  . GLU A 1 388 ? 145.160 195.467 137.988 1.00 434.97 ? 388  GLU A CB  1 
ATOM   2768  C CG  . GLU A 1 388 ? 146.582 195.395 138.540 1.00 455.66 ? 388  GLU A CG  1 
ATOM   2769  C CD  . GLU A 1 388 ? 146.645 195.202 140.048 1.00 467.75 ? 388  GLU A CD  1 
ATOM   2770  O OE1 . GLU A 1 388 ? 145.795 195.770 140.768 1.00 480.90 ? 388  GLU A OE1 1 
ATOM   2771  O OE2 . GLU A 1 388 ? 147.552 194.482 140.516 1.00 477.09 ? 388  GLU A OE2 1 
ATOM   2772  N N   . SER A 1 389 ? 142.686 194.589 136.510 1.00 390.75 ? 389  SER A N   1 
ATOM   2773  C CA  . SER A 1 389 ? 141.376 194.765 135.891 1.00 396.87 ? 389  SER A CA  1 
ATOM   2774  C C   . SER A 1 389 ? 140.439 193.631 136.303 1.00 385.73 ? 389  SER A C   1 
ATOM   2775  O O   . SER A 1 389 ? 139.279 193.861 136.687 1.00 404.38 ? 389  SER A O   1 
ATOM   2776  C CB  . SER A 1 389 ? 141.502 194.806 134.365 1.00 408.08 ? 389  SER A CB  1 
ATOM   2777  O OG  . SER A 1 389 ? 140.249 195.058 133.749 1.00 416.70 ? 389  SER A OG  1 
ATOM   2778  N N   . VAL A 1 390 ? 140.984 192.420 136.213 1.00 379.85 ? 390  VAL A N   1 
ATOM   2779  C CA  . VAL A 1 390 ? 140.249 191.197 136.561 1.00 377.80 ? 390  VAL A CA  1 
ATOM   2780  C C   . VAL A 1 390 ? 139.785 191.262 138.007 1.00 360.52 ? 390  VAL A C   1 
ATOM   2781  O O   . VAL A 1 390 ? 138.624 190.952 138.314 1.00 369.39 ? 390  VAL A O   1 
ATOM   2782  C CB  . VAL A 1 390 ? 141.095 189.918 136.336 1.00 393.48 ? 390  VAL A CB  1 
ATOM   2783  C CG1 . VAL A 1 390 ? 140.363 188.678 136.844 1.00 395.92 ? 390  VAL A CG1 1 
ATOM   2784  C CG2 . VAL A 1 390 ? 141.442 189.753 134.860 1.00 411.59 ? 390  VAL A CG2 1 
ATOM   2785  N N   . ARG A 1 391 ? 140.691 191.651 138.899 1.00 362.48 ? 391  ARG A N   1 
ATOM   2786  C CA  . ARG A 1 391 ? 140.377 191.737 140.320 1.00 368.30 ? 391  ARG A CA  1 
ATOM   2787  C C   . ARG A 1 391 ? 139.288 192.773 140.565 1.00 357.25 ? 391  ARG A C   1 
ATOM   2788  O O   . ARG A 1 391 ? 138.383 192.560 141.372 1.00 328.88 ? 391  ARG A O   1 
ATOM   2789  C CB  . ARG A 1 391 ? 141.629 192.088 141.126 1.00 380.74 ? 391  ARG A CB  1 
ATOM   2790  C CG  . ARG A 1 391 ? 141.349 192.488 142.566 1.00 391.30 ? 391  ARG A CG  1 
ATOM   2791  C CD  . ARG A 1 391 ? 142.197 191.683 143.537 1.00 398.99 ? 391  ARG A CD  1 
ATOM   2792  N NE  . ARG A 1 391 ? 143.181 192.515 144.222 1.00 406.85 ? 391  ARG A NE  1 
ATOM   2793  C CZ  . ARG A 1 391 ? 143.159 192.780 145.525 1.00 413.55 ? 391  ARG A CZ  1 
ATOM   2794  N NH1 . ARG A 1 391 ? 142.200 192.277 146.289 1.00 418.66 ? 391  ARG A NH1 1 
ATOM   2795  N NH2 . ARG A 1 391 ? 144.097 193.548 146.063 1.00 418.31 ? 391  ARG A NH2 1 
ATOM   2796  N N   . ASN A 1 392 ? 139.381 193.893 139.858 1.00 366.84 ? 392  ASN A N   1 
ATOM   2797  C CA  . ASN A 1 392 ? 138.371 194.954 139.951 1.00 373.90 ? 392  ASN A CA  1 
ATOM   2798  C C   . ASN A 1 392 ? 136.995 194.399 139.578 1.00 366.31 ? 392  ASN A C   1 
ATOM   2799  O O   . ASN A 1 392 ? 135.998 194.638 140.282 1.00 387.78 ? 392  ASN A O   1 
ATOM   2800  C CB  . ASN A 1 392 ? 138.731 196.173 139.091 1.00 399.50 ? 392  ASN A CB  1 
ATOM   2801  C CG  . ASN A 1 392 ? 139.915 196.957 139.641 1.00 414.49 ? 392  ASN A CG  1 
ATOM   2802  O OD1 . ASN A 1 392 ? 140.606 196.516 140.563 1.00 407.13 ? 392  ASN A OD1 1 
ATOM   2803  N ND2 . ASN A 1 392 ? 140.156 198.131 139.068 1.00 423.47 ? 392  ASN A ND2 1 
ATOM   2804  N N   . GLN A 1 393 ? 136.987 193.665 138.471 1.00 365.44 ? 393  GLN A N   1 
ATOM   2805  C CA  . GLN A 1 393 ? 135.768 193.049 137.944 1.00 363.17 ? 393  GLN A CA  1 
ATOM   2806  C C   . GLN A 1 393 ? 135.154 192.116 138.987 1.00 349.14 ? 393  GLN A C   1 
ATOM   2807  O O   . GLN A 1 393 ? 133.939 192.148 139.241 1.00 357.01 ? 393  GLN A O   1 
ATOM   2808  C CB  . GLN A 1 393 ? 135.996 192.349 136.605 1.00 377.53 ? 393  GLN A CB  1 
ATOM   2809  C CG  . GLN A 1 393 ? 136.157 193.307 135.435 1.00 405.02 ? 393  GLN A CG  1 
ATOM   2810  C CD  . GLN A 1 393 ? 136.481 192.603 134.127 1.00 443.33 ? 393  GLN A CD  1 
ATOM   2811  O OE1 . GLN A 1 393 ? 136.064 191.467 133.894 1.00 459.10 ? 393  GLN A OE1 1 
ATOM   2812  N NE2 . GLN A 1 393 ? 137.224 193.284 133.261 1.00 456.18 ? 393  GLN A NE2 1 
ATOM   2813  N N   . VAL A 1 394 ? 136.026 191.308 139.572 1.00 330.86 ? 394  VAL A N   1 
ATOM   2814  C CA  . VAL A 1 394 ? 135.644 190.336 140.602 1.00 320.50 ? 394  VAL A CA  1 
ATOM   2815  C C   . VAL A 1 394 ? 134.990 191.048 141.777 1.00 327.95 ? 394  VAL A C   1 
ATOM   2816  O O   . VAL A 1 394 ? 133.939 190.624 142.276 1.00 336.40 ? 394  VAL A O   1 
ATOM   2817  C CB  . VAL A 1 394 ? 136.844 189.473 141.079 1.00 327.28 ? 394  VAL A CB  1 
ATOM   2818  C CG1 . VAL A 1 394 ? 136.472 188.635 142.300 1.00 318.05 ? 394  VAL A CG1 1 
ATOM   2819  C CG2 . VAL A 1 394 ? 137.351 188.575 139.950 1.00 340.87 ? 394  VAL A CG2 1 
ATOM   2820  N N   . GLU A 1 395 ? 135.637 192.128 142.192 1.00 343.60 ? 395  GLU A N   1 
ATOM   2821  C CA  . GLU A 1 395 ? 135.171 192.958 143.311 1.00 358.16 ? 395  GLU A CA  1 
ATOM   2822  C C   . GLU A 1 395 ? 133.772 193.480 143.026 1.00 348.60 ? 395  GLU A C   1 
ATOM   2823  O O   . GLU A 1 395 ? 132.885 193.419 143.888 1.00 366.08 ? 395  GLU A O   1 
ATOM   2824  C CB  . GLU A 1 395 ? 136.133 194.116 143.619 1.00 395.59 ? 395  GLU A CB  1 
ATOM   2825  C CG  . GLU A 1 395 ? 137.405 193.695 144.348 1.00 425.19 ? 395  GLU A CG  1 
ATOM   2826  C CD  . GLU A 1 395 ? 137.161 193.256 145.784 1.00 426.19 ? 395  GLU A CD  1 
ATOM   2827  O OE1 . GLU A 1 395 ? 136.482 193.991 146.534 1.00 427.76 ? 395  GLU A OE1 1 
ATOM   2828  O OE2 . GLU A 1 395 ? 137.658 192.176 146.167 1.00 420.52 ? 395  GLU A OE2 1 
ATOM   2829  N N   . ASP A 1 396 ? 133.610 193.982 141.809 1.00 359.13 ? 396  ASP A N   1 
ATOM   2830  C CA  . ASP A 1 396 ? 132.335 194.536 141.335 1.00 377.60 ? 396  ASP A CA  1 
ATOM   2831  C C   . ASP A 1 396 ? 131.238 193.474 141.434 1.00 358.12 ? 396  ASP A C   1 
ATOM   2832  O O   . ASP A 1 396 ? 130.131 193.742 141.931 1.00 363.61 ? 396  ASP A O   1 
ATOM   2833  C CB  . ASP A 1 396 ? 132.461 195.054 139.894 1.00 387.27 ? 396  ASP A CB  1 
ATOM   2834  C CG  . ASP A 1 396 ? 131.165 195.650 139.364 1.00 407.75 ? 396  ASP A CG  1 
ATOM   2835  O OD1 . ASP A 1 396 ? 130.572 196.506 140.055 1.00 427.32 ? 396  ASP A OD1 1 
ATOM   2836  O OD2 . ASP A 1 396 ? 130.743 195.265 138.253 1.00 402.81 ? 396  ASP A OD2 1 
ATOM   2837  N N   . LEU A 1 397 ? 131.585 192.289 140.950 1.00 350.86 ? 397  LEU A N   1 
ATOM   2838  C CA  . LEU A 1 397 ? 130.680 191.137 140.943 1.00 349.04 ? 397  LEU A CA  1 
ATOM   2839  C C   . LEU A 1 397 ? 130.224 190.820 142.370 1.00 343.31 ? 397  LEU A C   1 
ATOM   2840  O O   . LEU A 1 397 ? 129.026 190.611 142.632 1.00 354.94 ? 397  LEU A O   1 
ATOM   2841  C CB  . LEU A 1 397 ? 131.361 189.918 140.304 1.00 367.69 ? 397  LEU A CB  1 
ATOM   2842  C CG  . LEU A 1 397 ? 130.689 188.544 140.384 1.00 368.26 ? 397  LEU A CG  1 
ATOM   2843  C CD1 . LEU A 1 397 ? 129.229 188.606 139.970 1.00 366.17 ? 397  LEU A CD1 1 
ATOM   2844  C CD2 . LEU A 1 397 ? 131.455 187.548 139.524 1.00 369.92 ? 397  LEU A CD2 1 
ATOM   2845  N N   . LEU A 1 398 ? 131.208 190.797 143.259 1.00 335.30 ? 398  LEU A N   1 
ATOM   2846  C CA  . LEU A 1 398 ? 130.984 190.510 144.679 1.00 339.28 ? 398  LEU A CA  1 
ATOM   2847  C C   . LEU A 1 398 ? 130.008 191.516 145.272 1.00 355.58 ? 398  LEU A C   1 
ATOM   2848  O O   . LEU A 1 398 ? 129.067 191.145 145.985 1.00 337.70 ? 398  LEU A O   1 
ATOM   2849  C CB  . LEU A 1 398 ? 132.293 190.441 145.464 1.00 339.38 ? 398  LEU A CB  1 
ATOM   2850  C CG  . LEU A 1 398 ? 133.185 189.249 145.095 1.00 335.21 ? 398  LEU A CG  1 
ATOM   2851  C CD1 . LEU A 1 398 ? 134.630 189.521 145.496 1.00 354.20 ? 398  LEU A CD1 1 
ATOM   2852  C CD2 . LEU A 1 398 ? 132.678 187.954 145.714 1.00 325.74 ? 398  LEU A CD2 1 
ATOM   2853  N N   . ALA A 1 399 ? 130.257 192.777 144.953 1.00 369.74 ? 399  ALA A N   1 
ATOM   2854  C CA  . ALA A 1 399 ? 129.433 193.901 145.418 1.00 379.91 ? 399  ALA A CA  1 
ATOM   2855  C C   . ALA A 1 399 ? 127.990 193.705 144.972 1.00 348.03 ? 399  ALA A C   1 
ATOM   2856  O O   . ALA A 1 399 ? 127.052 193.868 145.767 1.00 345.95 ? 399  ALA A O   1 
ATOM   2857  C CB  . ALA A 1 399 ? 129.979 195.229 144.906 1.00 385.55 ? 399  ALA A CB  1 
ATOM   2858  N N   . THR A 1 400 ? 127.852 193.357 143.698 1.00 325.56 ? 400  THR A N   1 
ATOM   2859  C CA  . THR A 1 400 ? 126.544 193.125 143.075 1.00 343.04 ? 400  THR A CA  1 
ATOM   2860  C C   . THR A 1 400 ? 125.796 192.024 143.828 1.00 331.49 ? 400  THR A C   1 
ATOM   2861  O O   . THR A 1 400 ? 124.603 192.166 144.147 1.00 348.59 ? 400  THR A O   1 
ATOM   2862  C CB  . THR A 1 400 ? 126.599 192.789 141.560 1.00 356.52 ? 400  THR A CB  1 
ATOM   2863  O OG1 . THR A 1 400 ? 127.307 191.564 141.342 1.00 345.42 ? 400  THR A OG1 1 
ATOM   2864  C CG2 . THR A 1 400 ? 127.240 193.922 140.750 1.00 367.33 ? 400  THR A CG2 1 
ATOM   2865  N N   . LEU A 1 401 ? 126.530 190.950 144.090 1.00 322.20 ? 401  LEU A N   1 
ATOM   2866  C CA  . LEU A 1 401 ? 125.998 189.784 144.800 1.00 329.96 ? 401  LEU A CA  1 
ATOM   2867  C C   . LEU A 1 401 ? 125.477 190.196 146.175 1.00 343.67 ? 401  LEU A C   1 
ATOM   2868  O O   . LEU A 1 401 ? 124.373 189.809 146.582 1.00 340.08 ? 401  LEU A O   1 
ATOM   2869  C CB  . LEU A 1 401 ? 127.022 188.648 144.898 1.00 344.31 ? 401  LEU A CB  1 
ATOM   2870  C CG  . LEU A 1 401 ? 126.947 187.684 143.711 1.00 346.28 ? 401  LEU A CG  1 
ATOM   2871  C CD1 . LEU A 1 401 ? 128.287 187.016 143.448 1.00 355.61 ? 401  LEU A CD1 1 
ATOM   2872  C CD2 . LEU A 1 401 ? 125.854 186.653 143.952 1.00 354.63 ? 401  LEU A CD2 1 
ATOM   2873  N N   . GLU A 1 402 ? 126.297 190.983 146.855 1.00 359.55 ? 402  GLU A N   1 
ATOM   2874  C CA  . GLU A 1 402 ? 125.984 191.493 148.195 1.00 364.82 ? 402  GLU A CA  1 
ATOM   2875  C C   . GLU A 1 402 ? 124.687 192.290 148.163 1.00 368.40 ? 402  GLU A C   1 
ATOM   2876  O O   . GLU A 1 402 ? 123.808 192.111 149.016 1.00 365.53 ? 402  GLU A O   1 
ATOM   2877  C CB  . GLU A 1 402 ? 127.143 192.313 148.776 1.00 379.80 ? 402  GLU A CB  1 
ATOM   2878  C CG  . GLU A 1 402 ? 128.306 191.446 149.245 1.00 395.24 ? 402  GLU A CG  1 
ATOM   2879  C CD  . GLU A 1 402 ? 129.532 192.240 149.667 1.00 410.56 ? 402  GLU A CD  1 
ATOM   2880  O OE1 . GLU A 1 402 ? 129.875 193.239 148.996 1.00 427.25 ? 402  GLU A OE1 1 
ATOM   2881  O OE2 . GLU A 1 402 ? 130.169 191.852 150.670 1.00 415.91 ? 402  GLU A OE2 1 
ATOM   2882  N N   . LYS A 1 403 ? 124.602 193.157 147.163 1.00 373.95 ? 403  LYS A N   1 
ATOM   2883  C CA  . LYS A 1 403 ? 123.434 194.020 146.951 1.00 368.19 ? 403  LYS A CA  1 
ATOM   2884  C C   . LYS A 1 403 ? 122.179 193.168 146.786 1.00 365.64 ? 403  LYS A C   1 
ATOM   2885  O O   . LYS A 1 403 ? 121.135 193.441 147.403 1.00 388.81 ? 403  LYS A O   1 
ATOM   2886  C CB  . LYS A 1 403 ? 123.626 194.931 145.731 1.00 383.06 ? 403  LYS A CB  1 
ATOM   2887  C CG  . LYS A 1 403 ? 122.647 196.092 145.659 1.00 410.16 ? 403  LYS A CG  1 
ATOM   2888  C CD  . LYS A 1 403 ? 122.804 196.867 144.362 1.00 429.95 ? 403  LYS A CD  1 
ATOM   2889  C CE  . LYS A 1 403 ? 121.863 198.059 144.304 1.00 456.41 ? 403  LYS A CE  1 
ATOM   2890  N NZ  . LYS A 1 403 ? 121.950 198.777 143.002 1.00 465.84 ? 403  LYS A NZ  1 
ATOM   2891  N N   . SER A 1 404 ? 122.321 192.146 145.952 1.00 359.21 ? 404  SER A N   1 
ATOM   2892  C CA  . SER A 1 404 ? 121.234 191.208 145.655 1.00 364.38 ? 404  SER A CA  1 
ATOM   2893  C C   . SER A 1 404 ? 120.744 190.546 146.942 1.00 338.31 ? 404  SER A C   1 
ATOM   2894  O O   . SER A 1 404 ? 119.535 190.454 147.194 1.00 317.01 ? 404  SER A O   1 
ATOM   2895  C CB  . SER A 1 404 ? 121.660 190.165 144.613 1.00 378.94 ? 404  SER A CB  1 
ATOM   2896  O OG  . SER A 1 404 ? 122.579 189.226 145.133 1.00 396.39 ? 404  SER A OG  1 
ATOM   2897  N N   . GLY A 1 405 ? 121.713 190.102 147.730 1.00 337.28 ? 405  GLY A N   1 
ATOM   2898  C CA  . GLY A 1 405 ? 121.463 189.436 149.010 1.00 363.60 ? 405  GLY A CA  1 
ATOM   2899  C C   . GLY A 1 405 ? 120.802 190.316 150.054 1.00 369.69 ? 405  GLY A C   1 
ATOM   2900  O O   . GLY A 1 405 ? 120.087 189.829 150.923 1.00 376.17 ? 405  GLY A O   1 
ATOM   2901  N N   . ALA A 1 406 ? 121.110 191.603 149.983 1.00 365.30 ? 406  ALA A N   1 
ATOM   2902  C CA  . ALA A 1 406 ? 120.495 192.637 150.815 1.00 382.52 ? 406  ALA A CA  1 
ATOM   2903  C C   . ALA A 1 406 ? 118.974 192.566 150.816 1.00 393.63 ? 406  ALA A C   1 
ATOM   2904  O O   . ALA A 1 406 ? 118.353 192.586 151.884 1.00 382.18 ? 406  ALA A O   1 
ATOM   2905  C CB  . ALA A 1 406 ? 120.959 194.035 150.411 1.00 389.09 ? 406  ALA A CB  1 
ATOM   2906  N N   . GLY A 1 407 ? 118.386 192.472 149.625 1.00 396.02 ? 407  GLY A N   1 
ATOM   2907  C CA  . GLY A 1 407 ? 116.931 192.461 149.461 1.00 400.93 ? 407  GLY A CA  1 
ATOM   2908  C C   . GLY A 1 407 ? 116.172 191.355 150.182 1.00 403.12 ? 407  GLY A C   1 
ATOM   2909  O O   . GLY A 1 407 ? 114.993 191.532 150.500 1.00 411.31 ? 407  GLY A O   1 
ATOM   2910  N N   . VAL A 1 408 ? 116.835 190.222 150.430 1.00 405.24 ? 408  VAL A N   1 
ATOM   2911  C CA  . VAL A 1 408 ? 116.255 189.114 151.204 1.00 398.83 ? 408  VAL A CA  1 
ATOM   2912  C C   . VAL A 1 408 ? 117.162 188.766 152.402 1.00 388.10 ? 408  VAL A C   1 
ATOM   2913  O O   . VAL A 1 408 ? 118.302 188.338 152.216 1.00 354.75 ? 408  VAL A O   1 
ATOM   2914  C CB  . VAL A 1 408 ? 115.954 187.873 150.314 1.00 385.96 ? 408  VAL A CB  1 
ATOM   2915  C CG1 . VAL A 1 408 ? 117.222 187.234 149.752 1.00 365.51 ? 408  VAL A CG1 1 
ATOM   2916  C CG2 . VAL A 1 408 ? 115.116 186.849 151.075 1.00 395.05 ? 408  VAL A CG2 1 
ATOM   2917  N N   . PRO A 1 409 ? 116.658 188.951 153.642 1.00 387.53 ? 409  PRO A N   1 
ATOM   2918  C CA  . PRO A 1 409 ? 117.505 188.754 154.823 1.00 396.86 ? 409  PRO A CA  1 
ATOM   2919  C C   . PRO A 1 409 ? 117.835 187.291 155.150 1.00 387.79 ? 409  PRO A C   1 
ATOM   2920  O O   . PRO A 1 409 ? 118.784 187.038 155.896 1.00 390.16 ? 409  PRO A O   1 
ATOM   2921  C CB  . PRO A 1 409 ? 116.670 189.373 155.946 1.00 418.24 ? 409  PRO A CB  1 
ATOM   2922  C CG  . PRO A 1 409 ? 115.265 189.135 155.521 1.00 411.61 ? 409  PRO A CG  1 
ATOM   2923  C CD  . PRO A 1 409 ? 115.262 189.247 154.023 1.00 395.95 ? 409  PRO A CD  1 
ATOM   2924  N N   . ALA A 1 410 ? 117.064 186.349 154.601 1.00 370.48 ? 410  ALA A N   1 
ATOM   2925  C CA  . ALA A 1 410 ? 117.275 184.913 154.833 1.00 375.53 ? 410  ALA A CA  1 
ATOM   2926  C C   . ALA A 1 410 ? 118.610 184.359 154.313 1.00 361.44 ? 410  ALA A C   1 
ATOM   2927  O O   . ALA A 1 410 ? 119.043 183.292 154.755 1.00 362.72 ? 410  ALA A O   1 
ATOM   2928  C CB  . ALA A 1 410 ? 116.122 184.117 154.238 1.00 392.72 ? 410  ALA A CB  1 
ATOM   2929  N N   . VAL A 1 411 ? 119.242 185.063 153.372 1.00 340.38 ? 411  VAL A N   1 
ATOM   2930  C CA  . VAL A 1 411 ? 120.559 184.692 152.854 1.00 325.01 ? 411  VAL A CA  1 
ATOM   2931  C C   . VAL A 1 411 ? 121.580 185.760 153.237 1.00 324.83 ? 411  VAL A C   1 
ATOM   2932  O O   . VAL A 1 411 ? 121.760 186.744 152.509 1.00 312.31 ? 411  VAL A O   1 
ATOM   2933  C CB  . VAL A 1 411 ? 120.541 184.552 151.311 1.00 339.68 ? 411  VAL A CB  1 
ATOM   2934  C CG1 . VAL A 1 411 ? 121.879 184.020 150.794 1.00 338.78 ? 411  VAL A CG1 1 
ATOM   2935  C CG2 . VAL A 1 411 ? 119.366 183.696 150.838 1.00 337.52 ? 411  VAL A CG2 1 
ATOM   2936  N N   . ILE A 1 412 ? 122.237 185.577 154.383 1.00 337.69 ? 412  ILE A N   1 
ATOM   2937  C CA  . ILE A 1 412 ? 123.406 186.398 154.724 1.00 343.19 ? 412  ILE A CA  1 
ATOM   2938  C C   . ILE A 1 412 ? 124.584 185.914 153.870 1.00 332.01 ? 412  ILE A C   1 
ATOM   2939  O O   . ILE A 1 412 ? 124.827 184.710 153.742 1.00 323.90 ? 412  ILE A O   1 
ATOM   2940  C CB  . ILE A 1 412 ? 123.725 186.422 156.241 1.00 356.82 ? 412  ILE A CB  1 
ATOM   2941  C CG1 . ILE A 1 412 ? 124.688 187.572 156.562 1.00 394.79 ? 412  ILE A CG1 1 
ATOM   2942  C CG2 . ILE A 1 412 ? 124.298 185.101 156.736 1.00 357.12 ? 412  ILE A CG2 1 
ATOM   2943  C CD1 . ILE A 1 412 ? 124.949 187.756 158.042 1.00 429.10 ? 412  ILE A CD1 1 
ATOM   2944  N N   . LEU A 1 413 ? 125.286 186.868 153.268 1.00 344.85 ? 413  LEU A N   1 
ATOM   2945  C CA  . LEU A 1 413 ? 126.217 186.594 152.180 1.00 344.29 ? 413  LEU A CA  1 
ATOM   2946  C C   . LEU A 1 413 ? 127.572 187.174 152.553 1.00 358.97 ? 413  LEU A C   1 
ATOM   2947  O O   . LEU A 1 413 ? 127.674 188.355 152.893 1.00 380.09 ? 413  LEU A O   1 
ATOM   2948  C CB  . LEU A 1 413 ? 125.680 187.211 150.884 1.00 348.82 ? 413  LEU A CB  1 
ATOM   2949  C CG  . LEU A 1 413 ? 125.791 186.334 149.636 1.00 344.79 ? 413  LEU A CG  1 
ATOM   2950  C CD1 . LEU A 1 413 ? 124.835 186.785 148.543 1.00 348.07 ? 413  LEU A CD1 1 
ATOM   2951  C CD2 . LEU A 1 413 ? 127.219 186.328 149.132 1.00 340.74 ? 413  LEU A CD2 1 
ATOM   2952  N N   . ARG A 1 414 ? 128.605 186.337 152.479 1.00 357.28 ? 414  ARG A N   1 
ATOM   2953  C CA  . ARG A 1 414 ? 129.895 186.631 153.092 1.00 357.44 ? 414  ARG A CA  1 
ATOM   2954  C C   . ARG A 1 414 ? 131.052 186.232 152.178 1.00 343.93 ? 414  ARG A C   1 
ATOM   2955  O O   . ARG A 1 414 ? 130.908 185.354 151.328 1.00 372.32 ? 414  ARG A O   1 
ATOM   2956  C CB  . ARG A 1 414 ? 129.982 185.883 154.427 1.00 367.10 ? 414  ARG A CB  1 
ATOM   2957  C CG  . ARG A 1 414 ? 130.917 186.504 155.450 1.00 387.19 ? 414  ARG A CG  1 
ATOM   2958  C CD  . ARG A 1 414 ? 130.701 185.888 156.825 1.00 391.72 ? 414  ARG A CD  1 
ATOM   2959  N NE  . ARG A 1 414 ? 131.689 186.354 157.799 1.00 417.39 ? 414  ARG A NE  1 
ATOM   2960  C CZ  . ARG A 1 414 ? 131.676 187.540 158.415 1.00 449.57 ? 414  ARG A CZ  1 
ATOM   2961  N NH1 . ARG A 1 414 ? 130.719 188.441 158.178 1.00 459.58 ? 414  ARG A NH1 1 
ATOM   2962  N NH2 . ARG A 1 414 ? 132.641 187.835 159.284 1.00 465.21 ? 414  ARG A NH2 1 
ATOM   2963  N N   . ARG A 1 415 ? 132.192 186.895 152.357 1.00 346.50 ? 415  ARG A N   1 
ATOM   2964  C CA  . ARG A 1 415 ? 133.431 186.545 151.660 1.00 339.60 ? 415  ARG A CA  1 
ATOM   2965  C C   . ARG A 1 415 ? 134.119 185.456 152.475 1.00 335.10 ? 415  ARG A C   1 
ATOM   2966  O O   . ARG A 1 415 ? 133.842 185.334 153.666 1.00 332.36 ? 415  ARG A O   1 
ATOM   2967  C CB  . ARG A 1 415 ? 134.368 187.756 151.572 1.00 360.50 ? 415  ARG A CB  1 
ATOM   2968  C CG  . ARG A 1 415 ? 133.768 189.013 150.959 1.00 369.59 ? 415  ARG A CG  1 
ATOM   2969  C CD  . ARG A 1 415 ? 133.725 188.944 149.445 1.00 379.62 ? 415  ARG A CD  1 
ATOM   2970  N NE  . ARG A 1 415 ? 133.077 190.126 148.876 1.00 393.45 ? 415  ARG A NE  1 
ATOM   2971  C CZ  . ARG A 1 415 ? 133.639 191.329 148.733 1.00 392.59 ? 415  ARG A CZ  1 
ATOM   2972  N NH1 . ARG A 1 415 ? 134.895 191.564 149.122 1.00 395.58 ? 415  ARG A NH1 1 
ATOM   2973  N NH2 . ARG A 1 415 ? 132.930 192.320 148.195 1.00 383.46 ? 415  ARG A NH2 1 
ATOM   2974  N N   . PRO A 1 416 ? 135.041 184.705 151.895 1.00 367.10 ? 416  PRO A N   1 
ATOM   2975  C CA  . PRO A 1 416 ? 135.892 183.832 152.706 1.00 367.52 ? 416  PRO A CA  1 
ATOM   2976  C C   . PRO A 1 416 ? 137.084 184.670 153.131 1.00 359.32 ? 416  PRO A C   1 
ATOM   2977  O O   . PRO A 1 416 ? 137.708 185.282 152.277 1.00 350.45 ? 416  PRO A O   1 
ATOM   2978  C CB  . PRO A 1 416 ? 136.327 182.771 151.715 1.00 370.48 ? 416  PRO A CB  1 
ATOM   2979  C CG  . PRO A 1 416 ? 136.407 183.512 150.431 1.00 394.83 ? 416  PRO A CG  1 
ATOM   2980  C CD  . PRO A 1 416 ? 135.291 184.522 150.459 1.00 390.99 ? 416  PRO A CD  1 
ATOM   2981  N N   . ASN A 1 417 ? 137.393 184.727 154.423 1.00 384.14 ? 417  ASN A N   1 
ATOM   2982  C CA  . ASN A 1 417 ? 138.371 185.701 154.920 1.00 409.78 ? 417  ASN A CA  1 
ATOM   2983  C C   . ASN A 1 417 ? 139.809 185.574 154.404 1.00 406.12 ? 417  ASN A C   1 
ATOM   2984  O O   . ASN A 1 417 ? 140.444 186.569 154.062 1.00 388.44 ? 417  ASN A O   1 
ATOM   2985  C CB  . ASN A 1 417 ? 138.359 185.742 156.459 1.00 445.43 ? 417  ASN A CB  1 
ATOM   2986  C CG  . ASN A 1 417 ? 139.317 184.742 157.085 1.00 461.27 ? 417  ASN A CG  1 
ATOM   2987  O OD1 . ASN A 1 417 ? 140.529 184.836 156.904 1.00 458.89 ? 417  ASN A OD1 1 
ATOM   2988  N ND2 . ASN A 1 417 ? 138.776 183.778 157.815 1.00 471.13 ? 417  ASN A ND2 1 
ATOM   2989  N N   . GLN A 1 418 ? 140.316 184.352 154.363 1.00 419.35 ? 418  GLN A N   1 
ATOM   2990  C CA  . GLN A 1 418 ? 141.697 184.122 153.968 1.00 423.42 ? 418  GLN A CA  1 
ATOM   2991  C C   . GLN A 1 418 ? 141.850 184.155 152.464 1.00 384.82 ? 418  GLN A C   1 
ATOM   2992  O O   . GLN A 1 418 ? 140.863 184.154 151.744 1.00 351.55 ? 418  GLN A O   1 
ATOM   2993  C CB  . GLN A 1 418 ? 142.212 182.796 154.524 1.00 454.69 ? 418  GLN A CB  1 
ATOM   2994  C CG  . GLN A 1 418 ? 143.172 182.948 155.696 1.00 476.06 ? 418  GLN A CG  1 
ATOM   2995  C CD  . GLN A 1 418 ? 144.423 183.741 155.352 1.00 486.95 ? 418  GLN A CD  1 
ATOM   2996  O OE1 . GLN A 1 418 ? 145.405 183.719 156.094 1.00 492.03 ? 418  GLN A OE1 1 
ATOM   2997  N NE2 . GLN A 1 418 ? 144.393 184.447 154.229 1.00 494.46 ? 418  GLN A NE2 1 
ATOM   2998  N N   . SER A 1 419 ? 143.090 184.155 151.990 1.00 394.36 ? 419  SER A N   1 
ATOM   2999  C CA  . SER A 1 419 ? 143.343 184.002 150.565 1.00 397.78 ? 419  SER A CA  1 
ATOM   3000  C C   . SER A 1 419 ? 143.363 182.516 150.225 1.00 381.80 ? 419  SER A C   1 
ATOM   3001  O O   . SER A 1 419 ? 144.409 181.952 149.911 1.00 361.21 ? 419  SER A O   1 
ATOM   3002  C CB  . SER A 1 419 ? 144.668 184.655 150.176 1.00 400.61 ? 419  SER A CB  1 
ATOM   3003  O OG  . SER A 1 419 ? 145.756 183.763 150.351 1.00 397.38 ? 419  SER A OG  1 
ATOM   3004  N N   . GLN A 1 420 ? 142.196 181.892 150.306 1.00 355.94 ? 420  GLN A N   1 
ATOM   3005  C CA  . GLN A 1 420 ? 142.050 180.465 150.072 1.00 329.71 ? 420  GLN A CA  1 
ATOM   3006  C C   . GLN A 1 420 ? 142.161 180.070 148.614 1.00 327.43 ? 420  GLN A C   1 
ATOM   3007  O O   . GLN A 1 420 ? 141.811 180.844 147.726 1.00 350.92 ? 420  GLN A O   1 
ATOM   3008  C CB  . GLN A 1 420 ? 140.712 179.984 150.617 1.00 325.18 ? 420  GLN A CB  1 
ATOM   3009  C CG  . GLN A 1 420 ? 140.695 179.794 152.117 1.00 339.71 ? 420  GLN A CG  1 
ATOM   3010  C CD  . GLN A 1 420 ? 139.722 178.725 152.533 1.00 353.97 ? 420  GLN A CD  1 
ATOM   3011  O OE1 . GLN A 1 420 ? 140.091 177.566 152.693 1.00 348.56 ? 420  GLN A OE1 1 
ATOM   3012  N NE2 . GLN A 1 420 ? 138.463 179.103 152.696 1.00 370.30 ? 420  GLN A NE2 1 
ATOM   3013  N N   . PRO A 1 421 ? 142.666 178.781 148.388 1.00 316.48 ? 421  PRO A N   1 
ATOM   3014  C CA  . PRO A 1 421 ? 142.599 178.373 146.979 1.00 305.08 ? 421  PRO A CA  1 
ATOM   3015  C C   . PRO A 1 421 ? 141.165 178.049 146.621 1.00 327.64 ? 421  PRO A C   1 
ATOM   3016  O O   . PRO A 1 421 ? 140.409 177.664 147.499 1.00 372.53 ? 421  PRO A O   1 
ATOM   3017  C CB  . PRO A 1 421 ? 143.417 177.097 146.945 1.00 327.68 ? 421  PRO A CB  1 
ATOM   3018  C CG  . PRO A 1 421 ? 143.057 176.437 148.212 1.00 354.14 ? 421  PRO A CG  1 
ATOM   3019  C CD  . PRO A 1 421 ? 143.225 177.568 149.169 1.00 346.17 ? 421  PRO A CD  1 
ATOM   3020  N N   . LEU A 1 422 ? 140.799 178.184 145.355 1.00 321.34 ? 422  LEU A N   1 
ATOM   3021  C CA  . LEU A 1 422 ? 139.431 177.932 144.922 1.00 312.62 ? 422  LEU A CA  1 
ATOM   3022  C C   . LEU A 1 422 ? 139.011 176.479 145.121 1.00 295.42 ? 422  LEU A C   1 
ATOM   3023  O O   . LEU A 1 422 ? 139.801 175.572 144.869 1.00 287.95 ? 422  LEU A O   1 
ATOM   3024  C CB  . LEU A 1 422 ? 139.307 178.297 143.454 1.00 307.83 ? 422  LEU A CB  1 
ATOM   3025  C CG  . LEU A 1 422 ? 137.974 178.872 143.036 1.00 314.04 ? 422  LEU A CG  1 
ATOM   3026  C CD1 . LEU A 1 422 ? 138.038 179.277 141.578 1.00 326.57 ? 422  LEU A CD1 1 
ATOM   3027  C CD2 . LEU A 1 422 ? 136.944 177.788 143.245 1.00 338.47 ? 422  LEU A CD2 1 
ATOM   3028  N N   . PRO A 1 423 ? 137.698 176.269 145.577 1.00 299.66 ? 423  PRO A N   1 
ATOM   3029  C CA  . PRO A 1 423 ? 137.339 174.846 145.699 1.00 286.25 ? 423  PRO A CA  1 
ATOM   3030  C C   . PRO A 1 423 ? 137.149 174.277 144.319 1.00 303.09 ? 423  PRO A C   1 
ATOM   3031  O O   . PRO A 1 423 ? 136.993 175.081 143.403 1.00 316.48 ? 423  PRO A O   1 
ATOM   3032  C CB  . PRO A 1 423 ? 135.995 174.877 146.405 1.00 284.95 ? 423  PRO A CB  1 
ATOM   3033  C CG  . PRO A 1 423 ? 135.344 176.045 145.812 1.00 304.48 ? 423  PRO A CG  1 
ATOM   3034  C CD  . PRO A 1 423 ? 136.427 177.057 145.955 1.00 309.26 ? 423  PRO A CD  1 
ATOM   3035  N N   . PRO A 1 424 ? 137.179 172.881 144.170 1.00 302.92 ? 424  PRO A N   1 
ATOM   3036  C CA  . PRO A 1 424 ? 137.029 172.464 142.766 1.00 317.81 ? 424  PRO A CA  1 
ATOM   3037  C C   . PRO A 1 424 ? 135.675 172.883 142.214 1.00 324.41 ? 424  PRO A C   1 
ATOM   3038  O O   . PRO A 1 424 ? 134.669 172.680 142.874 1.00 334.39 ? 424  PRO A O   1 
ATOM   3039  C CB  . PRO A 1 424 ? 137.100 170.939 142.836 1.00 330.51 ? 424  PRO A CB  1 
ATOM   3040  C CG  . PRO A 1 424 ? 136.546 170.608 144.161 1.00 335.80 ? 424  PRO A CG  1 
ATOM   3041  C CD  . PRO A 1 424 ? 137.273 171.587 145.003 1.00 301.02 ? 424  PRO A CD  1 
ATOM   3042  N N   . SER A 1 425 ? 135.649 173.460 141.021 1.00 324.22 ? 425  SER A N   1 
ATOM   3043  C CA  . SER A 1 425 ? 134.390 173.773 140.369 1.00 317.53 ? 425  SER A CA  1 
ATOM   3044  C C   . SER A 1 425 ? 134.546 173.995 138.878 1.00 301.44 ? 425  SER A C   1 
ATOM   3045  O O   . SER A 1 425 ? 135.625 174.312 138.400 1.00 303.08 ? 425  SER A O   1 
ATOM   3046  C CB  . SER A 1 425 ? 133.790 175.003 141.002 1.00 305.74 ? 425  SER A CB  1 
ATOM   3047  O OG  . SER A 1 425 ? 134.633 175.441 142.031 1.00 318.92 ? 425  SER A OG  1 
ATOM   3048  N N   . SER A 1 426 ? 133.449 173.882 138.149 1.00 282.37 ? 426  SER A N   1 
ATOM   3049  C CA  . SER A 1 426 ? 133.494 174.039 136.719 1.00 295.71 ? 426  SER A CA  1 
ATOM   3050  C C   . SER A 1 426 ? 134.209 175.362 136.543 1.00 320.19 ? 426  SER A C   1 
ATOM   3051  O O   . SER A 1 426 ? 134.982 175.534 135.601 1.00 345.24 ? 426  SER A O   1 
ATOM   3052  C CB  . SER A 1 426 ? 132.085 174.110 136.135 1.00 316.93 ? 426  SER A CB  1 
ATOM   3053  O OG  . SER A 1 426 ? 131.204 173.239 136.823 1.00 351.40 ? 426  SER A OG  1 
ATOM   3054  N N   . LEU A 1 427 ? 133.956 176.305 137.448 1.00 323.52 ? 427  LEU A N   1 
ATOM   3055  C CA  . LEU A 1 427 ? 134.604 177.588 137.323 1.00 321.32 ? 427  LEU A CA  1 
ATOM   3056  C C   . LEU A 1 427 ? 136.101 177.395 137.197 1.00 320.78 ? 427  LEU A C   1 
ATOM   3057  O O   . LEU A 1 427 ? 136.729 178.105 136.452 1.00 331.48 ? 427  LEU A O   1 
ATOM   3058  C CB  . LEU A 1 427 ? 134.298 178.499 138.505 1.00 308.25 ? 427  LEU A CB  1 
ATOM   3059  C CG  . LEU A 1 427 ? 135.131 179.772 138.449 1.00 317.32 ? 427  LEU A CG  1 
ATOM   3060  C CD1 . LEU A 1 427 ? 135.042 180.399 137.073 1.00 296.83 ? 427  LEU A CD1 1 
ATOM   3061  C CD2 . LEU A 1 427 ? 134.695 180.763 139.504 1.00 335.12 ? 427  LEU A CD2 1 
ATOM   3062  N N   . GLN A 1 428 ? 136.685 176.461 137.934 1.00 307.30 ? 428  GLN A N   1 
ATOM   3063  C CA  . GLN A 1 428 ? 138.121 176.246 137.838 1.00 314.72 ? 428  GLN A CA  1 
ATOM   3064  C C   . GLN A 1 428 ? 138.410 175.810 136.441 1.00 293.10 ? 428  GLN A C   1 
ATOM   3065  O O   . GLN A 1 428 ? 139.379 176.255 135.783 1.00 329.65 ? 428  GLN A O   1 
ATOM   3066  C CB  . GLN A 1 428 ? 138.541 175.114 138.746 1.00 323.34 ? 428  GLN A CB  1 
ATOM   3067  C CG  . GLN A 1 428 ? 138.913 175.546 140.136 1.00 316.35 ? 428  GLN A CG  1 
ATOM   3068  C CD  . GLN A 1 428 ? 139.288 174.367 140.986 1.00 357.88 ? 428  GLN A CD  1 
ATOM   3069  O OE1 . GLN A 1 428 ? 140.133 174.466 141.867 1.00 365.87 ? 428  GLN A OE1 1 
ATOM   3070  N NE2 . GLN A 1 428 ? 138.665 173.231 140.718 1.00 388.20 ? 428  GLN A NE2 1 
ATOM   3071  N N   . ARG A 1 429 ? 137.546 174.948 135.916 1.00 291.50 ? 429  ARG A N   1 
ATOM   3072  C CA  . ARG A 1 429 ? 137.739 174.416 134.570 1.00 308.97 ? 429  ARG A CA  1 
ATOM   3073  C C   . ARG A 1 429 ? 137.713 175.536 133.534 1.00 311.93 ? 429  ARG A C   1 
ATOM   3074  O O   . ARG A 1 429 ? 138.507 175.544 132.593 1.00 269.14 ? 429  ARG A O   1 
ATOM   3075  C CB  . ARG A 1 429 ? 136.666 173.374 134.246 1.00 292.51 ? 429  ARG A CB  1 
ATOM   3076  C CG  . ARG A 1 429 ? 137.221 172.017 133.844 1.00 302.23 ? 429  ARG A CG  1 
ATOM   3077  C CD  . ARG A 1 429 ? 138.221 172.144 132.706 1.00 313.31 ? 429  ARG A CD  1 
ATOM   3078  N NE  . ARG A 1 429 ? 139.551 171.685 133.094 1.00 291.92 ? 429  ARG A NE  1 
ATOM   3079  C CZ  . ARG A 1 429 ? 140.308 170.879 132.357 1.00 326.16 ? 429  ARG A CZ  1 
ATOM   3080  N NH1 . ARG A 1 429 ? 139.866 170.438 131.187 1.00 326.35 ? 429  ARG A NH1 1 
ATOM   3081  N NH2 . ARG A 1 429 ? 141.507 170.513 132.789 1.00 342.54 ? 429  ARG A NH2 1 
ATOM   3082  N N   . PHE A 1 430 ? 136.800 176.484 133.718 1.00 319.79 ? 430  PHE A N   1 
ATOM   3083  C CA  . PHE A 1 430 ? 136.716 177.668 132.857 1.00 304.37 ? 430  PHE A CA  1 
ATOM   3084  C C   . PHE A 1 430 ? 137.901 178.602 132.988 1.00 308.24 ? 430  PHE A C   1 
ATOM   3085  O O   . PHE A 1 430 ? 138.343 179.202 132.029 1.00 321.90 ? 430  PHE A O   1 
ATOM   3086  C CB  . PHE A 1 430 ? 135.443 178.440 133.128 1.00 299.27 ? 430  PHE A CB  1 
ATOM   3087  C CG  . PHE A 1 430 ? 134.334 178.096 132.201 1.00 317.56 ? 430  PHE A CG  1 
ATOM   3088  C CD1 . PHE A 1 430 ? 133.626 176.928 132.364 1.00 321.07 ? 430  PHE A CD1 1 
ATOM   3089  C CD2 . PHE A 1 430 ? 134.007 178.934 131.163 1.00 314.78 ? 430  PHE A CD2 1 
ATOM   3090  C CE1 . PHE A 1 430 ? 132.603 176.599 131.511 1.00 326.58 ? 430  PHE A CE1 1 
ATOM   3091  C CE2 . PHE A 1 430 ? 132.983 178.615 130.302 1.00 342.61 ? 430  PHE A CE2 1 
ATOM   3092  C CZ  . PHE A 1 430 ? 132.279 177.445 130.478 1.00 336.44 ? 430  PHE A CZ  1 
ATOM   3093  N N   . LEU A 1 431 ? 138.492 178.596 134.172 1.00 295.05 ? 431  LEU A N   1 
ATOM   3094  C CA  . LEU A 1 431 ? 139.695 179.360 134.452 1.00 307.93 ? 431  LEU A CA  1 
ATOM   3095  C C   . LEU A 1 431 ? 140.902 178.942 133.634 1.00 331.91 ? 431  LEU A C   1 
ATOM   3096  O O   . LEU A 1 431 ? 141.667 179.779 133.187 1.00 354.82 ? 431  LEU A O   1 
ATOM   3097  C CB  . LEU A 1 431 ? 140.043 179.259 135.930 1.00 301.06 ? 431  LEU A CB  1 
ATOM   3098  C CG  . LEU A 1 431 ? 140.296 180.570 136.664 1.00 306.64 ? 431  LEU A CG  1 
ATOM   3099  C CD1 . LEU A 1 431 ? 139.519 181.717 136.050 1.00 317.41 ? 431  LEU A CD1 1 
ATOM   3100  C CD2 . LEU A 1 431 ? 139.946 180.421 138.129 1.00 306.58 ? 431  LEU A CD2 1 
ATOM   3101  N N   . ARG A 1 432 ? 141.063 177.641 133.424 1.00 346.90 ? 432  ARG A N   1 
ATOM   3102  C CA  . ARG A 1 432 ? 142.288 177.121 132.830 1.00 350.70 ? 432  ARG A CA  1 
ATOM   3103  C C   . ARG A 1 432 ? 142.492 177.706 131.442 1.00 340.71 ? 432  ARG A C   1 
ATOM   3104  O O   . ARG A 1 432 ? 143.612 178.043 131.055 1.00 337.49 ? 432  ARG A O   1 
ATOM   3105  C CB  . ARG A 1 432 ? 142.242 175.594 132.757 1.00 338.55 ? 432  ARG A CB  1 
ATOM   3106  C CG  . ARG A 1 432 ? 143.591 174.921 132.952 1.00 340.68 ? 432  ARG A CG  1 
ATOM   3107  C CD  . ARG A 1 432 ? 143.541 173.456 132.550 1.00 355.61 ? 432  ARG A CD  1 
ATOM   3108  N NE  . ARG A 1 432 ? 144.509 172.652 133.290 1.00 367.45 ? 432  ARG A NE  1 
ATOM   3109  C CZ  . ARG A 1 432 ? 144.747 171.366 133.055 1.00 371.84 ? 432  ARG A CZ  1 
ATOM   3110  N NH1 . ARG A 1 432 ? 144.086 170.731 132.097 1.00 344.75 ? 432  ARG A NH1 1 
ATOM   3111  N NH2 . ARG A 1 432 ? 145.646 170.713 133.779 1.00 389.23 ? 432  ARG A NH2 1 
ATOM   3112  N N   . ALA A 1 433 ? 141.402 177.829 130.697 1.00 320.40 ? 433  ALA A N   1 
ATOM   3113  C CA  . ALA A 1 433 ? 141.441 178.427 129.373 1.00 336.40 ? 433  ALA A CA  1 
ATOM   3114  C C   . ALA A 1 433 ? 141.674 179.933 129.323 1.00 330.13 ? 433  ALA A C   1 
ATOM   3115  O O   . ALA A 1 433 ? 142.400 180.415 128.462 1.00 344.18 ? 433  ALA A O   1 
ATOM   3116  C CB  . ALA A 1 433 ? 140.185 178.072 128.600 1.00 343.32 ? 433  ALA A CB  1 
ATOM   3117  N N   . ARG A 1 434 ? 141.032 180.684 130.209 1.00 311.41 ? 434  ARG A N   1 
ATOM   3118  C CA  . ARG A 1 434 ? 140.944 182.124 129.998 1.00 325.15 ? 434  ARG A CA  1 
ATOM   3119  C C   . ARG A 1 434 ? 141.494 183.089 131.035 1.00 317.56 ? 434  ARG A C   1 
ATOM   3120  O O   . ARG A 1 434 ? 142.391 183.862 130.727 1.00 320.69 ? 434  ARG A O   1 
ATOM   3121  C CB  . ARG A 1 434 ? 139.491 182.499 129.736 1.00 331.04 ? 434  ARG A CB  1 
ATOM   3122  C CG  . ARG A 1 434 ? 139.279 183.256 128.445 1.00 364.16 ? 434  ARG A CG  1 
ATOM   3123  C CD  . ARG A 1 434 ? 138.607 184.591 128.697 1.00 380.68 ? 434  ARG A CD  1 
ATOM   3124  N NE  . ARG A 1 434 ? 139.444 185.695 128.253 1.00 392.79 ? 434  ARG A NE  1 
ATOM   3125  C CZ  . ARG A 1 434 ? 140.082 185.725 127.088 1.00 406.76 ? 434  ARG A CZ  1 
ATOM   3126  N NH1 . ARG A 1 434 ? 139.975 184.710 126.244 1.00 408.02 ? 434  ARG A NH1 1 
ATOM   3127  N NH2 . ARG A 1 434 ? 140.824 186.773 126.764 1.00 417.59 ? 434  ARG A NH2 1 
ATOM   3128  N N   . ASN A 1 435 ? 140.948 183.005 132.246 1.00 329.91 ? 435  ASN A N   1 
ATOM   3129  C CA  . ASN A 1 435 ? 140.914 184.042 133.283 1.00 335.47 ? 435  ASN A CA  1 
ATOM   3130  C C   . ASN A 1 435 ? 139.554 184.688 133.260 1.00 345.26 ? 435  ASN A C   1 
ATOM   3131  O O   . ASN A 1 435 ? 139.116 185.147 132.216 1.00 362.89 ? 435  ASN A O   1 
ATOM   3132  C CB  . ASN A 1 435 ? 141.919 185.147 133.047 1.00 354.96 ? 435  ASN A CB  1 
ATOM   3133  C CG  . ASN A 1 435 ? 143.198 184.912 133.775 1.00 370.55 ? 435  ASN A CG  1 
ATOM   3134  O OD1 . ASN A 1 435 ? 143.232 184.168 134.748 1.00 371.82 ? 435  ASN A OD1 1 
ATOM   3135  N ND2 . ASN A 1 435 ? 144.269 185.537 133.315 1.00 383.63 ? 435  ASN A ND2 1 
ATOM   3136  N N   . ILE A 1 436 ? 138.889 184.757 134.403 1.00 328.43 ? 436  ILE A N   1 
ATOM   3137  C CA  . ILE A 1 436 ? 137.539 185.302 134.410 1.00 333.85 ? 436  ILE A CA  1 
ATOM   3138  C C   . ILE A 1 436 ? 137.114 185.875 135.748 1.00 318.02 ? 436  ILE A C   1 
ATOM   3139  O O   . ILE A 1 436 ? 137.636 185.508 136.792 1.00 292.06 ? 436  ILE A O   1 
ATOM   3140  C CB  . ILE A 1 436 ? 136.480 184.278 133.939 1.00 333.66 ? 436  ILE A CB  1 
ATOM   3141  C CG1 . ILE A 1 436 ? 136.999 182.838 134.010 1.00 353.47 ? 436  ILE A CG1 1 
ATOM   3142  C CG2 . ILE A 1 436 ? 136.000 184.626 132.540 1.00 330.82 ? 436  ILE A CG2 1 
ATOM   3143  C CD1 . ILE A 1 436 ? 136.214 181.853 133.177 1.00 358.74 ? 436  ILE A CD1 1 
ATOM   3144  N N   . SER A 1 437 ? 136.134 186.764 135.707 1.00 334.58 ? 437  SER A N   1 
ATOM   3145  C CA  . SER A 1 437 ? 135.587 187.336 136.916 1.00 330.67 ? 437  SER A CA  1 
ATOM   3146  C C   . SER A 1 437 ? 134.541 186.377 137.439 1.00 306.83 ? 437  SER A C   1 
ATOM   3147  O O   . SER A 1 437 ? 133.350 186.626 137.341 1.00 288.29 ? 437  SER A O   1 
ATOM   3148  C CB  . SER A 1 437 ? 134.958 188.685 136.610 1.00 349.01 ? 437  SER A CB  1 
ATOM   3149  O OG  . SER A 1 437 ? 135.552 189.259 135.461 1.00 368.82 ? 437  SER A OG  1 
ATOM   3150  N N   . GLY A 1 438 ? 135.020 185.276 137.994 1.00 312.21 ? 438  GLY A N   1 
ATOM   3151  C CA  . GLY A 1 438 ? 134.210 184.152 138.460 1.00 305.42 ? 438  GLY A CA  1 
ATOM   3152  C C   . GLY A 1 438 ? 133.925 184.171 139.944 1.00 284.38 ? 438  GLY A C   1 
ATOM   3153  O O   . GLY A 1 438 ? 134.742 184.661 140.726 1.00 298.43 ? 438  GLY A O   1 
ATOM   3154  N N   . VAL A 1 439 ? 132.765 183.687 140.318 1.00 275.89 ? 439  VAL A N   1 
ATOM   3155  C CA  . VAL A 1 439 ? 132.405 183.661 141.697 1.00 279.05 ? 439  VAL A CA  1 
ATOM   3156  C C   . VAL A 1 439 ? 131.807 182.317 141.917 1.00 277.65 ? 439  VAL A C   1 
ATOM   3157  O O   . VAL A 1 439 ? 131.124 181.808 141.058 1.00 302.79 ? 439  VAL A O   1 
ATOM   3158  C CB  . VAL A 1 439 ? 131.319 184.701 141.976 1.00 309.97 ? 439  VAL A CB  1 
ATOM   3159  C CG1 . VAL A 1 439 ? 130.752 184.536 143.369 1.00 315.52 ? 439  VAL A CG1 1 
ATOM   3160  C CG2 . VAL A 1 439 ? 131.860 186.102 141.774 1.00 340.07 ? 439  VAL A CG2 1 
ATOM   3161  N N   . VAL A 1 440 ? 132.051 181.742 143.072 1.00 275.29 ? 440  VAL A N   1 
ATOM   3162  C CA  . VAL A 1 440 ? 131.405 180.509 143.412 1.00 281.53 ? 440  VAL A CA  1 
ATOM   3163  C C   . VAL A 1 440 ? 130.642 180.748 144.671 1.00 270.46 ? 440  VAL A C   1 
ATOM   3164  O O   . VAL A 1 440 ? 131.186 181.266 145.635 1.00 271.46 ? 440  VAL A O   1 
ATOM   3165  C CB  . VAL A 1 440 ? 132.428 179.395 143.646 1.00 300.08 ? 440  VAL A CB  1 
ATOM   3166  C CG1 . VAL A 1 440 ? 131.770 178.165 144.234 1.00 297.75 ? 440  VAL A CG1 1 
ATOM   3167  C CG2 . VAL A 1 440 ? 133.119 179.046 142.351 1.00 317.12 ? 440  VAL A CG2 1 
ATOM   3168  N N   . LEU A 1 441 ? 129.380 180.365 144.660 1.00 290.87 ? 441  LEU A N   1 
ATOM   3169  C CA  . LEU A 1 441 ? 128.549 180.547 145.811 1.00 294.68 ? 441  LEU A CA  1 
ATOM   3170  C C   . LEU A 1 441 ? 128.446 179.228 146.487 1.00 274.04 ? 441  LEU A C   1 
ATOM   3171  O O   . LEU A 1 441 ? 127.993 178.238 145.931 1.00 294.05 ? 441  LEU A O   1 
ATOM   3172  C CB  . LEU A 1 441 ? 127.175 181.040 145.407 1.00 304.45 ? 441  LEU A CB  1 
ATOM   3173  C CG  . LEU A 1 441 ? 127.206 182.396 144.721 1.00 323.28 ? 441  LEU A CG  1 
ATOM   3174  C CD1 . LEU A 1 441 ? 125.874 182.683 144.060 1.00 320.05 ? 441  LEU A CD1 1 
ATOM   3175  C CD2 . LEU A 1 441 ? 127.535 183.467 145.738 1.00 330.97 ? 441  LEU A CD2 1 
ATOM   3176  N N   . ALA A 1 442 ? 128.862 179.231 147.725 1.00 300.02 ? 442  ALA A N   1 
ATOM   3177  C CA  . ALA A 1 442 ? 129.019 177.988 148.462 1.00 299.89 ? 442  ALA A CA  1 
ATOM   3178  C C   . ALA A 1 442 ? 128.422 177.993 149.861 1.00 278.49 ? 442  ALA A C   1 
ATOM   3179  O O   . ALA A 1 442 ? 128.401 179.005 150.552 1.00 283.10 ? 442  ALA A O   1 
ATOM   3180  C CB  . ALA A 1 442 ? 130.492 177.622 148.540 1.00 326.01 ? 442  ALA A CB  1 
ATOM   3181  N N   . ASP A 1 443 ? 127.975 176.828 150.303 1.00 304.18 ? 443  ASP A N   1 
ATOM   3182  C CA  . ASP A 1 443 ? 127.539 176.664 151.679 1.00 315.21 ? 443  ASP A CA  1 
ATOM   3183  C C   . ASP A 1 443 ? 128.711 176.897 152.632 1.00 314.22 ? 443  ASP A C   1 
ATOM   3184  O O   . ASP A 1 443 ? 128.546 177.455 153.717 1.00 320.86 ? 443  ASP A O   1 
ATOM   3185  C CB  . ASP A 1 443 ? 126.952 175.269 151.895 1.00 319.65 ? 443  ASP A CB  1 
ATOM   3186  C CG  . ASP A 1 443 ? 128.019 174.197 151.999 1.00 345.67 ? 443  ASP A CG  1 
ATOM   3187  O OD1 . ASP A 1 443 ? 129.067 174.333 151.333 1.00 380.29 ? 443  ASP A OD1 1 
ATOM   3188  O OD2 . ASP A 1 443 ? 127.811 173.219 152.747 1.00 336.58 ? 443  ASP A OD2 1 
ATOM   3189  N N   . HIS A 1 444 ? 129.889 176.440 152.218 1.00 306.42 ? 444  HIS A N   1 
ATOM   3190  C CA  . HIS A 1 444 ? 131.034 176.269 153.104 1.00 315.39 ? 444  HIS A CA  1 
ATOM   3191  C C   . HIS A 1 444 ? 132.022 177.418 152.979 1.00 321.18 ? 444  HIS A C   1 
ATOM   3192  O O   . HIS A 1 444 ? 132.175 178.002 151.905 1.00 313.21 ? 444  HIS A O   1 
ATOM   3193  C CB  . HIS A 1 444 ? 131.749 174.949 152.786 1.00 320.40 ? 444  HIS A CB  1 
ATOM   3194  C CG  . HIS A 1 444 ? 132.118 174.796 151.344 1.00 300.69 ? 444  HIS A CG  1 
ATOM   3195  N ND1 . HIS A 1 444 ? 131.291 174.182 150.429 1.00 320.82 ? 444  HIS A ND1 1 
ATOM   3196  C CD2 . HIS A 1 444 ? 133.207 175.204 150.653 1.00 305.42 ? 444  HIS A CD2 1 
ATOM   3197  C CE1 . HIS A 1 444 ? 131.859 174.213 149.237 1.00 332.33 ? 444  HIS A CE1 1 
ATOM   3198  N NE2 . HIS A 1 444 ? 133.025 174.824 149.347 1.00 305.71 ? 444  HIS A NE2 1 
ATOM   3199  N N   . SER A 1 445 ? 132.688 177.721 154.091 1.00 331.24 ? 445  SER A N   1 
ATOM   3200  C CA  . SER A 1 445 ? 133.807 178.653 154.111 1.00 332.32 ? 445  SER A CA  1 
ATOM   3201  C C   . SER A 1 445 ? 135.058 177.913 153.666 1.00 329.41 ? 445  SER A C   1 
ATOM   3202  O O   . SER A 1 445 ? 135.678 178.270 152.667 1.00 301.53 ? 445  SER A O   1 
ATOM   3203  C CB  . SER A 1 445 ? 134.015 179.216 155.519 1.00 343.90 ? 445  SER A CB  1 
ATOM   3204  O OG  . SER A 1 445 ? 134.167 178.176 156.470 1.00 360.62 ? 445  SER A OG  1 
ATOM   3205  N N   . GLY A 1 446 ? 135.411 176.874 154.421 1.00 342.10 ? 446  GLY A N   1 
ATOM   3206  C CA  . GLY A 1 446 ? 136.624 176.096 154.184 1.00 358.98 ? 446  GLY A CA  1 
ATOM   3207  C C   . GLY A 1 446 ? 136.263 174.741 153.625 1.00 339.63 ? 446  GLY A C   1 
ATOM   3208  O O   . GLY A 1 446 ? 135.746 174.646 152.515 1.00 360.33 ? 446  GLY A O   1 
ATOM   3209  N N   . ALA A 1 447 ? 136.540 173.691 154.394 1.00 324.45 ? 447  ALA A N   1 
ATOM   3210  C CA  . ALA A 1 447 ? 136.120 172.339 154.043 1.00 314.55 ? 447  ALA A CA  1 
ATOM   3211  C C   . ALA A 1 447 ? 134.596 172.251 154.081 1.00 313.96 ? 447  ALA A C   1 
ATOM   3212  O O   . ALA A 1 447 ? 133.943 173.069 154.738 1.00 311.08 ? 447  ALA A O   1 
ATOM   3213  C CB  . ALA A 1 447 ? 136.735 171.334 155.001 1.00 341.99 ? 447  ALA A CB  1 
ATOM   3214  N N   . PHE A 1 448 ? 134.036 171.259 153.391 1.00 314.53 ? 448  PHE A N   1 
ATOM   3215  C CA  . PHE A 1 448 ? 132.581 171.183 153.206 1.00 313.83 ? 448  PHE A CA  1 
ATOM   3216  C C   . PHE A 1 448 ? 131.844 170.918 154.522 1.00 321.48 ? 448  PHE A C   1 
ATOM   3217  O O   . PHE A 1 448 ? 132.439 170.463 155.502 1.00 324.95 ? 448  PHE A O   1 
ATOM   3218  C CB  . PHE A 1 448 ? 132.170 170.087 152.205 1.00 312.10 ? 448  PHE A CB  1 
ATOM   3219  C CG  . PHE A 1 448 ? 132.833 170.160 150.851 1.00 301.81 ? 448  PHE A CG  1 
ATOM   3220  C CD1 . PHE A 1 448 ? 133.228 171.369 150.282 1.00 321.14 ? 448  PHE A CD1 1 
ATOM   3221  C CD2 . PHE A 1 448 ? 133.010 168.991 150.115 1.00 281.13 ? 448  PHE A CD2 1 
ATOM   3222  C CE1 . PHE A 1 448 ? 133.818 171.400 149.025 1.00 323.62 ? 448  PHE A CE1 1 
ATOM   3223  C CE2 . PHE A 1 448 ? 133.596 169.017 148.861 1.00 297.37 ? 448  PHE A CE2 1 
ATOM   3224  C CZ  . PHE A 1 448 ? 133.999 170.223 148.314 1.00 312.58 ? 448  PHE A CZ  1 
ATOM   3225  N N   . HIS A 1 449 ? 130.577 171.306 154.552 1.00 325.54 ? 449  HIS A N   1 
ATOM   3226  C CA  . HIS A 1 449 ? 129.680 170.949 155.634 1.00 334.23 ? 449  HIS A CA  1 
ATOM   3227  C C   . HIS A 1 449 ? 128.961 169.666 155.300 1.00 328.08 ? 449  HIS A C   1 
ATOM   3228  O O   . HIS A 1 449 ? 128.254 169.114 156.125 1.00 355.52 ? 449  HIS A O   1 
ATOM   3229  C CB  . HIS A 1 449 ? 128.645 172.041 155.853 1.00 347.55 ? 449  HIS A CB  1 
ATOM   3230  C CG  . HIS A 1 449 ? 129.222 173.312 156.375 1.00 359.36 ? 449  HIS A CG  1 
ATOM   3231  N ND1 . HIS A 1 449 ? 130.522 173.408 156.815 1.00 379.38 ? 449  HIS A ND1 1 
ATOM   3232  C CD2 . HIS A 1 449 ? 128.682 174.542 156.521 1.00 349.27 ? 449  HIS A CD2 1 
ATOM   3233  C CE1 . HIS A 1 449 ? 130.759 174.644 157.211 1.00 380.37 ? 449  HIS A CE1 1 
ATOM   3234  N NE2 . HIS A 1 449 ? 129.659 175.353 157.041 1.00 365.31 ? 449  HIS A NE2 1 
ATOM   3235  N N   . ASN A 1 450 ? 129.152 169.187 154.083 1.00 317.37 ? 450  ASN A N   1 
ATOM   3236  C CA  . ASN A 1 450 ? 128.435 168.041 153.610 1.00 318.74 ? 450  ASN A CA  1 
ATOM   3237  C C   . ASN A 1 450 ? 129.237 166.846 154.049 1.00 327.70 ? 450  ASN A C   1 
ATOM   3238  O O   . ASN A 1 450 ? 130.252 166.520 153.455 1.00 343.64 ? 450  ASN A O   1 
ATOM   3239  C CB  . ASN A 1 450 ? 128.361 168.138 152.094 1.00 308.17 ? 450  ASN A CB  1 
ATOM   3240  C CG  . ASN A 1 450 ? 128.085 166.823 151.439 1.00 294.05 ? 450  ASN A CG  1 
ATOM   3241  O OD1 . ASN A 1 450 ? 128.999 166.119 151.051 1.00 295.86 ? 450  ASN A OD1 1 
ATOM   3242  N ND2 . ASN A 1 450 ? 126.818 166.487 151.305 1.00 294.50 ? 450  ASN A ND2 1 
ATOM   3243  N N   . LYS A 1 451 ? 128.796 166.202 155.118 1.00 298.05 ? 451  LYS A N   1 
ATOM   3244  C CA  . LYS A 1 451 ? 129.575 165.116 155.664 1.00 324.74 ? 451  LYS A CA  1 
ATOM   3245  C C   . LYS A 1 451 ? 129.687 163.974 154.678 1.00 313.19 ? 451  LYS A C   1 
ATOM   3246  O O   . LYS A 1 451 ? 130.762 163.450 154.468 1.00 332.34 ? 451  LYS A O   1 
ATOM   3247  C CB  . LYS A 1 451 ? 128.954 164.626 156.965 1.00 350.93 ? 451  LYS A CB  1 
ATOM   3248  C CG  . LYS A 1 451 ? 129.554 165.266 158.202 1.00 394.74 ? 451  LYS A CG  1 
ATOM   3249  C CD  . LYS A 1 451 ? 128.741 164.963 159.449 1.00 407.78 ? 451  LYS A CD  1 
ATOM   3250  C CE  . LYS A 1 451 ? 127.374 165.618 159.392 1.00 415.28 ? 451  LYS A CE  1 
ATOM   3251  N NZ  . LYS A 1 451 ? 126.587 165.115 158.235 1.00 424.12 ? 451  LYS A NZ  1 
ATOM   3252  N N   . TYR A 1 452 ? 128.577 163.604 154.055 1.00 287.58 ? 452  TYR A N   1 
ATOM   3253  C CA  . TYR A 1 452 ? 128.577 162.530 153.074 1.00 272.34 ? 452  TYR A CA  1 
ATOM   3254  C C   . TYR A 1 452 ? 128.806 163.005 151.647 1.00 263.63 ? 452  TYR A C   1 
ATOM   3255  O O   . TYR A 1 452 ? 127.895 162.972 150.836 1.00 249.71 ? 452  TYR A O   1 
ATOM   3256  C CB  . TYR A 1 452 ? 127.272 161.759 153.162 1.00 277.08 ? 452  TYR A CB  1 
ATOM   3257  C CG  . TYR A 1 452 ? 126.824 161.503 154.561 1.00 290.47 ? 452  TYR A CG  1 
ATOM   3258  C CD1 . TYR A 1 452 ? 127.610 160.788 155.433 1.00 306.90 ? 452  TYR A CD1 1 
ATOM   3259  C CD2 . TYR A 1 452 ? 125.616 161.973 155.008 1.00 312.85 ? 452  TYR A CD2 1 
ATOM   3260  C CE1 . TYR A 1 452 ? 127.204 160.550 156.719 1.00 314.48 ? 452  TYR A CE1 1 
ATOM   3261  C CE2 . TYR A 1 452 ? 125.200 161.737 156.289 1.00 335.88 ? 452  TYR A CE2 1 
ATOM   3262  C CZ  . TYR A 1 452 ? 125.999 161.025 157.134 1.00 337.44 ? 452  TYR A CZ  1 
ATOM   3263  O OH  . TYR A 1 452 ? 125.584 160.794 158.415 1.00 373.05 ? 452  TYR A OH  1 
ATOM   3264  N N   . TYR A 1 453 ? 130.019 163.425 151.319 1.00 268.85 ? 453  TYR A N   1 
ATOM   3265  C CA  . TYR A 1 453 ? 130.279 163.904 149.974 1.00 266.86 ? 453  TYR A CA  1 
ATOM   3266  C C   . TYR A 1 453 ? 130.103 162.775 148.996 1.00 256.37 ? 453  TYR A C   1 
ATOM   3267  O O   . TYR A 1 453 ? 130.382 161.638 149.302 1.00 247.59 ? 453  TYR A O   1 
ATOM   3268  C CB  . TYR A 1 453 ? 131.677 164.455 149.843 1.00 280.83 ? 453  TYR A CB  1 
ATOM   3269  C CG  . TYR A 1 453 ? 131.843 165.230 148.577 1.00 266.90 ? 453  TYR A CG  1 
ATOM   3270  C CD1 . TYR A 1 453 ? 130.894 166.132 148.184 1.00 249.77 ? 453  TYR A CD1 1 
ATOM   3271  C CD2 . TYR A 1 453 ? 132.945 165.056 147.775 1.00 287.22 ? 453  TYR A CD2 1 
ATOM   3272  C CE1 . TYR A 1 453 ? 131.033 166.844 147.027 1.00 273.55 ? 453  TYR A CE1 1 
ATOM   3273  C CE2 . TYR A 1 453 ? 133.091 165.767 146.615 1.00 307.70 ? 453  TYR A CE2 1 
ATOM   3274  C CZ  . TYR A 1 453 ? 132.125 166.658 146.252 1.00 281.65 ? 453  TYR A CZ  1 
ATOM   3275  O OH  . TYR A 1 453 ? 132.259 167.372 145.092 1.00 309.45 ? 453  TYR A OH  1 
ATOM   3276  N N   . GLN A 1 454 ? 129.613 163.077 147.810 1.00 291.78 ? 454  GLN A N   1 
ATOM   3277  C CA  . GLN A 1 454 ? 129.390 161.996 146.836 1.00 299.02 ? 454  GLN A CA  1 
ATOM   3278  C C   . GLN A 1 454 ? 129.492 160.589 147.430 1.00 260.35 ? 454  GLN A C   1 
ATOM   3279  O O   . GLN A 1 454 ? 130.484 159.888 147.247 1.00 246.72 ? 454  GLN A O   1 
ATOM   3280  C CB  . GLN A 1 454 ? 130.251 162.173 145.578 1.00 301.77 ? 454  GLN A CB  1 
ATOM   3281  C CG  . GLN A 1 454 ? 131.702 162.541 145.804 1.00 297.26 ? 454  GLN A CG  1 
ATOM   3282  C CD  . GLN A 1 454 ? 132.318 163.201 144.584 1.00 333.00 ? 454  GLN A CD  1 
ATOM   3283  O OE1 . GLN A 1 454 ? 131.739 164.122 144.005 1.00 324.14 ? 454  GLN A OE1 1 
ATOM   3284  N NE2 . GLN A 1 454 ? 133.497 162.735 144.184 1.00 360.18 ? 454  GLN A NE2 1 
ATOM   3285  N N   . SER A 1 455 ? 128.450 160.235 148.184 1.00 270.53 ? 455  SER A N   1 
ATOM   3286  C CA  . SER A 1 455 ? 128.366 158.991 148.949 1.00 270.84 ? 455  SER A CA  1 
ATOM   3287  C C   . SER A 1 455 ? 126.934 158.442 148.997 1.00 285.08 ? 455  SER A C   1 
ATOM   3288  O O   . SER A 1 455 ? 125.971 159.166 148.744 1.00 307.22 ? 455  SER A O   1 
ATOM   3289  C CB  . SER A 1 455 ? 128.897 159.200 150.369 1.00 275.12 ? 455  SER A CB  1 
ATOM   3290  O OG  . SER A 1 455 ? 129.144 157.959 151.008 1.00 299.54 ? 455  SER A OG  1 
ATOM   3291  N N   . ILE A 1 456 ? 126.810 157.156 149.317 1.00 296.23 ? 456  ILE A N   1 
ATOM   3292  C CA  . ILE A 1 456 ? 125.527 156.442 149.323 1.00 297.03 ? 456  ILE A CA  1 
ATOM   3293  C C   . ILE A 1 456 ? 124.510 157.192 150.189 1.00 303.42 ? 456  ILE A C   1 
ATOM   3294  O O   . ILE A 1 456 ? 123.303 157.076 149.965 1.00 314.99 ? 456  ILE A O   1 
ATOM   3295  C CB  . ILE A 1 456 ? 125.666 154.984 149.853 1.00 314.39 ? 456  ILE A CB  1 
ATOM   3296  C CG1 . ILE A 1 456 ? 126.718 154.197 149.047 1.00 341.38 ? 456  ILE A CG1 1 
ATOM   3297  C CG2 . ILE A 1 456 ? 124.327 154.255 149.824 1.00 324.61 ? 456  ILE A CG2 1 
ATOM   3298  C CD1 . ILE A 1 456 ? 128.051 154.011 149.750 1.00 374.96 ? 456  ILE A CD1 1 
ATOM   3299  N N   . TYR A 1 457 ? 124.999 157.968 151.160 1.00 295.12 ? 457  TYR A N   1 
ATOM   3300  C CA  . TYR A 1 457 ? 124.145 158.599 152.170 1.00 312.61 ? 457  TYR A CA  1 
ATOM   3301  C C   . TYR A 1 457 ? 123.721 160.039 151.855 1.00 303.01 ? 457  TYR A C   1 
ATOM   3302  O O   . TYR A 1 457 ? 122.918 160.612 152.595 1.00 287.58 ? 457  TYR A O   1 
ATOM   3303  C CB  . TYR A 1 457 ? 124.860 158.605 153.514 1.00 324.85 ? 457  TYR A CB  1 
ATOM   3304  C CG  . TYR A 1 457 ? 125.540 157.312 153.888 1.00 309.39 ? 457  TYR A CG  1 
ATOM   3305  C CD1 . TYR A 1 457 ? 124.834 156.271 154.490 1.00 291.38 ? 457  TYR A CD1 1 
ATOM   3306  C CD2 . TYR A 1 457 ? 126.903 157.141 153.663 1.00 321.16 ? 457  TYR A CD2 1 
ATOM   3307  C CE1 . TYR A 1 457 ? 125.470 155.093 154.849 1.00 300.09 ? 457  TYR A CE1 1 
ATOM   3308  C CE2 . TYR A 1 457 ? 127.544 155.968 154.012 1.00 326.29 ? 457  TYR A CE2 1 
ATOM   3309  C CZ  . TYR A 1 457 ? 126.829 154.952 154.603 1.00 312.81 ? 457  TYR A CZ  1 
ATOM   3310  O OH  . TYR A 1 457 ? 127.496 153.809 154.942 1.00 336.41 ? 457  TYR A OH  1 
ATOM   3311  N N   . ASP A 1 458 ? 124.246 160.613 150.770 1.00 298.79 ? 458  ASP A N   1 
ATOM   3312  C CA  . ASP A 1 458 ? 123.988 162.012 150.394 1.00 280.29 ? 458  ASP A CA  1 
ATOM   3313  C C   . ASP A 1 458 ? 122.572 162.162 149.837 1.00 259.50 ? 458  ASP A C   1 
ATOM   3314  O O   . ASP A 1 458 ? 122.379 162.390 148.644 1.00 277.02 ? 458  ASP A O   1 
ATOM   3315  C CB  . ASP A 1 458 ? 125.027 162.452 149.347 1.00 304.07 ? 458  ASP A CB  1 
ATOM   3316  C CG  . ASP A 1 458 ? 125.125 163.964 149.182 1.00 296.26 ? 458  ASP A CG  1 
ATOM   3317  O OD1 . ASP A 1 458 ? 124.426 164.719 149.892 1.00 287.71 ? 458  ASP A OD1 1 
ATOM   3318  O OD2 . ASP A 1 458 ? 125.919 164.400 148.317 1.00 275.27 ? 458  ASP A OD2 1 
ATOM   3319  N N   . THR A 1 459 ? 121.585 162.049 150.715 1.00 274.80 ? 459  THR A N   1 
ATOM   3320  C CA  . THR A 1 459 ? 120.184 161.931 150.312 1.00 285.55 ? 459  THR A CA  1 
ATOM   3321  C C   . THR A 1 459 ? 119.344 163.066 150.897 1.00 288.21 ? 459  THR A C   1 
ATOM   3322  O O   . THR A 1 459 ? 119.851 163.920 151.629 1.00 280.39 ? 459  THR A O   1 
ATOM   3323  C CB  . THR A 1 459 ? 119.602 160.569 150.755 1.00 290.45 ? 459  THR A CB  1 
ATOM   3324  O OG1 . THR A 1 459 ? 119.426 160.536 152.179 1.00 280.34 ? 459  THR A OG1 1 
ATOM   3325  C CG2 . THR A 1 459 ? 120.521 159.432 150.346 1.00 310.84 ? 459  THR A CG2 1 
ATOM   3326  N N   . ALA A 1 460 ? 118.061 163.072 150.551 1.00 285.15 ? 460  ALA A N   1 
ATOM   3327  C CA  . ALA A 1 460 ? 117.076 163.956 151.172 1.00 300.52 ? 460  ALA A CA  1 
ATOM   3328  C C   . ALA A 1 460 ? 117.263 164.079 152.693 1.00 300.67 ? 460  ALA A C   1 
ATOM   3329  O O   . ALA A 1 460 ? 117.183 165.180 153.242 1.00 308.97 ? 460  ALA A O   1 
ATOM   3330  C CB  . ALA A 1 460 ? 115.667 163.470 150.849 1.00 321.44 ? 460  ALA A CB  1 
ATOM   3331  N N   . GLU A 1 461 ? 117.511 162.948 153.357 1.00 305.66 ? 461  GLU A N   1 
ATOM   3332  C CA  . GLU A 1 461 ? 117.764 162.920 154.804 1.00 328.23 ? 461  GLU A CA  1 
ATOM   3333  C C   . GLU A 1 461 ? 118.912 163.839 155.215 1.00 321.09 ? 461  GLU A C   1 
ATOM   3334  O O   . GLU A 1 461 ? 118.824 164.516 156.240 1.00 341.66 ? 461  GLU A O   1 
ATOM   3335  C CB  . GLU A 1 461 ? 118.058 161.495 155.282 1.00 382.81 ? 461  GLU A CB  1 
ATOM   3336  C CG  . GLU A 1 461 ? 116.860 160.555 155.238 1.00 428.07 ? 461  GLU A CG  1 
ATOM   3337  C CD  . GLU A 1 461 ? 117.122 159.223 155.925 1.00 466.25 ? 461  GLU A CD  1 
ATOM   3338  O OE1 . GLU A 1 461 ? 118.292 158.782 155.975 1.00 480.57 ? 461  GLU A OE1 1 
ATOM   3339  O OE2 . GLU A 1 461 ? 116.150 158.609 156.414 1.00 475.46 ? 461  GLU A OE2 1 
ATOM   3340  N N   . ASN A 1 462 ? 119.978 163.856 154.415 1.00 321.04 ? 462  ASN A N   1 
ATOM   3341  C CA  . ASN A 1 462 ? 121.108 164.767 154.632 1.00 330.94 ? 462  ASN A CA  1 
ATOM   3342  C C   . ASN A 1 462 ? 120.714 166.233 154.455 1.00 323.89 ? 462  ASN A C   1 
ATOM   3343  O O   . ASN A 1 462 ? 121.034 167.074 155.297 1.00 337.71 ? 462  ASN A O   1 
ATOM   3344  C CB  . ASN A 1 462 ? 122.269 164.426 153.685 1.00 321.10 ? 462  ASN A CB  1 
ATOM   3345  C CG  . ASN A 1 462 ? 123.568 165.128 154.055 1.00 344.33 ? 462  ASN A CG  1 
ATOM   3346  O OD1 . ASN A 1 462 ? 123.709 165.711 155.133 1.00 359.10 ? 462  ASN A OD1 1 
ATOM   3347  N ND2 . ASN A 1 462 ? 124.540 165.051 153.161 1.00 340.38 ? 462  ASN A ND2 1 
ATOM   3348  N N   . ILE A 1 463 ? 120.009 166.525 153.364 1.00 323.47 ? 463  ILE A N   1 
ATOM   3349  C CA  . ILE A 1 463 ? 119.586 167.893 153.040 1.00 323.85 ? 463  ILE A CA  1 
ATOM   3350  C C   . ILE A 1 463 ? 118.303 168.331 153.782 1.00 321.29 ? 463  ILE A C   1 
ATOM   3351  O O   . ILE A 1 463 ? 117.784 169.418 153.530 1.00 327.76 ? 463  ILE A O   1 
ATOM   3352  C CB  . ILE A 1 463 ? 119.471 168.077 151.494 1.00 326.74 ? 463  ILE A CB  1 
ATOM   3353  C CG1 . ILE A 1 463 ? 119.859 169.501 151.095 1.00 347.04 ? 463  ILE A CG1 1 
ATOM   3354  C CG2 . ILE A 1 463 ? 118.097 167.682 150.963 1.00 326.61 ? 463  ILE A CG2 1 
ATOM   3355  C CD1 . ILE A 1 463 ? 119.423 169.922 149.707 1.00 362.21 ? 463  ILE A CD1 1 
ATOM   3356  N N   . ASN A 1 464 ? 117.796 167.484 154.683 1.00 317.76 ? 464  ASN A N   1 
ATOM   3357  C CA  . ASN A 1 464 ? 116.707 167.832 155.605 1.00 331.06 ? 464  ASN A CA  1 
ATOM   3358  C C   . ASN A 1 464 ? 115.318 167.838 154.943 1.00 313.55 ? 464  ASN A C   1 
ATOM   3359  O O   . ASN A 1 464 ? 114.370 168.385 155.512 1.00 329.94 ? 464  ASN A O   1 
ATOM   3360  C CB  . ASN A 1 464 ? 117.002 169.175 156.311 1.00 352.59 ? 464  ASN A CB  1 
ATOM   3361  C CG  . ASN A 1 464 ? 116.652 169.164 157.790 1.00 376.78 ? 464  ASN A CG  1 
ATOM   3362  O OD1 . ASN A 1 464 ? 117.546 169.103 158.638 1.00 378.44 ? 464  ASN A OD1 1 
ATOM   3363  N ND2 . ASN A 1 464 ? 115.351 169.235 158.107 1.00 392.58 ? 464  ASN A ND2 1 
ATOM   3364  N N   . VAL A 1 465 ? 115.198 167.223 153.760 1.00 295.72 ? 465  VAL A N   1 
ATOM   3365  C CA  . VAL A 1 465 ? 113.906 167.059 153.081 1.00 301.04 ? 465  VAL A CA  1 
ATOM   3366  C C   . VAL A 1 465 ? 113.169 165.879 153.723 1.00 339.64 ? 465  VAL A C   1 
ATOM   3367  O O   . VAL A 1 465 ? 113.407 164.717 153.375 1.00 329.83 ? 465  VAL A O   1 
ATOM   3368  C CB  . VAL A 1 465 ? 114.076 166.817 151.563 1.00 307.83 ? 465  VAL A CB  1 
ATOM   3369  C CG1 . VAL A 1 465 ? 112.745 166.489 150.896 1.00 327.73 ? 465  VAL A CG1 1 
ATOM   3370  C CG2 . VAL A 1 465 ? 114.705 168.024 150.890 1.00 325.88 ? 465  VAL A CG2 1 
ATOM   3371  N N   . SER A 1 466 ? 112.287 166.192 154.669 1.00 371.36 ? 466  SER A N   1 
ATOM   3372  C CA  . SER A 1 466 ? 111.540 165.188 155.425 1.00 386.97 ? 466  SER A CA  1 
ATOM   3373  C C   . SER A 1 466 ? 110.068 165.580 155.480 1.00 380.62 ? 466  SER A C   1 
ATOM   3374  O O   . SER A 1 466 ? 109.696 166.524 156.182 1.00 386.36 ? 466  SER A O   1 
ATOM   3375  C CB  . SER A 1 466 ? 112.110 165.057 156.840 1.00 409.42 ? 466  SER A CB  1 
ATOM   3376  O OG  . SER A 1 466 ? 112.131 166.308 157.508 1.00 413.86 ? 466  SER A OG  1 
ATOM   3377  N N   . TYR A 1 467 ? 109.241 164.851 154.734 1.00 377.96 ? 467  TYR A N   1 
ATOM   3378  C CA  . TYR A 1 467 ? 107.809 165.134 154.648 1.00 374.49 ? 467  TYR A CA  1 
ATOM   3379  C C   . TYR A 1 467 ? 107.047 164.486 155.806 1.00 390.43 ? 467  TYR A C   1 
ATOM   3380  O O   . TYR A 1 467 ? 107.483 163.453 156.322 1.00 404.47 ? 467  TYR A O   1 
ATOM   3381  C CB  . TYR A 1 467 ? 107.254 164.650 153.310 1.00 367.60 ? 467  TYR A CB  1 
ATOM   3382  C CG  . TYR A 1 467 ? 107.836 165.409 152.147 1.00 359.63 ? 467  TYR A CG  1 
ATOM   3383  C CD1 . TYR A 1 467 ? 107.247 166.590 151.701 1.00 365.61 ? 467  TYR A CD1 1 
ATOM   3384  C CD2 . TYR A 1 467 ? 108.991 164.968 151.507 1.00 337.60 ? 467  TYR A CD2 1 
ATOM   3385  C CE1 . TYR A 1 467 ? 107.783 167.304 150.640 1.00 368.61 ? 467  TYR A CE1 1 
ATOM   3386  C CE2 . TYR A 1 467 ? 109.533 165.675 150.444 1.00 342.56 ? 467  TYR A CE2 1 
ATOM   3387  C CZ  . TYR A 1 467 ? 108.928 166.843 150.012 1.00 347.86 ? 467  TYR A CZ  1 
ATOM   3388  O OH  . TYR A 1 467 ? 109.462 167.551 148.957 1.00 318.34 ? 467  TYR A OH  1 
ATOM   3389  N N   . PRO A 1 468 ? 105.916 165.095 156.230 1.00 399.05 ? 468  PRO A N   1 
ATOM   3390  C CA  . PRO A 1 468 ? 105.064 164.477 157.256 1.00 405.93 ? 468  PRO A CA  1 
ATOM   3391  C C   . PRO A 1 468 ? 104.518 163.103 156.860 1.00 411.10 ? 468  PRO A C   1 
ATOM   3392  O O   . PRO A 1 468 ? 104.293 162.843 155.674 1.00 402.88 ? 468  PRO A O   1 
ATOM   3393  C CB  . PRO A 1 468 ? 103.911 165.475 157.405 1.00 416.68 ? 468  PRO A CB  1 
ATOM   3394  C CG  . PRO A 1 468 ? 104.484 166.781 156.991 1.00 408.70 ? 468  PRO A CG  1 
ATOM   3395  C CD  . PRO A 1 468 ? 105.480 166.471 155.917 1.00 393.35 ? 468  PRO A CD  1 
ATOM   3396  N N   . GLU A 1 469 ? 104.307 162.245 157.857 1.00 425.00 ? 469  GLU A N   1 
ATOM   3397  C CA  . GLU A 1 469 ? 103.828 160.878 157.633 1.00 443.64 ? 469  GLU A CA  1 
ATOM   3398  C C   . GLU A 1 469 ? 102.353 160.830 157.217 1.00 434.87 ? 469  GLU A C   1 
ATOM   3399  O O   . GLU A 1 469 ? 101.952 159.924 156.482 1.00 433.21 ? 469  GLU A O   1 
ATOM   3400  C CB  . GLU A 1 469 ? 104.053 160.023 158.889 1.00 470.24 ? 469  GLU A CB  1 
ATOM   3401  C CG  . GLU A 1 469 ? 103.827 158.521 158.713 1.00 493.02 ? 469  GLU A CG  1 
ATOM   3402  C CD  . GLU A 1 469 ? 104.724 157.884 157.662 1.00 498.93 ? 469  GLU A CD  1 
ATOM   3403  O OE1 . GLU A 1 469 ? 105.882 158.328 157.499 1.00 500.00 ? 469  GLU A OE1 1 
ATOM   3404  O OE2 . GLU A 1 469 ? 104.270 156.927 156.998 1.00 498.48 ? 469  GLU A OE2 1 
ATOM   3405  N N   . TRP A 1 470 ? 101.553 161.784 157.700 1.00 419.50 ? 470  TRP A N   1 
ATOM   3406  C CA  . TRP A 1 470 ? 100.140 161.894 157.298 1.00 411.84 ? 470  TRP A CA  1 
ATOM   3407  C C   . TRP A 1 470 ? 99.972  162.248 155.813 1.00 404.40 ? 470  TRP A C   1 
ATOM   3408  O O   . TRP A 1 470 ? 99.043  161.762 155.164 1.00 403.28 ? 470  TRP A O   1 
ATOM   3409  C CB  . TRP A 1 470 ? 99.362  162.871 158.196 1.00 412.55 ? 470  TRP A CB  1 
ATOM   3410  C CG  . TRP A 1 470 ? 99.817  164.306 158.166 1.00 401.21 ? 470  TRP A CG  1 
ATOM   3411  C CD1 . TRP A 1 470 ? 99.489  165.254 157.240 1.00 390.20 ? 470  TRP A CD1 1 
ATOM   3412  C CD2 . TRP A 1 470 ? 100.650 164.959 159.131 1.00 404.75 ? 470  TRP A CD2 1 
ATOM   3413  N NE1 . TRP A 1 470 ? 100.080 166.453 157.558 1.00 386.24 ? 470  TRP A NE1 1 
ATOM   3414  C CE2 . TRP A 1 470 ? 100.799 166.301 158.714 1.00 402.76 ? 470  TRP A CE2 1 
ATOM   3415  C CE3 . TRP A 1 470 ? 101.294 164.537 160.303 1.00 418.23 ? 470  TRP A CE3 1 
ATOM   3416  C CZ2 . TRP A 1 470 ? 101.568 167.229 159.430 1.00 423.57 ? 470  TRP A CZ2 1 
ATOM   3417  C CZ3 . TRP A 1 470 ? 102.060 165.461 161.017 1.00 428.65 ? 470  TRP A CZ3 1 
ATOM   3418  C CH2 . TRP A 1 470 ? 102.189 166.792 160.575 1.00 429.21 ? 470  TRP A CH2 1 
ATOM   3419  N N   . LEU A 1 471 ? 100.866 163.087 155.288 1.00 408.09 ? 471  LEU A N   1 
ATOM   3420  C CA  . LEU A 1 471 ? 100.976 163.299 153.840 1.00 424.24 ? 471  LEU A CA  1 
ATOM   3421  C C   . LEU A 1 471 ? 101.638 162.086 153.188 1.00 437.80 ? 471  LEU A C   1 
ATOM   3422  O O   . LEU A 1 471 ? 102.276 161.278 153.870 1.00 442.99 ? 471  LEU A O   1 
ATOM   3423  C CB  . LEU A 1 471 ? 101.786 164.561 153.525 1.00 426.10 ? 471  LEU A CB  1 
ATOM   3424  C CG  . LEU A 1 471 ? 101.243 165.900 154.035 1.00 431.16 ? 471  LEU A CG  1 
ATOM   3425  C CD1 . LEU A 1 471 ? 102.168 167.037 153.620 1.00 421.57 ? 471  LEU A CD1 1 
ATOM   3426  C CD2 . LEU A 1 471 ? 99.827  166.150 153.532 1.00 440.61 ? 471  LEU A CD2 1 
ATOM   3427  N N   . SER A 1 472 ? 101.513 161.983 151.866 1.00 443.99 ? 472  SER A N   1 
ATOM   3428  C CA  . SER A 1 472 ? 101.946 160.777 151.133 1.00 455.47 ? 472  SER A CA  1 
ATOM   3429  C C   . SER A 1 472 ? 101.993 160.870 149.594 1.00 438.32 ? 472  SER A C   1 
ATOM   3430  O O   . SER A 1 472 ? 103.053 160.627 149.010 1.00 421.85 ? 472  SER A O   1 
ATOM   3431  C CB  . SER A 1 472 ? 101.126 159.541 151.563 1.00 471.25 ? 472  SER A CB  1 
ATOM   3432  O OG  . SER A 1 472 ? 99.764  159.850 151.809 1.00 478.13 ? 472  SER A OG  1 
ATOM   3433  N N   . PRO A 1 473 ? 100.862 161.207 148.931 1.00 424.24 ? 473  PRO A N   1 
ATOM   3434  C CA  . PRO A 1 473 ? 100.772 160.964 147.496 1.00 417.29 ? 473  PRO A CA  1 
ATOM   3435  C C   . PRO A 1 473 ? 101.330 162.161 146.689 1.00 385.14 ? 473  PRO A C   1 
ATOM   3436  O O   . PRO A 1 473 ? 102.476 162.550 146.922 1.00 345.40 ? 473  PRO A O   1 
ATOM   3437  C CB  . PRO A 1 473 ? 99.267  160.729 147.326 1.00 432.12 ? 473  PRO A CB  1 
ATOM   3438  C CG  . PRO A 1 473 ? 98.655  161.700 148.289 1.00 427.59 ? 473  PRO A CG  1 
ATOM   3439  C CD  . PRO A 1 473 ? 99.672  161.958 149.381 1.00 410.71 ? 473  PRO A CD  1 
ATOM   3440  N N   . GLU A 1 474 ? 100.561 162.730 145.755 1.00 399.23 ? 474  GLU A N   1 
ATOM   3441  C CA  . GLU A 1 474 ? 100.958 163.964 145.052 1.00 416.60 ? 474  GLU A CA  1 
ATOM   3442  C C   . GLU A 1 474 ? 101.009 165.226 145.932 1.00 392.37 ? 474  GLU A C   1 
ATOM   3443  O O   . GLU A 1 474 ? 101.517 166.253 145.487 1.00 412.80 ? 474  GLU A O   1 
ATOM   3444  C CB  . GLU A 1 474 ? 100.063 164.212 143.813 1.00 432.57 ? 474  GLU A CB  1 
ATOM   3445  C CG  . GLU A 1 474 ? 98.740  164.952 144.041 1.00 451.08 ? 474  GLU A CG  1 
ATOM   3446  C CD  . GLU A 1 474 ? 97.855  164.332 145.110 1.00 459.68 ? 474  GLU A CD  1 
ATOM   3447  O OE1 . GLU A 1 474 ? 97.845  163.088 145.235 1.00 468.62 ? 474  GLU A OE1 1 
ATOM   3448  O OE2 . GLU A 1 474 ? 97.165  165.090 145.824 1.00 456.62 ? 474  GLU A OE2 1 
ATOM   3449  N N   . GLU A 1 475 ? 100.471 165.162 147.151 1.00 383.83 ? 475  GLU A N   1 
ATOM   3450  C CA  . GLU A 1 475 ? 100.496 166.301 148.080 1.00 396.94 ? 475  GLU A CA  1 
ATOM   3451  C C   . GLU A 1 475 ? 101.918 166.726 148.493 1.00 392.05 ? 475  GLU A C   1 
ATOM   3452  O O   . GLU A 1 475 ? 102.150 167.903 148.787 1.00 382.97 ? 475  GLU A O   1 
ATOM   3453  C CB  . GLU A 1 475 ? 99.649  166.000 149.330 1.00 408.01 ? 475  GLU A CB  1 
ATOM   3454  C CG  . GLU A 1 475 ? 99.093  167.236 150.027 1.00 429.92 ? 475  GLU A CG  1 
ATOM   3455  C CD  . GLU A 1 475 ? 97.949  167.888 149.266 1.00 439.65 ? 475  GLU A CD  1 
ATOM   3456  O OE1 . GLU A 1 475 ? 96.941  167.201 148.995 1.00 441.38 ? 475  GLU A OE1 1 
ATOM   3457  O OE2 . GLU A 1 475 ? 98.054  169.092 148.946 1.00 448.51 ? 475  GLU A OE2 1 
ATOM   3458  N N   . ASP A 1 476 ? 102.857 165.775 148.509 1.00 384.90 ? 476  ASP A N   1 
ATOM   3459  C CA  . ASP A 1 476 ? 104.265 166.060 148.839 1.00 366.26 ? 476  ASP A CA  1 
ATOM   3460  C C   . ASP A 1 476 ? 105.002 166.897 147.788 1.00 344.08 ? 476  ASP A C   1 
ATOM   3461  O O   . ASP A 1 476 ? 106.030 167.500 148.099 1.00 316.67 ? 476  ASP A O   1 
ATOM   3462  C CB  . ASP A 1 476 ? 105.047 164.762 149.087 1.00 358.66 ? 476  ASP A CB  1 
ATOM   3463  C CG  . ASP A 1 476 ? 104.614 164.043 150.353 1.00 357.72 ? 476  ASP A CG  1 
ATOM   3464  O OD1 . ASP A 1 476 ? 104.268 164.714 151.349 1.00 359.83 ? 476  ASP A OD1 1 
ATOM   3465  O OD2 . ASP A 1 476 ? 104.639 162.796 150.357 1.00 386.49 ? 476  ASP A OD2 1 
ATOM   3466  N N   . LEU A 1 477 ? 104.500 166.919 146.553 1.00 332.75 ? 477  LEU A N   1 
ATOM   3467  C CA  . LEU A 1 477 ? 105.023 167.834 145.531 1.00 345.35 ? 477  LEU A CA  1 
ATOM   3468  C C   . LEU A 1 477 ? 104.946 169.294 145.957 1.00 361.21 ? 477  LEU A C   1 
ATOM   3469  O O   . LEU A 1 477 ? 105.918 170.035 145.812 1.00 386.82 ? 477  LEU A O   1 
ATOM   3470  C CB  . LEU A 1 477 ? 104.262 167.689 144.217 1.00 321.56 ? 477  LEU A CB  1 
ATOM   3471  C CG  . LEU A 1 477 ? 104.627 166.472 143.386 1.00 338.71 ? 477  LEU A CG  1 
ATOM   3472  C CD1 . LEU A 1 477 ? 103.491 166.123 142.439 1.00 365.81 ? 477  LEU A CD1 1 
ATOM   3473  C CD2 . LEU A 1 477 ? 105.910 166.742 142.617 1.00 357.85 ? 477  LEU A CD2 1 
ATOM   3474  N N   . ASN A 1 478 ? 103.790 169.690 146.481 1.00 342.70 ? 478  ASN A N   1 
ATOM   3475  C CA  . ASN A 1 478 ? 103.498 171.094 146.758 1.00 352.28 ? 478  ASN A CA  1 
ATOM   3476  C C   . ASN A 1 478 ? 103.860 171.568 148.173 1.00 369.83 ? 478  ASN A C   1 
ATOM   3477  O O   . ASN A 1 478 ? 103.776 172.768 148.452 1.00 377.91 ? 478  ASN A O   1 
ATOM   3478  C CB  . ASN A 1 478 ? 102.023 171.381 146.461 1.00 371.13 ? 478  ASN A CB  1 
ATOM   3479  C CG  . ASN A 1 478 ? 101.674 171.187 144.994 1.00 377.39 ? 478  ASN A CG  1 
ATOM   3480  O OD1 . ASN A 1 478 ? 101.454 172.155 144.266 1.00 399.21 ? 478  ASN A OD1 1 
ATOM   3481  N ND2 . ASN A 1 478 ? 101.627 169.934 144.552 1.00 357.58 ? 478  ASN A ND2 1 
ATOM   3482  N N   . PHE A 1 479 ? 104.271 170.649 149.053 1.00 356.22 ? 479  PHE A N   1 
ATOM   3483  C CA  . PHE A 1 479 ? 104.627 171.006 150.435 1.00 347.15 ? 479  PHE A CA  1 
ATOM   3484  C C   . PHE A 1 479 ? 105.982 171.716 150.519 1.00 331.32 ? 479  PHE A C   1 
ATOM   3485  O O   . PHE A 1 479 ? 107.033 171.079 150.438 1.00 336.72 ? 479  PHE A O   1 
ATOM   3486  C CB  . PHE A 1 479 ? 104.631 169.772 151.340 1.00 341.79 ? 479  PHE A CB  1 
ATOM   3487  C CG  . PHE A 1 479 ? 104.997 170.076 152.766 1.00 352.00 ? 479  PHE A CG  1 
ATOM   3488  C CD1 . PHE A 1 479 ? 104.095 170.723 153.603 1.00 380.18 ? 479  PHE A CD1 1 
ATOM   3489  C CD2 . PHE A 1 479 ? 106.246 169.729 153.271 1.00 370.60 ? 479  PHE A CD2 1 
ATOM   3490  C CE1 . PHE A 1 479 ? 104.426 171.011 154.920 1.00 390.58 ? 479  PHE A CE1 1 
ATOM   3491  C CE2 . PHE A 1 479 ? 106.584 170.014 154.588 1.00 388.89 ? 479  PHE A CE2 1 
ATOM   3492  C CZ  . PHE A 1 479 ? 105.673 170.656 155.413 1.00 397.60 ? 479  PHE A CZ  1 
ATOM   3493  N N   . VAL A 1 480 ? 105.940 173.037 150.678 1.00 345.94 ? 480  VAL A N   1 
ATOM   3494  C CA  . VAL A 1 480 ? 107.154 173.848 150.859 1.00 350.25 ? 480  VAL A CA  1 
ATOM   3495  C C   . VAL A 1 480 ? 107.880 173.535 152.176 1.00 321.56 ? 480  VAL A C   1 
ATOM   3496  O O   . VAL A 1 480 ? 107.688 174.212 153.189 1.00 337.42 ? 480  VAL A O   1 
ATOM   3497  C CB  . VAL A 1 480 ? 106.875 175.378 150.739 1.00 376.88 ? 480  VAL A CB  1 
ATOM   3498  C CG1 . VAL A 1 480 ? 106.610 175.754 149.289 1.00 369.80 ? 480  VAL A CG1 1 
ATOM   3499  C CG2 . VAL A 1 480 ? 105.722 175.843 151.639 1.00 398.75 ? 480  VAL A CG2 1 
ATOM   3500  N N   . THR A 1 481 ? 108.712 172.496 152.148 1.00 315.75 ? 481  THR A N   1 
ATOM   3501  C CA  . THR A 1 481 ? 109.549 172.137 153.307 1.00 348.46 ? 481  THR A CA  1 
ATOM   3502  C C   . THR A 1 481 ? 110.613 173.210 153.601 1.00 328.05 ? 481  THR A C   1 
ATOM   3503  O O   . THR A 1 481 ? 110.958 174.007 152.729 1.00 325.10 ? 481  THR A O   1 
ATOM   3504  C CB  . THR A 1 481 ? 110.185 170.722 153.167 1.00 373.35 ? 481  THR A CB  1 
ATOM   3505  O OG1 . THR A 1 481 ? 111.082 170.478 154.261 1.00 393.69 ? 481  THR A OG1 1 
ATOM   3506  C CG2 . THR A 1 481 ? 110.938 170.547 151.846 1.00 365.67 ? 481  THR A CG2 1 
ATOM   3507  N N   . ASP A 1 482 ? 111.116 173.218 154.835 1.00 329.75 ? 482  ASP A N   1 
ATOM   3508  C CA  . ASP A 1 482 ? 111.955 174.304 155.347 1.00 358.45 ? 482  ASP A CA  1 
ATOM   3509  C C   . ASP A 1 482 ? 113.237 174.422 154.546 1.00 333.06 ? 482  ASP A C   1 
ATOM   3510  O O   . ASP A 1 482 ? 113.643 175.532 154.162 1.00 320.14 ? 482  ASP A O   1 
ATOM   3511  C CB  . ASP A 1 482 ? 112.265 174.093 156.839 1.00 395.66 ? 482  ASP A CB  1 
ATOM   3512  C CG  . ASP A 1 482 ? 112.683 175.379 157.545 1.00 423.85 ? 482  ASP A CG  1 
ATOM   3513  O OD1 . ASP A 1 482 ? 113.744 175.943 157.199 1.00 443.72 ? 482  ASP A OD1 1 
ATOM   3514  O OD2 . ASP A 1 482 ? 111.952 175.818 158.460 1.00 415.98 ? 482  ASP A OD2 1 
ATOM   3515  N N   . THR A 1 483 ? 113.834 173.260 154.274 1.00 343.35 ? 483  THR A N   1 
ATOM   3516  C CA  . THR A 1 483 ? 115.059 173.178 153.461 1.00 351.80 ? 483  THR A CA  1 
ATOM   3517  C C   . THR A 1 483 ? 114.809 173.774 152.087 1.00 316.36 ? 483  THR A C   1 
ATOM   3518  O O   . THR A 1 483 ? 115.637 174.559 151.591 1.00 282.92 ? 483  THR A O   1 
ATOM   3519  C CB  . THR A 1 483 ? 115.636 171.748 153.337 1.00 366.07 ? 483  THR A CB  1 
ATOM   3520  O OG1 . THR A 1 483 ? 116.811 171.778 152.515 1.00 349.56 ? 483  THR A OG1 1 
ATOM   3521  C CG2 . THR A 1 483 ? 114.634 170.761 152.735 1.00 379.39 ? 483  THR A CG2 1 
ATOM   3522  N N   . ALA A 1 484 ? 113.667 173.398 151.507 1.00 322.04 ? 484  ALA A N   1 
ATOM   3523  C CA  . ALA A 1 484 ? 113.280 173.881 150.176 1.00 346.22 ? 484  ALA A CA  1 
ATOM   3524  C C   . ALA A 1 484 ? 113.179 175.398 150.176 1.00 326.18 ? 484  ALA A C   1 
ATOM   3525  O O   . ALA A 1 484 ? 113.680 176.062 149.260 1.00 319.37 ? 484  ALA A O   1 
ATOM   3526  C CB  . ALA A 1 484 ? 111.977 173.261 149.694 1.00 357.97 ? 484  ALA A CB  1 
ATOM   3527  N N   . LYS A 1 485 ? 112.531 175.910 151.215 1.00 348.37 ? 485  LYS A N   1 
ATOM   3528  C CA  . LYS A 1 485 ? 112.334 177.354 151.398 1.00 357.62 ? 485  LYS A CA  1 
ATOM   3529  C C   . LYS A 1 485 ? 113.681 178.064 151.437 1.00 337.72 ? 485  LYS A C   1 
ATOM   3530  O O   . LYS A 1 485 ? 113.875 179.095 150.771 1.00 340.99 ? 485  LYS A O   1 
ATOM   3531  C CB  . LYS A 1 485 ? 111.516 177.677 152.658 1.00 359.82 ? 485  LYS A CB  1 
ATOM   3532  C CG  . LYS A 1 485 ? 110.027 177.408 152.502 1.00 372.52 ? 485  LYS A CG  1 
ATOM   3533  C CD  . LYS A 1 485 ? 109.219 177.929 153.682 1.00 380.70 ? 485  LYS A CD  1 
ATOM   3534  C CE  . LYS A 1 485 ? 109.432 177.091 154.932 1.00 383.04 ? 485  LYS A CE  1 
ATOM   3535  N NZ  . LYS A 1 485 ? 108.472 177.445 156.014 1.00 396.28 ? 485  LYS A NZ  1 
ATOM   3536  N N   . ALA A 1 486 ? 114.583 177.485 152.220 1.00 332.64 ? 486  ALA A N   1 
ATOM   3537  C CA  . ALA A 1 486 ? 115.938 178.013 152.397 1.00 343.05 ? 486  ALA A CA  1 
ATOM   3538  C C   . ALA A 1 486 ? 116.647 178.101 151.045 1.00 332.39 ? 486  ALA A C   1 
ATOM   3539  O O   . ALA A 1 486 ? 117.264 179.132 150.703 1.00 332.54 ? 486  ALA A O   1 
ATOM   3540  C CB  . ALA A 1 486 ? 116.745 177.160 153.368 1.00 355.93 ? 486  ALA A CB  1 
ATOM   3541  N N   . LEU A 1 487 ? 116.527 177.008 150.302 1.00 332.18 ? 487  LEU A N   1 
ATOM   3542  C CA  . LEU A 1 487 ? 117.135 176.883 148.973 1.00 315.20 ? 487  LEU A CA  1 
ATOM   3543  C C   . LEU A 1 487 ? 116.625 177.971 148.057 1.00 313.66 ? 487  LEU A C   1 
ATOM   3544  O O   . LEU A 1 487 ? 117.384 178.518 147.280 1.00 310.84 ? 487  LEU A O   1 
ATOM   3545  C CB  . LEU A 1 487 ? 116.869 175.514 148.329 1.00 321.20 ? 487  LEU A CB  1 
ATOM   3546  C CG  . LEU A 1 487 ? 118.076 174.591 148.147 1.00 321.93 ? 487  LEU A CG  1 
ATOM   3547  C CD1 . LEU A 1 487 ? 118.527 173.981 149.461 1.00 312.85 ? 487  LEU A CD1 1 
ATOM   3548  C CD2 . LEU A 1 487 ? 117.721 173.500 147.147 1.00 357.15 ? 487  LEU A CD2 1 
ATOM   3549  N N   . ALA A 1 488 ? 115.309 178.179 148.098 1.00 325.38 ? 488  ALA A N   1 
ATOM   3550  C CA  . ALA A 1 488 ? 114.623 179.182 147.294 1.00 331.96 ? 488  ALA A CA  1 
ATOM   3551  C C   . ALA A 1 488 ? 115.149 180.538 147.584 1.00 338.24 ? 488  ALA A C   1 
ATOM   3552  O O   . ALA A 1 488 ? 115.197 181.342 146.641 1.00 323.18 ? 488  ALA A O   1 
ATOM   3553  C CB  . ALA A 1 488 ? 113.121 179.139 147.534 1.00 333.21 ? 488  ALA A CB  1 
ATOM   3554  N N   . ASP A 1 489 ? 115.470 180.856 148.842 1.00 340.80 ? 489  ASP A N   1 
ATOM   3555  C CA  . ASP A 1 489 ? 116.054 182.138 149.216 1.00 342.40 ? 489  ASP A CA  1 
ATOM   3556  C C   . ASP A 1 489 ? 117.353 182.370 148.424 1.00 320.99 ? 489  ASP A C   1 
ATOM   3557  O O   . ASP A 1 489 ? 117.590 183.440 147.799 1.00 346.12 ? 489  ASP A O   1 
ATOM   3558  C CB  . ASP A 1 489 ? 116.286 182.264 150.727 1.00 360.43 ? 489  ASP A CB  1 
ATOM   3559  C CG  . ASP A 1 489 ? 114.989 182.216 151.530 1.00 394.79 ? 489  ASP A CG  1 
ATOM   3560  O OD1 . ASP A 1 489 ? 114.062 182.998 151.223 1.00 396.95 ? 489  ASP A OD1 1 
ATOM   3561  O OD2 . ASP A 1 489 ? 114.902 181.405 152.477 1.00 399.17 ? 489  ASP A OD2 1 
ATOM   3562  N N   . VAL A 1 490 ? 118.179 181.331 148.489 1.00 315.51 ? 490  VAL A N   1 
ATOM   3563  C CA  . VAL A 1 490 ? 119.495 181.335 147.821 1.00 309.56 ? 490  VAL A CA  1 
ATOM   3564  C C   . VAL A 1 490 ? 119.323 181.549 146.331 1.00 304.95 ? 490  VAL A C   1 
ATOM   3565  O O   . VAL A 1 490 ? 120.019 182.359 145.704 1.00 305.58 ? 490  VAL A O   1 
ATOM   3566  C CB  . VAL A 1 490 ? 120.336 180.042 147.986 1.00 300.05 ? 490  VAL A CB  1 
ATOM   3567  C CG1 . VAL A 1 490 ? 121.712 180.236 147.344 1.00 298.03 ? 490  VAL A CG1 1 
ATOM   3568  C CG2 . VAL A 1 490 ? 120.516 179.652 149.442 1.00 314.80 ? 490  VAL A CG2 1 
ATOM   3569  N N   . ALA A 1 491 ? 118.385 180.802 145.779 1.00 301.56 ? 491  ALA A N   1 
ATOM   3570  C CA  . ALA A 1 491 ? 118.044 180.846 144.344 1.00 309.89 ? 491  ALA A CA  1 
ATOM   3571  C C   . ALA A 1 491 ? 117.624 182.235 143.968 1.00 301.24 ? 491  ALA A C   1 
ATOM   3572  O O   . ALA A 1 491 ? 118.075 182.749 142.945 1.00 299.24 ? 491  ALA A O   1 
ATOM   3573  C CB  . ALA A 1 491 ? 116.934 179.872 144.030 1.00 330.34 ? 491  ALA A CB  1 
ATOM   3574  N N   . THR A 1 492 ? 116.770 182.825 144.789 1.00 314.38 ? 492  THR A N   1 
ATOM   3575  C CA  . THR A 1 492 ? 116.253 184.188 144.590 1.00 331.57 ? 492  THR A CA  1 
ATOM   3576  C C   . THR A 1 492 ? 117.413 185.171 144.502 1.00 295.98 ? 492  THR A C   1 
ATOM   3577  O O   . THR A 1 492 ? 117.468 186.024 143.589 1.00 297.79 ? 492  THR A O   1 
ATOM   3578  C CB  . THR A 1 492 ? 115.364 184.614 145.790 1.00 324.88 ? 492  THR A CB  1 
ATOM   3579  O OG1 . THR A 1 492 ? 114.118 183.908 145.743 1.00 359.46 ? 492  THR A OG1 1 
ATOM   3580  C CG2 . THR A 1 492 ? 115.095 186.127 145.815 1.00 334.03 ? 492  THR A CG2 1 
ATOM   3581  N N   . VAL A 1 493 ? 118.316 185.024 145.470 1.00 296.85 ? 493  VAL A N   1 
ATOM   3582  C CA  . VAL A 1 493 ? 119.504 185.880 145.574 1.00 320.47 ? 493  VAL A CA  1 
ATOM   3583  C C   . VAL A 1 493 ? 120.330 185.791 144.292 1.00 310.68 ? 493  VAL A C   1 
ATOM   3584  O O   . VAL A 1 493 ? 120.759 186.816 143.731 1.00 263.67 ? 493  VAL A O   1 
ATOM   3585  C CB  . VAL A 1 493 ? 120.386 185.529 146.799 1.00 329.31 ? 493  VAL A CB  1 
ATOM   3586  C CG1 . VAL A 1 493 ? 121.802 186.093 146.668 1.00 313.56 ? 493  VAL A CG1 1 
ATOM   3587  C CG2 . VAL A 1 493 ? 119.730 186.045 148.067 1.00 355.57 ? 493  VAL A CG2 1 
ATOM   3588  N N   . LEU A 1 494 ? 120.527 184.551 143.862 1.00 325.99 ? 494  LEU A N   1 
ATOM   3589  C CA  . LEU A 1 494 ? 121.300 184.244 142.654 1.00 319.57 ? 494  LEU A CA  1 
ATOM   3590  C C   . LEU A 1 494 ? 120.686 184.931 141.450 1.00 310.95 ? 494  LEU A C   1 
ATOM   3591  O O   . LEU A 1 494 ? 121.394 185.550 140.645 1.00 314.76 ? 494  LEU A O   1 
ATOM   3592  C CB  . LEU A 1 494 ? 121.429 182.732 142.422 1.00 314.68 ? 494  LEU A CB  1 
ATOM   3593  C CG  . LEU A 1 494 ? 122.418 182.346 141.308 1.00 325.67 ? 494  LEU A CG  1 
ATOM   3594  C CD1 . LEU A 1 494 ? 123.426 181.294 141.740 1.00 354.12 ? 494  LEU A CD1 1 
ATOM   3595  C CD2 . LEU A 1 494 ? 121.686 181.878 140.063 1.00 343.24 ? 494  LEU A CD2 1 
ATOM   3596  N N   . GLY A 1 495 ? 119.371 184.808 141.355 1.00 301.15 ? 495  GLY A N   1 
ATOM   3597  C CA  . GLY A 1 495 ? 118.584 185.398 140.263 1.00 306.83 ? 495  GLY A CA  1 
ATOM   3598  C C   . GLY A 1 495 ? 118.799 186.902 140.224 1.00 313.37 ? 495  GLY A C   1 
ATOM   3599  O O   . GLY A 1 495 ? 119.041 187.483 139.149 1.00 308.22 ? 495  GLY A O   1 
ATOM   3600  N N   . ARG A 1 496 ? 118.705 187.499 141.412 1.00 310.69 ? 496  ARG A N   1 
ATOM   3601  C CA  . ARG A 1 496 ? 118.867 188.946 141.575 1.00 300.47 ? 496  ARG A CA  1 
ATOM   3602  C C   . ARG A 1 496 ? 120.247 189.378 141.075 1.00 313.07 ? 496  ARG A C   1 
ATOM   3603  O O   . ARG A 1 496 ? 120.373 190.371 140.332 1.00 324.23 ? 496  ARG A O   1 
ATOM   3604  C CB  . ARG A 1 496 ? 118.527 189.414 142.983 1.00 300.84 ? 496  ARG A CB  1 
ATOM   3605  C CG  . ARG A 1 496 ? 117.026 189.419 143.224 1.00 322.69 ? 496  ARG A CG  1 
ATOM   3606  C CD  . ARG A 1 496 ? 116.664 189.907 144.616 1.00 343.24 ? 496  ARG A CD  1 
ATOM   3607  N NE  . ARG A 1 496 ? 115.337 189.456 145.042 1.00 334.40 ? 496  ARG A NE  1 
ATOM   3608  C CZ  . ARG A 1 496 ? 114.710 189.872 146.143 1.00 370.02 ? 496  ARG A CZ  1 
ATOM   3609  N NH1 . ARG A 1 496 ? 115.268 190.768 146.953 1.00 389.32 ? 496  ARG A NH1 1 
ATOM   3610  N NH2 . ARG A 1 496 ? 113.504 189.394 146.438 1.00 379.55 ? 496  ARG A NH2 1 
ATOM   3611  N N   . ALA A 1 497 ? 121.245 188.607 141.492 1.00 311.19 ? 497  ALA A N   1 
ATOM   3612  C CA  . ALA A 1 497 ? 122.640 188.854 141.122 1.00 321.50 ? 497  ALA A CA  1 
ATOM   3613  C C   . ALA A 1 497 ? 122.796 188.833 139.609 1.00 321.57 ? 497  ALA A C   1 
ATOM   3614  O O   . ALA A 1 497 ? 123.436 189.716 139.022 1.00 341.26 ? 497  ALA A O   1 
ATOM   3615  C CB  . ALA A 1 497 ? 123.566 187.833 141.767 1.00 365.80 ? 497  ALA A CB  1 
ATOM   3616  N N   . LEU A 1 498 ? 122.196 187.814 139.012 1.00 316.86 ? 498  LEU A N   1 
ATOM   3617  C CA  . LEU A 1 498 ? 122.229 187.612 137.557 1.00 315.99 ? 498  LEU A CA  1 
ATOM   3618  C C   . LEU A 1 498 ? 121.639 188.817 136.849 1.00 318.39 ? 498  LEU A C   1 
ATOM   3619  O O   . LEU A 1 498 ? 122.214 189.322 135.877 1.00 335.53 ? 498  LEU A O   1 
ATOM   3620  C CB  . LEU A 1 498 ? 121.570 186.290 137.145 1.00 303.23 ? 498  LEU A CB  1 
ATOM   3621  C CG  . LEU A 1 498 ? 122.353 185.023 137.543 1.00 305.53 ? 498  LEU A CG  1 
ATOM   3622  C CD1 . LEU A 1 498 ? 121.554 183.762 137.240 1.00 303.03 ? 498  LEU A CD1 1 
ATOM   3623  C CD2 . LEU A 1 498 ? 123.712 184.952 136.865 1.00 311.98 ? 498  LEU A CD2 1 
ATOM   3624  N N   . TYR A 1 499 ? 120.496 189.256 137.364 1.00 321.85 ? 499  TYR A N   1 
ATOM   3625  C CA  . TYR A 1 499 ? 119.769 190.411 136.822 1.00 337.24 ? 499  TYR A CA  1 
ATOM   3626  C C   . TYR A 1 499 ? 120.665 191.647 136.846 1.00 330.85 ? 499  TYR A C   1 
ATOM   3627  O O   . TYR A 1 499 ? 120.760 192.386 135.849 1.00 339.99 ? 499  TYR A O   1 
ATOM   3628  C CB  . TYR A 1 499 ? 118.468 190.669 137.594 1.00 345.60 ? 499  TYR A CB  1 
ATOM   3629  C CG  . TYR A 1 499 ? 117.516 191.626 136.906 1.00 338.55 ? 499  TYR A CG  1 
ATOM   3630  C CD1 . TYR A 1 499 ? 116.976 191.323 135.655 1.00 358.03 ? 499  TYR A CD1 1 
ATOM   3631  C CD2 . TYR A 1 499 ? 117.136 192.825 137.512 1.00 345.21 ? 499  TYR A CD2 1 
ATOM   3632  C CE1 . TYR A 1 499 ? 116.100 192.191 135.021 1.00 369.06 ? 499  TYR A CE1 1 
ATOM   3633  C CE2 . TYR A 1 499 ? 116.259 193.700 136.886 1.00 355.24 ? 499  TYR A CE2 1 
ATOM   3634  C CZ  . TYR A 1 499 ? 115.744 193.381 135.640 1.00 372.12 ? 499  TYR A CZ  1 
ATOM   3635  O OH  . TYR A 1 499 ? 114.874 194.244 135.014 1.00 382.21 ? 499  TYR A OH  1 
ATOM   3636  N N   . GLU A 1 500 ? 121.289 191.888 137.996 1.00 343.04 ? 500  GLU A N   1 
ATOM   3637  C CA  . GLU A 1 500 ? 122.235 192.988 138.152 1.00 357.37 ? 500  GLU A CA  1 
ATOM   3638  C C   . GLU A 1 500 ? 123.453 192.790 137.257 1.00 346.11 ? 500  GLU A C   1 
ATOM   3639  O O   . GLU A 1 500 ? 123.943 193.735 136.639 1.00 350.25 ? 500  GLU A O   1 
ATOM   3640  C CB  . GLU A 1 500 ? 122.671 193.118 139.612 1.00 384.92 ? 500  GLU A CB  1 
ATOM   3641  C CG  . GLU A 1 500 ? 121.884 194.149 140.406 1.00 403.93 ? 500  GLU A CG  1 
ATOM   3642  C CD  . GLU A 1 500 ? 122.348 194.253 141.845 1.00 411.75 ? 500  GLU A CD  1 
ATOM   3643  O OE1 . GLU A 1 500 ? 123.509 194.654 142.070 1.00 413.65 ? 500  GLU A OE1 1 
ATOM   3644  O OE2 . GLU A 1 500 ? 121.550 193.934 142.752 1.00 414.02 ? 500  GLU A OE2 1 
ATOM   3645  N N   . LEU A 1 501 ? 123.954 191.555 137.235 1.00 338.00 ? 501  LEU A N   1 
ATOM   3646  C CA  . LEU A 1 501 ? 125.057 191.173 136.360 1.00 336.09 ? 501  LEU A CA  1 
ATOM   3647  C C   . LEU A 1 501 ? 124.628 191.302 134.906 1.00 338.29 ? 501  LEU A C   1 
ATOM   3648  O O   . LEU A 1 501 ? 125.380 191.797 134.067 1.00 377.19 ? 501  LEU A O   1 
ATOM   3649  C CB  . LEU A 1 501 ? 125.504 189.740 136.654 1.00 345.51 ? 501  LEU A CB  1 
ATOM   3650  C CG  . LEU A 1 501 ? 126.837 189.585 137.390 1.00 355.26 ? 501  LEU A CG  1 
ATOM   3651  C CD1 . LEU A 1 501 ? 127.447 188.219 137.115 1.00 376.21 ? 501  LEU A CD1 1 
ATOM   3652  C CD2 . LEU A 1 501 ? 127.800 190.695 137.000 1.00 319.53 ? 501  LEU A CD2 1 
ATOM   3653  N N   . ALA A 1 502 ? 123.405 190.867 134.618 1.00 319.64 ? 502  ALA A N   1 
ATOM   3654  C CA  . ALA A 1 502 ? 122.799 191.128 133.333 1.00 345.51 ? 502  ALA A CA  1 
ATOM   3655  C C   . ALA A 1 502 ? 122.667 192.636 133.268 1.00 364.22 ? 502  ALA A C   1 
ATOM   3656  O O   . ALA A 1 502 ? 122.865 193.243 132.226 1.00 377.21 ? 502  ALA A O   1 
ATOM   3657  C CB  . ALA A 1 502 ? 121.446 190.462 133.225 1.00 351.47 ? 502  ALA A CB  1 
ATOM   3658  N N   . GLY A 1 503 ? 122.392 193.216 134.434 1.00 361.22 ? 503  GLY A N   1 
ATOM   3659  C CA  . GLY A 1 503 ? 122.394 194.652 134.629 1.00 372.83 ? 503  GLY A CA  1 
ATOM   3660  C C   . GLY A 1 503 ? 121.188 195.549 134.418 1.00 370.98 ? 503  GLY A C   1 
ATOM   3661  O O   . GLY A 1 503 ? 121.368 196.761 134.416 1.00 382.39 ? 503  GLY A O   1 
ATOM   3662  N N   . GLY A 1 504 ? 119.986 195.014 134.226 1.00 368.54 ? 504  GLY A N   1 
ATOM   3663  C CA  . GLY A 1 504 ? 118.864 195.889 133.903 1.00 392.30 ? 504  GLY A CA  1 
ATOM   3664  C C   . GLY A 1 504 ? 118.447 196.943 134.927 1.00 398.06 ? 504  GLY A C   1 
ATOM   3665  O O   . GLY A 1 504 ? 118.276 198.106 134.568 1.00 390.73 ? 504  GLY A O   1 
ATOM   3666  N N   . THR A 1 505 ? 118.303 196.570 136.194 1.00 406.02 ? 505  THR A N   1 
ATOM   3667  C CA  . THR A 1 505 ? 118.222 197.536 137.295 1.00 415.86 ? 505  THR A CA  1 
ATOM   3668  C C   . THR A 1 505 ? 116.895 198.297 137.474 1.00 408.68 ? 505  THR A C   1 
ATOM   3669  O O   . THR A 1 505 ? 116.759 199.098 138.393 1.00 388.85 ? 505  THR A O   1 
ATOM   3670  C CB  . THR A 1 505 ? 119.353 198.563 137.192 1.00 422.75 ? 505  THR A CB  1 
ATOM   3671  O OG1 . THR A 1 505 ? 119.196 199.317 135.985 1.00 422.61 ? 505  THR A OG1 1 
ATOM   3672  C CG2 . THR A 1 505 ? 120.693 197.855 137.171 1.00 428.54 ? 505  THR A CG2 1 
ATOM   3673  N N   . ASN A 1 506 ? 116.011 198.148 136.484 1.00 421.56 ? 506  ASN A N   1 
ATOM   3674  C CA  . ASN A 1 506 ? 114.592 198.529 136.547 1.00 421.94 ? 506  ASN A CA  1 
ATOM   3675  C C   . ASN A 1 506 ? 113.644 197.698 137.438 1.00 405.65 ? 506  ASN A C   1 
ATOM   3676  O O   . ASN A 1 506 ? 112.816 198.252 138.161 1.00 425.48 ? 506  ASN A O   1 
ATOM   3677  C CB  . ASN A 1 506 ? 114.011 198.623 135.132 1.00 441.35 ? 506  ASN A CB  1 
ATOM   3678  C CG  . ASN A 1 506 ? 114.234 199.982 134.500 1.00 464.54 ? 506  ASN A CG  1 
ATOM   3679  O OD1 . ASN A 1 506 ? 114.368 200.098 133.282 1.00 467.54 ? 506  ASN A OD1 1 
ATOM   3680  N ND2 . ASN A 1 506 ? 114.275 201.020 135.327 1.00 485.13 ? 506  ASN A ND2 1 
ATOM   3681  N N   . PHE A 1 507 ? 113.773 196.372 137.370 1.00 391.78 ? 507  PHE A N   1 
ATOM   3682  C CA  . PHE A 1 507 ? 112.912 195.449 138.091 1.00 390.65 ? 507  PHE A CA  1 
ATOM   3683  C C   . PHE A 1 507 ? 113.748 194.441 138.863 1.00 371.66 ? 507  PHE A C   1 
ATOM   3684  O O   . PHE A 1 507 ? 113.773 193.255 138.550 1.00 347.39 ? 507  PHE A O   1 
ATOM   3685  C CB  . PHE A 1 507 ? 112.004 194.706 137.113 1.00 395.58 ? 507  PHE A CB  1 
ATOM   3686  C CG  . PHE A 1 507 ? 111.233 195.602 136.201 1.00 412.57 ? 507  PHE A CG  1 
ATOM   3687  C CD1 . PHE A 1 507 ? 111.057 196.936 136.509 1.00 429.57 ? 507  PHE A CD1 1 
ATOM   3688  C CD2 . PHE A 1 507 ? 110.676 195.106 135.038 1.00 419.29 ? 507  PHE A CD2 1 
ATOM   3689  C CE1 . PHE A 1 507 ? 110.337 197.763 135.671 1.00 433.59 ? 507  PHE A CE1 1 
ATOM   3690  C CE2 . PHE A 1 507 ? 109.955 195.926 134.194 1.00 431.52 ? 507  PHE A CE2 1 
ATOM   3691  C CZ  . PHE A 1 507 ? 109.785 197.259 134.511 1.00 431.65 ? 507  PHE A CZ  1 
ATOM   3692  N N   . SER A 1 508 ? 114.412 194.924 139.902 1.00 380.54 ? 508  SER A N   1 
ATOM   3693  C CA  . SER A 1 508 ? 115.248 194.065 140.753 1.00 384.45 ? 508  SER A CA  1 
ATOM   3694  C C   . SER A 1 508 ? 114.471 193.365 141.878 1.00 389.49 ? 508  SER A C   1 
ATOM   3695  O O   . SER A 1 508 ? 114.975 192.406 142.467 1.00 382.91 ? 508  SER A O   1 
ATOM   3696  C CB  . SER A 1 508 ? 116.396 194.876 141.361 1.00 397.90 ? 508  SER A CB  1 
ATOM   3697  O OG  . SER A 1 508 ? 115.904 195.963 142.128 1.00 406.84 ? 508  SER A OG  1 
ATOM   3698  N N   . ASP A 1 509 ? 113.265 193.851 142.181 1.00 390.71 ? 509  ASP A N   1 
ATOM   3699  C CA  . ASP A 1 509 ? 112.417 193.270 143.230 1.00 394.53 ? 509  ASP A CA  1 
ATOM   3700  C C   . ASP A 1 509 ? 111.588 192.089 142.730 1.00 379.69 ? 509  ASP A C   1 
ATOM   3701  O O   . ASP A 1 509 ? 111.442 191.094 143.442 1.00 387.21 ? 509  ASP A O   1 
ATOM   3702  C CB  . ASP A 1 509 ? 111.478 194.332 143.815 1.00 424.20 ? 509  ASP A CB  1 
ATOM   3703  C CG  . ASP A 1 509 ? 112.224 195.472 144.490 1.00 447.56 ? 509  ASP A CG  1 
ATOM   3704  O OD1 . ASP A 1 509 ? 113.128 195.198 145.310 1.00 464.15 ? 509  ASP A OD1 1 
ATOM   3705  O OD2 . ASP A 1 509 ? 111.897 196.645 144.210 1.00 457.21 ? 509  ASP A OD2 1 
ATOM   3706  N N   . THR A 1 510 ? 111.080 192.228 141.515 1.00 391.74 ? 510  THR A N   1 
ATOM   3707  C CA  . THR A 1 510 ? 110.030 191.381 141.000 1.00 405.34 ? 510  THR A CA  1 
ATOM   3708  C C   . THR A 1 510 ? 110.474 189.944 140.951 1.00 402.98 ? 510  THR A C   1 
ATOM   3709  O O   . THR A 1 510 ? 109.697 189.042 141.251 1.00 406.83 ? 510  THR A O   1 
ATOM   3710  C CB  . THR A 1 510 ? 109.636 191.798 139.578 1.00 419.12 ? 510  THR A CB  1 
ATOM   3711  O OG1 . THR A 1 510 ? 110.814 191.890 138.771 1.00 410.93 ? 510  THR A OG1 1 
ATOM   3712  C CG2 . THR A 1 510 ? 108.939 193.146 139.595 1.00 435.81 ? 510  THR A CG2 1 
ATOM   3713  N N   . VAL A 1 511 ? 111.722 189.719 140.571 1.00 385.98 ? 511  VAL A N   1 
ATOM   3714  C CA  . VAL A 1 511 ? 112.172 188.357 140.400 1.00 364.10 ? 511  VAL A CA  1 
ATOM   3715  C C   . VAL A 1 511 ? 112.666 187.791 141.704 1.00 346.41 ? 511  VAL A C   1 
ATOM   3716  O O   . VAL A 1 511 ? 113.685 188.211 142.228 1.00 351.26 ? 511  VAL A O   1 
ATOM   3717  C CB  . VAL A 1 511 ? 113.320 188.269 139.394 1.00 380.17 ? 511  VAL A CB  1 
ATOM   3718  C CG1 . VAL A 1 511 ? 114.471 189.159 139.822 1.00 397.68 ? 511  VAL A CG1 1 
ATOM   3719  C CG2 . VAL A 1 511 ? 113.775 186.827 139.256 1.00 389.04 ? 511  VAL A CG2 1 
ATOM   3720  N N   . GLN A 1 512 ? 111.926 186.822 142.214 1.00 345.20 ? 512  GLN A N   1 
ATOM   3721  C CA  . GLN A 1 512 ? 112.364 185.998 143.317 1.00 339.25 ? 512  GLN A CA  1 
ATOM   3722  C C   . GLN A 1 512 ? 111.907 184.612 142.941 1.00 330.60 ? 512  GLN A C   1 
ATOM   3723  O O   . GLN A 1 512 ? 110.860 184.465 142.323 1.00 345.31 ? 512  GLN A O   1 
ATOM   3724  C CB  . GLN A 1 512 ? 111.706 186.440 144.614 1.00 347.39 ? 512  GLN A CB  1 
ATOM   3725  C CG  . GLN A 1 512 ? 110.229 186.105 144.699 1.00 379.60 ? 512  GLN A CG  1 
ATOM   3726  C CD  . GLN A 1 512 ? 109.507 186.940 145.725 1.00 408.95 ? 512  GLN A CD  1 
ATOM   3727  O OE1 . GLN A 1 512 ? 109.993 187.992 146.134 1.00 422.82 ? 512  GLN A OE1 1 
ATOM   3728  N NE2 . GLN A 1 512 ? 108.338 186.479 146.146 1.00 415.19 ? 512  GLN A NE2 1 
ATOM   3729  N N   . ALA A 1 513 ? 112.660 183.595 143.321 1.00 313.64 ? 513  ALA A N   1 
ATOM   3730  C CA  . ALA A 1 513 ? 112.292 182.253 142.928 1.00 330.79 ? 513  ALA A CA  1 
ATOM   3731  C C   . ALA A 1 513 ? 111.397 181.680 143.994 1.00 339.01 ? 513  ALA A C   1 
ATOM   3732  O O   . ALA A 1 513 ? 111.803 181.498 145.129 1.00 321.09 ? 513  ALA A O   1 
ATOM   3733  C CB  . ALA A 1 513 ? 113.528 181.400 142.758 1.00 337.11 ? 513  ALA A CB  1 
ATOM   3734  N N   . ASP A 1 514 ? 110.166 181.391 143.605 1.00 366.04 ? 514  ASP A N   1 
ATOM   3735  C CA  . ASP A 1 514 ? 109.145 180.911 144.537 1.00 369.40 ? 514  ASP A CA  1 
ATOM   3736  C C   . ASP A 1 514 ? 109.527 179.548 145.130 1.00 337.52 ? 514  ASP A C   1 
ATOM   3737  O O   . ASP A 1 514 ? 110.063 178.697 144.415 1.00 323.48 ? 514  ASP A O   1 
ATOM   3738  C CB  . ASP A 1 514 ? 107.751 180.861 143.882 1.00 394.39 ? 514  ASP A CB  1 
ATOM   3739  C CG  . ASP A 1 514 ? 107.638 179.805 142.795 1.00 396.54 ? 514  ASP A CG  1 
ATOM   3740  O OD1 . ASP A 1 514 ? 108.576 179.687 141.977 1.00 410.03 ? 514  ASP A OD1 1 
ATOM   3741  O OD2 . ASP A 1 514 ? 106.607 179.099 142.756 1.00 408.17 ? 514  ASP A OD2 1 
ATOM   3742  N N   . PRO A 1 515 ? 109.259 179.339 146.438 1.00 332.07 ? 515  PRO A N   1 
ATOM   3743  C CA  . PRO A 1 515 ? 109.684 178.131 147.090 1.00 316.16 ? 515  PRO A CA  1 
ATOM   3744  C C   . PRO A 1 515 ? 108.928 176.929 146.613 1.00 300.77 ? 515  PRO A C   1 
ATOM   3745  O O   . PRO A 1 515 ? 109.509 175.848 146.693 1.00 312.64 ? 515  PRO A O   1 
ATOM   3746  C CB  . PRO A 1 515 ? 109.392 178.383 148.582 1.00 339.37 ? 515  PRO A CB  1 
ATOM   3747  C CG  . PRO A 1 515 ? 109.017 179.814 148.698 1.00 365.60 ? 515  PRO A CG  1 
ATOM   3748  C CD  . PRO A 1 515 ? 108.490 180.201 147.357 1.00 352.52 ? 515  PRO A CD  1 
ATOM   3749  N N   . GLN A 1 516 ? 107.669 177.096 146.184 1.00 326.07 ? 516  GLN A N   1 
ATOM   3750  C CA  . GLN A 1 516 ? 106.832 175.994 145.766 1.00 354.95 ? 516  GLN A CA  1 
ATOM   3751  C C   . GLN A 1 516 ? 107.493 175.218 144.624 1.00 342.83 ? 516  GLN A C   1 
ATOM   3752  O O   . GLN A 1 516 ? 107.554 173.976 144.642 1.00 325.91 ? 516  GLN A O   1 
ATOM   3753  C CB  . GLN A 1 516 ? 105.434 176.474 145.348 1.00 367.74 ? 516  GLN A CB  1 
ATOM   3754  C CG  . GLN A 1 516 ? 104.376 175.381 145.406 1.00 384.77 ? 516  GLN A CG  1 
ATOM   3755  C CD  . GLN A 1 516 ? 103.064 175.788 144.761 1.00 420.10 ? 516  GLN A CD  1 
ATOM   3756  O OE1 . GLN A 1 516 ? 102.732 176.972 144.684 1.00 443.21 ? 516  GLN A OE1 1 
ATOM   3757  N NE2 . GLN A 1 516 ? 102.306 174.801 144.296 1.00 434.21 ? 516  GLN A NE2 1 
ATOM   3758  N N   . THR A 1 517 ? 107.978 175.992 143.657 1.00 339.66 ? 517  THR A N   1 
ATOM   3759  C CA  . THR A 1 517 ? 108.647 175.444 142.472 1.00 341.53 ? 517  THR A CA  1 
ATOM   3760  C C   . THR A 1 517 ? 109.852 174.608 142.889 1.00 321.69 ? 517  THR A C   1 
ATOM   3761  O O   . THR A 1 517 ? 110.051 173.486 142.395 1.00 317.52 ? 517  THR A O   1 
ATOM   3762  C CB  . THR A 1 517 ? 109.088 176.563 141.500 1.00 355.24 ? 517  THR A CB  1 
ATOM   3763  O OG1 . THR A 1 517 ? 107.930 177.236 140.994 1.00 379.98 ? 517  THR A OG1 1 
ATOM   3764  C CG2 . THR A 1 517 ? 109.885 176.006 140.318 1.00 360.12 ? 517  THR A CG2 1 
ATOM   3765  N N   . VAL A 1 518 ? 110.627 175.185 143.801 1.00 297.93 ? 518  VAL A N   1 
ATOM   3766  C CA  . VAL A 1 518 ? 111.837 174.548 144.334 1.00 296.10 ? 518  VAL A CA  1 
ATOM   3767  C C   . VAL A 1 518 ? 111.481 173.205 144.969 1.00 296.29 ? 518  VAL A C   1 
ATOM   3768  O O   . VAL A 1 518 ? 112.151 172.189 144.726 1.00 291.68 ? 518  VAL A O   1 
ATOM   3769  C CB  . VAL A 1 518 ? 112.566 175.442 145.375 1.00 322.42 ? 518  VAL A CB  1 
ATOM   3770  C CG1 . VAL A 1 518 ? 113.586 174.656 146.207 1.00 320.78 ? 518  VAL A CG1 1 
ATOM   3771  C CG2 . VAL A 1 518 ? 113.241 176.617 144.686 1.00 319.14 ? 518  VAL A CG2 1 
ATOM   3772  N N   . THR A 1 519 ? 110.426 173.243 145.773 1.00 301.59 ? 519  THR A N   1 
ATOM   3773  C CA  . THR A 1 519 ? 109.935 172.062 146.485 1.00 315.38 ? 519  THR A CA  1 
ATOM   3774  C C   . THR A 1 519 ? 109.566 170.964 145.485 1.00 308.37 ? 519  THR A C   1 
ATOM   3775  O O   . THR A 1 519 ? 109.940 169.792 145.664 1.00 310.34 ? 519  THR A O   1 
ATOM   3776  C CB  . THR A 1 519 ? 108.907 172.346 147.628 1.00 319.47 ? 519  THR A CB  1 
ATOM   3777  O OG1 . THR A 1 519 ? 108.997 171.304 148.611 1.00 316.58 ? 519  THR A OG1 1 
ATOM   3778  C CG2 . THR A 1 519 ? 107.460 172.462 147.165 1.00 338.16 ? 519  THR A CG2 1 
ATOM   3779  N N   . ARG A 1 520 ? 108.835 171.343 144.442 1.00 299.49 ? 520  ARG A N   1 
ATOM   3780  C CA  . ARG A 1 520 ? 108.406 170.395 143.422 1.00 309.44 ? 520  ARG A CA  1 
ATOM   3781  C C   . ARG A 1 520 ? 109.610 169.795 142.708 1.00 310.89 ? 520  ARG A C   1 
ATOM   3782  O O   . ARG A 1 520 ? 109.636 168.600 142.414 1.00 311.64 ? 520  ARG A O   1 
ATOM   3783  C CB  . ARG A 1 520 ? 107.481 171.076 142.412 1.00 332.93 ? 520  ARG A CB  1 
ATOM   3784  C CG  . ARG A 1 520 ? 106.007 171.012 142.779 1.00 342.58 ? 520  ARG A CG  1 
ATOM   3785  C CD  . ARG A 1 520 ? 105.328 172.356 142.572 1.00 353.46 ? 520  ARG A CD  1 
ATOM   3786  N NE  . ARG A 1 520 ? 104.709 172.459 141.254 1.00 357.19 ? 520  ARG A NE  1 
ATOM   3787  C CZ  . ARG A 1 520 ? 103.836 173.400 140.910 1.00 365.07 ? 520  ARG A CZ  1 
ATOM   3788  N NH1 . ARG A 1 520 ? 103.475 174.326 141.788 1.00 365.25 ? 520  ARG A NH1 1 
ATOM   3789  N NH2 . ARG A 1 520 ? 103.322 173.417 139.687 1.00 382.57 ? 520  ARG A NH2 1 
ATOM   3790  N N   . LEU A 1 521 ? 110.606 170.630 142.433 1.00 309.99 ? 521  LEU A N   1 
ATOM   3791  C CA  . LEU A 1 521 ? 111.820 170.172 141.758 1.00 310.78 ? 521  LEU A CA  1 
ATOM   3792  C C   . LEU A 1 521 ? 112.514 169.132 142.647 1.00 317.42 ? 521  LEU A C   1 
ATOM   3793  O O   . LEU A 1 521 ? 112.941 168.057 142.192 1.00 323.83 ? 521  LEU A O   1 
ATOM   3794  C CB  . LEU A 1 521 ? 112.797 171.313 141.451 1.00 296.78 ? 521  LEU A CB  1 
ATOM   3795  C CG  . LEU A 1 521 ? 112.539 172.121 140.182 1.00 310.22 ? 521  LEU A CG  1 
ATOM   3796  C CD1 . LEU A 1 521 ? 113.347 173.411 140.212 1.00 324.58 ? 521  LEU A CD1 1 
ATOM   3797  C CD2 . LEU A 1 521 ? 112.881 171.305 138.946 1.00 306.64 ? 521  LEU A CD2 1 
ATOM   3798  N N   . LEU A 1 522 ? 112.699 169.553 143.898 1.00 293.29 ? 522  LEU A N   1 
ATOM   3799  C CA  . LEU A 1 522 ? 113.440 168.779 144.894 1.00 284.27 ? 522  LEU A CA  1 
ATOM   3800  C C   . LEU A 1 522 ? 112.797 167.408 145.073 1.00 301.42 ? 522  LEU A C   1 
ATOM   3801  O O   . LEU A 1 522 ? 113.493 166.372 145.084 1.00 338.36 ? 522  LEU A O   1 
ATOM   3802  C CB  . LEU A 1 522 ? 113.506 169.535 146.236 1.00 295.93 ? 522  LEU A CB  1 
ATOM   3803  C CG  . LEU A 1 522 ? 114.840 169.656 146.979 1.00 311.01 ? 522  LEU A CG  1 
ATOM   3804  C CD1 . LEU A 1 522 ? 115.954 170.185 146.091 1.00 303.13 ? 522  LEU A CD1 1 
ATOM   3805  C CD2 . LEU A 1 522 ? 114.672 170.567 148.187 1.00 318.67 ? 522  LEU A CD2 1 
ATOM   3806  N N   . TYR A 1 523 ? 111.471 167.440 145.206 1.00 308.16 ? 523  TYR A N   1 
ATOM   3807  C CA  . TYR A 1 523 ? 110.675 166.221 145.395 1.00 315.54 ? 523  TYR A CA  1 
ATOM   3808  C C   . TYR A 1 523 ? 110.886 165.270 144.229 1.00 301.34 ? 523  TYR A C   1 
ATOM   3809  O O   . TYR A 1 523 ? 111.094 164.063 144.422 1.00 286.26 ? 523  TYR A O   1 
ATOM   3810  C CB  . TYR A 1 523 ? 109.176 166.513 145.504 1.00 325.35 ? 523  TYR A CB  1 
ATOM   3811  C CG  . TYR A 1 523 ? 108.385 165.258 145.815 1.00 323.48 ? 523  TYR A CG  1 
ATOM   3812  C CD1 . TYR A 1 523 ? 108.418 164.699 147.093 1.00 314.06 ? 523  TYR A CD1 1 
ATOM   3813  C CD2 . TYR A 1 523 ? 107.640 164.606 144.832 1.00 311.23 ? 523  TYR A CD2 1 
ATOM   3814  C CE1 . TYR A 1 523 ? 107.719 163.542 147.392 1.00 318.80 ? 523  TYR A CE1 1 
ATOM   3815  C CE2 . TYR A 1 523 ? 106.937 163.442 145.122 1.00 331.80 ? 523  TYR A CE2 1 
ATOM   3816  C CZ  . TYR A 1 523 ? 106.980 162.915 146.405 1.00 332.85 ? 523  TYR A CZ  1 
ATOM   3817  O OH  . TYR A 1 523 ? 106.288 161.766 146.713 1.00 338.60 ? 523  TYR A OH  1 
ATOM   3818  N N   . GLY A 1 524 ? 110.823 165.846 143.033 1.00 315.85 ? 524  GLY A N   1 
ATOM   3819  C CA  . GLY A 1 524 ? 110.997 165.104 141.780 1.00 324.61 ? 524  GLY A CA  1 
ATOM   3820  C C   . GLY A 1 524 ? 112.348 164.414 141.766 1.00 308.72 ? 524  GLY A C   1 
ATOM   3821  O O   . GLY A 1 524 ? 112.483 163.221 141.444 1.00 327.33 ? 524  GLY A O   1 
ATOM   3822  N N   . PHE A 1 525 ? 113.366 165.178 142.149 1.00 301.17 ? 525  PHE A N   1 
ATOM   3823  C CA  . PHE A 1 525 ? 114.730 164.608 142.246 1.00 298.46 ? 525  PHE A CA  1 
ATOM   3824  C C   . PHE A 1 525 ? 114.970 163.665 143.437 1.00 283.49 ? 525  PHE A C   1 
ATOM   3825  O O   . PHE A 1 525 ? 115.271 162.473 143.241 1.00 308.99 ? 525  PHE A O   1 
ATOM   3826  C CB  . PHE A 1 525 ? 115.784 165.701 142.104 1.00 291.00 ? 525  PHE A CB  1 
ATOM   3827  C CG  . PHE A 1 525 ? 115.722 166.403 140.771 1.00 299.45 ? 525  PHE A CG  1 
ATOM   3828  C CD1 . PHE A 1 525 ? 115.849 165.679 139.587 1.00 298.27 ? 525  PHE A CD1 1 
ATOM   3829  C CD2 . PHE A 1 525 ? 115.515 167.778 140.690 1.00 306.83 ? 525  PHE A CD2 1 
ATOM   3830  C CE1 . PHE A 1 525 ? 115.786 166.313 138.356 1.00 317.97 ? 525  PHE A CE1 1 
ATOM   3831  C CE2 . PHE A 1 525 ? 115.450 168.418 139.463 1.00 307.46 ? 525  PHE A CE2 1 
ATOM   3832  C CZ  . PHE A 1 525 ? 115.590 167.687 138.293 1.00 318.08 ? 525  PHE A CZ  1 
ATOM   3833  N N   . LEU A 1 526 ? 114.806 164.176 144.648 1.00 279.09 ? 526  LEU A N   1 
ATOM   3834  C CA  . LEU A 1 526 ? 115.233 163.476 145.855 1.00 298.20 ? 526  LEU A CA  1 
ATOM   3835  C C   . LEU A 1 526 ? 114.264 162.456 146.454 1.00 307.93 ? 526  LEU A C   1 
ATOM   3836  O O   . LEU A 1 526 ? 114.651 161.764 147.401 1.00 344.93 ? 526  LEU A O   1 
ATOM   3837  C CB  . LEU A 1 526 ? 115.589 164.496 146.941 1.00 306.22 ? 526  LEU A CB  1 
ATOM   3838  C CG  . LEU A 1 526 ? 116.643 165.539 146.587 1.00 309.50 ? 526  LEU A CG  1 
ATOM   3839  C CD1 . LEU A 1 526 ? 116.861 166.450 147.780 1.00 318.27 ? 526  LEU A CD1 1 
ATOM   3840  C CD2 . LEU A 1 526 ? 117.951 164.884 146.176 1.00 318.76 ? 526  LEU A CD2 1 
ATOM   3841  N N   . ILE A 1 527 ? 113.039 162.335 145.933 1.00 296.16 ? 527  ILE A N   1 
ATOM   3842  C CA  . ILE A 1 527 ? 112.026 161.455 146.562 1.00 307.72 ? 527  ILE A CA  1 
ATOM   3843  C C   . ILE A 1 527 ? 111.333 160.518 145.574 1.00 308.87 ? 527  ILE A C   1 
ATOM   3844  O O   . ILE A 1 527 ? 111.387 159.298 145.741 1.00 314.43 ? 527  ILE A O   1 
ATOM   3845  C CB  . ILE A 1 527 ? 110.941 162.258 147.319 1.00 316.17 ? 527  ILE A CB  1 
ATOM   3846  C CG1 . ILE A 1 527 ? 111.546 163.395 148.149 1.00 322.23 ? 527  ILE A CG1 1 
ATOM   3847  C CG2 . ILE A 1 527 ? 110.125 161.337 148.223 1.00 351.89 ? 527  ILE A CG2 1 
ATOM   3848  C CD1 . ILE A 1 527 ? 112.413 162.953 149.312 1.00 335.66 ? 527  ILE A CD1 1 
ATOM   3849  N N   . LYS A 1 528 ? 110.665 161.091 144.574 1.00 305.99 ? 528  LYS A N   1 
ATOM   3850  C CA  . LYS A 1 528 ? 110.002 160.322 143.522 1.00 297.63 ? 528  LYS A CA  1 
ATOM   3851  C C   . LYS A 1 528 ? 110.031 161.122 142.225 1.00 292.71 ? 528  LYS A C   1 
ATOM   3852  O O   . LYS A 1 528 ? 109.582 162.257 142.207 1.00 308.05 ? 528  LYS A O   1 
ATOM   3853  C CB  . LYS A 1 528 ? 108.562 160.024 143.922 1.00 329.24 ? 528  LYS A CB  1 
ATOM   3854  C CG  . LYS A 1 528 ? 107.862 158.995 143.047 1.00 358.51 ? 528  LYS A CG  1 
ATOM   3855  C CD  . LYS A 1 528 ? 106.386 158.903 143.402 1.00 384.26 ? 528  LYS A CD  1 
ATOM   3856  C CE  . LYS A 1 528 ? 105.726 157.683 142.783 1.00 397.60 ? 528  LYS A CE  1 
ATOM   3857  N NZ  . LYS A 1 528 ? 104.242 157.751 142.889 1.00 412.21 ? 528  LYS A NZ  1 
ATOM   3858  N N   . ALA A 1 529 ? 110.559 160.533 141.152 1.00 300.73 ? 529  ALA A N   1 
ATOM   3859  C CA  . ALA A 1 529 ? 110.674 161.203 139.850 1.00 307.77 ? 529  ALA A CA  1 
ATOM   3860  C C   . ALA A 1 529 ? 109.393 161.037 139.059 1.00 312.14 ? 529  ALA A C   1 
ATOM   3861  O O   . ALA A 1 529 ? 108.920 161.979 138.431 1.00 333.00 ? 529  ALA A O   1 
ATOM   3862  C CB  . ALA A 1 529 ? 111.850 160.647 139.067 1.00 326.45 ? 529  ALA A CB  1 
ATOM   3863  N N   . ASN A 1 530 ? 108.847 159.827 139.081 1.00 309.59 ? 530  ASN A N   1 
ATOM   3864  C CA  . ASN A 1 530 ? 107.531 159.567 138.525 1.00 316.40 ? 530  ASN A CA  1 
ATOM   3865  C C   . ASN A 1 530 ? 106.489 160.325 139.356 1.00 306.04 ? 530  ASN A C   1 
ATOM   3866  O O   . ASN A 1 530 ? 106.020 159.831 140.379 1.00 313.83 ? 530  ASN A O   1 
ATOM   3867  C CB  . ASN A 1 530 ? 107.268 158.051 138.508 1.00 348.28 ? 530  ASN A CB  1 
ATOM   3868  C CG  . ASN A 1 530 ? 106.064 157.656 137.670 1.00 357.51 ? 530  ASN A CG  1 
ATOM   3869  O OD1 . ASN A 1 530 ? 105.444 158.484 137.004 1.00 353.85 ? 530  ASN A OD1 1 
ATOM   3870  N ND2 . ASN A 1 530 ? 105.734 156.365 137.703 1.00 374.32 ? 530  ASN A ND2 1 
ATOM   3871  N N   . ASN A 1 531 ? 106.179 161.547 138.916 1.00 319.60 ? 531  ASN A N   1 
ATOM   3872  C CA  . ASN A 1 531 ? 105.206 162.440 139.567 1.00 320.29 ? 531  ASN A CA  1 
ATOM   3873  C C   . ASN A 1 531 ? 104.044 162.736 138.645 1.00 350.00 ? 531  ASN A C   1 
ATOM   3874  O O   . ASN A 1 531 ? 103.962 162.200 137.544 1.00 361.84 ? 531  ASN A O   1 
ATOM   3875  C CB  . ASN A 1 531 ? 105.859 163.781 139.898 1.00 305.59 ? 531  ASN A CB  1 
ATOM   3876  C CG  . ASN A 1 531 ? 106.995 163.653 140.875 1.00 327.71 ? 531  ASN A CG  1 
ATOM   3877  O OD1 . ASN A 1 531 ? 106.907 162.914 141.857 1.00 330.93 ? 531  ASN A OD1 1 
ATOM   3878  N ND2 . ASN A 1 531 ? 108.063 164.404 140.630 1.00 304.63 ? 531  ASN A ND2 1 
ATOM   3879  N N   . SER A 1 532 ? 103.140 163.596 139.108 1.00 365.57 ? 532  SER A N   1 
ATOM   3880  C CA  . SER A 1 532 ? 102.237 164.309 138.217 1.00 368.03 ? 532  SER A CA  1 
ATOM   3881  C C   . SER A 1 532 ? 103.038 165.326 137.405 1.00 358.94 ? 532  SER A C   1 
ATOM   3882  O O   . SER A 1 532 ? 102.921 165.369 136.180 1.00 350.85 ? 532  SER A O   1 
ATOM   3883  C CB  . SER A 1 532 ? 101.134 165.018 139.008 1.00 369.36 ? 532  SER A CB  1 
ATOM   3884  O OG  . SER A 1 532 ? 101.677 165.946 139.932 1.00 360.58 ? 532  SER A OG  1 
ATOM   3885  N N   . TRP A 1 533 ? 103.867 166.117 138.094 1.00 351.06 ? 533  TRP A N   1 
ATOM   3886  C CA  . TRP A 1 533 ? 104.564 167.252 137.473 1.00 347.89 ? 533  TRP A CA  1 
ATOM   3887  C C   . TRP A 1 533 ? 105.649 166.848 136.473 1.00 336.13 ? 533  TRP A C   1 
ATOM   3888  O O   . TRP A 1 533 ? 105.528 167.155 135.292 1.00 344.07 ? 533  TRP A O   1 
ATOM   3889  C CB  . TRP A 1 533 ? 105.149 168.190 138.533 1.00 333.87 ? 533  TRP A CB  1 
ATOM   3890  C CG  . TRP A 1 533 ? 105.653 169.463 137.948 1.00 318.41 ? 533  TRP A CG  1 
ATOM   3891  C CD1 . TRP A 1 533 ? 104.935 170.361 137.226 1.00 333.43 ? 533  TRP A CD1 1 
ATOM   3892  C CD2 . TRP A 1 533 ? 106.983 169.982 138.029 1.00 324.47 ? 533  TRP A CD2 1 
ATOM   3893  N NE1 . TRP A 1 533 ? 105.730 171.417 136.852 1.00 352.03 ? 533  TRP A NE1 1 
ATOM   3894  C CE2 . TRP A 1 533 ? 106.993 171.212 137.335 1.00 335.83 ? 533  TRP A CE2 1 
ATOM   3895  C CE3 . TRP A 1 533 ? 108.166 169.535 138.630 1.00 330.00 ? 533  TRP A CE3 1 
ATOM   3896  C CZ2 . TRP A 1 533 ? 108.145 171.999 137.216 1.00 338.41 ? 533  TRP A CZ2 1 
ATOM   3897  C CZ3 . TRP A 1 533 ? 109.314 170.317 138.510 1.00 344.58 ? 533  TRP A CZ3 1 
ATOM   3898  C CH2 . TRP A 1 533 ? 109.292 171.537 137.809 1.00 334.13 ? 533  TRP A CH2 1 
ATOM   3899  N N   . PHE A 1 534 ? 106.698 166.178 136.952 1.00 336.84 ? 534  PHE A N   1 
ATOM   3900  C CA  . PHE A 1 534 ? 107.776 165.646 136.096 1.00 323.77 ? 534  PHE A CA  1 
ATOM   3901  C C   . PHE A 1 534 ? 107.256 164.971 134.836 1.00 334.08 ? 534  PHE A C   1 
ATOM   3902  O O   . PHE A 1 534 ? 107.771 165.223 133.743 1.00 349.17 ? 534  PHE A O   1 
ATOM   3903  C CB  . PHE A 1 534 ? 108.650 164.656 136.883 1.00 313.78 ? 534  PHE A CB  1 
ATOM   3904  C CG  . PHE A 1 534 ? 109.871 165.267 137.531 1.00 309.87 ? 534  PHE A CG  1 
ATOM   3905  C CD1 . PHE A 1 534 ? 109.950 166.630 137.839 1.00 312.61 ? 534  PHE A CD1 1 
ATOM   3906  C CD2 . PHE A 1 534 ? 110.943 164.455 137.867 1.00 317.41 ? 534  PHE A CD2 1 
ATOM   3907  C CE1 . PHE A 1 534 ? 111.080 167.159 138.434 1.00 323.17 ? 534  PHE A CE1 1 
ATOM   3908  C CE2 . PHE A 1 534 ? 112.069 164.978 138.477 1.00 346.80 ? 534  PHE A CE2 1 
ATOM   3909  C CZ  . PHE A 1 534 ? 112.144 166.333 138.752 1.00 347.55 ? 534  PHE A CZ  1 
ATOM   3910  N N   . GLN A 1 535 ? 106.243 164.118 134.993 1.00 329.17 ? 535  GLN A N   1 
ATOM   3911  C CA  . GLN A 1 535 ? 105.566 163.512 133.844 1.00 317.09 ? 535  GLN A CA  1 
ATOM   3912  C C   . GLN A 1 535 ? 105.023 164.595 132.918 1.00 289.55 ? 535  GLN A C   1 
ATOM   3913  O O   . GLN A 1 535 ? 105.298 164.576 131.723 1.00 267.26 ? 535  GLN A O   1 
ATOM   3914  C CB  . GLN A 1 535 ? 104.445 162.567 134.285 1.00 327.63 ? 535  GLN A CB  1 
ATOM   3915  C CG  . GLN A 1 535 ? 104.947 161.206 134.744 1.00 350.79 ? 535  GLN A CG  1 
ATOM   3916  C CD  . GLN A 1 535 ? 103.826 160.220 135.039 1.00 366.19 ? 535  GLN A CD  1 
ATOM   3917  O OE1 . GLN A 1 535 ? 102.743 160.599 135.490 1.00 374.44 ? 535  GLN A OE1 1 
ATOM   3918  N NE2 . GLN A 1 535 ? 104.089 158.940 134.793 1.00 364.14 ? 535  GLN A NE2 1 
ATOM   3919  N N   . SER A 1 536 ? 104.315 165.568 133.490 1.00 282.54 ? 536  SER A N   1 
ATOM   3920  C CA  . SER A 1 536 ? 103.686 166.649 132.718 1.00 280.10 ? 536  SER A CA  1 
ATOM   3921  C C   . SER A 1 536 ? 104.618 167.634 131.996 1.00 301.94 ? 536  SER A C   1 
ATOM   3922  O O   . SER A 1 536 ? 104.121 168.616 131.435 1.00 309.75 ? 536  SER A O   1 
ATOM   3923  C CB  . SER A 1 536 ? 102.687 167.435 133.588 1.00 311.89 ? 536  SER A CB  1 
ATOM   3924  O OG  . SER A 1 536 ? 103.330 168.333 134.478 1.00 310.15 ? 536  SER A OG  1 
ATOM   3925  N N   . ILE A 1 537 ? 105.941 167.421 132.025 1.00 310.54 ? 537  ILE A N   1 
ATOM   3926  C CA  . ILE A 1 537 ? 106.844 168.165 131.130 1.00 301.98 ? 537  ILE A CA  1 
ATOM   3927  C C   . ILE A 1 537 ? 107.628 167.308 130.130 1.00 291.54 ? 537  ILE A C   1 
ATOM   3928  O O   . ILE A 1 537 ? 108.152 167.847 129.161 1.00 326.82 ? 537  ILE A O   1 
ATOM   3929  C CB  . ILE A 1 537 ? 107.857 169.091 131.851 1.00 332.85 ? 537  ILE A CB  1 
ATOM   3930  C CG1 . ILE A 1 537 ? 107.345 169.592 133.215 1.00 345.32 ? 537  ILE A CG1 1 
ATOM   3931  C CG2 . ILE A 1 537 ? 108.224 170.260 130.934 1.00 336.84 ? 537  ILE A CG2 1 
ATOM   3932  C CD1 . ILE A 1 537 ? 107.889 168.806 134.382 1.00 354.68 ? 537  ILE A CD1 1 
ATOM   3933  N N   . LEU A 1 538 ? 107.712 165.997 130.324 1.00 297.47 ? 538  LEU A N   1 
ATOM   3934  C CA  . LEU A 1 538 ? 108.479 165.164 129.386 1.00 331.82 ? 538  LEU A CA  1 
ATOM   3935  C C   . LEU A 1 538 ? 107.754 164.887 128.064 1.00 336.44 ? 538  LEU A C   1 
ATOM   3936  O O   . LEU A 1 538 ? 106.592 165.250 127.883 1.00 348.33 ? 538  LEU A O   1 
ATOM   3937  C CB  . LEU A 1 538 ? 108.885 163.849 130.056 1.00 317.80 ? 538  LEU A CB  1 
ATOM   3938  C CG  . LEU A 1 538 ? 109.869 164.037 131.207 1.00 309.04 ? 538  LEU A CG  1 
ATOM   3939  C CD1 . LEU A 1 538 ? 110.126 162.718 131.906 1.00 309.78 ? 538  LEU A CD1 1 
ATOM   3940  C CD2 . LEU A 1 538 ? 111.180 164.647 130.724 1.00 315.39 ? 538  LEU A CD2 1 
ATOM   3941  N N   . ARG A 1 539 ? 108.484 164.279 127.135 1.00 326.74 ? 539  ARG A N   1 
ATOM   3942  C CA  . ARG A 1 539 ? 107.899 163.651 125.953 1.00 345.45 ? 539  ARG A CA  1 
ATOM   3943  C C   . ARG A 1 539 ? 107.408 162.245 126.322 1.00 354.90 ? 539  ARG A C   1 
ATOM   3944  O O   . ARG A 1 539 ? 107.747 161.728 127.392 1.00 362.48 ? 539  ARG A O   1 
ATOM   3945  C CB  . ARG A 1 539 ? 108.931 163.591 124.824 1.00 341.84 ? 539  ARG A CB  1 
ATOM   3946  C CG  . ARG A 1 539 ? 109.442 164.968 124.418 1.00 353.34 ? 539  ARG A CG  1 
ATOM   3947  C CD  . ARG A 1 539 ? 110.221 164.964 123.110 1.00 366.68 ? 539  ARG A CD  1 
ATOM   3948  N NE  . ARG A 1 539 ? 111.657 164.750 123.315 1.00 366.34 ? 539  ARG A NE  1 
ATOM   3949  C CZ  . ARG A 1 539 ? 112.286 163.571 123.332 1.00 352.65 ? 539  ARG A CZ  1 
ATOM   3950  N NH1 . ARG A 1 539 ? 111.633 162.422 123.153 1.00 347.80 ? 539  ARG A NH1 1 
ATOM   3951  N NH2 . ARG A 1 539 ? 113.604 163.540 123.530 1.00 343.54 ? 539  ARG A NH2 1 
ATOM   3952  N N   . GLN A 1 540 ? 106.607 161.635 125.449 1.00 350.82 ? 540  GLN A N   1 
ATOM   3953  C CA  . GLN A 1 540 ? 106.124 160.259 125.674 1.00 355.59 ? 540  GLN A CA  1 
ATOM   3954  C C   . GLN A 1 540 ? 107.232 159.206 125.561 1.00 359.11 ? 540  GLN A C   1 
ATOM   3955  O O   . GLN A 1 540 ? 107.112 158.124 126.138 1.00 328.89 ? 540  GLN A O   1 
ATOM   3956  C CB  . GLN A 1 540 ? 104.963 159.891 124.731 1.00 383.57 ? 540  GLN A CB  1 
ATOM   3957  C CG  . GLN A 1 540 ? 103.577 160.064 125.340 1.00 383.71 ? 540  GLN A CG  1 
ATOM   3958  C CD  . GLN A 1 540 ? 102.528 159.189 124.680 1.00 412.40 ? 540  GLN A CD  1 
ATOM   3959  O OE1 . GLN A 1 540 ? 102.500 159.044 123.457 1.00 422.87 ? 540  GLN A OE1 1 
ATOM   3960  N NE2 . GLN A 1 540 ? 101.654 158.601 125.491 1.00 425.41 ? 540  GLN A NE2 1 
ATOM   3961  N N   . ASP A 1 541 ? 108.286 159.510 124.803 1.00 356.02 ? 541  ASP A N   1 
ATOM   3962  C CA  . ASP A 1 541 ? 109.490 158.671 124.781 1.00 362.84 ? 541  ASP A CA  1 
ATOM   3963  C C   . ASP A 1 541 ? 110.262 158.804 126.096 1.00 355.59 ? 541  ASP A C   1 
ATOM   3964  O O   . ASP A 1 541 ? 110.762 157.813 126.641 1.00 348.05 ? 541  ASP A O   1 
ATOM   3965  C CB  . ASP A 1 541 ? 110.391 159.043 123.603 1.00 375.98 ? 541  ASP A CB  1 
ATOM   3966  C CG  . ASP A 1 541 ? 109.759 158.723 122.259 1.00 418.62 ? 541  ASP A CG  1 
ATOM   3967  O OD1 . ASP A 1 541 ? 108.549 158.986 122.089 1.00 439.82 ? 541  ASP A OD1 1 
ATOM   3968  O OD2 . ASP A 1 541 ? 110.475 158.213 121.371 1.00 435.39 ? 541  ASP A OD2 1 
ATOM   3969  N N   . LEU A 1 542 ? 110.338 160.034 126.599 1.00 321.86 ? 542  LEU A N   1 
ATOM   3970  C CA  . LEU A 1 542 ? 111.013 160.327 127.865 1.00 297.47 ? 542  LEU A CA  1 
ATOM   3971  C C   . LEU A 1 542 ? 110.235 159.951 129.135 1.00 310.80 ? 542  LEU A C   1 
ATOM   3972  O O   . LEU A 1 542 ? 110.811 159.997 130.222 1.00 344.43 ? 542  LEU A O   1 
ATOM   3973  C CB  . LEU A 1 542 ? 111.425 161.806 127.924 1.00 305.54 ? 542  LEU A CB  1 
ATOM   3974  C CG  . LEU A 1 542 ? 112.845 162.150 127.451 1.00 319.64 ? 542  LEU A CG  1 
ATOM   3975  C CD1 . LEU A 1 542 ? 113.205 161.471 126.134 1.00 326.27 ? 542  LEU A CD1 1 
ATOM   3976  C CD2 . LEU A 1 542 ? 113.003 163.666 127.359 1.00 315.11 ? 542  LEU A CD2 1 
ATOM   3977  N N   . ARG A 1 543 ? 108.997 159.496 129.001 1.00 324.10 ? 543  ARG A N   1 
ATOM   3978  C CA  . ARG A 1 543 ? 108.221 159.129 130.177 1.00 339.22 ? 543  ARG A CA  1 
ATOM   3979  C C   . ARG A 1 543 ? 108.939 158.008 130.925 1.00 314.17 ? 543  ARG A C   1 
ATOM   3980  O O   . ARG A 1 543 ? 108.963 157.983 132.155 1.00 315.65 ? 543  ARG A O   1 
ATOM   3981  C CB  . ARG A 1 543 ? 106.814 158.684 129.777 1.00 376.03 ? 543  ARG A CB  1 
ATOM   3982  C CG  . ARG A 1 543 ? 106.084 157.894 130.851 1.00 400.55 ? 543  ARG A CG  1 
ATOM   3983  C CD  . ARG A 1 543 ? 105.098 156.913 130.240 1.00 409.55 ? 543  ARG A CD  1 
ATOM   3984  N NE  . ARG A 1 543 ? 103.875 157.574 129.792 1.00 430.43 ? 543  ARG A NE  1 
ATOM   3985  C CZ  . ARG A 1 543 ? 103.000 157.033 128.951 1.00 477.97 ? 543  ARG A CZ  1 
ATOM   3986  N NH1 . ARG A 1 543 ? 103.209 155.818 128.463 1.00 489.85 ? 543  ARG A NH1 1 
ATOM   3987  N NH2 . ARG A 1 543 ? 101.914 157.707 128.597 1.00 498.18 ? 543  ARG A NH2 1 
ATOM   3988  N N   . SER A 1 544 ? 109.519 157.084 130.168 1.00 312.32 ? 544  SER A N   1 
ATOM   3989  C CA  . SER A 1 544 ? 110.231 155.930 130.731 1.00 348.38 ? 544  SER A CA  1 
ATOM   3990  C C   . SER A 1 544 ? 111.376 156.320 131.677 1.00 312.55 ? 544  SER A C   1 
ATOM   3991  O O   . SER A 1 544 ? 111.664 155.599 132.632 1.00 314.08 ? 544  SER A O   1 
ATOM   3992  C CB  . SER A 1 544 ? 110.777 155.044 129.604 1.00 374.15 ? 544  SER A CB  1 
ATOM   3993  O OG  . SER A 1 544 ? 111.350 153.850 130.115 1.00 383.76 ? 544  SER A OG  1 
ATOM   3994  N N   . TYR A 1 545 ? 111.999 157.468 131.418 1.00 299.99 ? 545  TYR A N   1 
ATOM   3995  C CA  . TYR A 1 545 ? 113.166 157.930 132.177 1.00 298.10 ? 545  TYR A CA  1 
ATOM   3996  C C   . TYR A 1 545 ? 112.835 158.364 133.620 1.00 304.16 ? 545  TYR A C   1 
ATOM   3997  O O   . TYR A 1 545 ? 113.746 158.623 134.408 1.00 311.86 ? 545  TYR A O   1 
ATOM   3998  C CB  . TYR A 1 545 ? 113.900 159.056 131.415 1.00 302.02 ? 545  TYR A CB  1 
ATOM   3999  C CG  . TYR A 1 545 ? 114.675 158.573 130.198 1.00 289.17 ? 545  TYR A CG  1 
ATOM   4000  C CD1 . TYR A 1 545 ? 114.023 158.234 129.017 1.00 322.11 ? 545  TYR A CD1 1 
ATOM   4001  C CD2 . TYR A 1 545 ? 116.060 158.446 130.231 1.00 314.00 ? 545  TYR A CD2 1 
ATOM   4002  C CE1 . TYR A 1 545 ? 114.722 157.782 127.910 1.00 343.32 ? 545  TYR A CE1 1 
ATOM   4003  C CE2 . TYR A 1 545 ? 116.771 158.000 129.128 1.00 340.16 ? 545  TYR A CE2 1 
ATOM   4004  C CZ  . TYR A 1 545 ? 116.097 157.663 127.971 1.00 351.51 ? 545  TYR A CZ  1 
ATOM   4005  O OH  . TYR A 1 545 ? 116.800 157.223 126.872 1.00 377.97 ? 545  TYR A OH  1 
ATOM   4006  N N   . LEU A 1 546 ? 111.547 158.459 133.956 1.00 301.74 ? 546  LEU A N   1 
ATOM   4007  C CA  . LEU A 1 546 ? 111.103 158.635 135.337 1.00 301.37 ? 546  LEU A CA  1 
ATOM   4008  C C   . LEU A 1 546 ? 110.735 157.284 135.922 1.00 304.02 ? 546  LEU A C   1 
ATOM   4009  O O   . LEU A 1 546 ? 109.679 156.731 135.609 1.00 329.45 ? 546  LEU A O   1 
ATOM   4010  C CB  . LEU A 1 546 ? 109.881 159.552 135.398 1.00 320.39 ? 546  LEU A CB  1 
ATOM   4011  C CG  . LEU A 1 546 ? 110.012 160.898 134.694 1.00 323.44 ? 546  LEU A CG  1 
ATOM   4012  C CD1 . LEU A 1 546 ? 108.662 161.602 134.707 1.00 319.25 ? 546  LEU A CD1 1 
ATOM   4013  C CD2 . LEU A 1 546 ? 111.109 161.745 135.333 1.00 332.73 ? 546  LEU A CD2 1 
ATOM   4014  N N   . GLY A 1 547 ? 111.618 156.742 136.753 1.00 336.29 ? 547  GLY A N   1 
ATOM   4015  C CA  . GLY A 1 547 ? 111.295 155.559 137.549 1.00 352.31 ? 547  GLY A CA  1 
ATOM   4016  C C   . GLY A 1 547 ? 110.565 155.994 138.803 1.00 336.90 ? 547  GLY A C   1 
ATOM   4017  O O   . GLY A 1 547 ? 110.458 157.194 139.077 1.00 322.70 ? 547  GLY A O   1 
ATOM   4018  N N   . ASP A 1 548 ? 110.159 155.050 139.635 1.00 344.77 ? 548  ASP A N   1 
ATOM   4019  C CA  . ASP A 1 548 ? 109.697 155.408 140.965 1.00 342.42 ? 548  ASP A CA  1 
ATOM   4020  C C   . ASP A 1 548 ? 110.852 155.452 141.963 1.00 357.94 ? 548  ASP A C   1 
ATOM   4021  O O   . ASP A 1 548 ? 110.885 154.678 142.907 1.00 367.15 ? 548  ASP A O   1 
ATOM   4022  C CB  . ASP A 1 548 ? 108.635 154.419 141.430 1.00 377.23 ? 548  ASP A CB  1 
ATOM   4023  C CG  . ASP A 1 548 ? 108.184 154.673 142.847 1.00 396.17 ? 548  ASP A CG  1 
ATOM   4024  O OD1 . ASP A 1 548 ? 108.601 155.691 143.435 1.00 390.03 ? 548  ASP A OD1 1 
ATOM   4025  O OD2 . ASP A 1 548 ? 107.411 153.849 143.376 1.00 417.84 ? 548  ASP A OD2 1 
ATOM   4026  N N   . GLY A 1 549 ? 111.789 156.369 141.779 1.00 360.56 ? 549  GLY A N   1 
ATOM   4027  C CA  . GLY A 1 549 ? 112.905 156.470 142.703 1.00 331.22 ? 549  GLY A CA  1 
ATOM   4028  C C   . GLY A 1 549 ? 113.566 157.826 142.684 1.00 336.22 ? 549  GLY A C   1 
ATOM   4029  O O   . GLY A 1 549 ? 113.369 158.582 141.731 1.00 356.28 ? 549  GLY A O   1 
ATOM   4030  N N   . PRO A 1 550 ? 114.341 158.150 143.710 1.00 321.46 ? 550  PRO A N   1 
ATOM   4031  C CA  . PRO A 1 550 ? 115.168 159.351 143.625 1.00 294.43 ? 550  PRO A CA  1 
ATOM   4032  C C   . PRO A 1 550 ? 116.163 159.086 142.509 1.00 306.98 ? 550  PRO A C   1 
ATOM   4033  O O   . PRO A 1 550 ? 116.724 157.991 142.463 1.00 315.54 ? 550  PRO A O   1 
ATOM   4034  C CB  . PRO A 1 550 ? 115.878 159.380 144.976 1.00 314.19 ? 550  PRO A CB  1 
ATOM   4035  C CG  . PRO A 1 550 ? 115.956 157.949 145.383 1.00 337.71 ? 550  PRO A CG  1 
ATOM   4036  C CD  . PRO A 1 550 ? 114.700 157.308 144.864 1.00 335.29 ? 550  PRO A CD  1 
ATOM   4037  N N   . LEU A 1 551 ? 116.385 160.048 141.623 1.00 298.39 ? 551  LEU A N   1 
ATOM   4038  C CA  . LEU A 1 551 ? 117.298 159.812 140.521 1.00 292.22 ? 551  LEU A CA  1 
ATOM   4039  C C   . LEU A 1 551 ? 118.701 159.636 141.062 1.00 296.81 ? 551  LEU A C   1 
ATOM   4040  O O   . LEU A 1 551 ? 119.014 160.124 142.135 1.00 289.59 ? 551  LEU A O   1 
ATOM   4041  C CB  . LEU A 1 551 ? 117.285 160.992 139.565 1.00 304.94 ? 551  LEU A CB  1 
ATOM   4042  C CG  . LEU A 1 551 ? 116.174 161.057 138.533 1.00 306.24 ? 551  LEU A CG  1 
ATOM   4043  C CD1 . LEU A 1 551 ? 114.868 160.626 139.157 1.00 326.55 ? 551  LEU A CD1 1 
ATOM   4044  C CD2 . LEU A 1 551 ? 116.065 162.480 138.035 1.00 301.11 ? 551  LEU A CD2 1 
ATOM   4045  N N   . GLN A 1 552 ? 119.542 158.924 140.324 1.00 294.83 ? 552  GLN A N   1 
ATOM   4046  C CA  . GLN A 1 552 ? 120.938 158.775 140.688 1.00 276.63 ? 552  GLN A CA  1 
ATOM   4047  C C   . GLN A 1 552 ? 121.746 159.577 139.705 1.00 275.51 ? 552  GLN A C   1 
ATOM   4048  O O   . GLN A 1 552 ? 121.517 159.510 138.505 1.00 310.75 ? 552  GLN A O   1 
ATOM   4049  C CB  . GLN A 1 552 ? 121.354 157.319 140.661 1.00 283.97 ? 552  GLN A CB  1 
ATOM   4050  C CG  . GLN A 1 552 ? 120.427 156.404 141.431 1.00 302.42 ? 552  GLN A CG  1 
ATOM   4051  C CD  . GLN A 1 552 ? 120.290 156.811 142.875 1.00 320.16 ? 552  GLN A CD  1 
ATOM   4052  O OE1 . GLN A 1 552 ? 120.367 157.983 143.205 1.00 310.94 ? 552  GLN A OE1 1 
ATOM   4053  N NE2 . GLN A 1 552 ? 120.078 155.842 143.744 1.00 331.37 ? 552  GLN A NE2 1 
ATOM   4054  N N   . HIS A 1 553 ? 122.673 160.364 140.223 1.00 274.18 ? 553  HIS A N   1 
ATOM   4055  C CA  . HIS A 1 553 ? 123.312 161.414 139.461 1.00 291.42 ? 553  HIS A CA  1 
ATOM   4056  C C   . HIS A 1 553 ? 124.577 161.001 138.745 1.00 296.60 ? 553  HIS A C   1 
ATOM   4057  O O   . HIS A 1 553 ? 125.333 161.830 138.275 1.00 315.54 ? 553  HIS A O   1 
ATOM   4058  C CB  . HIS A 1 553 ? 123.500 162.639 140.327 1.00 283.57 ? 553  HIS A CB  1 
ATOM   4059  C CG  . HIS A 1 553 ? 122.208 163.198 140.813 1.00 277.05 ? 553  HIS A CG  1 
ATOM   4060  N ND1 . HIS A 1 553 ? 121.134 163.399 139.977 1.00 298.51 ? 553  HIS A ND1 1 
ATOM   4061  C CD2 . HIS A 1 553 ? 121.795 163.555 142.048 1.00 303.78 ? 553  HIS A CD2 1 
ATOM   4062  C CE1 . HIS A 1 553 ? 120.121 163.875 140.674 1.00 302.93 ? 553  HIS A CE1 1 
ATOM   4063  N NE2 . HIS A 1 553 ? 120.495 163.977 141.933 1.00 322.59 ? 553  HIS A NE2 1 
ATOM   4064  N N   . TYR A 1 554 ? 124.800 159.705 138.665 1.00 279.81 ? 554  TYR A N   1 
ATOM   4065  C CA  . TYR A 1 554 ? 125.933 159.183 137.943 1.00 285.77 ? 554  TYR A CA  1 
ATOM   4066  C C   . TYR A 1 554 ? 125.841 159.581 136.468 1.00 306.57 ? 554  TYR A C   1 
ATOM   4067  O O   . TYR A 1 554 ? 124.778 159.517 135.871 1.00 302.65 ? 554  TYR A O   1 
ATOM   4068  C CB  . TYR A 1 554 ? 125.888 157.671 138.075 1.00 302.85 ? 554  TYR A CB  1 
ATOM   4069  C CG  . TYR A 1 554 ? 127.188 156.981 137.833 1.00 309.11 ? 554  TYR A CG  1 
ATOM   4070  C CD1 . TYR A 1 554 ? 128.276 157.215 138.641 1.00 326.95 ? 554  TYR A CD1 1 
ATOM   4071  C CD2 . TYR A 1 554 ? 127.320 156.078 136.800 1.00 309.14 ? 554  TYR A CD2 1 
ATOM   4072  C CE1 . TYR A 1 554 ? 129.471 156.579 138.416 1.00 327.95 ? 554  TYR A CE1 1 
ATOM   4073  C CE2 . TYR A 1 554 ? 128.509 155.437 136.566 1.00 315.22 ? 554  TYR A CE2 1 
ATOM   4074  C CZ  . TYR A 1 554 ? 129.576 155.693 137.378 1.00 321.56 ? 554  TYR A CZ  1 
ATOM   4075  O OH  . TYR A 1 554 ? 130.753 155.049 137.144 1.00 291.45 ? 554  TYR A OH  1 
ATOM   4076  N N   . ILE A 1 555 ? 126.966 160.001 135.901 1.00 314.92 ? 555  ILE A N   1 
ATOM   4077  C CA  . ILE A 1 555 ? 127.169 160.287 134.475 1.00 289.63 ? 555  ILE A CA  1 
ATOM   4078  C C   . ILE A 1 555 ? 127.281 158.930 133.815 1.00 305.28 ? 555  ILE A C   1 
ATOM   4079  O O   . ILE A 1 555 ? 128.380 158.440 133.534 1.00 327.16 ? 555  ILE A O   1 
ATOM   4080  C CB  . ILE A 1 555 ? 128.450 161.121 134.224 1.00 317.06 ? 555  ILE A CB  1 
ATOM   4081  C CG1 . ILE A 1 555 ? 128.400 162.416 135.047 1.00 363.42 ? 555  ILE A CG1 1 
ATOM   4082  C CG2 . ILE A 1 555 ? 128.680 161.390 132.734 1.00 304.22 ? 555  ILE A CG2 1 
ATOM   4083  C CD1 . ILE A 1 555 ? 129.253 162.374 136.297 1.00 381.03 ? 555  ILE A CD1 1 
ATOM   4084  N N   . ALA A 1 556 ? 126.167 158.266 133.608 1.00 317.59 ? 556  ALA A N   1 
ATOM   4085  C CA  . ALA A 1 556 ? 126.278 156.893 133.199 1.00 339.40 ? 556  ALA A CA  1 
ATOM   4086  C C   . ALA A 1 556 ? 126.919 156.924 131.850 1.00 342.04 ? 556  ALA A C   1 
ATOM   4087  O O   . ALA A 1 556 ? 126.853 157.920 131.144 1.00 360.36 ? 556  ALA A O   1 
ATOM   4088  C CB  . ALA A 1 556 ? 124.920 156.224 133.135 1.00 370.27 ? 556  ALA A CB  1 
ATOM   4089  N N   . VAL A 1 557 ? 127.481 155.788 131.475 1.00 325.30 ? 557  VAL A N   1 
ATOM   4090  C CA  . VAL A 1 557 ? 128.113 155.601 130.190 1.00 331.78 ? 557  VAL A CA  1 
ATOM   4091  C C   . VAL A 1 557 ? 127.082 155.806 129.097 1.00 335.35 ? 557  VAL A C   1 
ATOM   4092  O O   . VAL A 1 557 ? 127.396 156.324 128.036 1.00 341.74 ? 557  VAL A O   1 
ATOM   4093  C CB  . VAL A 1 557 ? 128.657 154.188 130.068 1.00 305.00 ? 557  VAL A CB  1 
ATOM   4094  C CG1 . VAL A 1 557 ? 127.512 153.207 130.200 1.00 328.38 ? 557  VAL A CG1 1 
ATOM   4095  C CG2 . VAL A 1 557 ? 129.353 154.017 128.737 1.00 302.13 ? 557  VAL A CG2 1 
ATOM   4096  N N   . SER A 1 558 ? 125.851 155.383 129.349 1.00 318.68 ? 558  SER A N   1 
ATOM   4097  C CA  . SER A 1 558 ? 124.791 155.545 128.368 1.00 324.36 ? 558  SER A CA  1 
ATOM   4098  C C   . SER A 1 558 ? 124.563 157.016 128.073 1.00 334.80 ? 558  SER A C   1 
ATOM   4099  O O   . SER A 1 558 ? 124.615 157.837 128.970 1.00 376.10 ? 558  SER A O   1 
ATOM   4100  C CB  . SER A 1 558 ? 123.498 154.936 128.885 1.00 331.50 ? 558  SER A CB  1 
ATOM   4101  O OG  . SER A 1 558 ? 122.873 155.807 129.802 1.00 339.53 ? 558  SER A OG  1 
ATOM   4102  N N   . SER A 1 559 ? 124.307 157.323 126.806 1.00 301.76 ? 559  SER A N   1 
ATOM   4103  C CA  . SER A 1 559 ? 124.192 158.692 126.304 1.00 304.15 ? 559  SER A CA  1 
ATOM   4104  C C   . SER A 1 559 ? 123.797 159.716 127.344 1.00 307.07 ? 559  SER A C   1 
ATOM   4105  O O   . SER A 1 559 ? 124.668 160.225 128.041 1.00 338.35 ? 559  SER A O   1 
ATOM   4106  C CB  . SER A 1 559 ? 123.201 158.755 125.141 1.00 301.32 ? 559  SER A CB  1 
ATOM   4107  O OG  . SER A 1 559 ? 122.173 157.787 125.278 1.00 272.11 ? 559  SER A OG  1 
ATOM   4108  N N   . PRO A 1 560 ? 122.429 160.016 127.444 1.00 295.91 ? 560  PRO A N   1 
ATOM   4109  C CA  . PRO A 1 560 ? 122.122 161.000 128.480 1.00 315.31 ? 560  PRO A CA  1 
ATOM   4110  C C   . PRO A 1 560 ? 121.354 160.338 129.613 1.00 336.04 ? 560  PRO A C   1 
ATOM   4111  O O   . PRO A 1 560 ? 120.328 159.714 129.385 1.00 352.39 ? 560  PRO A O   1 
ATOM   4112  C CB  . PRO A 1 560 ? 121.224 161.977 127.738 1.00 301.47 ? 560  PRO A CB  1 
ATOM   4113  C CG  . PRO A 1 560 ? 120.386 161.098 126.872 1.00 330.47 ? 560  PRO A CG  1 
ATOM   4114  C CD  . PRO A 1 560 ? 121.077 159.761 126.762 1.00 334.64 ? 560  PRO A CD  1 
ATOM   4115  N N   . THR A 1 561 ? 121.855 160.481 130.831 1.00 308.63 ? 561  THR A N   1 
ATOM   4116  C CA  . THR A 1 561 ? 121.277 159.813 131.977 1.00 316.50 ? 561  THR A CA  1 
ATOM   4117  C C   . THR A 1 561 ? 119.970 160.461 132.348 1.00 297.11 ? 561  THR A C   1 
ATOM   4118  O O   . THR A 1 561 ? 119.675 161.557 131.913 1.00 240.29 ? 561  THR A O   1 
ATOM   4119  C CB  . THR A 1 561 ? 122.206 159.886 133.181 1.00 301.52 ? 561  THR A CB  1 
ATOM   4120  O OG1 . THR A 1 561 ? 123.472 160.388 132.754 1.00 314.97 ? 561  THR A OG1 1 
ATOM   4121  C CG2 . THR A 1 561 ? 122.388 158.519 133.779 1.00 284.06 ? 561  THR A CG2 1 
ATOM   4122  N N   . ASN A 1 562 ? 119.211 159.822 133.221 1.00 280.12 ? 562  ASN A N   1 
ATOM   4123  C CA  . ASN A 1 562 ? 117.869 160.290 133.487 1.00 262.31 ? 562  ASN A CA  1 
ATOM   4124  C C   . ASN A 1 562 ? 117.969 161.725 133.964 1.00 274.72 ? 562  ASN A C   1 
ATOM   4125  O O   . ASN A 1 562 ? 117.103 162.550 133.676 1.00 292.38 ? 562  ASN A O   1 
ATOM   4126  C CB  . ASN A 1 562 ? 117.194 159.422 134.550 1.00 282.34 ? 562  ASN A CB  1 
ATOM   4127  C CG  . ASN A 1 562 ? 117.486 157.946 134.367 1.00 293.08 ? 562  ASN A CG  1 
ATOM   4128  O OD1 . ASN A 1 562 ? 118.437 157.569 133.683 1.00 303.72 ? 562  ASN A OD1 1 
ATOM   4129  N ND2 . ASN A 1 562 ? 116.666 157.100 134.981 1.00 307.18 ? 562  ASN A ND2 1 
ATOM   4130  N N   . THR A 1 563 ? 119.029 162.014 134.707 1.00 298.54 ? 563  THR A N   1 
ATOM   4131  C CA  . THR A 1 563 ? 119.160 163.298 135.360 1.00 298.50 ? 563  THR A CA  1 
ATOM   4132  C C   . THR A 1 563 ? 119.127 164.437 134.383 1.00 271.25 ? 563  THR A C   1 
ATOM   4133  O O   . THR A 1 563 ? 118.859 165.561 134.764 1.00 283.55 ? 563  THR A O   1 
ATOM   4134  C CB  . THR A 1 563 ? 120.456 163.392 136.155 1.00 318.05 ? 563  THR A CB  1 
ATOM   4135  O OG1 . THR A 1 563 ? 120.722 162.123 136.755 1.00 344.98 ? 563  THR A OG1 1 
ATOM   4136  C CG2 . THR A 1 563 ? 120.317 164.412 137.240 1.00 303.47 ? 563  THR A CG2 1 
ATOM   4137  N N   . THR A 1 564 ? 119.467 164.163 133.137 1.00 276.03 ? 564  THR A N   1 
ATOM   4138  C CA  . THR A 1 564 ? 119.780 165.216 132.179 1.00 279.46 ? 564  THR A CA  1 
ATOM   4139  C C   . THR A 1 564 ? 118.523 165.668 131.454 1.00 291.44 ? 564  THR A C   1 
ATOM   4140  O O   . THR A 1 564 ? 118.256 166.874 131.317 1.00 321.00 ? 564  THR A O   1 
ATOM   4141  C CB  . THR A 1 564 ? 120.764 164.738 131.092 1.00 286.04 ? 564  THR A CB  1 
ATOM   4142  O OG1 . THR A 1 564 ? 121.944 164.193 131.698 1.00 291.17 ? 564  THR A OG1 1 
ATOM   4143  C CG2 . THR A 1 564 ? 121.157 165.887 130.171 1.00 281.36 ? 564  THR A CG2 1 
ATOM   4144  N N   . TYR A 1 565 ? 117.773 164.665 131.001 1.00 308.71 ? 565  TYR A N   1 
ATOM   4145  C CA  . TYR A 1 565 ? 116.520 164.891 130.262 1.00 299.89 ? 565  TYR A CA  1 
ATOM   4146  C C   . TYR A 1 565 ? 115.551 165.697 131.116 1.00 286.23 ? 565  TYR A C   1 
ATOM   4147  O O   . TYR A 1 565 ? 114.939 166.663 130.636 1.00 312.88 ? 565  TYR A O   1 
ATOM   4148  C CB  . TYR A 1 565 ? 115.847 163.570 129.859 1.00 293.30 ? 565  TYR A CB  1 
ATOM   4149  C CG  . TYR A 1 565 ? 116.289 162.975 128.534 1.00 300.24 ? 565  TYR A CG  1 
ATOM   4150  C CD1 . TYR A 1 565 ? 116.517 163.776 127.409 1.00 301.70 ? 565  TYR A CD1 1 
ATOM   4151  C CD2 . TYR A 1 565 ? 116.420 161.596 128.387 1.00 310.99 ? 565  TYR A CD2 1 
ATOM   4152  C CE1 . TYR A 1 565 ? 116.889 163.220 126.196 1.00 309.96 ? 565  TYR A CE1 1 
ATOM   4153  C CE2 . TYR A 1 565 ? 116.797 161.035 127.176 1.00 321.07 ? 565  TYR A CE2 1 
ATOM   4154  C CZ  . TYR A 1 565 ? 117.025 161.849 126.085 1.00 315.87 ? 565  TYR A CZ  1 
ATOM   4155  O OH  . TYR A 1 565 ? 117.399 161.291 124.884 1.00 332.99 ? 565  TYR A OH  1 
ATOM   4156  N N   . VAL A 1 566 ? 115.441 165.271 132.372 1.00 270.41 ? 566  VAL A N   1 
ATOM   4157  C CA  . VAL A 1 566 ? 114.550 165.915 133.343 1.00 274.54 ? 566  VAL A CA  1 
ATOM   4158  C C   . VAL A 1 566 ? 114.928 167.384 133.507 1.00 279.41 ? 566  VAL A C   1 
ATOM   4159  O O   . VAL A 1 566 ? 114.056 168.267 133.497 1.00 307.35 ? 566  VAL A O   1 
ATOM   4160  C CB  . VAL A 1 566 ? 114.470 165.160 134.681 1.00 285.64 ? 566  VAL A CB  1 
ATOM   4161  C CG1 . VAL A 1 566 ? 113.654 165.948 135.689 1.00 295.23 ? 566  VAL A CG1 1 
ATOM   4162  C CG2 . VAL A 1 566 ? 113.829 163.790 134.475 1.00 294.80 ? 566  VAL A CG2 1 
ATOM   4163  N N   . VAL A 1 567 ? 116.228 167.606 133.645 1.00 282.63 ? 567  VAL A N   1 
ATOM   4164  C CA  . VAL A 1 567 ? 116.787 168.951 133.816 1.00 290.94 ? 567  VAL A CA  1 
ATOM   4165  C C   . VAL A 1 567 ? 116.412 169.828 132.624 1.00 278.63 ? 567  VAL A C   1 
ATOM   4166  O O   . VAL A 1 567 ? 115.978 170.976 132.793 1.00 297.62 ? 567  VAL A O   1 
ATOM   4167  C CB  . VAL A 1 567 ? 118.305 168.988 134.114 1.00 290.73 ? 567  VAL A CB  1 
ATOM   4168  C CG1 . VAL A 1 567 ? 118.749 170.420 134.381 1.00 307.48 ? 567  VAL A CG1 1 
ATOM   4169  C CG2 . VAL A 1 567 ? 118.635 168.144 135.341 1.00 314.69 ? 567  VAL A CG2 1 
ATOM   4170  N N   . GLN A 1 568 ? 116.583 169.252 131.441 1.00 282.23 ? 568  GLN A N   1 
ATOM   4171  C CA  . GLN A 1 568 ? 116.292 169.927 130.176 1.00 300.27 ? 568  GLN A CA  1 
ATOM   4172  C C   . GLN A 1 568 ? 114.827 170.348 130.142 1.00 306.84 ? 568  GLN A C   1 
ATOM   4173  O O   . GLN A 1 568 ? 114.510 171.506 129.779 1.00 318.32 ? 568  GLN A O   1 
ATOM   4174  C CB  . GLN A 1 568 ? 116.594 169.024 128.980 1.00 300.53 ? 568  GLN A CB  1 
ATOM   4175  C CG  . GLN A 1 568 ? 116.669 169.777 127.666 1.00 305.04 ? 568  GLN A CG  1 
ATOM   4176  C CD  . GLN A 1 568 ? 116.964 168.883 126.479 1.00 329.11 ? 568  GLN A CD  1 
ATOM   4177  O OE1 . GLN A 1 568 ? 117.079 167.661 126.609 1.00 331.86 ? 568  GLN A OE1 1 
ATOM   4178  N NE2 . GLN A 1 568 ? 117.090 169.492 125.306 1.00 346.74 ? 568  GLN A NE2 1 
ATOM   4179  N N   . TYR A 1 569 ? 113.966 169.408 130.540 1.00 280.99 ? 569  TYR A N   1 
ATOM   4180  C CA  . TYR A 1 569 ? 112.522 169.594 130.425 1.00 308.29 ? 569  TYR A CA  1 
ATOM   4181  C C   . TYR A 1 569 ? 111.954 170.441 131.533 1.00 311.44 ? 569  TYR A C   1 
ATOM   4182  O O   . TYR A 1 569 ? 111.157 171.349 131.241 1.00 328.67 ? 569  TYR A O   1 
ATOM   4183  C CB  . TYR A 1 569 ? 111.794 168.268 130.181 1.00 311.81 ? 569  TYR A CB  1 
ATOM   4184  C CG  . TYR A 1 569 ? 111.854 167.915 128.711 1.00 322.64 ? 569  TYR A CG  1 
ATOM   4185  C CD1 . TYR A 1 569 ? 110.932 168.449 127.820 1.00 340.94 ? 569  TYR A CD1 1 
ATOM   4186  C CD2 . TYR A 1 569 ? 112.878 167.116 128.194 1.00 327.24 ? 569  TYR A CD2 1 
ATOM   4187  C CE1 . TYR A 1 569 ? 110.994 168.163 126.467 1.00 357.51 ? 569  TYR A CE1 1 
ATOM   4188  C CE2 . TYR A 1 569 ? 112.953 166.827 126.840 1.00 322.76 ? 569  TYR A CE2 1 
ATOM   4189  C CZ  . TYR A 1 569 ? 112.004 167.352 125.979 1.00 351.32 ? 569  TYR A CZ  1 
ATOM   4190  O OH  . TYR A 1 569 ? 112.065 167.069 124.634 1.00 354.94 ? 569  TYR A OH  1 
ATOM   4191  N N   . ALA A 1 570 ? 112.475 170.257 132.739 1.00 303.82 ? 570  ALA A N   1 
ATOM   4192  C CA  . ALA A 1 570 ? 112.165 171.140 133.882 1.00 321.18 ? 570  ALA A CA  1 
ATOM   4193  C C   . ALA A 1 570 ? 112.547 172.578 133.543 1.00 308.70 ? 570  ALA A C   1 
ATOM   4194  O O   . ALA A 1 570 ? 111.769 173.518 133.774 1.00 332.23 ? 570  ALA A O   1 
ATOM   4195  C CB  . ALA A 1 570 ? 112.907 170.680 135.126 1.00 344.55 ? 570  ALA A CB  1 
ATOM   4196  N N   . LEU A 1 571 ? 113.751 172.706 132.991 1.00 311.94 ? 571  LEU A N   1 
ATOM   4197  C CA  . LEU A 1 571 ? 114.298 174.014 132.599 1.00 308.22 ? 571  LEU A CA  1 
ATOM   4198  C C   . LEU A 1 571 ? 113.384 174.675 131.580 1.00 316.83 ? 571  LEU A C   1 
ATOM   4199  O O   . LEU A 1 571 ? 113.078 175.868 131.698 1.00 341.01 ? 571  LEU A O   1 
ATOM   4200  C CB  . LEU A 1 571 ? 115.726 173.882 132.067 1.00 308.78 ? 571  LEU A CB  1 
ATOM   4201  C CG  . LEU A 1 571 ? 116.488 175.132 131.624 1.00 316.79 ? 571  LEU A CG  1 
ATOM   4202  C CD1 . LEU A 1 571 ? 116.501 176.193 132.716 1.00 320.24 ? 571  LEU A CD1 1 
ATOM   4203  C CD2 . LEU A 1 571 ? 117.904 174.737 131.219 1.00 329.39 ? 571  LEU A CD2 1 
ATOM   4204  N N   . ALA A 1 572 ? 112.965 173.883 130.605 1.00 298.21 ? 572  ALA A N   1 
ATOM   4205  C CA  . ALA A 1 572 ? 112.070 174.335 129.534 1.00 321.74 ? 572  ALA A CA  1 
ATOM   4206  C C   . ALA A 1 572 ? 110.775 174.878 130.128 1.00 313.81 ? 572  ALA A C   1 
ATOM   4207  O O   . ALA A 1 572 ? 110.301 175.957 129.745 1.00 322.63 ? 572  ALA A O   1 
ATOM   4208  C CB  . ALA A 1 572 ? 111.775 173.210 128.549 1.00 338.64 ? 572  ALA A CB  1 
ATOM   4209  N N   . ASN A 1 573 ? 110.236 174.103 131.062 1.00 284.12 ? 573  ASN A N   1 
ATOM   4210  C CA  . ASN A 1 573 ? 108.987 174.441 131.752 1.00 286.47 ? 573  ASN A CA  1 
ATOM   4211  C C   . ASN A 1 573 ? 109.130 175.783 132.454 1.00 295.11 ? 573  ASN A C   1 
ATOM   4212  O O   . ASN A 1 573 ? 108.241 176.654 132.352 1.00 348.59 ? 573  ASN A O   1 
ATOM   4213  C CB  . ASN A 1 573 ? 108.533 173.395 132.787 1.00 299.00 ? 573  ASN A CB  1 
ATOM   4214  C CG  . ASN A 1 573 ? 107.017 173.303 132.880 1.00 309.69 ? 573  ASN A CG  1 
ATOM   4215  O OD1 . ASN A 1 573 ? 106.405 172.415 132.288 1.00 341.01 ? 573  ASN A OD1 1 
ATOM   4216  N ND2 . ASN A 1 573 ? 106.402 174.235 133.602 1.00 322.77 ? 573  ASN A ND2 1 
ATOM   4217  N N   . LEU A 1 574 ? 110.254 175.925 133.149 1.00 301.20 ? 574  LEU A N   1 
ATOM   4218  C CA  . LEU A 1 574 ? 110.536 177.120 133.948 1.00 320.28 ? 574  LEU A CA  1 
ATOM   4219  C C   . LEU A 1 574 ? 110.765 178.402 133.115 1.00 327.85 ? 574  LEU A C   1 
ATOM   4220  O O   . LEU A 1 574 ? 110.035 179.401 133.230 1.00 358.54 ? 574  LEU A O   1 
ATOM   4221  C CB  . LEU A 1 574 ? 111.690 176.851 134.922 1.00 330.29 ? 574  LEU A CB  1 
ATOM   4222  C CG  . LEU A 1 574 ? 111.379 176.030 136.198 1.00 331.98 ? 574  LEU A CG  1 
ATOM   4223  C CD1 . LEU A 1 574 ? 110.079 175.225 136.179 1.00 334.45 ? 574  LEU A CD1 1 
ATOM   4224  C CD2 . LEU A 1 574 ? 112.544 175.117 136.555 1.00 341.45 ? 574  LEU A CD2 1 
ATOM   4225  N N   . THR A 1 575 ? 111.781 178.329 132.258 1.00 313.87 ? 575  THR A N   1 
ATOM   4226  C CA  . THR A 1 575 ? 112.187 179.450 131.416 1.00 352.12 ? 575  THR A CA  1 
ATOM   4227  C C   . THR A 1 575 ? 111.247 179.635 130.232 1.00 354.55 ? 575  THR A C   1 
ATOM   4228  O O   . THR A 1 575 ? 110.792 180.743 129.952 1.00 379.82 ? 575  THR A O   1 
ATOM   4229  C CB  . THR A 1 575 ? 113.618 179.262 130.868 1.00 383.70 ? 575  THR A CB  1 
ATOM   4230  O OG1 . THR A 1 575 ? 113.735 177.976 130.246 1.00 389.35 ? 575  THR A OG1 1 
ATOM   4231  C CG2 . THR A 1 575 ? 114.643 179.383 131.987 1.00 382.49 ? 575  THR A CG2 1 
ATOM   4232  N N   . GLY A 1 576 ? 110.966 178.545 129.531 1.00 353.16 ? 576  GLY A N   1 
ATOM   4233  C CA  . GLY A 1 576 ? 110.150 178.602 128.326 1.00 372.63 ? 576  GLY A CA  1 
ATOM   4234  C C   . GLY A 1 576 ? 108.689 178.933 128.545 1.00 375.51 ? 576  GLY A C   1 
ATOM   4235  O O   . GLY A 1 576 ? 108.212 179.018 129.682 1.00 376.95 ? 576  GLY A O   1 
ATOM   4236  N N   . THR A 1 577 ? 107.988 179.114 127.429 1.00 375.50 ? 577  THR A N   1 
ATOM   4237  C CA  . THR A 1 577 ? 106.572 179.463 127.421 1.00 368.39 ? 577  THR A CA  1 
ATOM   4238  C C   . THR A 1 577 ? 105.807 178.495 126.519 1.00 359.38 ? 577  THR A C   1 
ATOM   4239  O O   . THR A 1 577 ? 106.327 178.048 125.489 1.00 345.38 ? 577  THR A O   1 
ATOM   4240  C CB  . THR A 1 577 ? 106.348 180.926 126.963 1.00 378.53 ? 577  THR A CB  1 
ATOM   4241  O OG1 . THR A 1 577 ? 104.981 181.296 127.183 1.00 399.65 ? 577  THR A OG1 1 
ATOM   4242  C CG2 . THR A 1 577 ? 106.698 181.132 125.481 1.00 380.00 ? 577  THR A CG2 1 
ATOM   4243  N N   . VAL A 1 578 ? 104.583 178.163 126.928 1.00 355.21 ? 578  VAL A N   1 
ATOM   4244  C CA  . VAL A 1 578 ? 103.685 177.346 126.111 1.00 354.33 ? 578  VAL A CA  1 
ATOM   4245  C C   . VAL A 1 578 ? 103.249 178.140 124.874 1.00 357.75 ? 578  VAL A C   1 
ATOM   4246  O O   . VAL A 1 578 ? 103.004 179.348 124.957 1.00 355.90 ? 578  VAL A O   1 
ATOM   4247  C CB  . VAL A 1 578 ? 102.462 176.837 126.918 1.00 368.53 ? 578  VAL A CB  1 
ATOM   4248  C CG1 . VAL A 1 578 ? 101.495 177.968 127.269 1.00 390.89 ? 578  VAL A CG1 1 
ATOM   4249  C CG2 . VAL A 1 578 ? 101.742 175.730 126.160 1.00 375.90 ? 578  VAL A CG2 1 
ATOM   4250  N N   . VAL A 1 579 ? 103.164 177.451 123.738 1.00 364.23 ? 579  VAL A N   1 
ATOM   4251  C CA  . VAL A 1 579 ? 102.903 178.088 122.445 1.00 373.87 ? 579  VAL A CA  1 
ATOM   4252  C C   . VAL A 1 579 ? 101.823 177.305 121.689 1.00 382.43 ? 579  VAL A C   1 
ATOM   4253  O O   . VAL A 1 579 ? 101.866 176.073 121.633 1.00 382.69 ? 579  VAL A O   1 
ATOM   4254  C CB  . VAL A 1 579 ? 104.213 178.233 121.621 1.00 372.98 ? 579  VAL A CB  1 
ATOM   4255  C CG1 . VAL A 1 579 ? 104.782 176.880 121.202 1.00 360.59 ? 579  VAL A CG1 1 
ATOM   4256  C CG2 . VAL A 1 579 ? 104.007 179.139 120.412 1.00 377.74 ? 579  VAL A CG2 1 
ATOM   4257  N N   . ASN A 1 580 ? 100.855 178.027 121.119 1.00 401.70 ? 580  ASN A N   1 
ATOM   4258  C CA  . ASN A 1 580 ? 99.689  177.405 120.462 1.00 397.83 ? 580  ASN A CA  1 
ATOM   4259  C C   . ASN A 1 580 ? 100.021 176.781 119.099 1.00 370.12 ? 580  ASN A C   1 
ATOM   4260  O O   . ASN A 1 580 ? 99.622  177.294 118.047 1.00 350.51 ? 580  ASN A O   1 
ATOM   4261  C CB  . ASN A 1 580 ? 98.505  178.394 120.358 1.00 403.40 ? 580  ASN A CB  1 
ATOM   4262  C CG  . ASN A 1 580 ? 98.833  179.651 119.558 1.00 406.80 ? 580  ASN A CG  1 
ATOM   4263  O OD1 . ASN A 1 580 ? 100.000 180.004 119.372 1.00 393.49 ? 580  ASN A OD1 1 
ATOM   4264  N ND2 . ASN A 1 580 ? 97.795  180.331 119.082 1.00 407.02 ? 580  ASN A ND2 1 
ATOM   4265  N N   . LEU A 1 581 ? 100.740 175.660 119.140 1.00 346.20 ? 581  LEU A N   1 
ATOM   4266  C CA  . LEU A 1 581 ? 101.151 174.936 117.939 1.00 354.63 ? 581  LEU A CA  1 
ATOM   4267  C C   . LEU A 1 581 ? 100.722 173.473 118.020 1.00 349.75 ? 581  LEU A C   1 
ATOM   4268  O O   . LEU A 1 581 ? 100.766 172.866 119.092 1.00 365.54 ? 581  LEU A O   1 
ATOM   4269  C CB  . LEU A 1 581 ? 102.669 175.015 117.751 1.00 335.33 ? 581  LEU A CB  1 
ATOM   4270  C CG  . LEU A 1 581 ? 103.351 176.367 117.500 1.00 350.79 ? 581  LEU A CG  1 
ATOM   4271  C CD1 . LEU A 1 581 ? 104.773 176.125 117.005 1.00 357.57 ? 581  LEU A CD1 1 
ATOM   4272  C CD2 . LEU A 1 581 ? 102.594 177.263 116.527 1.00 352.65 ? 581  LEU A CD2 1 
ATOM   4273  N N   . THR A 1 582 ? 100.297 172.924 116.882 1.00 358.85 ? 582  THR A N   1 
ATOM   4274  C CA  . THR A 1 582 ? 99.968  171.501 116.771 1.00 366.96 ? 582  THR A CA  1 
ATOM   4275  C C   . THR A 1 582 ? 101.241 170.665 116.599 1.00 350.48 ? 582  THR A C   1 
ATOM   4276  O O   . THR A 1 582 ? 102.324 171.207 116.354 1.00 304.36 ? 582  THR A O   1 
ATOM   4277  C CB  . THR A 1 582 ? 98.967  171.217 115.624 1.00 406.08 ? 582  THR A CB  1 
ATOM   4278  O OG1 . THR A 1 582 ? 98.430  169.896 115.775 1.00 429.82 ? 582  THR A OG1 1 
ATOM   4279  C CG2 . THR A 1 582 ? 99.616  171.346 114.237 1.00 409.15 ? 582  THR A CG2 1 
ATOM   4280  N N   . ARG A 1 583 ? 101.086 169.346 116.711 1.00 336.07 ? 583  ARG A N   1 
ATOM   4281  C CA  . ARG A 1 583 ? 102.208 168.409 116.777 1.00 344.29 ? 583  ARG A CA  1 
ATOM   4282  C C   . ARG A 1 583 ? 103.109 168.569 115.564 1.00 357.75 ? 583  ARG A C   1 
ATOM   4283  O O   . ARG A 1 583 ? 104.342 168.611 115.700 1.00 381.12 ? 583  ARG A O   1 
ATOM   4284  C CB  . ARG A 1 583 ? 101.685 166.971 116.872 1.00 363.03 ? 583  ARG A CB  1 
ATOM   4285  C CG  . ARG A 1 583 ? 102.742 165.873 116.828 1.00 367.23 ? 583  ARG A CG  1 
ATOM   4286  C CD  . ARG A 1 583 ? 102.124 164.517 117.140 1.00 381.30 ? 583  ARG A CD  1 
ATOM   4287  N NE  . ARG A 1 583 ? 102.819 163.416 116.471 1.00 411.25 ? 583  ARG A NE  1 
ATOM   4288  C CZ  . ARG A 1 583 ? 102.671 163.066 115.189 1.00 433.97 ? 583  ARG A CZ  1 
ATOM   4289  N NH1 . ARG A 1 583 ? 101.848 163.731 114.374 1.00 441.15 ? 583  ARG A NH1 1 
ATOM   4290  N NH2 . ARG A 1 583 ? 103.366 162.037 114.708 1.00 451.50 ? 583  ARG A NH2 1 
ATOM   4291  N N   . GLU A 1 584 ? 102.469 168.670 114.401 1.00 378.77 ? 584  GLU A N   1 
ATOM   4292  C CA  . GLU A 1 584 ? 103.171 168.838 113.126 1.00 400.69 ? 584  GLU A CA  1 
ATOM   4293  C C   . GLU A 1 584 ? 104.028 170.100 113.165 1.00 398.14 ? 584  GLU A C   1 
ATOM   4294  O O   . GLU A 1 584 ? 105.206 170.081 112.765 1.00 408.80 ? 584  GLU A O   1 
ATOM   4295  C CB  . GLU A 1 584 ? 102.188 168.913 111.945 1.00 428.50 ? 584  GLU A CB  1 
ATOM   4296  C CG  . GLU A 1 584 ? 101.275 167.700 111.751 1.00 444.93 ? 584  GLU A CG  1 
ATOM   4297  C CD  . GLU A 1 584 ? 102.022 166.379 111.640 1.00 453.86 ? 584  GLU A CD  1 
ATOM   4298  O OE1 . GLU A 1 584 ? 103.123 166.353 111.047 1.00 468.76 ? 584  GLU A OE1 1 
ATOM   4299  O OE2 . GLU A 1 584 ? 101.498 165.359 112.142 1.00 446.06 ? 584  GLU A OE2 1 
ATOM   4300  N N   . GLN A 1 585 ? 103.405 171.170 113.653 1.00 394.36 ? 585  GLN A N   1 
ATOM   4301  C CA  . GLN A 1 585 ? 104.066 172.477 113.763 1.00 394.75 ? 585  GLN A CA  1 
ATOM   4302  C C   . GLN A 1 585 ? 105.304 172.365 114.644 1.00 407.05 ? 585  GLN A C   1 
ATOM   4303  O O   . GLN A 1 585 ? 106.376 172.879 114.296 1.00 418.17 ? 585  GLN A O   1 
ATOM   4304  C CB  . GLN A 1 585 ? 103.104 173.566 114.266 1.00 382.73 ? 585  GLN A CB  1 
ATOM   4305  C CG  . GLN A 1 585 ? 102.128 174.049 113.205 1.00 384.02 ? 585  GLN A CG  1 
ATOM   4306  C CD  . GLN A 1 585 ? 101.080 175.006 113.748 1.00 381.09 ? 585  GLN A CD  1 
ATOM   4307  O OE1 . GLN A 1 585 ? 100.260 174.636 114.588 1.00 362.56 ? 585  GLN A OE1 1 
ATOM   4308  N NE2 . GLN A 1 585 ? 101.092 176.241 113.256 1.00 388.55 ? 585  GLN A NE2 1 
ATOM   4309  N N   . CYS A 1 586 ? 105.121 171.688 115.769 1.00 386.35 ? 586  CYS A N   1 
ATOM   4310  C CA  . CYS A 1 586 ? 106.191 171.465 116.749 1.00 381.27 ? 586  CYS A CA  1 
ATOM   4311  C C   . CYS A 1 586 ? 107.365 170.746 116.088 1.00 384.94 ? 586  CYS A C   1 
ATOM   4312  O O   . CYS A 1 586 ? 108.529 171.135 116.257 1.00 408.62 ? 586  CYS A O   1 
ATOM   4313  C CB  . CYS A 1 586 ? 105.697 170.638 117.950 1.00 393.98 ? 586  CYS A CB  1 
ATOM   4314  S SG  . CYS A 1 586 ? 105.948 171.438 119.548 1.00 399.55 ? 586  CYS A SG  1 
ATOM   4315  N N   . GLN A 1 587 ? 107.015 169.704 115.345 1.00 399.33 ? 587  GLN A N   1 
ATOM   4316  C CA  . GLN A 1 587 ? 107.990 168.879 114.626 1.00 418.01 ? 587  GLN A CA  1 
ATOM   4317  C C   . GLN A 1 587 ? 108.804 169.742 113.659 1.00 429.07 ? 587  GLN A C   1 
ATOM   4318  O O   . GLN A 1 587 ? 110.042 169.636 113.616 1.00 427.12 ? 587  GLN A O   1 
ATOM   4319  C CB  . GLN A 1 587 ? 107.307 167.722 113.879 1.00 444.65 ? 587  GLN A CB  1 
ATOM   4320  C CG  . GLN A 1 587 ? 108.251 166.627 113.385 1.00 461.70 ? 587  GLN A CG  1 
ATOM   4321  C CD  . GLN A 1 587 ? 109.019 165.924 114.498 1.00 475.88 ? 587  GLN A CD  1 
ATOM   4322  O OE1 . GLN A 1 587 ? 110.179 165.552 114.320 1.00 482.32 ? 587  GLN A OE1 1 
ATOM   4323  N NE2 . GLN A 1 587 ? 108.377 165.739 115.649 1.00 481.25 ? 587  GLN A NE2 1 
ATOM   4324  N N   . ASP A 1 588 ? 108.115 170.555 112.853 1.00 443.29 ? 588  ASP A N   1 
ATOM   4325  C CA  . ASP A 1 588 ? 108.746 171.345 111.786 1.00 462.90 ? 588  ASP A CA  1 
ATOM   4326  C C   . ASP A 1 588 ? 108.306 172.813 111.846 1.00 461.45 ? 588  ASP A C   1 
ATOM   4327  O O   . ASP A 1 588 ? 107.429 173.232 111.085 1.00 450.55 ? 588  ASP A O   1 
ATOM   4328  C CB  . ASP A 1 588 ? 108.405 170.748 110.413 1.00 490.79 ? 588  ASP A CB  1 
ATOM   4329  C CG  . ASP A 1 588 ? 108.965 169.344 110.221 1.00 500.00 ? 588  ASP A CG  1 
ATOM   4330  O OD1 . ASP A 1 588 ? 110.117 169.086 110.632 1.00 500.00 ? 588  ASP A OD1 1 
ATOM   4331  O OD2 . ASP A 1 588 ? 108.251 168.496 109.643 1.00 500.00 ? 588  ASP A OD2 1 
ATOM   4332  N N   . PRO A 1 589 ? 108.912 173.601 112.757 1.00 470.27 ? 589  PRO A N   1 
ATOM   4333  C CA  . PRO A 1 589 ? 108.581 175.027 112.862 1.00 474.06 ? 589  PRO A CA  1 
ATOM   4334  C C   . PRO A 1 589 ? 109.200 175.910 111.763 1.00 474.69 ? 589  PRO A C   1 
ATOM   4335  O O   . PRO A 1 589 ? 108.815 177.075 111.641 1.00 472.61 ? 589  PRO A O   1 
ATOM   4336  C CB  . PRO A 1 589 ? 109.107 175.416 114.249 1.00 476.00 ? 589  PRO A CB  1 
ATOM   4337  C CG  . PRO A 1 589 ? 110.167 174.421 114.568 1.00 474.30 ? 589  PRO A CG  1 
ATOM   4338  C CD  . PRO A 1 589 ? 109.961 173.203 113.715 1.00 473.41 ? 589  PRO A CD  1 
ATOM   4339  N N   . SER A 1 590 ? 110.144 175.370 110.988 1.00 480.14 ? 590  SER A N   1 
ATOM   4340  C CA  . SER A 1 590 ? 110.672 176.053 109.798 1.00 485.50 ? 590  SER A CA  1 
ATOM   4341  C C   . SER A 1 590 ? 109.609 176.244 108.710 1.00 487.18 ? 590  SER A C   1 
ATOM   4342  O O   . SER A 1 590 ? 109.647 177.232 107.973 1.00 483.86 ? 590  SER A O   1 
ATOM   4343  C CB  . SER A 1 590 ? 111.862 175.282 109.218 1.00 486.75 ? 590  SER A CB  1 
ATOM   4344  O OG  . SER A 1 590 ? 112.919 175.193 110.156 1.00 487.16 ? 590  SER A OG  1 
ATOM   4345  N N   . LYS A 1 591 ? 108.677 175.293 108.611 1.00 488.44 ? 591  LYS A N   1 
ATOM   4346  C CA  . LYS A 1 591 ? 107.537 175.397 107.690 1.00 493.68 ? 591  LYS A CA  1 
ATOM   4347  C C   . LYS A 1 591 ? 106.591 176.544 108.068 1.00 469.79 ? 591  LYS A C   1 
ATOM   4348  O O   . LYS A 1 591 ? 106.019 177.192 107.188 1.00 473.67 ? 591  LYS A O   1 
ATOM   4349  C CB  . LYS A 1 591 ? 106.761 174.074 107.643 1.00 500.00 ? 591  LYS A CB  1 
ATOM   4350  C CG  . LYS A 1 591 ? 105.740 173.987 106.515 1.00 500.00 ? 591  LYS A CG  1 
ATOM   4351  C CD  . LYS A 1 591 ? 105.144 172.591 106.384 1.00 500.00 ? 591  LYS A CD  1 
ATOM   4352  C CE  . LYS A 1 591 ? 104.168 172.257 107.507 1.00 500.00 ? 591  LYS A CE  1 
ATOM   4353  N NZ  . LYS A 1 591 ? 102.970 173.145 107.530 1.00 500.00 ? 591  LYS A NZ  1 
ATOM   4354  N N   . VAL A 1 592 ? 106.435 176.784 109.370 1.00 451.00 ? 592  VAL A N   1 
ATOM   4355  C CA  . VAL A 1 592 ? 105.618 177.891 109.880 1.00 457.10 ? 592  VAL A CA  1 
ATOM   4356  C C   . VAL A 1 592 ? 106.386 179.204 109.655 1.00 466.82 ? 592  VAL A C   1 
ATOM   4357  O O   . VAL A 1 592 ? 107.605 179.234 109.849 1.00 453.29 ? 592  VAL A O   1 
ATOM   4358  C CB  . VAL A 1 592 ? 105.292 177.707 111.387 1.00 457.13 ? 592  VAL A CB  1 
ATOM   4359  C CG1 . VAL A 1 592 ? 104.406 178.835 111.916 1.00 461.90 ? 592  VAL A CG1 1 
ATOM   4360  C CG2 . VAL A 1 592 ? 104.622 176.355 111.630 1.00 451.44 ? 592  VAL A CG2 1 
ATOM   4361  N N   . PRO A 1 593 ? 105.688 180.287 109.235 1.00 491.25 ? 593  PRO A N   1 
ATOM   4362  C CA  . PRO A 1 593 ? 106.385 181.572 109.039 1.00 500.00 ? 593  PRO A CA  1 
ATOM   4363  C C   . PRO A 1 593 ? 106.941 182.173 110.335 1.00 499.96 ? 593  PRO A C   1 
ATOM   4364  O O   . PRO A 1 593 ? 108.115 182.549 110.382 1.00 500.00 ? 593  PRO A O   1 
ATOM   4365  C CB  . PRO A 1 593 ? 105.310 182.483 108.422 1.00 500.00 ? 593  PRO A CB  1 
ATOM   4366  C CG  . PRO A 1 593 ? 104.007 181.815 108.685 1.00 500.00 ? 593  PRO A CG  1 
ATOM   4367  C CD  . PRO A 1 593 ? 104.289 180.348 108.768 1.00 500.00 ? 593  PRO A CD  1 
ATOM   4368  N N   . SER A 1 594 ? 106.103 182.249 111.367 1.00 481.33 ? 594  SER A N   1 
ATOM   4369  C CA  . SER A 1 594 ? 106.531 182.677 112.701 1.00 464.39 ? 594  SER A CA  1 
ATOM   4370  C C   . SER A 1 594 ? 107.214 181.514 113.429 1.00 451.86 ? 594  SER A C   1 
ATOM   4371  O O   . SER A 1 594 ? 107.266 180.396 112.907 1.00 460.69 ? 594  SER A O   1 
ATOM   4372  C CB  . SER A 1 594 ? 105.329 183.180 113.508 1.00 464.26 ? 594  SER A CB  1 
ATOM   4373  O OG  . SER A 1 594 ? 104.330 182.180 113.618 1.00 465.54 ? 594  SER A OG  1 
ATOM   4374  N N   . GLU A 1 595 ? 107.738 181.795 114.624 1.00 431.67 ? 595  GLU A N   1 
ATOM   4375  C CA  . GLU A 1 595 ? 108.363 180.790 115.502 1.00 417.24 ? 595  GLU A CA  1 
ATOM   4376  C C   . GLU A 1 595 ? 109.662 180.229 114.897 1.00 404.42 ? 595  GLU A C   1 
ATOM   4377  O O   . GLU A 1 595 ? 109.651 179.212 114.197 1.00 409.75 ? 595  GLU A O   1 
ATOM   4378  C CB  . GLU A 1 595 ? 107.373 179.659 115.859 1.00 418.45 ? 595  GLU A CB  1 
ATOM   4379  C CG  . GLU A 1 595 ? 106.006 180.123 116.354 1.00 431.37 ? 595  GLU A CG  1 
ATOM   4380  C CD  . GLU A 1 595 ? 106.072 180.976 117.611 1.00 441.90 ? 595  GLU A CD  1 
ATOM   4381  O OE1 . GLU A 1 595 ? 106.782 180.590 118.564 1.00 448.56 ? 595  GLU A OE1 1 
ATOM   4382  O OE2 . GLU A 1 595 ? 105.404 182.031 117.649 1.00 444.30 ? 595  GLU A OE2 1 
ATOM   4383  N N   . ASN A 1 596 ? 110.778 180.898 115.193 1.00 377.59 ? 596  ASN A N   1 
ATOM   4384  C CA  . ASN A 1 596 ? 112.078 180.580 114.589 1.00 362.31 ? 596  ASN A CA  1 
ATOM   4385  C C   . ASN A 1 596 ? 112.706 179.324 115.187 1.00 328.65 ? 596  ASN A C   1 
ATOM   4386  O O   . ASN A 1 596 ? 113.022 179.296 116.374 1.00 354.15 ? 596  ASN A O   1 
ATOM   4387  C CB  . ASN A 1 596 ? 113.040 181.769 114.744 1.00 367.70 ? 596  ASN A CB  1 
ATOM   4388  C CG  . ASN A 1 596 ? 114.245 181.688 113.815 1.00 381.84 ? 596  ASN A CG  1 
ATOM   4389  O OD1 . ASN A 1 596 ? 114.698 180.604 113.438 1.00 377.33 ? 596  ASN A OD1 1 
ATOM   4390  N ND2 . ASN A 1 596 ? 114.774 182.849 113.442 1.00 384.34 ? 596  ASN A ND2 1 
ATOM   4391  N N   . LYS A 1 597 ? 112.911 178.306 114.349 1.00 341.28 ? 597  LYS A N   1 
ATOM   4392  C CA  . LYS A 1 597 ? 113.546 177.041 114.763 1.00 362.78 ? 597  LYS A CA  1 
ATOM   4393  C C   . LYS A 1 597 ? 114.989 177.228 115.244 1.00 366.49 ? 597  LYS A C   1 
ATOM   4394  O O   . LYS A 1 597 ? 115.475 176.458 116.076 1.00 352.83 ? 597  LYS A O   1 
ATOM   4395  C CB  . LYS A 1 597 ? 113.530 176.030 113.606 1.00 381.71 ? 597  LYS A CB  1 
ATOM   4396  C CG  . LYS A 1 597 ? 113.930 174.612 113.993 1.00 406.80 ? 597  LYS A CG  1 
ATOM   4397  C CD  . LYS A 1 597 ? 113.844 173.666 112.806 1.00 432.29 ? 597  LYS A CD  1 
ATOM   4398  C CE  . LYS A 1 597 ? 114.237 172.246 113.189 1.00 455.04 ? 597  LYS A CE  1 
ATOM   4399  N NZ  . LYS A 1 597 ? 115.659 172.132 113.623 1.00 456.68 ? 597  LYS A NZ  1 
ATOM   4400  N N   . ASP A 1 598 ? 115.664 178.241 114.707 1.00 377.18 ? 598  ASP A N   1 
ATOM   4401  C CA  . ASP A 1 598 ? 117.052 178.529 115.050 1.00 383.04 ? 598  ASP A CA  1 
ATOM   4402  C C   . ASP A 1 598 ? 117.180 179.096 116.469 1.00 359.31 ? 598  ASP A C   1 
ATOM   4403  O O   . ASP A 1 598 ? 118.027 178.647 117.242 1.00 361.05 ? 598  ASP A O   1 
ATOM   4404  C CB  . ASP A 1 598 ? 117.645 179.510 114.023 1.00 420.97 ? 598  ASP A CB  1 
ATOM   4405  C CG  . ASP A 1 598 ? 119.165 179.465 113.954 1.00 448.04 ? 598  ASP A CG  1 
ATOM   4406  O OD1 . ASP A 1 598 ? 119.788 178.519 114.485 1.00 457.83 ? 598  ASP A OD1 1 
ATOM   4407  O OD2 . ASP A 1 598 ? 119.744 180.388 113.342 1.00 461.15 ? 598  ASP A OD2 1 
ATOM   4408  N N   . LEU A 1 599 ? 116.325 180.063 116.806 1.00 346.68 ? 599  LEU A N   1 
ATOM   4409  C CA  . LEU A 1 599 ? 116.406 180.779 118.094 1.00 334.57 ? 599  LEU A CA  1 
ATOM   4410  C C   . LEU A 1 599 ? 115.934 179.992 119.316 1.00 323.47 ? 599  LEU A C   1 
ATOM   4411  O O   . LEU A 1 599 ? 116.403 180.260 120.422 1.00 349.44 ? 599  LEU A O   1 
ATOM   4412  C CB  . LEU A 1 599 ? 115.639 182.111 118.038 1.00 346.05 ? 599  LEU A CB  1 
ATOM   4413  C CG  . LEU A 1 599 ? 116.407 183.317 117.487 1.00 381.93 ? 599  LEU A CG  1 
ATOM   4414  C CD1 . LEU A 1 599 ? 117.067 183.019 116.145 1.00 388.73 ? 599  LEU A CD1 1 
ATOM   4415  C CD2 . LEU A 1 599 ? 115.473 184.515 117.378 1.00 396.28 ? 599  LEU A CD2 1 
ATOM   4416  N N   . TYR A 1 600 ? 115.016 179.043 119.127 1.00 321.76 ? 600  TYR A N   1 
ATOM   4417  C CA  . TYR A 1 600 ? 114.430 178.273 120.238 1.00 324.50 ? 600  TYR A CA  1 
ATOM   4418  C C   . TYR A 1 600 ? 114.501 176.761 119.992 1.00 333.27 ? 600  TYR A C   1 
ATOM   4419  O O   . TYR A 1 600 ? 115.066 176.312 118.993 1.00 342.63 ? 600  TYR A O   1 
ATOM   4420  C CB  . TYR A 1 600 ? 112.973 178.696 120.451 1.00 307.98 ? 600  TYR A CB  1 
ATOM   4421  C CG  . TYR A 1 600 ? 112.771 180.186 120.604 1.00 324.18 ? 600  TYR A CG  1 
ATOM   4422  C CD1 . TYR A 1 600 ? 112.580 180.998 119.489 1.00 343.35 ? 600  TYR A CD1 1 
ATOM   4423  C CD2 . TYR A 1 600 ? 112.762 180.785 121.863 1.00 348.95 ? 600  TYR A CD2 1 
ATOM   4424  C CE1 . TYR A 1 600 ? 112.386 182.365 119.616 1.00 354.87 ? 600  TYR A CE1 1 
ATOM   4425  C CE2 . TYR A 1 600 ? 112.569 182.155 122.002 1.00 368.35 ? 600  TYR A CE2 1 
ATOM   4426  C CZ  . TYR A 1 600 ? 112.379 182.942 120.870 1.00 365.64 ? 600  TYR A CZ  1 
ATOM   4427  O OH  . TYR A 1 600 ? 112.186 184.301 120.986 1.00 358.67 ? 600  TYR A OH  1 
ATOM   4428  N N   . GLU A 1 601 ? 113.958 175.991 120.936 1.00 338.65 ? 601  GLU A N   1 
ATOM   4429  C CA  . GLU A 1 601 ? 113.704 174.560 120.768 1.00 355.70 ? 601  GLU A CA  1 
ATOM   4430  C C   . GLU A 1 601 ? 112.242 174.300 121.093 1.00 342.43 ? 601  GLU A C   1 
ATOM   4431  O O   . GLU A 1 601 ? 111.824 174.527 122.227 1.00 342.94 ? 601  GLU A O   1 
ATOM   4432  C CB  . GLU A 1 601 ? 114.585 173.726 121.707 1.00 390.80 ? 601  GLU A CB  1 
ATOM   4433  C CG  . GLU A 1 601 ? 115.811 173.105 121.049 1.00 415.82 ? 601  GLU A CG  1 
ATOM   4434  C CD  . GLU A 1 601 ? 116.428 171.976 121.867 1.00 428.72 ? 601  GLU A CD  1 
ATOM   4435  O OE1 . GLU A 1 601 ? 116.090 171.824 123.062 1.00 423.18 ? 601  GLU A OE1 1 
ATOM   4436  O OE2 . GLU A 1 601 ? 117.265 171.234 121.309 1.00 443.34 ? 601  GLU A OE2 1 
ATOM   4437  N N   . TYR A 1 602 ? 111.480 173.818 120.108 1.00 340.01 ? 602  TYR A N   1 
ATOM   4438  C CA  . TYR A 1 602 ? 110.042 173.564 120.269 1.00 329.65 ? 602  TYR A CA  1 
ATOM   4439  C C   . TYR A 1 602 ? 109.804 172.087 120.538 1.00 338.70 ? 602  TYR A C   1 
ATOM   4440  O O   . TYR A 1 602 ? 109.721 171.276 119.610 1.00 332.92 ? 602  TYR A O   1 
ATOM   4441  C CB  . TYR A 1 602 ? 109.269 174.007 119.032 1.00 323.35 ? 602  TYR A CB  1 
ATOM   4442  C CG  . TYR A 1 602 ? 109.471 175.460 118.706 1.00 336.01 ? 602  TYR A CG  1 
ATOM   4443  C CD1 . TYR A 1 602 ? 110.572 175.876 117.953 1.00 332.20 ? 602  TYR A CD1 1 
ATOM   4444  C CD2 . TYR A 1 602 ? 108.574 176.426 119.154 1.00 326.35 ? 602  TYR A CD2 1 
ATOM   4445  C CE1 . TYR A 1 602 ? 110.771 177.209 117.651 1.00 327.69 ? 602  TYR A CE1 1 
ATOM   4446  C CE2 . TYR A 1 602 ? 108.763 177.765 118.854 1.00 347.95 ? 602  TYR A CE2 1 
ATOM   4447  C CZ  . TYR A 1 602 ? 109.867 178.152 118.105 1.00 353.85 ? 602  TYR A CZ  1 
ATOM   4448  O OH  . TYR A 1 602 ? 110.059 179.480 117.814 1.00 375.50 ? 602  TYR A OH  1 
ATOM   4449  N N   . SER A 1 603 ? 109.714 171.752 121.821 1.00 343.73 ? 603  SER A N   1 
ATOM   4450  C CA  . SER A 1 603 ? 109.480 170.389 122.267 1.00 335.19 ? 603  SER A CA  1 
ATOM   4451  C C   . SER A 1 603 ? 107.992 170.180 122.508 1.00 321.87 ? 603  SER A C   1 
ATOM   4452  O O   . SER A 1 603 ? 107.328 171.050 123.111 1.00 305.68 ? 603  SER A O   1 
ATOM   4453  C CB  . SER A 1 603 ? 110.256 170.124 123.551 1.00 373.76 ? 603  SER A CB  1 
ATOM   4454  O OG  . SER A 1 603 ? 109.904 171.052 124.566 1.00 387.48 ? 603  SER A OG  1 
ATOM   4455  N N   . TRP A 1 604 ? 107.473 169.073 121.981 1.00 321.60 ? 604  TRP A N   1 
ATOM   4456  C CA  . TRP A 1 604 ? 106.078 168.697 122.153 1.00 347.45 ? 604  TRP A CA  1 
ATOM   4457  C C   . TRP A 1 604 ? 105.937 167.914 123.447 1.00 316.93 ? 604  TRP A C   1 
ATOM   4458  O O   . TRP A 1 604 ? 105.850 166.686 123.444 1.00 313.31 ? 604  TRP A O   1 
ATOM   4459  C CB  . TRP A 1 604 ? 105.597 167.856 120.970 1.00 362.30 ? 604  TRP A CB  1 
ATOM   4460  C CG  . TRP A 1 604 ? 104.180 168.136 120.571 1.00 364.46 ? 604  TRP A CG  1 
ATOM   4461  C CD1 . TRP A 1 604 ? 103.689 169.300 120.055 1.00 354.57 ? 604  TRP A CD1 1 
ATOM   4462  C CD2 . TRP A 1 604 ? 103.070 167.235 120.655 1.00 358.13 ? 604  TRP A CD2 1 
ATOM   4463  N NE1 . TRP A 1 604 ? 102.342 169.179 119.812 1.00 350.98 ? 604  TRP A NE1 1 
ATOM   4464  C CE2 . TRP A 1 604 ? 101.938 167.921 120.172 1.00 372.68 ? 604  TRP A CE2 1 
ATOM   4465  C CE3 . TRP A 1 604 ? 102.923 165.914 121.092 1.00 374.65 ? 604  TRP A CE3 1 
ATOM   4466  C CZ2 . TRP A 1 604 ? 100.676 167.332 120.114 1.00 396.18 ? 604  TRP A CZ2 1 
ATOM   4467  C CZ3 . TRP A 1 604 ? 101.670 165.331 121.033 1.00 393.34 ? 604  TRP A CZ3 1 
ATOM   4468  C CH2 . TRP A 1 604 ? 100.564 166.039 120.548 1.00 394.47 ? 604  TRP A CH2 1 
ATOM   4469  N N   . VAL A 1 605 ? 105.891 168.638 124.555 1.00 314.79 ? 605  VAL A N   1 
ATOM   4470  C CA  . VAL A 1 605 ? 105.769 168.052 125.882 1.00 328.41 ? 605  VAL A CA  1 
ATOM   4471  C C   . VAL A 1 605 ? 104.390 167.502 126.185 1.00 331.84 ? 605  VAL A C   1 
ATOM   4472  O O   . VAL A 1 605 ? 103.406 167.944 125.617 1.00 370.58 ? 605  VAL A O   1 
ATOM   4473  C CB  . VAL A 1 605 ? 106.094 169.080 126.966 1.00 347.68 ? 605  VAL A CB  1 
ATOM   4474  C CG1 . VAL A 1 605 ? 105.971 170.482 126.401 1.00 349.14 ? 605  VAL A CG1 1 
ATOM   4475  C CG2 . VAL A 1 605 ? 105.175 168.894 128.159 1.00 348.46 ? 605  VAL A CG2 1 
ATOM   4476  N N   . GLN A 1 606 ? 104.338 166.571 127.125 1.00 305.47 ? 606  GLN A N   1 
ATOM   4477  C CA  . GLN A 1 606 ? 103.104 165.961 127.581 1.00 322.72 ? 606  GLN A CA  1 
ATOM   4478  C C   . GLN A 1 606 ? 102.343 166.905 128.486 1.00 347.21 ? 606  GLN A C   1 
ATOM   4479  O O   . GLN A 1 606 ? 102.832 167.968 128.835 1.00 383.00 ? 606  GLN A O   1 
ATOM   4480  C CB  . GLN A 1 606 ? 103.398 164.680 128.336 1.00 357.98 ? 606  GLN A CB  1 
ATOM   4481  C CG  . GLN A 1 606 ? 103.693 163.504 127.440 1.00 379.63 ? 606  GLN A CG  1 
ATOM   4482  C CD  . GLN A 1 606 ? 103.699 162.212 128.208 1.00 351.49 ? 606  GLN A CD  1 
ATOM   4483  O OE1 . GLN A 1 606 ? 103.722 162.216 129.434 1.00 355.41 ? 606  GLN A OE1 1 
ATOM   4484  N NE2 . GLN A 1 606 ? 103.673 161.095 127.493 1.00 317.26 ? 606  GLN A NE2 1 
ATOM   4485  N N   . GLY A 1 607 ? 101.124 166.531 128.834 1.00 356.96 ? 607  GLY A N   1 
ATOM   4486  C CA  . GLY A 1 607 ? 100.250 167.403 129.594 1.00 352.02 ? 607  GLY A CA  1 
ATOM   4487  C C   . GLY A 1 607 ? 99.753  166.839 130.909 1.00 346.28 ? 607  GLY A C   1 
ATOM   4488  O O   . GLY A 1 607 ? 99.772  165.628 131.132 1.00 310.31 ? 607  GLY A O   1 
ATOM   4489  N N   . PRO A 1 608 ? 99.307  167.805 131.825 1.00 342.74 ? 608  PRO A N   1 
ATOM   4490  C CA  . PRO A 1 608 ? 98.832  167.224 133.095 1.00 349.54 ? 608  PRO A CA  1 
ATOM   4491  C C   . PRO A 1 608 ? 97.580  166.391 132.874 1.00 370.54 ? 608  PRO A C   1 
ATOM   4492  O O   . PRO A 1 608 ? 96.772  166.751 132.030 1.00 402.27 ? 608  PRO A O   1 
ATOM   4493  C CB  . PRO A 1 608 ? 98.486  168.446 133.942 1.00 365.10 ? 608  PRO A CB  1 
ATOM   4494  C CG  . PRO A 1 608 ? 98.027  169.450 132.960 1.00 363.31 ? 608  PRO A CG  1 
ATOM   4495  C CD  . PRO A 1 608 ? 99.087  169.334 131.923 1.00 355.15 ? 608  PRO A CD  1 
ATOM   4496  N N   . LEU A 1 609 ? 97.412  165.296 133.606 1.00 376.42 ? 609  LEU A N   1 
ATOM   4497  C CA  . LEU A 1 609 ? 96.257  164.456 133.377 1.00 375.69 ? 609  LEU A CA  1 
ATOM   4498  C C   . LEU A 1 609 ? 95.024  165.333 133.486 1.00 404.57 ? 609  LEU A C   1 
ATOM   4499  O O   . LEU A 1 609 ? 94.885  166.112 134.429 1.00 400.25 ? 609  LEU A O   1 
ATOM   4500  C CB  . LEU A 1 609 ? 96.198  163.327 134.405 1.00 378.60 ? 609  LEU A CB  1 
ATOM   4501  C CG  . LEU A 1 609 ? 96.626  161.941 133.917 1.00 379.59 ? 609  LEU A CG  1 
ATOM   4502  C CD1 . LEU A 1 609 ? 97.544  161.274 134.929 1.00 383.58 ? 609  LEU A CD1 1 
ATOM   4503  C CD2 . LEU A 1 609 ? 95.411  161.071 133.634 1.00 367.65 ? 609  LEU A CD2 1 
ATOM   4504  N N   . HIS A 1 610 ? 94.123  165.195 132.522 1.00 439.58 ? 610  HIS A N   1 
ATOM   4505  C CA  . HIS A 1 610 ? 92.845  165.890 132.581 1.00 466.83 ? 610  HIS A CA  1 
ATOM   4506  C C   . HIS A 1 610 ? 91.902  165.213 133.566 1.00 478.15 ? 610  HIS A C   1 
ATOM   4507  O O   . HIS A 1 610 ? 91.966  163.999 133.761 1.00 469.26 ? 610  HIS A O   1 
ATOM   4508  C CB  . HIS A 1 610 ? 92.207  166.021 131.200 1.00 471.46 ? 610  HIS A CB  1 
ATOM   4509  C CG  . HIS A 1 610 ? 91.460  167.303 131.011 1.00 479.22 ? 610  HIS A CG  1 
ATOM   4510  N ND1 . HIS A 1 610 ? 90.524  167.484 130.016 1.00 488.23 ? 610  HIS A ND1 1 
ATOM   4511  C CD2 . HIS A 1 610 ? 91.504  168.466 131.702 1.00 475.54 ? 610  HIS A CD2 1 
ATOM   4512  C CE1 . HIS A 1 610 ? 90.027  168.705 130.100 1.00 486.02 ? 610  HIS A CE1 1 
ATOM   4513  N NE2 . HIS A 1 610 ? 90.605  169.322 131.115 1.00 476.18 ? 610  HIS A NE2 1 
ATOM   4514  N N   . SER A 1 611 ? 91.028  165.996 134.187 1.00 499.64 ? 611  SER A N   1 
ATOM   4515  C CA  . SER A 1 611 ? 90.121  165.451 135.203 1.00 500.00 ? 611  SER A CA  1 
ATOM   4516  C C   . SER A 1 611 ? 89.235  164.322 134.668 1.00 500.00 ? 611  SER A C   1 
ATOM   4517  O O   . SER A 1 611 ? 89.081  164.159 133.454 1.00 494.72 ? 611  SER A O   1 
ATOM   4518  C CB  . SER A 1 611 ? 89.243  166.566 135.783 1.00 500.00 ? 611  SER A CB  1 
ATOM   4519  O OG  . SER A 1 611 ? 88.515  166.114 136.912 1.00 500.00 ? 611  SER A OG  1 
ATOM   4520  N N   . ASN A 1 612 ? 88.661  163.559 135.600 1.00 500.00 ? 612  ASN A N   1 
ATOM   4521  C CA  . ASN A 1 612 ? 87.801  162.397 135.315 1.00 500.00 ? 612  ASN A CA  1 
ATOM   4522  C C   . ASN A 1 612 ? 88.496  161.283 134.515 1.00 500.00 ? 612  ASN A C   1 
ATOM   4523  O O   . ASN A 1 612 ? 88.882  160.262 135.090 1.00 500.00 ? 612  ASN A O   1 
ATOM   4524  C CB  . ASN A 1 612 ? 86.477  162.822 134.649 1.00 500.00 ? 612  ASN A CB  1 
ATOM   4525  C CG  . ASN A 1 612 ? 85.625  163.708 135.543 1.00 500.00 ? 612  ASN A CG  1 
ATOM   4526  O OD1 . ASN A 1 612 ? 85.226  164.804 135.147 1.00 500.00 ? 612  ASN A OD1 1 
ATOM   4527  N ND2 . ASN A 1 612 ? 85.338  163.237 136.753 1.00 500.00 ? 612  ASN A ND2 1 
ATOM   4528  N N   . GLU A 1 613 ? 88.659  161.485 133.205 1.00 500.00 ? 613  GLU A N   1 
ATOM   4529  C CA  . GLU A 1 613 ? 89.293  160.494 132.329 1.00 489.38 ? 613  GLU A CA  1 
ATOM   4530  C C   . GLU A 1 613 ? 90.811  160.655 132.347 1.00 472.68 ? 613  GLU A C   1 
ATOM   4531  O O   . GLU A 1 613 ? 91.323  161.768 132.500 1.00 466.23 ? 613  GLU A O   1 
ATOM   4532  C CB  . GLU A 1 613 ? 88.777  160.628 130.892 1.00 494.31 ? 613  GLU A CB  1 
ATOM   4533  C CG  . GLU A 1 613 ? 87.287  160.352 130.736 1.00 500.00 ? 613  GLU A CG  1 
ATOM   4534  C CD  . GLU A 1 613 ? 86.787  160.555 129.315 1.00 500.00 ? 613  GLU A CD  1 
ATOM   4535  O OE1 . GLU A 1 613 ? 87.501  160.179 128.360 1.00 500.00 ? 613  GLU A OE1 1 
ATOM   4536  O OE2 . GLU A 1 613 ? 85.668  161.086 129.151 1.00 500.00 ? 613  GLU A OE2 1 
ATOM   4537  N N   . THR A 1 614 ? 91.520  159.540 132.180 1.00 463.48 ? 614  THR A N   1 
ATOM   4538  C CA  . THR A 1 614 ? 92.984  159.533 132.153 1.00 456.34 ? 614  THR A CA  1 
ATOM   4539  C C   . THR A 1 614 ? 93.496  159.945 130.771 1.00 454.56 ? 614  THR A C   1 
ATOM   4540  O O   . THR A 1 614 ? 93.902  159.101 129.966 1.00 454.24 ? 614  THR A O   1 
ATOM   4541  C CB  . THR A 1 614 ? 93.547  158.149 132.534 1.00 453.10 ? 614  THR A CB  1 
ATOM   4542  O OG1 . THR A 1 614 ? 92.995  157.147 131.669 1.00 459.03 ? 614  THR A OG1 1 
ATOM   4543  C CG2 . THR A 1 614 ? 93.206  157.814 133.979 1.00 447.08 ? 614  THR A CG2 1 
ATOM   4544  N N   . ASP A 1 615 ? 93.460  161.252 130.514 1.00 463.18 ? 615  ASP A N   1 
ATOM   4545  C CA  . ASP A 1 615 ? 93.923  161.842 129.255 1.00 471.30 ? 615  ASP A CA  1 
ATOM   4546  C C   . ASP A 1 615 ? 94.764  163.083 129.545 1.00 459.88 ? 615  ASP A C   1 
ATOM   4547  O O   . ASP A 1 615 ? 94.473  163.831 130.482 1.00 468.58 ? 615  ASP A O   1 
ATOM   4548  C CB  . ASP A 1 615 ? 92.732  162.236 128.374 1.00 491.55 ? 615  ASP A CB  1 
ATOM   4549  C CG  . ASP A 1 615 ? 91.915  161.039 127.912 1.00 500.00 ? 615  ASP A CG  1 
ATOM   4550  O OD1 . ASP A 1 615 ? 92.512  160.038 127.460 1.00 500.00 ? 615  ASP A OD1 1 
ATOM   4551  O OD2 . ASP A 1 615 ? 90.669  161.107 127.988 1.00 500.00 ? 615  ASP A OD2 1 
ATOM   4552  N N   . ARG A 1 616 ? 95.799  163.293 128.733 1.00 445.27 ? 616  ARG A N   1 
ATOM   4553  C CA  . ARG A 1 616 ? 96.700  164.437 128.873 1.00 438.93 ? 616  ARG A CA  1 
ATOM   4554  C C   . ARG A 1 616 ? 96.444  165.478 127.788 1.00 427.90 ? 616  ARG A C   1 
ATOM   4555  O O   . ARG A 1 616 ? 95.824  165.183 126.762 1.00 429.01 ? 616  ARG A O   1 
ATOM   4556  C CB  . ARG A 1 616 ? 98.154  163.970 128.816 1.00 436.29 ? 616  ARG A CB  1 
ATOM   4557  C CG  . ARG A 1 616 ? 98.541  163.062 129.970 1.00 415.79 ? 616  ARG A CG  1 
ATOM   4558  C CD  . ARG A 1 616 ? 100.015 162.703 129.936 1.00 395.63 ? 616  ARG A CD  1 
ATOM   4559  N NE  . ARG A 1 616 ? 100.375 161.792 131.023 1.00 395.38 ? 616  ARG A NE  1 
ATOM   4560  C CZ  . ARG A 1 616 ? 100.553 162.137 132.302 1.00 392.02 ? 616  ARG A CZ  1 
ATOM   4561  N NH1 . ARG A 1 616 ? 100.411 163.399 132.714 1.00 375.21 ? 616  ARG A NH1 1 
ATOM   4562  N NH2 . ARG A 1 616 ? 100.876 161.199 133.190 1.00 401.08 ? 616  ARG A NH2 1 
ATOM   4563  N N   . LEU A 1 617 ? 96.928  166.693 128.039 1.00 408.12 ? 617  LEU A N   1 
ATOM   4564  C CA  . LEU A 1 617 ? 96.818  167.811 127.104 1.00 410.63 ? 617  LEU A CA  1 
ATOM   4565  C C   . LEU A 1 617 ? 98.208  168.164 126.571 1.00 377.89 ? 617  LEU A C   1 
ATOM   4566  O O   . LEU A 1 617 ? 98.857  169.072 127.096 1.00 395.65 ? 617  LEU A O   1 
ATOM   4567  C CB  . LEU A 1 617 ? 96.198  169.026 127.805 1.00 435.99 ? 617  LEU A CB  1 
ATOM   4568  C CG  . LEU A 1 617 ? 94.727  168.926 128.217 1.00 456.21 ? 617  LEU A CG  1 
ATOM   4569  C CD1 . LEU A 1 617 ? 94.381  170.052 129.184 1.00 460.93 ? 617  LEU A CD1 1 
ATOM   4570  C CD2 . LEU A 1 617 ? 93.813  168.954 126.998 1.00 462.50 ? 617  LEU A CD2 1 
ATOM   4571  N N   . PRO A 1 618 ? 98.678  167.443 125.532 1.00 365.94 ? 618  PRO A N   1 
ATOM   4572  C CA  . PRO A 1 618 ? 100.012 167.738 125.004 1.00 368.16 ? 618  PRO A CA  1 
ATOM   4573  C C   . PRO A 1 618 ? 100.109 169.119 124.348 1.00 356.51 ? 618  PRO A C   1 
ATOM   4574  O O   . PRO A 1 618 ? 99.153  169.577 123.716 1.00 365.42 ? 618  PRO A O   1 
ATOM   4575  C CB  . PRO A 1 618 ? 100.249 166.620 123.988 1.00 373.07 ? 618  PRO A CB  1 
ATOM   4576  C CG  . PRO A 1 618 ? 98.889  166.190 123.576 1.00 393.56 ? 618  PRO A CG  1 
ATOM   4577  C CD  . PRO A 1 618 ? 98.048  166.321 124.812 1.00 383.97 ? 618  PRO A CD  1 
ATOM   4578  N N   . ARG A 1 619 ? 101.270 169.751 124.510 1.00 348.65 ? 619  ARG A N   1 
ATOM   4579  C CA  . ARG A 1 619 ? 101.474 171.171 124.203 1.00 345.59 ? 619  ARG A CA  1 
ATOM   4580  C C   . ARG A 1 619 ? 102.923 171.430 123.819 1.00 314.33 ? 619  ARG A C   1 
ATOM   4581  O O   . ARG A 1 619 ? 103.815 170.729 124.288 1.00 297.24 ? 619  ARG A O   1 
ATOM   4582  C CB  . ARG A 1 619 ? 101.102 172.024 125.420 1.00 343.57 ? 619  ARG A CB  1 
ATOM   4583  C CG  . ARG A 1 619 ? 101.699 171.542 126.739 1.00 352.65 ? 619  ARG A CG  1 
ATOM   4584  C CD  . ARG A 1 619 ? 101.261 172.408 127.908 1.00 375.57 ? 619  ARG A CD  1 
ATOM   4585  N NE  . ARG A 1 619 ? 99.814  172.353 128.127 1.00 397.04 ? 619  ARG A NE  1 
ATOM   4586  C CZ  . ARG A 1 619 ? 99.137  173.112 128.993 1.00 430.23 ? 619  ARG A CZ  1 
ATOM   4587  N NH1 . ARG A 1 619 ? 99.757  174.015 129.755 1.00 434.29 ? 619  ARG A NH1 1 
ATOM   4588  N NH2 . ARG A 1 619 ? 97.817  172.968 129.099 1.00 434.39 ? 619  ARG A NH2 1 
ATOM   4589  N N   . CYS A 1 620 ? 103.159 172.436 122.989 1.00 324.76 ? 620  CYS A N   1 
ATOM   4590  C CA  . CYS A 1 620 ? 104.509 172.719 122.526 1.00 347.93 ? 620  CYS A CA  1 
ATOM   4591  C C   . CYS A 1 620 ? 105.091 173.891 123.279 1.00 361.99 ? 620  CYS A C   1 
ATOM   4592  O O   . CYS A 1 620 ? 104.501 174.966 123.317 1.00 365.88 ? 620  CYS A O   1 
ATOM   4593  C CB  . CYS A 1 620 ? 104.510 173.042 121.039 1.00 353.59 ? 620  CYS A CB  1 
ATOM   4594  S SG  . CYS A 1 620 ? 104.940 171.650 119.978 1.00 389.77 ? 620  CYS A SG  1 
ATOM   4595  N N   . VAL A 1 621 ? 106.266 173.687 123.862 1.00 353.02 ? 621  VAL A N   1 
ATOM   4596  C CA  . VAL A 1 621 ? 106.892 174.715 124.669 1.00 334.90 ? 621  VAL A CA  1 
ATOM   4597  C C   . VAL A 1 621 ? 108.072 175.348 123.965 1.00 327.98 ? 621  VAL A C   1 
ATOM   4598  O O   . VAL A 1 621 ? 109.009 174.661 123.589 1.00 346.19 ? 621  VAL A O   1 
ATOM   4599  C CB  . VAL A 1 621 ? 107.422 174.117 125.967 1.00 333.12 ? 621  VAL A CB  1 
ATOM   4600  C CG1 . VAL A 1 621 ? 107.937 175.226 126.859 1.00 350.49 ? 621  VAL A CG1 1 
ATOM   4601  C CG2 . VAL A 1 621 ? 106.335 173.320 126.657 1.00 306.10 ? 621  VAL A CG2 1 
ATOM   4602  N N   . ARG A 1 622 ? 108.049 176.664 123.810 1.00 315.51 ? 622  ARG A N   1 
ATOM   4603  C CA  . ARG A 1 622 ? 109.165 177.334 123.178 1.00 337.62 ? 622  ARG A CA  1 
ATOM   4604  C C   . ARG A 1 622 ? 110.049 177.775 124.300 1.00 349.35 ? 622  ARG A C   1 
ATOM   4605  O O   . ARG A 1 622 ? 109.646 178.567 125.136 1.00 365.06 ? 622  ARG A O   1 
ATOM   4606  C CB  . ARG A 1 622 ? 108.706 178.557 122.399 1.00 359.20 ? 622  ARG A CB  1 
ATOM   4607  C CG  . ARG A 1 622 ? 109.831 179.520 122.052 1.00 367.11 ? 622  ARG A CG  1 
ATOM   4608  C CD  . ARG A 1 622 ? 109.419 180.508 120.973 1.00 358.42 ? 622  ARG A CD  1 
ATOM   4609  N NE  . ARG A 1 622 ? 108.375 181.413 121.433 1.00 378.34 ? 622  ARG A NE  1 
ATOM   4610  C CZ  . ARG A 1 622 ? 108.378 182.015 122.616 1.00 391.62 ? 622  ARG A CZ  1 
ATOM   4611  N NH1 . ARG A 1 622 ? 109.375 181.812 123.461 1.00 402.12 ? 622  ARG A NH1 1 
ATOM   4612  N NH2 . ARG A 1 622 ? 107.388 182.823 122.955 1.00 396.69 ? 622  ARG A NH2 1 
ATOM   4613  N N   . SER A 1 623 ? 111.265 177.258 124.307 1.00 338.72 ? 623  SER A N   1 
ATOM   4614  C CA  . SER A 1 623 ? 112.185 177.456 125.402 1.00 317.73 ? 623  SER A CA  1 
ATOM   4615  C C   . SER A 1 623 ? 113.556 177.293 124.827 1.00 300.65 ? 623  SER A C   1 
ATOM   4616  O O   . SER A 1 623 ? 113.704 176.776 123.734 1.00 321.77 ? 623  SER A O   1 
ATOM   4617  C CB  . SER A 1 623 ? 111.965 176.392 126.457 1.00 308.75 ? 623  SER A CB  1 
ATOM   4618  O OG  . SER A 1 623 ? 112.014 175.108 125.874 1.00 311.64 ? 623  SER A OG  1 
ATOM   4619  N N   . THR A 1 624 ? 114.563 177.723 125.562 1.00 299.68 ? 624  THR A N   1 
ATOM   4620  C CA  . THR A 1 624 ? 115.923 177.645 125.075 1.00 312.88 ? 624  THR A CA  1 
ATOM   4621  C C   . THR A 1 624 ? 116.677 176.471 125.670 1.00 290.62 ? 624  THR A C   1 
ATOM   4622  O O   . THR A 1 624 ? 117.891 176.445 125.653 1.00 280.59 ? 624  THR A O   1 
ATOM   4623  C CB  . THR A 1 624 ? 116.686 178.937 125.344 1.00 315.71 ? 624  THR A CB  1 
ATOM   4624  O OG1 . THR A 1 624 ? 115.756 180.017 125.421 1.00 306.44 ? 624  THR A OG1 1 
ATOM   4625  C CG2 . THR A 1 624 ? 117.654 179.205 124.224 1.00 343.47 ? 624  THR A CG2 1 
ATOM   4626  N N   . ALA A 1 625 ? 115.960 175.496 126.199 1.00 282.45 ? 625  ALA A N   1 
ATOM   4627  C CA  . ALA A 1 625 ? 116.599 174.454 126.976 1.00 292.11 ? 625  ALA A CA  1 
ATOM   4628  C C   . ALA A 1 625 ? 117.225 173.403 126.095 1.00 265.77 ? 625  ALA A C   1 
ATOM   4629  O O   . ALA A 1 625 ? 116.675 172.335 125.903 1.00 274.38 ? 625  ALA A O   1 
ATOM   4630  C CB  . ALA A 1 625 ? 115.586 173.807 127.892 1.00 304.40 ? 625  ALA A CB  1 
ATOM   4631  N N   . ARG A 1 626 ? 118.405 173.704 125.585 1.00 254.29 ? 626  ARG A N   1 
ATOM   4632  C CA  . ARG A 1 626 ? 119.122 172.780 124.691 1.00 294.51 ? 626  ARG A CA  1 
ATOM   4633  C C   . ARG A 1 626 ? 120.081 171.849 125.446 1.00 282.11 ? 626  ARG A C   1 
ATOM   4634  O O   . ARG A 1 626 ? 120.144 171.891 126.676 1.00 300.49 ? 626  ARG A O   1 
ATOM   4635  C CB  . ARG A 1 626 ? 119.857 173.579 123.606 1.00 312.01 ? 626  ARG A CB  1 
ATOM   4636  C CG  . ARG A 1 626 ? 118.947 174.554 122.863 1.00 323.88 ? 626  ARG A CG  1 
ATOM   4637  C CD  . ARG A 1 626 ? 119.694 175.519 121.963 1.00 326.65 ? 626  ARG A CD  1 
ATOM   4638  N NE  . ARG A 1 626 ? 118.942 176.768 121.817 1.00 335.19 ? 626  ARG A NE  1 
ATOM   4639  C CZ  . ARG A 1 626 ? 119.447 177.938 121.419 1.00 354.50 ? 626  ARG A CZ  1 
ATOM   4640  N NH1 . ARG A 1 626 ? 120.735 178.073 121.096 1.00 358.46 ? 626  ARG A NH1 1 
ATOM   4641  N NH2 . ARG A 1 626 ? 118.645 178.998 121.334 1.00 364.43 ? 626  ARG A NH2 1 
ATOM   4642  N N   . LEU A 1 627 ? 120.792 170.993 124.706 1.00 288.31 ? 627  LEU A N   1 
ATOM   4643  C CA  . LEU A 1 627 ? 121.855 170.132 125.256 1.00 287.70 ? 627  LEU A CA  1 
ATOM   4644  C C   . LEU A 1 627 ? 123.221 170.407 124.612 1.00 297.21 ? 627  LEU A C   1 
ATOM   4645  O O   . LEU A 1 627 ? 123.329 171.186 123.662 1.00 319.47 ? 627  LEU A O   1 
ATOM   4646  C CB  . LEU A 1 627 ? 121.500 168.664 125.046 1.00 281.54 ? 627  LEU A CB  1 
ATOM   4647  C CG  . LEU A 1 627 ? 120.265 168.115 125.750 1.00 285.10 ? 627  LEU A CG  1 
ATOM   4648  C CD1 . LEU A 1 627 ? 120.171 166.608 125.551 1.00 303.35 ? 627  LEU A CD1 1 
ATOM   4649  C CD2 . LEU A 1 627 ? 120.266 168.453 127.227 1.00 296.31 ? 627  LEU A CD2 1 
ATOM   4650  N N   . ALA A 1 628 ? 124.260 169.773 125.152 1.00 288.60 ? 628  ALA A N   1 
ATOM   4651  C CA  . ALA A 1 628 ? 125.608 169.865 124.584 1.00 289.63 ? 628  ALA A CA  1 
ATOM   4652  C C   . ALA A 1 628 ? 126.463 168.680 125.016 1.00 297.92 ? 628  ALA A C   1 
ATOM   4653  O O   . ALA A 1 628 ? 126.793 168.555 126.194 1.00 327.30 ? 628  ALA A O   1 
ATOM   4654  C CB  . ALA A 1 628 ? 126.266 171.162 125.017 1.00 334.95 ? 628  ALA A CB  1 
ATOM   4655  N N   . ARG A 1 629 ? 126.816 167.823 124.058 1.00 317.08 ? 629  ARG A N   1 
ATOM   4656  C CA  . ARG A 1 629 ? 127.544 166.573 124.318 1.00 319.43 ? 629  ARG A CA  1 
ATOM   4657  C C   . ARG A 1 629 ? 128.816 166.836 125.111 1.00 310.49 ? 629  ARG A C   1 
ATOM   4658  O O   . ARG A 1 629 ? 129.575 167.743 124.764 1.00 289.51 ? 629  ARG A O   1 
ATOM   4659  C CB  . ARG A 1 629 ? 127.884 165.886 122.982 1.00 343.71 ? 629  ARG A CB  1 
ATOM   4660  C CG  . ARG A 1 629 ? 128.713 164.604 123.043 1.00 331.63 ? 629  ARG A CG  1 
ATOM   4661  C CD  . ARG A 1 629 ? 128.141 163.578 124.008 1.00 342.83 ? 629  ARG A CD  1 
ATOM   4662  N NE  . ARG A 1 629 ? 128.397 162.196 123.591 1.00 355.92 ? 629  ARG A NE  1 
ATOM   4663  C CZ  . ARG A 1 629 ? 128.111 161.113 124.319 1.00 350.92 ? 629  ARG A CZ  1 
ATOM   4664  N NH1 . ARG A 1 629 ? 127.564 161.222 125.529 1.00 335.44 ? 629  ARG A NH1 1 
ATOM   4665  N NH2 . ARG A 1 629 ? 128.380 159.903 123.834 1.00 357.98 ? 629  ARG A NH2 1 
ATOM   4666  N N   . ALA A 1 630 ? 129.009 166.061 126.163 1.00 316.32 ? 630  ALA A N   1 
ATOM   4667  C CA  . ALA A 1 630 ? 130.037 166.336 127.129 1.00 310.27 ? 630  ALA A CA  1 
ATOM   4668  C C   . ALA A 1 630 ? 130.877 165.103 127.322 1.00 302.67 ? 630  ALA A C   1 
ATOM   4669  O O   . ALA A 1 630 ? 130.800 164.441 128.338 1.00 302.14 ? 630  ALA A O   1 
ATOM   4670  C CB  . ALA A 1 630 ? 129.403 166.751 128.440 1.00 283.88 ? 630  ALA A CB  1 
ATOM   4671  N N   . LEU A 1 631 ? 131.697 164.815 126.324 1.00 318.10 ? 631  LEU A N   1 
ATOM   4672  C CA  . LEU A 1 631 ? 132.646 163.725 126.369 1.00 348.85 ? 631  LEU A CA  1 
ATOM   4673  C C   . LEU A 1 631 ? 133.963 164.430 126.450 1.00 337.46 ? 631  LEU A C   1 
ATOM   4674  O O   . LEU A 1 631 ? 134.189 165.348 125.676 1.00 369.59 ? 631  LEU A O   1 
ATOM   4675  C CB  . LEU A 1 631 ? 132.595 162.953 125.066 1.00 352.62 ? 631  LEU A CB  1 
ATOM   4676  C CG  . LEU A 1 631 ? 132.489 161.444 125.209 1.00 386.95 ? 631  LEU A CG  1 
ATOM   4677  C CD1 . LEU A 1 631 ? 131.244 160.970 124.490 1.00 412.91 ? 631  LEU A CD1 1 
ATOM   4678  C CD2 . LEU A 1 631 ? 133.720 160.784 124.627 1.00 414.41 ? 631  LEU A CD2 1 
ATOM   4679  N N   . SER A 1 632 ? 134.889 163.907 127.227 1.00 267.73 ? 632  SER A N   1 
ATOM   4680  C CA  . SER A 1 632 ? 136.125 164.611 127.407 1.00 289.30 ? 632  SER A CA  1 
ATOM   4681  C C   . SER A 1 632 ? 136.836 164.855 126.087 1.00 303.59 ? 632  SER A C   1 
ATOM   4682  O O   . SER A 1 632 ? 136.874 164.010 125.169 1.00 339.50 ? 632  SER A O   1 
ATOM   4683  C CB  . SER A 1 632 ? 137.037 163.840 128.344 1.00 283.99 ? 632  SER A CB  1 
ATOM   4684  O OG  . SER A 1 632 ? 136.357 162.728 128.876 1.00 275.87 ? 632  SER A OG  1 
ATOM   4685  N N   . PRO A 1 633 ? 137.453 166.109 126.033 1.00 309.14 ? 633  PRO A N   1 
ATOM   4686  C CA  . PRO A 1 633 ? 138.144 166.356 124.771 1.00 326.24 ? 633  PRO A CA  1 
ATOM   4687  C C   . PRO A 1 633 ? 139.236 165.329 124.616 1.00 319.24 ? 633  PRO A C   1 
ATOM   4688  O O   . PRO A 1 633 ? 139.728 165.154 123.513 1.00 353.67 ? 633  PRO A O   1 
ATOM   4689  C CB  . PRO A 1 633 ? 138.755 167.735 124.960 1.00 352.05 ? 633  PRO A CB  1 
ATOM   4690  C CG  . PRO A 1 633 ? 137.799 168.430 125.829 1.00 342.78 ? 633  PRO A CG  1 
ATOM   4691  C CD  . PRO A 1 633 ? 137.626 167.394 126.871 1.00 323.31 ? 633  PRO A CD  1 
ATOM   4692  N N   . ALA A 1 634 ? 139.652 164.691 125.702 1.00 304.06 ? 634  ALA A N   1 
ATOM   4693  C CA  . ALA A 1 634 ? 140.671 163.671 125.567 1.00 310.77 ? 634  ALA A CA  1 
ATOM   4694  C C   . ALA A 1 634 ? 140.114 162.612 124.655 1.00 297.02 ? 634  ALA A C   1 
ATOM   4695  O O   . ALA A 1 634 ? 140.803 162.132 123.780 1.00 328.77 ? 634  ALA A O   1 
ATOM   4696  C CB  . ALA A 1 634 ? 141.014 163.061 126.903 1.00 324.12 ? 634  ALA A CB  1 
ATOM   4697  N N   . PHE A 1 635 ? 138.860 162.245 124.849 1.00 287.39 ? 635  PHE A N   1 
ATOM   4698  C CA  . PHE A 1 635 ? 138.238 161.293 123.948 1.00 309.13 ? 635  PHE A CA  1 
ATOM   4699  C C   . PHE A 1 635 ? 138.048 161.816 122.539 1.00 323.34 ? 635  PHE A C   1 
ATOM   4700  O O   . PHE A 1 635 ? 138.254 161.084 121.583 1.00 356.83 ? 635  PHE A O   1 
ATOM   4701  C CB  . PHE A 1 635 ? 136.959 160.709 124.532 1.00 314.07 ? 635  PHE A CB  1 
ATOM   4702  C CG  . PHE A 1 635 ? 137.198 159.738 125.657 1.00 310.31 ? 635  PHE A CG  1 
ATOM   4703  C CD1 . PHE A 1 635 ? 138.471 159.298 125.966 1.00 316.11 ? 635  PHE A CD1 1 
ATOM   4704  C CD2 . PHE A 1 635 ? 136.150 159.277 126.407 1.00 312.88 ? 635  PHE A CD2 1 
ATOM   4705  C CE1 . PHE A 1 635 ? 138.685 158.419 126.995 1.00 316.23 ? 635  PHE A CE1 1 
ATOM   4706  C CE2 . PHE A 1 635 ? 136.359 158.395 127.436 1.00 307.08 ? 635  PHE A CE2 1 
ATOM   4707  C CZ  . PHE A 1 635 ? 137.626 157.968 127.728 1.00 307.07 ? 635  PHE A CZ  1 
ATOM   4708  N N   . GLU A 1 636 ? 137.664 163.076 122.398 1.00 325.20 ? 636  GLU A N   1 
ATOM   4709  C CA  . GLU A 1 636 ? 137.538 163.635 121.046 1.00 353.63 ? 636  GLU A CA  1 
ATOM   4710  C C   . GLU A 1 636 ? 138.870 163.658 120.264 1.00 366.49 ? 636  GLU A C   1 
ATOM   4711  O O   . GLU A 1 636 ? 138.923 163.297 119.095 1.00 386.29 ? 636  GLU A O   1 
ATOM   4712  C CB  . GLU A 1 636 ? 136.965 165.045 121.117 1.00 357.72 ? 636  GLU A CB  1 
ATOM   4713  C CG  . GLU A 1 636 ? 136.047 165.392 119.965 1.00 379.08 ? 636  GLU A CG  1 
ATOM   4714  C CD  . GLU A 1 636 ? 136.520 164.808 118.650 1.00 401.71 ? 636  GLU A CD  1 
ATOM   4715  O OE1 . GLU A 1 636 ? 137.575 165.249 118.152 1.00 410.04 ? 636  GLU A OE1 1 
ATOM   4716  O OE2 . GLU A 1 636 ? 135.837 163.910 118.113 1.00 404.99 ? 636  GLU A OE2 1 
ATOM   4717  N N   . LEU A 1 637 ? 139.935 164.068 120.936 1.00 352.62 ? 637  LEU A N   1 
ATOM   4718  C CA  . LEU A 1 637 ? 141.298 164.089 120.446 1.00 357.70 ? 637  LEU A CA  1 
ATOM   4719  C C   . LEU A 1 637 ? 141.835 162.678 120.342 1.00 354.26 ? 637  LEU A C   1 
ATOM   4720  O O   . LEU A 1 637 ? 142.932 162.458 119.848 1.00 346.33 ? 637  LEU A O   1 
ATOM   4721  C CB  . LEU A 1 637 ? 142.182 164.951 121.339 1.00 354.60 ? 637  LEU A CB  1 
ATOM   4722  C CG  . LEU A 1 637 ? 142.019 166.466 121.201 1.00 366.27 ? 637  LEU A CG  1 
ATOM   4723  C CD1 . LEU A 1 637 ? 141.372 166.885 119.891 1.00 351.88 ? 637  LEU A CD1 1 
ATOM   4724  C CD2 . LEU A 1 637 ? 141.243 167.025 122.372 1.00 382.08 ? 637  LEU A CD2 1 
ATOM   4725  N N   . SER A 1 638 ? 141.081 161.724 120.866 1.00 352.22 ? 638  SER A N   1 
ATOM   4726  C CA  . SER A 1 638 ? 141.471 160.335 120.744 1.00 355.28 ? 638  SER A CA  1 
ATOM   4727  C C   . SER A 1 638 ? 142.868 160.171 121.290 1.00 338.73 ? 638  SER A C   1 
ATOM   4728  O O   . SER A 1 638 ? 143.698 159.497 120.695 1.00 324.26 ? 638  SER A O   1 
ATOM   4729  C CB  . SER A 1 638 ? 141.421 159.884 119.288 1.00 356.65 ? 638  SER A CB  1 
ATOM   4730  O OG  . SER A 1 638 ? 140.182 159.273 118.989 1.00 366.23 ? 638  SER A OG  1 
ATOM   4731  N N   . GLN A 1 639 ? 143.125 160.779 122.442 1.00 330.35 ? 639  GLN A N   1 
ATOM   4732  C CA  . GLN A 1 639 ? 144.437 160.716 123.069 1.00 346.58 ? 639  GLN A CA  1 
ATOM   4733  C C   . GLN A 1 639 ? 144.219 160.238 124.490 1.00 332.39 ? 639  GLN A C   1 
ATOM   4734  O O   . GLN A 1 639 ? 144.254 161.015 125.444 1.00 365.63 ? 639  GLN A O   1 
ATOM   4735  C CB  . GLN A 1 639 ? 145.105 162.091 123.067 1.00 350.59 ? 639  GLN A CB  1 
ATOM   4736  C CG  . GLN A 1 639 ? 144.159 163.241 123.375 1.00 358.88 ? 639  GLN A CG  1 
ATOM   4737  C CD  . GLN A 1 639 ? 144.888 164.552 123.591 1.00 372.41 ? 639  GLN A CD  1 
ATOM   4738  O OE1 . GLN A 1 639 ? 145.766 164.654 124.448 1.00 391.64 ? 639  GLN A OE1 1 
ATOM   4739  N NE2 . GLN A 1 639 ? 144.527 165.566 122.813 1.00 375.46 ? 639  GLN A NE2 1 
ATOM   4740  N N   . TRP A 1 640 ? 143.976 158.939 124.607 1.00 311.94 ? 640  TRP A N   1 
ATOM   4741  C CA  . TRP A 1 640 ? 143.498 158.343 125.839 1.00 324.03 ? 640  TRP A CA  1 
ATOM   4742  C C   . TRP A 1 640 ? 144.393 158.429 127.055 1.00 330.25 ? 640  TRP A C   1 
ATOM   4743  O O   . TRP A 1 640 ? 143.901 158.678 128.140 1.00 341.36 ? 640  TRP A O   1 
ATOM   4744  C CB  . TRP A 1 640 ? 143.103 156.903 125.586 1.00 316.90 ? 640  TRP A CB  1 
ATOM   4745  C CG  . TRP A 1 640 ? 142.348 156.766 124.341 1.00 307.07 ? 640  TRP A CG  1 
ATOM   4746  C CD1 . TRP A 1 640 ? 141.215 157.425 124.002 1.00 310.89 ? 640  TRP A CD1 1 
ATOM   4747  C CD2 . TRP A 1 640 ? 142.679 155.937 123.240 1.00 310.19 ? 640  TRP A CD2 1 
ATOM   4748  N NE1 . TRP A 1 640 ? 140.804 157.044 122.757 1.00 299.16 ? 640  TRP A NE1 1 
ATOM   4749  C CE2 . TRP A 1 640 ? 141.691 156.127 122.267 1.00 309.29 ? 640  TRP A CE2 1 
ATOM   4750  C CE3 . TRP A 1 640 ? 143.712 155.041 122.985 1.00 319.54 ? 640  TRP A CE3 1 
ATOM   4751  C CZ2 . TRP A 1 640 ? 141.703 155.459 121.064 1.00 323.65 ? 640  TRP A CZ2 1 
ATOM   4752  C CZ3 . TRP A 1 640 ? 143.723 154.381 121.791 1.00 327.96 ? 640  TRP A CZ3 1 
ATOM   4753  C CH2 . TRP A 1 640 ? 142.729 154.593 120.842 1.00 337.30 ? 640  TRP A CH2 1 
ATOM   4754  N N   . SER A 1 641 ? 145.689 158.209 126.902 1.00 348.99 ? 641  SER A N   1 
ATOM   4755  C CA  . SER A 1 641 ? 146.573 158.283 128.057 1.00 367.27 ? 641  SER A CA  1 
ATOM   4756  C C   . SER A 1 641 ? 146.997 159.718 128.249 1.00 356.26 ? 641  SER A C   1 
ATOM   4757  O O   . SER A 1 641 ? 148.145 160.068 128.027 1.00 385.40 ? 641  SER A O   1 
ATOM   4758  C CB  . SER A 1 641 ? 147.795 157.392 127.868 1.00 397.25 ? 641  SER A CB  1 
ATOM   4759  O OG  . SER A 1 641 ? 148.825 157.760 128.769 1.00 421.22 ? 641  SER A OG  1 
ATOM   4760  N N   . SER A 1 642 ? 146.036 160.568 128.610 1.00 328.54 ? 642  SER A N   1 
ATOM   4761  C CA  . SER A 1 642 ? 146.238 162.018 128.681 1.00 349.99 ? 642  SER A CA  1 
ATOM   4762  C C   . SER A 1 642 ? 146.019 162.627 130.057 1.00 337.78 ? 642  SER A C   1 
ATOM   4763  O O   . SER A 1 642 ? 145.013 162.378 130.695 1.00 349.96 ? 642  SER A O   1 
ATOM   4764  C CB  . SER A 1 642 ? 145.322 162.730 127.687 1.00 358.26 ? 642  SER A CB  1 
ATOM   4765  O OG  . SER A 1 642 ? 145.263 164.127 127.944 1.00 344.33 ? 642  SER A OG  1 
ATOM   4766  N N   . THR A 1 643 ? 146.963 163.452 130.488 1.00 337.43 ? 643  THR A N   1 
ATOM   4767  C CA  . THR A 1 643 ? 146.886 164.117 131.781 1.00 347.33 ? 643  THR A CA  1 
ATOM   4768  C C   . THR A 1 643 ? 145.765 165.127 132.008 1.00 336.79 ? 643  THR A C   1 
ATOM   4769  O O   . THR A 1 643 ? 145.212 165.186 133.099 1.00 323.35 ? 643  THR A O   1 
ATOM   4770  C CB  . THR A 1 643 ? 148.193 164.847 132.102 1.00 360.24 ? 643  THR A CB  1 
ATOM   4771  O OG1 . THR A 1 643 ? 149.243 164.326 131.281 1.00 372.94 ? 643  THR A OG1 1 
ATOM   4772  C CG2 . THR A 1 643 ? 148.549 164.664 133.564 1.00 374.63 ? 643  THR A CG2 1 
ATOM   4773  N N   . GLU A 1 644 ? 145.467 165.965 131.025 1.00 315.47 ? 644  GLU A N   1 
ATOM   4774  C CA  . GLU A 1 644 ? 144.609 167.114 131.300 1.00 320.78 ? 644  GLU A CA  1 
ATOM   4775  C C   . GLU A 1 644 ? 143.187 167.237 130.729 1.00 308.57 ? 644  GLU A C   1 
ATOM   4776  O O   . GLU A 1 644 ? 142.621 168.319 130.808 1.00 305.75 ? 644  GLU A O   1 
ATOM   4777  C CB  . GLU A 1 644 ? 145.373 168.400 131.020 1.00 337.88 ? 644  GLU A CB  1 
ATOM   4778  C CG  . GLU A 1 644 ? 145.209 168.911 129.607 1.00 367.07 ? 644  GLU A CG  1 
ATOM   4779  C CD  . GLU A 1 644 ? 146.511 169.424 129.035 1.00 410.64 ? 644  GLU A CD  1 
ATOM   4780  O OE1 . GLU A 1 644 ? 147.407 169.772 129.833 1.00 426.86 ? 644  GLU A OE1 1 
ATOM   4781  O OE2 . GLU A 1 644 ? 146.640 169.475 127.793 1.00 430.46 ? 644  GLU A OE2 1 
ATOM   4782  N N   . TYR A 1 645 ? 142.617 166.196 130.129 1.00 300.28 ? 645  TYR A N   1 
ATOM   4783  C CA  . TYR A 1 645 ? 141.240 166.318 129.635 1.00 305.12 ? 645  TYR A CA  1 
ATOM   4784  C C   . TYR A 1 645 ? 140.217 165.374 130.227 1.00 301.52 ? 645  TYR A C   1 
ATOM   4785  O O   . TYR A 1 645 ? 139.039 165.446 129.933 1.00 298.21 ? 645  TYR A O   1 
ATOM   4786  C CB  . TYR A 1 645 ? 141.194 166.283 128.124 1.00 328.71 ? 645  TYR A CB  1 
ATOM   4787  C CG  . TYR A 1 645 ? 141.443 167.631 127.542 1.00 315.92 ? 645  TYR A CG  1 
ATOM   4788  C CD1 . TYR A 1 645 ? 142.556 168.352 127.904 1.00 365.90 ? 645  TYR A CD1 1 
ATOM   4789  C CD2 . TYR A 1 645 ? 140.562 168.188 126.645 1.00 305.40 ? 645  TYR A CD2 1 
ATOM   4790  C CE1 . TYR A 1 645 ? 142.798 169.594 127.375 1.00 387.82 ? 645  TYR A CE1 1 
ATOM   4791  C CE2 . TYR A 1 645 ? 140.793 169.432 126.107 1.00 353.33 ? 645  TYR A CE2 1 
ATOM   4792  C CZ  . TYR A 1 645 ? 141.908 170.128 126.478 1.00 379.02 ? 645  TYR A CZ  1 
ATOM   4793  O OH  . TYR A 1 645 ? 142.142 171.369 125.948 1.00 391.65 ? 645  TYR A OH  1 
ATOM   4794  N N   . SER A 1 646 ? 140.677 164.489 131.076 1.00 276.16 ? 646  SER A N   1 
ATOM   4795  C CA  . SER A 1 646 ? 139.775 163.628 131.877 1.00 310.33 ? 646  SER A CA  1 
ATOM   4796  C C   . SER A 1 646 ? 139.322 162.393 131.126 1.00 304.53 ? 646  SER A C   1 
ATOM   4797  O O   . SER A 1 646 ? 138.422 162.450 130.281 1.00 293.41 ? 646  SER A O   1 
ATOM   4798  C CB  . SER A 1 646 ? 138.554 164.392 132.403 1.00 328.75 ? 646  SER A CB  1 
ATOM   4799  O OG  . SER A 1 646 ? 137.579 164.626 131.402 1.00 339.68 ? 646  SER A OG  1 
ATOM   4800  N N   . THR A 1 647 ? 139.931 161.269 131.480 1.00 311.42 ? 647  THR A N   1 
ATOM   4801  C CA  . THR A 1 647 ? 139.887 160.062 130.673 1.00 306.84 ? 647  THR A CA  1 
ATOM   4802  C C   . THR A 1 647 ? 139.114 158.937 131.364 1.00 292.33 ? 647  THR A C   1 
ATOM   4803  O O   . THR A 1 647 ? 139.417 157.758 131.167 1.00 294.71 ? 647  THR A O   1 
ATOM   4804  C CB  . THR A 1 647 ? 141.329 159.622 130.371 1.00 305.98 ? 647  THR A CB  1 
ATOM   4805  O OG1 . THR A 1 647 ? 142.009 159.336 131.598 1.00 291.67 ? 647  THR A OG1 1 
ATOM   4806  C CG2 . THR A 1 647 ? 142.071 160.729 129.660 1.00 330.41 ? 647  THR A CG2 1 
ATOM   4807  N N   . TRP A 1 648 ? 138.105 159.298 132.159 1.00 284.96 ? 648  TRP A N   1 
ATOM   4808  C CA  . TRP A 1 648 ? 137.352 158.300 132.911 1.00 281.33 ? 648  TRP A CA  1 
ATOM   4809  C C   . TRP A 1 648 ? 136.454 157.540 131.960 1.00 279.02 ? 648  TRP A C   1 
ATOM   4810  O O   . TRP A 1 648 ? 135.689 158.144 131.207 1.00 289.45 ? 648  TRP A O   1 
ATOM   4811  C CB  . TRP A 1 648 ? 136.538 158.908 134.053 1.00 280.72 ? 648  TRP A CB  1 
ATOM   4812  C CG  . TRP A 1 648 ? 137.366 159.278 135.240 1.00 269.89 ? 648  TRP A CG  1 
ATOM   4813  C CD1 . TRP A 1 648 ? 137.715 160.528 135.622 1.00 296.48 ? 648  TRP A CD1 1 
ATOM   4814  C CD2 . TRP A 1 648 ? 137.951 158.388 136.191 1.00 252.57 ? 648  TRP A CD2 1 
ATOM   4815  N NE1 . TRP A 1 648 ? 138.480 160.483 136.760 1.00 299.11 ? 648  TRP A NE1 1 
ATOM   4816  C CE2 . TRP A 1 648 ? 138.640 159.176 137.131 1.00 285.34 ? 648  TRP A CE2 1 
ATOM   4817  C CE3 . TRP A 1 648 ? 137.961 156.999 136.341 1.00 293.26 ? 648  TRP A CE3 1 
ATOM   4818  C CZ2 . TRP A 1 648 ? 139.338 158.621 138.214 1.00 315.00 ? 648  TRP A CZ2 1 
ATOM   4819  C CZ3 . TRP A 1 648 ? 138.653 156.445 137.420 1.00 298.80 ? 648  TRP A CZ3 1 
ATOM   4820  C CH2 . TRP A 1 648 ? 139.332 157.256 138.340 1.00 289.85 ? 648  TRP A CH2 1 
ATOM   4821  N N   . THR A 1 649 ? 136.599 156.216 131.977 1.00 286.41 ? 649  THR A N   1 
ATOM   4822  C CA  . THR A 1 649 ? 135.772 155.303 131.199 1.00 276.73 ? 649  THR A CA  1 
ATOM   4823  C C   . THR A 1 649 ? 135.220 154.241 132.124 1.00 278.63 ? 649  THR A C   1 
ATOM   4824  O O   . THR A 1 649 ? 135.935 153.735 132.997 1.00 285.22 ? 649  THR A O   1 
ATOM   4825  C CB  . THR A 1 649 ? 136.581 154.588 130.107 1.00 289.99 ? 649  THR A CB  1 
ATOM   4826  O OG1 . THR A 1 649 ? 137.898 154.320 130.594 1.00 282.83 ? 649  THR A OG1 1 
ATOM   4827  C CG2 . THR A 1 649 ? 136.674 155.431 128.851 1.00 331.20 ? 649  THR A CG2 1 
ATOM   4828  N N   . GLU A 1 650 ? 133.950 153.908 131.922 1.00 284.40 ? 650  GLU A N   1 
ATOM   4829  C CA  . GLU A 1 650 ? 133.299 152.865 132.692 1.00 288.53 ? 650  GLU A CA  1 
ATOM   4830  C C   . GLU A 1 650 ? 133.566 151.548 131.981 1.00 299.50 ? 650  GLU A C   1 
ATOM   4831  O O   . GLU A 1 650 ? 133.301 151.429 130.781 1.00 310.52 ? 650  GLU A O   1 
ATOM   4832  C CB  . GLU A 1 650 ? 131.795 153.120 132.769 1.00 293.04 ? 650  GLU A CB  1 
ATOM   4833  C CG  . GLU A 1 650 ? 131.096 152.412 133.917 1.00 299.49 ? 650  GLU A CG  1 
ATOM   4834  C CD  . GLU A 1 650 ? 129.580 152.512 133.848 1.00 312.23 ? 650  GLU A CD  1 
ATOM   4835  O OE1 . GLU A 1 650 ? 128.991 152.220 132.782 1.00 312.56 ? 650  GLU A OE1 1 
ATOM   4836  O OE2 . GLU A 1 650 ? 128.969 152.868 134.875 1.00 307.34 ? 650  GLU A OE2 1 
ATOM   4837  N N   . SER A 1 651 ? 134.108 150.572 132.709 1.00 305.17 ? 651  SER A N   1 
ATOM   4838  C CA  . SER A 1 651 ? 134.197 149.210 132.196 1.00 285.53 ? 651  SER A CA  1 
ATOM   4839  C C   . SER A 1 651 ? 132.797 148.742 131.933 1.00 272.82 ? 651  SER A C   1 
ATOM   4840  O O   . SER A 1 651 ? 131.907 149.034 132.724 1.00 305.26 ? 651  SER A O   1 
ATOM   4841  C CB  . SER A 1 651 ? 134.819 148.261 133.214 1.00 286.78 ? 651  SER A CB  1 
ATOM   4842  O OG  . SER A 1 651 ? 134.959 146.965 132.660 1.00 307.66 ? 651  SER A OG  1 
ATOM   4843  N N   . ARG A 1 652 ? 132.589 148.038 130.828 1.00 286.74 ? 652  ARG A N   1 
ATOM   4844  C CA  . ARG A 1 652 ? 131.305 147.390 130.606 1.00 291.61 ? 652  ARG A CA  1 
ATOM   4845  C C   . ARG A 1 652 ? 131.404 145.920 130.963 1.00 272.77 ? 652  ARG A C   1 
ATOM   4846  O O   . ARG A 1 652 ? 132.500 145.369 131.058 1.00 290.46 ? 652  ARG A O   1 
ATOM   4847  C CB  . ARG A 1 652 ? 130.766 147.640 129.201 1.00 297.47 ? 652  ARG A CB  1 
ATOM   4848  C CG  . ARG A 1 652 ? 131.465 146.958 128.046 1.00 286.34 ? 652  ARG A CG  1 
ATOM   4849  C CD  . ARG A 1 652 ? 130.553 146.994 126.824 1.00 322.62 ? 652  ARG A CD  1 
ATOM   4850  N NE  . ARG A 1 652 ? 130.630 148.252 126.075 1.00 309.93 ? 652  ARG A NE  1 
ATOM   4851  C CZ  . ARG A 1 652 ? 129.882 148.546 125.007 1.00 345.91 ? 652  ARG A CZ  1 
ATOM   4852  N NH1 . ARG A 1 652 ? 128.976 147.682 124.541 1.00 367.82 ? 652  ARG A NH1 1 
ATOM   4853  N NH2 . ARG A 1 652 ? 130.031 149.716 124.393 1.00 346.36 ? 652  ARG A NH2 1 
ATOM   4854  N N   . TRP A 1 653 ? 130.246 145.312 131.196 1.00 276.70 ? 653  TRP A N   1 
ATOM   4855  C CA  . TRP A 1 653 ? 130.159 143.973 131.771 1.00 285.52 ? 653  TRP A CA  1 
ATOM   4856  C C   . TRP A 1 653 ? 128.967 143.212 131.195 1.00 307.97 ? 653  TRP A C   1 
ATOM   4857  O O   . TRP A 1 653 ? 128.211 143.759 130.385 1.00 339.68 ? 653  TRP A O   1 
ATOM   4858  C CB  . TRP A 1 653 ? 130.047 144.085 133.292 1.00 286.33 ? 653  TRP A CB  1 
ATOM   4859  C CG  . TRP A 1 653 ? 128.866 144.891 133.755 1.00 306.65 ? 653  TRP A CG  1 
ATOM   4860  C CD1 . TRP A 1 653 ? 127.575 144.470 133.882 1.00 333.65 ? 653  TRP A CD1 1 
ATOM   4861  C CD2 . TRP A 1 653 ? 128.879 146.258 134.153 1.00 306.72 ? 653  TRP A CD2 1 
ATOM   4862  N NE1 . TRP A 1 653 ? 126.782 145.497 134.333 1.00 320.62 ? 653  TRP A NE1 1 
ATOM   4863  C CE2 . TRP A 1 653 ? 127.562 146.607 134.507 1.00 310.74 ? 653  TRP A CE2 1 
ATOM   4864  C CE3 . TRP A 1 653 ? 129.880 147.228 134.242 1.00 322.10 ? 653  TRP A CE3 1 
ATOM   4865  C CZ2 . TRP A 1 653 ? 127.224 147.887 134.939 1.00 318.89 ? 653  TRP A CZ2 1 
ATOM   4866  C CZ3 . TRP A 1 653 ? 129.543 148.494 134.671 1.00 277.15 ? 653  TRP A CZ3 1 
ATOM   4867  C CH2 . TRP A 1 653 ? 128.233 148.814 135.012 1.00 302.25 ? 653  TRP A CH2 1 
ATOM   4868  N N   . LYS A 1 654 ? 128.807 141.958 131.617 1.00 302.53 ? 654  LYS A N   1 
ATOM   4869  C CA  . LYS A 1 654 ? 127.674 141.131 131.211 1.00 318.06 ? 654  LYS A CA  1 
ATOM   4870  C C   . LYS A 1 654 ? 126.895 140.656 132.433 1.00 323.70 ? 654  LYS A C   1 
ATOM   4871  O O   . LYS A 1 654 ? 127.262 139.673 133.075 1.00 342.13 ? 654  LYS A O   1 
ATOM   4872  C CB  . LYS A 1 654 ? 128.123 139.958 130.319 1.00 372.17 ? 654  LYS A CB  1 
ATOM   4873  C CG  . LYS A 1 654 ? 129.190 139.019 130.880 1.00 405.67 ? 654  LYS A CG  1 
ATOM   4874  C CD  . LYS A 1 654 ? 129.835 138.206 129.767 1.00 445.49 ? 654  LYS A CD  1 
ATOM   4875  C CE  . LYS A 1 654 ? 130.762 137.128 130.310 1.00 458.11 ? 654  LYS A CE  1 
ATOM   4876  N NZ  . LYS A 1 654 ? 130.043 136.054 131.054 1.00 463.14 ? 654  LYS A NZ  1 
ATOM   4877  N N   . ASP A 1 655 ? 125.830 141.391 132.754 1.00 343.91 ? 655  ASP A N   1 
ATOM   4878  C CA  . ASP A 1 655 ? 124.856 141.018 133.791 1.00 365.16 ? 655  ASP A CA  1 
ATOM   4879  C C   . ASP A 1 655 ? 125.457 140.763 135.177 1.00 336.80 ? 655  ASP A C   1 
ATOM   4880  O O   . ASP A 1 655 ? 125.799 139.624 135.509 1.00 322.10 ? 655  ASP A O   1 
ATOM   4881  C CB  . ASP A 1 655 ? 124.032 139.797 133.346 1.00 393.58 ? 655  ASP A CB  1 
ATOM   4882  C CG  . ASP A 1 655 ? 123.165 140.083 132.126 1.00 422.54 ? 655  ASP A CG  1 
ATOM   4883  O OD1 . ASP A 1 655 ? 123.577 140.890 131.263 1.00 443.86 ? 655  ASP A OD1 1 
ATOM   4884  O OD2 . ASP A 1 655 ? 122.069 139.490 132.028 1.00 436.00 ? 655  ASP A OD2 1 
ATOM   4885  N N   . ILE A 1 656 ? 125.577 141.828 135.974 1.00 324.44 ? 656  ILE A N   1 
ATOM   4886  C CA  . ILE A 1 656 ? 125.948 141.693 137.387 1.00 299.53 ? 656  ILE A CA  1 
ATOM   4887  C C   . ILE A 1 656 ? 124.805 141.009 138.132 1.00 310.99 ? 656  ILE A C   1 
ATOM   4888  O O   . ILE A 1 656 ? 123.635 141.351 137.932 1.00 326.90 ? 656  ILE A O   1 
ATOM   4889  C CB  . ILE A 1 656 ? 126.317 143.041 138.072 1.00 292.31 ? 656  ILE A CB  1 
ATOM   4890  C CG1 . ILE A 1 656 ? 125.109 143.995 138.190 1.00 335.58 ? 656  ILE A CG1 1 
ATOM   4891  C CG2 . ILE A 1 656 ? 127.476 143.721 137.348 1.00 288.37 ? 656  ILE A CG2 1 
ATOM   4892  C CD1 . ILE A 1 656 ? 124.411 143.980 139.540 1.00 351.82 ? 656  ILE A CD1 1 
ATOM   4893  N N   . ARG A 1 657 ? 125.138 140.008 138.941 1.00 316.40 ? 657  ARG A N   1 
ATOM   4894  C CA  . ARG A 1 657 ? 124.160 139.387 139.827 1.00 305.71 ? 657  ARG A CA  1 
ATOM   4895  C C   . ARG A 1 657 ? 124.816 138.702 141.010 1.00 299.95 ? 657  ARG A C   1 
ATOM   4896  O O   . ARG A 1 657 ? 125.961 138.226 140.930 1.00 305.48 ? 657  ARG A O   1 
ATOM   4897  C CB  . ARG A 1 657 ? 123.244 138.403 139.084 1.00 315.51 ? 657  ARG A CB  1 
ATOM   4898  C CG  . ARG A 1 657 ? 123.884 137.127 138.552 1.00 319.65 ? 657  ARG A CG  1 
ATOM   4899  C CD  . ARG A 1 657 ? 122.799 136.144 138.128 1.00 332.15 ? 657  ARG A CD  1 
ATOM   4900  N NE  . ARG A 1 657 ? 123.334 134.859 137.682 1.00 320.50 ? 657  ARG A NE  1 
ATOM   4901  C CZ  . ARG A 1 657 ? 123.844 134.608 136.475 1.00 348.41 ? 657  ARG A CZ  1 
ATOM   4902  N NH1 . ARG A 1 657 ? 123.935 135.559 135.543 1.00 366.66 ? 657  ARG A NH1 1 
ATOM   4903  N NH2 . ARG A 1 657 ? 124.304 133.388 136.205 1.00 369.29 ? 657  ARG A NH2 1 
ATOM   4904  N N   . ALA A 1 658 ? 124.068 138.681 142.107 1.00 285.70 ? 658  ALA A N   1 
ATOM   4905  C CA  . ALA A 1 658 ? 124.485 138.047 143.337 1.00 280.84 ? 658  ALA A CA  1 
ATOM   4906  C C   . ALA A 1 658 ? 123.426 137.056 143.734 1.00 272.30 ? 658  ALA A C   1 
ATOM   4907  O O   . ALA A 1 658 ? 122.253 137.211 143.385 1.00 293.33 ? 658  ALA A O   1 
ATOM   4908  C CB  . ALA A 1 658 ? 124.680 139.081 144.429 1.00 302.84 ? 658  ALA A CB  1 
ATOM   4909  N N   . ARG A 1 659 ? 123.849 136.040 144.474 1.00 278.72 ? 659  ARG A N   1 
ATOM   4910  C CA  . ARG A 1 659 ? 122.955 134.983 144.904 1.00 275.50 ? 659  ARG A CA  1 
ATOM   4911  C C   . ARG A 1 659 ? 123.526 134.172 146.054 1.00 274.71 ? 659  ARG A C   1 
ATOM   4912  O O   . ARG A 1 659 ? 124.730 133.888 146.099 1.00 262.22 ? 659  ARG A O   1 
ATOM   4913  C CB  . ARG A 1 659 ? 122.631 134.071 143.735 1.00 278.71 ? 659  ARG A CB  1 
ATOM   4914  C CG  . ARG A 1 659 ? 123.838 133.526 142.984 1.00 278.56 ? 659  ARG A CG  1 
ATOM   4915  C CD  . ARG A 1 659 ? 123.339 132.786 141.754 1.00 287.06 ? 659  ARG A CD  1 
ATOM   4916  N NE  . ARG A 1 659 ? 124.325 131.862 141.210 1.00 265.94 ? 659  ARG A NE  1 
ATOM   4917  C CZ  . ARG A 1 659 ? 124.035 130.762 140.516 1.00 289.02 ? 659  ARG A CZ  1 
ATOM   4918  N NH1 . ARG A 1 659 ? 122.768 130.409 140.256 1.00 286.38 ? 659  ARG A NH1 1 
ATOM   4919  N NH2 . ARG A 1 659 ? 125.031 129.990 140.077 1.00 325.45 ? 659  ARG A NH2 1 
ATOM   4920  N N   . ILE A 1 660 ? 122.627 133.790 146.961 1.00 285.60 ? 660  ILE A N   1 
ATOM   4921  C CA  . ILE A 1 660 ? 122.977 133.118 148.209 1.00 280.64 ? 660  ILE A CA  1 
ATOM   4922  C C   . ILE A 1 660 ? 122.480 131.670 148.155 1.00 270.23 ? 660  ILE A C   1 
ATOM   4923  O O   . ILE A 1 660 ? 121.341 131.417 147.760 1.00 274.98 ? 660  ILE A O   1 
ATOM   4924  C CB  . ILE A 1 660 ? 122.407 133.887 149.425 1.00 287.41 ? 660  ILE A CB  1 
ATOM   4925  C CG1 . ILE A 1 660 ? 123.109 133.452 150.705 1.00 332.84 ? 660  ILE A CG1 1 
ATOM   4926  C CG2 . ILE A 1 660 ? 120.895 133.729 149.553 1.00 287.35 ? 660  ILE A CG2 1 
ATOM   4927  C CD1 . ILE A 1 660 ? 122.572 134.115 151.956 1.00 362.45 ? 660  ILE A CD1 1 
ATOM   4928  N N   . PHE A 1 661 ? 123.348 130.730 148.529 1.00 268.45 ? 661  PHE A N   1 
ATOM   4929  C CA  . PHE A 1 661 ? 123.051 129.300 148.414 1.00 276.29 ? 661  PHE A CA  1 
ATOM   4930  C C   . PHE A 1 661 ? 123.918 128.453 149.323 1.00 275.98 ? 661  PHE A C   1 
ATOM   4931  O O   . PHE A 1 661 ? 124.970 128.898 149.749 1.00 285.86 ? 661  PHE A O   1 
ATOM   4932  C CB  . PHE A 1 661 ? 123.285 128.837 146.989 1.00 270.33 ? 661  PHE A CB  1 
ATOM   4933  C CG  . PHE A 1 661 ? 124.692 129.042 146.513 1.00 272.70 ? 661  PHE A CG  1 
ATOM   4934  C CD1 . PHE A 1 661 ? 125.729 128.195 146.909 1.00 271.39 ? 661  PHE A CD1 1 
ATOM   4935  C CD2 . PHE A 1 661 ? 124.983 130.085 145.662 1.00 294.32 ? 661  PHE A CD2 1 
ATOM   4936  C CE1 . PHE A 1 661 ? 127.022 128.392 146.456 1.00 291.12 ? 661  PHE A CE1 1 
ATOM   4937  C CE2 . PHE A 1 661 ? 126.261 130.279 145.201 1.00 304.04 ? 661  PHE A CE2 1 
ATOM   4938  C CZ  . PHE A 1 661 ? 127.291 129.442 145.595 1.00 296.13 ? 661  PHE A CZ  1 
ATOM   4939  N N   . LEU A 1 662 ? 123.506 127.209 149.552 1.00 276.73 ? 662  LEU A N   1 
ATOM   4940  C CA  . LEU A 1 662 ? 124.305 126.268 150.345 1.00 285.61 ? 662  LEU A CA  1 
ATOM   4941  C C   . LEU A 1 662 ? 125.375 125.597 149.491 1.00 273.94 ? 662  LEU A C   1 
ATOM   4942  O O   . LEU A 1 662 ? 125.067 125.056 148.430 1.00 285.84 ? 662  LEU A O   1 
ATOM   4943  C CB  . LEU A 1 662 ? 123.432 125.197 150.994 1.00 299.94 ? 662  LEU A CB  1 
ATOM   4944  C CG  . LEU A 1 662 ? 122.834 125.587 152.340 1.00 315.59 ? 662  LEU A CG  1 
ATOM   4945  C CD1 . LEU A 1 662 ? 121.976 126.825 152.182 1.00 320.42 ? 662  LEU A CD1 1 
ATOM   4946  C CD2 . LEU A 1 662 ? 122.052 124.420 152.931 1.00 346.38 ? 662  LEU A CD2 1 
ATOM   4947  N N   . ILE A 1 663 ? 126.622 125.646 149.957 1.00 268.62 ? 663  ILE A N   1 
ATOM   4948  C CA  . ILE A 1 663 ? 127.730 124.922 149.345 1.00 282.01 ? 663  ILE A CA  1 
ATOM   4949  C C   . ILE A 1 663 ? 127.994 123.675 150.193 1.00 307.41 ? 663  ILE A C   1 
ATOM   4950  O O   . ILE A 1 663 ? 128.024 123.751 151.424 1.00 312.95 ? 663  ILE A O   1 
ATOM   4951  C CB  . ILE A 1 663 ? 128.994 125.815 149.198 1.00 284.48 ? 663  ILE A CB  1 
ATOM   4952  C CG1 . ILE A 1 663 ? 129.900 125.290 148.080 1.00 340.59 ? 663  ILE A CG1 1 
ATOM   4953  C CG2 . ILE A 1 663 ? 129.792 125.929 150.495 1.00 273.04 ? 663  ILE A CG2 1 
ATOM   4954  C CD1 . ILE A 1 663 ? 131.081 126.188 147.768 1.00 357.49 ? 663  ILE A CD1 1 
ATOM   4955  N N   . ALA A 1 664 ? 128.145 122.528 149.530 1.00 329.89 ? 664  ALA A N   1 
ATOM   4956  C CA  . ALA A 1 664 ? 128.453 121.265 150.210 1.00 321.31 ? 664  ALA A CA  1 
ATOM   4957  C C   . ALA A 1 664 ? 129.959 121.131 150.374 1.00 304.34 ? 664  ALA A C   1 
ATOM   4958  O O   . ALA A 1 664 ? 130.731 121.763 149.641 1.00 276.25 ? 664  ALA A O   1 
ATOM   4959  C CB  . ALA A 1 664 ? 127.892 120.086 149.433 1.00 334.67 ? 664  ALA A CB  1 
ATOM   4960  N N   . SER A 1 665 ? 130.370 120.304 151.332 1.00 307.10 ? 665  SER A N   1 
ATOM   4961  C CA  . SER A 1 665 ? 131.786 120.184 151.693 1.00 336.11 ? 665  SER A CA  1 
ATOM   4962  C C   . SER A 1 665 ? 132.577 119.560 150.562 1.00 326.82 ? 665  SER A C   1 
ATOM   4963  O O   . SER A 1 665 ? 132.115 118.594 149.958 1.00 336.20 ? 665  SER A O   1 
ATOM   4964  C CB  . SER A 1 665 ? 131.963 119.346 152.963 1.00 360.82 ? 665  SER A CB  1 
ATOM   4965  O OG  . SER A 1 665 ? 131.854 117.957 152.702 1.00 380.13 ? 665  SER A OG  1 
ATOM   4966  N N   . LYS A 1 666 ? 133.764 120.105 150.288 1.00 341.20 ? 666  LYS A N   1 
ATOM   4967  C CA  . LYS A 1 666 ? 134.665 119.566 149.268 1.00 352.35 ? 666  LYS A CA  1 
ATOM   4968  C C   . LYS A 1 666 ? 134.801 118.065 149.409 1.00 322.06 ? 666  LYS A C   1 
ATOM   4969  O O   . LYS A 1 666 ? 134.800 117.354 148.398 1.00 323.52 ? 666  LYS A O   1 
ATOM   4970  C CB  . LYS A 1 666 ? 136.048 120.224 149.342 1.00 365.55 ? 666  LYS A CB  1 
ATOM   4971  C CG  . LYS A 1 666 ? 136.091 121.630 148.758 1.00 402.04 ? 666  LYS A CG  1 
ATOM   4972  C CD  . LYS A 1 666 ? 137.463 122.279 148.905 1.00 429.48 ? 666  LYS A CD  1 
ATOM   4973  C CE  . LYS A 1 666 ? 138.488 121.740 147.911 1.00 424.54 ? 666  LYS A CE  1 
ATOM   4974  N NZ  . LYS A 1 666 ? 138.180 122.081 146.493 1.00 415.46 ? 666  LYS A NZ  1 
ATOM   4975  N N   . GLU A 1 667 ? 134.915 117.611 150.659 1.00 336.05 ? 667  GLU A N   1 
ATOM   4976  C CA  . GLU A 1 667 ? 135.057 116.193 150.979 1.00 351.31 ? 667  GLU A CA  1 
ATOM   4977  C C   . GLU A 1 667 ? 133.881 115.408 150.423 1.00 330.06 ? 667  GLU A C   1 
ATOM   4978  O O   . GLU A 1 667 ? 134.063 114.350 149.792 1.00 359.48 ? 667  GLU A O   1 
ATOM   4979  C CB  . GLU A 1 667 ? 135.099 115.969 152.498 1.00 362.47 ? 667  GLU A CB  1 
ATOM   4980  C CG  . GLU A 1 667 ? 136.373 116.444 153.184 1.00 408.45 ? 667  GLU A CG  1 
ATOM   4981  C CD  . GLU A 1 667 ? 136.317 116.318 154.700 1.00 435.46 ? 667  GLU A CD  1 
ATOM   4982  O OE1 . GLU A 1 667 ? 135.648 115.394 155.212 1.00 444.69 ? 667  GLU A OE1 1 
ATOM   4983  O OE2 . GLU A 1 667 ? 136.954 117.146 155.386 1.00 448.40 ? 667  GLU A OE2 1 
ATOM   4984  N N   . LEU A 1 668 ? 132.691 115.954 150.675 1.00 317.53 ? 668  LEU A N   1 
ATOM   4985  C CA  . LEU A 1 668 ? 131.438 115.322 150.225 1.00 307.79 ? 668  LEU A CA  1 
ATOM   4986  C C   . LEU A 1 668 ? 131.437 115.184 148.712 1.00 290.54 ? 668  LEU A C   1 
ATOM   4987  O O   . LEU A 1 668 ? 131.083 114.123 148.182 1.00 321.05 ? 668  LEU A O   1 
ATOM   4988  C CB  . LEU A 1 668 ? 130.182 116.068 150.680 1.00 314.94 ? 668  LEU A CB  1 
ATOM   4989  C CG  . LEU A 1 668 ? 128.871 115.318 150.417 1.00 317.84 ? 668  LEU A CG  1 
ATOM   4990  C CD1 . LEU A 1 668 ? 128.691 114.186 151.415 1.00 330.78 ? 668  LEU A CD1 1 
ATOM   4991  C CD2 . LEU A 1 668 ? 127.682 116.264 150.467 1.00 359.02 ? 668  LEU A CD2 1 
ATOM   4992  N N   . GLU A 1 669 ? 131.843 116.261 148.053 1.00 300.60 ? 669  GLU A N   1 
ATOM   4993  C CA  . GLU A 1 669 ? 131.911 116.322 146.589 1.00 324.60 ? 669  GLU A CA  1 
ATOM   4994  C C   . GLU A 1 669 ? 132.833 115.218 146.066 1.00 332.30 ? 669  GLU A C   1 
ATOM   4995  O O   . GLU A 1 669 ? 132.486 114.490 145.114 1.00 359.22 ? 669  GLU A O   1 
ATOM   4996  C CB  . GLU A 1 669 ? 132.362 117.710 146.104 1.00 347.36 ? 669  GLU A CB  1 
ATOM   4997  C CG  . GLU A 1 669 ? 131.483 118.868 146.586 1.00 357.50 ? 669  GLU A CG  1 
ATOM   4998  C CD  . GLU A 1 669 ? 131.817 120.199 145.931 1.00 374.88 ? 669  GLU A CD  1 
ATOM   4999  O OE1 . GLU A 1 669 ? 133.018 120.511 145.774 1.00 381.64 ? 669  GLU A OE1 1 
ATOM   5000  O OE2 . GLU A 1 669 ? 130.873 120.943 145.589 1.00 370.62 ? 669  GLU A OE2 1 
ATOM   5001  N N   . LEU A 1 670 ? 133.989 115.123 146.714 1.00 327.93 ? 670  LEU A N   1 
ATOM   5002  C CA  . LEU A 1 670 ? 135.011 114.135 146.366 1.00 317.63 ? 670  LEU A CA  1 
ATOM   5003  C C   . LEU A 1 670 ? 134.436 112.725 146.468 1.00 304.21 ? 670  LEU A C   1 
ATOM   5004  O O   . LEU A 1 670 ? 134.621 111.891 145.568 1.00 317.28 ? 670  LEU A O   1 
ATOM   5005  C CB  . LEU A 1 670 ? 136.262 114.296 147.240 1.00 352.02 ? 670  LEU A CB  1 
ATOM   5006  C CG  . LEU A 1 670 ? 137.422 113.307 147.029 1.00 395.89 ? 670  LEU A CG  1 
ATOM   5007  C CD1 . LEU A 1 670 ? 138.766 114.024 147.088 1.00 421.49 ? 670  LEU A CD1 1 
ATOM   5008  C CD2 . LEU A 1 670 ? 137.391 112.152 148.030 1.00 396.51 ? 670  LEU A CD2 1 
ATOM   5009  N N   . ILE A 1 671 ? 133.743 112.499 147.575 1.00 288.20 ? 671  ILE A N   1 
ATOM   5010  C CA  . ILE A 1 671 ? 133.105 111.209 147.868 1.00 303.26 ? 671  ILE A CA  1 
ATOM   5011  C C   . ILE A 1 671 ? 132.127 110.848 146.766 1.00 298.88 ? 671  ILE A C   1 
ATOM   5012  O O   . ILE A 1 671 ? 132.116 109.711 146.274 1.00 337.43 ? 671  ILE A O   1 
ATOM   5013  C CB  . ILE A 1 671 ? 132.396 111.214 149.251 1.00 322.23 ? 671  ILE A CB  1 
ATOM   5014  C CG1 . ILE A 1 671 ? 133.436 111.125 150.381 1.00 365.72 ? 671  ILE A CG1 1 
ATOM   5015  C CG2 . ILE A 1 671 ? 131.356 110.099 149.377 1.00 317.28 ? 671  ILE A CG2 1 
ATOM   5016  C CD1 . ILE A 1 671 ? 134.161 109.796 150.513 1.00 384.94 ? 671  ILE A CD1 1 
ATOM   5017  N N   . THR A 1 672 ? 131.320 111.835 146.402 1.00 292.48 ? 672  THR A N   1 
ATOM   5018  C CA  . THR A 1 672 ? 130.300 111.689 145.355 1.00 306.45 ? 672  THR A CA  1 
ATOM   5019  C C   . THR A 1 672 ? 130.959 111.266 144.043 1.00 300.73 ? 672  THR A C   1 
ATOM   5020  O O   . THR A 1 672 ? 130.489 110.335 143.365 1.00 321.42 ? 672  THR A O   1 
ATOM   5021  C CB  . THR A 1 672 ? 129.481 112.981 145.144 1.00 334.44 ? 672  THR A CB  1 
ATOM   5022  O OG1 . THR A 1 672 ? 128.642 113.205 146.284 1.00 356.16 ? 672  THR A OG1 1 
ATOM   5023  C CG2 . THR A 1 672 ? 128.608 112.899 143.879 1.00 347.56 ? 672  THR A CG2 1 
ATOM   5024  N N   . LEU A 1 673 ? 132.041 111.971 143.727 1.00 292.12 ? 673  LEU A N   1 
ATOM   5025  C CA  . LEU A 1 673 ? 132.808 111.721 142.505 1.00 301.47 ? 673  LEU A CA  1 
ATOM   5026  C C   . LEU A 1 673 ? 133.311 110.276 142.479 1.00 322.03 ? 673  LEU A C   1 
ATOM   5027  O O   . LEU A 1 673 ? 133.199 109.580 141.466 1.00 335.89 ? 673  LEU A O   1 
ATOM   5028  C CB  . LEU A 1 673 ? 133.943 112.717 142.280 1.00 310.93 ? 673  LEU A CB  1 
ATOM   5029  C CG  . LEU A 1 673 ? 134.617 112.534 140.907 1.00 318.91 ? 673  LEU A CG  1 
ATOM   5030  C CD1 . LEU A 1 673 ? 134.704 113.826 140.110 1.00 315.16 ? 673  LEU A CD1 1 
ATOM   5031  C CD2 . LEU A 1 673 ? 135.993 111.900 141.076 1.00 363.22 ? 673  LEU A CD2 1 
ATOM   5032  N N   . THR A 1 674 ? 133.853 109.872 143.621 1.00 323.60 ? 674  THR A N   1 
ATOM   5033  C CA  . THR A 1 674 ? 134.394 108.521 143.811 1.00 333.92 ? 674  THR A CA  1 
ATOM   5034  C C   . THR A 1 674 ? 133.313 107.483 143.547 1.00 317.34 ? 674  THR A C   1 
ATOM   5035  O O   . THR A 1 674 ? 133.537 106.492 142.835 1.00 340.95 ? 674  THR A O   1 
ATOM   5036  C CB  . THR A 1 674 ? 134.968 108.324 145.228 1.00 362.78 ? 674  THR A CB  1 
ATOM   5037  O OG1 . THR A 1 674 ? 135.975 109.312 145.475 1.00 385.42 ? 674  THR A OG1 1 
ATOM   5038  C CG2 . THR A 1 674 ? 135.576 106.928 145.389 1.00 391.46 ? 674  THR A CG2 1 
ATOM   5039  N N   . VAL A 1 675 ? 132.154 107.742 144.135 1.00 302.42 ? 675  VAL A N   1 
ATOM   5040  C CA  . VAL A 1 675 ? 130.981 106.868 144.012 1.00 305.60 ? 675  VAL A CA  1 
ATOM   5041  C C   . VAL A 1 675 ? 130.601 106.709 142.548 1.00 292.88 ? 675  VAL A C   1 
ATOM   5042  O O   . VAL A 1 675 ? 130.363 105.584 142.063 1.00 324.63 ? 675  VAL A O   1 
ATOM   5043  C CB  . VAL A 1 675 ? 129.794 107.395 144.850 1.00 312.74 ? 675  VAL A CB  1 
ATOM   5044  C CG1 . VAL A 1 675 ? 128.475 106.778 144.419 1.00 300.90 ? 675  VAL A CG1 1 
ATOM   5045  C CG2 . VAL A 1 675 ? 130.043 107.119 146.326 1.00 362.11 ? 675  VAL A CG2 1 
ATOM   5046  N N   . GLY A 1 676 ? 130.570 107.845 141.860 1.00 298.98 ? 676  GLY A N   1 
ATOM   5047  C CA  . GLY A 1 676 ? 130.231 107.910 140.438 1.00 321.19 ? 676  GLY A CA  1 
ATOM   5048  C C   . GLY A 1 676 ? 131.173 107.056 139.633 1.00 312.35 ? 676  GLY A C   1 
ATOM   5049  O O   . GLY A 1 676 ? 130.713 106.114 138.983 1.00 307.45 ? 676  GLY A O   1 
ATOM   5050  N N   . PHE A 1 677 ? 132.472 107.369 139.727 1.00 322.65 ? 677  PHE A N   1 
ATOM   5051  C CA  . PHE A 1 677 ? 133.509 106.601 139.036 1.00 325.21 ? 677  PHE A CA  1 
ATOM   5052  C C   . PHE A 1 677 ? 133.459 105.134 139.464 1.00 338.83 ? 677  PHE A C   1 
ATOM   5053  O O   . PHE A 1 677 ? 133.502 104.221 138.615 1.00 363.69 ? 677  PHE A O   1 
ATOM   5054  C CB  . PHE A 1 677 ? 134.915 107.160 139.283 1.00 320.46 ? 677  PHE A CB  1 
ATOM   5055  C CG  . PHE A 1 677 ? 135.403 108.075 138.197 1.00 364.46 ? 677  PHE A CG  1 
ATOM   5056  C CD1 . PHE A 1 677 ? 135.761 107.563 136.952 1.00 378.36 ? 677  PHE A CD1 1 
ATOM   5057  C CD2 . PHE A 1 677 ? 135.525 109.446 138.416 1.00 398.35 ? 677  PHE A CD2 1 
ATOM   5058  C CE1 . PHE A 1 677 ? 136.220 108.401 135.943 1.00 395.70 ? 677  PHE A CE1 1 
ATOM   5059  C CE2 . PHE A 1 677 ? 135.988 110.289 137.413 1.00 401.99 ? 677  PHE A CE2 1 
ATOM   5060  C CZ  . PHE A 1 677 ? 136.335 109.766 136.174 1.00 403.91 ? 677  PHE A CZ  1 
ATOM   5061  N N   . GLY A 1 678 ? 133.355 104.950 140.775 1.00 326.86 ? 678  GLY A N   1 
ATOM   5062  C CA  . GLY A 1 678 ? 133.257 103.626 141.384 1.00 331.50 ? 678  GLY A CA  1 
ATOM   5063  C C   . GLY A 1 678 ? 132.124 102.819 140.817 1.00 336.00 ? 678  GLY A C   1 
ATOM   5064  O O   . GLY A 1 678 ? 132.368 101.729 140.298 1.00 370.72 ? 678  GLY A O   1 
ATOM   5065  N N   . ILE A 1 679 ? 130.903 103.339 140.976 1.00 342.40 ? 679  ILE A N   1 
ATOM   5066  C CA  . ILE A 1 679 ? 129.688 102.619 140.545 1.00 340.81 ? 679  ILE A CA  1 
ATOM   5067  C C   . ILE A 1 679 ? 129.753 102.341 139.055 1.00 298.44 ? 679  ILE A C   1 
ATOM   5068  O O   . ILE A 1 679 ? 129.447 101.211 138.636 1.00 305.56 ? 679  ILE A O   1 
ATOM   5069  C CB  . ILE A 1 679 ? 128.357 103.297 140.990 1.00 361.98 ? 679  ILE A CB  1 
ATOM   5070  C CG1 . ILE A 1 679 ? 127.165 102.338 140.846 1.00 385.66 ? 679  ILE A CG1 1 
ATOM   5071  C CG2 . ILE A 1 679 ? 128.070 104.574 140.224 1.00 363.03 ? 679  ILE A CG2 1 
ATOM   5072  C CD1 . ILE A 1 679 ? 127.130 101.229 141.876 1.00 414.91 ? 679  ILE A CD1 1 
ATOM   5073  N N   . LEU A 1 680 ? 130.205 103.334 138.290 1.00 300.07 ? 680  LEU A N   1 
ATOM   5074  C CA  . LEU A 1 680 ? 130.322 103.229 136.842 1.00 312.06 ? 680  LEU A CA  1 
ATOM   5075  C C   . LEU A 1 680 ? 131.281 102.104 136.493 1.00 333.03 ? 680  LEU A C   1 
ATOM   5076  O O   . LEU A 1 680 ? 130.981 101.255 135.618 1.00 349.38 ? 680  LEU A O   1 
ATOM   5077  C CB  . LEU A 1 680 ? 130.887 104.526 136.244 1.00 318.89 ? 680  LEU A CB  1 
ATOM   5078  C CG  . LEU A 1 680 ? 131.584 104.486 134.878 1.00 306.86 ? 680  LEU A CG  1 
ATOM   5079  C CD1 . LEU A 1 680 ? 130.650 103.945 133.803 1.00 336.57 ? 680  LEU A CD1 1 
ATOM   5080  C CD2 . LEU A 1 680 ? 132.085 105.880 134.525 1.00 330.51 ? 680  LEU A CD2 1 
ATOM   5081  N N   . ILE A 1 681 ? 132.438 102.141 137.152 1.00 342.53 ? 681  ILE A N   1 
ATOM   5082  C CA  . ILE A 1 681 ? 133.511 101.173 136.902 1.00 350.66 ? 681  ILE A CA  1 
ATOM   5083  C C   . ILE A 1 681 ? 133.010 99.757  137.161 1.00 324.12 ? 681  ILE A C   1 
ATOM   5084  O O   . ILE A 1 681 ? 133.235 98.837  136.349 1.00 321.71 ? 681  ILE A O   1 
ATOM   5085  C CB  . ILE A 1 681 ? 134.802 101.493 137.705 1.00 356.94 ? 681  ILE A CB  1 
ATOM   5086  C CG1 . ILE A 1 681 ? 135.589 102.596 136.982 1.00 394.96 ? 681  ILE A CG1 1 
ATOM   5087  C CG2 . ILE A 1 681 ? 135.699 100.267 137.872 1.00 346.76 ? 681  ILE A CG2 1 
ATOM   5088  C CD1 . ILE A 1 681 ? 136.562 103.354 137.863 1.00 428.43 ? 681  ILE A CD1 1 
ATOM   5089  N N   . PHE A 1 682 ? 132.334 99.622  138.293 1.00 315.67 ? 682  PHE A N   1 
ATOM   5090  C CA  . PHE A 1 682 ? 131.773 98.330  138.729 1.00 324.86 ? 682  PHE A CA  1 
ATOM   5091  C C   . PHE A 1 682 ? 130.799 97.815  137.685 1.00 328.78 ? 682  PHE A C   1 
ATOM   5092  O O   . PHE A 1 682 ? 130.846 96.626  137.323 1.00 359.07 ? 682  PHE A O   1 
ATOM   5093  C CB  . PHE A 1 682 ? 131.102 98.511  140.098 1.00 339.28 ? 682  PHE A CB  1 
ATOM   5094  C CG  . PHE A 1 682 ? 130.208 97.381  140.513 1.00 346.88 ? 682  PHE A CG  1 
ATOM   5095  C CD1 . PHE A 1 682 ? 128.853 97.385  140.168 1.00 327.60 ? 682  PHE A CD1 1 
ATOM   5096  C CD2 . PHE A 1 682 ? 130.704 96.333  141.289 1.00 353.45 ? 682  PHE A CD2 1 
ATOM   5097  C CE1 . PHE A 1 682 ? 128.021 96.350  140.566 1.00 366.22 ? 682  PHE A CE1 1 
ATOM   5098  C CE2 . PHE A 1 682 ? 129.874 95.296  141.693 1.00 359.29 ? 682  PHE A CE2 1 
ATOM   5099  C CZ  . PHE A 1 682 ? 128.531 95.305  141.333 1.00 380.38 ? 682  PHE A CZ  1 
ATOM   5100  N N   . SER A 1 683 ? 129.943 98.715  137.219 1.00 333.20 ? 683  SER A N   1 
ATOM   5101  C CA  . SER A 1 683 ? 128.931 98.399  136.207 1.00 350.18 ? 683  SER A CA  1 
ATOM   5102  C C   . SER A 1 683 ? 129.596 97.870  134.948 1.00 337.92 ? 683  SER A C   1 
ATOM   5103  O O   . SER A 1 683 ? 129.169 96.843  134.384 1.00 361.96 ? 683  SER A O   1 
ATOM   5104  C CB  . SER A 1 683 ? 128.046 99.601  135.883 1.00 360.18 ? 683  SER A CB  1 
ATOM   5105  O OG  . SER A 1 683 ? 128.672 100.502 134.987 1.00 340.71 ? 683  SER A OG  1 
ATOM   5106  N N   . LEU A 1 684 ? 130.643 98.581  134.538 1.00 295.91 ? 684  LEU A N   1 
ATOM   5107  C CA  . LEU A 1 684 ? 131.414 98.232  133.341 1.00 292.02 ? 684  LEU A CA  1 
ATOM   5108  C C   . LEU A 1 684 ? 131.983 96.826  133.476 1.00 315.92 ? 684  LEU A C   1 
ATOM   5109  O O   . LEU A 1 684 ? 131.862 95.976  132.547 1.00 333.53 ? 684  LEU A O   1 
ATOM   5110  C CB  . LEU A 1 684 ? 132.524 99.244  133.030 1.00 307.71 ? 684  LEU A CB  1 
ATOM   5111  C CG  . LEU A 1 684 ? 132.072 100.523 132.319 1.00 340.43 ? 684  LEU A CG  1 
ATOM   5112  C CD1 . LEU A 1 684 ? 133.143 101.598 132.424 1.00 364.90 ? 684  LEU A CD1 1 
ATOM   5113  C CD2 . LEU A 1 684 ? 131.729 100.265 130.858 1.00 345.49 ? 684  LEU A CD2 1 
ATOM   5114  N N   . ILE A 1 685 ? 132.555 96.581  134.649 1.00 322.32 ? 685  ILE A N   1 
ATOM   5115  C CA  . ILE A 1 685 ? 133.163 95.282  134.968 1.00 303.28 ? 685  ILE A CA  1 
ATOM   5116  C C   . ILE A 1 685 ? 132.130 94.154  134.866 1.00 290.73 ? 685  ILE A C   1 
ATOM   5117  O O   . ILE A 1 685 ? 132.343 93.147  134.148 1.00 316.48 ? 685  ILE A O   1 
ATOM   5118  C CB  . ILE A 1 685 ? 133.899 95.285  136.332 1.00 322.39 ? 685  ILE A CB  1 
ATOM   5119  C CG1 . ILE A 1 685 ? 135.155 96.174  136.256 1.00 330.42 ? 685  ILE A CG1 1 
ATOM   5120  C CG2 . ILE A 1 685 ? 134.264 93.869  136.783 1.00 328.51 ? 685  ILE A CG2 1 
ATOM   5121  C CD1 . ILE A 1 685 ? 136.152 95.816  135.170 1.00 344.66 ? 685  ILE A CD1 1 
ATOM   5122  N N   . VAL A 1 686 ? 131.108 94.276  135.708 1.00 280.99 ? 686  VAL A N   1 
ATOM   5123  C CA  . VAL A 1 686 ? 130.103 93.226  135.891 1.00 328.93 ? 686  VAL A CA  1 
ATOM   5124  C C   . VAL A 1 686 ? 129.425 92.912  134.562 1.00 327.78 ? 686  VAL A C   1 
ATOM   5125  O O   . VAL A 1 686 ? 129.260 91.739  134.188 1.00 340.63 ? 686  VAL A O   1 
ATOM   5126  C CB  . VAL A 1 686 ? 129.059 93.633  136.961 1.00 347.90 ? 686  VAL A CB  1 
ATOM   5127  C CG1 . VAL A 1 686 ? 127.801 92.765  136.905 1.00 349.28 ? 686  VAL A CG1 1 
ATOM   5128  C CG2 . VAL A 1 686 ? 129.694 93.563  138.344 1.00 363.09 ? 686  VAL A CG2 1 
ATOM   5129  N N   . THR A 1 687 ? 129.047 93.981  133.880 1.00 316.72 ? 687  THR A N   1 
ATOM   5130  C CA  . THR A 1 687 ? 128.371 93.899  132.577 1.00 331.83 ? 687  THR A CA  1 
ATOM   5131  C C   . THR A 1 687 ? 129.248 93.149  131.587 1.00 315.53 ? 687  THR A C   1 
ATOM   5132  O O   . THR A 1 687 ? 128.764 92.255  130.869 1.00 327.97 ? 687  THR A O   1 
ATOM   5133  C CB  . THR A 1 687 ? 128.037 95.297  132.013 1.00 345.21 ? 687  THR A CB  1 
ATOM   5134  O OG1 . THR A 1 687 ? 127.201 95.997  132.942 1.00 363.85 ? 687  THR A OG1 1 
ATOM   5135  C CG2 . THR A 1 687 ? 127.310 95.199  130.677 1.00 359.48 ? 687  THR A CG2 1 
ATOM   5136  N N   . TYR A 1 688 ? 130.525 93.531  131.577 1.00 310.25 ? 688  TYR A N   1 
ATOM   5137  C CA  . TYR A 1 688 ? 131.518 92.918  130.687 1.00 327.37 ? 688  TYR A CA  1 
ATOM   5138  C C   . TYR A 1 688 ? 131.600 91.419  130.937 1.00 324.39 ? 688  TYR A C   1 
ATOM   5139  O O   . TYR A 1 688 ? 131.601 90.614  129.992 1.00 332.08 ? 688  TYR A O   1 
ATOM   5140  C CB  . TYR A 1 688 ? 132.900 93.561  130.830 1.00 347.77 ? 688  TYR A CB  1 
ATOM   5141  C CG  . TYR A 1 688 ? 133.904 93.085  129.808 1.00 360.90 ? 688  TYR A CG  1 
ATOM   5142  C CD1 . TYR A 1 688 ? 133.976 93.680  128.550 1.00 383.91 ? 688  TYR A CD1 1 
ATOM   5143  C CD2 . TYR A 1 688 ? 134.788 92.045  130.097 1.00 377.51 ? 688  TYR A CD2 1 
ATOM   5144  C CE1 . TYR A 1 688 ? 134.898 93.251  127.605 1.00 417.10 ? 688  TYR A CE1 1 
ATOM   5145  C CE2 . TYR A 1 688 ? 135.713 91.608  129.160 1.00 410.54 ? 688  TYR A CE2 1 
ATOM   5146  C CZ  . TYR A 1 688 ? 135.765 92.214  127.915 1.00 425.42 ? 688  TYR A CZ  1 
ATOM   5147  O OH  . TYR A 1 688 ? 136.680 91.787  126.979 1.00 439.63 ? 688  TYR A OH  1 
ATOM   5148  N N   . CYS A 1 689 ? 131.663 91.084  132.221 1.00 336.35 ? 689  CYS A N   1 
ATOM   5149  C CA  . CYS A 1 689 ? 131.750 89.690  132.670 1.00 355.44 ? 689  CYS A CA  1 
ATOM   5150  C C   . CYS A 1 689 ? 130.551 88.897  132.161 1.00 349.15 ? 689  CYS A C   1 
ATOM   5151  O O   . CYS A 1 689 ? 130.702 87.782  131.634 1.00 383.26 ? 689  CYS A O   1 
ATOM   5152  C CB  . CYS A 1 689 ? 131.868 89.588  134.195 1.00 385.10 ? 689  CYS A CB  1 
ATOM   5153  S SG  . CYS A 1 689 ? 133.478 90.107  134.832 1.00 406.47 ? 689  CYS A SG  1 
ATOM   5154  N N   . ILE A 1 690 ? 129.385 89.506  132.329 1.00 330.76 ? 690  ILE A N   1 
ATOM   5155  C CA  . ILE A 1 690 ? 128.115 88.905  131.912 1.00 342.13 ? 690  ILE A CA  1 
ATOM   5156  C C   . ILE A 1 690 ? 128.140 88.616  130.410 1.00 330.70 ? 690  ILE A C   1 
ATOM   5157  O O   . ILE A 1 690 ? 127.756 87.523  129.967 1.00 345.56 ? 690  ILE A O   1 
ATOM   5158  C CB  . ILE A 1 690 ? 126.881 89.688  132.405 1.00 351.06 ? 690  ILE A CB  1 
ATOM   5159  C CG1 . ILE A 1 690 ? 126.831 89.662  133.940 1.00 352.43 ? 690  ILE A CG1 1 
ATOM   5160  C CG2 . ILE A 1 690 ? 125.599 89.054  131.883 1.00 356.25 ? 690  ILE A CG2 1 
ATOM   5161  C CD1 . ILE A 1 690 ? 126.090 90.831  134.546 1.00 370.95 ? 690  ILE A CD1 1 
ATOM   5162  N N   . ASN A 1 691 ? 128.607 89.611  129.669 1.00 323.38 ? 691  ASN A N   1 
ATOM   5163  C CA  . ASN A 1 691 ? 128.714 89.530  128.210 1.00 337.09 ? 691  ASN A CA  1 
ATOM   5164  C C   . ASN A 1 691 ? 129.603 88.357  127.811 1.00 341.29 ? 691  ASN A C   1 
ATOM   5165  O O   . ASN A 1 691 ? 129.256 87.565  126.922 1.00 361.61 ? 691  ASN A O   1 
ATOM   5166  C CB  . ASN A 1 691 ? 129.232 90.849  127.620 1.00 342.58 ? 691  ASN A CB  1 
ATOM   5167  C CG  . ASN A 1 691 ? 128.612 91.173  126.278 1.00 345.28 ? 691  ASN A CG  1 
ATOM   5168  O OD1 . ASN A 1 691 ? 127.388 91.189  126.135 1.00 333.58 ? 691  ASN A OD1 1 
ATOM   5169  N ND2 . ASN A 1 691 ? 129.454 91.456  125.290 1.00 365.61 ? 691  ASN A ND2 1 
ATOM   5170  N N   . ALA A 1 692 ? 130.735 88.273  128.499 1.00 342.11 ? 692  ALA A N   1 
ATOM   5171  C CA  . ALA A 1 692 ? 131.725 87.215  128.273 1.00 357.64 ? 692  ALA A CA  1 
ATOM   5172  C C   . ALA A 1 692 ? 131.090 85.845  128.481 1.00 343.57 ? 692  ALA A C   1 
ATOM   5173  O O   . ALA A 1 692 ? 131.264 84.930  127.663 1.00 370.08 ? 692  ALA A O   1 
ATOM   5174  C CB  . ALA A 1 692 ? 132.936 87.387  129.182 1.00 386.38 ? 692  ALA A CB  1 
ATOM   5175  N N   . LYS A 1 693 ? 130.355 85.718  129.582 1.00 324.13 ? 693  LYS A N   1 
ATOM   5176  C CA  . LYS A 1 693 ? 129.702 84.475  129.964 1.00 334.78 ? 693  LYS A CA  1 
ATOM   5177  C C   . LYS A 1 693 ? 128.205 84.540  129.654 1.00 330.14 ? 693  LYS A C   1 
ATOM   5178  O O   . LYS A 1 693 ? 127.373 84.184  130.489 1.00 331.61 ? 693  LYS A O   1 
ATOM   5179  C CB  . LYS A 1 693 ? 129.944 84.212  131.458 1.00 357.25 ? 693  LYS A CB  1 
ATOM   5180  C CG  . LYS A 1 693 ? 131.405 84.265  131.896 1.00 368.58 ? 693  LYS A CG  1 
ATOM   5181  C CD  . LYS A 1 693 ? 132.297 83.385  131.030 1.00 399.95 ? 693  LYS A CD  1 
ATOM   5182  C CE  . LYS A 1 693 ? 133.595 83.012  131.731 1.00 426.12 ? 693  LYS A CE  1 
ATOM   5183  N NZ  . LYS A 1 693 ? 133.403 82.029  132.837 1.00 427.26 ? 693  LYS A NZ  1 
ATOM   5184  N N   . ALA A 1 694 ? 127.866 84.986  128.445 1.00 350.07 ? 694  ALA A N   1 
ATOM   5185  C CA  . ALA A 1 694 ? 126.468 85.131  128.032 1.00 382.74 ? 694  ALA A CA  1 
ATOM   5186  C C   . ALA A 1 694 ? 125.827 83.762  127.845 1.00 398.52 ? 694  ALA A C   1 
ATOM   5187  O O   . ALA A 1 694 ? 124.816 83.448  128.474 1.00 394.59 ? 694  ALA A O   1 
ATOM   5188  C CB  . ALA A 1 694 ? 126.369 85.939  126.745 1.00 389.01 ? 694  ALA A CB  1 
ATOM   5189  N N   . ASP A 1 695 ? 126.447 82.948  126.995 1.00 412.43 ? 695  ASP A N   1 
ATOM   5190  C CA  . ASP A 1 695 ? 125.976 81.587  126.720 1.00 422.26 ? 695  ASP A CA  1 
ATOM   5191  C C   . ASP A 1 695 ? 126.182 80.635  127.909 1.00 410.86 ? 695  ASP A C   1 
ATOM   5192  O O   . ASP A 1 695 ? 125.469 79.635  128.033 1.00 404.89 ? 695  ASP A O   1 
ATOM   5193  C CB  . ASP A 1 695 ? 126.671 81.020  125.474 1.00 440.90 ? 695  ASP A CB  1 
ATOM   5194  C CG  . ASP A 1 695 ? 126.379 81.829  124.214 1.00 445.89 ? 695  ASP A CG  1 
ATOM   5195  O OD1 . ASP A 1 695 ? 126.347 83.077  124.290 1.00 437.35 ? 695  ASP A OD1 1 
ATOM   5196  O OD2 . ASP A 1 695 ? 126.194 81.214  123.142 1.00 460.62 ? 695  ASP A OD2 1 
ATOM   5197  N N   . VAL A 1 696 ? 127.144 80.952  128.777 1.00 387.78 ? 696  VAL A N   1 
ATOM   5198  C CA  . VAL A 1 696 ? 127.462 80.125  129.942 1.00 381.94 ? 696  VAL A CA  1 
ATOM   5199  C C   . VAL A 1 696 ? 126.449 80.358  131.069 1.00 381.38 ? 696  VAL A C   1 
ATOM   5200  O O   . VAL A 1 696 ? 125.906 79.397  131.621 1.00 381.90 ? 696  VAL A O   1 
ATOM   5201  C CB  . VAL A 1 696 ? 128.900 80.394  130.452 1.00 387.02 ? 696  VAL A CB  1 
ATOM   5202  C CG1 . VAL A 1 696 ? 129.226 79.527  131.667 1.00 387.84 ? 696  VAL A CG1 1 
ATOM   5203  C CG2 . VAL A 1 696 ? 129.913 80.160  129.334 1.00 396.59 ? 696  VAL A CG2 1 
ATOM   5204  N N   . LEU A 1 697 ? 126.205 81.626  131.408 1.00 369.34 ? 697  LEU A N   1 
ATOM   5205  C CA  . LEU A 1 697 ? 125.250 81.985  132.473 1.00 360.58 ? 697  LEU A CA  1 
ATOM   5206  C C   . LEU A 1 697 ? 123.800 81.631  132.153 1.00 361.43 ? 697  LEU A C   1 
ATOM   5207  O O   . LEU A 1 697 ? 123.007 81.403  133.069 1.00 334.03 ? 697  LEU A O   1 
ATOM   5208  C CB  . LEU A 1 697 ? 125.316 83.483  132.800 1.00 354.93 ? 697  LEU A CB  1 
ATOM   5209  C CG  . LEU A 1 697 ? 126.561 83.987  133.532 1.00 374.03 ? 697  LEU A CG  1 
ATOM   5210  C CD1 . LEU A 1 697 ? 126.620 85.507  133.483 1.00 382.48 ? 697  LEU A CD1 1 
ATOM   5211  C CD2 . LEU A 1 697 ? 126.588 83.497  134.972 1.00 388.00 ? 697  LEU A CD2 1 
ATOM   5212  N N   . PHE A 1 698 ? 123.457 81.608  130.865 1.00 386.91 ? 698  PHE A N   1 
ATOM   5213  C CA  . PHE A 1 698 ? 122.089 81.355  130.421 1.00 396.05 ? 698  PHE A CA  1 
ATOM   5214  C C   . PHE A 1 698 ? 122.016 80.105  129.544 1.00 397.29 ? 698  PHE A C   1 
ATOM   5215  O O   . PHE A 1 698 ? 121.601 79.035  129.998 1.00 362.80 ? 698  PHE A O   1 
ATOM   5216  C CB  . PHE A 1 698 ? 121.552 82.567  129.653 1.00 388.60 ? 698  PHE A CB  1 
ATOM   5217  C CG  . PHE A 1 698 ? 121.854 83.903  130.305 1.00 386.91 ? 698  PHE A CG  1 
ATOM   5218  C CD1 . PHE A 1 698 ? 121.632 84.118  131.662 1.00 379.55 ? 698  PHE A CD1 1 
ATOM   5219  C CD2 . PHE A 1 698 ? 122.335 84.961  129.546 1.00 389.97 ? 698  PHE A CD2 1 
ATOM   5220  C CE1 . PHE A 1 698 ? 121.899 85.349  132.248 1.00 353.31 ? 698  PHE A CE1 1 
ATOM   5221  C CE2 . PHE A 1 698 ? 122.605 86.195  130.124 1.00 377.41 ? 698  PHE A CE2 1 
ATOM   5222  C CZ  . PHE A 1 698 ? 122.387 86.388  131.478 1.00 357.53 ? 698  PHE A CZ  1 
ATOM   5223  N N   . GLY B 2 78  ? 119.807 96.620  105.281 1.00 436.00 ? 78   GLY B N   1 
ATOM   5224  C CA  . GLY B 2 78  ? 120.438 96.107  106.532 1.00 423.04 ? 78   GLY B CA  1 
ATOM   5225  C C   . GLY B 2 78  ? 120.433 97.125  107.659 1.00 391.70 ? 78   GLY B C   1 
ATOM   5226  O O   . GLY B 2 78  ? 120.303 98.328  107.424 1.00 386.04 ? 78   GLY B O   1 
ATOM   5227  N N   . ALA B 2 79  ? 120.575 96.627  108.885 1.00 385.93 ? 79   ALA B N   1 
ATOM   5228  C CA  . ALA B 2 79  ? 120.642 97.464  110.085 1.00 387.27 ? 79   ALA B CA  1 
ATOM   5229  C C   . ALA B 2 79  ? 121.913 98.289  110.143 1.00 363.73 ? 79   ALA B C   1 
ATOM   5230  O O   . ALA B 2 79  ? 121.876 99.442  110.600 1.00 339.45 ? 79   ALA B O   1 
ATOM   5231  C CB  . ALA B 2 79  ? 120.525 96.604  111.336 1.00 411.32 ? 79   ALA B CB  1 
ATOM   5232  N N   . LYS B 2 80  ? 123.010 97.699  109.656 1.00 365.17 ? 80   LYS B N   1 
ATOM   5233  C CA  . LYS B 2 80  ? 124.304 98.370  109.605 1.00 366.70 ? 80   LYS B CA  1 
ATOM   5234  C C   . LYS B 2 80  ? 124.205 99.650  108.787 1.00 344.59 ? 80   LYS B C   1 
ATOM   5235  O O   . LYS B 2 80  ? 124.709 100.705 109.208 1.00 365.24 ? 80   LYS B O   1 
ATOM   5236  C CB  . LYS B 2 80  ? 125.396 97.455  109.042 1.00 382.22 ? 80   LYS B CB  1 
ATOM   5237  C CG  . LYS B 2 80  ? 126.808 97.990  109.251 1.00 385.04 ? 80   LYS B CG  1 
ATOM   5238  C CD  . LYS B 2 80  ? 127.863 96.896  109.137 1.00 409.04 ? 80   LYS B CD  1 
ATOM   5239  C CE  . LYS B 2 80  ? 127.974 96.049  110.402 1.00 411.57 ? 80   LYS B CE  1 
ATOM   5240  N NZ  . LYS B 2 80  ? 128.478 96.804  111.585 1.00 410.68 ? 80   LYS B NZ  1 
ATOM   5241  N N   . HIS B 2 81  ? 123.547 99.528  107.636 1.00 357.74 ? 81   HIS B N   1 
ATOM   5242  C CA  . HIS B 2 81  ? 123.350 100.652 106.719 1.00 382.07 ? 81   HIS B CA  1 
ATOM   5243  C C   . HIS B 2 81  ? 122.608 101.785 107.428 1.00 354.87 ? 81   HIS B C   1 
ATOM   5244  O O   . HIS B 2 81  ? 122.996 102.957 107.332 1.00 377.78 ? 81   HIS B O   1 
ATOM   5245  C CB  . HIS B 2 81  ? 122.582 100.210 105.466 1.00 411.90 ? 81   HIS B CB  1 
ATOM   5246  C CG  . HIS B 2 81  ? 122.456 101.278 104.423 1.00 433.88 ? 81   HIS B CG  1 
ATOM   5247  N ND1 . HIS B 2 81  ? 121.326 102.056 104.288 1.00 435.54 ? 81   HIS B ND1 1 
ATOM   5248  C CD2 . HIS B 2 81  ? 123.321 101.701 103.471 1.00 450.62 ? 81   HIS B CD2 1 
ATOM   5249  C CE1 . HIS B 2 81  ? 121.499 102.911 103.295 1.00 443.80 ? 81   HIS B CE1 1 
ATOM   5250  N NE2 . HIS B 2 81  ? 122.701 102.717 102.783 1.00 455.05 ? 81   HIS B NE2 1 
ATOM   5251  N N   . VAL B 2 82  ? 121.552 101.391 108.133 1.00 327.58 ? 82   VAL B N   1 
ATOM   5252  C CA  . VAL B 2 82  ? 120.696 102.322 108.867 1.00 353.39 ? 82   VAL B CA  1 
ATOM   5253  C C   . VAL B 2 82  ? 121.545 103.079 109.905 1.00 358.60 ? 82   VAL B C   1 
ATOM   5254  O O   . VAL B 2 82  ? 121.442 104.309 110.034 1.00 382.29 ? 82   VAL B O   1 
ATOM   5255  C CB  . VAL B 2 82  ? 119.494 101.636 109.556 1.00 393.02 ? 82   VAL B CB  1 
ATOM   5256  C CG1 . VAL B 2 82  ? 118.663 102.659 110.338 1.00 400.27 ? 82   VAL B CG1 1 
ATOM   5257  C CG2 . VAL B 2 82  ? 118.634 100.883 108.538 1.00 411.20 ? 82   VAL B CG2 1 
ATOM   5258  N N   . ILE B 2 83  ? 122.364 102.312 110.619 1.00 342.81 ? 83   ILE B N   1 
ATOM   5259  C CA  . ILE B 2 83  ? 123.196 102.934 111.656 1.00 320.50 ? 83   ILE B CA  1 
ATOM   5260  C C   . ILE B 2 83  ? 124.186 103.899 111.053 1.00 321.85 ? 83   ILE B C   1 
ATOM   5261  O O   . ILE B 2 83  ? 124.375 104.986 111.608 1.00 325.50 ? 83   ILE B O   1 
ATOM   5262  C CB  . ILE B 2 83  ? 123.851 101.955 112.679 1.00 312.43 ? 83   ILE B CB  1 
ATOM   5263  C CG1 . ILE B 2 83  ? 124.201 102.717 113.964 1.00 353.15 ? 83   ILE B CG1 1 
ATOM   5264  C CG2 . ILE B 2 83  ? 125.115 101.286 112.143 1.00 340.49 ? 83   ILE B CG2 1 
ATOM   5265  C CD1 . ILE B 2 83  ? 124.444 101.843 115.176 1.00 381.37 ? 83   ILE B CD1 1 
ATOM   5266  N N   . MET B 2 84  ? 124.753 103.558 109.902 1.00 352.12 ? 84   MET B N   1 
ATOM   5267  C CA  . MET B 2 84  ? 125.696 104.448 109.242 1.00 359.37 ? 84   MET B CA  1 
ATOM   5268  C C   . MET B 2 84  ? 124.970 105.745 108.918 1.00 353.45 ? 84   MET B C   1 
ATOM   5269  O O   . MET B 2 84  ? 125.526 106.834 109.064 1.00 378.84 ? 84   MET B O   1 
ATOM   5270  C CB  . MET B 2 84  ? 126.238 103.809 107.963 1.00 385.65 ? 84   MET B CB  1 
ATOM   5271  C CG  . MET B 2 84  ? 127.658 103.281 108.087 1.00 422.70 ? 84   MET B CG  1 
ATOM   5272  S SD  . MET B 2 84  ? 128.008 101.947 106.926 1.00 477.01 ? 84   MET B SD  1 
ATOM   5273  C CE  . MET B 2 84  ? 129.775 102.146 106.705 1.00 456.43 ? 84   MET B CE  1 
ATOM   5274  N N   . LEU B 2 85  ? 123.719 105.622 108.488 1.00 344.25 ? 85   LEU B N   1 
ATOM   5275  C CA  . LEU B 2 85  ? 122.862 106.790 108.273 1.00 348.55 ? 85   LEU B CA  1 
ATOM   5276  C C   . LEU B 2 85  ? 122.640 107.651 109.544 1.00 333.42 ? 85   LEU B C   1 
ATOM   5277  O O   . LEU B 2 85  ? 122.638 108.879 109.448 1.00 344.04 ? 85   LEU B O   1 
ATOM   5278  C CB  . LEU B 2 85  ? 121.521 106.346 107.665 1.00 357.48 ? 85   LEU B CB  1 
ATOM   5279  C CG  . LEU B 2 85  ? 121.026 107.192 106.500 1.00 364.17 ? 85   LEU B CG  1 
ATOM   5280  C CD1 . LEU B 2 85  ? 119.842 106.524 105.805 1.00 376.88 ? 85   LEU B CD1 1 
ATOM   5281  C CD2 . LEU B 2 85  ? 120.706 108.589 106.999 1.00 378.53 ? 85   LEU B CD2 1 
ATOM   5282  N N   . PHE B 2 86  ? 122.451 107.024 110.711 1.00 327.87 ? 86   PHE B N   1 
ATOM   5283  C CA  . PHE B 2 86  ? 122.361 107.756 111.995 1.00 334.00 ? 86   PHE B CA  1 
ATOM   5284  C C   . PHE B 2 86  ? 123.664 108.487 112.363 1.00 327.34 ? 86   PHE B C   1 
ATOM   5285  O O   . PHE B 2 86  ? 123.669 109.685 112.613 1.00 348.85 ? 86   PHE B O   1 
ATOM   5286  C CB  . PHE B 2 86  ? 122.121 106.816 113.203 1.00 340.68 ? 86   PHE B CB  1 
ATOM   5287  C CG  . PHE B 2 86  ? 120.713 106.311 113.388 1.00 343.85 ? 86   PHE B CG  1 
ATOM   5288  C CD1 . PHE B 2 86  ? 119.597 106.914 112.806 1.00 363.34 ? 86   PHE B CD1 1 
ATOM   5289  C CD2 . PHE B 2 86  ? 120.511 105.224 114.240 1.00 323.48 ? 86   PHE B CD2 1 
ATOM   5290  C CE1 . PHE B 2 86  ? 118.325 106.411 113.039 1.00 372.87 ? 86   PHE B CE1 1 
ATOM   5291  C CE2 . PHE B 2 86  ? 119.245 104.721 114.474 1.00 331.18 ? 86   PHE B CE2 1 
ATOM   5292  C CZ  . PHE B 2 86  ? 118.149 105.316 113.874 1.00 364.65 ? 86   PHE B CZ  1 
ATOM   5293  N N   . VAL B 2 87  ? 124.736 107.704 112.490 1.00 321.70 ? 87   VAL B N   1 
ATOM   5294  C CA  . VAL B 2 87  ? 125.909 108.081 113.309 1.00 318.47 ? 87   VAL B CA  1 
ATOM   5295  C C   . VAL B 2 87  ? 126.427 109.460 113.016 1.00 338.09 ? 87   VAL B C   1 
ATOM   5296  O O   . VAL B 2 87  ? 126.597 110.254 113.969 1.00 373.48 ? 87   VAL B O   1 
ATOM   5297  C CB  . VAL B 2 87  ? 127.039 107.010 113.239 1.00 348.25 ? 87   VAL B CB  1 
ATOM   5298  C CG1 . VAL B 2 87  ? 128.363 107.529 113.808 1.00 349.13 ? 87   VAL B CG1 1 
ATOM   5299  C CG2 . VAL B 2 87  ? 126.612 105.742 113.972 1.00 371.90 ? 87   VAL B CG2 1 
ATOM   5300  N N   . PRO B 2 88  ? 126.693 109.751 111.717 1.00 337.39 ? 88   PRO B N   1 
ATOM   5301  C CA  . PRO B 2 88  ? 127.195 111.065 111.325 1.00 345.62 ? 88   PRO B CA  1 
ATOM   5302  C C   . PRO B 2 88  ? 126.217 112.152 111.731 1.00 337.18 ? 88   PRO B C   1 
ATOM   5303  O O   . PRO B 2 88  ? 126.632 113.193 112.274 1.00 356.83 ? 88   PRO B O   1 
ATOM   5304  C CB  . PRO B 2 88  ? 127.316 110.975 109.797 1.00 366.08 ? 88   PRO B CB  1 
ATOM   5305  C CG  . PRO B 2 88  ? 127.329 109.525 109.493 1.00 373.40 ? 88   PRO B CG  1 
ATOM   5306  C CD  . PRO B 2 88  ? 126.442 108.921 110.530 1.00 334.43 ? 88   PRO B CD  1 
ATOM   5307  N N   . VAL B 2 89  ? 124.932 111.877 111.473 1.00 314.59 ? 89   VAL B N   1 
ATOM   5308  C CA  . VAL B 2 89  ? 123.855 112.816 111.799 1.00 335.46 ? 89   VAL B CA  1 
ATOM   5309  C C   . VAL B 2 89  ? 123.860 113.118 113.295 1.00 322.90 ? 89   VAL B C   1 
ATOM   5310  O O   . VAL B 2 89  ? 123.761 114.285 113.711 1.00 337.78 ? 89   VAL B O   1 
ATOM   5311  C CB  . VAL B 2 89  ? 122.442 112.269 111.409 1.00 330.52 ? 89   VAL B CB  1 
ATOM   5312  C CG1 . VAL B 2 89  ? 121.317 113.156 111.944 1.00 322.94 ? 89   VAL B CG1 1 
ATOM   5313  C CG2 . VAL B 2 89  ? 122.303 112.099 109.901 1.00 336.69 ? 89   VAL B CG2 1 
ATOM   5314  N N   . THR B 2 90  ? 123.974 112.044 114.069 1.00 308.95 ? 90   THR B N   1 
ATOM   5315  C CA  . THR B 2 90  ? 123.993 112.116 115.532 1.00 304.93 ? 90   THR B CA  1 
ATOM   5316  C C   . THR B 2 90  ? 125.137 113.009 115.996 1.00 304.37 ? 90   THR B C   1 
ATOM   5317  O O   . THR B 2 90  ? 124.955 113.878 116.861 1.00 324.01 ? 90   THR B O   1 
ATOM   5318  C CB  . THR B 2 90  ? 124.100 110.707 116.175 1.00 345.88 ? 90   THR B CB  1 
ATOM   5319  O OG1 . THR B 2 90  ? 122.895 109.974 115.923 1.00 358.90 ? 90   THR B OG1 1 
ATOM   5320  C CG2 . THR B 2 90  ? 124.343 110.776 117.697 1.00 348.67 ? 90   THR B CG2 1 
ATOM   5321  N N   . LEU B 2 91  ? 126.320 112.783 115.433 1.00 322.52 ? 91   LEU B N   1 
ATOM   5322  C CA  . LEU B 2 91  ? 127.504 113.550 115.801 1.00 328.31 ? 91   LEU B CA  1 
ATOM   5323  C C   . LEU B 2 91  ? 127.314 115.021 115.459 1.00 322.67 ? 91   LEU B C   1 
ATOM   5324  O O   . LEU B 2 91  ? 127.697 115.903 116.228 1.00 314.48 ? 91   LEU B O   1 
ATOM   5325  C CB  . LEU B 2 91  ? 128.742 112.999 115.090 1.00 324.91 ? 91   LEU B CB  1 
ATOM   5326  C CG  . LEU B 2 91  ? 129.533 111.926 115.839 1.00 377.70 ? 91   LEU B CG  1 
ATOM   5327  C CD1 . LEU B 2 91  ? 129.709 110.686 114.975 1.00 394.07 ? 91   LEU B CD1 1 
ATOM   5328  C CD2 . LEU B 2 91  ? 130.882 112.467 116.287 1.00 403.53 ? 91   LEU B CD2 1 
ATOM   5329  N N   . CYS B 2 92  ? 126.716 115.277 114.301 1.00 322.81 ? 92   CYS B N   1 
ATOM   5330  C CA  . CYS B 2 92  ? 126.423 116.647 113.874 1.00 343.79 ? 92   CYS B CA  1 
ATOM   5331  C C   . CYS B 2 92  ? 125.530 117.339 114.899 1.00 336.84 ? 92   CYS B C   1 
ATOM   5332  O O   . CYS B 2 92  ? 125.784 118.489 115.303 1.00 322.64 ? 92   CYS B O   1 
ATOM   5333  C CB  . CYS B 2 92  ? 125.776 116.695 112.491 1.00 351.78 ? 92   CYS B CB  1 
ATOM   5334  S SG  . CYS B 2 92  ? 125.690 118.378 111.848 1.00 342.73 ? 92   CYS B SG  1 
ATOM   5335  N N   . MET B 2 93  ? 124.498 116.606 115.301 1.00 332.43 ? 93   MET B N   1 
ATOM   5336  C CA  . MET B 2 93  ? 123.517 117.086 116.281 1.00 314.64 ? 93   MET B CA  1 
ATOM   5337  C C   . MET B 2 93  ? 124.213 117.450 117.583 1.00 319.99 ? 93   MET B C   1 
ATOM   5338  O O   . MET B 2 93  ? 123.962 118.515 118.165 1.00 316.58 ? 93   MET B O   1 
ATOM   5339  C CB  . MET B 2 93  ? 122.423 116.043 116.542 1.00 339.47 ? 93   MET B CB  1 
ATOM   5340  C CG  . MET B 2 93  ? 121.619 115.631 115.314 1.00 368.53 ? 93   MET B CG  1 
ATOM   5341  S SD  . MET B 2 93  ? 120.010 116.397 115.125 1.00 404.86 ? 93   MET B SD  1 
ATOM   5342  C CE  . MET B 2 93  ? 119.107 115.611 116.446 1.00 384.82 ? 93   MET B CE  1 
ATOM   5343  N N   . VAL B 2 94  ? 125.084 116.546 118.010 1.00 310.14 ? 94   VAL B N   1 
ATOM   5344  C CA  . VAL B 2 94  ? 125.863 116.703 119.245 1.00 293.52 ? 94   VAL B CA  1 
ATOM   5345  C C   . VAL B 2 94  ? 126.686 117.983 119.185 1.00 308.77 ? 94   VAL B C   1 
ATOM   5346  O O   . VAL B 2 94  ? 126.712 118.769 120.136 1.00 300.51 ? 94   VAL B O   1 
ATOM   5347  C CB  . VAL B 2 94  ? 126.805 115.497 119.468 1.00 306.35 ? 94   VAL B CB  1 
ATOM   5348  C CG1 . VAL B 2 94  ? 127.852 115.780 120.551 1.00 332.49 ? 94   VAL B CG1 1 
ATOM   5349  C CG2 . VAL B 2 94  ? 126.000 114.238 119.782 1.00 338.63 ? 94   VAL B CG2 1 
ATOM   5350  N N   . VAL B 2 95  ? 127.345 118.153 118.042 1.00 319.35 ? 95   VAL B N   1 
ATOM   5351  C CA  . VAL B 2 95  ? 128.209 119.308 117.783 1.00 320.04 ? 95   VAL B CA  1 
ATOM   5352  C C   . VAL B 2 95  ? 127.394 120.596 117.916 1.00 330.00 ? 95   VAL B C   1 
ATOM   5353  O O   . VAL B 2 95  ? 127.833 121.568 118.595 1.00 344.03 ? 95   VAL B O   1 
ATOM   5354  C CB  . VAL B 2 95  ? 128.860 119.261 116.381 1.00 310.43 ? 95   VAL B CB  1 
ATOM   5355  C CG1 . VAL B 2 95  ? 129.581 120.572 116.067 1.00 320.93 ? 95   VAL B CG1 1 
ATOM   5356  C CG2 . VAL B 2 95  ? 129.824 118.083 116.273 1.00 340.96 ? 95   VAL B CG2 1 
ATOM   5357  N N   . VAL B 2 96  ? 126.220 120.569 117.289 1.00 316.64 ? 96   VAL B N   1 
ATOM   5358  C CA  . VAL B 2 96  ? 125.344 121.736 117.260 1.00 291.68 ? 96   VAL B CA  1 
ATOM   5359  C C   . VAL B 2 96  ? 124.915 122.072 118.702 1.00 305.30 ? 96   VAL B C   1 
ATOM   5360  O O   . VAL B 2 96  ? 124.928 123.246 119.108 1.00 278.11 ? 96   VAL B O   1 
ATOM   5361  C CB  . VAL B 2 96  ? 124.173 121.563 116.303 1.00 314.58 ? 96   VAL B CB  1 
ATOM   5362  C CG1 . VAL B 2 96  ? 123.245 122.775 116.360 1.00 321.98 ? 96   VAL B CG1 1 
ATOM   5363  C CG2 . VAL B 2 96  ? 124.737 121.356 114.907 1.00 331.34 ? 96   VAL B CG2 1 
ATOM   5364  N N   . VAL B 2 97  ? 124.584 121.037 119.466 1.00 305.17 ? 97   VAL B N   1 
ATOM   5365  C CA  . VAL B 2 97  ? 123.893 121.165 120.723 1.00 308.38 ? 97   VAL B CA  1 
ATOM   5366  C C   . VAL B 2 97  ? 124.890 121.707 121.734 1.00 313.32 ? 97   VAL B C   1 
ATOM   5367  O O   . VAL B 2 97  ? 124.594 122.675 122.446 1.00 322.52 ? 97   VAL B O   1 
ATOM   5368  C CB  . VAL B 2 97  ? 123.276 119.829 121.187 1.00 304.89 ? 97   VAL B CB  1 
ATOM   5369  C CG1 . VAL B 2 97  ? 122.914 119.859 122.670 1.00 304.14 ? 97   VAL B CG1 1 
ATOM   5370  C CG2 . VAL B 2 97  ? 122.044 119.517 120.346 1.00 315.79 ? 97   VAL B CG2 1 
ATOM   5371  N N   . ALA B 2 98  ? 126.013 121.005 121.840 1.00 291.74 ? 98   ALA B N   1 
ATOM   5372  C CA  . ALA B 2 98  ? 127.046 121.288 122.832 1.00 305.71 ? 98   ALA B CA  1 
ATOM   5373  C C   . ALA B 2 98  ? 127.543 122.711 122.679 1.00 300.01 ? 98   ALA B C   1 
ATOM   5374  O O   . ALA B 2 98  ? 127.667 123.444 123.677 1.00 330.76 ? 98   ALA B O   1 
ATOM   5375  C CB  . ALA B 2 98  ? 128.215 120.334 122.658 1.00 348.33 ? 98   ALA B CB  1 
ATOM   5376  N N   . THR B 2 99  ? 127.842 123.101 121.444 1.00 319.80 ? 99   THR B N   1 
ATOM   5377  C CA  . THR B 2 99  ? 128.354 124.437 121.163 1.00 337.81 ? 99   THR B CA  1 
ATOM   5378  C C   . THR B 2 99  ? 127.324 125.491 121.544 1.00 310.59 ? 99   THR B C   1 
ATOM   5379  O O   . THR B 2 99  ? 127.665 126.535 122.099 1.00 332.39 ? 99   THR B O   1 
ATOM   5380  C CB  . THR B 2 99  ? 128.720 124.601 119.677 1.00 342.71 ? 99   THR B CB  1 
ATOM   5381  O OG1 . THR B 2 99  ? 129.821 123.741 119.355 1.00 338.55 ? 99   THR B OG1 1 
ATOM   5382  C CG2 . THR B 2 99  ? 129.105 126.042 119.380 1.00 344.16 ? 99   THR B CG2 1 
ATOM   5383  N N   . ILE B 2 100 ? 126.061 125.208 121.244 1.00 283.49 ? 100  ILE B N   1 
ATOM   5384  C CA  . ILE B 2 100 ? 124.967 126.119 121.603 1.00 309.11 ? 100  ILE B CA  1 
ATOM   5385  C C   . ILE B 2 100 ? 124.921 126.319 123.111 1.00 297.28 ? 100  ILE B C   1 
ATOM   5386  O O   . ILE B 2 100 ? 124.800 127.456 123.594 1.00 312.61 ? 100  ILE B O   1 
ATOM   5387  C CB  . ILE B 2 100 ? 123.600 125.715 121.007 1.00 308.94 ? 100  ILE B CB  1 
ATOM   5388  C CG1 . ILE B 2 100 ? 123.607 126.005 119.510 1.00 313.05 ? 100  ILE B CG1 1 
ATOM   5389  C CG2 . ILE B 2 100 ? 122.453 126.511 121.629 1.00 300.87 ? 100  ILE B CG2 1 
ATOM   5390  C CD1 . ILE B 2 100 ? 122.558 125.246 118.744 1.00 348.62 ? 100  ILE B CD1 1 
ATOM   5391  N N   . LYS B 2 101 ? 125.032 125.202 123.820 1.00 303.45 ? 101  LYS B N   1 
ATOM   5392  C CA  . LYS B 2 101 ? 125.008 125.189 125.283 1.00 343.46 ? 101  LYS B CA  1 
ATOM   5393  C C   . LYS B 2 101 ? 126.131 126.053 125.833 1.00 339.19 ? 101  LYS B C   1 
ATOM   5394  O O   . LYS B 2 101 ? 125.903 126.874 126.751 1.00 347.71 ? 101  LYS B O   1 
ATOM   5395  C CB  . LYS B 2 101 ? 125.065 123.778 125.878 1.00 357.65 ? 101  LYS B CB  1 
ATOM   5396  C CG  . LYS B 2 101 ? 123.865 122.879 125.597 1.00 364.29 ? 101  LYS B CG  1 
ATOM   5397  C CD  . LYS B 2 101 ? 122.498 123.520 125.794 1.00 367.03 ? 101  LYS B CD  1 
ATOM   5398  C CE  . LYS B 2 101 ? 122.285 124.039 127.203 1.00 372.32 ? 101  LYS B CE  1 
ATOM   5399  N NZ  . LYS B 2 101 ? 120.869 124.460 127.401 1.00 364.97 ? 101  LYS B NZ  1 
ATOM   5400  N N   . SER B 2 102 ? 127.316 125.870 125.249 1.00 312.10 ? 102  SER B N   1 
ATOM   5401  C CA  . SER B 2 102 ? 128.550 126.448 125.833 1.00 319.51 ? 102  SER B CA  1 
ATOM   5402  C C   . SER B 2 102 ? 128.817 127.894 125.414 1.00 320.09 ? 102  SER B C   1 
ATOM   5403  O O   . SER B 2 102 ? 128.922 128.802 126.245 1.00 340.16 ? 102  SER B O   1 
ATOM   5404  C CB  . SER B 2 102 ? 129.744 125.573 125.457 1.00 318.49 ? 102  SER B CB  1 
ATOM   5405  O OG  . SER B 2 102 ? 129.908 125.515 124.053 1.00 317.00 ? 102  SER B OG  1 
ATOM   5406  N N   . VAL B 2 103 ? 128.898 128.072 124.098 1.00 287.59 ? 103  VAL B N   1 
ATOM   5407  C CA  . VAL B 2 103 ? 129.388 129.306 123.485 1.00 312.35 ? 103  VAL B CA  1 
ATOM   5408  C C   . VAL B 2 103 ? 128.449 130.512 123.660 1.00 321.65 ? 103  VAL B C   1 
ATOM   5409  O O   . VAL B 2 103 ? 128.909 131.656 123.631 1.00 330.73 ? 103  VAL B O   1 
ATOM   5410  C CB  . VAL B 2 103 ? 129.771 129.061 121.996 1.00 322.24 ? 103  VAL B CB  1 
ATOM   5411  C CG1 . VAL B 2 103 ? 130.069 130.352 121.246 1.00 346.64 ? 103  VAL B CG1 1 
ATOM   5412  C CG2 . VAL B 2 103 ? 130.982 128.139 121.922 1.00 316.93 ? 103  VAL B CG2 1 
ATOM   5413  N N   . SER B 2 104 ? 127.154 130.262 123.846 1.00 328.77 ? 104  SER B N   1 
ATOM   5414  C CA  . SER B 2 104 ? 126.155 131.313 124.116 1.00 354.13 ? 104  SER B CA  1 
ATOM   5415  C C   . SER B 2 104 ? 125.833 132.157 122.882 1.00 344.78 ? 104  SER B C   1 
ATOM   5416  O O   . SER B 2 104 ? 124.699 132.134 122.407 1.00 347.08 ? 104  SER B O   1 
ATOM   5417  C CB  . SER B 2 104 ? 126.560 132.209 125.304 1.00 370.09 ? 104  SER B CB  1 
ATOM   5418  O OG  . SER B 2 104 ? 127.410 133.279 124.919 1.00 361.09 ? 104  SER B OG  1 
ATOM   5419  N N   . PHE B 2 105 ? 126.827 132.898 122.387 1.00 330.99 ? 105  PHE B N   1 
ATOM   5420  C CA  . PHE B 2 105 ? 126.730 133.741 121.177 1.00 340.63 ? 105  PHE B CA  1 
ATOM   5421  C C   . PHE B 2 105 ? 125.650 133.368 120.159 1.00 345.11 ? 105  PHE B C   1 
ATOM   5422  O O   . PHE B 2 105 ? 124.898 134.229 119.704 1.00 360.30 ? 105  PHE B O   1 
ATOM   5423  C CB  . PHE B 2 105 ? 128.086 133.749 120.478 1.00 318.50 ? 105  PHE B CB  1 
ATOM   5424  C CG  . PHE B 2 105 ? 128.079 134.378 119.109 1.00 328.86 ? 105  PHE B CG  1 
ATOM   5425  C CD1 . PHE B 2 105 ? 128.102 135.760 118.963 1.00 341.76 ? 105  PHE B CD1 1 
ATOM   5426  C CD2 . PHE B 2 105 ? 128.106 133.584 117.959 1.00 305.66 ? 105  PHE B CD2 1 
ATOM   5427  C CE1 . PHE B 2 105 ? 128.123 136.340 117.701 1.00 336.88 ? 105  PHE B CE1 1 
ATOM   5428  C CE2 . PHE B 2 105 ? 128.135 134.160 116.700 1.00 313.58 ? 105  PHE B CE2 1 
ATOM   5429  C CZ  . PHE B 2 105 ? 128.139 135.538 116.570 1.00 318.26 ? 105  PHE B CZ  1 
ATOM   5430  N N   . TYR B 2 106 ? 125.592 132.091 119.801 1.00 328.76 ? 106  TYR B N   1 
ATOM   5431  C CA  . TYR B 2 106 ? 124.655 131.612 118.784 1.00 319.23 ? 106  TYR B CA  1 
ATOM   5432  C C   . TYR B 2 106 ? 123.173 131.709 119.179 1.00 339.23 ? 106  TYR B C   1 
ATOM   5433  O O   . TYR B 2 106 ? 122.312 131.798 118.305 1.00 348.27 ? 106  TYR B O   1 
ATOM   5434  C CB  . TYR B 2 106 ? 125.038 130.198 118.348 1.00 313.52 ? 106  TYR B CB  1 
ATOM   5435  C CG  . TYR B 2 106 ? 126.341 130.186 117.579 1.00 315.01 ? 106  TYR B CG  1 
ATOM   5436  C CD1 . TYR B 2 106 ? 126.371 130.542 116.233 1.00 320.50 ? 106  TYR B CD1 1 
ATOM   5437  C CD2 . TYR B 2 106 ? 127.544 129.843 118.198 1.00 320.40 ? 106  TYR B CD2 1 
ATOM   5438  C CE1 . TYR B 2 106 ? 127.557 130.546 115.517 1.00 338.62 ? 106  TYR B CE1 1 
ATOM   5439  C CE2 . TYR B 2 106 ? 128.740 129.844 117.489 1.00 327.08 ? 106  TYR B CE2 1 
ATOM   5440  C CZ  . TYR B 2 106 ? 128.739 130.196 116.147 1.00 338.65 ? 106  TYR B CZ  1 
ATOM   5441  O OH  . TYR B 2 106 ? 129.906 130.204 115.420 1.00 328.04 ? 106  TYR B OH  1 
ATOM   5442  N N   . THR B 2 107 ? 122.888 131.709 120.481 1.00 362.86 ? 107  THR B N   1 
ATOM   5443  C CA  . THR B 2 107 ? 121.523 131.907 120.990 1.00 373.21 ? 107  THR B CA  1 
ATOM   5444  C C   . THR B 2 107 ? 121.036 133.357 120.841 1.00 385.97 ? 107  THR B C   1 
ATOM   5445  O O   . THR B 2 107 ? 119.838 133.586 120.653 1.00 403.67 ? 107  THR B O   1 
ATOM   5446  C CB  . THR B 2 107 ? 121.406 131.503 122.476 1.00 378.68 ? 107  THR B CB  1 
ATOM   5447  O OG1 . THR B 2 107 ? 122.289 132.305 123.272 1.00 382.63 ? 107  THR B OG1 1 
ATOM   5448  C CG2 . THR B 2 107 ? 121.745 130.031 122.668 1.00 375.04 ? 107  THR B CG2 1 
ATOM   5449  N N   . ARG B 2 108 ? 121.964 134.315 120.957 1.00 363.18 ? 108  ARG B N   1 
ATOM   5450  C CA  . ARG B 2 108 ? 121.696 135.760 120.774 1.00 384.45 ? 108  ARG B CA  1 
ATOM   5451  C C   . ARG B 2 108 ? 120.793 136.072 119.570 1.00 379.86 ? 108  ARG B C   1 
ATOM   5452  O O   . ARG B 2 108 ? 120.365 137.213 119.364 1.00 337.09 ? 108  ARG B O   1 
ATOM   5453  C CB  . ARG B 2 108 ? 123.024 136.522 120.610 1.00 420.74 ? 108  ARG B CB  1 
ATOM   5454  C CG  . ARG B 2 108 ? 122.993 137.995 121.001 1.00 440.01 ? 108  ARG B CG  1 
ATOM   5455  C CD  . ARG B 2 108 ? 123.221 138.193 122.491 1.00 434.92 ? 108  ARG B CD  1 
ATOM   5456  N NE  . ARG B 2 108 ? 124.550 137.749 122.915 1.00 406.99 ? 108  ARG B NE  1 
ATOM   5457  C CZ  . ARG B 2 108 ? 125.013 137.810 124.164 1.00 413.72 ? 108  ARG B CZ  1 
ATOM   5458  N NH1 . ARG B 2 108 ? 124.268 138.311 125.150 1.00 420.35 ? 108  ARG B NH1 1 
ATOM   5459  N NH2 . ARG B 2 108 ? 126.241 137.370 124.431 1.00 426.84 ? 108  ARG B NH2 1 
ATOM   5460  N N   . ILE B 2 167 ? 131.709 126.779 93.775  1.00 436.58 ? 167  ILE B N   1 
ATOM   5461  C CA  . ILE B 2 167 ? 132.515 126.184 94.844  1.00 447.07 ? 167  ILE B CA  1 
ATOM   5462  C C   . ILE B 2 167 ? 132.894 127.171 95.963  1.00 432.63 ? 167  ILE B C   1 
ATOM   5463  O O   . ILE B 2 167 ? 133.658 126.821 96.866  1.00 422.56 ? 167  ILE B O   1 
ATOM   5464  C CB  . ILE B 2 167 ? 133.789 125.504 94.273  1.00 463.12 ? 167  ILE B CB  1 
ATOM   5465  C CG1 . ILE B 2 167 ? 134.756 126.531 93.648  1.00 456.54 ? 167  ILE B CG1 1 
ATOM   5466  C CG2 . ILE B 2 167 ? 133.404 124.443 93.250  1.00 475.71 ? 167  ILE B CG2 1 
ATOM   5467  C CD1 . ILE B 2 167 ? 135.861 127.020 94.568  1.00 445.04 ? 167  ILE B CD1 1 
ATOM   5468  N N   . ILE B 2 168 ? 132.357 128.391 95.903  1.00 423.53 ? 168  ILE B N   1 
ATOM   5469  C CA  . ILE B 2 168 ? 132.603 129.418 96.925  1.00 400.58 ? 168  ILE B CA  1 
ATOM   5470  C C   . ILE B 2 168 ? 131.716 129.141 98.144  1.00 396.84 ? 168  ILE B C   1 
ATOM   5471  O O   . ILE B 2 168 ? 132.155 129.320 99.281  1.00 391.32 ? 168  ILE B O   1 
ATOM   5472  C CB  . ILE B 2 168 ? 132.377 130.855 96.370  1.00 410.14 ? 168  ILE B CB  1 
ATOM   5473  C CG1 . ILE B 2 168 ? 133.515 131.250 95.409  1.00 438.48 ? 168  ILE B CG1 1 
ATOM   5474  C CG2 . ILE B 2 168 ? 132.286 131.891 97.492  1.00 398.27 ? 168  ILE B CG2 1 
ATOM   5475  C CD1 . ILE B 2 168 ? 133.481 130.573 94.054  1.00 456.30 ? 168  ILE B CD1 1 
ATOM   5476  N N   . SER B 2 169 ? 130.478 128.702 97.898  1.00 418.26 ? 169  SER B N   1 
ATOM   5477  C CA  . SER B 2 169 ? 129.535 128.315 98.963  1.00 427.48 ? 169  SER B CA  1 
ATOM   5478  C C   . SER B 2 169 ? 130.111 127.292 99.951  1.00 415.78 ? 169  SER B C   1 
ATOM   5479  O O   . SER B 2 169 ? 129.726 127.280 101.119 1.00 413.80 ? 169  SER B O   1 
ATOM   5480  C CB  . SER B 2 169 ? 128.237 127.764 98.358  1.00 449.93 ? 169  SER B CB  1 
ATOM   5481  O OG  . SER B 2 169 ? 127.269 127.501 99.362  1.00 450.22 ? 169  SER B OG  1 
ATOM   5482  N N   . SER B 2 170 ? 131.008 126.430 99.470  1.00 436.72 ? 170  SER B N   1 
ATOM   5483  C CA  . SER B 2 170 ? 131.794 125.556 100.339 1.00 429.83 ? 170  SER B CA  1 
ATOM   5484  C C   . SER B 2 170 ? 132.977 126.319 100.933 1.00 394.11 ? 170  SER B C   1 
ATOM   5485  O O   . SER B 2 170 ? 133.108 126.395 102.149 1.00 385.91 ? 170  SER B O   1 
ATOM   5486  C CB  . SER B 2 170 ? 132.295 124.327 99.571  1.00 444.31 ? 170  SER B CB  1 
ATOM   5487  O OG  . SER B 2 170 ? 133.091 124.697 98.457  1.00 439.91 ? 170  SER B OG  1 
ATOM   5488  N N   . LEU B 2 171 ? 133.807 126.899 100.063 1.00 370.54 ? 171  LEU B N   1 
ATOM   5489  C CA  . LEU B 2 171 ? 135.113 127.474 100.445 1.00 363.47 ? 171  LEU B CA  1 
ATOM   5490  C C   . LEU B 2 171 ? 135.041 128.622 101.436 1.00 352.82 ? 171  LEU B C   1 
ATOM   5491  O O   . LEU B 2 171 ? 135.660 128.558 102.510 1.00 353.91 ? 171  LEU B O   1 
ATOM   5492  C CB  . LEU B 2 171 ? 135.877 127.921 99.190  1.00 382.04 ? 171  LEU B CB  1 
ATOM   5493  C CG  . LEU B 2 171 ? 137.281 128.523 99.379  1.00 404.87 ? 171  LEU B CG  1 
ATOM   5494  C CD1 . LEU B 2 171 ? 138.228 128.039 98.287  1.00 436.24 ? 171  LEU B CD1 1 
ATOM   5495  C CD2 . LEU B 2 171 ? 137.271 130.050 99.430  1.00 411.22 ? 171  LEU B CD2 1 
ATOM   5496  N N   . LEU B 2 172 ? 134.309 129.662 101.041 1.00 354.62 ? 172  LEU B N   1 
ATOM   5497  C CA  . LEU B 2 172 ? 134.151 130.871 101.858 1.00 361.94 ? 172  LEU B CA  1 
ATOM   5498  C C   . LEU B 2 172 ? 133.560 130.516 103.215 1.00 344.79 ? 172  LEU B C   1 
ATOM   5499  O O   . LEU B 2 172 ? 134.037 130.974 104.256 1.00 365.86 ? 172  LEU B O   1 
ATOM   5500  C CB  . LEU B 2 172 ? 133.261 131.898 101.141 1.00 401.29 ? 172  LEU B CB  1 
ATOM   5501  C CG  . LEU B 2 172 ? 132.815 133.167 101.894 1.00 426.60 ? 172  LEU B CG  1 
ATOM   5502  C CD1 . LEU B 2 172 ? 132.856 134.389 100.982 1.00 444.14 ? 172  LEU B CD1 1 
ATOM   5503  C CD2 . LEU B 2 172 ? 131.426 133.018 102.512 1.00 413.66 ? 172  LEU B CD2 1 
ATOM   5504  N N   . LEU B 2 173 ? 132.516 129.699 103.159 1.00 331.98 ? 173  LEU B N   1 
ATOM   5505  C CA  . LEU B 2 173 ? 131.796 129.231 104.351 1.00 340.72 ? 173  LEU B CA  1 
ATOM   5506  C C   . LEU B 2 173 ? 132.763 128.516 105.291 1.00 332.15 ? 173  LEU B C   1 
ATOM   5507  O O   . LEU B 2 173 ? 132.798 128.758 106.509 1.00 347.59 ? 173  LEU B O   1 
ATOM   5508  C CB  . LEU B 2 173 ? 130.670 128.262 103.942 1.00 365.10 ? 173  LEU B CB  1 
ATOM   5509  C CG  . LEU B 2 173 ? 129.691 127.568 104.916 1.00 363.43 ? 173  LEU B CG  1 
ATOM   5510  C CD1 . LEU B 2 173 ? 128.729 126.701 104.111 1.00 376.25 ? 173  LEU B CD1 1 
ATOM   5511  C CD2 . LEU B 2 173 ? 130.351 126.723 105.998 1.00 334.65 ? 173  LEU B CD2 1 
ATOM   5512  N N   . LEU B 2 174 ? 133.555 127.634 104.693 1.00 333.56 ? 174  LEU B N   1 
ATOM   5513  C CA  . LEU B 2 174 ? 134.520 126.796 105.388 1.00 347.51 ? 174  LEU B CA  1 
ATOM   5514  C C   . LEU B 2 174 ? 135.524 127.699 106.078 1.00 358.56 ? 174  LEU B C   1 
ATOM   5515  O O   . LEU B 2 174 ? 135.850 127.444 107.238 1.00 342.12 ? 174  LEU B O   1 
ATOM   5516  C CB  . LEU B 2 174 ? 135.248 125.827 104.441 1.00 366.37 ? 174  LEU B CB  1 
ATOM   5517  C CG  . LEU B 2 174 ? 135.528 124.415 104.964 1.00 378.84 ? 174  LEU B CG  1 
ATOM   5518  C CD1 . LEU B 2 174 ? 136.394 123.664 103.967 1.00 385.22 ? 174  LEU B CD1 1 
ATOM   5519  C CD2 . LEU B 2 174 ? 136.147 124.419 106.355 1.00 375.44 ? 174  LEU B CD2 1 
ATOM   5520  N N   . PHE B 2 175 ? 135.999 128.747 105.398 1.00 362.34 ? 175  PHE B N   1 
ATOM   5521  C CA  . PHE B 2 175 ? 136.992 129.590 106.078 1.00 323.09 ? 175  PHE B CA  1 
ATOM   5522  C C   . PHE B 2 175 ? 136.356 130.540 107.115 1.00 317.71 ? 175  PHE B C   1 
ATOM   5523  O O   . PHE B 2 175 ? 136.734 130.544 108.299 1.00 335.34 ? 175  PHE B O   1 
ATOM   5524  C CB  . PHE B 2 175 ? 137.836 130.389 105.081 1.00 323.68 ? 175  PHE B CB  1 
ATOM   5525  C CG  . PHE B 2 175 ? 138.837 129.554 104.334 1.00 332.24 ? 175  PHE B CG  1 
ATOM   5526  C CD1 . PHE B 2 175 ? 139.888 128.945 105.007 1.00 331.16 ? 175  PHE B CD1 1 
ATOM   5527  C CD2 . PHE B 2 175 ? 138.736 129.377 102.957 1.00 364.83 ? 175  PHE B CD2 1 
ATOM   5528  C CE1 . PHE B 2 175 ? 140.817 128.173 104.325 1.00 353.18 ? 175  PHE B CE1 1 
ATOM   5529  C CE2 . PHE B 2 175 ? 139.663 128.604 102.271 1.00 377.88 ? 175  PHE B CE2 1 
ATOM   5530  C CZ  . PHE B 2 175 ? 140.704 128.000 102.956 1.00 369.26 ? 175  PHE B CZ  1 
ATOM   5531  N N   . PHE B 2 176 ? 135.435 131.355 106.609 1.00 311.56 ? 176  PHE B N   1 
ATOM   5532  C CA  . PHE B 2 176 ? 134.960 132.542 107.330 1.00 332.05 ? 176  PHE B CA  1 
ATOM   5533  C C   . PHE B 2 176 ? 134.205 132.057 108.575 1.00 339.10 ? 176  PHE B C   1 
ATOM   5534  O O   . PHE B 2 176 ? 134.417 132.531 109.722 1.00 353.20 ? 176  PHE B O   1 
ATOM   5535  C CB  . PHE B 2 176 ? 134.017 133.346 106.424 1.00 337.07 ? 176  PHE B CB  1 
ATOM   5536  C CG  . PHE B 2 176 ? 133.295 134.464 107.121 1.00 343.23 ? 176  PHE B CG  1 
ATOM   5537  C CD1 . PHE B 2 176 ? 133.884 135.716 107.246 1.00 342.77 ? 176  PHE B CD1 1 
ATOM   5538  C CD2 . PHE B 2 176 ? 132.018 134.269 107.642 1.00 337.14 ? 176  PHE B CD2 1 
ATOM   5539  C CE1 . PHE B 2 176 ? 133.219 136.749 107.887 1.00 349.02 ? 176  PHE B CE1 1 
ATOM   5540  C CE2 . PHE B 2 176 ? 131.349 135.298 108.284 1.00 341.70 ? 176  PHE B CE2 1 
ATOM   5541  C CZ  . PHE B 2 176 ? 131.950 136.541 108.405 1.00 351.24 ? 176  PHE B CZ  1 
ATOM   5542  N N   . PHE B 2 177 ? 133.248 131.163 108.305 1.00 318.68 ? 177  PHE B N   1 
ATOM   5543  C CA  . PHE B 2 177 ? 132.384 130.676 109.390 1.00 317.76 ? 177  PHE B CA  1 
ATOM   5544  C C   . PHE B 2 177 ? 133.186 129.933 110.418 1.00 305.80 ? 177  PHE B C   1 
ATOM   5545  O O   . PHE B 2 177 ? 132.931 130.138 111.614 1.00 332.95 ? 177  PHE B O   1 
ATOM   5546  C CB  . PHE B 2 177 ? 131.150 129.887 108.925 1.00 332.28 ? 177  PHE B CB  1 
ATOM   5547  C CG  . PHE B 2 177 ? 130.069 130.757 108.335 1.00 366.80 ? 177  PHE B CG  1 
ATOM   5548  C CD1 . PHE B 2 177 ? 129.476 131.768 109.092 1.00 384.36 ? 177  PHE B CD1 1 
ATOM   5549  C CD2 . PHE B 2 177 ? 129.644 130.574 107.027 1.00 379.09 ? 177  PHE B CD2 1 
ATOM   5550  C CE1 . PHE B 2 177 ? 128.487 132.576 108.547 1.00 403.76 ? 177  PHE B CE1 1 
ATOM   5551  C CE2 . PHE B 2 177 ? 128.654 131.375 106.477 1.00 386.78 ? 177  PHE B CE2 1 
ATOM   5552  C CZ  . PHE B 2 177 ? 128.073 132.377 107.239 1.00 406.97 ? 177  PHE B CZ  1 
ATOM   5553  N N   . SER B 2 178 ? 134.161 129.139 109.968 1.00 283.70 ? 178  SER B N   1 
ATOM   5554  C CA  . SER B 2 178 ? 135.050 128.406 110.876 1.00 290.68 ? 178  SER B CA  1 
ATOM   5555  C C   . SER B 2 178 ? 135.783 129.371 111.791 1.00 283.32 ? 178  SER B C   1 
ATOM   5556  O O   . SER B 2 178 ? 135.867 129.149 113.008 1.00 326.88 ? 178  SER B O   1 
ATOM   5557  C CB  . SER B 2 178 ? 136.090 127.577 110.137 1.00 317.29 ? 178  SER B CB  1 
ATOM   5558  O OG  . SER B 2 178 ? 137.033 127.015 111.040 1.00 334.66 ? 178  SER B OG  1 
ATOM   5559  N N   . PHE B 2 179 ? 136.297 130.427 111.180 1.00 295.17 ? 179  PHE B N   1 
ATOM   5560  C CA  . PHE B 2 179 ? 137.041 131.479 111.885 1.00 315.08 ? 179  PHE B CA  1 
ATOM   5561  C C   . PHE B 2 179 ? 136.169 132.091 112.975 1.00 307.61 ? 179  PHE B C   1 
ATOM   5562  O O   . PHE B 2 179 ? 136.611 132.263 114.128 1.00 334.24 ? 179  PHE B O   1 
ATOM   5563  C CB  . PHE B 2 179 ? 137.535 132.541 110.883 1.00 333.63 ? 179  PHE B CB  1 
ATOM   5564  C CG  . PHE B 2 179 ? 138.000 133.822 111.513 1.00 348.98 ? 179  PHE B CG  1 
ATOM   5565  C CD1 . PHE B 2 179 ? 139.278 133.923 112.052 1.00 355.61 ? 179  PHE B CD1 1 
ATOM   5566  C CD2 . PHE B 2 179 ? 137.167 134.938 111.547 1.00 362.74 ? 179  PHE B CD2 1 
ATOM   5567  C CE1 . PHE B 2 179 ? 139.711 135.108 112.631 1.00 367.95 ? 179  PHE B CE1 1 
ATOM   5568  C CE2 . PHE B 2 179 ? 137.595 136.126 112.123 1.00 382.00 ? 179  PHE B CE2 1 
ATOM   5569  C CZ  . PHE B 2 179 ? 138.869 136.211 112.666 1.00 382.54 ? 179  PHE B CZ  1 
ATOM   5570  N N   . ILE B 2 180 ? 134.937 132.398 112.579 1.00 301.38 ? 180  ILE B N   1 
ATOM   5571  C CA  . ILE B 2 180 ? 133.950 133.005 113.477 1.00 308.76 ? 180  ILE B CA  1 
ATOM   5572  C C   . ILE B 2 180 ? 133.710 132.092 114.681 1.00 306.78 ? 180  ILE B C   1 
ATOM   5573  O O   . ILE B 2 180 ? 133.701 132.539 115.841 1.00 326.15 ? 180  ILE B O   1 
ATOM   5574  C CB  . ILE B 2 180 ? 132.625 133.438 112.778 1.00 330.48 ? 180  ILE B CB  1 
ATOM   5575  C CG1 . ILE B 2 180 ? 132.657 134.951 112.528 1.00 338.82 ? 180  ILE B CG1 1 
ATOM   5576  C CG2 . ILE B 2 180 ? 131.383 133.102 113.612 1.00 323.10 ? 180  ILE B CG2 1 
ATOM   5577  C CD1 . ILE B 2 180 ? 131.480 135.493 111.748 1.00 365.28 ? 180  ILE B CD1 1 
ATOM   5578  N N   . TYR B 2 181 ? 133.539 130.817 114.375 1.00 294.66 ? 181  TYR B N   1 
ATOM   5579  C CA  . TYR B 2 181 ? 133.214 129.786 115.349 1.00 296.94 ? 181  TYR B CA  1 
ATOM   5580  C C   . TYR B 2 181 ? 134.340 129.691 116.360 1.00 285.99 ? 181  TYR B C   1 
ATOM   5581  O O   . TYR B 2 181 ? 134.112 129.668 117.593 1.00 320.86 ? 181  TYR B O   1 
ATOM   5582  C CB  . TYR B 2 181 ? 132.997 128.423 114.674 1.00 275.35 ? 181  TYR B CB  1 
ATOM   5583  C CG  . TYR B 2 181 ? 132.752 127.316 115.674 1.00 293.04 ? 181  TYR B CG  1 
ATOM   5584  C CD1 . TYR B 2 181 ? 131.480 127.078 116.170 1.00 302.89 ? 181  TYR B CD1 1 
ATOM   5585  C CD2 . TYR B 2 181 ? 133.799 126.533 116.155 1.00 305.37 ? 181  TYR B CD2 1 
ATOM   5586  C CE1 . TYR B 2 181 ? 131.249 126.084 117.098 1.00 281.01 ? 181  TYR B CE1 1 
ATOM   5587  C CE2 . TYR B 2 181 ? 133.578 125.534 117.088 1.00 296.50 ? 181  TYR B CE2 1 
ATOM   5588  C CZ  . TYR B 2 181 ? 132.300 125.314 117.559 1.00 299.57 ? 181  TYR B CZ  1 
ATOM   5589  O OH  . TYR B 2 181 ? 132.071 124.319 118.485 1.00 326.85 ? 181  TYR B OH  1 
ATOM   5590  N N   . LEU B 2 182 ? 135.549 129.563 115.820 1.00 273.74 ? 182  LEU B N   1 
ATOM   5591  C CA  . LEU B 2 182 ? 136.766 129.400 116.624 1.00 301.29 ? 182  LEU B CA  1 
ATOM   5592  C C   . LEU B 2 182 ? 136.924 130.583 117.572 1.00 312.74 ? 182  LEU B C   1 
ATOM   5593  O O   . LEU B 2 182 ? 137.203 130.403 118.775 1.00 342.95 ? 182  LEU B O   1 
ATOM   5594  C CB  . LEU B 2 182 ? 138.003 129.247 115.729 1.00 314.93 ? 182  LEU B CB  1 
ATOM   5595  C CG  . LEU B 2 182 ? 139.114 128.402 116.357 1.00 340.10 ? 182  LEU B CG  1 
ATOM   5596  C CD1 . LEU B 2 182 ? 138.763 126.918 116.332 1.00 366.32 ? 182  LEU B CD1 1 
ATOM   5597  C CD2 . LEU B 2 182 ? 140.456 128.633 115.676 1.00 353.38 ? 182  LEU B CD2 1 
ATOM   5598  N N   . GLY B 2 183 ? 136.731 131.774 116.999 1.00 311.56 ? 183  GLY B N   1 
ATOM   5599  C CA  . GLY B 2 183 ? 136.843 133.027 117.756 1.00 329.87 ? 183  GLY B CA  1 
ATOM   5600  C C   . GLY B 2 183 ? 135.857 133.036 118.909 1.00 318.57 ? 183  GLY B C   1 
ATOM   5601  O O   . GLY B 2 183 ? 136.217 133.396 120.040 1.00 334.19 ? 183  GLY B O   1 
ATOM   5602  N N   . GLU B 2 184 ? 134.636 132.635 118.600 1.00 299.56 ? 184  GLU B N   1 
ATOM   5603  C CA  . GLU B 2 184 ? 133.545 132.571 119.580 1.00 309.02 ? 184  GLU B CA  1 
ATOM   5604  C C   . GLU B 2 184 ? 133.926 131.656 120.731 1.00 280.03 ? 184  GLU B C   1 
ATOM   5605  O O   . GLU B 2 184 ? 133.744 132.005 121.907 1.00 307.04 ? 184  GLU B O   1 
ATOM   5606  C CB  . GLU B 2 184 ? 132.240 132.125 118.939 1.00 335.05 ? 184  GLU B CB  1 
ATOM   5607  C CG  . GLU B 2 184 ? 131.084 132.984 119.386 1.00 374.38 ? 184  GLU B CG  1 
ATOM   5608  C CD  . GLU B 2 184 ? 131.211 134.426 118.913 1.00 378.42 ? 184  GLU B CD  1 
ATOM   5609  O OE1 . GLU B 2 184 ? 131.323 134.648 117.687 1.00 375.67 ? 184  GLU B OE1 1 
ATOM   5610  O OE2 . GLU B 2 184 ? 131.188 135.338 119.768 1.00 375.66 ? 184  GLU B OE2 1 
ATOM   5611  N N   . VAL B 2 185 ? 134.456 130.497 120.356 1.00 274.62 ? 185  VAL B N   1 
ATOM   5612  C CA  . VAL B 2 185 ? 134.885 129.477 121.321 1.00 270.90 ? 185  VAL B CA  1 
ATOM   5613  C C   . VAL B 2 185 ? 135.943 130.059 122.258 1.00 278.65 ? 185  VAL B C   1 
ATOM   5614  O O   . VAL B 2 185 ? 135.868 129.884 123.488 1.00 299.31 ? 185  VAL B O   1 
ATOM   5615  C CB  . VAL B 2 185 ? 135.362 128.160 120.674 1.00 301.57 ? 185  VAL B CB  1 
ATOM   5616  C CG1 . VAL B 2 185 ? 135.963 127.222 121.720 1.00 314.34 ? 185  VAL B CG1 1 
ATOM   5617  C CG2 . VAL B 2 185 ? 134.206 127.468 119.962 1.00 315.12 ? 185  VAL B CG2 1 
ATOM   5618  N N   . PHE B 2 186 ? 136.898 130.747 121.646 1.00 294.40 ? 186  PHE B N   1 
ATOM   5619  C CA  . PHE B 2 186 ? 137.998 131.379 122.377 1.00 308.41 ? 186  PHE B CA  1 
ATOM   5620  C C   . PHE B 2 186 ? 137.460 132.380 123.392 1.00 301.44 ? 186  PHE B C   1 
ATOM   5621  O O   . PHE B 2 186 ? 137.887 132.398 124.553 1.00 322.48 ? 186  PHE B O   1 
ATOM   5622  C CB  . PHE B 2 186 ? 139.069 131.925 121.452 1.00 316.92 ? 186  PHE B CB  1 
ATOM   5623  C CG  . PHE B 2 186 ? 139.814 130.849 120.702 1.00 322.55 ? 186  PHE B CG  1 
ATOM   5624  C CD1 . PHE B 2 186 ? 140.152 129.634 121.311 1.00 307.08 ? 186  PHE B CD1 1 
ATOM   5625  C CD2 . PHE B 2 186 ? 140.193 131.054 119.388 1.00 340.10 ? 186  PHE B CD2 1 
ATOM   5626  C CE1 . PHE B 2 186 ? 140.837 128.656 120.611 1.00 338.75 ? 186  PHE B CE1 1 
ATOM   5627  C CE2 . PHE B 2 186 ? 140.885 130.083 118.690 1.00 348.39 ? 186  PHE B CE2 1 
ATOM   5628  C CZ  . PHE B 2 186 ? 141.206 128.881 119.297 1.00 345.92 ? 186  PHE B CZ  1 
ATOM   5629  N N   . LYS B 2 187 ? 136.513 133.179 122.925 1.00 278.27 ? 187  LYS B N   1 
ATOM   5630  C CA  . LYS B 2 187 ? 135.853 134.203 123.744 1.00 306.75 ? 187  LYS B CA  1 
ATOM   5631  C C   . LYS B 2 187 ? 135.196 133.560 124.960 1.00 287.48 ? 187  LYS B C   1 
ATOM   5632  O O   . LYS B 2 187 ? 135.344 134.034 126.096 1.00 298.67 ? 187  LYS B O   1 
ATOM   5633  C CB  . LYS B 2 187 ? 134.787 134.981 122.949 1.00 303.18 ? 187  LYS B CB  1 
ATOM   5634  C CG  . LYS B 2 187 ? 135.304 135.772 121.755 1.00 310.91 ? 187  LYS B CG  1 
ATOM   5635  C CD  . LYS B 2 187 ? 135.913 137.100 122.146 1.00 333.15 ? 187  LYS B CD  1 
ATOM   5636  C CE  . LYS B 2 187 ? 136.854 137.621 121.068 1.00 355.16 ? 187  LYS B CE  1 
ATOM   5637  N NZ  . LYS B 2 187 ? 136.178 137.778 119.749 1.00 374.39 ? 187  LYS B NZ  1 
ATOM   5638  N N   . THR B 2 188 ? 134.465 132.482 124.703 1.00 266.44 ? 188  THR B N   1 
ATOM   5639  C CA  . THR B 2 188 ? 133.687 131.797 125.725 1.00 292.86 ? 188  THR B CA  1 
ATOM   5640  C C   . THR B 2 188 ? 134.550 131.286 126.870 1.00 285.47 ? 188  THR B C   1 
ATOM   5641  O O   . THR B 2 188 ? 134.158 131.384 128.038 1.00 297.58 ? 188  THR B O   1 
ATOM   5642  C CB  . THR B 2 188 ? 132.875 130.642 125.104 1.00 301.07 ? 188  THR B CB  1 
ATOM   5643  O OG1 . THR B 2 188 ? 131.901 131.198 124.217 1.00 311.17 ? 188  THR B OG1 1 
ATOM   5644  C CG2 . THR B 2 188 ? 132.169 129.800 126.171 1.00 322.22 ? 188  THR B CG2 1 
ATOM   5645  N N   . TYR B 2 189 ? 135.716 130.750 126.537 1.00 268.61 ? 189  TYR B N   1 
ATOM   5646  C CA  . TYR B 2 189 ? 136.612 130.206 127.549 1.00 300.47 ? 189  TYR B CA  1 
ATOM   5647  C C   . TYR B 2 189 ? 137.591 131.264 128.059 1.00 289.68 ? 189  TYR B C   1 
ATOM   5648  O O   . TYR B 2 189 ? 138.345 131.005 128.996 1.00 316.30 ? 189  TYR B O   1 
ATOM   5649  C CB  . TYR B 2 189 ? 137.317 128.950 127.017 1.00 321.65 ? 189  TYR B CB  1 
ATOM   5650  C CG  . TYR B 2 189 ? 136.412 127.730 127.006 1.00 336.80 ? 189  TYR B CG  1 
ATOM   5651  C CD1 . TYR B 2 189 ? 135.258 127.695 126.214 1.00 349.65 ? 189  TYR B CD1 1 
ATOM   5652  C CD2 . TYR B 2 189 ? 136.688 126.623 127.809 1.00 363.09 ? 189  TYR B CD2 1 
ATOM   5653  C CE1 . TYR B 2 189 ? 134.418 126.590 126.212 1.00 372.57 ? 189  TYR B CE1 1 
ATOM   5654  C CE2 . TYR B 2 189 ? 135.856 125.512 127.811 1.00 398.76 ? 189  TYR B CE2 1 
ATOM   5655  C CZ  . TYR B 2 189 ? 134.720 125.500 127.010 1.00 411.94 ? 189  TYR B CZ  1 
ATOM   5656  O OH  . TYR B 2 189 ? 133.892 124.401 127.009 1.00 429.51 ? 189  TYR B OH  1 
ATOM   5657  N N   . ASN B 2 190 ? 137.556 132.452 127.449 1.00 286.94 ? 190  ASN B N   1 
ATOM   5658  C CA  . ASN B 2 190 ? 138.329 133.617 127.882 1.00 304.33 ? 190  ASN B CA  1 
ATOM   5659  C C   . ASN B 2 190 ? 139.820 133.316 127.803 1.00 300.01 ? 190  ASN B C   1 
ATOM   5660  O O   . ASN B 2 190 ? 140.570 133.475 128.770 1.00 310.87 ? 190  ASN B O   1 
ATOM   5661  C CB  . ASN B 2 190 ? 137.896 134.090 129.280 1.00 311.81 ? 190  ASN B CB  1 
ATOM   5662  C CG  . ASN B 2 190 ? 138.257 135.545 129.547 1.00 317.61 ? 190  ASN B CG  1 
ATOM   5663  O OD1 . ASN B 2 190 ? 137.936 136.433 128.755 1.00 295.01 ? 190  ASN B OD1 1 
ATOM   5664  N ND2 . ASN B 2 190 ? 138.920 135.795 130.671 1.00 321.63 ? 190  ASN B ND2 1 
ATOM   5665  N N   . VAL B 2 191 ? 140.221 132.873 126.616 1.00 295.70 ? 191  VAL B N   1 
ATOM   5666  C CA  . VAL B 2 191 ? 141.564 132.403 126.354 1.00 300.17 ? 191  VAL B CA  1 
ATOM   5667  C C   . VAL B 2 191 ? 142.147 133.231 125.229 1.00 289.35 ? 191  VAL B C   1 
ATOM   5668  O O   . VAL B 2 191 ? 141.567 133.300 124.148 1.00 289.07 ? 191  VAL B O   1 
ATOM   5669  C CB  . VAL B 2 191 ? 141.559 130.924 125.928 1.00 329.41 ? 191  VAL B CB  1 
ATOM   5670  C CG1 . VAL B 2 191 ? 142.981 130.367 125.906 1.00 378.18 ? 191  VAL B CG1 1 
ATOM   5671  C CG2 . VAL B 2 191 ? 140.669 130.109 126.857 1.00 339.90 ? 191  VAL B CG2 1 
ATOM   5672  N N   . ALA B 2 192 ? 143.298 133.845 125.484 1.00 294.21 ? 192  ALA B N   1 
ATOM   5673  C CA  . ALA B 2 192 ? 144.003 134.603 124.459 1.00 312.30 ? 192  ALA B CA  1 
ATOM   5674  C C   . ALA B 2 192 ? 144.534 133.679 123.370 1.00 301.35 ? 192  ALA B C   1 
ATOM   5675  O O   . ALA B 2 192 ? 145.283 132.747 123.654 1.00 343.14 ? 192  ALA B O   1 
ATOM   5676  C CB  . ALA B 2 192 ? 145.146 135.396 125.072 1.00 334.82 ? 192  ALA B CB  1 
ATOM   5677  N N   . VAL B 2 193 ? 144.125 133.933 122.131 1.00 305.83 ? 193  VAL B N   1 
ATOM   5678  C CA  . VAL B 2 193 ? 144.672 133.245 120.964 1.00 306.46 ? 193  VAL B CA  1 
ATOM   5679  C C   . VAL B 2 193 ? 145.022 134.305 119.937 1.00 317.66 ? 193  VAL B C   1 
ATOM   5680  O O   . VAL B 2 193 ? 144.191 135.152 119.614 1.00 313.99 ? 193  VAL B O   1 
ATOM   5681  C CB  . VAL B 2 193 ? 143.659 132.261 120.357 1.00 336.33 ? 193  VAL B CB  1 
ATOM   5682  C CG1 . VAL B 2 193 ? 144.332 131.401 119.293 1.00 369.31 ? 193  VAL B CG1 1 
ATOM   5683  C CG2 . VAL B 2 193 ? 143.056 131.381 121.446 1.00 352.40 ? 193  VAL B CG2 1 
ATOM   5684  N N   . ASP B 2 194 ? 146.251 134.259 119.433 1.00 329.64 ? 194  ASP B N   1 
ATOM   5685  C CA  . ASP B 2 194 ? 146.746 135.298 118.526 1.00 330.92 ? 194  ASP B CA  1 
ATOM   5686  C C   . ASP B 2 194 ? 146.357 135.029 117.086 1.00 314.91 ? 194  ASP B C   1 
ATOM   5687  O O   . ASP B 2 194 ? 146.199 133.875 116.680 1.00 294.05 ? 194  ASP B O   1 
ATOM   5688  C CB  . ASP B 2 194 ? 148.258 135.431 118.614 1.00 351.54 ? 194  ASP B CB  1 
ATOM   5689  C CG  . ASP B 2 194 ? 148.974 134.210 118.116 1.00 389.63 ? 194  ASP B CG  1 
ATOM   5690  O OD1 . ASP B 2 194 ? 148.948 133.174 118.822 1.00 407.55 ? 194  ASP B OD1 1 
ATOM   5691  O OD2 . ASP B 2 194 ? 149.545 134.280 117.007 1.00 422.37 ? 194  ASP B OD2 1 
ATOM   5692  N N   . TYR B 2 195 ? 146.244 136.114 116.318 1.00 330.65 ? 195  TYR B N   1 
ATOM   5693  C CA  . TYR B 2 195 ? 145.818 136.062 114.917 1.00 323.75 ? 195  TYR B CA  1 
ATOM   5694  C C   . TYR B 2 195 ? 146.565 135.020 114.103 1.00 325.09 ? 195  TYR B C   1 
ATOM   5695  O O   . TYR B 2 195 ? 145.961 134.376 113.244 1.00 361.71 ? 195  TYR B O   1 
ATOM   5696  C CB  . TYR B 2 195 ? 145.955 137.434 114.224 1.00 322.27 ? 195  TYR B CB  1 
ATOM   5697  C CG  . TYR B 2 195 ? 144.682 138.255 114.211 1.00 319.57 ? 195  TYR B CG  1 
ATOM   5698  C CD1 . TYR B 2 195 ? 143.619 137.911 113.376 1.00 330.92 ? 195  TYR B CD1 1 
ATOM   5699  C CD2 . TYR B 2 195 ? 144.538 139.377 115.025 1.00 334.63 ? 195  TYR B CD2 1 
ATOM   5700  C CE1 . TYR B 2 195 ? 142.450 138.661 113.352 1.00 333.62 ? 195  TYR B CE1 1 
ATOM   5701  C CE2 . TYR B 2 195 ? 143.372 140.134 115.008 1.00 341.83 ? 195  TYR B CE2 1 
ATOM   5702  C CZ  . TYR B 2 195 ? 142.334 139.777 114.167 1.00 327.47 ? 195  TYR B CZ  1 
ATOM   5703  O OH  . TYR B 2 195 ? 141.176 140.519 114.163 1.00 330.92 ? 195  TYR B OH  1 
ATOM   5704  N N   . ILE B 2 196 ? 147.859 134.842 114.372 1.00 303.82 ? 196  ILE B N   1 
ATOM   5705  C CA  . ILE B 2 196 ? 148.685 134.006 113.494 1.00 319.91 ? 196  ILE B CA  1 
ATOM   5706  C C   . ILE B 2 196 ? 148.232 132.548 113.626 1.00 304.11 ? 196  ILE B C   1 
ATOM   5707  O O   . ILE B 2 196 ? 148.027 131.845 112.617 1.00 334.64 ? 196  ILE B O   1 
ATOM   5708  C CB  . ILE B 2 196 ? 150.192 134.108 113.838 1.00 338.87 ? 196  ILE B CB  1 
ATOM   5709  C CG1 . ILE B 2 196 ? 150.711 135.544 113.631 1.00 381.16 ? 196  ILE B CG1 1 
ATOM   5710  C CG2 . ILE B 2 196 ? 151.019 133.102 113.038 1.00 368.73 ? 196  ILE B CG2 1 
ATOM   5711  C CD1 . ILE B 2 196 ? 150.576 136.087 112.220 1.00 396.55 ? 196  ILE B CD1 1 
ATOM   5712  N N   . THR B 2 197 ? 148.130 132.125 114.881 1.00 298.60 ? 197  THR B N   1 
ATOM   5713  C CA  . THR B 2 197 ? 147.790 130.747 115.225 1.00 305.11 ? 197  THR B CA  1 
ATOM   5714  C C   . THR B 2 197 ? 146.423 130.388 114.628 1.00 304.19 ? 197  THR B C   1 
ATOM   5715  O O   . THR B 2 197 ? 146.249 129.319 114.018 1.00 348.90 ? 197  THR B O   1 
ATOM   5716  C CB  . THR B 2 197 ? 147.736 130.541 116.751 1.00 318.23 ? 197  THR B CB  1 
ATOM   5717  O OG1 . THR B 2 197 ? 148.976 130.958 117.332 1.00 350.72 ? 197  THR B OG1 1 
ATOM   5718  C CG2 . THR B 2 197 ? 147.487 129.078 117.110 1.00 316.40 ? 197  THR B CG2 1 
ATOM   5719  N N   . VAL B 2 198 ? 145.486 131.301 114.824 1.00 287.04 ? 198  VAL B N   1 
ATOM   5720  C CA  . VAL B 2 198 ? 144.119 131.085 114.326 1.00 306.63 ? 198  VAL B CA  1 
ATOM   5721  C C   . VAL B 2 198 ? 144.112 130.971 112.818 1.00 303.26 ? 198  VAL B C   1 
ATOM   5722  O O   . VAL B 2 198 ? 143.435 130.092 112.279 1.00 320.48 ? 198  VAL B O   1 
ATOM   5723  C CB  . VAL B 2 198 ? 143.135 132.154 114.829 1.00 317.34 ? 198  VAL B CB  1 
ATOM   5724  C CG1 . VAL B 2 198 ? 141.809 132.105 114.072 1.00 300.77 ? 198  VAL B CG1 1 
ATOM   5725  C CG2 . VAL B 2 198 ? 142.924 131.946 116.320 1.00 349.43 ? 198  VAL B CG2 1 
ATOM   5726  N N   . ALA B 2 199 ? 144.885 131.838 112.173 1.00 311.46 ? 199  ALA B N   1 
ATOM   5727  C CA  . ALA B 2 199 ? 145.014 131.853 110.712 1.00 327.13 ? 199  ALA B CA  1 
ATOM   5728  C C   . ALA B 2 199 ? 145.518 130.505 110.220 1.00 299.90 ? 199  ALA B C   1 
ATOM   5729  O O   . ALA B 2 199 ? 144.973 129.923 109.259 1.00 325.36 ? 199  ALA B O   1 
ATOM   5730  C CB  . ALA B 2 199 ? 145.933 132.974 110.245 1.00 353.46 ? 199  ALA B CB  1 
ATOM   5731  N N   . LEU B 2 200 ? 146.549 130.021 110.906 1.00 315.00 ? 200  LEU B N   1 
ATOM   5732  C CA  . LEU B 2 200 ? 147.192 128.746 110.565 1.00 316.84 ? 200  LEU B CA  1 
ATOM   5733  C C   . LEU B 2 200 ? 146.161 127.624 110.709 1.00 306.74 ? 200  LEU B C   1 
ATOM   5734  O O   . LEU B 2 200 ? 146.019 126.747 109.838 1.00 339.79 ? 200  LEU B O   1 
ATOM   5735  C CB  . LEU B 2 200 ? 148.444 128.511 111.420 1.00 301.36 ? 200  LEU B CB  1 
ATOM   5736  C CG  . LEU B 2 200 ? 148.998 127.086 111.495 1.00 317.74 ? 200  LEU B CG  1 
ATOM   5737  C CD1 . LEU B 2 200 ? 150.500 127.148 111.720 1.00 336.09 ? 200  LEU B CD1 1 
ATOM   5738  C CD2 . LEU B 2 200 ? 148.293 126.233 112.562 1.00 321.68 ? 200  LEU B CD2 1 
ATOM   5739  N N   . LEU B 2 201 ? 145.473 127.658 111.848 1.00 284.60 ? 201  LEU B N   1 
ATOM   5740  C CA  . LEU B 2 201 ? 144.482 126.652 112.208 1.00 313.66 ? 201  LEU B CA  1 
ATOM   5741  C C   . LEU B 2 201 ? 143.282 126.654 111.247 1.00 293.08 ? 201  LEU B C   1 
ATOM   5742  O O   . LEU B 2 201 ? 142.845 125.593 110.805 1.00 305.30 ? 201  LEU B O   1 
ATOM   5743  C CB  . LEU B 2 201 ? 144.038 126.853 113.666 1.00 313.90 ? 201  LEU B CB  1 
ATOM   5744  C CG  . LEU B 2 201 ? 142.977 125.926 114.272 1.00 339.14 ? 201  LEU B CG  1 
ATOM   5745  C CD1 . LEU B 2 201 ? 143.277 124.457 114.013 1.00 354.46 ? 201  LEU B CD1 1 
ATOM   5746  C CD2 . LEU B 2 201 ? 142.854 126.187 115.769 1.00 367.57 ? 201  LEU B CD2 1 
ATOM   5747  N N   . ILE B 2 202 ? 142.776 127.837 110.912 1.00 277.33 ? 202  ILE B N   1 
ATOM   5748  C CA  . ILE B 2 202 ? 141.681 127.960 109.944 1.00 285.70 ? 202  ILE B CA  1 
ATOM   5749  C C   . ILE B 2 202 ? 142.163 127.601 108.537 1.00 299.26 ? 202  ILE B C   1 
ATOM   5750  O O   . ILE B 2 202 ? 141.442 126.928 107.801 1.00 344.74 ? 202  ILE B O   1 
ATOM   5751  C CB  . ILE B 2 202 ? 141.004 129.360 109.997 1.00 309.13 ? 202  ILE B CB  1 
ATOM   5752  C CG1 . ILE B 2 202 ? 139.824 129.340 110.970 1.00 317.58 ? 202  ILE B CG1 1 
ATOM   5753  C CG2 . ILE B 2 202 ? 140.452 129.807 108.646 1.00 334.71 ? 202  ILE B CG2 1 
ATOM   5754  C CD1 . ILE B 2 202 ? 140.141 128.813 112.350 1.00 324.79 ? 202  ILE B CD1 1 
ATOM   5755  N N   . TRP B 2 203 ? 143.358 128.046 108.162 1.00 296.43 ? 203  TRP B N   1 
ATOM   5756  C CA  . TRP B 2 203 ? 143.944 127.672 106.870 1.00 303.65 ? 203  TRP B CA  1 
ATOM   5757  C C   . TRP B 2 203 ? 144.122 126.163 106.794 1.00 297.39 ? 203  TRP B C   1 
ATOM   5758  O O   . TRP B 2 203 ? 143.800 125.557 105.777 1.00 337.90 ? 203  TRP B O   1 
ATOM   5759  C CB  . TRP B 2 203 ? 145.282 128.377 106.646 1.00 324.15 ? 203  TRP B CB  1 
ATOM   5760  C CG  . TRP B 2 203 ? 145.892 128.157 105.303 1.00 309.34 ? 203  TRP B CG  1 
ATOM   5761  C CD1 . TRP B 2 203 ? 147.020 127.452 105.029 1.00 317.29 ? 203  TRP B CD1 1 
ATOM   5762  C CD2 . TRP B 2 203 ? 145.416 128.657 104.054 1.00 315.33 ? 203  TRP B CD2 1 
ATOM   5763  N NE1 . TRP B 2 203 ? 147.283 127.477 103.681 1.00 318.79 ? 203  TRP B NE1 1 
ATOM   5764  C CE2 . TRP B 2 203 ? 146.314 128.213 103.058 1.00 321.32 ? 203  TRP B CE2 1 
ATOM   5765  C CE3 . TRP B 2 203 ? 144.316 129.438 103.676 1.00 359.53 ? 203  TRP B CE3 1 
ATOM   5766  C CZ2 . TRP B 2 203 ? 146.145 128.518 101.704 1.00 366.04 ? 203  TRP B CZ2 1 
ATOM   5767  C CZ3 . TRP B 2 203 ? 144.147 129.746 102.325 1.00 385.17 ? 203  TRP B CZ3 1 
ATOM   5768  C CH2 . TRP B 2 203 ? 145.059 129.285 101.356 1.00 390.00 ? 203  TRP B CH2 1 
ATOM   5769  N N   . ASN B 2 204 ? 144.626 125.565 107.869 1.00 283.55 ? 204  ASN B N   1 
ATOM   5770  C CA  . ASN B 2 204 ? 144.686 124.111 107.973 1.00 301.79 ? 204  ASN B CA  1 
ATOM   5771  C C   . ASN B 2 204 ? 143.294 123.519 107.861 1.00 287.64 ? 204  ASN B C   1 
ATOM   5772  O O   . ASN B 2 204 ? 142.959 122.952 106.820 1.00 307.85 ? 204  ASN B O   1 
ATOM   5773  C CB  . ASN B 2 204 ? 145.355 123.654 109.275 1.00 335.10 ? 204  ASN B CB  1 
ATOM   5774  C CG  . ASN B 2 204 ? 146.850 123.489 109.132 1.00 347.44 ? 204  ASN B CG  1 
ATOM   5775  O OD1 . ASN B 2 204 ? 147.320 122.447 108.690 1.00 328.94 ? 204  ASN B OD1 1 
ATOM   5776  N ND2 . ASN B 2 204 ? 147.605 124.508 109.519 1.00 370.92 ? 204  ASN B ND2 1 
ATOM   5777  N N   . PHE B 2 205 ? 142.482 123.687 108.909 1.00 286.48 ? 205  PHE B N   1 
ATOM   5778  C CA  . PHE B 2 205 ? 141.106 123.170 108.942 1.00 299.37 ? 205  PHE B CA  1 
ATOM   5779  C C   . PHE B 2 205 ? 140.386 123.379 107.618 1.00 290.00 ? 205  PHE B C   1 
ATOM   5780  O O   . PHE B 2 205 ? 139.751 122.474 107.098 1.00 295.79 ? 205  PHE B O   1 
ATOM   5781  C CB  . PHE B 2 205 ? 140.295 123.841 110.053 1.00 316.32 ? 205  PHE B CB  1 
ATOM   5782  C CG  . PHE B 2 205 ? 138.852 123.419 110.097 1.00 289.85 ? 205  PHE B CG  1 
ATOM   5783  C CD1 . PHE B 2 205 ? 138.486 122.217 110.689 1.00 331.01 ? 205  PHE B CD1 1 
ATOM   5784  C CD2 . PHE B 2 205 ? 137.858 124.222 109.556 1.00 307.09 ? 205  PHE B CD2 1 
ATOM   5785  C CE1 . PHE B 2 205 ? 137.153 121.820 110.738 1.00 337.37 ? 205  PHE B CE1 1 
ATOM   5786  C CE2 . PHE B 2 205 ? 136.522 123.832 109.603 1.00 333.52 ? 205  PHE B CE2 1 
ATOM   5787  C CZ  . PHE B 2 205 ? 136.169 122.629 110.194 1.00 323.16 ? 205  PHE B CZ  1 
ATOM   5788  N N   . GLY B 2 206 ? 140.510 124.580 107.076 1.00 289.53 ? 206  GLY B N   1 
ATOM   5789  C CA  . GLY B 2 206 ? 139.884 124.909 105.808 1.00 309.66 ? 206  GLY B CA  1 
ATOM   5790  C C   . GLY B 2 206 ? 140.387 124.163 104.587 1.00 303.32 ? 206  GLY B C   1 
ATOM   5791  O O   . GLY B 2 206 ? 139.580 123.544 103.880 1.00 309.48 ? 206  GLY B O   1 
ATOM   5792  N N   . VAL B 2 207 ? 141.681 124.333 104.307 1.00 307.47 ? 207  VAL B N   1 
ATOM   5793  C CA  . VAL B 2 207 ? 142.270 123.829 103.052 1.00 318.50 ? 207  VAL B CA  1 
ATOM   5794  C C   . VAL B 2 207 ? 142.122 122.308 103.010 1.00 314.32 ? 207  VAL B C   1 
ATOM   5795  O O   . VAL B 2 207 ? 141.737 121.759 101.959 1.00 350.96 ? 207  VAL B O   1 
ATOM   5796  C CB  . VAL B 2 207 ? 143.732 124.267 102.821 1.00 333.27 ? 207  VAL B CB  1 
ATOM   5797  C CG1 . VAL B 2 207 ? 144.269 123.677 101.521 1.00 349.32 ? 207  VAL B CG1 1 
ATOM   5798  C CG2 . VAL B 2 207 ? 143.835 125.785 102.744 1.00 348.32 ? 207  VAL B CG2 1 
ATOM   5799  N N   . VAL B 2 208 ? 142.411 121.666 104.144 1.00 286.71 ? 208  VAL B N   1 
ATOM   5800  C CA  . VAL B 2 208 ? 142.317 120.203 104.190 1.00 316.07 ? 208  VAL B CA  1 
ATOM   5801  C C   . VAL B 2 208 ? 140.893 119.749 103.956 1.00 314.73 ? 208  VAL B C   1 
ATOM   5802  O O   . VAL B 2 208 ? 140.684 118.784 103.209 1.00 346.21 ? 208  VAL B O   1 
ATOM   5803  C CB  . VAL B 2 208 ? 142.907 119.500 105.444 1.00 305.10 ? 208  VAL B CB  1 
ATOM   5804  C CG1 . VAL B 2 208 ? 144.373 119.852 105.635 1.00 309.95 ? 208  VAL B CG1 1 
ATOM   5805  C CG2 . VAL B 2 208 ? 142.095 119.780 106.690 1.00 336.30 ? 208  VAL B CG2 1 
ATOM   5806  N N   . GLY B 2 209 ? 139.945 120.468 104.551 1.00 309.14 ? 209  GLY B N   1 
ATOM   5807  C CA  . GLY B 2 209 ? 138.518 120.185 104.383 1.00 336.49 ? 209  GLY B CA  1 
ATOM   5808  C C   . GLY B 2 209 ? 138.137 120.255 102.910 1.00 329.14 ? 209  GLY B C   1 
ATOM   5809  O O   . GLY B 2 209 ? 137.443 119.368 102.385 1.00 338.97 ? 209  GLY B O   1 
ATOM   5810  N N   . MET B 2 210 ? 138.613 121.320 102.273 1.00 309.19 ? 210  MET B N   1 
ATOM   5811  C CA  . MET B 2 210 ? 138.349 121.582 100.856 1.00 303.53 ? 210  MET B CA  1 
ATOM   5812  C C   . MET B 2 210 ? 138.868 120.412 100.015 1.00 307.01 ? 210  MET B C   1 
ATOM   5813  O O   . MET B 2 210 ? 138.168 119.915 99.114  1.00 312.28 ? 210  MET B O   1 
ATOM   5814  C CB  . MET B 2 210 ? 138.954 122.904 100.369 1.00 322.79 ? 210  MET B CB  1 
ATOM   5815  C CG  . MET B 2 210 ? 138.164 124.139 100.770 1.00 355.16 ? 210  MET B CG  1 
ATOM   5816  S SD  . MET B 2 210 ? 136.441 124.106 100.234 1.00 376.89 ? 210  MET B SD  1 
ATOM   5817  C CE  . MET B 2 210 ? 136.627 124.293 98.463  1.00 402.34 ? 210  MET B CE  1 
ATOM   5818  N N   . ILE B 2 211 ? 140.091 120.000 100.335 1.00 300.96 ? 211  ILE B N   1 
ATOM   5819  C CA  . ILE B 2 211 ? 140.705 118.906 99.574  1.00 295.93 ? 211  ILE B CA  1 
ATOM   5820  C C   . ILE B 2 211 ? 139.926 117.623 99.752  1.00 300.02 ? 211  ILE B C   1 
ATOM   5821  O O   . ILE B 2 211 ? 139.718 116.913 98.765  1.00 328.48 ? 211  ILE B O   1 
ATOM   5822  C CB  . ILE B 2 211 ? 142.253 118.772 99.687  1.00 306.71 ? 211  ILE B CB  1 
ATOM   5823  C CG1 . ILE B 2 211 ? 142.724 118.343 101.064 1.00 318.75 ? 211  ILE B CG1 1 
ATOM   5824  C CG2 . ILE B 2 211 ? 142.937 120.082 99.296  1.00 332.77 ? 211  ILE B CG2 1 
ATOM   5825  C CD1 . ILE B 2 211 ? 142.554 116.877 101.392 1.00 333.54 ? 211  ILE B CD1 1 
ATOM   5826  N N   . SER B 2 212 ? 139.468 117.374 100.972 1.00 306.31 ? 212  SER B N   1 
ATOM   5827  C CA  . SER B 2 212 ? 138.648 116.202 101.290 1.00 336.23 ? 212  SER B CA  1 
ATOM   5828  C C   . SER B 2 212 ? 137.382 116.202 100.434 1.00 331.65 ? 212  SER B C   1 
ATOM   5829  O O   . SER B 2 212 ? 137.011 115.172 99.842  1.00 341.91 ? 212  SER B O   1 
ATOM   5830  C CB  . SER B 2 212 ? 138.297 116.161 102.778 1.00 342.87 ? 212  SER B CB  1 
ATOM   5831  O OG  . SER B 2 212 ? 139.446 116.373 103.578 1.00 353.03 ? 212  SER B OG  1 
ATOM   5832  N N   . ILE B 2 213 ? 136.757 117.373 100.382 1.00 313.82 ? 213  ILE B N   1 
ATOM   5833  C CA  . ILE B 2 213 ? 135.526 117.574 99.617  1.00 330.94 ? 213  ILE B CA  1 
ATOM   5834  C C   . ILE B 2 213 ? 135.767 117.251 98.138  1.00 340.14 ? 213  ILE B C   1 
ATOM   5835  O O   . ILE B 2 213 ? 134.974 116.546 97.502  1.00 359.24 ? 213  ILE B O   1 
ATOM   5836  C CB  . ILE B 2 213 ? 134.859 118.972 99.758  1.00 361.35 ? 213  ILE B CB  1 
ATOM   5837  C CG1 . ILE B 2 213 ? 134.636 119.400 101.223 1.00 362.89 ? 213  ILE B CG1 1 
ATOM   5838  C CG2 . ILE B 2 213 ? 133.504 118.987 99.049  1.00 371.16 ? 213  ILE B CG2 1 
ATOM   5839  C CD1 . ILE B 2 213 ? 134.333 118.292 102.207 1.00 353.94 ? 213  ILE B CD1 1 
ATOM   5840  N N   . HIS B 2 214 ? 136.858 117.811 97.601  1.00 346.69 ? 214  HIS B N   1 
ATOM   5841  C CA  . HIS B 2 214 ? 137.128 117.851 96.155  1.00 346.51 ? 214  HIS B CA  1 
ATOM   5842  C C   . HIS B 2 214 ? 138.458 117.203 95.705  1.00 334.60 ? 214  HIS B C   1 
ATOM   5843  O O   . HIS B 2 214 ? 138.974 117.538 94.634  1.00 343.37 ? 214  HIS B O   1 
ATOM   5844  C CB  . HIS B 2 214 ? 137.107 119.312 95.684  1.00 353.18 ? 214  HIS B CB  1 
ATOM   5845  C CG  . HIS B 2 214 ? 135.939 120.101 96.187  1.00 352.73 ? 214  HIS B CG  1 
ATOM   5846  N ND1 . HIS B 2 214 ? 136.051 121.037 97.192  1.00 345.38 ? 214  HIS B ND1 1 
ATOM   5847  C CD2 . HIS B 2 214 ? 134.637 120.103 95.816  1.00 373.93 ? 214  HIS B CD2 1 
ATOM   5848  C CE1 . HIS B 2 214 ? 134.869 121.580 97.420  1.00 351.30 ? 214  HIS B CE1 1 
ATOM   5849  N NE2 . HIS B 2 214 ? 133.993 121.030 96.599  1.00 363.49 ? 214  HIS B NE2 1 
ATOM   5850  N N   . TRP B 2 215 ? 139.012 116.291 96.505  1.00 316.45 ? 215  TRP B N   1 
ATOM   5851  C CA  . TRP B 2 215 ? 140.201 115.517 96.103  1.00 340.41 ? 215  TRP B CA  1 
ATOM   5852  C C   . TRP B 2 215 ? 140.322 114.225 96.926  1.00 340.41 ? 215  TRP B C   1 
ATOM   5853  O O   . TRP B 2 215 ? 141.374 113.912 97.495  1.00 290.35 ? 215  TRP B O   1 
ATOM   5854  C CB  . TRP B 2 215 ? 141.482 116.368 96.197  1.00 359.24 ? 215  TRP B CB  1 
ATOM   5855  C CG  . TRP B 2 215 ? 142.594 115.872 95.303  1.00 366.86 ? 215  TRP B CG  1 
ATOM   5856  C CD1 . TRP B 2 215 ? 143.564 114.961 95.619  1.00 361.65 ? 215  TRP B CD1 1 
ATOM   5857  C CD2 . TRP B 2 215 ? 142.837 116.261 93.948  1.00 376.50 ? 215  TRP B CD2 1 
ATOM   5858  N NE1 . TRP B 2 215 ? 144.395 114.761 94.545  1.00 370.21 ? 215  TRP B NE1 1 
ATOM   5859  C CE2 . TRP B 2 215 ? 143.973 115.546 93.505  1.00 384.23 ? 215  TRP B CE2 1 
ATOM   5860  C CE3 . TRP B 2 215 ? 142.206 117.146 93.062  1.00 405.84 ? 215  TRP B CE3 1 
ATOM   5861  C CZ2 . TRP B 2 215 ? 144.495 115.687 92.210  1.00 407.18 ? 215  TRP B CZ2 1 
ATOM   5862  C CZ3 . TRP B 2 215 ? 142.726 117.289 91.771  1.00 428.88 ? 215  TRP B CZ3 1 
ATOM   5863  C CH2 . TRP B 2 215 ? 143.861 116.561 91.361  1.00 421.70 ? 215  TRP B CH2 1 
ATOM   5864  N N   . LYS B 2 216 ? 139.221 113.479 96.965  1.00 373.81 ? 216  LYS B N   1 
ATOM   5865  C CA  . LYS B 2 216 ? 139.150 112.175 97.628  1.00 402.22 ? 216  LYS B CA  1 
ATOM   5866  C C   . LYS B 2 216 ? 139.599 112.212 99.101  1.00 371.26 ? 216  LYS B C   1 
ATOM   5867  O O   . LYS B 2 216 ? 138.763 112.383 99.994  1.00 348.15 ? 216  LYS B O   1 
ATOM   5868  C CB  . LYS B 2 216 ? 139.909 111.112 96.803  1.00 407.94 ? 216  LYS B CB  1 
ATOM   5869  C CG  . LYS B 2 216 ? 139.882 109.707 97.393  1.00 412.49 ? 216  LYS B CG  1 
ATOM   5870  C CD  . LYS B 2 216 ? 140.249 108.650 96.362  1.00 415.48 ? 216  LYS B CD  1 
ATOM   5871  C CE  . LYS B 2 216 ? 140.278 107.256 96.974  1.00 410.49 ? 216  LYS B CE  1 
ATOM   5872  N NZ  . LYS B 2 216 ? 138.939 106.802 97.447  1.00 402.45 ? 216  LYS B NZ  1 
ATOM   5873  N N   . GLY B 2 217 ? 140.905 112.076 99.347  1.00 338.82 ? 217  GLY B N   1 
ATOM   5874  C CA  . GLY B 2 217 ? 141.429 111.919 100.702 1.00 334.17 ? 217  GLY B CA  1 
ATOM   5875  C C   . GLY B 2 217 ? 140.930 110.657 101.383 1.00 310.02 ? 217  GLY B C   1 
ATOM   5876  O O   . GLY B 2 217 ? 140.348 109.791 100.728 1.00 335.51 ? 217  GLY B O   1 
ATOM   5877  N N   . PRO B 2 218 ? 141.169 110.531 102.698 1.00 291.81 ? 218  PRO B N   1 
ATOM   5878  C CA  . PRO B 2 218 ? 140.470 109.492 103.458 1.00 306.71 ? 218  PRO B CA  1 
ATOM   5879  C C   . PRO B 2 218 ? 138.971 109.785 103.487 1.00 313.37 ? 218  PRO B C   1 
ATOM   5880  O O   . PRO B 2 218 ? 138.573 110.946 103.613 1.00 302.32 ? 218  PRO B O   1 
ATOM   5881  C CB  . PRO B 2 218 ? 141.082 109.563 104.862 1.00 329.46 ? 218  PRO B CB  1 
ATOM   5882  C CG  . PRO B 2 218 ? 142.024 110.712 104.871 1.00 341.37 ? 218  PRO B CG  1 
ATOM   5883  C CD  . PRO B 2 218 ? 142.096 111.330 103.514 1.00 316.79 ? 218  PRO B CD  1 
ATOM   5884  N N   . LEU B 2 219 ? 138.162 108.740 103.341 1.00 333.10 ? 219  LEU B N   1 
ATOM   5885  C CA  . LEU B 2 219 ? 136.715 108.890 103.197 1.00 360.26 ? 219  LEU B CA  1 
ATOM   5886  C C   . LEU B 2 219 ? 136.057 109.341 104.495 1.00 354.13 ? 219  LEU B C   1 
ATOM   5887  O O   . LEU B 2 219 ? 135.108 110.127 104.468 1.00 367.27 ? 219  LEU B O   1 
ATOM   5888  C CB  . LEU B 2 219 ? 136.090 107.583 102.699 1.00 397.77 ? 219  LEU B CB  1 
ATOM   5889  C CG  . LEU B 2 219 ? 134.580 107.614 102.409 1.00 420.85 ? 219  LEU B CG  1 
ATOM   5890  C CD1 . LEU B 2 219 ? 134.253 106.947 101.077 1.00 435.00 ? 219  LEU B CD1 1 
ATOM   5891  C CD2 . LEU B 2 219 ? 133.778 106.978 103.539 1.00 415.93 ? 219  LEU B CD2 1 
ATOM   5892  N N   . ARG B 2 220 ? 136.564 108.842 105.621 1.00 345.03 ? 220  ARG B N   1 
ATOM   5893  C CA  . ARG B 2 220 ? 136.067 109.223 106.937 1.00 350.80 ? 220  ARG B CA  1 
ATOM   5894  C C   . ARG B 2 220 ? 136.289 110.701 107.184 1.00 340.26 ? 220  ARG B C   1 
ATOM   5895  O O   . ARG B 2 220 ? 135.401 111.372 107.727 1.00 361.70 ? 220  ARG B O   1 
ATOM   5896  C CB  . ARG B 2 220 ? 136.751 108.406 108.040 1.00 363.08 ? 220  ARG B CB  1 
ATOM   5897  C CG  . ARG B 2 220 ? 136.347 106.941 108.082 1.00 370.62 ? 220  ARG B CG  1 
ATOM   5898  C CD  . ARG B 2 220 ? 135.007 106.741 108.775 1.00 375.98 ? 220  ARG B CD  1 
ATOM   5899  N NE  . ARG B 2 220 ? 134.631 105.327 108.846 1.00 393.55 ? 220  ARG B NE  1 
ATOM   5900  C CZ  . ARG B 2 220 ? 135.132 104.429 109.700 1.00 399.85 ? 220  ARG B CZ  1 
ATOM   5901  N NH1 . ARG B 2 220 ? 136.063 104.763 110.597 1.00 405.21 ? 220  ARG B NH1 1 
ATOM   5902  N NH2 . ARG B 2 220 ? 134.698 103.170 109.655 1.00 398.62 ? 220  ARG B NH2 1 
ATOM   5903  N N   . LEU B 2 221 ? 137.478 111.176 106.802 1.00 340.34 ? 221  LEU B N   1 
ATOM   5904  C CA  . LEU B 2 221 ? 137.865 112.572 106.989 1.00 320.91 ? 221  LEU B CA  1 
ATOM   5905  C C   . LEU B 2 221 ? 136.878 113.493 106.292 1.00 301.78 ? 221  LEU B C   1 
ATOM   5906  O O   . LEU B 2 221 ? 136.425 114.495 106.873 1.00 308.83 ? 221  LEU B O   1 
ATOM   5907  C CB  . LEU B 2 221 ? 139.264 112.848 106.431 1.00 319.81 ? 221  LEU B CB  1 
ATOM   5908  C CG  . LEU B 2 221 ? 139.855 114.242 106.672 1.00 326.99 ? 221  LEU B CG  1 
ATOM   5909  C CD1 . LEU B 2 221 ? 140.189 114.447 108.142 1.00 346.26 ? 221  LEU B CD1 1 
ATOM   5910  C CD2 . LEU B 2 221 ? 141.097 114.442 105.822 1.00 349.12 ? 221  LEU B CD2 1 
ATOM   5911  N N   . GLN B 2 222 ? 136.565 113.126 105.052 1.00 312.18 ? 222  GLN B N   1 
ATOM   5912  C CA  . GLN B 2 222 ? 135.629 113.893 104.217 1.00 326.68 ? 222  GLN B CA  1 
ATOM   5913  C C   . GLN B 2 222 ? 134.277 113.995 104.902 1.00 310.07 ? 222  GLN B C   1 
ATOM   5914  O O   . GLN B 2 222 ? 133.680 115.080 104.967 1.00 324.90 ? 222  GLN B O   1 
ATOM   5915  C CB  . GLN B 2 222 ? 135.453 113.251 102.839 1.00 344.02 ? 222  GLN B CB  1 
ATOM   5916  C CG  . GLN B 2 222 ? 134.610 114.063 101.866 1.00 336.78 ? 222  GLN B CG  1 
ATOM   5917  C CD  . GLN B 2 222 ? 134.401 113.348 100.544 1.00 394.41 ? 222  GLN B CD  1 
ATOM   5918  O OE1 . GLN B 2 222 ? 135.312 112.707 100.017 1.00 410.08 ? 222  GLN B OE1 1 
ATOM   5919  N NE2 . GLN B 2 222 ? 133.193 113.455 99.999  1.00 416.96 ? 222  GLN B NE2 1 
ATOM   5920  N N   . GLN B 2 223 ? 133.829 112.846 105.405 1.00 312.25 ? 223  GLN B N   1 
ATOM   5921  C CA  . GLN B 2 223 ? 132.543 112.736 106.105 1.00 332.00 ? 223  GLN B CA  1 
ATOM   5922  C C   . GLN B 2 223 ? 132.513 113.683 107.296 1.00 319.68 ? 223  GLN B C   1 
ATOM   5923  O O   . GLN B 2 223 ? 131.530 114.419 107.509 1.00 326.86 ? 223  GLN B O   1 
ATOM   5924  C CB  . GLN B 2 223 ? 132.303 111.317 106.641 1.00 345.17 ? 223  GLN B CB  1 
ATOM   5925  C CG  . GLN B 2 223 ? 131.823 110.288 105.635 1.00 367.80 ? 223  GLN B CG  1 
ATOM   5926  C CD  . GLN B 2 223 ? 131.498 108.961 106.299 1.00 374.45 ? 223  GLN B CD  1 
ATOM   5927  O OE1 . GLN B 2 223 ? 132.105 107.935 105.993 1.00 373.65 ? 223  GLN B OE1 1 
ATOM   5928  N NE2 . GLN B 2 223 ? 130.545 108.979 107.227 1.00 378.28 ? 223  GLN B NE2 1 
ATOM   5929  N N   . ALA B 2 224 ? 133.604 113.638 108.052 1.00 317.71 ? 224  ALA B N   1 
ATOM   5930  C CA  . ALA B 2 224 ? 133.776 114.463 109.252 1.00 318.53 ? 224  ALA B CA  1 
ATOM   5931  C C   . ALA B 2 224 ? 133.653 115.940 108.892 1.00 308.55 ? 224  ALA B C   1 
ATOM   5932  O O   . ALA B 2 224 ? 132.948 116.709 109.567 1.00 330.71 ? 224  ALA B O   1 
ATOM   5933  C CB  . ALA B 2 224 ? 135.123 114.194 109.913 1.00 335.43 ? 224  ALA B CB  1 
ATOM   5934  N N   . TYR B 2 225 ? 134.352 116.298 107.821 1.00 314.37 ? 225  TYR B N   1 
ATOM   5935  C CA  . TYR B 2 225 ? 134.369 117.674 107.315 1.00 326.41 ? 225  TYR B CA  1 
ATOM   5936  C C   . TYR B 2 225 ? 132.965 118.131 106.972 1.00 328.94 ? 225  TYR B C   1 
ATOM   5937  O O   . TYR B 2 225 ? 132.551 119.241 107.345 1.00 367.21 ? 225  TYR B O   1 
ATOM   5938  C CB  . TYR B 2 225 ? 135.363 117.908 106.177 1.00 319.58 ? 225  TYR B CB  1 
ATOM   5939  C CG  . TYR B 2 225 ? 136.582 118.520 106.758 1.00 311.70 ? 225  TYR B CG  1 
ATOM   5940  C CD1 . TYR B 2 225 ? 136.584 119.865 107.101 1.00 323.44 ? 225  TYR B CD1 1 
ATOM   5941  C CD2 . TYR B 2 225 ? 137.696 117.748 107.071 1.00 312.04 ? 225  TYR B CD2 1 
ATOM   5942  C CE1 . TYR B 2 225 ? 137.684 120.443 107.695 1.00 341.67 ? 225  TYR B CE1 1 
ATOM   5943  C CE2 . TYR B 2 225 ? 138.812 118.319 107.659 1.00 326.13 ? 225  TYR B CE2 1 
ATOM   5944  C CZ  . TYR B 2 225 ? 138.798 119.666 107.969 1.00 326.05 ? 225  TYR B CZ  1 
ATOM   5945  O OH  . TYR B 2 225 ? 139.883 120.245 108.562 1.00 327.16 ? 225  TYR B OH  1 
ATOM   5946  N N   . LEU B 2 226 ? 132.255 117.251 106.278 1.00 311.50 ? 226  LEU B N   1 
ATOM   5947  C CA  . LEU B 2 226 ? 130.874 117.502 105.847 1.00 317.45 ? 226  LEU B CA  1 
ATOM   5948  C C   . LEU B 2 226 ? 129.998 117.783 107.058 1.00 324.14 ? 226  LEU B C   1 
ATOM   5949  O O   . LEU B 2 226 ? 129.209 118.754 107.064 1.00 319.38 ? 226  LEU B O   1 
ATOM   5950  C CB  . LEU B 2 226 ? 130.273 116.325 105.060 1.00 337.01 ? 226  LEU B CB  1 
ATOM   5951  C CG  . LEU B 2 226 ? 130.207 116.482 103.541 1.00 372.44 ? 226  LEU B CG  1 
ATOM   5952  C CD1 . LEU B 2 226 ? 131.600 116.428 102.942 1.00 390.09 ? 226  LEU B CD1 1 
ATOM   5953  C CD2 . LEU B 2 226 ? 129.329 115.402 102.922 1.00 406.14 ? 226  LEU B CD2 1 
ATOM   5954  N N   . ILE B 2 227 ? 130.162 116.919 108.063 1.00 310.78 ? 227  ILE B N   1 
ATOM   5955  C CA  . ILE B 2 227 ? 129.376 117.025 109.300 1.00 308.41 ? 227  ILE B CA  1 
ATOM   5956  C C   . ILE B 2 227 ? 129.638 118.368 109.968 1.00 306.45 ? 227  ILE B C   1 
ATOM   5957  O O   . ILE B 2 227 ? 128.686 119.040 110.404 1.00 321.28 ? 227  ILE B O   1 
ATOM   5958  C CB  . ILE B 2 227 ? 129.354 115.814 110.278 1.00 321.94 ? 227  ILE B CB  1 
ATOM   5959  C CG1 . ILE B 2 227 ? 130.702 115.529 110.917 1.00 355.80 ? 227  ILE B CG1 1 
ATOM   5960  C CG2 . ILE B 2 227 ? 128.793 114.580 109.587 1.00 335.91 ? 227  ILE B CG2 1 
ATOM   5961  C CD1 . ILE B 2 227 ? 130.612 114.672 112.159 1.00 377.12 ? 227  ILE B CD1 1 
ATOM   5962  N N   . MET B 2 228 ? 130.913 118.736 110.016 1.00 303.32 ? 228  MET B N   1 
ATOM   5963  C CA  . MET B 2 228 ? 131.349 120.000 110.616 1.00 295.02 ? 228  MET B CA  1 
ATOM   5964  C C   . MET B 2 228 ? 130.677 121.172 109.915 1.00 309.67 ? 228  MET B C   1 
ATOM   5965  O O   . MET B 2 228 ? 130.158 122.093 110.571 1.00 302.09 ? 228  MET B O   1 
ATOM   5966  C CB  . MET B 2 228 ? 132.878 120.155 110.594 1.00 315.75 ? 228  MET B CB  1 
ATOM   5967  C CG  . MET B 2 228 ? 133.646 119.288 111.590 1.00 328.79 ? 228  MET B CG  1 
ATOM   5968  S SD  . MET B 2 228 ? 133.197 119.481 113.334 1.00 381.60 ? 228  MET B SD  1 
ATOM   5969  C CE  . MET B 2 228 ? 133.346 121.252 113.597 1.00 355.09 ? 228  MET B CE  1 
ATOM   5970  N N   . ILE B 2 229 ? 130.699 121.104 108.590 1.00 306.04 ? 229  ILE B N   1 
ATOM   5971  C CA  . ILE B 2 229 ? 130.109 122.136 107.729 1.00 315.44 ? 229  ILE B CA  1 
ATOM   5972  C C   . ILE B 2 229 ? 128.627 122.296 108.051 1.00 305.48 ? 229  ILE B C   1 
ATOM   5973  O O   . ILE B 2 229 ? 128.127 123.427 108.206 1.00 326.36 ? 229  ILE B O   1 
ATOM   5974  C CB  . ILE B 2 229 ? 130.307 121.803 106.222 1.00 330.11 ? 229  ILE B CB  1 
ATOM   5975  C CG1 . ILE B 2 229 ? 131.751 122.100 105.799 1.00 353.53 ? 229  ILE B CG1 1 
ATOM   5976  C CG2 . ILE B 2 229 ? 129.323 122.556 105.322 1.00 345.04 ? 229  ILE B CG2 1 
ATOM   5977  C CD1 . ILE B 2 229 ? 132.141 123.564 105.832 1.00 363.79 ? 229  ILE B CD1 1 
ATOM   5978  N N   . SER B 2 230 ? 127.964 121.145 108.143 1.00 268.14 ? 230  SER B N   1 
ATOM   5979  C CA  . SER B 2 230 ? 126.529 121.091 108.433 1.00 301.19 ? 230  SER B CA  1 
ATOM   5980  C C   . SER B 2 230 ? 126.236 121.768 109.766 1.00 307.87 ? 230  SER B C   1 
ATOM   5981  O O   . SER B 2 230 ? 125.297 122.576 109.875 1.00 316.45 ? 230  SER B O   1 
ATOM   5982  C CB  . SER B 2 230 ? 125.949 119.673 108.348 1.00 311.90 ? 230  SER B CB  1 
ATOM   5983  O OG  . SER B 2 230 ? 126.548 118.795 109.269 1.00 331.52 ? 230  SER B OG  1 
ATOM   5984  N N   . ALA B 2 231 ? 127.060 121.424 110.748 1.00 297.86 ? 231  ALA B N   1 
ATOM   5985  C CA  . ALA B 2 231 ? 126.946 121.967 112.106 1.00 305.92 ? 231  ALA B CA  1 
ATOM   5986  C C   . ALA B 2 231 ? 127.051 123.482 112.076 1.00 298.32 ? 231  ALA B C   1 
ATOM   5987  O O   . ALA B 2 231 ? 126.246 124.190 112.703 1.00 281.90 ? 231  ALA B O   1 
ATOM   5988  C CB  . ALA B 2 231 ? 128.013 121.382 113.016 1.00 323.32 ? 231  ALA B CB  1 
ATOM   5989  N N   . LEU B 2 232 ? 128.053 123.945 111.336 1.00 281.40 ? 232  LEU B N   1 
ATOM   5990  C CA  . LEU B 2 232 ? 128.329 125.378 111.181 1.00 300.60 ? 232  LEU B CA  1 
ATOM   5991  C C   . LEU B 2 232 ? 127.108 126.087 110.606 1.00 312.01 ? 232  LEU B C   1 
ATOM   5992  O O   . LEU B 2 232 ? 126.692 127.149 111.106 1.00 316.79 ? 232  LEU B O   1 
ATOM   5993  C CB  . LEU B 2 232 ? 129.574 125.631 110.317 1.00 303.82 ? 232  LEU B CB  1 
ATOM   5994  C CG  . LEU B 2 232 ? 130.842 126.049 111.065 1.00 322.86 ? 232  LEU B CG  1 
ATOM   5995  C CD1 . LEU B 2 232 ? 131.181 125.101 112.208 1.00 354.51 ? 232  LEU B CD1 1 
ATOM   5996  C CD2 . LEU B 2 232 ? 131.999 126.151 110.084 1.00 335.65 ? 232  LEU B CD2 1 
ATOM   5997  N N   . MET B 2 233 ? 126.563 125.469 109.562 1.00 317.46 ? 233  MET B N   1 
ATOM   5998  C CA  . MET B 2 233 ? 125.387 125.994 108.862 1.00 321.00 ? 233  MET B CA  1 
ATOM   5999  C C   . MET B 2 233 ? 124.219 126.141 109.834 1.00 315.86 ? 233  MET B C   1 
ATOM   6000  O O   . MET B 2 233 ? 123.536 127.183 109.862 1.00 344.41 ? 233  MET B O   1 
ATOM   6001  C CB  . MET B 2 233 ? 125.002 125.126 107.660 1.00 335.65 ? 233  MET B CB  1 
ATOM   6002  C CG  . MET B 2 233 ? 125.768 125.468 106.392 1.00 367.36 ? 233  MET B CG  1 
ATOM   6003  S SD  . MET B 2 233 ? 125.206 127.000 105.619 1.00 414.71 ? 233  MET B SD  1 
ATOM   6004  C CE  . MET B 2 233 ? 123.593 126.520 105.002 1.00 403.15 ? 233  MET B CE  1 
ATOM   6005  N N   . ALA B 2 234 ? 124.028 125.084 110.615 1.00 298.66 ? 234  ALA B N   1 
ATOM   6006  C CA  . ALA B 2 234 ? 122.954 125.027 111.611 1.00 307.49 ? 234  ALA B CA  1 
ATOM   6007  C C   . ALA B 2 234 ? 123.096 126.167 112.605 1.00 331.34 ? 234  ALA B C   1 
ATOM   6008  O O   . ALA B 2 234 ? 122.115 126.856 112.927 1.00 344.08 ? 234  ALA B O   1 
ATOM   6009  C CB  . ALA B 2 234 ? 122.920 123.689 112.301 1.00 285.11 ? 234  ALA B CB  1 
ATOM   6010  N N   . LEU B 2 235 ? 124.328 126.342 113.066 1.00 325.57 ? 235  LEU B N   1 
ATOM   6011  C CA  . LEU B 2 235 ? 124.674 127.392 114.031 1.00 321.46 ? 235  LEU B CA  1 
ATOM   6012  C C   . LEU B 2 235 ? 124.314 128.758 113.473 1.00 326.57 ? 235  LEU B C   1 
ATOM   6013  O O   . LEU B 2 235 ? 123.704 129.587 114.167 1.00 339.72 ? 235  LEU B O   1 
ATOM   6014  C CB  . LEU B 2 235 ? 126.157 127.345 114.401 1.00 292.78 ? 235  LEU B CB  1 
ATOM   6015  C CG  . LEU B 2 235 ? 126.520 126.516 115.622 1.00 306.82 ? 235  LEU B CG  1 
ATOM   6016  C CD1 . LEU B 2 235 ? 128.018 126.644 115.905 1.00 332.11 ? 235  LEU B CD1 1 
ATOM   6017  C CD2 . LEU B 2 235 ? 125.663 126.924 116.821 1.00 331.57 ? 235  LEU B CD2 1 
ATOM   6018  N N   . VAL B 2 236 ? 124.703 128.956 112.219 1.00 311.96 ? 236  VAL B N   1 
ATOM   6019  C CA  . VAL B 2 236 ? 124.456 130.210 111.497 1.00 315.81 ? 236  VAL B CA  1 
ATOM   6020  C C   . VAL B 2 236 ? 122.955 130.498 111.456 1.00 320.24 ? 236  VAL B C   1 
ATOM   6021  O O   . VAL B 2 236 ? 122.513 131.631 111.736 1.00 324.50 ? 236  VAL B O   1 
ATOM   6022  C CB  . VAL B 2 236 ? 125.086 130.190 110.079 1.00 318.01 ? 236  VAL B CB  1 
ATOM   6023  C CG1 . VAL B 2 236 ? 124.522 131.282 109.179 1.00 322.02 ? 236  VAL B CG1 1 
ATOM   6024  C CG2 . VAL B 2 236 ? 126.595 130.343 110.184 1.00 336.53 ? 236  VAL B CG2 1 
ATOM   6025  N N   . PHE B 2 237 ? 122.211 129.453 111.108 1.00 324.93 ? 237  PHE B N   1 
ATOM   6026  C CA  . PHE B 2 237 ? 120.752 129.526 111.003 1.00 327.86 ? 237  PHE B CA  1 
ATOM   6027  C C   . PHE B 2 237 ? 120.148 129.959 112.338 1.00 346.07 ? 237  PHE B C   1 
ATOM   6028  O O   . PHE B 2 237 ? 119.279 130.846 112.390 1.00 386.12 ? 237  PHE B O   1 
ATOM   6029  C CB  . PHE B 2 237 ? 120.136 128.203 110.530 1.00 338.84 ? 237  PHE B CB  1 
ATOM   6030  C CG  . PHE B 2 237 ? 119.906 128.141 109.045 1.00 345.64 ? 237  PHE B CG  1 
ATOM   6031  C CD1 . PHE B 2 237 ? 120.970 128.268 108.158 1.00 350.44 ? 237  PHE B CD1 1 
ATOM   6032  C CD2 . PHE B 2 237 ? 118.624 127.955 108.530 1.00 360.80 ? 237  PHE B CD2 1 
ATOM   6033  C CE1 . PHE B 2 237 ? 120.764 128.213 106.789 1.00 380.05 ? 237  PHE B CE1 1 
ATOM   6034  C CE2 . PHE B 2 237 ? 118.412 127.896 107.160 1.00 385.71 ? 237  PHE B CE2 1 
ATOM   6035  C CZ  . PHE B 2 237 ? 119.483 128.026 106.288 1.00 400.02 ? 237  PHE B CZ  1 
ATOM   6036  N N   . ILE B 2 238 ? 120.638 129.318 113.388 1.00 336.17 ? 238  ILE B N   1 
ATOM   6037  C CA  . ILE B 2 238 ? 120.188 129.581 114.758 1.00 343.52 ? 238  ILE B CA  1 
ATOM   6038  C C   . ILE B 2 238 ? 120.418 131.047 115.114 1.00 336.08 ? 238  ILE B C   1 
ATOM   6039  O O   . ILE B 2 238 ? 119.524 131.715 115.662 1.00 343.71 ? 238  ILE B O   1 
ATOM   6040  C CB  . ILE B 2 238 ? 120.793 128.567 115.750 1.00 328.67 ? 238  ILE B CB  1 
ATOM   6041  C CG1 . ILE B 2 238 ? 120.173 127.188 115.474 1.00 324.52 ? 238  ILE B CG1 1 
ATOM   6042  C CG2 . ILE B 2 238 ? 120.519 128.961 117.196 1.00 346.57 ? 238  ILE B CG2 1 
ATOM   6043  C CD1 . ILE B 2 238 ? 121.028 126.017 115.880 1.00 330.01 ? 238  ILE B CD1 1 
ATOM   6044  N N   . LYS B 2 239 ? 121.613 131.512 114.776 1.00 311.47 ? 239  LYS B N   1 
ATOM   6045  C CA  . LYS B 2 239 ? 122.024 132.894 115.029 1.00 328.87 ? 239  LYS B CA  1 
ATOM   6046  C C   . LYS B 2 239 ? 121.068 133.868 114.343 1.00 326.70 ? 239  LYS B C   1 
ATOM   6047  O O   . LYS B 2 239 ? 120.634 134.849 114.976 1.00 330.26 ? 239  LYS B O   1 
ATOM   6048  C CB  . LYS B 2 239 ? 123.484 133.129 114.612 1.00 358.56 ? 239  LYS B CB  1 
ATOM   6049  C CG  . LYS B 2 239 ? 124.078 134.462 115.048 1.00 359.22 ? 239  LYS B CG  1 
ATOM   6050  C CD  . LYS B 2 239 ? 124.479 134.511 116.511 1.00 352.53 ? 239  LYS B CD  1 
ATOM   6051  C CE  . LYS B 2 239 ? 124.850 135.933 116.920 1.00 373.36 ? 239  LYS B CE  1 
ATOM   6052  N NZ  . LYS B 2 239 ? 123.683 136.858 117.000 1.00 395.26 ? 239  LYS B NZ  1 
ATOM   6053  N N   . TYR B 2 240 ? 120.831 133.670 113.057 1.00 329.25 ? 240  TYR B N   1 
ATOM   6054  C CA  . TYR B 2 240 ? 120.156 134.668 112.247 1.00 335.97 ? 240  TYR B CA  1 
ATOM   6055  C C   . TYR B 2 240 ? 118.714 134.349 111.902 1.00 343.88 ? 240  TYR B C   1 
ATOM   6056  O O   . TYR B 2 240 ? 118.121 134.980 111.041 1.00 364.63 ? 240  TYR B O   1 
ATOM   6057  C CB  . TYR B 2 240 ? 120.980 134.957 110.999 1.00 343.55 ? 240  TYR B CB  1 
ATOM   6058  C CG  . TYR B 2 240 ? 122.430 135.268 111.301 1.00 344.35 ? 240  TYR B CG  1 
ATOM   6059  C CD1 . TYR B 2 240 ? 122.858 135.509 112.599 1.00 344.27 ? 240  TYR B CD1 1 
ATOM   6060  C CD2 . TYR B 2 240 ? 123.369 135.323 110.287 1.00 357.50 ? 240  TYR B CD2 1 
ATOM   6061  C CE1 . TYR B 2 240 ? 124.178 135.790 112.874 1.00 357.71 ? 240  TYR B CE1 1 
ATOM   6062  C CE2 . TYR B 2 240 ? 124.692 135.605 110.553 1.00 383.85 ? 240  TYR B CE2 1 
ATOM   6063  C CZ  . TYR B 2 240 ? 125.090 135.836 111.849 1.00 386.36 ? 240  TYR B CZ  1 
ATOM   6064  O OH  . TYR B 2 240 ? 126.411 136.114 112.117 1.00 389.59 ? 240  TYR B OH  1 
ATOM   6065  N N   . LEU B 2 241 ? 118.152 133.353 112.561 1.00 338.06 ? 241  LEU B N   1 
ATOM   6066  C CA  . LEU B 2 241 ? 116.769 133.017 112.325 1.00 353.01 ? 241  LEU B CA  1 
ATOM   6067  C C   . LEU B 2 241 ? 115.986 133.348 113.568 1.00 363.56 ? 241  LEU B C   1 
ATOM   6068  O O   . LEU B 2 241 ? 116.387 132.974 114.667 1.00 370.84 ? 241  LEU B O   1 
ATOM   6069  C CB  . LEU B 2 241 ? 116.622 131.539 111.987 1.00 374.93 ? 241  LEU B CB  1 
ATOM   6070  C CG  . LEU B 2 241 ? 115.908 131.220 110.675 1.00 386.37 ? 241  LEU B CG  1 
ATOM   6071  C CD1 . LEU B 2 241 ? 116.175 132.292 109.630 1.00 395.11 ? 241  LEU B CD1 1 
ATOM   6072  C CD2 . LEU B 2 241 ? 116.320 129.849 110.163 1.00 372.49 ? 241  LEU B CD2 1 
ATOM   6073  N N   . PRO B 2 242 ? 114.870 134.055 113.400 1.00 30.00  ? 242  PRO B N   1 
ATOM   6074  C CA  . PRO B 2 242 ? 113.965 134.385 114.511 1.00 30.00  ? 242  PRO B CA  1 
ATOM   6075  C C   . PRO B 2 242 ? 113.278 133.124 115.020 1.00 30.00  ? 242  PRO B C   1 
ATOM   6076  O O   . PRO B 2 242 ? 113.071 132.208 114.225 1.00 30.00  ? 242  PRO B O   1 
ATOM   6077  C CB  . PRO B 2 242 ? 112.944 135.318 113.860 1.00 20.00  ? 242  PRO B CB  1 
ATOM   6078  C CG  . PRO B 2 242 ? 113.685 135.952 112.733 1.00 20.00  ? 242  PRO B CG  1 
ATOM   6079  C CD  . PRO B 2 242 ? 114.627 134.901 112.218 1.00 20.00  ? 242  PRO B CD  1 
ATOM   6080  N N   . GLU B 2 243 ? 112.832 133.108 116.266 1.00 30.00  ? 243  GLU B N   1 
ATOM   6081  C CA  . GLU B 2 243 ? 112.433 131.859 116.883 1.00 30.00  ? 243  GLU B CA  1 
ATOM   6082  C C   . GLU B 2 243 ? 111.374 131.271 115.975 1.00 30.00  ? 243  GLU B C   1 
ATOM   6083  O O   . GLU B 2 243 ? 111.308 130.057 115.782 1.00 30.00  ? 243  GLU B O   1 
ATOM   6084  C CB  . GLU B 2 243 ? 111.862 132.102 118.280 1.00 20.00  ? 243  GLU B CB  1 
ATOM   6085  C CG  . GLU B 2 243 ? 112.436 133.324 118.980 1.00 20.00  ? 243  GLU B CG  1 
ATOM   6086  C CD  . GLU B 2 243 ? 111.794 133.576 120.330 1.00 20.00  ? 243  GLU B CD  1 
ATOM   6087  O OE1 . GLU B 2 243 ? 110.549 133.664 120.391 1.00 20.00  ? 243  GLU B OE1 1 
ATOM   6088  O OE2 . GLU B 2 243 ? 112.533 133.685 121.331 1.00 20.00  ? 243  GLU B OE2 1 
ATOM   6089  N N   . TRP B 2 244 ? 110.551 132.141 115.408 1.00 30.00  ? 244  TRP B N   1 
ATOM   6090  C CA  . TRP B 2 244 ? 109.566 131.715 114.414 1.00 30.00  ? 244  TRP B CA  1 
ATOM   6091  C C   . TRP B 2 244 ? 110.096 131.268 113.041 1.00 30.00  ? 244  TRP B C   1 
ATOM   6092  O O   . TRP B 2 244 ? 109.601 130.301 112.471 1.00 30.00  ? 244  TRP B O   1 
ATOM   6093  C CB  . TRP B 2 244 ? 108.404 132.704 114.304 1.00 20.00  ? 244  TRP B CB  1 
ATOM   6094  C CG  . TRP B 2 244 ? 107.204 132.164 115.004 1.00 20.00  ? 244  TRP B CG  1 
ATOM   6095  C CD1 . TRP B 2 244 ? 105.897 132.338 114.663 1.00 20.00  ? 244  TRP B CD1 1 
ATOM   6096  C CD2 . TRP B 2 244 ? 107.209 131.323 116.159 1.00 20.00  ? 244  TRP B CD2 1 
ATOM   6097  N NE1 . TRP B 2 244 ? 105.086 131.668 115.545 1.00 20.00  ? 244  TRP B NE1 1 
ATOM   6098  C CE2 . TRP B 2 244 ? 105.871 131.036 116.473 1.00 20.00  ? 244  TRP B CE2 1 
ATOM   6099  C CE3 . TRP B 2 244 ? 108.218 130.791 116.962 1.00 20.00  ? 244  TRP B CE3 1 
ATOM   6100  C CZ2 . TRP B 2 244 ? 105.517 130.241 117.554 1.00 20.00  ? 244  TRP B CZ2 1 
ATOM   6101  C CZ3 . TRP B 2 244 ? 107.866 130.006 118.028 1.00 20.00  ? 244  TRP B CZ3 1 
ATOM   6102  C CH2 . TRP B 2 244 ? 106.528 129.737 118.319 1.00 20.00  ? 244  TRP B CH2 1 
ATOM   6103  N N   . THR B 2 245 ? 111.090 131.962 112.505 1.00 401.41 ? 245  THR B N   1 
ATOM   6104  C CA  . THR B 2 245 ? 111.610 131.587 111.195 1.00 394.62 ? 245  THR B CA  1 
ATOM   6105  C C   . THR B 2 245 ? 112.222 130.184 111.198 1.00 382.63 ? 245  THR B C   1 
ATOM   6106  O O   . THR B 2 245 ? 111.929 129.381 110.312 1.00 341.69 ? 245  THR B O   1 
ATOM   6107  C CB  . THR B 2 245 ? 112.641 132.612 110.697 1.00 410.63 ? 245  THR B CB  1 
ATOM   6108  O OG1 . THR B 2 245 ? 111.976 133.850 110.428 1.00 402.19 ? 245  THR B OG1 1 
ATOM   6109  C CG2 . THR B 2 245 ? 113.331 132.125 109.426 1.00 415.61 ? 245  THR B CG2 1 
ATOM   6110  N N   . ALA B 2 246 ? 113.031 129.868 112.206 1.00 409.58 ? 246  ALA B N   1 
ATOM   6111  C CA  . ALA B 2 246 ? 113.436 128.500 112.404 1.00 391.46 ? 246  ALA B CA  1 
ATOM   6112  C C   . ALA B 2 246 ? 112.193 127.641 112.486 1.00 366.59 ? 246  ALA B C   1 
ATOM   6113  O O   . ALA B 2 246 ? 112.122 126.584 111.875 1.00 350.05 ? 246  ALA B O   1 
ATOM   6114  C CB  . ALA B 2 246 ? 114.263 128.375 113.672 1.00 395.81 ? 246  ALA B CB  1 
ATOM   6115  N N   . TRP B 2 247 ? 111.200 128.100 113.234 1.00 374.42 ? 247  TRP B N   1 
ATOM   6116  C CA  . TRP B 2 247 ? 109.978 127.328 113.358 1.00 386.09 ? 247  TRP B CA  1 
ATOM   6117  C C   . TRP B 2 247 ? 109.162 127.221 112.073 1.00 402.80 ? 247  TRP B C   1 
ATOM   6118  O O   . TRP B 2 247 ? 108.685 126.142 111.727 1.00 397.50 ? 247  TRP B O   1 
ATOM   6119  C CB  . TRP B 2 247 ? 109.146 127.859 114.513 1.00 399.49 ? 247  TRP B CB  1 
ATOM   6120  C CG  . TRP B 2 247 ? 109.874 127.717 115.793 1.00 409.56 ? 247  TRP B CG  1 
ATOM   6121  C CD1 . TRP B 2 247 ? 109.858 128.575 116.848 1.00 421.57 ? 247  TRP B CD1 1 
ATOM   6122  C CD2 . TRP B 2 247 ? 110.747 126.646 116.155 1.00 409.42 ? 247  TRP B CD2 1 
ATOM   6123  N NE1 . TRP B 2 247 ? 110.663 128.098 117.855 1.00 434.96 ? 247  TRP B NE1 1 
ATOM   6124  C CE2 . TRP B 2 247 ? 111.221 126.913 117.451 1.00 421.76 ? 247  TRP B CE2 1 
ATOM   6125  C CE3 . TRP B 2 247 ? 111.170 125.481 115.512 1.00 401.03 ? 247  TRP B CE3 1 
ATOM   6126  C CZ2 . TRP B 2 247 ? 112.099 126.062 118.112 1.00 402.89 ? 247  TRP B CZ2 1 
ATOM   6127  C CZ3 . TRP B 2 247 ? 112.038 124.639 116.170 1.00 403.59 ? 247  TRP B CZ3 1 
ATOM   6128  C CH2 . TRP B 2 247 ? 112.492 124.931 117.455 1.00 391.86 ? 247  TRP B CH2 1 
ATOM   6129  N N   . LEU B 2 248 ? 108.997 128.334 111.365 1.00 409.64 ? 248  LEU B N   1 
ATOM   6130  C CA  . LEU B 2 248 ? 108.259 128.296 110.108 1.00 390.92 ? 248  LEU B CA  1 
ATOM   6131  C C   . LEU B 2 248 ? 108.989 127.504 109.042 1.00 352.61 ? 248  LEU B C   1 
ATOM   6132  O O   . LEU B 2 248 ? 108.400 126.721 108.309 1.00 335.82 ? 248  LEU B O   1 
ATOM   6133  C CB  . LEU B 2 248 ? 107.972 129.706 109.603 1.00 404.53 ? 248  LEU B CB  1 
ATOM   6134  C CG  . LEU B 2 248 ? 106.502 130.051 109.367 1.00 415.41 ? 248  LEU B CG  1 
ATOM   6135  C CD1 . LEU B 2 248 ? 106.372 131.151 108.326 1.00 421.67 ? 248  LEU B CD1 1 
ATOM   6136  C CD2 . LEU B 2 248 ? 105.698 128.824 108.964 1.00 413.60 ? 248  LEU B CD2 1 
ATOM   6137  N N   . ILE B 2 249 ? 110.292 127.721 108.982 1.00 351.93 ? 249  ILE B N   1 
ATOM   6138  C CA  . ILE B 2 249 ? 111.142 127.206 107.926 1.00 367.80 ? 249  ILE B CA  1 
ATOM   6139  C C   . ILE B 2 249 ? 111.254 125.696 107.995 1.00 363.50 ? 249  ILE B C   1 
ATOM   6140  O O   . ILE B 2 249 ? 111.266 125.027 106.968 1.00 369.56 ? 249  ILE B O   1 
ATOM   6141  C CB  . ILE B 2 249 ? 112.537 127.838 107.960 1.00 385.82 ? 249  ILE B CB  1 
ATOM   6142  C CG1 . ILE B 2 249 ? 112.425 129.348 107.738 1.00 394.48 ? 249  ILE B CG1 1 
ATOM   6143  C CG2 . ILE B 2 249 ? 113.434 127.192 106.917 1.00 379.61 ? 249  ILE B CG2 1 
ATOM   6144  C CD1 . ILE B 2 249 ? 113.715 130.007 107.305 1.00 395.95 ? 249  ILE B CD1 1 
ATOM   6145  N N   . LEU B 2 250 ? 111.345 125.157 109.205 1.00 369.93 ? 250  LEU B N   1 
ATOM   6146  C CA  . LEU B 2 250 ? 111.451 123.712 109.363 1.00 362.11 ? 250  LEU B CA  1 
ATOM   6147  C C   . LEU B 2 250 ? 110.158 123.041 108.940 1.00 344.23 ? 250  LEU B C   1 
ATOM   6148  O O   . LEU B 2 250 ? 110.161 121.923 108.438 1.00 331.99 ? 250  LEU B O   1 
ATOM   6149  C CB  . LEU B 2 250 ? 111.773 123.354 110.809 1.00 356.66 ? 250  LEU B CB  1 
ATOM   6150  C CG  . LEU B 2 250 ? 113.230 123.517 111.225 1.00 369.05 ? 250  LEU B CG  1 
ATOM   6151  C CD1 . LEU B 2 250 ? 113.526 122.682 112.456 1.00 375.15 ? 250  LEU B CD1 1 
ATOM   6152  C CD2 . LEU B 2 250 ? 114.150 123.128 110.087 1.00 368.82 ? 250  LEU B CD2 1 
ATOM   6153  N N   . ALA B 2 251 ? 109.053 123.742 109.145 1.00 350.42 ? 251  ALA B N   1 
ATOM   6154  C CA  . ALA B 2 251 ? 107.722 123.231 108.823 1.00 370.36 ? 251  ALA B CA  1 
ATOM   6155  C C   . ALA B 2 251 ? 107.489 123.321 107.304 1.00 381.47 ? 251  ALA B C   1 
ATOM   6156  O O   . ALA B 2 251 ? 107.028 122.370 106.655 1.00 381.16 ? 251  ALA B O   1 
ATOM   6157  C CB  . ALA B 2 251 ? 106.640 123.988 109.584 1.00 377.36 ? 251  ALA B CB  1 
ATOM   6158  N N   . VAL B 2 252 ? 107.842 124.481 106.763 1.00 385.50 ? 252  VAL B N   1 
ATOM   6159  C CA  . VAL B 2 252 ? 107.448 124.894 105.426 1.00 387.36 ? 252  VAL B CA  1 
ATOM   6160  C C   . VAL B 2 252 ? 108.313 124.183 104.423 1.00 372.46 ? 252  VAL B C   1 
ATOM   6161  O O   . VAL B 2 252 ? 107.768 123.644 103.445 1.00 359.06 ? 252  VAL B O   1 
ATOM   6162  C CB  . VAL B 2 252 ? 107.499 126.436 105.248 1.00 418.15 ? 252  VAL B CB  1 
ATOM   6163  C CG1 . VAL B 2 252 ? 107.471 126.845 103.776 1.00 447.53 ? 252  VAL B CG1 1 
ATOM   6164  C CG2 . VAL B 2 252 ? 106.329 127.080 105.980 1.00 415.85 ? 252  VAL B CG2 1 
ATOM   6165  N N   . ILE B 2 253 ? 109.629 124.194 104.660 1.00 385.31 ? 253  ILE B N   1 
ATOM   6166  C CA  . ILE B 2 253 ? 110.582 123.559 103.742 1.00 408.23 ? 253  ILE B CA  1 
ATOM   6167  C C   . ILE B 2 253 ? 110.273 122.075 103.611 1.00 401.86 ? 253  ILE B C   1 
ATOM   6168  O O   . ILE B 2 253 ? 110.257 121.538 102.490 1.00 421.48 ? 253  ILE B O   1 
ATOM   6169  C CB  . ILE B 2 253 ? 112.080 123.823 104.075 1.00 413.68 ? 253  ILE B CB  1 
ATOM   6170  C CG1 . ILE B 2 253 ? 112.958 123.401 102.884 1.00 415.24 ? 253  ILE B CG1 1 
ATOM   6171  C CG2 . ILE B 2 253 ? 112.535 123.112 105.347 1.00 401.47 ? 253  ILE B CG2 1 
ATOM   6172  C CD1 . ILE B 2 253 ? 114.341 124.011 102.879 1.00 418.42 ? 253  ILE B CD1 1 
ATOM   6173  N N   . SER B 2 254 ? 110.020 121.450 104.760 1.00 384.21 ? 254  SER B N   1 
ATOM   6174  C CA  . SER B 2 254 ? 109.703 120.019 104.816 1.00 392.75 ? 254  SER B CA  1 
ATOM   6175  C C   . SER B 2 254 ? 108.462 119.723 103.984 1.00 411.88 ? 254  SER B C   1 
ATOM   6176  O O   . SER B 2 254 ? 108.438 118.762 103.199 1.00 425.23 ? 254  SER B O   1 
ATOM   6177  C CB  . SER B 2 254 ? 109.495 119.547 106.256 1.00 411.63 ? 254  SER B CB  1 
ATOM   6178  O OG  . SER B 2 254 ? 108.360 120.153 106.849 1.00 413.50 ? 254  SER B OG  1 
ATOM   6179  N N   . VAL B 2 255 ? 107.457 120.573 104.175 1.00 426.76 ? 255  VAL B N   1 
ATOM   6180  C CA  . VAL B 2 255 ? 106.178 120.458 103.467 1.00 420.23 ? 255  VAL B CA  1 
ATOM   6181  C C   . VAL B 2 255 ? 106.408 120.518 101.957 1.00 431.70 ? 255  VAL B C   1 
ATOM   6182  O O   . VAL B 2 255 ? 105.863 119.702 101.197 1.00 436.54 ? 255  VAL B O   1 
ATOM   6183  C CB  . VAL B 2 255 ? 105.123 121.497 103.946 1.00 418.81 ? 255  VAL B CB  1 
ATOM   6184  C CG1 . VAL B 2 255 ? 103.951 121.613 102.970 1.00 404.84 ? 255  VAL B CG1 1 
ATOM   6185  C CG2 . VAL B 2 255 ? 104.608 121.126 105.334 1.00 424.38 ? 255  VAL B CG2 1 
ATOM   6186  N N   . TYR B 2 256 ? 107.220 121.492 101.568 1.00 450.93 ? 256  TYR B N   1 
ATOM   6187  C CA  . TYR B 2 256 ? 107.570 121.721 100.163 1.00 471.59 ? 256  TYR B CA  1 
ATOM   6188  C C   . TYR B 2 256 ? 108.213 120.470 99.571  1.00 456.12 ? 256  TYR B C   1 
ATOM   6189  O O   . TYR B 2 256 ? 107.858 120.030 98.468  1.00 478.91 ? 256  TYR B O   1 
ATOM   6190  C CB  . TYR B 2 256 ? 108.507 122.928 100.017 1.00 500.00 ? 256  TYR B CB  1 
ATOM   6191  C CG  . TYR B 2 256 ? 108.729 123.378 98.588  1.00 500.00 ? 256  TYR B CG  1 
ATOM   6192  C CD1 . TYR B 2 256 ? 107.816 124.221 97.951  1.00 500.00 ? 256  TYR B CD1 1 
ATOM   6193  C CD2 . TYR B 2 256 ? 109.858 122.970 97.873  1.00 500.00 ? 256  TYR B CD2 1 
ATOM   6194  C CE1 . TYR B 2 256 ? 108.017 124.641 96.641  1.00 500.00 ? 256  TYR B CE1 1 
ATOM   6195  C CE2 . TYR B 2 256 ? 110.068 123.385 96.563  1.00 500.00 ? 256  TYR B CE2 1 
ATOM   6196  C CZ  . TYR B 2 256 ? 109.146 124.220 95.951  1.00 500.00 ? 256  TYR B CZ  1 
ATOM   6197  O OH  . TYR B 2 256 ? 109.349 124.633 94.653  1.00 500.00 ? 256  TYR B OH  1 
ATOM   6198  N N   . ASP B 2 257 ? 109.152 119.928 100.336 1.00 435.42 ? 257  ASP B N   1 
ATOM   6199  C CA  . ASP B 2 257 ? 109.892 118.722 99.948  1.00 424.90 ? 257  ASP B CA  1 
ATOM   6200  C C   . ASP B 2 257 ? 108.924 117.567 99.709  1.00 410.36 ? 257  ASP B C   1 
ATOM   6201  O O   . ASP B 2 257 ? 109.023 116.849 98.704  1.00 412.99 ? 257  ASP B O   1 
ATOM   6202  C CB  . ASP B 2 257 ? 110.967 118.336 100.971 1.00 435.63 ? 257  ASP B CB  1 
ATOM   6203  C CG  . ASP B 2 257 ? 112.019 117.403 100.385 1.00 422.58 ? 257  ASP B CG  1 
ATOM   6204  O OD1 . ASP B 2 257 ? 112.726 117.817 99.441  1.00 401.96 ? 257  ASP B OD1 1 
ATOM   6205  O OD2 . ASP B 2 257 ? 112.141 116.258 100.867 1.00 427.20 ? 257  ASP B OD2 1 
ATOM   6206  N N   . LEU B 2 258 ? 108.003 117.423 100.653 1.00 413.44 ? 258  LEU B N   1 
ATOM   6207  C CA  . LEU B 2 258 ? 106.979 116.374 100.613 1.00 427.22 ? 258  LEU B CA  1 
ATOM   6208  C C   . LEU B 2 258 ? 106.154 116.495 99.334  1.00 450.70 ? 258  LEU B C   1 
ATOM   6209  O O   . LEU B 2 258 ? 105.908 115.502 98.633  1.00 444.21 ? 258  LEU B O   1 
ATOM   6210  C CB  . LEU B 2 258 ? 106.080 116.430 101.858 1.00 442.35 ? 258  LEU B CB  1 
ATOM   6211  C CG  . LEU B 2 258 ? 105.224 115.197 102.173 1.00 451.98 ? 258  LEU B CG  1 
ATOM   6212  C CD1 . LEU B 2 258 ? 106.089 113.993 102.521 1.00 441.06 ? 258  LEU B CD1 1 
ATOM   6213  C CD2 . LEU B 2 258 ? 104.259 115.505 103.309 1.00 452.46 ? 258  LEU B CD2 1 
ATOM   6214  N N   . VAL B 2 259 ? 105.753 117.730 99.062  1.00 476.62 ? 259  VAL B N   1 
ATOM   6215  C CA  . VAL B 2 259 ? 104.949 118.064 97.881  1.00 489.42 ? 259  VAL B CA  1 
ATOM   6216  C C   . VAL B 2 259 ? 105.693 117.648 96.607  1.00 488.60 ? 259  VAL B C   1 
ATOM   6217  O O   . VAL B 2 259 ? 105.120 117.030 95.706  1.00 488.29 ? 259  VAL B O   1 
ATOM   6218  C CB  . VAL B 2 259 ? 104.534 119.563 97.844  1.00 495.62 ? 259  VAL B CB  1 
ATOM   6219  C CG1 . VAL B 2 259 ? 103.924 119.948 96.496  1.00 500.00 ? 259  VAL B CG1 1 
ATOM   6220  C CG2 . VAL B 2 259 ? 103.555 119.878 98.975  1.00 490.63 ? 259  VAL B CG2 1 
ATOM   6221  N N   . ALA B 2 260 ? 106.986 117.986 96.562  1.00 489.92 ? 260  ALA B N   1 
ATOM   6222  C CA  . ALA B 2 260 ? 107.855 117.715 95.407  1.00 495.62 ? 260  ALA B CA  1 
ATOM   6223  C C   . ALA B 2 260 ? 108.293 116.245 95.249  1.00 500.00 ? 260  ALA B C   1 
ATOM   6224  O O   . ALA B 2 260 ? 109.294 115.968 94.582  1.00 500.00 ? 260  ALA B O   1 
ATOM   6225  C CB  . ALA B 2 260 ? 109.077 118.631 95.449  1.00 487.13 ? 260  ALA B CB  1 
ATOM   6226  N N   . VAL B 2 261 ? 107.589 115.324 95.910  1.00 500.00 ? 261  VAL B N   1 
ATOM   6227  C CA  . VAL B 2 261 ? 107.505 113.919 95.499  1.00 500.00 ? 261  VAL B CA  1 
ATOM   6228  C C   . VAL B 2 261 ? 106.092 113.616 95.000  1.00 500.00 ? 261  VAL B C   1 
ATOM   6229  O O   . VAL B 2 261 ? 105.920 112.958 93.963  1.00 500.00 ? 261  VAL B O   1 
ATOM   6230  C CB  . VAL B 2 261 ? 107.870 112.974 96.669  1.00 500.00 ? 261  VAL B CB  1 
ATOM   6231  C CG1 . VAL B 2 261 ? 107.741 111.507 96.254  1.00 500.00 ? 261  VAL B CG1 1 
ATOM   6232  C CG2 . VAL B 2 261 ? 109.276 113.286 97.185  1.00 500.00 ? 261  VAL B CG2 1 
ATOM   6233  N N   . VAL B 2 379 ? 118.686 105.208 101.861 1.00 434.11 ? 379  VAL B N   1 
ATOM   6234  C CA  . VAL B 2 379 ? 118.767 106.493 101.173 1.00 441.78 ? 379  VAL B CA  1 
ATOM   6235  C C   . VAL B 2 379 ? 120.080 107.206 101.511 1.00 444.68 ? 379  VAL B C   1 
ATOM   6236  O O   . VAL B 2 379 ? 120.574 107.110 102.638 1.00 437.23 ? 379  VAL B O   1 
ATOM   6237  C CB  . VAL B 2 379 ? 117.555 107.403 101.518 1.00 438.40 ? 379  VAL B CB  1 
ATOM   6238  C CG1 . VAL B 2 379 ? 117.526 107.763 103.003 1.00 442.87 ? 379  VAL B CG1 1 
ATOM   6239  C CG2 . VAL B 2 379 ? 117.541 108.656 100.646 1.00 431.97 ? 379  VAL B CG2 1 
ATOM   6240  N N   . LYS B 2 380 ? 120.636 107.914 100.527 1.00 451.11 ? 380  LYS B N   1 
ATOM   6241  C CA  . LYS B 2 380 ? 121.828 108.737 100.734 1.00 435.76 ? 380  LYS B CA  1 
ATOM   6242  C C   . LYS B 2 380 ? 121.410 110.026 101.439 1.00 403.56 ? 380  LYS B C   1 
ATOM   6243  O O   . LYS B 2 380 ? 120.584 110.782 100.918 1.00 388.82 ? 380  LYS B O   1 
ATOM   6244  C CB  . LYS B 2 380 ? 122.511 109.052 99.399  1.00 441.60 ? 380  LYS B CB  1 
ATOM   6245  C CG  . LYS B 2 380 ? 123.921 109.613 99.536  1.00 449.79 ? 380  LYS B CG  1 
ATOM   6246  C CD  . LYS B 2 380 ? 124.514 110.007 98.191  1.00 469.90 ? 380  LYS B CD  1 
ATOM   6247  C CE  . LYS B 2 380 ? 124.898 108.795 97.354  1.00 477.14 ? 380  LYS B CE  1 
ATOM   6248  N NZ  . LYS B 2 380 ? 125.601 109.181 96.099  1.00 480.33 ? 380  LYS B NZ  1 
ATOM   6249  N N   . LEU B 2 381 ? 121.981 110.268 102.619 1.00 375.73 ? 381  LEU B N   1 
ATOM   6250  C CA  . LEU B 2 381 ? 121.583 111.399 103.459 1.00 361.17 ? 381  LEU B CA  1 
ATOM   6251  C C   . LEU B 2 381 ? 122.246 112.673 102.944 1.00 351.53 ? 381  LEU B C   1 
ATOM   6252  O O   . LEU B 2 381 ? 123.476 112.764 102.884 1.00 348.12 ? 381  LEU B O   1 
ATOM   6253  C CB  . LEU B 2 381 ? 121.947 111.138 104.930 1.00 346.44 ? 381  LEU B CB  1 
ATOM   6254  C CG  . LEU B 2 381 ? 121.123 111.802 106.050 1.00 354.59 ? 381  LEU B CG  1 
ATOM   6255  C CD1 . LEU B 2 381 ? 121.527 113.252 106.250 1.00 376.54 ? 381  LEU B CD1 1 
ATOM   6256  C CD2 . LEU B 2 381 ? 119.614 111.696 105.836 1.00 365.85 ? 381  LEU B CD2 1 
ATOM   6257  N N   . GLY B 2 382 ? 121.420 113.645 102.563 1.00 356.93 ? 382  GLY B N   1 
ATOM   6258  C CA  . GLY B 2 382 ? 121.899 114.879 101.948 1.00 367.92 ? 382  GLY B CA  1 
ATOM   6259  C C   . GLY B 2 382 ? 122.529 115.829 102.944 1.00 352.68 ? 382  GLY B C   1 
ATOM   6260  O O   . GLY B 2 382 ? 122.209 115.797 104.133 1.00 329.44 ? 382  GLY B O   1 
ATOM   6261  N N   . LEU B 2 383 ? 123.419 116.684 102.445 1.00 351.56 ? 383  LEU B N   1 
ATOM   6262  C CA  . LEU B 2 383 ? 124.099 117.679 103.279 1.00 340.75 ? 383  LEU B CA  1 
ATOM   6263  C C   . LEU B 2 383 ? 123.102 118.694 103.845 1.00 331.96 ? 383  LEU B C   1 
ATOM   6264  O O   . LEU B 2 383 ? 123.265 119.153 104.968 1.00 324.69 ? 383  LEU B O   1 
ATOM   6265  C CB  . LEU B 2 383 ? 125.219 118.378 102.493 1.00 356.04 ? 383  LEU B CB  1 
ATOM   6266  C CG  . LEU B 2 383 ? 126.374 119.060 103.252 1.00 375.65 ? 383  LEU B CG  1 
ATOM   6267  C CD1 . LEU B 2 383 ? 125.972 120.383 103.902 1.00 357.39 ? 383  LEU B CD1 1 
ATOM   6268  C CD2 . LEU B 2 383 ? 127.015 118.122 104.273 1.00 379.76 ? 383  LEU B CD2 1 
ATOM   6269  N N   . GLY B 2 384 ? 122.069 119.026 103.074 1.00 333.90 ? 384  GLY B N   1 
ATOM   6270  C CA  . GLY B 2 384 ? 120.978 119.865 103.562 1.00 347.42 ? 384  GLY B CA  1 
ATOM   6271  C C   . GLY B 2 384 ? 120.177 119.228 104.688 1.00 339.85 ? 384  GLY B C   1 
ATOM   6272  O O   . GLY B 2 384 ? 119.909 119.873 105.701 1.00 303.76 ? 384  GLY B O   1 
ATOM   6273  N N   . ASP B 2 385 ? 119.807 117.958 104.509 1.00 355.72 ? 385  ASP B N   1 
ATOM   6274  C CA  . ASP B 2 385 ? 119.016 117.205 105.498 1.00 359.67 ? 385  ASP B CA  1 
ATOM   6275  C C   . ASP B 2 385 ? 119.661 117.255 106.857 1.00 352.65 ? 385  ASP B C   1 
ATOM   6276  O O   . ASP B 2 385 ? 119.017 117.552 107.885 1.00 371.43 ? 385  ASP B O   1 
ATOM   6277  C CB  . ASP B 2 385 ? 118.873 115.730 105.078 1.00 372.67 ? 385  ASP B CB  1 
ATOM   6278  C CG  . ASP B 2 385 ? 118.141 115.550 103.755 1.00 414.16 ? 385  ASP B CG  1 
ATOM   6279  O OD1 . ASP B 2 385 ? 118.000 116.534 102.993 1.00 434.25 ? 385  ASP B OD1 1 
ATOM   6280  O OD2 . ASP B 2 385 ? 117.713 114.411 103.472 1.00 428.96 ? 385  ASP B OD2 1 
ATOM   6281  N N   . PHE B 2 386 ? 120.972 116.956 106.822 1.00 327.12 ? 386  PHE B N   1 
ATOM   6282  C CA  . PHE B 2 386 ? 121.885 116.959 107.987 1.00 317.31 ? 386  PHE B CA  1 
ATOM   6283  C C   . PHE B 2 386 ? 121.758 118.311 108.698 1.00 316.72 ? 386  PHE B C   1 
ATOM   6284  O O   . PHE B 2 386 ? 121.589 118.402 109.928 1.00 326.16 ? 386  PHE B O   1 
ATOM   6285  C CB  . PHE B 2 386 ? 123.370 116.940 107.538 1.00 322.68 ? 386  PHE B CB  1 
ATOM   6286  C CG  . PHE B 2 386 ? 124.019 115.588 107.470 1.00 329.09 ? 386  PHE B CG  1 
ATOM   6287  C CD1 . PHE B 2 386 ? 124.228 114.836 108.613 1.00 334.78 ? 386  PHE B CD1 1 
ATOM   6288  C CD2 . PHE B 2 386 ? 124.533 115.114 106.265 1.00 356.40 ? 386  PHE B CD2 1 
ATOM   6289  C CE1 . PHE B 2 386 ? 124.869 113.605 108.538 1.00 339.04 ? 386  PHE B CE1 1 
ATOM   6290  C CE2 . PHE B 2 386 ? 125.174 113.886 106.189 1.00 364.31 ? 386  PHE B CE2 1 
ATOM   6291  C CZ  . PHE B 2 386 ? 125.339 113.127 107.329 1.00 335.59 ? 386  PHE B CZ  1 
ATOM   6292  N N   . ILE B 2 387 ? 121.913 119.346 107.871 1.00 316.74 ? 387  ILE B N   1 
ATOM   6293  C CA  . ILE B 2 387 ? 121.929 120.736 108.340 1.00 310.30 ? 387  ILE B CA  1 
ATOM   6294  C C   . ILE B 2 387 ? 120.608 121.048 109.045 1.00 308.53 ? 387  ILE B C   1 
ATOM   6295  O O   . ILE B 2 387 ? 120.602 121.643 110.130 1.00 323.56 ? 387  ILE B O   1 
ATOM   6296  C CB  . ILE B 2 387 ? 122.113 121.766 107.186 1.00 330.22 ? 387  ILE B CB  1 
ATOM   6297  C CG1 . ILE B 2 387 ? 123.555 121.765 106.689 1.00 349.55 ? 387  ILE B CG1 1 
ATOM   6298  C CG2 . ILE B 2 387 ? 121.741 123.189 107.629 1.00 335.26 ? 387  ILE B CG2 1 
ATOM   6299  C CD1 . ILE B 2 387 ? 123.741 122.333 105.296 1.00 361.33 ? 387  ILE B CD1 1 
ATOM   6300  N N   . PHE B 2 388 ? 119.520 120.641 108.404 1.00 329.64 ? 388  PHE B N   1 
ATOM   6301  C CA  . PHE B 2 388 ? 118.193 120.913 108.962 1.00 343.95 ? 388  PHE B CA  1 
ATOM   6302  C C   . PHE B 2 388 ? 118.019 120.216 110.297 1.00 339.62 ? 388  PHE B C   1 
ATOM   6303  O O   . PHE B 2 388 ? 117.498 120.842 111.243 1.00 312.34 ? 388  PHE B O   1 
ATOM   6304  C CB  . PHE B 2 388 ? 117.070 120.631 107.961 1.00 352.04 ? 388  PHE B CB  1 
ATOM   6305  C CG  . PHE B 2 388 ? 117.036 121.620 106.827 1.00 359.67 ? 388  PHE B CG  1 
ATOM   6306  C CD1 . PHE B 2 388 ? 116.868 122.981 107.084 1.00 348.80 ? 388  PHE B CD1 1 
ATOM   6307  C CD2 . PHE B 2 388 ? 117.196 121.207 105.507 1.00 382.46 ? 388  PHE B CD2 1 
ATOM   6308  C CE1 . PHE B 2 388 ? 116.856 123.904 106.051 1.00 365.72 ? 388  PHE B CE1 1 
ATOM   6309  C CE2 . PHE B 2 388 ? 117.182 122.127 104.467 1.00 382.35 ? 388  PHE B CE2 1 
ATOM   6310  C CZ  . PHE B 2 388 ? 117.014 123.477 104.741 1.00 387.20 ? 388  PHE B CZ  1 
ATOM   6311  N N   . TYR B 2 389 ? 118.499 118.973 110.369 1.00 339.04 ? 389  TYR B N   1 
ATOM   6312  C CA  . TYR B 2 389 ? 118.447 118.189 111.603 1.00 338.54 ? 389  TYR B CA  1 
ATOM   6313  C C   . TYR B 2 389 ? 119.187 118.921 112.724 1.00 320.63 ? 389  TYR B C   1 
ATOM   6314  O O   . TYR B 2 389 ? 118.687 119.035 113.855 1.00 339.94 ? 389  TYR B O   1 
ATOM   6315  C CB  . TYR B 2 389 ? 119.001 116.759 111.456 1.00 345.15 ? 389  TYR B CB  1 
ATOM   6316  C CG  . TYR B 2 389 ? 118.294 115.867 110.454 1.00 332.54 ? 389  TYR B CG  1 
ATOM   6317  C CD1 . TYR B 2 389 ? 116.903 115.885 110.311 1.00 345.37 ? 389  TYR B CD1 1 
ATOM   6318  C CD2 . TYR B 2 389 ? 119.022 114.981 109.658 1.00 328.62 ? 389  TYR B CD2 1 
ATOM   6319  C CE1 . TYR B 2 389 ? 116.267 115.062 109.393 1.00 350.61 ? 389  TYR B CE1 1 
ATOM   6320  C CE2 . TYR B 2 389 ? 118.393 114.155 108.738 1.00 341.52 ? 389  TYR B CE2 1 
ATOM   6321  C CZ  . TYR B 2 389 ? 117.017 114.196 108.609 1.00 342.63 ? 389  TYR B CZ  1 
ATOM   6322  O OH  . TYR B 2 389 ? 116.399 113.372 107.697 1.00 348.08 ? 389  TYR B OH  1 
ATOM   6323  N N   . SER B 2 390 ? 120.370 119.400 112.369 1.00 305.48 ? 390  SER B N   1 
ATOM   6324  C CA  . SER B 2 390 ? 121.240 120.131 113.296 1.00 312.20 ? 390  SER B CA  1 
ATOM   6325  C C   . SER B 2 390 ? 120.526 121.355 113.831 1.00 300.24 ? 390  SER B C   1 
ATOM   6326  O O   . SER B 2 390 ? 120.546 121.622 115.041 1.00 289.18 ? 390  SER B O   1 
ATOM   6327  C CB  . SER B 2 390 ? 122.560 120.466 112.618 1.00 336.47 ? 390  SER B CB  1 
ATOM   6328  O OG  . SER B 2 390 ? 123.439 119.360 112.691 1.00 322.21 ? 390  SER B OG  1 
ATOM   6329  N N   . VAL B 2 391 ? 119.894 122.077 112.915 1.00 301.04 ? 391  VAL B N   1 
ATOM   6330  C CA  . VAL B 2 391 ? 119.143 123.299 113.231 1.00 318.04 ? 391  VAL B CA  1 
ATOM   6331  C C   . VAL B 2 391 ? 118.054 122.988 114.230 1.00 318.56 ? 391  VAL B C   1 
ATOM   6332  O O   . VAL B 2 391 ? 117.884 123.713 115.236 1.00 335.34 ? 391  VAL B O   1 
ATOM   6333  C CB  . VAL B 2 391 ? 118.482 123.971 111.993 1.00 324.35 ? 391  VAL B CB  1 
ATOM   6334  C CG1 . VAL B 2 391 ? 117.631 125.178 112.410 1.00 316.36 ? 391  VAL B CG1 1 
ATOM   6335  C CG2 . VAL B 2 391 ? 119.521 124.397 110.962 1.00 324.26 ? 391  VAL B CG2 1 
ATOM   6336  N N   . LEU B 2 392 ? 117.328 121.901 113.952 1.00 318.25 ? 392  LEU B N   1 
ATOM   6337  C CA  . LEU B 2 392 ? 116.057 121.634 114.691 1.00 317.82 ? 392  LEU B CA  1 
ATOM   6338  C C   . LEU B 2 392 ? 116.418 121.470 116.212 1.00 317.51 ? 392  LEU B C   1 
ATOM   6339  O O   . LEU B 2 392 ? 115.925 122.179 117.141 1.00 328.98 ? 392  LEU B O   1 
ATOM   6340  C CB  . LEU B 2 392 ? 115.309 120.413 114.154 1.00 328.47 ? 392  LEU B CB  1 
ATOM   6341  C CG  . LEU B 2 392 ? 113.819 120.345 114.526 1.00 326.14 ? 392  LEU B CG  1 
ATOM   6342  C CD1 . LEU B 2 392 ? 113.051 119.484 113.528 1.00 333.93 ? 392  LEU B CD1 1 
ATOM   6343  C CD2 . LEU B 2 392 ? 113.602 119.855 115.954 1.00 326.44 ? 392  LEU B CD2 1 
ATOM   6344  N N   . VAL B 2 393 ? 117.338 120.534 116.365 1.00 323.46 ? 393  VAL B N   1 
ATOM   6345  C CA  . VAL B 2 393 ? 117.811 120.139 117.705 1.00 316.60 ? 393  VAL B CA  1 
ATOM   6346  C C   . VAL B 2 393 ? 118.474 121.317 118.384 1.00 327.31 ? 393  VAL B C   1 
ATOM   6347  O O   . VAL B 2 393 ? 118.220 121.540 119.569 1.00 332.87 ? 393  VAL B O   1 
ATOM   6348  C CB  . VAL B 2 393 ? 118.691 118.870 117.674 1.00 316.02 ? 393  VAL B CB  1 
ATOM   6349  C CG1 . VAL B 2 393 ? 120.080 119.138 117.104 1.00 335.09 ? 393  VAL B CG1 1 
ATOM   6350  C CG2 . VAL B 2 393 ? 118.789 118.260 119.063 1.00 330.32 ? 393  VAL B CG2 1 
ATOM   6351  N N   . GLY B 2 394 ? 119.279 122.059 117.623 1.00 330.31 ? 394  GLY B N   1 
ATOM   6352  C CA  . GLY B 2 394 ? 119.988 123.229 118.135 1.00 339.06 ? 394  GLY B CA  1 
ATOM   6353  C C   . GLY B 2 394 ? 119.002 124.250 118.685 1.00 323.06 ? 394  GLY B C   1 
ATOM   6354  O O   . GLY B 2 394 ? 119.169 124.792 119.784 1.00 344.71 ? 394  GLY B O   1 
ATOM   6355  N N   . LYS B 2 395 ? 117.975 124.487 117.874 1.00 288.14 ? 395  LYS B N   1 
ATOM   6356  C CA  . LYS B 2 395 ? 116.899 125.437 118.207 1.00 320.22 ? 395  LYS B CA  1 
ATOM   6357  C C   . LYS B 2 395 ? 116.234 125.031 119.513 1.00 319.70 ? 395  LYS B C   1 
ATOM   6358  O O   . LYS B 2 395 ? 116.011 125.873 120.400 1.00 341.22 ? 395  LYS B O   1 
ATOM   6359  C CB  . LYS B 2 395 ? 115.847 125.581 117.085 1.00 354.53 ? 395  LYS B CB  1 
ATOM   6360  C CG  . LYS B 2 395 ? 115.905 126.909 116.344 1.00 364.05 ? 395  LYS B CG  1 
ATOM   6361  C CD  . LYS B 2 395 ? 115.443 128.062 117.235 1.00 364.17 ? 395  LYS B CD  1 
ATOM   6362  C CE  . LYS B 2 395 ? 116.374 129.266 117.168 1.00 378.12 ? 395  LYS B CE  1 
ATOM   6363  N NZ  . LYS B 2 395 ? 116.223 130.138 118.367 1.00 374.04 ? 395  LYS B NZ  1 
ATOM   6364  N N   . ALA B 2 396 ? 115.934 123.739 119.598 1.00 301.30 ? 396  ALA B N   1 
ATOM   6365  C CA  . ALA B 2 396 ? 115.288 123.153 120.775 1.00 317.42 ? 396  ALA B CA  1 
ATOM   6366  C C   . ALA B 2 396 ? 116.135 123.405 122.023 1.00 325.16 ? 396  ALA B C   1 
ATOM   6367  O O   . ALA B 2 396 ? 115.625 123.817 123.072 1.00 333.34 ? 396  ALA B O   1 
ATOM   6368  C CB  . ALA B 2 396 ? 115.042 121.667 120.580 1.00 300.38 ? 396  ALA B CB  1 
ATOM   6369  N N   . SER B 2 397 ? 117.423 123.144 121.864 1.00 314.91 ? 397  SER B N   1 
ATOM   6370  C CA  . SER B 2 397 ? 118.413 123.317 122.931 1.00 332.62 ? 397  SER B CA  1 
ATOM   6371  C C   . SER B 2 397 ? 118.406 124.759 123.426 1.00 327.00 ? 397  SER B C   1 
ATOM   6372  O O   . SER B 2 397 ? 118.388 125.023 124.636 1.00 338.29 ? 397  SER B O   1 
ATOM   6373  C CB  . SER B 2 397 ? 119.813 122.911 122.439 1.00 337.10 ? 397  SER B CB  1 
ATOM   6374  O OG  . SER B 2 397 ? 120.840 123.518 123.201 1.00 352.85 ? 397  SER B OG  1 
ATOM   6375  N N   . ALA B 2 398 ? 118.415 125.665 122.458 1.00 331.91 ? 398  ALA B N   1 
ATOM   6376  C CA  . ALA B 2 398 ? 118.426 127.109 122.710 1.00 343.40 ? 398  ALA B CA  1 
ATOM   6377  C C   . ALA B 2 398 ? 117.202 127.688 123.421 1.00 359.27 ? 398  ALA B C   1 
ATOM   6378  O O   . ALA B 2 398 ? 117.301 128.235 124.534 1.00 334.95 ? 398  ALA B O   1 
ATOM   6379  C CB  . ALA B 2 398 ? 118.668 127.858 121.403 1.00 353.48 ? 398  ALA B CB  1 
ATOM   6380  N N   . THR B 2 399 ? 116.059 127.580 122.748 1.00 374.36 ? 399  THR B N   1 
ATOM   6381  C CA  . THR B 2 399 ? 114.828 128.237 123.165 1.00 394.34 ? 399  THR B CA  1 
ATOM   6382  C C   . THR B 2 399 ? 113.777 127.173 123.475 1.00 385.82 ? 399  THR B C   1 
ATOM   6383  O O   . THR B 2 399 ? 112.993 126.780 122.609 1.00 385.95 ? 399  THR B O   1 
ATOM   6384  C CB  . THR B 2 399 ? 114.330 129.219 122.075 1.00 421.75 ? 399  THR B CB  1 
ATOM   6385  O OG1 . THR B 2 399 ? 115.411 130.061 121.647 1.00 370.38 ? 399  THR B OG1 1 
ATOM   6386  C CG2 . THR B 2 399 ? 113.189 130.090 122.600 1.00 443.18 ? 399  THR B CG2 1 
ATOM   6387  N N   . ALA B 2 400 ? 113.795 126.695 124.718 1.00 395.40 ? 400  ALA B N   1 
ATOM   6388  C CA  . ALA B 2 400 ? 112.787 125.753 125.211 1.00 392.57 ? 400  ALA B CA  1 
ATOM   6389  C C   . ALA B 2 400 ? 112.717 125.755 126.732 1.00 382.52 ? 400  ALA B C   1 
ATOM   6390  O O   . ALA B 2 400 ? 113.713 126.020 127.412 1.00 387.50 ? 400  ALA B O   1 
ATOM   6391  C CB  . ALA B 2 400 ? 113.079 124.350 124.713 1.00 380.12 ? 400  ALA B CB  1 
ATOM   6392  N N   . SER B 2 401 ? 111.530 125.453 127.251 1.00 370.94 ? 401  SER B N   1 
ATOM   6393  C CA  . SER B 2 401 ? 111.317 125.326 128.689 1.00 384.96 ? 401  SER B CA  1 
ATOM   6394  C C   . SER B 2 401 ? 111.985 124.061 129.228 1.00 377.34 ? 401  SER B C   1 
ATOM   6395  O O   . SER B 2 401 ? 112.553 124.074 130.322 1.00 393.52 ? 401  SER B O   1 
ATOM   6396  C CB  . SER B 2 401 ? 109.820 125.304 129.008 1.00 399.47 ? 401  SER B CB  1 
ATOM   6397  O OG  . SER B 2 401 ? 109.593 125.431 130.402 1.00 419.69 ? 401  SER B OG  1 
ATOM   6398  N N   . GLY B 2 402 ? 111.929 122.981 128.447 1.00 356.03 ? 402  GLY B N   1 
ATOM   6399  C CA  . GLY B 2 402 ? 112.477 121.687 128.858 1.00 357.58 ? 402  GLY B CA  1 
ATOM   6400  C C   . GLY B 2 402 ? 113.970 121.492 128.687 1.00 329.95 ? 402  GLY B C   1 
ATOM   6401  O O   . GLY B 2 402 ? 114.468 120.400 128.944 1.00 317.93 ? 402  GLY B O   1 
ATOM   6402  N N   . ASP B 2 403 ? 114.670 122.525 128.220 1.00 326.35 ? 403  ASP B N   1 
ATOM   6403  C CA  . ASP B 2 403 ? 116.131 122.596 128.237 1.00 325.22 ? 403  ASP B CA  1 
ATOM   6404  C C   . ASP B 2 403 ? 116.817 121.391 127.575 1.00 313.60 ? 403  ASP B C   1 
ATOM   6405  O O   . ASP B 2 403 ? 117.351 121.520 126.471 1.00 342.26 ? 403  ASP B O   1 
ATOM   6406  C CB  . ASP B 2 403 ? 116.633 122.840 129.675 1.00 346.36 ? 403  ASP B CB  1 
ATOM   6407  C CG  . ASP B 2 403 ? 118.078 123.337 129.733 1.00 373.37 ? 403  ASP B CG  1 
ATOM   6408  O OD1 . ASP B 2 403 ? 118.556 123.965 128.762 1.00 385.52 ? 403  ASP B OD1 1 
ATOM   6409  O OD2 . ASP B 2 403 ? 118.736 123.114 130.771 1.00 378.97 ? 403  ASP B OD2 1 
ATOM   6410  N N   . TRP B 2 404 ? 116.795 120.237 128.242 1.00 303.65 ? 404  TRP B N   1 
ATOM   6411  C CA  . TRP B 2 404 ? 117.389 119.006 127.717 1.00 309.45 ? 404  TRP B CA  1 
ATOM   6412  C C   . TRP B 2 404 ? 116.381 117.906 127.398 1.00 313.27 ? 404  TRP B C   1 
ATOM   6413  O O   . TRP B 2 404 ? 116.597 117.154 126.445 1.00 309.33 ? 404  TRP B O   1 
ATOM   6414  C CB  . TRP B 2 404 ? 118.445 118.490 128.680 1.00 289.50 ? 404  TRP B CB  1 
ATOM   6415  C CG  . TRP B 2 404 ? 119.712 119.195 128.520 1.00 313.04 ? 404  TRP B CG  1 
ATOM   6416  C CD1 . TRP B 2 404 ? 120.091 120.353 129.127 1.00 322.27 ? 404  TRP B CD1 1 
ATOM   6417  C CD2 . TRP B 2 404 ? 120.782 118.815 127.666 1.00 315.92 ? 404  TRP B CD2 1 
ATOM   6418  N NE1 . TRP B 2 404 ? 121.347 120.713 128.712 1.00 315.51 ? 404  TRP B NE1 1 
ATOM   6419  C CE2 . TRP B 2 404 ? 121.795 119.783 127.812 1.00 311.52 ? 404  TRP B CE2 1 
ATOM   6420  C CE3 . TRP B 2 404 ? 120.992 117.740 126.794 1.00 321.86 ? 404  TRP B CE3 1 
ATOM   6421  C CZ2 . TRP B 2 404 ? 122.996 119.713 127.119 1.00 319.25 ? 404  TRP B CZ2 1 
ATOM   6422  C CZ3 . TRP B 2 404 ? 122.191 117.669 126.104 1.00 325.08 ? 404  TRP B CZ3 1 
ATOM   6423  C CH2 . TRP B 2 404 ? 123.178 118.653 126.272 1.00 326.86 ? 404  TRP B CH2 1 
ATOM   6424  N N   . ASN B 2 405 ? 115.304 117.792 128.181 1.00 313.80 ? 405  ASN B N   1 
ATOM   6425  C CA  . ASN B 2 405 ? 114.198 116.884 127.829 1.00 316.36 ? 405  ASN B CA  1 
ATOM   6426  C C   . ASN B 2 405 ? 113.847 117.094 126.345 1.00 325.23 ? 405  ASN B C   1 
ATOM   6427  O O   . ASN B 2 405 ? 113.745 116.131 125.545 1.00 369.00 ? 405  ASN B O   1 
ATOM   6428  C CB  . ASN B 2 405 ? 112.923 117.228 128.608 1.00 322.70 ? 405  ASN B CB  1 
ATOM   6429  C CG  . ASN B 2 405 ? 112.899 116.651 129.999 1.00 331.60 ? 405  ASN B CG  1 
ATOM   6430  O OD1 . ASN B 2 405 ? 113.359 115.537 130.231 1.00 325.77 ? 405  ASN B OD1 1 
ATOM   6431  N ND2 . ASN B 2 405 ? 112.333 117.406 130.939 1.00 336.74 ? 405  ASN B ND2 1 
ATOM   6432  N N   . THR B 2 406 ? 113.656 118.375 126.031 1.00 313.03 ? 406  THR B N   1 
ATOM   6433  C CA  . THR B 2 406 ? 113.190 118.795 124.715 1.00 334.72 ? 406  THR B CA  1 
ATOM   6434  C C   . THR B 2 406 ? 114.107 118.418 123.570 1.00 322.40 ? 406  THR B C   1 
ATOM   6435  O O   . THR B 2 406 ? 113.636 117.791 122.601 1.00 310.87 ? 406  THR B O   1 
ATOM   6436  C CB  . THR B 2 406 ? 112.928 120.317 124.685 1.00 352.32 ? 406  THR B CB  1 
ATOM   6437  O OG1 . THR B 2 406 ? 112.111 120.687 125.802 1.00 374.27 ? 406  THR B OG1 1 
ATOM   6438  C CG2 . THR B 2 406 ? 112.220 120.718 123.417 1.00 351.22 ? 406  THR B CG2 1 
ATOM   6439  N N   . THR B 2 407 ? 115.369 118.840 123.667 1.00 278.86 ? 407  THR B N   1 
ATOM   6440  C CA  . THR B 2 407 ? 116.350 118.617 122.604 1.00 282.78 ? 407  THR B CA  1 
ATOM   6441  C C   . THR B 2 407 ? 116.503 117.120 122.334 1.00 281.26 ? 407  THR B C   1 
ATOM   6442  O O   . THR B 2 407 ? 116.501 116.677 121.174 1.00 301.70 ? 407  THR B O   1 
ATOM   6443  C CB  . THR B 2 407 ? 117.720 119.322 122.894 1.00 312.14 ? 407  THR B CB  1 
ATOM   6444  O OG1 . THR B 2 407 ? 118.244 119.886 121.686 1.00 330.40 ? 407  THR B OG1 1 
ATOM   6445  C CG2 . THR B 2 407 ? 118.793 118.393 123.513 1.00 311.20 ? 407  THR B CG2 1 
ATOM   6446  N N   . ILE B 2 408 ? 116.626 116.381 123.433 1.00 284.49 ? 408  ILE B N   1 
ATOM   6447  C CA  . ILE B 2 408 ? 116.792 114.923 123.387 1.00 301.88 ? 408  ILE B CA  1 
ATOM   6448  C C   . ILE B 2 408 ? 115.606 114.288 122.670 1.00 288.67 ? 408  ILE B C   1 
ATOM   6449  O O   . ILE B 2 408 ? 115.783 113.416 121.796 1.00 279.19 ? 408  ILE B O   1 
ATOM   6450  C CB  . ILE B 2 408 ? 116.972 114.311 124.798 1.00 284.43 ? 408  ILE B CB  1 
ATOM   6451  C CG1 . ILE B 2 408 ? 118.447 114.418 125.206 1.00 300.64 ? 408  ILE B CG1 1 
ATOM   6452  C CG2 . ILE B 2 408 ? 116.524 112.851 124.847 1.00 287.73 ? 408  ILE B CG2 1 
ATOM   6453  C CD1 . ILE B 2 408 ? 118.716 114.252 126.687 1.00 319.44 ? 408  ILE B CD1 1 
ATOM   6454  N N   . ALA B 2 409 ? 114.418 114.749 123.063 1.00 287.09 ? 409  ALA B N   1 
ATOM   6455  C CA  . ALA B 2 409 ? 113.160 114.259 122.490 1.00 293.43 ? 409  ALA B CA  1 
ATOM   6456  C C   . ALA B 2 409 ? 113.145 114.475 120.985 1.00 297.41 ? 409  ALA B C   1 
ATOM   6457  O O   . ALA B 2 409 ? 112.791 113.569 120.212 1.00 304.59 ? 409  ALA B O   1 
ATOM   6458  C CB  . ALA B 2 409 ? 111.966 114.939 123.139 1.00 306.01 ? 409  ALA B CB  1 
ATOM   6459  N N   . CYS B 2 410 ? 113.540 115.684 120.604 1.00 295.38 ? 410  CYS B N   1 
ATOM   6460  C CA  . CYS B 2 410 ? 113.597 116.091 119.194 1.00 300.01 ? 410  CYS B CA  1 
ATOM   6461  C C   . CYS B 2 410 ? 114.512 115.169 118.415 1.00 307.23 ? 410  CYS B C   1 
ATOM   6462  O O   . CYS B 2 410 ? 114.163 114.707 117.324 1.00 298.76 ? 410  CYS B O   1 
ATOM   6463  C CB  . CYS B 2 410 ? 114.068 117.527 119.037 1.00 303.75 ? 410  CYS B CB  1 
ATOM   6464  S SG  . CYS B 2 410 ? 112.947 118.689 119.819 1.00 349.51 ? 410  CYS B SG  1 
ATOM   6465  N N   . PHE B 2 411 ? 115.673 114.922 119.004 1.00 313.27 ? 411  PHE B N   1 
ATOM   6466  C CA  . PHE B 2 411 ? 116.706 114.058 118.419 1.00 307.08 ? 411  PHE B CA  1 
ATOM   6467  C C   . PHE B 2 411 ? 116.127 112.663 118.161 1.00 296.46 ? 411  PHE B C   1 
ATOM   6468  O O   . PHE B 2 411 ? 116.299 112.086 117.059 1.00 294.89 ? 411  PHE B O   1 
ATOM   6469  C CB  . PHE B 2 411 ? 117.938 114.091 119.363 1.00 310.09 ? 411  PHE B CB  1 
ATOM   6470  C CG  . PHE B 2 411 ? 118.872 112.914 119.261 1.00 330.20 ? 411  PHE B CG  1 
ATOM   6471  C CD1 . PHE B 2 411 ? 118.601 111.735 119.947 1.00 331.40 ? 411  PHE B CD1 1 
ATOM   6472  C CD2 . PHE B 2 411 ? 120.065 113.011 118.553 1.00 332.00 ? 411  PHE B CD2 1 
ATOM   6473  C CE1 . PHE B 2 411 ? 119.467 110.658 119.882 1.00 340.96 ? 411  PHE B CE1 1 
ATOM   6474  C CE2 . PHE B 2 411 ? 120.937 111.939 118.487 1.00 346.06 ? 411  PHE B CE2 1 
ATOM   6475  C CZ  . PHE B 2 411 ? 120.639 110.761 119.150 1.00 348.45 ? 411  PHE B CZ  1 
ATOM   6476  N N   . VAL B 2 412 ? 115.446 112.165 119.192 1.00 298.82 ? 412  VAL B N   1 
ATOM   6477  C CA  . VAL B 2 412 ? 114.831 110.837 119.148 1.00 301.76 ? 412  VAL B CA  1 
ATOM   6478  C C   . VAL B 2 412 ? 113.828 110.761 118.003 1.00 300.22 ? 412  VAL B C   1 
ATOM   6479  O O   . VAL B 2 412 ? 113.813 109.785 117.228 1.00 307.67 ? 412  VAL B O   1 
ATOM   6480  C CB  . VAL B 2 412 ? 114.212 110.385 120.491 1.00 323.97 ? 412  VAL B CB  1 
ATOM   6481  C CG1 . VAL B 2 412 ? 113.412 109.092 120.324 1.00 318.76 ? 412  VAL B CG1 1 
ATOM   6482  C CG2 . VAL B 2 412 ? 115.300 110.173 121.538 1.00 329.75 ? 412  VAL B CG2 1 
ATOM   6483  N N   . ALA B 2 413 ? 113.014 111.805 117.914 1.00 303.83 ? 413  ALA B N   1 
ATOM   6484  C CA  . ALA B 2 413 ? 111.981 111.923 116.879 1.00 331.26 ? 413  ALA B CA  1 
ATOM   6485  C C   . ALA B 2 413 ? 112.604 111.864 115.506 1.00 324.31 ? 413  ALA B C   1 
ATOM   6486  O O   . ALA B 2 413 ? 112.117 111.175 114.631 1.00 359.75 ? 413  ALA B O   1 
ATOM   6487  C CB  . ALA B 2 413 ? 111.185 113.201 117.043 1.00 347.21 ? 413  ALA B CB  1 
ATOM   6488  N N   . ILE B 2 414 ? 113.681 112.625 115.352 1.00 282.62 ? 414  ILE B N   1 
ATOM   6489  C CA  . ILE B 2 414 ? 114.435 112.721 114.092 1.00 305.97 ? 414  ILE B CA  1 
ATOM   6490  C C   . ILE B 2 414 ? 114.913 111.327 113.683 1.00 294.90 ? 414  ILE B C   1 
ATOM   6491  O O   . ILE B 2 414 ? 114.737 110.913 112.504 1.00 332.32 ? 414  ILE B O   1 
ATOM   6492  C CB  . ILE B 2 414 ? 115.602 113.742 114.188 1.00 311.74 ? 414  ILE B CB  1 
ATOM   6493  C CG1 . ILE B 2 414 ? 115.035 115.160 114.027 1.00 334.69 ? 414  ILE B CG1 1 
ATOM   6494  C CG2 . ILE B 2 414 ? 116.683 113.479 113.137 1.00 323.00 ? 414  ILE B CG2 1 
ATOM   6495  C CD1 . ILE B 2 414 ? 116.030 116.284 114.229 1.00 354.37 ? 414  ILE B CD1 1 
ATOM   6496  N N   . LEU B 2 415 ? 115.487 110.638 114.671 1.00 287.99 ? 415  LEU B N   1 
ATOM   6497  C CA  . LEU B 2 415 ? 116.050 109.307 114.442 1.00 304.19 ? 415  LEU B CA  1 
ATOM   6498  C C   . LEU B 2 415 ? 114.920 108.354 113.968 1.00 312.94 ? 415  LEU B C   1 
ATOM   6499  O O   . LEU B 2 415 ? 115.084 107.583 113.000 1.00 320.21 ? 415  LEU B O   1 
ATOM   6500  C CB  . LEU B 2 415 ? 116.805 108.733 115.648 1.00 298.78 ? 415  LEU B CB  1 
ATOM   6501  C CG  . LEU B 2 415 ? 118.326 108.903 115.582 1.00 301.60 ? 415  LEU B CG  1 
ATOM   6502  C CD1 . LEU B 2 415 ? 118.724 110.324 115.931 1.00 337.56 ? 415  LEU B CD1 1 
ATOM   6503  C CD2 . LEU B 2 415 ? 119.028 107.918 116.499 1.00 320.93 ? 415  LEU B CD2 1 
ATOM   6504  N N   . ILE B 2 416 ? 113.803 108.442 114.661 1.00 312.31 ? 416  ILE B N   1 
ATOM   6505  C CA  . ILE B 2 416 ? 112.676 107.571 114.333 1.00 328.41 ? 416  ILE B CA  1 
ATOM   6506  C C   . ILE B 2 416 ? 112.141 107.877 112.968 1.00 335.69 ? 416  ILE B C   1 
ATOM   6507  O O   . ILE B 2 416 ? 111.838 106.933 112.237 1.00 355.84 ? 416  ILE B O   1 
ATOM   6508  C CB  . ILE B 2 416 ? 111.600 107.457 115.431 1.00 358.67 ? 416  ILE B CB  1 
ATOM   6509  C CG1 . ILE B 2 416 ? 112.016 106.312 116.342 1.00 391.57 ? 416  ILE B CG1 1 
ATOM   6510  C CG2 . ILE B 2 416 ? 110.215 107.129 114.874 1.00 377.31 ? 416  ILE B CG2 1 
ATOM   6511  C CD1 . ILE B 2 416 ? 113.164 106.697 117.235 1.00 410.98 ? 416  ILE B CD1 1 
ATOM   6512  N N   . GLY B 2 417 ? 112.089 109.160 112.611 1.00 337.85 ? 417  GLY B N   1 
ATOM   6513  C CA  . GLY B 2 417 ? 111.662 109.597 111.276 1.00 364.98 ? 417  GLY B CA  1 
ATOM   6514  C C   . GLY B 2 417 ? 112.546 108.966 110.211 1.00 361.00 ? 417  GLY B C   1 
ATOM   6515  O O   . GLY B 2 417 ? 112.050 108.437 109.203 1.00 376.80 ? 417  GLY B O   1 
ATOM   6516  N N   . LEU B 2 418 ? 113.847 109.039 110.469 1.00 350.63 ? 418  LEU B N   1 
ATOM   6517  C CA  . LEU B 2 418 ? 114.867 108.495 109.564 1.00 356.58 ? 418  LEU B CA  1 
ATOM   6518  C C   . LEU B 2 418 ? 114.628 106.999 109.348 1.00 361.70 ? 418  LEU B C   1 
ATOM   6519  O O   . LEU B 2 418 ? 114.651 106.505 108.203 1.00 386.56 ? 418  LEU B O   1 
ATOM   6520  C CB  . LEU B 2 418 ? 116.261 108.776 110.134 1.00 364.48 ? 418  LEU B CB  1 
ATOM   6521  C CG  . LEU B 2 418 ? 117.422 108.822 109.136 1.00 358.18 ? 418  LEU B CG  1 
ATOM   6522  C CD1 . LEU B 2 418 ? 118.377 109.968 109.467 1.00 346.44 ? 418  LEU B CD1 1 
ATOM   6523  C CD2 . LEU B 2 418 ? 118.143 107.478 109.072 1.00 372.77 ? 418  LEU B CD2 1 
ATOM   6524  N N   . CYS B 2 419 ? 114.587 106.267 110.456 1.00 357.49 ? 419  CYS B N   1 
ATOM   6525  C CA  . CYS B 2 419 ? 114.474 104.816 110.420 1.00 365.74 ? 419  CYS B CA  1 
ATOM   6526  C C   . CYS B 2 419 ? 113.152 104.385 109.829 1.00 343.57 ? 419  CYS B C   1 
ATOM   6527  O O   . CYS B 2 419 ? 113.082 103.433 109.053 1.00 360.03 ? 419  CYS B O   1 
ATOM   6528  C CB  . CYS B 2 419 ? 114.661 104.221 111.808 1.00 389.90 ? 419  CYS B CB  1 
ATOM   6529  S SG  . CYS B 2 419 ? 116.396 104.024 112.257 1.00 389.66 ? 419  CYS B SG  1 
ATOM   6530  N N   . LEU B 2 420 ? 112.099 105.098 110.193 1.00 311.20 ? 420  LEU B N   1 
ATOM   6531  C CA  . LEU B 2 420 ? 110.798 104.815 109.632 1.00 327.84 ? 420  LEU B CA  1 
ATOM   6532  C C   . LEU B 2 420 ? 110.868 105.051 108.136 1.00 340.45 ? 420  LEU B C   1 
ATOM   6533  O O   . LEU B 2 420 ? 110.330 104.276 107.348 1.00 375.36 ? 420  LEU B O   1 
ATOM   6534  C CB  . LEU B 2 420 ? 109.734 105.703 110.260 1.00 357.49 ? 420  LEU B CB  1 
ATOM   6535  C CG  . LEU B 2 420 ? 108.592 105.019 111.014 1.00 388.85 ? 420  LEU B CG  1 
ATOM   6536  C CD1 . LEU B 2 420 ? 107.270 105.712 110.723 1.00 395.30 ? 420  LEU B CD1 1 
ATOM   6537  C CD2 . LEU B 2 420 ? 108.497 103.529 110.721 1.00 403.69 ? 420  LEU B CD2 1 
ATOM   6538  N N   . THR B 2 421 ? 111.563 106.106 107.735 1.00 333.35 ? 421  THR B N   1 
ATOM   6539  C CA  . THR B 2 421 ? 111.676 106.396 106.320 1.00 330.35 ? 421  THR B CA  1 
ATOM   6540  C C   . THR B 2 421 ? 112.366 105.230 105.643 1.00 327.51 ? 421  THR B C   1 
ATOM   6541  O O   . THR B 2 421 ? 111.945 104.784 104.580 1.00 346.87 ? 421  THR B O   1 
ATOM   6542  C CB  . THR B 2 421 ? 112.514 107.656 106.062 1.00 356.76 ? 421  THR B CB  1 
ATOM   6543  O OG1 . THR B 2 421 ? 111.842 108.799 106.597 1.00 342.11 ? 421  THR B OG1 1 
ATOM   6544  C CG2 . THR B 2 421 ? 112.715 107.856 104.576 1.00 384.42 ? 421  THR B CG2 1 
ATOM   6545  N N   . LEU B 2 422 ? 113.417 104.714 106.272 1.00 339.54 ? 422  LEU B N   1 
ATOM   6546  C CA  . LEU B 2 422 ? 114.179 103.606 105.704 1.00 363.15 ? 422  LEU B CA  1 
ATOM   6547  C C   . LEU B 2 422 ? 113.328 102.347 105.548 1.00 364.10 ? 422  LEU B C   1 
ATOM   6548  O O   . LEU B 2 422 ? 113.424 101.645 104.541 1.00 370.65 ? 422  LEU B O   1 
ATOM   6549  C CB  . LEU B 2 422 ? 115.408 103.304 106.565 1.00 391.24 ? 422  LEU B CB  1 
ATOM   6550  C CG  . LEU B 2 422 ? 116.769 103.491 105.893 1.00 419.08 ? 422  LEU B CG  1 
ATOM   6551  C CD1 . LEU B 2 422 ? 117.455 104.748 106.405 1.00 421.07 ? 422  LEU B CD1 1 
ATOM   6552  C CD2 . LEU B 2 422 ? 117.649 102.269 106.110 1.00 421.13 ? 422  LEU B CD2 1 
ATOM   6553  N N   . LEU B 2 423 ? 112.495 102.068 106.545 1.00 382.62 ? 423  LEU B N   1 
ATOM   6554  C CA  . LEU B 2 423 ? 111.599 100.919 106.503 1.00 390.41 ? 423  LEU B CA  1 
ATOM   6555  C C   . LEU B 2 423 ? 110.573 101.078 105.385 1.00 399.97 ? 423  LEU B C   1 
ATOM   6556  O O   . LEU B 2 423 ? 110.255 100.121 104.679 1.00 413.34 ? 423  LEU B O   1 
ATOM   6557  C CB  . LEU B 2 423 ? 110.891 100.740 107.847 1.00 389.76 ? 423  LEU B CB  1 
ATOM   6558  C CG  . LEU B 2 423 ? 111.414 99.617  108.745 1.00 422.03 ? 423  LEU B CG  1 
ATOM   6559  C CD1 . LEU B 2 423 ? 112.411 100.159 109.757 1.00 428.07 ? 423  LEU B CD1 1 
ATOM   6560  C CD2 . LEU B 2 423 ? 110.265 98.908  109.445 1.00 449.74 ? 423  LEU B CD2 1 
ATOM   6561  N N   . LEU B 2 424 ? 110.056 102.292 105.234 1.00 375.02 ? 424  LEU B N   1 
ATOM   6562  C CA  . LEU B 2 424 ? 109.091 102.581 104.183 1.00 360.67 ? 424  LEU B CA  1 
ATOM   6563  C C   . LEU B 2 424 ? 109.741 102.364 102.824 1.00 385.67 ? 424  LEU B C   1 
ATOM   6564  O O   . LEU B 2 424 ? 109.122 101.834 101.902 1.00 397.44 ? 424  LEU B O   1 
ATOM   6565  C CB  . LEU B 2 424 ? 108.581 104.018 104.301 1.00 365.82 ? 424  LEU B CB  1 
ATOM   6566  C CG  . LEU B 2 424 ? 107.162 104.192 104.845 1.00 368.22 ? 424  LEU B CG  1 
ATOM   6567  C CD1 . LEU B 2 424 ? 107.187 104.868 106.207 1.00 366.07 ? 424  LEU B CD1 1 
ATOM   6568  C CD2 . LEU B 2 424 ? 106.303 104.979 103.867 1.00 386.72 ? 424  LEU B CD2 1 
ATOM   6569  N N   . LEU B 2 425 ? 110.999 102.777 102.712 1.00 386.47 ? 425  LEU B N   1 
ATOM   6570  C CA  . LEU B 2 425 ? 111.751 102.614 101.489 1.00 384.38 ? 425  LEU B CA  1 
ATOM   6571  C C   . LEU B 2 425 ? 111.827 101.132 101.184 1.00 390.06 ? 425  LEU B C   1 
ATOM   6572  O O   . LEU B 2 425 ? 111.646 100.708 100.044 1.00 399.85 ? 425  LEU B O   1 
ATOM   6573  C CB  . LEU B 2 425 ? 113.164 103.150 101.695 1.00 396.98 ? 425  LEU B CB  1 
ATOM   6574  C CG  . LEU B 2 425 ? 113.775 104.001 100.585 1.00 422.56 ? 425  LEU B CG  1 
ATOM   6575  C CD1 . LEU B 2 425 ? 113.311 105.444 100.707 1.00 432.45 ? 425  LEU B CD1 1 
ATOM   6576  C CD2 . LEU B 2 425 ? 115.293 103.917 100.636 1.00 420.20 ? 425  LEU B CD2 1 
ATOM   6577  N N   . ALA B 2 426 ? 112.073 100.345 102.223 1.00 405.66 ? 426  ALA B N   1 
ATOM   6578  C CA  . ALA B 2 426 ? 112.156 98.901  102.080 1.00 427.23 ? 426  ALA B CA  1 
ATOM   6579  C C   . ALA B 2 426 ? 110.845 98.268  101.624 1.00 444.69 ? 426  ALA B C   1 
ATOM   6580  O O   . ALA B 2 426 ? 110.846 97.369  100.788 1.00 467.51 ? 426  ALA B O   1 
ATOM   6581  C CB  . ALA B 2 426 ? 112.609 98.273  103.388 1.00 439.08 ? 426  ALA B CB  1 
ATOM   6582  N N   . ILE B 2 427 ? 109.729 98.732  102.176 1.00 452.79 ? 427  ILE B N   1 
ATOM   6583  C CA  . ILE B 2 427 ? 108.435 98.081  101.945 1.00 471.19 ? 427  ILE B CA  1 
ATOM   6584  C C   . ILE B 2 427 ? 107.646 98.698  100.776 1.00 500.00 ? 427  ILE B C   1 
ATOM   6585  O O   . ILE B 2 427 ? 106.534 98.277  100.471 1.00 487.97 ? 427  ILE B O   1 
ATOM   6586  C CB  . ILE B 2 427 ? 107.638 97.967  103.286 1.00 462.46 ? 427  ILE B CB  1 
ATOM   6587  C CG1 . ILE B 2 427 ? 107.887 96.602  103.931 1.00 465.26 ? 427  ILE B CG1 1 
ATOM   6588  C CG2 . ILE B 2 427 ? 106.138 98.209  103.143 1.00 455.64 ? 427  ILE B CG2 1 
ATOM   6589  C CD1 . ILE B 2 427 ? 108.521 96.682  105.302 1.00 467.38 ? 427  ILE B CD1 1 
ATOM   6590  N N   . PHE B 2 428 ? 108.201 99.789  100.265 1.00 500.00 ? 428  PHE B N   1 
ATOM   6591  C CA  . PHE B 2 428 ? 107.516 100.658 99.330  1.00 500.00 ? 428  PHE B CA  1 
ATOM   6592  C C   . PHE B 2 428 ? 108.489 101.232 98.321  1.00 500.00 ? 428  PHE B C   1 
ATOM   6593  O O   . PHE B 2 428 ? 109.679 101.364 98.596  1.00 500.00 ? 428  PHE B O   1 
ATOM   6594  C CB  . PHE B 2 428 ? 106.876 101.821 100.086 1.00 500.00 ? 428  PHE B CB  1 
ATOM   6595  C CG  . PHE B 2 428 ? 105.482 101.549 100.561 1.00 500.00 ? 428  PHE B CG  1 
ATOM   6596  C CD1 . PHE B 2 428 ? 104.723 100.548 99.988  1.00 500.00 ? 428  PHE B CD1 1 
ATOM   6597  C CD2 . PHE B 2 428 ? 104.930 102.303 101.580 1.00 500.00 ? 428  PHE B CD2 1 
ATOM   6598  C CE1 . PHE B 2 428 ? 103.437 100.300 100.425 1.00 500.00 ? 428  PHE B CE1 1 
ATOM   6599  C CE2 . PHE B 2 428 ? 103.646 102.063 102.022 1.00 500.00 ? 428  PHE B CE2 1 
ATOM   6600  C CZ  . PHE B 2 428 ? 102.896 101.059 101.443 1.00 500.00 ? 428  PHE B CZ  1 
ATOM   6601  N N   . LYS B 2 429 ? 107.973 101.573 97.150  1.00 500.00 ? 429  LYS B N   1 
ATOM   6602  C CA  . LYS B 2 429 ? 108.707 102.389 96.199  1.00 500.00 ? 429  LYS B CA  1 
ATOM   6603  C C   . LYS B 2 429 ? 107.993 103.731 96.005  1.00 500.00 ? 429  LYS B C   1 
ATOM   6604  O O   . LYS B 2 429 ? 108.593 104.707 95.558  1.00 500.00 ? 429  LYS B O   1 
ATOM   6605  C CB  . LYS B 2 429 ? 108.880 101.668 94.854  1.00 500.00 ? 429  LYS B CB  1 
ATOM   6606  C CG  . LYS B 2 429 ? 108.353 100.240 94.802  1.00 500.00 ? 429  LYS B CG  1 
ATOM   6607  C CD  . LYS B 2 429 ? 106.858 100.194 95.074  1.00 500.00 ? 429  LYS B CD  1 
ATOM   6608  C CE  . LYS B 2 429 ? 106.354 98.764  95.163  1.00 500.00 ? 429  LYS B CE  1 
ATOM   6609  N NZ  . LYS B 2 429 ? 106.146 98.168  93.816  1.00 500.00 ? 429  LYS B NZ  1 
ATOM   6610  N N   . LYS B 2 430 ? 106.708 103.770 96.351  1.00 500.00 ? 430  LYS B N   1 
ATOM   6611  C CA  . LYS B 2 430 ? 105.886 104.963 96.153  1.00 500.00 ? 430  LYS B CA  1 
ATOM   6612  C C   . LYS B 2 430 ? 106.351 106.163 96.974  1.00 500.00 ? 430  LYS B C   1 
ATOM   6613  O O   . LYS B 2 430 ? 106.378 107.290 96.480  1.00 500.00 ? 430  LYS B O   1 
ATOM   6614  C CB  . LYS B 2 430 ? 104.419 104.658 96.472  1.00 500.00 ? 430  LYS B CB  1 
ATOM   6615  C CG  . LYS B 2 430 ? 103.484 104.778 95.280  1.00 500.00 ? 430  LYS B CG  1 
ATOM   6616  C CD  . LYS B 2 430 ? 102.751 106.110 95.277  1.00 500.00 ? 430  LYS B CD  1 
ATOM   6617  C CE  . LYS B 2 430 ? 102.089 106.367 93.933  1.00 500.00 ? 430  LYS B CE  1 
ATOM   6618  N NZ  . LYS B 2 430 ? 101.425 105.143 93.405  1.00 500.00 ? 430  LYS B NZ  1 
ATOM   6619  N N   . ALA B 2 431 ? 106.716 105.915 98.227  1.00 500.00 ? 431  ALA B N   1 
ATOM   6620  C CA  . ALA B 2 431 ? 107.193 106.972 99.109  1.00 500.00 ? 431  ALA B CA  1 
ATOM   6621  C C   . ALA B 2 431 ? 108.716 106.990 99.188  1.00 500.00 ? 431  ALA B C   1 
ATOM   6622  O O   . ALA B 2 431 ? 109.343 106.018 99.606  1.00 500.00 ? 431  ALA B O   1 
ATOM   6623  C CB  . ALA B 2 431 ? 106.584 106.814 100.492 1.00 500.00 ? 431  ALA B CB  1 
ATOM   6624  N N   . LEU B 2 432 ? 109.300 108.087 98.731  1.00 500.00 ? 432  LEU B N   1 
ATOM   6625  C CA  . LEU B 2 432 ? 110.736 108.248 98.814  1.00 500.00 ? 432  LEU B CA  1 
ATOM   6626  C C   . LEU B 2 432 ? 111.217 109.464 99.600  1.00 474.48 ? 432  LEU B C   1 
ATOM   6627  O O   . LEU B 2 432 ? 112.418 109.732 99.592  1.00 466.96 ? 432  LEU B O   1 
ATOM   6628  C CB  . LEU B 2 432 ? 111.346 108.270 97.409  1.00 500.00 ? 432  LEU B CB  1 
ATOM   6629  C CG  . LEU B 2 432 ? 112.235 107.082 97.037  1.00 500.00 ? 432  LEU B CG  1 
ATOM   6630  C CD1 . LEU B 2 432 ? 111.397 105.834 96.804  1.00 500.00 ? 432  LEU B CD1 1 
ATOM   6631  C CD2 . LEU B 2 432 ? 113.077 107.403 95.811  1.00 500.00 ? 432  LEU B CD2 1 
ATOM   6632  N N   . PRO B 2 433 ? 110.342 110.237 100.247 1.00 451.03 ? 433  PRO B N   1 
ATOM   6633  C CA  . PRO B 2 433 ? 110.899 111.529 100.700 1.00 435.18 ? 433  PRO B CA  1 
ATOM   6634  C C   . PRO B 2 433 ? 112.075 111.350 101.646 1.00 411.86 ? 433  PRO B C   1 
ATOM   6635  O O   . PRO B 2 433 ? 111.995 110.566 102.584 1.00 413.46 ? 433  PRO B O   1 
ATOM   6636  C CB  . PRO B 2 433 ? 109.734 112.186 101.446 1.00 443.84 ? 433  PRO B CB  1 
ATOM   6637  C CG  . PRO B 2 433 ? 108.520 111.658 100.787 1.00 444.57 ? 433  PRO B CG  1 
ATOM   6638  C CD  . PRO B 2 433 ? 108.861 110.212 100.683 1.00 446.25 ? 433  PRO B CD  1 
ATOM   6639  N N   . ALA B 2 434 ? 113.170 112.053 101.371 1.00 407.29 ? 434  ALA B N   1 
ATOM   6640  C CA  . ALA B 2 434 ? 114.370 111.955 102.200 1.00 406.50 ? 434  ALA B CA  1 
ATOM   6641  C C   . ALA B 2 434 ? 114.340 112.535 103.625 1.00 380.43 ? 434  ALA B C   1 
ATOM   6642  O O   . ALA B 2 434 ? 114.782 111.885 104.571 1.00 338.69 ? 434  ALA B O   1 
ATOM   6643  C CB  . ALA B 2 434 ? 115.562 112.516 101.435 1.00 423.30 ? 434  ALA B CB  1 
ATOM   6644  N N   . LEU B 2 435 ? 113.834 113.754 103.782 1.00 366.07 ? 435  LEU B N   1 
ATOM   6645  C CA  . LEU B 2 435 ? 113.968 114.428 105.070 1.00 349.96 ? 435  LEU B CA  1 
ATOM   6646  C C   . LEU B 2 435 ? 112.725 115.012 105.712 1.00 349.15 ? 435  LEU B C   1 
ATOM   6647  O O   . LEU B 2 435 ? 112.764 115.427 106.861 1.00 339.82 ? 435  LEU B O   1 
ATOM   6648  C CB  . LEU B 2 435 ? 115.027 115.524 104.968 1.00 358.91 ? 435  LEU B CB  1 
ATOM   6649  C CG  . LEU B 2 435 ? 114.547 116.937 104.651 1.00 374.85 ? 435  LEU B CG  1 
ATOM   6650  C CD1 . LEU B 2 435 ? 114.662 117.817 105.883 1.00 383.93 ? 435  LEU B CD1 1 
ATOM   6651  C CD2 . LEU B 2 435 ? 115.360 117.515 103.504 1.00 382.85 ? 435  LEU B CD2 1 
ATOM   6652  N N   . PRO B 2 436 ? 111.631 115.066 104.975 1.00 366.52 ? 436  PRO B N   1 
ATOM   6653  C CA  . PRO B 2 436 ? 110.474 115.875 105.386 1.00 355.31 ? 436  PRO B CA  1 
ATOM   6654  C C   . PRO B 2 436 ? 109.788 115.232 106.564 1.00 346.00 ? 436  PRO B C   1 
ATOM   6655  O O   . PRO B 2 436 ? 109.447 115.943 107.524 1.00 334.59 ? 436  PRO B O   1 
ATOM   6656  C CB  . PRO B 2 436 ? 109.589 115.905 104.138 1.00 372.50 ? 436  PRO B CB  1 
ATOM   6657  C CG  . PRO B 2 436 ? 109.978 114.719 103.336 1.00 375.58 ? 436  PRO B CG  1 
ATOM   6658  C CD  . PRO B 2 436 ? 111.397 114.385 103.685 1.00 373.08 ? 436  PRO B CD  1 
ATOM   6659  N N   . ILE B 2 437 ? 109.600 113.914 106.482 1.00 351.31 ? 437  ILE B N   1 
ATOM   6660  C CA  . ILE B 2 437 ? 108.939 113.151 107.542 1.00 352.72 ? 437  ILE B CA  1 
ATOM   6661  C C   . ILE B 2 437 ? 109.693 113.314 108.858 1.00 345.65 ? 437  ILE B C   1 
ATOM   6662  O O   . ILE B 2 437 ? 109.085 113.561 109.915 1.00 352.19 ? 437  ILE B O   1 
ATOM   6663  C CB  . ILE B 2 437 ? 108.738 111.647 107.189 1.00 367.48 ? 437  ILE B CB  1 
ATOM   6664  C CG1 . ILE B 2 437 ? 107.897 110.948 108.266 1.00 386.37 ? 437  ILE B CG1 1 
ATOM   6665  C CG2 . ILE B 2 437 ? 110.056 110.900 107.006 1.00 363.40 ? 437  ILE B CG2 1 
ATOM   6666  C CD1 . ILE B 2 437 ? 107.416 109.569 107.870 1.00 400.95 ? 437  ILE B CD1 1 
ATOM   6667  N N   . SER B 2 438 ? 111.012 113.177 108.752 1.00 344.18 ? 438  SER B N   1 
ATOM   6668  C CA  . SER B 2 438 ? 111.909 113.297 109.907 1.00 339.16 ? 438  SER B CA  1 
ATOM   6669  C C   . SER B 2 438 ? 111.756 114.666 110.552 1.00 318.12 ? 438  SER B C   1 
ATOM   6670  O O   . SER B 2 438 ? 111.645 114.778 111.783 1.00 304.64 ? 438  SER B O   1 
ATOM   6671  C CB  . SER B 2 438 ? 113.374 112.956 109.586 1.00 340.32 ? 438  SER B CB  1 
ATOM   6672  O OG  . SER B 2 438 ? 113.729 113.299 108.262 1.00 385.56 ? 438  SER B OG  1 
ATOM   6673  N N   . ILE B 2 439 ? 111.747 115.680 109.692 1.00 325.59 ? 439  ILE B N   1 
ATOM   6674  C CA  . ILE B 2 439 ? 111.606 117.078 110.121 1.00 329.71 ? 439  ILE B CA  1 
ATOM   6675  C C   . ILE B 2 439 ? 110.308 117.260 110.894 1.00 313.48 ? 439  ILE B C   1 
ATOM   6676  O O   . ILE B 2 439 ? 110.287 117.884 111.964 1.00 322.06 ? 439  ILE B O   1 
ATOM   6677  C CB  . ILE B 2 439 ? 111.712 118.129 108.983 1.00 362.22 ? 439  ILE B CB  1 
ATOM   6678  C CG1 . ILE B 2 439 ? 113.183 118.305 108.573 1.00 393.69 ? 439  ILE B CG1 1 
ATOM   6679  C CG2 . ILE B 2 439 ? 111.131 119.479 109.434 1.00 367.57 ? 439  ILE B CG2 1 
ATOM   6680  C CD1 . ILE B 2 439 ? 113.472 119.437 107.599 1.00 389.39 ? 439  ILE B CD1 1 
ATOM   6681  N N   . THR B 2 440 ? 109.248 116.705 110.323 1.00 328.30 ? 440  THR B N   1 
ATOM   6682  C CA  . THR B 2 440 ? 107.902 116.767 110.906 1.00 336.69 ? 440  THR B CA  1 
ATOM   6683  C C   . THR B 2 440 ? 107.909 116.161 112.305 1.00 323.17 ? 440  THR B C   1 
ATOM   6684  O O   . THR B 2 440 ? 107.366 116.741 113.256 1.00 330.76 ? 440  THR B O   1 
ATOM   6685  C CB  . THR B 2 440 ? 106.861 116.023 110.036 1.00 347.38 ? 440  THR B CB  1 
ATOM   6686  O OG1 . THR B 2 440 ? 106.988 116.434 108.667 1.00 353.46 ? 440  THR B OG1 1 
ATOM   6687  C CG2 . THR B 2 440 ? 105.439 116.304 110.518 1.00 367.02 ? 440  THR B CG2 1 
ATOM   6688  N N   . PHE B 2 441 ? 108.537 114.994 112.385 1.00 319.40 ? 441  PHE B N   1 
ATOM   6689  C CA  . PHE B 2 441 ? 108.655 114.244 113.642 1.00 352.16 ? 441  PHE B CA  1 
ATOM   6690  C C   . PHE B 2 441 ? 109.352 115.093 114.700 1.00 339.00 ? 441  PHE B C   1 
ATOM   6691  O O   . PHE B 2 441 ? 108.903 115.181 115.848 1.00 334.91 ? 441  PHE B O   1 
ATOM   6692  C CB  . PHE B 2 441 ? 109.350 112.884 113.445 1.00 357.86 ? 441  PHE B CB  1 
ATOM   6693  C CG  . PHE B 2 441 ? 108.393 111.750 113.185 1.00 354.71 ? 441  PHE B CG  1 
ATOM   6694  C CD1 . PHE B 2 441 ? 107.360 111.887 112.255 1.00 364.14 ? 441  PHE B CD1 1 
ATOM   6695  C CD2 . PHE B 2 441 ? 108.516 110.544 113.870 1.00 346.76 ? 441  PHE B CD2 1 
ATOM   6696  C CE1 . PHE B 2 441 ? 106.471 110.850 112.020 1.00 379.17 ? 441  PHE B CE1 1 
ATOM   6697  C CE2 . PHE B 2 441 ? 107.630 109.502 113.635 1.00 369.52 ? 441  PHE B CE2 1 
ATOM   6698  C CZ  . PHE B 2 441 ? 106.607 109.655 112.711 1.00 385.88 ? 441  PHE B CZ  1 
ATOM   6699  N N   . GLY B 2 442 ? 110.448 115.704 114.267 1.00 347.21 ? 442  GLY B N   1 
ATOM   6700  C CA  . GLY B 2 442 ? 111.270 116.569 115.122 1.00 344.89 ? 442  GLY B CA  1 
ATOM   6701  C C   . GLY B 2 442 ? 110.429 117.708 115.672 1.00 340.11 ? 442  GLY B C   1 
ATOM   6702  O O   . GLY B 2 442 ? 110.473 118.006 116.884 1.00 333.18 ? 442  GLY B O   1 
ATOM   6703  N N   . LEU B 2 443 ? 109.662 118.318 114.774 1.00 332.49 ? 443  LEU B N   1 
ATOM   6704  C CA  . LEU B 2 443 ? 108.785 119.437 115.106 1.00 337.00 ? 443  LEU B CA  1 
ATOM   6705  C C   . LEU B 2 443 ? 107.781 119.027 116.165 1.00 338.09 ? 443  LEU B C   1 
ATOM   6706  O O   . LEU B 2 443 ? 107.593 119.745 117.191 1.00 360.58 ? 443  LEU B O   1 
ATOM   6707  C CB  . LEU B 2 443 ? 108.090 120.006 113.868 1.00 337.68 ? 443  LEU B CB  1 
ATOM   6708  C CG  . LEU B 2 443 ? 109.042 120.793 112.962 1.00 345.94 ? 443  LEU B CG  1 
ATOM   6709  C CD1 . LEU B 2 443 ? 108.506 120.855 111.537 1.00 357.76 ? 443  LEU B CD1 1 
ATOM   6710  C CD2 . LEU B 2 443 ? 109.309 122.189 113.520 1.00 329.40 ? 443  LEU B CD2 1 
ATOM   6711  N N   . VAL B 2 444 ? 107.079 117.937 115.883 1.00 316.05 ? 444  VAL B N   1 
ATOM   6712  C CA  . VAL B 2 444 ? 105.974 117.464 116.727 1.00 335.41 ? 444  VAL B CA  1 
ATOM   6713  C C   . VAL B 2 444 ? 106.538 117.153 118.136 1.00 329.95 ? 444  VAL B C   1 
ATOM   6714  O O   . VAL B 2 444 ? 105.940 117.545 119.157 1.00 347.43 ? 444  VAL B O   1 
ATOM   6715  C CB  . VAL B 2 444 ? 105.283 116.218 116.118 1.00 353.67 ? 444  VAL B CB  1 
ATOM   6716  C CG1 . VAL B 2 444 ? 104.370 115.521 117.125 1.00 343.93 ? 444  VAL B CG1 1 
ATOM   6717  C CG2 . VAL B 2 444 ? 104.498 116.609 114.871 1.00 377.73 ? 444  VAL B CG2 1 
ATOM   6718  N N   . PHE B 2 445 ? 107.672 116.469 118.152 1.00 334.07 ? 445  PHE B N   1 
ATOM   6719  C CA  . PHE B 2 445 ? 108.220 116.121 119.470 1.00 341.74 ? 445  PHE B CA  1 
ATOM   6720  C C   . PHE B 2 445 ? 108.691 117.326 120.211 1.00 354.33 ? 445  PHE B C   1 
ATOM   6721  O O   . PHE B 2 445 ? 108.470 117.371 121.419 1.00 374.23 ? 445  PHE B O   1 
ATOM   6722  C CB  . PHE B 2 445 ? 109.231 114.985 119.419 1.00 346.84 ? 445  PHE B CB  1 
ATOM   6723  C CG  . PHE B 2 445 ? 108.573 113.641 119.465 1.00 367.48 ? 445  PHE B CG  1 
ATOM   6724  C CD1 . PHE B 2 445 ? 108.055 113.074 118.307 1.00 389.65 ? 445  PHE B CD1 1 
ATOM   6725  C CD2 . PHE B 2 445 ? 108.384 112.981 120.676 1.00 366.97 ? 445  PHE B CD2 1 
ATOM   6726  C CE1 . PHE B 2 445 ? 107.409 111.853 118.342 1.00 394.97 ? 445  PHE B CE1 1 
ATOM   6727  C CE2 . PHE B 2 445 ? 107.739 111.753 120.715 1.00 382.33 ? 445  PHE B CE2 1 
ATOM   6728  C CZ  . PHE B 2 445 ? 107.254 111.190 119.545 1.00 394.77 ? 445  PHE B CZ  1 
ATOM   6729  N N   . TYR B 2 446 ? 109.236 118.317 119.506 1.00 336.50 ? 446  TYR B N   1 
ATOM   6730  C CA  . TYR B 2 446 ? 109.636 119.594 120.097 1.00 326.89 ? 446  TYR B CA  1 
ATOM   6731  C C   . TYR B 2 446 ? 108.444 120.252 120.769 1.00 322.91 ? 446  TYR B C   1 
ATOM   6732  O O   . TYR B 2 446 ? 108.515 120.451 121.980 1.00 313.66 ? 446  TYR B O   1 
ATOM   6733  C CB  . TYR B 2 446 ? 110.241 120.591 119.080 1.00 298.25 ? 446  TYR B CB  1 
ATOM   6734  C CG  . TYR B 2 446 ? 110.412 121.956 119.720 1.00 300.50 ? 446  TYR B CG  1 
ATOM   6735  C CD1 . TYR B 2 446 ? 111.447 122.194 120.605 1.00 299.25 ? 446  TYR B CD1 1 
ATOM   6736  C CD2 . TYR B 2 446 ? 109.491 122.978 119.502 1.00 334.43 ? 446  TYR B CD2 1 
ATOM   6737  C CE1 . TYR B 2 446 ? 111.590 123.417 121.237 1.00 312.15 ? 446  TYR B CE1 1 
ATOM   6738  C CE2 . TYR B 2 446 ? 109.621 124.208 120.128 1.00 357.45 ? 446  TYR B CE2 1 
ATOM   6739  C CZ  . TYR B 2 446 ? 110.673 124.422 120.997 1.00 356.64 ? 446  TYR B CZ  1 
ATOM   6740  O OH  . TYR B 2 446 ? 110.811 125.647 121.609 1.00 387.81 ? 446  TYR B OH  1 
ATOM   6741  N N   . PHE B 2 447 ? 107.473 120.683 119.953 1.00 336.80 ? 447  PHE B N   1 
ATOM   6742  C CA  . PHE B 2 447 ? 106.409 121.569 120.445 1.00 343.92 ? 447  PHE B CA  1 
ATOM   6743  C C   . PHE B 2 447 ? 105.622 120.877 121.548 1.00 345.64 ? 447  PHE B C   1 
ATOM   6744  O O   . PHE B 2 447 ? 105.344 121.478 122.606 1.00 366.25 ? 447  PHE B O   1 
ATOM   6745  C CB  . PHE B 2 447 ? 105.490 122.035 119.315 1.00 342.93 ? 447  PHE B CB  1 
ATOM   6746  C CG  . PHE B 2 447 ? 106.097 123.105 118.464 1.00 344.70 ? 447  PHE B CG  1 
ATOM   6747  C CD1 . PHE B 2 447 ? 106.326 124.368 118.994 1.00 359.19 ? 447  PHE B CD1 1 
ATOM   6748  C CD2 . PHE B 2 447 ? 106.472 122.854 117.148 1.00 368.64 ? 447  PHE B CD2 1 
ATOM   6749  C CE1 . PHE B 2 447 ? 106.902 125.367 118.229 1.00 384.28 ? 447  PHE B CE1 1 
ATOM   6750  C CE2 . PHE B 2 447 ? 107.049 123.851 116.374 1.00 383.07 ? 447  PHE B CE2 1 
ATOM   6751  C CZ  . PHE B 2 447 ? 107.264 125.109 116.919 1.00 386.28 ? 447  PHE B CZ  1 
ATOM   6752  N N   . ALA B 2 448 ? 105.288 119.618 121.274 1.00 324.48 ? 448  ALA B N   1 
ATOM   6753  C CA  . ALA B 2 448 ? 104.514 118.795 122.218 1.00 338.77 ? 448  ALA B CA  1 
ATOM   6754  C C   . ALA B 2 448 ? 105.271 118.666 123.531 1.00 342.79 ? 448  ALA B C   1 
ATOM   6755  O O   . ALA B 2 448 ? 104.674 118.824 124.614 1.00 358.88 ? 448  ALA B O   1 
ATOM   6756  C CB  . ALA B 2 448 ? 104.197 117.435 121.631 1.00 340.96 ? 448  ALA B CB  1 
ATOM   6757  N N   . THR B 2 449 ? 106.573 118.399 123.404 1.00 331.09 ? 449  THR B N   1 
ATOM   6758  C CA  . THR B 2 449 ? 107.450 118.244 124.570 1.00 337.75 ? 449  THR B CA  1 
ATOM   6759  C C   . THR B 2 449 ? 107.438 119.511 125.415 1.00 343.64 ? 449  THR B C   1 
ATOM   6760  O O   . THR B 2 449 ? 107.320 119.451 126.645 1.00 336.03 ? 449  THR B O   1 
ATOM   6761  C CB  . THR B 2 449 ? 108.892 117.819 124.234 1.00 333.68 ? 449  THR B CB  1 
ATOM   6762  O OG1 . THR B 2 449 ? 108.866 116.533 123.602 1.00 336.10 ? 449  THR B OG1 1 
ATOM   6763  C CG2 . THR B 2 449 ? 109.748 117.714 125.509 1.00 327.56 ? 449  THR B CG2 1 
ATOM   6764  N N   . ASP B 2 450 ? 107.554 120.635 124.720 1.00 348.15 ? 450  ASP B N   1 
ATOM   6765  C CA  . ASP B 2 450 ? 107.563 121.960 125.346 1.00 354.32 ? 450  ASP B CA  1 
ATOM   6766  C C   . ASP B 2 450 ? 106.281 122.178 126.143 1.00 355.90 ? 450  ASP B C   1 
ATOM   6767  O O   . ASP B 2 450 ? 106.345 122.636 127.302 1.00 360.71 ? 450  ASP B O   1 
ATOM   6768  C CB  . ASP B 2 450 ? 107.755 123.072 124.303 1.00 387.69 ? 450  ASP B CB  1 
ATOM   6769  C CG  . ASP B 2 450 ? 108.203 124.400 124.916 1.00 416.11 ? 450  ASP B CG  1 
ATOM   6770  O OD1 . ASP B 2 450 ? 108.441 124.478 126.142 1.00 426.37 ? 450  ASP B OD1 1 
ATOM   6771  O OD2 . ASP B 2 450 ? 108.329 125.381 124.150 1.00 429.20 ? 450  ASP B OD2 1 
ATOM   6772  N N   . TYR B 2 451 ? 105.124 121.893 125.556 1.00 323.20 ? 451  TYR B N   1 
ATOM   6773  C CA  . TYR B 2 451 ? 103.858 122.342 126.142 1.00 335.32 ? 451  TYR B CA  1 
ATOM   6774  C C   . TYR B 2 451 ? 103.040 121.278 126.880 1.00 328.29 ? 451  TYR B C   1 
ATOM   6775  O O   . TYR B 2 451 ? 102.289 121.613 127.799 1.00 335.59 ? 451  TYR B O   1 
ATOM   6776  C CB  . TYR B 2 451 ? 103.022 123.035 125.064 1.00 354.30 ? 451  TYR B CB  1 
ATOM   6777  C CG  . TYR B 2 451 ? 103.787 124.117 124.317 1.00 362.98 ? 451  TYR B CG  1 
ATOM   6778  C CD1 . TYR B 2 451 ? 104.540 125.078 125.003 1.00 356.02 ? 451  TYR B CD1 1 
ATOM   6779  C CD2 . TYR B 2 451 ? 103.755 124.186 122.923 1.00 390.64 ? 451  TYR B CD2 1 
ATOM   6780  C CE1 . TYR B 2 451 ? 105.237 126.065 124.324 1.00 360.42 ? 451  TYR B CE1 1 
ATOM   6781  C CE2 . TYR B 2 451 ? 104.450 125.173 122.236 1.00 392.87 ? 451  TYR B CE2 1 
ATOM   6782  C CZ  . TYR B 2 451 ? 105.189 126.109 122.940 1.00 383.67 ? 451  TYR B CZ  1 
ATOM   6783  O OH  . TYR B 2 451 ? 105.880 127.090 122.263 1.00 407.57 ? 451  TYR B OH  1 
ATOM   6784  N N   . LEU B 2 452 ? 103.175 120.017 126.484 1.00 327.05 ? 452  LEU B N   1 
ATOM   6785  C CA  . LEU B 2 452 ? 102.471 118.914 127.140 1.00 340.98 ? 452  LEU B CA  1 
ATOM   6786  C C   . LEU B 2 452 ? 103.381 118.171 128.108 1.00 336.88 ? 452  LEU B C   1 
ATOM   6787  O O   . LEU B 2 452 ? 103.015 117.972 129.265 1.00 367.16 ? 452  LEU B O   1 
ATOM   6788  C CB  . LEU B 2 452 ? 101.908 117.945 126.103 1.00 347.59 ? 452  LEU B CB  1 
ATOM   6789  C CG  . LEU B 2 452 ? 100.923 118.570 125.112 1.00 372.29 ? 452  LEU B CG  1 
ATOM   6790  C CD1 . LEU B 2 452 ? 100.785 117.726 123.848 1.00 383.72 ? 452  LEU B CD1 1 
ATOM   6791  C CD2 . LEU B 2 452 ? 99.577  118.803 125.788 1.00 389.62 ? 452  LEU B CD2 1 
ATOM   6792  N N   . VAL B 2 453 ? 104.566 117.781 127.642 1.00 319.61 ? 453  VAL B N   1 
ATOM   6793  C CA  . VAL B 2 453 ? 105.479 116.952 128.430 1.00 327.07 ? 453  VAL B CA  1 
ATOM   6794  C C   . VAL B 2 453 ? 106.146 117.760 129.528 1.00 332.80 ? 453  VAL B C   1 
ATOM   6795  O O   . VAL B 2 453 ? 106.008 117.435 130.709 1.00 345.42 ? 453  VAL B O   1 
ATOM   6796  C CB  . VAL B 2 453 ? 106.556 116.285 127.544 1.00 339.52 ? 453  VAL B CB  1 
ATOM   6797  C CG1 . VAL B 2 453 ? 107.594 115.539 128.373 1.00 339.18 ? 453  VAL B CG1 1 
ATOM   6798  C CG2 . VAL B 2 453 ? 105.902 115.344 126.541 1.00 348.73 ? 453  VAL B CG2 1 
ATOM   6799  N N   . GLN B 2 454 ? 106.854 118.812 129.125 1.00 333.71 ? 454  GLN B N   1 
ATOM   6800  C CA  . GLN B 2 454 ? 107.704 119.593 130.032 1.00 340.88 ? 454  GLN B CA  1 
ATOM   6801  C C   . GLN B 2 454 ? 107.025 119.990 131.330 1.00 338.70 ? 454  GLN B C   1 
ATOM   6802  O O   . GLN B 2 454 ? 107.626 119.812 132.387 1.00 353.57 ? 454  GLN B O   1 
ATOM   6803  C CB  . GLN B 2 454 ? 108.224 120.866 129.357 1.00 364.73 ? 454  GLN B CB  1 
ATOM   6804  C CG  . GLN B 2 454 ? 109.438 121.498 130.021 1.00 363.73 ? 454  GLN B CG  1 
ATOM   6805  C CD  . GLN B 2 454 ? 109.152 122.308 131.277 1.00 366.79 ? 454  GLN B CD  1 
ATOM   6806  O OE1 . GLN B 2 454 ? 108.049 122.822 131.479 1.00 353.41 ? 454  GLN B OE1 1 
ATOM   6807  N NE2 . GLN B 2 454 ? 110.169 122.444 132.121 1.00 390.26 ? 454  GLN B NE2 1 
ATOM   6808  N N   . PRO B 2 455 ? 105.788 120.536 131.265 1.00 331.31 ? 455  PRO B N   1 
ATOM   6809  C CA  . PRO B 2 455 ? 105.309 121.122 132.522 1.00 325.59 ? 455  PRO B CA  1 
ATOM   6810  C C   . PRO B 2 455 ? 105.141 120.035 133.582 1.00 336.45 ? 455  PRO B C   1 
ATOM   6811  O O   . PRO B 2 455 ? 105.630 120.168 134.716 1.00 376.66 ? 455  PRO B O   1 
ATOM   6812  C CB  . PRO B 2 455 ? 103.955 121.731 132.143 1.00 339.06 ? 455  PRO B CB  1 
ATOM   6813  C CG  . PRO B 2 455 ? 103.997 121.882 130.665 1.00 355.84 ? 455  PRO B CG  1 
ATOM   6814  C CD  . PRO B 2 455 ? 104.827 120.743 130.171 1.00 343.79 ? 455  PRO B CD  1 
ATOM   6815  N N   . PHE B 2 456 ? 104.478 118.975 133.169 1.00 310.34 ? 456  PHE B N   1 
ATOM   6816  C CA  . PHE B 2 456 ? 104.218 117.799 134.001 1.00 332.72 ? 456  PHE B CA  1 
ATOM   6817  C C   . PHE B 2 456 ? 105.537 117.222 134.525 1.00 346.32 ? 456  PHE B C   1 
ATOM   6818  O O   . PHE B 2 456 ? 105.710 116.938 135.727 1.00 369.98 ? 456  PHE B O   1 
ATOM   6819  C CB  . PHE B 2 456 ? 103.519 116.777 133.087 1.00 326.63 ? 456  PHE B CB  1 
ATOM   6820  C CG  . PHE B 2 456 ? 103.468 115.371 133.609 1.00 313.46 ? 456  PHE B CG  1 
ATOM   6821  C CD1 . PHE B 2 456 ? 102.901 115.078 134.843 1.00 338.80 ? 456  PHE B CD1 1 
ATOM   6822  C CD2 . PHE B 2 456 ? 103.917 114.323 132.817 1.00 294.73 ? 456  PHE B CD2 1 
ATOM   6823  C CE1 . PHE B 2 456 ? 102.824 113.764 135.298 1.00 324.32 ? 456  PHE B CE1 1 
ATOM   6824  C CE2 . PHE B 2 456 ? 103.840 113.014 133.265 1.00 316.92 ? 456  PHE B CE2 1 
ATOM   6825  C CZ  . PHE B 2 456 ? 103.296 112.732 134.509 1.00 303.40 ? 456  PHE B CZ  1 
ATOM   6826  N N   . MET B 2 457 ? 106.446 117.065 133.565 1.00 335.44 ? 457  MET B N   1 
ATOM   6827  C CA  . MET B 2 457 ? 107.779 116.499 133.838 1.00 335.22 ? 457  MET B CA  1 
ATOM   6828  C C   . MET B 2 457 ? 108.505 117.364 134.856 1.00 331.21 ? 457  MET B C   1 
ATOM   6829  O O   . MET B 2 457 ? 109.104 116.837 135.807 1.00 341.98 ? 457  MET B O   1 
ATOM   6830  C CB  . MET B 2 457 ? 108.602 116.326 132.552 1.00 346.63 ? 457  MET B CB  1 
ATOM   6831  C CG  . MET B 2 457 ? 109.546 115.138 132.602 1.00 355.28 ? 457  MET B CG  1 
ATOM   6832  S SD  . MET B 2 457 ? 108.647 113.580 132.458 1.00 365.64 ? 457  MET B SD  1 
ATOM   6833  C CE  . MET B 2 457 ? 109.679 112.491 133.438 1.00 385.19 ? 457  MET B CE  1 
ATOM   6834  N N   . ASP B 2 458 ? 108.432 118.674 134.636 1.00 338.05 ? 458  ASP B N   1 
ATOM   6835  C CA  . ASP B 2 458 ? 109.071 119.658 135.516 1.00 340.19 ? 458  ASP B CA  1 
ATOM   6836  C C   . ASP B 2 458 ? 108.543 119.514 136.936 1.00 327.16 ? 458  ASP B C   1 
ATOM   6837  O O   . ASP B 2 458 ? 109.320 119.501 137.902 1.00 330.77 ? 458  ASP B O   1 
ATOM   6838  C CB  . ASP B 2 458 ? 108.869 121.094 135.029 1.00 372.41 ? 458  ASP B CB  1 
ATOM   6839  C CG  . ASP B 2 458 ? 109.733 122.096 135.786 1.00 391.40 ? 458  ASP B CG  1 
ATOM   6840  O OD1 . ASP B 2 458 ? 110.966 121.895 135.856 1.00 398.49 ? 458  ASP B OD1 1 
ATOM   6841  O OD2 . ASP B 2 458 ? 109.178 123.088 136.305 1.00 402.28 ? 458  ASP B OD2 1 
ATOM   6842  N N   . GLN B 2 459 ? 107.225 119.404 137.023 1.00 324.42 ? 459  GLN B N   1 
ATOM   6843  C CA  . GLN B 2 459 ? 106.523 119.258 138.304 1.00 333.47 ? 459  GLN B CA  1 
ATOM   6844  C C   . GLN B 2 459 ? 107.027 118.018 139.036 1.00 318.57 ? 459  GLN B C   1 
ATOM   6845  O O   . GLN B 2 459 ? 107.325 118.065 140.242 1.00 346.33 ? 459  GLN B O   1 
ATOM   6846  C CB  . GLN B 2 459 ? 104.998 119.236 138.108 1.00 341.43 ? 459  GLN B CB  1 
ATOM   6847  C CG  . GLN B 2 459 ? 104.218 119.922 139.229 1.00 363.34 ? 459  GLN B CG  1 
ATOM   6848  C CD  . GLN B 2 459 ? 102.943 120.618 138.767 1.00 371.40 ? 459  GLN B CD  1 
ATOM   6849  O OE1 . GLN B 2 459 ? 102.841 121.078 137.629 1.00 398.87 ? 459  GLN B OE1 1 
ATOM   6850  N NE2 . GLN B 2 459 ? 101.971 120.722 139.667 1.00 379.28 ? 459  GLN B NE2 1 
ATOM   6851  N N   . LEU B 2 460 ? 107.112 116.933 138.275 1.00 308.89 ? 460  LEU B N   1 
ATOM   6852  C CA  . LEU B 2 460 ? 107.575 115.640 138.789 1.00 315.71 ? 460  LEU B CA  1 
ATOM   6853  C C   . LEU B 2 460 ? 108.984 115.777 139.370 1.00 303.15 ? 460  LEU B C   1 
ATOM   6854  O O   . LEU B 2 460 ? 109.271 115.294 140.472 1.00 295.22 ? 460  LEU B O   1 
ATOM   6855  C CB  . LEU B 2 460 ? 107.539 114.542 137.715 1.00 310.27 ? 460  LEU B CB  1 
ATOM   6856  C CG  . LEU B 2 460 ? 106.344 113.591 137.793 1.00 325.20 ? 460  LEU B CG  1 
ATOM   6857  C CD1 . LEU B 2 460 ? 105.016 114.325 137.705 1.00 339.58 ? 460  LEU B CD1 1 
ATOM   6858  C CD2 . LEU B 2 460 ? 106.445 112.557 136.685 1.00 345.14 ? 460  LEU B CD2 1 
ATOM   6859  N N   . ALA B 2 461 ? 109.826 116.448 138.595 1.00 292.50 ? 461  ALA B N   1 
ATOM   6860  C CA  . ALA B 2 461 ? 111.225 116.679 138.948 1.00 330.04 ? 461  ALA B CA  1 
ATOM   6861  C C   . ALA B 2 461 ? 111.298 117.438 140.282 1.00 320.60 ? 461  ALA B C   1 
ATOM   6862  O O   . ALA B 2 461 ? 112.094 117.053 141.166 1.00 316.36 ? 461  ALA B O   1 
ATOM   6863  C CB  . ALA B 2 461 ? 111.954 117.440 137.849 1.00 345.13 ? 461  ALA B CB  1 
ATOM   6864  N N   . PHE B 2 462 ? 110.469 118.476 140.373 1.00 313.03 ? 462  PHE B N   1 
ATOM   6865  C CA  . PHE B 2 462 ? 110.493 119.365 141.522 1.00 314.57 ? 462  PHE B CA  1 
ATOM   6866  C C   . PHE B 2 462 ? 110.220 118.637 142.816 1.00 316.52 ? 462  PHE B C   1 
ATOM   6867  O O   . PHE B 2 462 ? 110.937 118.835 143.809 1.00 376.67 ? 462  PHE B O   1 
ATOM   6868  C CB  . PHE B 2 462 ? 109.514 120.523 141.397 1.00 351.72 ? 462  PHE B CB  1 
ATOM   6869  C CG  . PHE B 2 462 ? 109.556 121.452 142.573 1.00 370.74 ? 462  PHE B CG  1 
ATOM   6870  C CD1 . PHE B 2 462 ? 110.666 122.266 142.782 1.00 358.43 ? 462  PHE B CD1 1 
ATOM   6871  C CD2 . PHE B 2 462 ? 108.515 121.483 143.499 1.00 394.48 ? 462  PHE B CD2 1 
ATOM   6872  C CE1 . PHE B 2 462 ? 110.724 123.118 143.875 1.00 395.94 ? 462  PHE B CE1 1 
ATOM   6873  C CE2 . PHE B 2 462 ? 108.569 122.332 144.597 1.00 412.64 ? 462  PHE B CE2 1 
ATOM   6874  C CZ  . PHE B 2 462 ? 109.675 123.151 144.785 1.00 411.58 ? 462  PHE B CZ  1 
ATOM   6875  N N   . HIS B 2 463 ? 109.146 117.857 142.848 1.00 311.20 ? 463  HIS B N   1 
ATOM   6876  C CA  . HIS B 2 463 ? 108.795 117.096 144.053 1.00 334.50 ? 463  HIS B CA  1 
ATOM   6877  C C   . HIS B 2 463 ? 109.789 115.964 144.328 1.00 325.31 ? 463  HIS B C   1 
ATOM   6878  O O   . HIS B 2 463 ? 109.917 115.514 145.467 1.00 328.21 ? 463  HIS B O   1 
ATOM   6879  C CB  . HIS B 2 463 ? 107.394 116.508 143.935 1.00 349.10 ? 463  HIS B CB  1 
ATOM   6880  C CG  . HIS B 2 463 ? 106.301 117.530 143.951 1.00 367.21 ? 463  HIS B CG  1 
ATOM   6881  N ND1 . HIS B 2 463 ? 105.885 118.194 142.817 1.00 378.17 ? 463  HIS B ND1 1 
ATOM   6882  C CD2 . HIS B 2 463 ? 105.525 117.986 144.961 1.00 381.06 ? 463  HIS B CD2 1 
ATOM   6883  C CE1 . HIS B 2 463 ? 104.904 119.022 143.130 1.00 383.17 ? 463  HIS B CE1 1 
ATOM   6884  N NE2 . HIS B 2 463 ? 104.667 118.916 144.425 1.00 401.35 ? 463  HIS B NE2 1 
ATOM   6885  N N   . GLN B 2 464 ? 110.455 115.512 143.263 1.00 305.51 ? 464  GLN B N   1 
ATOM   6886  C CA  . GLN B 2 464 ? 111.470 114.449 143.262 1.00 301.31 ? 464  GLN B CA  1 
ATOM   6887  C C   . GLN B 2 464 ? 110.872 113.089 142.915 1.00 288.70 ? 464  GLN B C   1 
ATOM   6888  O O   . GLN B 2 464 ? 111.613 112.119 142.784 1.00 290.76 ? 464  GLN B O   1 
ATOM   6889  C CB  . GLN B 2 464 ? 112.296 114.368 144.561 1.00 280.22 ? 464  GLN B CB  1 
ATOM   6890  C CG  . GLN B 2 464 ? 113.637 113.660 144.384 1.00 287.26 ? 464  GLN B CG  1 
ATOM   6891  C CD  . GLN B 2 464 ? 114.575 113.831 145.559 1.00 326.02 ? 464  GLN B CD  1 
ATOM   6892  O OE1 . GLN B 2 464 ? 114.246 114.476 146.558 1.00 348.12 ? 464  GLN B OE1 1 
ATOM   6893  N NE2 . GLN B 2 464 ? 115.762 113.243 145.446 1.00 345.28 ? 464  GLN B NE2 1 
ATOM   6894  N N   . PHE B 2 465 ? 109.553 113.014 142.725 1.00 280.03 ? 465  PHE B N   1 
ATOM   6895  C CA  . PHE B 2 465 ? 108.934 111.738 142.384 1.00 290.25 ? 465  PHE B CA  1 
ATOM   6896  C C   . PHE B 2 465 ? 108.901 111.489 140.882 1.00 271.60 ? 465  PHE B C   1 
ATOM   6897  O O   . PHE B 2 465 ? 108.692 112.409 140.096 1.00 268.05 ? 465  PHE B O   1 
ATOM   6898  C CB  . PHE B 2 465 ? 107.566 111.533 143.048 1.00 320.15 ? 465  PHE B CB  1 
ATOM   6899  C CG  . PHE B 2 465 ? 106.549 112.602 142.762 1.00 319.22 ? 465  PHE B CG  1 
ATOM   6900  C CD1 . PHE B 2 465 ? 105.962 112.723 141.502 1.00 319.44 ? 465  PHE B CD1 1 
ATOM   6901  C CD2 . PHE B 2 465 ? 106.106 113.433 143.788 1.00 318.95 ? 465  PHE B CD2 1 
ATOM   6902  C CE1 . PHE B 2 465 ? 104.999 113.686 141.260 1.00 364.10 ? 465  PHE B CE1 1 
ATOM   6903  C CE2 . PHE B 2 465 ? 105.137 114.392 143.551 1.00 367.06 ? 465  PHE B CE2 1 
ATOM   6904  C CZ  . PHE B 2 465 ? 104.588 114.525 142.284 1.00 393.62 ? 465  PHE B CZ  1 
ATOM   6905  N N   . TYR B 2 466 ? 109.073 110.219 140.517 1.00 287.51 ? 466  TYR B N   1 
ATOM   6906  C CA  . TYR B 2 466 ? 109.512 109.803 139.188 1.00 298.65 ? 466  TYR B CA  1 
ATOM   6907  C C   . TYR B 2 466 ? 108.418 109.136 138.357 1.00 314.57 ? 466  TYR B C   1 
ATOM   6908  O O   . TYR B 2 466 ? 107.411 108.642 138.872 1.00 293.25 ? 466  TYR B O   1 
ATOM   6909  C CB  . TYR B 2 466 ? 110.686 108.830 139.325 1.00 306.37 ? 466  TYR B CB  1 
ATOM   6910  C CG  . TYR B 2 466 ? 112.045 109.455 139.564 1.00 312.71 ? 466  TYR B CG  1 
ATOM   6911  C CD1 . TYR B 2 466 ? 112.190 110.741 140.098 1.00 332.23 ? 466  TYR B CD1 1 
ATOM   6912  C CD2 . TYR B 2 466 ? 113.202 108.740 139.271 1.00 326.33 ? 466  TYR B CD2 1 
ATOM   6913  C CE1 . TYR B 2 466 ? 113.442 111.295 140.308 1.00 348.21 ? 466  TYR B CE1 1 
ATOM   6914  C CE2 . TYR B 2 466 ? 114.456 109.283 139.483 1.00 332.98 ? 466  TYR B CE2 1 
ATOM   6915  C CZ  . TYR B 2 466 ? 114.571 110.562 140.002 1.00 346.73 ? 466  TYR B CZ  1 
ATOM   6916  O OH  . TYR B 2 466 ? 115.811 111.107 140.207 1.00 327.18 ? 466  TYR B OH  1 
ATOM   6917  N N   . ILE B 2 467 ? 108.671 109.110 137.055 1.00 337.86 ? 467  ILE B N   1 
ATOM   6918  C CA  . ILE B 2 467 ? 107.718 108.638 136.066 1.00 347.16 ? 467  ILE B CA  1 
ATOM   6919  C C   . ILE B 2 467 ? 107.795 107.116 135.961 1.00 358.44 ? 467  ILE B C   1 
ATOM   6920  O O   . ILE B 2 467 ? 106.879 106.469 135.457 1.00 377.13 ? 467  ILE B O   1 
ATOM   6921  C CB  . ILE B 2 467 ? 107.991 109.329 134.701 1.00 359.65 ? 467  ILE B CB  1 
ATOM   6922  C CG1 . ILE B 2 467 ? 106.740 109.331 133.822 1.00 364.41 ? 467  ILE B CG1 1 
ATOM   6923  C CG2 . ILE B 2 467 ? 109.191 108.723 133.975 1.00 370.77 ? 467  ILE B CG2 1 
ATOM   6924  C CD1 . ILE B 2 467 ? 105.753 110.410 134.198 1.00 370.64 ? 467  ILE B CD1 1 
ATOM   6925  N N   . GLY C 3 2   ? 130.762 121.252 142.466 1.00 354.73 ? 2    GLY C N   1 
ATOM   6926  C CA  . GLY C 3 2   ? 129.977 121.698 141.277 1.00 349.67 ? 2    GLY C CA  1 
ATOM   6927  C C   . GLY C 3 2   ? 130.167 120.793 140.076 1.00 324.35 ? 2    GLY C C   1 
ATOM   6928  O O   . GLY C 3 2   ? 129.279 120.021 139.728 1.00 320.57 ? 2    GLY C O   1 
ATOM   6929  N N   . ALA C 3 3   ? 131.338 120.879 139.453 1.00 318.10 ? 3    ALA C N   1 
ATOM   6930  C CA  . ALA C 3 3   ? 131.641 120.075 138.271 1.00 326.84 ? 3    ALA C CA  1 
ATOM   6931  C C   . ALA C 3 3   ? 131.833 118.613 138.669 1.00 303.55 ? 3    ALA C C   1 
ATOM   6932  O O   . ALA C 3 3   ? 131.274 117.691 138.042 1.00 293.98 ? 3    ALA C O   1 
ATOM   6933  C CB  . ALA C 3 3   ? 132.893 120.599 137.584 1.00 354.53 ? 3    ALA C CB  1 
ATOM   6934  N N   . ALA C 3 4   ? 132.637 118.437 139.713 1.00 318.59 ? 4    ALA C N   1 
ATOM   6935  C CA  . ALA C 3 4   ? 132.959 117.113 140.253 1.00 335.57 ? 4    ALA C CA  1 
ATOM   6936  C C   . ALA C 3 4   ? 131.684 116.391 140.665 1.00 303.36 ? 4    ALA C C   1 
ATOM   6937  O O   . ALA C 3 4   ? 131.490 115.207 140.342 1.00 332.16 ? 4    ALA C O   1 
ATOM   6938  C CB  . ALA C 3 4   ? 133.890 117.245 141.450 1.00 357.15 ? 4    ALA C CB  1 
ATOM   6939  N N   . VAL C 3 5   ? 130.841 117.137 141.377 1.00 285.47 ? 5    VAL C N   1 
ATOM   6940  C CA  . VAL C 3 5   ? 129.560 116.611 141.875 1.00 289.16 ? 5    VAL C CA  1 
ATOM   6941  C C   . VAL C 3 5   ? 128.704 116.136 140.709 1.00 289.84 ? 5    VAL C C   1 
ATOM   6942  O O   . VAL C 3 5   ? 128.124 115.044 140.758 1.00 305.91 ? 5    VAL C O   1 
ATOM   6943  C CB  . VAL C 3 5   ? 128.775 117.632 142.720 1.00 320.05 ? 5    VAL C CB  1 
ATOM   6944  C CG1 . VAL C 3 5   ? 127.394 117.094 143.088 1.00 333.99 ? 5    VAL C CG1 1 
ATOM   6945  C CG2 . VAL C 3 5   ? 129.544 117.969 143.987 1.00 352.76 ? 5    VAL C CG2 1 
ATOM   6946  N N   . PHE C 3 6   ? 128.652 116.977 139.683 1.00 287.34 ? 6    PHE C N   1 
ATOM   6947  C CA  . PHE C 3 6   ? 127.877 116.702 138.467 1.00 290.80 ? 6    PHE C CA  1 
ATOM   6948  C C   . PHE C 3 6   ? 128.356 115.394 137.834 1.00 273.63 ? 6    PHE C C   1 
ATOM   6949  O O   . PHE C 3 6   ? 127.555 114.538 137.447 1.00 289.75 ? 6    PHE C O   1 
ATOM   6950  C CB  . PHE C 3 6   ? 128.004 117.815 137.418 1.00 313.37 ? 6    PHE C CB  1 
ATOM   6951  C CG  . PHE C 3 6   ? 127.828 117.330 136.002 1.00 284.95 ? 6    PHE C CG  1 
ATOM   6952  C CD1 . PHE C 3 6   ? 126.557 117.130 135.482 1.00 300.09 ? 6    PHE C CD1 1 
ATOM   6953  C CD2 . PHE C 3 6   ? 128.927 117.053 135.202 1.00 282.28 ? 6    PHE C CD2 1 
ATOM   6954  C CE1 . PHE C 3 6   ? 126.376 116.673 134.188 1.00 296.73 ? 6    PHE C CE1 1 
ATOM   6955  C CE2 . PHE C 3 6   ? 128.758 116.592 133.908 1.00 322.06 ? 6    PHE C CE2 1 
ATOM   6956  C CZ  . PHE C 3 6   ? 127.480 116.402 133.398 1.00 320.33 ? 6    PHE C CZ  1 
ATOM   6957  N N   . PHE C 3 7   ? 129.674 115.287 137.737 1.00 300.46 ? 7    PHE C N   1 
ATOM   6958  C CA  . PHE C 3 7   ? 130.279 114.103 137.125 1.00 311.02 ? 7    PHE C CA  1 
ATOM   6959  C C   . PHE C 3 7   ? 129.942 112.856 137.914 1.00 296.98 ? 7    PHE C C   1 
ATOM   6960  O O   . PHE C 3 7   ? 129.610 111.833 137.311 1.00 317.43 ? 7    PHE C O   1 
ATOM   6961  C CB  . PHE C 3 7   ? 131.765 114.259 136.804 1.00 322.02 ? 7    PHE C CB  1 
ATOM   6962  C CG  . PHE C 3 7   ? 132.000 114.812 135.435 1.00 296.60 ? 7    PHE C CG  1 
ATOM   6963  C CD1 . PHE C 3 7   ? 131.740 114.032 134.319 1.00 301.82 ? 7    PHE C CD1 1 
ATOM   6964  C CD2 . PHE C 3 7   ? 132.429 116.122 135.254 1.00 344.17 ? 7    PHE C CD2 1 
ATOM   6965  C CE1 . PHE C 3 7   ? 131.929 114.536 133.040 1.00 367.98 ? 7    PHE C CE1 1 
ATOM   6966  C CE2 . PHE C 3 7   ? 132.621 116.636 133.979 1.00 385.29 ? 7    PHE C CE2 1 
ATOM   6967  C CZ  . PHE C 3 7   ? 132.372 115.841 132.868 1.00 390.50 ? 7    PHE C CZ  1 
ATOM   6968  N N   . GLY C 3 8   ? 129.988 112.972 139.237 1.00 295.92 ? 8    GLY C N   1 
ATOM   6969  C CA  . GLY C 3 8   ? 129.634 111.882 140.144 1.00 312.40 ? 8    GLY C CA  1 
ATOM   6970  C C   . GLY C 3 8   ? 128.206 111.418 139.890 1.00 308.05 ? 8    GLY C C   1 
ATOM   6971  O O   . GLY C 3 8   ? 127.928 110.205 139.753 1.00 312.23 ? 8    GLY C O   1 
ATOM   6972  N N   . CYS C 3 9   ? 127.304 112.388 139.937 1.00 298.16 ? 9    CYS C N   1 
ATOM   6973  C CA  . CYS C 3 9   ? 125.854 112.132 139.835 1.00 310.19 ? 9    CYS C CA  1 
ATOM   6974  C C   . CYS C 3 9   ? 125.550 111.453 138.514 1.00 294.17 ? 9    CYS C C   1 
ATOM   6975  O O   . CYS C 3 9   ? 124.794 110.466 138.482 1.00 306.07 ? 9    CYS C O   1 
ATOM   6976  C CB  . CYS C 3 9   ? 125.059 113.422 139.977 1.00 320.85 ? 9    CYS C CB  1 
ATOM   6977  S SG  . CYS C 3 9   ? 125.176 114.125 141.631 1.00 342.53 ? 9    CYS C SG  1 
ATOM   6978  N N   . THR C 3 10  ? 126.152 111.989 137.450 1.00 285.46 ? 10   THR C N   1 
ATOM   6979  C CA  . THR C 3 10  ? 125.930 111.473 136.094 1.00 291.39 ? 10   THR C CA  1 
ATOM   6980  C C   . THR C 3 10  ? 126.400 110.006 136.042 1.00 297.33 ? 10   THR C C   1 
ATOM   6981  O O   . THR C 3 10  ? 125.692 109.151 135.481 1.00 313.01 ? 10   THR C O   1 
ATOM   6982  C CB  . THR C 3 10  ? 126.516 112.363 134.956 1.00 290.62 ? 10   THR C CB  1 
ATOM   6983  O OG1 . THR C 3 10  ? 125.804 112.110 133.740 1.00 322.98 ? 10   THR C OG1 1 
ATOM   6984  C CG2 . THR C 3 10  ? 127.976 112.107 134.685 1.00 310.93 ? 10   THR C CG2 1 
ATOM   6985  N N   . PHE C 3 11  ? 127.563 109.751 136.629 1.00 284.58 ? 11   PHE C N   1 
ATOM   6986  C CA  . PHE C 3 11  ? 128.080 108.384 136.595 1.00 296.41 ? 11   PHE C CA  1 
ATOM   6987  C C   . PHE C 3 11  ? 127.195 107.443 137.368 1.00 287.97 ? 11   PHE C C   1 
ATOM   6988  O O   . PHE C 3 11  ? 126.960 106.331 136.890 1.00 306.72 ? 11   PHE C O   1 
ATOM   6989  C CB  . PHE C 3 11  ? 129.539 108.292 137.033 1.00 302.21 ? 11   PHE C CB  1 
ATOM   6990  C CG  . PHE C 3 11  ? 130.522 108.938 136.085 1.00 301.83 ? 11   PHE C CG  1 
ATOM   6991  C CD1 . PHE C 3 11  ? 130.222 109.171 134.733 1.00 303.64 ? 11   PHE C CD1 1 
ATOM   6992  C CD2 . PHE C 3 11  ? 131.783 109.284 136.551 1.00 299.77 ? 11   PHE C CD2 1 
ATOM   6993  C CE1 . PHE C 3 11  ? 131.151 109.758 133.894 1.00 331.30 ? 11   PHE C CE1 1 
ATOM   6994  C CE2 . PHE C 3 11  ? 132.712 109.870 135.712 1.00 334.59 ? 11   PHE C CE2 1 
ATOM   6995  C CZ  . PHE C 3 11  ? 132.399 110.108 134.383 1.00 347.64 ? 11   PHE C CZ  1 
ATOM   6996  N N   . VAL C 3 12  ? 126.668 107.907 138.497 1.00 269.65 ? 12   VAL C N   1 
ATOM   6997  C CA  . VAL C 3 12  ? 125.727 107.131 139.311 1.00 270.21 ? 12   VAL C CA  1 
ATOM   6998  C C   . VAL C 3 12  ? 124.508 106.757 138.485 1.00 268.16 ? 12   VAL C C   1 
ATOM   6999  O O   . VAL C 3 12  ? 124.063 105.590 138.490 1.00 316.24 ? 12   VAL C O   1 
ATOM   7000  C CB  . VAL C 3 12  ? 125.307 107.881 140.598 1.00 306.93 ? 12   VAL C CB  1 
ATOM   7001  C CG1 . VAL C 3 12  ? 124.121 107.208 141.278 1.00 289.05 ? 12   VAL C CG1 1 
ATOM   7002  C CG2 . VAL C 3 12  ? 126.474 107.971 141.570 1.00 324.77 ? 12   VAL C CG2 1 
ATOM   7003  N N   . ALA C 3 13  ? 123.998 107.759 137.777 1.00 283.51 ? 13   ALA C N   1 
ATOM   7004  C CA  . ALA C 3 13  ? 122.744 107.616 137.012 1.00 308.52 ? 13   ALA C CA  1 
ATOM   7005  C C   . ALA C 3 13  ? 122.866 106.749 135.767 1.00 303.62 ? 13   ALA C C   1 
ATOM   7006  O O   . ALA C 3 13  ? 122.234 105.674 135.628 1.00 325.49 ? 13   ALA C O   1 
ATOM   7007  C CB  . ALA C 3 13  ? 122.196 108.989 136.632 1.00 331.78 ? 13   ALA C CB  1 
ATOM   7008  N N   . PHE C 3 14  ? 123.683 107.254 134.855 1.00 299.26 ? 14   PHE C N   1 
ATOM   7009  C CA  . PHE C 3 14  ? 123.813 106.684 133.537 1.00 310.61 ? 14   PHE C CA  1 
ATOM   7010  C C   . PHE C 3 14  ? 124.965 105.719 133.446 1.00 337.56 ? 14   PHE C C   1 
ATOM   7011  O O   . PHE C 3 14  ? 125.056 104.992 132.467 1.00 369.03 ? 14   PHE C O   1 
ATOM   7012  C CB  . PHE C 3 14  ? 123.984 107.795 132.517 1.00 314.43 ? 14   PHE C CB  1 
ATOM   7013  C CG  . PHE C 3 14  ? 122.865 108.780 132.533 1.00 315.38 ? 14   PHE C CG  1 
ATOM   7014  C CD1 . PHE C 3 14  ? 121.560 108.361 132.280 1.00 313.78 ? 14   PHE C CD1 1 
ATOM   7015  C CD2 . PHE C 3 14  ? 123.100 110.114 132.823 1.00 327.35 ? 14   PHE C CD2 1 
ATOM   7016  C CE1 . PHE C 3 14  ? 120.512 109.260 132.301 1.00 324.46 ? 14   PHE C CE1 1 
ATOM   7017  C CE2 . PHE C 3 14  ? 122.057 111.021 132.844 1.00 360.19 ? 14   PHE C CE2 1 
ATOM   7018  C CZ  . PHE C 3 14  ? 120.763 110.594 132.581 1.00 361.75 ? 14   PHE C CZ  1 
ATOM   7019  N N   . GLY C 3 15  ? 125.842 105.707 134.448 1.00 353.91 ? 15   GLY C N   1 
ATOM   7020  C CA  . GLY C 3 15  ? 126.973 104.790 134.466 1.00 356.73 ? 15   GLY C CA  1 
ATOM   7021  C C   . GLY C 3 15  ? 126.601 103.398 134.049 1.00 328.57 ? 15   GLY C C   1 
ATOM   7022  O O   . GLY C 3 15  ? 127.157 102.926 133.050 1.00 343.26 ? 15   GLY C O   1 
ATOM   7023  N N   . PRO C 3 16  ? 125.695 102.749 134.812 1.00 314.08 ? 16   PRO C N   1 
ATOM   7024  C CA  . PRO C 3 16  ? 125.286 101.380 134.521 1.00 323.11 ? 16   PRO C CA  1 
ATOM   7025  C C   . PRO C 3 16  ? 124.702 101.281 133.120 1.00 322.75 ? 16   PRO C C   1 
ATOM   7026  O O   . PRO C 3 16  ? 125.043 100.367 132.349 1.00 342.23 ? 16   PRO C O   1 
ATOM   7027  C CB  . PRO C 3 16  ? 124.204 101.089 135.571 1.00 327.96 ? 16   PRO C CB  1 
ATOM   7028  C CG  . PRO C 3 16  ? 124.388 102.110 136.628 1.00 335.28 ? 16   PRO C CG  1 
ATOM   7029  C CD  . PRO C 3 16  ? 124.916 103.318 135.926 1.00 322.66 ? 16   PRO C CD  1 
ATOM   7030  N N   . ALA C 3 17  ? 123.830 102.239 132.826 1.00 321.50 ? 17   ALA C N   1 
ATOM   7031  C CA  . ALA C 3 17  ? 123.151 102.321 131.525 1.00 336.71 ? 17   ALA C CA  1 
ATOM   7032  C C   . ALA C 3 17  ? 124.178 102.421 130.405 1.00 322.98 ? 17   ALA C C   1 
ATOM   7033  O O   . ALA C 3 17  ? 124.083 101.718 129.387 1.00 343.32 ? 17   ALA C O   1 
ATOM   7034  C CB  . ALA C 3 17  ? 122.236 103.537 131.485 1.00 354.46 ? 17   ALA C CB  1 
ATOM   7035  N N   . PHE C 3 18  ? 125.142 103.305 130.628 1.00 313.18 ? 18   PHE C N   1 
ATOM   7036  C CA  . PHE C 3 18  ? 126.226 103.559 129.672 1.00 336.60 ? 18   PHE C CA  1 
ATOM   7037  C C   . PHE C 3 18  ? 126.988 102.269 129.393 1.00 341.48 ? 18   PHE C C   1 
ATOM   7038  O O   . PHE C 3 18  ? 127.267 101.931 128.230 1.00 353.67 ? 18   PHE C O   1 
ATOM   7039  C CB  . PHE C 3 18  ? 127.170 104.644 130.198 1.00 364.06 ? 18   PHE C CB  1 
ATOM   7040  C CG  . PHE C 3 18  ? 128.253 105.032 129.235 1.00 375.35 ? 18   PHE C CG  1 
ATOM   7041  C CD1 . PHE C 3 18  ? 127.942 105.718 128.065 1.00 382.09 ? 18   PHE C CD1 1 
ATOM   7042  C CD2 . PHE C 3 18  ? 129.586 104.728 129.503 1.00 368.39 ? 18   PHE C CD2 1 
ATOM   7043  C CE1 . PHE C 3 18  ? 128.939 106.085 127.173 1.00 402.15 ? 18   PHE C CE1 1 
ATOM   7044  C CE2 . PHE C 3 18  ? 130.586 105.096 128.617 1.00 386.46 ? 18   PHE C CE2 1 
ATOM   7045  C CZ  . PHE C 3 18  ? 130.263 105.775 127.449 1.00 406.11 ? 18   PHE C CZ  1 
ATOM   7046  N N   . ALA C 3 19  ? 127.306 101.576 130.479 1.00 325.56 ? 19   ALA C N   1 
ATOM   7047  C CA  . ALA C 3 19  ? 128.042 100.309 130.427 1.00 323.82 ? 19   ALA C CA  1 
ATOM   7048  C C   . ALA C 3 19  ? 127.283 99.297  129.576 1.00 321.81 ? 19   ALA C C   1 
ATOM   7049  O O   . ALA C 3 19  ? 127.868 98.625  128.711 1.00 356.72 ? 19   ALA C O   1 
ATOM   7050  C CB  . ALA C 3 19  ? 128.295 99.755  131.823 1.00 324.99 ? 19   ALA C CB  1 
ATOM   7051  N N   . LEU C 3 20  ? 125.985 99.220  129.849 1.00 289.85 ? 20   LEU C N   1 
ATOM   7052  C CA  . LEU C 3 20  ? 125.082 98.304  129.145 1.00 291.31 ? 20   LEU C CA  1 
ATOM   7053  C C   . LEU C 3 20  ? 125.109 98.594  127.645 1.00 314.15 ? 20   LEU C C   1 
ATOM   7054  O O   . LEU C 3 20  ? 125.219 97.671  126.819 1.00 357.36 ? 20   LEU C O   1 
ATOM   7055  C CB  . LEU C 3 20  ? 123.649 98.339  129.699 1.00 283.35 ? 20   LEU C CB  1 
ATOM   7056  C CG  . LEU C 3 20  ? 123.370 97.964  131.173 1.00 298.87 ? 20   LEU C CG  1 
ATOM   7057  C CD1 . LEU C 3 20  ? 122.015 97.278  131.370 1.00 300.13 ? 20   LEU C CD1 1 
ATOM   7058  C CD2 . LEU C 3 20  ? 124.468 97.111  131.794 1.00 308.75 ? 20   LEU C CD2 1 
ATOM   7059  N N   . PHE C 3 21  ? 125.018 99.880  127.334 1.00 294.54 ? 21   PHE C N   1 
ATOM   7060  C CA  . PHE C 3 21  ? 125.011 100.362 125.954 1.00 312.34 ? 21   PHE C CA  1 
ATOM   7061  C C   . PHE C 3 21  ? 126.307 99.927  125.247 1.00 331.51 ? 21   PHE C C   1 
ATOM   7062  O O   . PHE C 3 21  ? 126.273 99.428  124.114 1.00 366.39 ? 21   PHE C O   1 
ATOM   7063  C CB  . PHE C 3 21  ? 124.839 101.877 125.887 1.00 332.34 ? 21   PHE C CB  1 
ATOM   7064  C CG  . PHE C 3 21  ? 124.612 102.387 124.501 1.00 328.38 ? 21   PHE C CG  1 
ATOM   7065  C CD1 . PHE C 3 21  ? 123.357 102.283 123.912 1.00 340.35 ? 21   PHE C CD1 1 
ATOM   7066  C CD2 . PHE C 3 21  ? 125.651 102.949 123.774 1.00 326.89 ? 21   PHE C CD2 1 
ATOM   7067  C CE1 . PHE C 3 21  ? 123.139 102.742 122.624 1.00 358.96 ? 21   PHE C CE1 1 
ATOM   7068  C CE2 . PHE C 3 21  ? 125.441 103.411 122.484 1.00 370.42 ? 21   PHE C CE2 1 
ATOM   7069  C CZ  . PHE C 3 21  ? 124.183 103.307 121.907 1.00 376.89 ? 21   PHE C CZ  1 
ATOM   7070  N N   . LEU C 3 22  ? 127.409 100.131 125.951 1.00 314.74 ? 22   LEU C N   1 
ATOM   7071  C CA  . LEU C 3 22  ? 128.724 100.000 125.287 1.00 316.04 ? 22   LEU C CA  1 
ATOM   7072  C C   . LEU C 3 22  ? 128.962 98.543  124.997 1.00 317.14 ? 22   LEU C C   1 
ATOM   7073  O O   . LEU C 3 22  ? 129.407 98.157  123.896 1.00 343.65 ? 22   LEU C O   1 
ATOM   7074  C CB  . LEU C 3 22  ? 129.873 100.595 126.107 1.00 335.93 ? 22   LEU C CB  1 
ATOM   7075  C CG  . LEU C 3 22  ? 130.270 102.027 125.734 1.00 348.33 ? 22   LEU C CG  1 
ATOM   7076  C CD1 . LEU C 3 22  ? 131.362 102.519 126.673 1.00 357.29 ? 22   LEU C CD1 1 
ATOM   7077  C CD2 . LEU C 3 22  ? 130.722 102.125 124.279 1.00 354.69 ? 22   LEU C CD2 1 
ATOM   7078  N N   . ILE C 3 23  ? 128.762 97.732  126.025 1.00 318.98 ? 23   ILE C N   1 
ATOM   7079  C CA  . ILE C 3 23  ? 129.095 96.320  125.976 1.00 333.58 ? 23   ILE C CA  1 
ATOM   7080  C C   . ILE C 3 23  ? 128.030 95.548  125.204 1.00 322.28 ? 23   ILE C C   1 
ATOM   7081  O O   . ILE C 3 23  ? 128.360 94.779  124.300 1.00 342.83 ? 23   ILE C O   1 
ATOM   7082  C CB  . ILE C 3 23  ? 129.268 95.758  127.405 1.00 341.57 ? 23   ILE C CB  1 
ATOM   7083  C CG1 . ILE C 3 23  ? 130.485 96.411  128.072 1.00 330.05 ? 23   ILE C CG1 1 
ATOM   7084  C CG2 . ILE C 3 23  ? 129.413 94.239  127.392 1.00 344.22 ? 23   ILE C CG2 1 
ATOM   7085  C CD1 . ILE C 3 23  ? 130.431 96.389  129.579 1.00 351.56 ? 23   ILE C CD1 1 
ATOM   7086  N N   . THR C 3 24  ? 126.765 95.763  125.556 1.00 295.85 ? 24   THR C N   1 
ATOM   7087  C CA  . THR C 3 24  ? 125.672 94.972  125.002 1.00 308.71 ? 24   THR C CA  1 
ATOM   7088  C C   . THR C 3 24  ? 125.127 95.545  123.695 1.00 316.66 ? 24   THR C C   1 
ATOM   7089  O O   . THR C 3 24  ? 125.217 94.896  122.650 1.00 359.30 ? 24   THR C O   1 
ATOM   7090  C CB  . THR C 3 24  ? 124.519 94.813  126.016 1.00 321.08 ? 24   THR C CB  1 
ATOM   7091  O OG1 . THR C 3 24  ? 125.057 94.629  127.332 1.00 308.10 ? 24   THR C OG1 1 
ATOM   7092  C CG2 . THR C 3 24  ? 123.643 93.625  125.652 1.00 349.04 ? 24   THR C CG2 1 
ATOM   7093  N N   . VAL C 3 25  ? 124.577 96.753  123.749 1.00 295.86 ? 25   VAL C N   1 
ATOM   7094  C CA  . VAL C 3 25  ? 123.790 97.292  122.637 1.00 323.33 ? 25   VAL C CA  1 
ATOM   7095  C C   . VAL C 3 25  ? 124.629 97.804  121.466 1.00 332.15 ? 25   VAL C C   1 
ATOM   7096  O O   . VAL C 3 25  ? 124.255 97.591  120.313 1.00 374.83 ? 25   VAL C O   1 
ATOM   7097  C CB  . VAL C 3 25  ? 122.827 98.401  123.122 1.00 354.90 ? 25   VAL C CB  1 
ATOM   7098  C CG1 . VAL C 3 25  ? 122.078 99.051  121.957 1.00 370.14 ? 25   VAL C CG1 1 
ATOM   7099  C CG2 . VAL C 3 25  ? 121.849 97.820  124.133 1.00 369.49 ? 25   VAL C CG2 1 
ATOM   7100  N N   . ALA C 3 26  ? 125.741 98.478  121.750 1.00 316.69 ? 26   ALA C N   1 
ATOM   7101  C CA  . ALA C 3 26  ? 126.476 99.222  120.716 1.00 334.61 ? 26   ALA C CA  1 
ATOM   7102  C C   . ALA C 3 26  ? 127.098 98.344  119.629 1.00 332.13 ? 26   ALA C C   1 
ATOM   7103  O O   . ALA C 3 26  ? 127.200 98.773  118.475 1.00 292.52 ? 26   ALA C O   1 
ATOM   7104  C CB  . ALA C 3 26  ? 127.543 100.106 121.349 1.00 363.33 ? 26   ALA C CB  1 
ATOM   7105  N N   . GLY C 3 27  ? 127.507 97.128  119.998 1.00 335.10 ? 27   GLY C N   1 
ATOM   7106  C CA  . GLY C 3 27  ? 128.119 96.185  119.058 1.00 362.47 ? 27   GLY C CA  1 
ATOM   7107  C C   . GLY C 3 27  ? 127.324 96.000  117.777 1.00 353.52 ? 27   GLY C C   1 
ATOM   7108  O O   . GLY C 3 27  ? 127.843 96.215  116.679 1.00 363.64 ? 27   GLY C O   1 
ATOM   7109  N N   . ASP C 3 28  ? 126.058 95.620  117.930 1.00 351.51 ? 28   ASP C N   1 
ATOM   7110  C CA  . ASP C 3 28  ? 125.154 95.411  116.801 1.00 342.96 ? 28   ASP C CA  1 
ATOM   7111  C C   . ASP C 3 28  ? 124.426 96.709  116.457 1.00 314.56 ? 28   ASP C C   1 
ATOM   7112  O O   . ASP C 3 28  ? 124.013 97.435  117.357 1.00 349.95 ? 28   ASP C O   1 
ATOM   7113  C CB  . ASP C 3 28  ? 124.119 94.337  117.137 1.00 375.82 ? 28   ASP C CB  1 
ATOM   7114  C CG  . ASP C 3 28  ? 124.750 93.002  117.507 1.00 421.27 ? 28   ASP C CG  1 
ATOM   7115  O OD1 . ASP C 3 28  ? 125.676 92.555  116.796 1.00 451.86 ? 28   ASP C OD1 1 
ATOM   7116  O OD2 . ASP C 3 28  ? 124.311 92.394  118.508 1.00 432.97 ? 28   ASP C OD2 1 
ATOM   7117  N N   . PRO C 3 29  ? 124.257 97.005  115.157 1.00 327.74 ? 29   PRO C N   1 
ATOM   7118  C CA  . PRO C 3 29  ? 123.463 98.164  114.733 1.00 332.40 ? 29   PRO C CA  1 
ATOM   7119  C C   . PRO C 3 29  ? 121.957 97.952  114.864 1.00 314.16 ? 29   PRO C C   1 
ATOM   7120  O O   . PRO C 3 29  ? 121.209 98.892  115.196 1.00 312.65 ? 29   PRO C O   1 
ATOM   7121  C CB  . PRO C 3 29  ? 123.871 98.333  113.274 1.00 348.13 ? 29   PRO C CB  1 
ATOM   7122  C CG  . PRO C 3 29  ? 124.220 96.964  112.818 1.00 356.61 ? 29   PRO C CG  1 
ATOM   7123  C CD  . PRO C 3 29  ? 124.844 96.296  114.004 1.00 351.98 ? 29   PRO C CD  1 
ATOM   7124  N N   . LEU C 3 30  ? 121.546 96.701  114.655 1.00 320.84 ? 30   LEU C N   1 
ATOM   7125  C CA  . LEU C 3 30  ? 120.156 96.286  114.822 1.00 335.21 ? 30   LEU C CA  1 
ATOM   7126  C C   . LEU C 3 30  ? 119.684 96.583  116.242 1.00 338.78 ? 30   LEU C C   1 
ATOM   7127  O O   . LEU C 3 30  ? 118.587 97.133  116.443 1.00 351.38 ? 30   LEU C O   1 
ATOM   7128  C CB  . LEU C 3 30  ? 120.015 94.795  114.496 1.00 340.68 ? 30   LEU C CB  1 
ATOM   7129  C CG  . LEU C 3 30  ? 118.626 94.156  114.527 1.00 359.32 ? 30   LEU C CG  1 
ATOM   7130  C CD1 . LEU C 3 30  ? 117.574 95.027  113.852 1.00 380.71 ? 30   LEU C CD1 1 
ATOM   7131  C CD2 . LEU C 3 30  ? 118.693 92.786  113.869 1.00 369.42 ? 30   LEU C CD2 1 
ATOM   7132  N N   . ARG C 3 31  ? 120.539 96.214  117.195 1.00 328.90 ? 31   ARG C N   1 
ATOM   7133  C CA  . ARG C 3 31  ? 120.260 96.420  118.621 1.00 323.06 ? 31   ARG C CA  1 
ATOM   7134  C C   . ARG C 3 31  ? 120.037 97.900  118.905 1.00 313.14 ? 31   ARG C C   1 
ATOM   7135  O O   . ARG C 3 31  ? 119.085 98.272  119.601 1.00 312.79 ? 31   ARG C O   1 
ATOM   7136  C CB  . ARG C 3 31  ? 121.395 95.899  119.510 1.00 313.23 ? 31   ARG C CB  1 
ATOM   7137  C CG  . ARG C 3 31  ? 121.391 94.396  119.691 1.00 326.97 ? 31   ARG C CG  1 
ATOM   7138  C CD  . ARG C 3 31  ? 122.390 93.954  120.749 1.00 317.72 ? 31   ARG C CD  1 
ATOM   7139  N NE  . ARG C 3 31  ? 122.587 92.504  120.727 1.00 333.32 ? 31   ARG C NE  1 
ATOM   7140  C CZ  . ARG C 3 31  ? 123.279 91.804  121.627 1.00 357.05 ? 31   ARG C CZ  1 
ATOM   7141  N NH1 . ARG C 3 31  ? 123.862 92.395  122.668 1.00 355.78 ? 31   ARG C NH1 1 
ATOM   7142  N NH2 . ARG C 3 31  ? 123.388 90.485  121.485 1.00 391.99 ? 31   ARG C NH2 1 
ATOM   7143  N N   . VAL C 3 32  ? 120.927 98.707  118.353 1.00 290.48 ? 32   VAL C N   1 
ATOM   7144  C CA  . VAL C 3 32  ? 120.892 100.165 118.500 1.00 299.59 ? 32   VAL C CA  1 
ATOM   7145  C C   . VAL C 3 32  ? 119.556 100.709 117.994 1.00 305.86 ? 32   VAL C C   1 
ATOM   7146  O O   . VAL C 3 32  ? 118.904 101.532 118.662 1.00 328.87 ? 32   VAL C O   1 
ATOM   7147  C CB  . VAL C 3 32  ? 122.062 100.823 117.727 1.00 288.55 ? 32   VAL C CB  1 
ATOM   7148  C CG1 . VAL C 3 32  ? 121.847 102.322 117.523 1.00 299.54 ? 32   VAL C CG1 1 
ATOM   7149  C CG2 . VAL C 3 32  ? 123.375 100.564 118.457 1.00 316.45 ? 32   VAL C CG2 1 
ATOM   7150  N N   . ILE C 3 33  ? 119.189 100.225 116.812 1.00 293.71 ? 33   ILE C N   1 
ATOM   7151  C CA  . ILE C 3 33  ? 117.944 100.621 116.147 1.00 306.70 ? 33   ILE C CA  1 
ATOM   7152  C C   . ILE C 3 33  ? 116.749 100.314 117.048 1.00 300.02 ? 33   ILE C C   1 
ATOM   7153  O O   . ILE C 3 33  ? 115.850 101.159 117.237 1.00 315.39 ? 33   ILE C O   1 
ATOM   7154  C CB  . ILE C 3 33  ? 117.754 99.923  114.774 1.00 332.28 ? 33   ILE C CB  1 
ATOM   7155  C CG1 . ILE C 3 33  ? 118.708 100.530 113.742 1.00 366.58 ? 33   ILE C CG1 1 
ATOM   7156  C CG2 . ILE C 3 33  ? 116.318 100.059 114.262 1.00 341.42 ? 33   ILE C CG2 1 
ATOM   7157  C CD1 . ILE C 3 33  ? 118.888 99.687  112.496 1.00 382.22 ? 33   ILE C CD1 1 
ATOM   7158  N N   . ILE C 3 34  ? 116.693 99.102  117.583 1.00 302.30 ? 34   ILE C N   1 
ATOM   7159  C CA  . ILE C 3 34  ? 115.571 98.745  118.440 1.00 298.22 ? 34   ILE C CA  1 
ATOM   7160  C C   . ILE C 3 34  ? 115.556 99.604  119.690 1.00 292.59 ? 34   ILE C C   1 
ATOM   7161  O O   . ILE C 3 34  ? 114.500 100.037 120.131 1.00 285.82 ? 34   ILE C O   1 
ATOM   7162  C CB  . ILE C 3 34  ? 115.523 97.243  118.785 1.00 305.39 ? 34   ILE C CB  1 
ATOM   7163  C CG1 . ILE C 3 34  ? 116.441 96.906  119.954 1.00 333.58 ? 34   ILE C CG1 1 
ATOM   7164  C CG2 . ILE C 3 34  ? 115.896 96.408  117.574 1.00 304.43 ? 34   ILE C CG2 1 
ATOM   7165  C CD1 . ILE C 3 34  ? 116.153 95.558  120.570 1.00 355.25 ? 34   ILE C CD1 1 
ATOM   7166  N N   . LEU C 3 35  ? 116.732 99.852  120.256 1.00 300.59 ? 35   LEU C N   1 
ATOM   7167  C CA  . LEU C 3 35  ? 116.824 100.724 121.432 1.00 305.81 ? 35   LEU C CA  1 
ATOM   7168  C C   . LEU C 3 35  ? 116.174 102.073 121.133 1.00 288.93 ? 35   LEU C C   1 
ATOM   7169  O O   . LEU C 3 35  ? 115.380 102.589 121.937 1.00 328.87 ? 35   LEU C O   1 
ATOM   7170  C CB  . LEU C 3 35  ? 118.292 100.903 121.845 1.00 297.63 ? 35   LEU C CB  1 
ATOM   7171  C CG  . LEU C 3 35  ? 118.633 101.948 122.914 1.00 312.95 ? 35   LEU C CG  1 
ATOM   7172  C CD1 . LEU C 3 35  ? 119.630 101.409 123.938 1.00 309.98 ? 35   LEU C CD1 1 
ATOM   7173  C CD2 . LEU C 3 35  ? 119.149 103.226 122.266 1.00 322.26 ? 35   LEU C CD2 1 
ATOM   7174  N N   . VAL C 3 36  ? 116.535 102.606 119.972 1.00 280.12 ? 36   VAL C N   1 
ATOM   7175  C CA  . VAL C 3 36  ? 116.033 103.899 119.510 1.00 278.60 ? 36   VAL C CA  1 
ATOM   7176  C C   . VAL C 3 36  ? 114.491 103.859 119.419 1.00 281.58 ? 36   VAL C C   1 
ATOM   7177  O O   . VAL C 3 36  ? 113.799 104.784 119.890 1.00 293.61 ? 36   VAL C O   1 
ATOM   7178  C CB  . VAL C 3 36  ? 116.792 104.381 118.250 1.00 298.67 ? 36   VAL C CB  1 
ATOM   7179  C CG1 . VAL C 3 36  ? 116.125 105.566 117.595 1.00 299.56 ? 36   VAL C CG1 1 
ATOM   7180  C CG2 . VAL C 3 36  ? 118.215 104.764 118.624 1.00 315.00 ? 36   VAL C CG2 1 
ATOM   7181  N N   . ALA C 3 37  ? 114.012 102.776 118.824 1.00 285.19 ? 37   ALA C N   1 
ATOM   7182  C CA  . ALA C 3 37  ? 112.581 102.556 118.641 1.00 321.79 ? 37   ALA C CA  1 
ATOM   7183  C C   . ALA C 3 37  ? 111.865 102.543 119.992 1.00 323.72 ? 37   ALA C C   1 
ATOM   7184  O O   . ALA C 3 37  ? 110.815 103.175 120.164 1.00 337.99 ? 37   ALA C O   1 
ATOM   7185  C CB  . ALA C 3 37  ? 112.312 101.310 117.821 1.00 355.67 ? 37   ALA C CB  1 
ATOM   7186  N N   . GLY C 3 38  ? 112.469 101.824 120.924 1.00 304.75 ? 38   GLY C N   1 
ATOM   7187  C CA  . GLY C 3 38  ? 111.955 101.694 122.293 1.00 318.85 ? 38   GLY C CA  1 
ATOM   7188  C C   . GLY C 3 38  ? 111.831 103.061 122.939 1.00 314.36 ? 38   GLY C C   1 
ATOM   7189  O O   . GLY C 3 38  ? 110.808 103.384 123.557 1.00 339.45 ? 38   GLY C O   1 
ATOM   7190  N N   . ALA C 3 39  ? 112.893 103.842 122.778 1.00 314.19 ? 39   ALA C N   1 
ATOM   7191  C CA  . ALA C 3 39  ? 112.974 105.206 123.323 1.00 303.00 ? 39   ALA C CA  1 
ATOM   7192  C C   . ALA C 3 39  ? 111.826 106.049 122.781 1.00 279.58 ? 39   ALA C C   1 
ATOM   7193  O O   . ALA C 3 39  ? 111.144 106.761 123.539 1.00 330.13 ? 39   ALA C O   1 
ATOM   7194  C CB  . ALA C 3 39  ? 114.299 105.872 122.990 1.00 308.23 ? 39   ALA C CB  1 
ATOM   7195  N N   . PHE C 3 40  ? 111.644 105.944 121.469 1.00 275.31 ? 40   PHE C N   1 
ATOM   7196  C CA  . PHE C 3 40  ? 110.588 106.675 120.758 1.00 298.19 ? 40   PHE C CA  1 
ATOM   7197  C C   . PHE C 3 40  ? 109.221 106.326 121.335 1.00 293.08 ? 40   PHE C C   1 
ATOM   7198  O O   . PHE C 3 40  ? 108.395 107.210 121.598 1.00 311.64 ? 40   PHE C O   1 
ATOM   7199  C CB  . PHE C 3 40  ? 110.563 106.346 119.292 1.00 315.07 ? 40   PHE C CB  1 
ATOM   7200  C CG  . PHE C 3 40  ? 109.447 107.010 118.534 1.00 318.73 ? 40   PHE C CG  1 
ATOM   7201  C CD1 . PHE C 3 40  ? 109.594 108.309 118.058 1.00 330.20 ? 40   PHE C CD1 1 
ATOM   7202  C CD2 . PHE C 3 40  ? 108.259 106.330 118.276 1.00 309.78 ? 40   PHE C CD2 1 
ATOM   7203  C CE1 . PHE C 3 40  ? 108.573 108.920 117.349 1.00 343.18 ? 40   PHE C CE1 1 
ATOM   7204  C CE2 . PHE C 3 40  ? 107.234 106.938 117.569 1.00 328.02 ? 40   PHE C CE2 1 
ATOM   7205  C CZ  . PHE C 3 40  ? 107.390 108.236 117.105 1.00 344.82 ? 40   PHE C CZ  1 
ATOM   7206  N N   . PHE C 3 41  ? 109.021 105.029 121.515 1.00 285.44 ? 41   PHE C N   1 
ATOM   7207  C CA  . PHE C 3 41  ? 107.774 104.480 122.058 1.00 307.21 ? 41   PHE C CA  1 
ATOM   7208  C C   . PHE C 3 41  ? 107.498 105.077 123.439 1.00 312.97 ? 41   PHE C C   1 
ATOM   7209  O O   . PHE C 3 41  ? 106.372 105.513 123.733 1.00 326.23 ? 41   PHE C O   1 
ATOM   7210  C CB  . PHE C 3 41  ? 107.796 102.944 122.125 1.00 320.23 ? 41   PHE C CB  1 
ATOM   7211  C CG  . PHE C 3 41  ? 107.167 102.279 120.933 1.00 350.18 ? 41   PHE C CG  1 
ATOM   7212  C CD1 . PHE C 3 41  ? 107.549 102.631 119.639 1.00 352.99 ? 41   PHE C CD1 1 
ATOM   7213  C CD2 . PHE C 3 41  ? 106.175 101.313 121.098 1.00 364.37 ? 41   PHE C CD2 1 
ATOM   7214  C CE1 . PHE C 3 41  ? 106.963 102.025 118.538 1.00 356.62 ? 41   PHE C CE1 1 
ATOM   7215  C CE2 . PHE C 3 41  ? 105.587 100.702 120.000 1.00 360.36 ? 41   PHE C CE2 1 
ATOM   7216  C CZ  . PHE C 3 41  ? 105.981 101.060 118.719 1.00 373.88 ? 41   PHE C CZ  1 
ATOM   7217  N N   . TRP C 3 42  ? 108.549 105.079 124.250 1.00 309.00 ? 42   TRP C N   1 
ATOM   7218  C CA  . TRP C 3 42  ? 108.490 105.604 125.615 1.00 312.11 ? 42   TRP C CA  1 
ATOM   7219  C C   . TRP C 3 42  ? 108.063 107.069 125.597 1.00 297.77 ? 42   TRP C C   1 
ATOM   7220  O O   . TRP C 3 42  ? 107.191 107.489 126.374 1.00 311.26 ? 42   TRP C O   1 
ATOM   7221  C CB  . TRP C 3 42  ? 109.795 105.420 126.376 1.00 320.02 ? 42   TRP C CB  1 
ATOM   7222  C CG  . TRP C 3 42  ? 109.705 105.947 127.776 1.00 308.98 ? 42   TRP C CG  1 
ATOM   7223  C CD1 . TRP C 3 42  ? 109.310 105.263 128.884 1.00 308.69 ? 42   TRP C CD1 1 
ATOM   7224  C CD2 . TRP C 3 42  ? 109.987 107.279 128.207 1.00 281.83 ? 42   TRP C CD2 1 
ATOM   7225  N NE1 . TRP C 3 42  ? 109.345 106.079 129.981 1.00 281.95 ? 42   TRP C NE1 1 
ATOM   7226  C CE2 . TRP C 3 42  ? 109.758 107.323 129.594 1.00 284.01 ? 42   TRP C CE2 1 
ATOM   7227  C CE3 . TRP C 3 42  ? 110.426 108.439 127.554 1.00 307.91 ? 42   TRP C CE3 1 
ATOM   7228  C CZ2 . TRP C 3 42  ? 109.940 108.481 130.348 1.00 317.35 ? 42   TRP C CZ2 1 
ATOM   7229  C CZ3 . TRP C 3 42  ? 110.619 109.594 128.309 1.00 339.78 ? 42   TRP C CZ3 1 
ATOM   7230  C CH2 . TRP C 3 42  ? 110.376 109.603 129.693 1.00 336.73 ? 42   TRP C CH2 1 
ATOM   7231  N N   . LEU C 3 43  ? 108.694 107.812 124.699 1.00 272.11 ? 43   LEU C N   1 
ATOM   7232  C CA  . LEU C 3 43  ? 108.423 109.243 124.519 1.00 302.93 ? 43   LEU C CA  1 
ATOM   7233  C C   . LEU C 3 43  ? 106.953 109.461 124.181 1.00 309.03 ? 43   LEU C C   1 
ATOM   7234  O O   . LEU C 3 43  ? 106.296 110.335 124.750 1.00 334.30 ? 43   LEU C O   1 
ATOM   7235  C CB  . LEU C 3 43  ? 109.319 109.897 123.460 1.00 313.25 ? 43   LEU C CB  1 
ATOM   7236  C CG  . LEU C 3 43  ? 110.767 110.218 123.841 1.00 331.19 ? 43   LEU C CG  1 
ATOM   7237  C CD1 . LEU C 3 43  ? 111.514 110.739 122.627 1.00 344.84 ? 43   LEU C CD1 1 
ATOM   7238  C CD2 . LEU C 3 43  ? 110.846 111.245 124.958 1.00 333.59 ? 43   LEU C CD2 1 
ATOM   7239  N N   . VAL C 3 44  ? 106.478 108.646 123.252 1.00 312.83 ? 44   VAL C N   1 
ATOM   7240  C CA  . VAL C 3 44  ? 105.087 108.693 122.785 1.00 324.82 ? 44   VAL C CA  1 
ATOM   7241  C C   . VAL C 3 44  ? 104.135 108.476 123.963 1.00 313.71 ? 44   VAL C C   1 
ATOM   7242  O O   . VAL C 3 44  ? 103.151 109.212 124.128 1.00 337.23 ? 44   VAL C O   1 
ATOM   7243  C CB  . VAL C 3 44  ? 104.755 107.707 121.643 1.00 330.37 ? 44   VAL C CB  1 
ATOM   7244  C CG1 . VAL C 3 44  ? 103.299 107.876 121.212 1.00 331.64 ? 44   VAL C CG1 1 
ATOM   7245  C CG2 . VAL C 3 44  ? 105.673 107.926 120.443 1.00 352.08 ? 44   VAL C CG2 1 
ATOM   7246  N N   . SER C 3 45  ? 104.466 107.464 124.754 1.00 292.64 ? 45   SER C N   1 
ATOM   7247  C CA  . SER C 3 45  ? 103.685 107.094 125.936 1.00 320.25 ? 45   SER C CA  1 
ATOM   7248  C C   . SER C 3 45  ? 103.589 108.286 126.899 1.00 320.50 ? 45   SER C C   1 
ATOM   7249  O O   . SER C 3 45  ? 102.516 108.617 127.412 1.00 341.55 ? 45   SER C O   1 
ATOM   7250  C CB  . SER C 3 45  ? 104.269 105.867 126.653 1.00 334.40 ? 45   SER C CB  1 
ATOM   7251  O OG  . SER C 3 45  ? 105.321 106.211 127.540 1.00 351.07 ? 45   SER C OG  1 
ATOM   7252  N N   . LEU C 3 46  ? 104.750 108.889 127.116 1.00 313.57 ? 46   LEU C N   1 
ATOM   7253  C CA  . LEU C 3 46  ? 104.890 110.052 128.003 1.00 307.01 ? 46   LEU C CA  1 
ATOM   7254  C C   . LEU C 3 46  ? 103.993 111.177 127.536 1.00 293.70 ? 46   LEU C C   1 
ATOM   7255  O O   . LEU C 3 46  ? 103.299 111.809 128.323 1.00 335.32 ? 46   LEU C O   1 
ATOM   7256  C CB  . LEU C 3 46  ? 106.340 110.562 128.059 1.00 320.82 ? 46   LEU C CB  1 
ATOM   7257  C CG  . LEU C 3 46  ? 106.849 111.210 129.359 1.00 319.54 ? 46   LEU C CG  1 
ATOM   7258  C CD1 . LEU C 3 46  ? 108.163 111.931 129.099 1.00 326.27 ? 46   LEU C CD1 1 
ATOM   7259  C CD2 . LEU C 3 46  ? 105.861 112.171 130.001 1.00 326.46 ? 46   LEU C CD2 1 
ATOM   7260  N N   . LEU C 3 47  ? 104.026 111.420 126.228 1.00 292.01 ? 47   LEU C N   1 
ATOM   7261  C CA  . LEU C 3 47  ? 103.257 112.462 125.559 1.00 315.33 ? 47   LEU C CA  1 
ATOM   7262  C C   . LEU C 3 47  ? 101.786 112.236 125.822 1.00 310.74 ? 47   LEU C C   1 
ATOM   7263  O O   . LEU C 3 47  ? 101.099 113.185 126.115 1.00 327.33 ? 47   LEU C O   1 
ATOM   7264  C CB  . LEU C 3 47  ? 103.508 112.364 124.040 1.00 320.74 ? 47   LEU C CB  1 
ATOM   7265  C CG  . LEU C 3 47  ? 103.318 113.563 123.124 1.00 325.22 ? 47   LEU C CG  1 
ATOM   7266  C CD1 . LEU C 3 47  ? 101.855 113.988 123.047 1.00 327.95 ? 47   LEU C CD1 1 
ATOM   7267  C CD2 . LEU C 3 47  ? 104.247 114.688 123.566 1.00 343.82 ? 47   LEU C CD2 1 
ATOM   7268  N N   . LEU C 3 48  ? 101.319 110.999 125.714 1.00 303.76 ? 48   LEU C N   1 
ATOM   7269  C CA  . LEU C 3 48  ? 99.905  110.730 125.958 1.00 317.37 ? 48   LEU C CA  1 
ATOM   7270  C C   . LEU C 3 48  ? 99.564  110.999 127.411 1.00 325.88 ? 48   LEU C C   1 
ATOM   7271  O O   . LEU C 3 48  ? 98.552  111.674 127.746 1.00 352.80 ? 48   LEU C O   1 
ATOM   7272  C CB  . LEU C 3 48  ? 99.520  109.302 125.573 1.00 320.34 ? 48   LEU C CB  1 
ATOM   7273  C CG  . LEU C 3 48  ? 99.707  108.897 124.106 1.00 358.04 ? 48   LEU C CG  1 
ATOM   7274  C CD1 . LEU C 3 48  ? 98.888  107.647 123.813 1.00 393.07 ? 48   LEU C CD1 1 
ATOM   7275  C CD2 . LEU C 3 48  ? 99.345  110.010 123.127 1.00 356.88 ? 48   LEU C CD2 1 
ATOM   7276  N N   . ALA C 3 49  ? 100.424 110.452 128.282 1.00 312.38 ? 49   ALA C N   1 
ATOM   7277  C CA  . ALA C 3 49  ? 100.270 110.629 129.741 1.00 322.46 ? 49   ALA C CA  1 
ATOM   7278  C C   . ALA C 3 49  ? 100.312 112.111 130.083 1.00 315.48 ? 49   ALA C C   1 
ATOM   7279  O O   . ALA C 3 49  ? 99.485  112.587 130.879 1.00 350.58 ? 49   ALA C O   1 
ATOM   7280  C CB  . ALA C 3 49  ? 101.368 109.894 130.489 1.00 352.98 ? 49   ALA C CB  1 
ATOM   7281  N N   . SER C 3 50  ? 101.271 112.810 129.466 1.00 312.96 ? 50   SER C N   1 
ATOM   7282  C CA  . SER C 3 50  ? 101.446 114.246 129.689 1.00 330.95 ? 50   SER C CA  1 
ATOM   7283  C C   . SER C 3 50  ? 100.182 114.996 129.306 1.00 322.58 ? 50   SER C C   1 
ATOM   7284  O O   . SER C 3 50  ? 99.726  115.873 130.047 1.00 311.83 ? 50   SER C O   1 
ATOM   7285  C CB  . SER C 3 50  ? 102.660 114.801 128.945 1.00 334.78 ? 50   SER C CB  1 
ATOM   7286  O OG  . SER C 3 50  ? 102.409 114.981 127.564 1.00 339.46 ? 50   SER C OG  1 
ATOM   7287  N N   . VAL C 3 51  ? 99.639  114.633 128.161 1.00 330.59 ? 51   VAL C N   1 
ATOM   7288  C CA  . VAL C 3 51  ? 98.410  115.226 127.619 1.00 336.62 ? 51   VAL C CA  1 
ATOM   7289  C C   . VAL C 3 51  ? 97.271  115.058 128.616 1.00 316.07 ? 51   VAL C C   1 
ATOM   7290  O O   . VAL C 3 51  ? 96.530  116.013 128.907 1.00 321.62 ? 51   VAL C O   1 
ATOM   7291  C CB  . VAL C 3 51  ? 98.044  114.609 126.240 1.00 337.77 ? 51   VAL C CB  1 
ATOM   7292  C CG1 . VAL C 3 51  ? 96.551  114.707 125.926 1.00 342.88 ? 51   VAL C CG1 1 
ATOM   7293  C CG2 . VAL C 3 51  ? 98.871  115.266 125.142 1.00 344.47 ? 51   VAL C CG2 1 
ATOM   7294  N N   . VAL C 3 52  ? 97.162  113.832 129.116 1.00 304.76 ? 52   VAL C N   1 
ATOM   7295  C CA  . VAL C 3 52  ? 96.129  113.460 130.090 1.00 321.49 ? 52   VAL C CA  1 
ATOM   7296  C C   . VAL C 3 52  ? 96.236  114.352 131.333 1.00 307.57 ? 52   VAL C C   1 
ATOM   7297  O O   . VAL C 3 52  ? 95.228  114.890 131.828 1.00 312.72 ? 52   VAL C O   1 
ATOM   7298  C CB  . VAL C 3 52  ? 96.233  111.962 130.494 1.00 322.13 ? 52   VAL C CB  1 
ATOM   7299  C CG1 . VAL C 3 52  ? 95.465  111.654 131.780 1.00 319.51 ? 52   VAL C CG1 1 
ATOM   7300  C CG2 . VAL C 3 52  ? 95.744  111.075 129.356 1.00 345.84 ? 52   VAL C CG2 1 
ATOM   7301  N N   . TRP C 3 53  ? 97.473  114.480 131.798 1.00 328.47 ? 53   TRP C N   1 
ATOM   7302  C CA  . TRP C 3 53  ? 97.793  115.285 132.979 1.00 343.58 ? 53   TRP C CA  1 
ATOM   7303  C C   . TRP C 3 53  ? 97.345  116.728 132.774 1.00 328.61 ? 53   TRP C C   1 
ATOM   7304  O O   . TRP C 3 53  ? 96.721  117.334 133.653 1.00 316.18 ? 53   TRP C O   1 
ATOM   7305  C CB  . TRP C 3 53  ? 99.282  115.231 133.327 1.00 351.70 ? 53   TRP C CB  1 
ATOM   7306  C CG  . TRP C 3 53  ? 99.643  116.064 134.519 1.00 332.98 ? 53   TRP C CG  1 
ATOM   7307  C CD1 . TRP C 3 53  ? 99.591  115.691 135.834 1.00 348.15 ? 53   TRP C CD1 1 
ATOM   7308  C CD2 . TRP C 3 53  ? 100.106 117.413 134.502 1.00 306.47 ? 53   TRP C CD2 1 
ATOM   7309  N NE1 . TRP C 3 53  ? 100.000 116.727 136.637 1.00 335.09 ? 53   TRP C NE1 1 
ATOM   7310  C CE2 . TRP C 3 53  ? 100.323 117.797 135.845 1.00 342.30 ? 53   TRP C CE2 1 
ATOM   7311  C CE3 . TRP C 3 53  ? 100.354 118.339 133.484 1.00 307.31 ? 53   TRP C CE3 1 
ATOM   7312  C CZ2 . TRP C 3 53  ? 100.788 119.069 136.195 1.00 349.20 ? 53   TRP C CZ2 1 
ATOM   7313  C CZ3 . TRP C 3 53  ? 100.821 119.604 133.831 1.00 340.21 ? 53   TRP C CZ3 1 
ATOM   7314  C CH2 . TRP C 3 53  ? 101.029 119.958 135.178 1.00 345.50 ? 53   TRP C CH2 1 
ATOM   7315  N N   . PHE C 3 54  ? 97.681  117.240 131.601 1.00 333.38 ? 54   PHE C N   1 
ATOM   7316  C CA  . PHE C 3 54  ? 97.347  118.611 131.194 1.00 335.84 ? 54   PHE C CA  1 
ATOM   7317  C C   . PHE C 3 54  ? 95.840  118.819 131.252 1.00 337.09 ? 54   PHE C C   1 
ATOM   7318  O O   . PHE C 3 54  ? 95.353  119.822 131.793 1.00 316.73 ? 54   PHE C O   1 
ATOM   7319  C CB  . PHE C 3 54  ? 97.864  118.837 129.764 1.00 328.29 ? 54   PHE C CB  1 
ATOM   7320  C CG  . PHE C 3 54  ? 97.781  120.255 129.283 1.00 348.01 ? 54   PHE C CG  1 
ATOM   7321  C CD1 . PHE C 3 54  ? 96.632  120.726 128.654 1.00 359.69 ? 54   PHE C CD1 1 
ATOM   7322  C CD2 . PHE C 3 54  ? 98.873  121.110 129.409 1.00 370.29 ? 54   PHE C CD2 1 
ATOM   7323  C CE1 . PHE C 3 54  ? 96.560  122.032 128.191 1.00 372.19 ? 54   PHE C CE1 1 
ATOM   7324  C CE2 . PHE C 3 54  ? 98.808  122.417 128.946 1.00 386.59 ? 54   PHE C CE2 1 
ATOM   7325  C CZ  . PHE C 3 54  ? 97.650  122.880 128.336 1.00 378.03 ? 54   PHE C CZ  1 
ATOM   7326  N N   . ILE C 3 55  ? 95.136  117.847 130.682 1.00 345.38 ? 55   ILE C N   1 
ATOM   7327  C CA  . ILE C 3 55  ? 93.670  117.858 130.624 1.00 349.68 ? 55   ILE C CA  1 
ATOM   7328  C C   . ILE C 3 55  ? 93.093  117.932 132.037 1.00 331.47 ? 55   ILE C C   1 
ATOM   7329  O O   . ILE C 3 55  ? 92.182  118.732 132.313 1.00 341.60 ? 55   ILE C O   1 
ATOM   7330  C CB  . ILE C 3 55  ? 93.098  116.656 129.826 1.00 374.14 ? 55   ILE C CB  1 
ATOM   7331  C CG1 . ILE C 3 55  ? 93.381  116.844 128.330 1.00 389.41 ? 55   ILE C CG1 1 
ATOM   7332  C CG2 . ILE C 3 55  ? 91.593  116.496 130.045 1.00 379.09 ? 55   ILE C CG2 1 
ATOM   7333  C CD1 . ILE C 3 55  ? 93.298  115.568 127.518 1.00 412.45 ? 55   ILE C CD1 1 
ATOM   7334  N N   . LEU C 3 56  ? 93.649  117.088 132.897 1.00 337.22 ? 56   LEU C N   1 
ATOM   7335  C CA  . LEU C 3 56  ? 93.236  117.002 134.300 1.00 338.57 ? 56   LEU C CA  1 
ATOM   7336  C C   . LEU C 3 56  ? 93.400  118.358 134.982 1.00 328.43 ? 56   LEU C C   1 
ATOM   7337  O O   . LEU C 3 56  ? 92.499  118.830 135.691 1.00 359.08 ? 56   LEU C O   1 
ATOM   7338  C CB  . LEU C 3 56  ? 94.002  115.910 135.071 1.00 354.33 ? 56   LEU C CB  1 
ATOM   7339  C CG  . LEU C 3 56  ? 93.249  114.599 135.337 1.00 365.14 ? 56   LEU C CG  1 
ATOM   7340  C CD1 . LEU C 3 56  ? 92.214  114.772 136.447 1.00 354.42 ? 56   LEU C CD1 1 
ATOM   7341  C CD2 . LEU C 3 56  ? 92.610  114.045 134.066 1.00 379.58 ? 56   LEU C CD2 1 
ATOM   7342  N N   . VAL C 3 57  ? 94.559  118.954 134.739 1.00 332.70 ? 57   VAL C N   1 
ATOM   7343  C CA  . VAL C 3 57  ? 94.920  120.255 135.305 1.00 342.90 ? 57   VAL C CA  1 
ATOM   7344  C C   . VAL C 3 57  ? 93.905  121.304 134.881 1.00 355.26 ? 57   VAL C C   1 
ATOM   7345  O O   . VAL C 3 57  ? 93.425  122.095 135.728 1.00 366.75 ? 57   VAL C O   1 
ATOM   7346  C CB  . VAL C 3 57  ? 96.368  120.697 134.952 1.00 365.17 ? 57   VAL C CB  1 
ATOM   7347  C CG1 . VAL C 3 57  ? 96.627  122.143 135.380 1.00 363.38 ? 57   VAL C CG1 1 
ATOM   7348  C CG2 . VAL C 3 57  ? 97.397  119.764 135.592 1.00 356.03 ? 57   VAL C CG2 1 
ATOM   7349  N N   . HIS C 3 58  ? 93.575  121.280 133.587 1.00 371.12 ? 58   HIS C N   1 
ATOM   7350  C CA  . HIS C 3 58  ? 92.837  122.411 132.973 1.00 382.76 ? 58   HIS C CA  1 
ATOM   7351  C C   . HIS C 3 58  ? 91.361  122.262 133.173 1.00 386.84 ? 58   HIS C C   1 
ATOM   7352  O O   . HIS C 3 58  ? 90.700  123.259 133.481 1.00 392.78 ? 58   HIS C O   1 
ATOM   7353  C CB  . HIS C 3 58  ? 93.209  122.580 131.498 1.00 390.44 ? 58   HIS C CB  1 
ATOM   7354  C CG  . HIS C 3 58  ? 94.523  123.270 131.294 1.00 403.46 ? 58   HIS C CG  1 
ATOM   7355  N ND1 . HIS C 3 58  ? 94.663  124.390 130.503 1.00 411.98 ? 58   HIS C ND1 1 
ATOM   7356  C CD2 . HIS C 3 58  ? 95.751  123.017 131.808 1.00 393.01 ? 58   HIS C CD2 1 
ATOM   7357  C CE1 . HIS C 3 58  ? 95.923  124.785 130.523 1.00 419.44 ? 58   HIS C CE1 1 
ATOM   7358  N NE2 . HIS C 3 58  ? 96.604  123.970 131.308 1.00 410.58 ? 58   HIS C NE2 1 
ATOM   7359  N N   . VAL C 3 59  ? 90.864  121.029 133.048 1.00 394.80 ? 59   VAL C N   1 
ATOM   7360  C CA  . VAL C 3 59  ? 89.444  120.725 133.285 1.00 392.47 ? 59   VAL C CA  1 
ATOM   7361  C C   . VAL C 3 59  ? 89.058  121.123 134.704 1.00 378.74 ? 59   VAL C C   1 
ATOM   7362  O O   . VAL C 3 59  ? 88.012  121.762 134.917 1.00 400.97 ? 59   VAL C O   1 
ATOM   7363  C CB  . VAL C 3 59  ? 89.096  119.240 132.997 1.00 420.02 ? 59   VAL C CB  1 
ATOM   7364  C CG1 . VAL C 3 59  ? 87.713  118.867 133.530 1.00 445.62 ? 59   VAL C CG1 1 
ATOM   7365  C CG2 . VAL C 3 59  ? 89.161  118.963 131.498 1.00 425.73 ? 59   VAL C CG2 1 
ATOM   7366  N N   . THR C 3 60  ? 89.821  120.623 135.671 1.00 364.84 ? 60   THR C N   1 
ATOM   7367  C CA  . THR C 3 60  ? 89.717  121.002 137.085 1.00 394.27 ? 60   THR C CA  1 
ATOM   7368  C C   . THR C 3 60  ? 90.167  122.430 137.428 1.00 418.78 ? 60   THR C C   1 
ATOM   7369  O O   . THR C 3 60  ? 89.575  123.089 138.279 1.00 431.02 ? 60   THR C O   1 
ATOM   7370  C CB  . THR C 3 60  ? 90.393  119.970 138.004 1.00 402.96 ? 60   THR C CB  1 
ATOM   7371  O OG1 . THR C 3 60  ? 89.691  118.727 137.903 1.00 411.58 ? 60   THR C OG1 1 
ATOM   7372  C CG2 . THR C 3 60  ? 90.363  120.429 139.453 1.00 403.48 ? 60   THR C CG2 1 
ATOM   7373  N N   . ASP C 3 61  ? 91.261  122.879 136.818 1.00 442.14 ? 61   ASP C N   1 
ATOM   7374  C CA  . ASP C 3 61  ? 91.736  124.264 136.972 1.00 466.61 ? 61   ASP C CA  1 
ATOM   7375  C C   . ASP C 3 61  ? 92.654  124.670 138.155 1.00 463.81 ? 61   ASP C C   1 
ATOM   7376  O O   . ASP C 3 61  ? 92.977  125.851 138.280 1.00 450.46 ? 61   ASP C O   1 
ATOM   7377  C CB  . ASP C 3 61  ? 90.542  125.225 136.916 1.00 490.58 ? 61   ASP C CB  1 
ATOM   7378  C CG  . ASP C 3 61  ? 90.961  126.661 136.669 1.00 500.00 ? 61   ASP C CG  1 
ATOM   7379  O OD1 . ASP C 3 61  ? 91.199  127.018 135.496 1.00 500.00 ? 61   ASP C OD1 1 
ATOM   7380  O OD2 . ASP C 3 61  ? 91.053  127.432 137.647 1.00 500.00 ? 61   ASP C OD2 1 
ATOM   7381  N N   . ARG C 3 62  ? 93.088  123.738 139.004 1.00 471.46 ? 62   ARG C N   1 
ATOM   7382  C CA  . ARG C 3 62  ? 94.078  124.081 140.033 1.00 479.91 ? 62   ARG C CA  1 
ATOM   7383  C C   . ARG C 3 62  ? 93.612  124.770 141.321 1.00 472.71 ? 62   ARG C C   1 
ATOM   7384  O O   . ARG C 3 62  ? 94.378  125.522 141.925 1.00 476.39 ? 62   ARG C O   1 
ATOM   7385  C CB  . ARG C 3 62  ? 95.176  124.948 139.401 1.00 500.00 ? 62   ARG C CB  1 
ATOM   7386  C CG  . ARG C 3 62  ? 96.507  124.244 139.188 1.00 500.00 ? 62   ARG C CG  1 
ATOM   7387  C CD  . ARG C 3 62  ? 97.638  125.243 138.985 1.00 500.00 ? 62   ARG C CD  1 
ATOM   7388  N NE  . ARG C 3 62  ? 98.272  125.622 140.247 1.00 500.00 ? 62   ARG C NE  1 
ATOM   7389  C CZ  . ARG C 3 62  ? 98.864  126.790 140.474 1.00 500.00 ? 62   ARG C CZ  1 
ATOM   7390  N NH1 . ARG C 3 62  ? 98.912  127.712 139.523 1.00 500.00 ? 62   ARG C NH1 1 
ATOM   7391  N NH2 . ARG C 3 62  ? 99.408  127.041 141.657 1.00 500.00 ? 62   ARG C NH2 1 
ATOM   7392  N N   . SER C 3 63  ? 92.376  124.537 141.740 1.00 459.31 ? 63   SER C N   1 
ATOM   7393  C CA  . SER C 3 63  ? 91.882  125.182 142.954 1.00 459.22 ? 63   SER C CA  1 
ATOM   7394  C C   . SER C 3 63  ? 92.566  124.807 144.285 1.00 448.19 ? 63   SER C C   1 
ATOM   7395  O O   . SER C 3 63  ? 92.886  125.680 145.090 1.00 443.95 ? 63   SER C O   1 
ATOM   7396  C CB  . SER C 3 63  ? 90.372  124.975 143.076 1.00 460.09 ? 63   SER C CB  1 
ATOM   7397  O OG  . SER C 3 63  ? 89.668  125.913 142.279 1.00 458.03 ? 63   SER C OG  1 
ATOM   7398  N N   . ASP C 3 64  ? 92.810  123.522 144.502 1.00 436.66 ? 64   ASP C N   1 
ATOM   7399  C CA  . ASP C 3 64  ? 93.265  123.011 145.801 1.00 439.44 ? 64   ASP C CA  1 
ATOM   7400  C C   . ASP C 3 64  ? 94.631  122.339 145.674 1.00 417.02 ? 64   ASP C C   1 
ATOM   7401  O O   . ASP C 3 64  ? 94.928  121.717 144.651 1.00 405.16 ? 64   ASP C O   1 
ATOM   7402  C CB  . ASP C 3 64  ? 92.247  122.019 146.370 1.00 451.32 ? 64   ASP C CB  1 
ATOM   7403  C CG  . ASP C 3 64  ? 90.910  122.668 146.694 1.00 463.70 ? 64   ASP C CG  1 
ATOM   7404  O OD1 . ASP C 3 64  ? 90.402  123.451 145.863 1.00 461.79 ? 64   ASP C OD1 1 
ATOM   7405  O OD2 . ASP C 3 64  ? 90.359  122.386 147.780 1.00 479.22 ? 64   ASP C OD2 1 
ATOM   7406  N N   . ALA C 3 65  ? 95.447  122.460 146.722 1.00 402.99 ? 65   ALA C N   1 
ATOM   7407  C CA  . ALA C 3 65  ? 96.822  121.944 146.710 1.00 400.62 ? 65   ALA C CA  1 
ATOM   7408  C C   . ALA C 3 65  ? 96.828  120.429 146.784 1.00 396.57 ? 65   ALA C C   1 
ATOM   7409  O O   . ALA C 3 65  ? 97.529  119.755 146.007 1.00 413.75 ? 65   ALA C O   1 
ATOM   7410  C CB  . ALA C 3 65  ? 97.620  122.533 147.863 1.00 411.30 ? 65   ALA C CB  1 
ATOM   7411  N N   . ARG C 3 66  ? 96.001  119.916 147.693 1.00 408.86 ? 66   ARG C N   1 
ATOM   7412  C CA  . ARG C 3 66  ? 95.823  118.464 147.871 1.00 417.97 ? 66   ARG C CA  1 
ATOM   7413  C C   . ARG C 3 66  ? 95.346  117.839 146.566 1.00 406.05 ? 66   ARG C C   1 
ATOM   7414  O O   . ARG C 3 66  ? 95.869  116.797 146.138 1.00 396.58 ? 66   ARG C O   1 
ATOM   7415  C CB  . ARG C 3 66  ? 94.840  118.170 149.018 1.00 421.05 ? 66   ARG C CB  1 
ATOM   7416  C CG  . ARG C 3 66  ? 94.850  116.728 149.515 1.00 430.25 ? 66   ARG C CG  1 
ATOM   7417  C CD  . ARG C 3 66  ? 93.680  115.905 148.992 1.00 437.95 ? 66   ARG C CD  1 
ATOM   7418  N NE  . ARG C 3 66  ? 92.460  116.116 149.776 1.00 441.88 ? 66   ARG C NE  1 
ATOM   7419  C CZ  . ARG C 3 66  ? 91.341  115.392 149.672 1.00 454.76 ? 66   ARG C CZ  1 
ATOM   7420  N NH1 . ARG C 3 66  ? 91.245  114.381 148.807 1.00 451.33 ? 66   ARG C NH1 1 
ATOM   7421  N NH2 . ARG C 3 66  ? 90.298  115.684 150.447 1.00 457.82 ? 66   ARG C NH2 1 
ATOM   7422  N N   . LEU C 3 67  ? 94.360  118.501 145.961 1.00 392.76 ? 67   LEU C N   1 
ATOM   7423  C CA  . LEU C 3 67  ? 93.771  118.048 144.695 1.00 383.33 ? 67   LEU C CA  1 
ATOM   7424  C C   . LEU C 3 67  ? 94.845  117.962 143.620 1.00 386.38 ? 67   LEU C C   1 
ATOM   7425  O O   . LEU C 3 67  ? 94.922  116.969 142.882 1.00 413.49 ? 67   LEU C O   1 
ATOM   7426  C CB  . LEU C 3 67  ? 92.647  118.980 144.232 1.00 390.68 ? 67   LEU C CB  1 
ATOM   7427  C CG  . LEU C 3 67  ? 91.943  118.611 142.911 1.00 391.60 ? 67   LEU C CG  1 
ATOM   7428  C CD1 . LEU C 3 67  ? 90.439  118.832 143.007 1.00 408.68 ? 67   LEU C CD1 1 
ATOM   7429  C CD2 . LEU C 3 67  ? 92.512  119.361 141.709 1.00 383.76 ? 67   LEU C CD2 1 
ATOM   7430  N N   . GLN C 3 68  ? 95.650  119.013 143.559 1.00 363.68 ? 68   GLN C N   1 
ATOM   7431  C CA  . GLN C 3 68  ? 96.749  119.120 142.591 1.00 364.02 ? 68   GLN C CA  1 
ATOM   7432  C C   . GLN C 3 68  ? 97.711  117.949 142.761 1.00 335.55 ? 68   GLN C C   1 
ATOM   7433  O O   . GLN C 3 68  ? 98.117  117.312 141.779 1.00 307.41 ? 68   GLN C O   1 
ATOM   7434  C CB  . GLN C 3 68  ? 97.488  120.463 142.712 1.00 393.88 ? 68   GLN C CB  1 
ATOM   7435  C CG  . GLN C 3 68  ? 98.342  120.831 141.497 1.00 402.72 ? 68   GLN C CG  1 
ATOM   7436  C CD  . GLN C 3 68  ? 97.568  121.498 140.363 1.00 408.30 ? 68   GLN C CD  1 
ATOM   7437  O OE1 . GLN C 3 68  ? 98.145  122.249 139.575 1.00 401.92 ? 68   GLN C OE1 1 
ATOM   7438  N NE2 . GLN C 3 68  ? 96.267  121.226 140.270 1.00 396.19 ? 68   GLN C NE2 1 
ATOM   7439  N N   . TYR C 3 69  ? 98.050  117.698 144.017 1.00 346.95 ? 69   TYR C N   1 
ATOM   7440  C CA  . TYR C 3 69  ? 98.965  116.613 144.394 1.00 341.99 ? 69   TYR C CA  1 
ATOM   7441  C C   . TYR C 3 69  ? 98.422  115.275 143.899 1.00 321.98 ? 69   TYR C C   1 
ATOM   7442  O O   . TYR C 3 69  ? 99.154  114.464 143.307 1.00 363.34 ? 69   TYR C O   1 
ATOM   7443  C CB  . TYR C 3 69  ? 99.172  116.574 145.907 1.00 347.26 ? 69   TYR C CB  1 
ATOM   7444  C CG  . TYR C 3 69  ? 100.330 115.727 146.369 1.00 348.07 ? 69   TYR C CG  1 
ATOM   7445  C CD1 . TYR C 3 69  ? 101.637 116.026 145.983 1.00 346.89 ? 69   TYR C CD1 1 
ATOM   7446  C CD2 . TYR C 3 69  ? 100.129 114.647 147.234 1.00 373.92 ? 69   TYR C CD2 1 
ATOM   7447  C CE1 . TYR C 3 69  ? 102.707 115.258 146.425 1.00 372.23 ? 69   TYR C CE1 1 
ATOM   7448  C CE2 . TYR C 3 69  ? 101.193 113.876 147.686 1.00 365.44 ? 69   TYR C CE2 1 
ATOM   7449  C CZ  . TYR C 3 69  ? 102.478 114.182 147.277 1.00 360.97 ? 69   TYR C CZ  1 
ATOM   7450  O OH  . TYR C 3 69  ? 103.529 113.416 147.720 1.00 372.04 ? 69   TYR C OH  1 
ATOM   7451  N N   . GLY C 3 70  ? 97.135  115.083 144.158 1.00 337.81 ? 70   GLY C N   1 
ATOM   7452  C CA  . GLY C 3 70  ? 96.419  113.865 143.765 1.00 356.12 ? 70   GLY C CA  1 
ATOM   7453  C C   . GLY C 3 70  ? 96.508  113.663 142.260 1.00 338.53 ? 70   GLY C C   1 
ATOM   7454  O O   . GLY C 3 70  ? 96.797  112.561 141.776 1.00 370.41 ? 70   GLY C O   1 
ATOM   7455  N N   . LEU C 3 71  ? 96.253  114.752 141.550 1.00 303.89 ? 71   LEU C N   1 
ATOM   7456  C CA  . LEU C 3 71  ? 96.286  114.778 140.081 1.00 345.02 ? 71   LEU C CA  1 
ATOM   7457  C C   . LEU C 3 71  ? 97.655  114.350 139.582 1.00 357.95 ? 71   LEU C C   1 
ATOM   7458  O O   . LEU C 3 71  ? 97.768  113.521 138.668 1.00 352.35 ? 71   LEU C O   1 
ATOM   7459  C CB  . LEU C 3 71  ? 95.928  116.165 139.518 1.00 361.51 ? 71   LEU C CB  1 
ATOM   7460  C CG  . LEU C 3 71  ? 94.509  116.325 138.973 1.00 374.62 ? 71   LEU C CG  1 
ATOM   7461  C CD1 . LEU C 3 71  ? 93.450  116.073 140.038 1.00 389.10 ? 71   LEU C CD1 1 
ATOM   7462  C CD2 . LEU C 3 71  ? 94.349  117.714 138.377 1.00 387.54 ? 71   LEU C CD2 1 
ATOM   7463  N N   . LEU C 3 72  ? 98.674  114.929 140.205 1.00 364.31 ? 72   LEU C N   1 
ATOM   7464  C CA  . LEU C 3 72  ? 100.077 114.650 139.875 1.00 344.00 ? 72   LEU C CA  1 
ATOM   7465  C C   . LEU C 3 72  ? 100.366 113.165 140.038 1.00 334.67 ? 72   LEU C C   1 
ATOM   7466  O O   . LEU C 3 72  ? 100.963 112.517 139.146 1.00 357.18 ? 72   LEU C O   1 
ATOM   7467  C CB  . LEU C 3 72  ? 101.064 115.433 140.750 1.00 345.66 ? 72   LEU C CB  1 
ATOM   7468  C CG  . LEU C 3 72  ? 101.529 116.804 140.261 1.00 368.99 ? 72   LEU C CG  1 
ATOM   7469  C CD1 . LEU C 3 72  ? 102.194 117.584 141.395 1.00 389.58 ? 72   LEU C CD1 1 
ATOM   7470  C CD2 . LEU C 3 72  ? 102.477 116.669 139.077 1.00 363.43 ? 72   LEU C CD2 1 
ATOM   7471  N N   . ILE C 3 73  ? 99.913  112.643 141.168 1.00 325.93 ? 73   ILE C N   1 
ATOM   7472  C CA  . ILE C 3 73  ? 100.085 111.223 141.515 1.00 316.94 ? 73   ILE C CA  1 
ATOM   7473  C C   . ILE C 3 73  ? 99.398  110.364 140.457 1.00 323.00 ? 73   ILE C C   1 
ATOM   7474  O O   . ILE C 3 73  ? 99.945  109.380 139.914 1.00 354.01 ? 73   ILE C O   1 
ATOM   7475  C CB  . ILE C 3 73  ? 99.554  110.885 142.928 1.00 327.53 ? 73   ILE C CB  1 
ATOM   7476  C CG1 . ILE C 3 73  ? 100.617 111.248 143.971 1.00 369.48 ? 73   ILE C CG1 1 
ATOM   7477  C CG2 . ILE C 3 73  ? 99.173  109.408 143.051 1.00 330.18 ? 73   ILE C CG2 1 
ATOM   7478  C CD1 . ILE C 3 73  ? 100.122 111.251 145.404 1.00 393.15 ? 73   ILE C CD1 1 
ATOM   7479  N N   . PHE C 3 74  ? 98.137  110.747 140.211 1.00 313.73 ? 74   PHE C N   1 
ATOM   7480  C CA  . PHE C 3 74  ? 97.272  110.052 139.239 1.00 338.51 ? 74   PHE C CA  1 
ATOM   7481  C C   . PHE C 3 74  ? 97.917  110.094 137.876 1.00 324.18 ? 74   PHE C C   1 
ATOM   7482  O O   . PHE C 3 74  ? 97.927  109.063 137.193 1.00 344.76 ? 74   PHE C O   1 
ATOM   7483  C CB  . PHE C 3 74  ? 95.871  110.682 139.182 1.00 365.64 ? 74   PHE C CB  1 
ATOM   7484  C CG  . PHE C 3 74  ? 95.071  110.285 137.969 1.00 344.48 ? 74   PHE C CG  1 
ATOM   7485  C CD1 . PHE C 3 74  ? 94.392  109.074 137.936 1.00 344.82 ? 74   PHE C CD1 1 
ATOM   7486  C CD2 . PHE C 3 74  ? 95.006  111.121 136.854 1.00 330.08 ? 74   PHE C CD2 1 
ATOM   7487  C CE1 . PHE C 3 74  ? 93.657  108.704 136.818 1.00 359.18 ? 74   PHE C CE1 1 
ATOM   7488  C CE2 . PHE C 3 74  ? 94.275  110.757 135.735 1.00 330.63 ? 74   PHE C CE2 1 
ATOM   7489  C CZ  . PHE C 3 74  ? 93.598  109.547 135.716 1.00 351.95 ? 74   PHE C CZ  1 
ATOM   7490  N N   . GLY C 3 75  ? 98.440  111.255 137.499 1.00 320.10 ? 75   GLY C N   1 
ATOM   7491  C CA  . GLY C 3 75  ? 99.104  111.447 136.211 1.00 342.34 ? 75   GLY C CA  1 
ATOM   7492  C C   . GLY C 3 75  ? 100.267 110.477 136.066 1.00 338.39 ? 75   GLY C C   1 
ATOM   7493  O O   . GLY C 3 75  ? 100.423 109.818 135.022 1.00 338.18 ? 75   GLY C O   1 
ATOM   7494  N N   . ALA C 3 76  ? 101.056 110.409 137.128 1.00 312.57 ? 76   ALA C N   1 
ATOM   7495  C CA  . ALA C 3 76  ? 102.232 109.525 137.182 1.00 318.24 ? 76   ALA C CA  1 
ATOM   7496  C C   . ALA C 3 76  ? 101.815 108.079 136.970 1.00 310.84 ? 76   ALA C C   1 
ATOM   7497  O O   . ALA C 3 76  ? 102.441 107.348 136.187 1.00 323.28 ? 76   ALA C O   1 
ATOM   7498  C CB  . ALA C 3 76  ? 103.007 109.698 138.483 1.00 336.75 ? 76   ALA C CB  1 
ATOM   7499  N N   . ALA C 3 77  ? 100.754 107.705 137.675 1.00 314.10 ? 77   ALA C N   1 
ATOM   7500  C CA  . ALA C 3 77  ? 100.194 106.351 137.609 1.00 340.52 ? 77   ALA C CA  1 
ATOM   7501  C C   . ALA C 3 77  ? 99.802  106.017 136.168 1.00 340.95 ? 77   ALA C C   1 
ATOM   7502  O O   . ALA C 3 77  ? 100.121 104.932 135.652 1.00 344.25 ? 77   ALA C O   1 
ATOM   7503  C CB  . ALA C 3 77  ? 99.006  106.196 138.547 1.00 368.24 ? 77   ALA C CB  1 
ATOM   7504  N N   . VAL C 3 78  ? 99.117  106.974 135.557 1.00 319.61 ? 78   VAL C N   1 
ATOM   7505  C CA  . VAL C 3 78  ? 98.642  106.852 134.176 1.00 324.13 ? 78   VAL C CA  1 
ATOM   7506  C C   . VAL C 3 78  ? 99.816  106.614 133.237 1.00 342.13 ? 78   VAL C C   1 
ATOM   7507  O O   . VAL C 3 78  ? 99.770  105.732 132.368 1.00 371.90 ? 78   VAL C O   1 
ATOM   7508  C CB  . VAL C 3 78  ? 97.808  108.076 133.730 1.00 339.76 ? 78   VAL C CB  1 
ATOM   7509  C CG1 . VAL C 3 78  ? 97.551  108.063 132.222 1.00 342.58 ? 78   VAL C CG1 1 
ATOM   7510  C CG2 . VAL C 3 78  ? 96.487  108.115 134.492 1.00 364.52 ? 78   VAL C CG2 1 
ATOM   7511  N N   . SER C 3 79  ? 100.851 107.419 133.441 1.00 315.32 ? 79   SER C N   1 
ATOM   7512  C CA  . SER C 3 79  ? 102.084 107.351 132.645 1.00 334.64 ? 79   SER C CA  1 
ATOM   7513  C C   . SER C 3 79  ? 102.695 105.970 132.748 1.00 323.90 ? 79   SER C C   1 
ATOM   7514  O O   . SER C 3 79  ? 103.091 105.379 131.736 1.00 336.62 ? 79   SER C O   1 
ATOM   7515  C CB  . SER C 3 79  ? 103.097 108.414 133.073 1.00 344.30 ? 79   SER C CB  1 
ATOM   7516  O OG  . SER C 3 79  ? 103.742 108.053 134.281 1.00 348.62 ? 79   SER C OG  1 
ATOM   7517  N N   . VAL C 3 80  ? 102.759 105.477 133.979 1.00 304.26 ? 80   VAL C N   1 
ATOM   7518  C CA  . VAL C 3 80  ? 103.315 104.155 134.285 1.00 295.32 ? 80   VAL C CA  1 
ATOM   7519  C C   . VAL C 3 80  ? 102.538 103.076 133.508 1.00 301.05 ? 80   VAL C C   1 
ATOM   7520  O O   . VAL C 3 80  ? 103.116 102.195 132.821 1.00 330.25 ? 80   VAL C O   1 
ATOM   7521  C CB  . VAL C 3 80  ? 103.338 103.844 135.800 1.00 323.21 ? 80   VAL C CB  1 
ATOM   7522  C CG1 . VAL C 3 80  ? 103.712 102.390 136.052 1.00 334.74 ? 80   VAL C CG1 1 
ATOM   7523  C CG2 . VAL C 3 80  ? 104.320 104.760 136.519 1.00 352.23 ? 80   VAL C CG2 1 
ATOM   7524  N N   . LEU C 3 81  ? 101.231 103.196 133.601 1.00 299.88 ? 81   LEU C N   1 
ATOM   7525  C CA  . LEU C 3 81  ? 100.309 102.258 132.943 1.00 304.76 ? 81   LEU C CA  1 
ATOM   7526  C C   . LEU C 3 81  ? 100.490 102.334 131.446 1.00 300.34 ? 81   LEU C C   1 
ATOM   7527  O O   . LEU C 3 81  ? 100.607 101.334 130.714 1.00 321.82 ? 81   LEU C O   1 
ATOM   7528  C CB  . LEU C 3 81  ? 98.861  102.488 133.369 1.00 322.29 ? 81   LEU C CB  1 
ATOM   7529  C CG  . LEU C 3 81  ? 98.627  102.081 134.830 1.00 344.36 ? 81   LEU C CG  1 
ATOM   7530  C CD1 . LEU C 3 81  ? 97.344  102.696 135.374 1.00 377.04 ? 81   LEU C CD1 1 
ATOM   7531  C CD2 . LEU C 3 81  ? 98.619  100.567 134.994 1.00 342.23 ? 81   LEU C CD2 1 
ATOM   7532  N N   . LEU C 3 82  ? 100.491 103.580 130.958 1.00 297.84 ? 82   LEU C N   1 
ATOM   7533  C CA  . LEU C 3 82  ? 100.710 103.917 129.543 1.00 313.35 ? 82   LEU C CA  1 
ATOM   7534  C C   . LEU C 3 82  ? 102.040 103.384 129.125 1.00 314.91 ? 82   LEU C C   1 
ATOM   7535  O O   . LEU C 3 82  ? 102.087 102.812 128.026 1.00 315.33 ? 82   LEU C O   1 
ATOM   7536  C CB  . LEU C 3 82  ? 100.646 105.430 129.287 1.00 312.75 ? 82   LEU C CB  1 
ATOM   7537  C CG  . LEU C 3 82  ? 99.318  105.969 128.743 1.00 353.50 ? 82   LEU C CG  1 
ATOM   7538  C CD1 . LEU C 3 82  ? 98.097  105.387 129.453 1.00 379.81 ? 82   LEU C CD1 1 
ATOM   7539  C CD2 . LEU C 3 82  ? 99.323  107.489 128.801 1.00 352.12 ? 82   LEU C CD2 1 
ATOM   7540  N N   . GLN C 3 83  ? 103.077 103.549 129.946 1.00 310.38 ? 83   GLN C N   1 
ATOM   7541  C CA  . GLN C 3 83  ? 104.416 103.056 129.625 1.00 299.37 ? 83   GLN C CA  1 
ATOM   7542  C C   . GLN C 3 83  ? 104.387 101.550 129.387 1.00 312.59 ? 83   GLN C C   1 
ATOM   7543  O O   . GLN C 3 83  ? 104.955 101.046 128.415 1.00 352.73 ? 83   GLN C O   1 
ATOM   7544  C CB  . GLN C 3 83  ? 105.424 103.335 130.748 1.00 310.47 ? 83   GLN C CB  1 
ATOM   7545  C CG  . GLN C 3 83  ? 106.134 104.670 130.669 1.00 333.14 ? 83   GLN C CG  1 
ATOM   7546  C CD  . GLN C 3 83  ? 106.966 104.936 131.910 1.00 356.99 ? 83   GLN C CD  1 
ATOM   7547  O OE1 . GLN C 3 83  ? 108.171 104.678 131.930 1.00 334.67 ? 83   GLN C OE1 1 
ATOM   7548  N NE2 . GLN C 3 83  ? 106.324 105.439 132.958 1.00 374.70 ? 83   GLN C NE2 1 
ATOM   7549  N N   . GLU C 3 84  ? 103.713 100.869 130.300 1.00 318.42 ? 84   GLU C N   1 
ATOM   7550  C CA  . GLU C 3 84  ? 103.567 99.410  130.258 1.00 320.44 ? 84   GLU C CA  1 
ATOM   7551  C C   . GLU C 3 84  ? 102.898 98.988  128.947 1.00 323.46 ? 84   GLU C C   1 
ATOM   7552  O O   . GLU C 3 84  ? 103.357 98.054  128.270 1.00 344.39 ? 84   GLU C O   1 
ATOM   7553  C CB  . GLU C 3 84  ? 102.837 98.851  131.480 1.00 328.99 ? 84   GLU C CB  1 
ATOM   7554  C CG  . GLU C 3 84  ? 103.636 98.964  132.779 1.00 354.28 ? 84   GLU C CG  1 
ATOM   7555  C CD  . GLU C 3 84  ? 104.878 98.088  132.813 1.00 337.28 ? 84   GLU C CD  1 
ATOM   7556  O OE1 . GLU C 3 84  ? 105.904 98.459  132.201 1.00 313.64 ? 84   GLU C OE1 1 
ATOM   7557  O OE2 . GLU C 3 84  ? 104.826 97.025  133.460 1.00 342.94 ? 84   GLU C OE2 1 
ATOM   7558  N N   . VAL C 3 85  ? 101.828 99.708  128.628 1.00 314.38 ? 85   VAL C N   1 
ATOM   7559  C CA  . VAL C 3 85  ? 101.039 99.454  127.424 1.00 308.83 ? 85   VAL C CA  1 
ATOM   7560  C C   . VAL C 3 85  ? 101.948 99.594  126.177 1.00 308.71 ? 85   VAL C C   1 
ATOM   7561  O O   . VAL C 3 85  ? 101.929 98.745  125.268 1.00 348.06 ? 85   VAL C O   1 
ATOM   7562  C CB  . VAL C 3 85  ? 99.763  100.318 127.341 1.00 324.31 ? 85   VAL C CB  1 
ATOM   7563  C CG1 . VAL C 3 85  ? 99.151  100.284 125.943 1.00 344.89 ? 85   VAL C CG1 1 
ATOM   7564  C CG2 . VAL C 3 85  ? 98.747  99.824  128.362 1.00 337.62 ? 85   VAL C CG2 1 
ATOM   7565  N N   . PHE C 3 86  ? 102.721 100.665 126.181 1.00 292.12 ? 86   PHE C N   1 
ATOM   7566  C CA  . PHE C 3 86  ? 103.603 100.938 125.055 1.00 309.57 ? 86   PHE C CA  1 
ATOM   7567  C C   . PHE C 3 86  ? 104.652 99.852  124.919 1.00 318.69 ? 86   PHE C C   1 
ATOM   7568  O O   . PHE C 3 86  ? 104.987 99.450  123.837 1.00 351.61 ? 86   PHE C O   1 
ATOM   7569  C CB  . PHE C 3 86  ? 104.154 102.358 125.064 1.00 325.57 ? 86   PHE C CB  1 
ATOM   7570  C CG  . PHE C 3 86  ? 103.270 103.323 124.332 1.00 332.20 ? 86   PHE C CG  1 
ATOM   7571  C CD1 . PHE C 3 86  ? 101.985 103.586 124.791 1.00 331.24 ? 86   PHE C CD1 1 
ATOM   7572  C CD2 . PHE C 3 86  ? 103.699 103.933 123.160 1.00 356.42 ? 86   PHE C CD2 1 
ATOM   7573  C CE1 . PHE C 3 86  ? 101.155 104.465 124.114 1.00 352.73 ? 86   PHE C CE1 1 
ATOM   7574  C CE2 . PHE C 3 86  ? 102.875 104.810 122.477 1.00 358.60 ? 86   PHE C CE2 1 
ATOM   7575  C CZ  . PHE C 3 86  ? 101.600 105.080 122.953 1.00 363.70 ? 86   PHE C CZ  1 
ATOM   7576  N N   . ARG C 3 87  ? 105.179 99.388  126.037 1.00 303.69 ? 87   ARG C N   1 
ATOM   7577  C CA  . ARG C 3 87  ? 106.149 98.295  126.074 1.00 314.99 ? 87   ARG C CA  1 
ATOM   7578  C C   . ARG C 3 87  ? 105.567 97.057  125.473 1.00 317.88 ? 87   ARG C C   1 
ATOM   7579  O O   . ARG C 3 87  ? 106.232 96.408  124.699 1.00 352.60 ? 87   ARG C O   1 
ATOM   7580  C CB  . ARG C 3 87  ? 106.632 98.035  127.511 1.00 328.33 ? 87   ARG C CB  1 
ATOM   7581  C CG  . ARG C 3 87  ? 107.022 96.595  127.842 1.00 322.58 ? 87   ARG C CG  1 
ATOM   7582  C CD  . ARG C 3 87  ? 107.722 96.564  129.180 1.00 333.46 ? 87   ARG C CD  1 
ATOM   7583  N NE  . ARG C 3 87  ? 109.043 97.178  129.075 1.00 338.57 ? 87   ARG C NE  1 
ATOM   7584  C CZ  . ARG C 3 87  ? 109.695 97.801  130.055 1.00 333.41 ? 87   ARG C CZ  1 
ATOM   7585  N NH1 . ARG C 3 87  ? 109.174 97.934  131.275 1.00 328.52 ? 87   ARG C NH1 1 
ATOM   7586  N NH2 . ARG C 3 87  ? 110.899 98.303  129.800 1.00 340.48 ? 87   ARG C NH2 1 
ATOM   7587  N N   . PHE C 3 88  ? 104.324 96.758  125.839 1.00 297.96 ? 88   PHE C N   1 
ATOM   7588  C CA  . PHE C 3 88  ? 103.585 95.599  125.282 1.00 316.30 ? 88   PHE C CA  1 
ATOM   7589  C C   . PHE C 3 88  ? 103.516 95.719  123.752 1.00 315.11 ? 88   PHE C C   1 
ATOM   7590  O O   . PHE C 3 88  ? 103.806 94.769  122.991 1.00 334.32 ? 88   PHE C O   1 
ATOM   7591  C CB  . PHE C 3 88  ? 102.174 95.502  125.862 1.00 332.69 ? 88   PHE C CB  1 
ATOM   7592  C CG  . PHE C 3 88  ? 101.361 94.368  125.307 1.00 337.70 ? 88   PHE C CG  1 
ATOM   7593  C CD1 . PHE C 3 88  ? 101.422 93.104  125.885 1.00 357.20 ? 88   PHE C CD1 1 
ATOM   7594  C CD2 . PHE C 3 88  ? 100.521 94.567  124.211 1.00 337.33 ? 88   PHE C CD2 1 
ATOM   7595  C CE1 . PHE C 3 88  ? 100.666 92.054  125.378 1.00 383.52 ? 88   PHE C CE1 1 
ATOM   7596  C CE2 . PHE C 3 88  ? 99.763  93.522  123.699 1.00 370.55 ? 88   PHE C CE2 1 
ATOM   7597  C CZ  . PHE C 3 88  ? 99.835  92.264  124.284 1.00 388.82 ? 88   PHE C CZ  1 
ATOM   7598  N N   . ALA C 3 89  ? 103.127 96.918  123.345 1.00 298.31 ? 89   ALA C N   1 
ATOM   7599  C CA  . ALA C 3 89  ? 102.982 97.257  121.917 1.00 321.09 ? 89   ALA C CA  1 
ATOM   7600  C C   . ALA C 3 89  ? 104.329 97.081  121.219 1.00 321.92 ? 89   ALA C C   1 
ATOM   7601  O O   . ALA C 3 89  ? 104.382 96.500  120.120 1.00 342.35 ? 89   ALA C O   1 
ATOM   7602  C CB  . ALA C 3 89  ? 102.470 98.678  121.745 1.00 340.11 ? 89   ALA C CB  1 
ATOM   7603  N N   . TYR C 3 90  ? 105.398 97.576  121.835 1.00 307.16 ? 90   TYR C N   1 
ATOM   7604  C CA  . TYR C 3 90  ? 106.730 97.475  121.249 1.00 321.36 ? 90   TYR C CA  1 
ATOM   7605  C C   . TYR C 3 90  ? 107.142 96.015  121.105 1.00 315.61 ? 90   TYR C C   1 
ATOM   7606  O O   . TYR C 3 90  ? 107.730 95.620  120.098 1.00 345.11 ? 90   TYR C O   1 
ATOM   7607  C CB  . TYR C 3 90  ? 107.751 98.229  122.103 1.00 321.42 ? 90   TYR C CB  1 
ATOM   7608  C CG  . TYR C 3 90  ? 109.167 98.145  121.581 1.00 305.69 ? 90   TYR C CG  1 
ATOM   7609  C CD1 . TYR C 3 90  ? 109.592 98.953  120.535 1.00 313.09 ? 90   TYR C CD1 1 
ATOM   7610  C CD2 . TYR C 3 90  ? 110.080 97.258  122.136 1.00 300.85 ? 90   TYR C CD2 1 
ATOM   7611  C CE1 . TYR C 3 90  ? 110.886 98.879  120.055 1.00 313.65 ? 90   TYR C CE1 1 
ATOM   7612  C CE2 . TYR C 3 90  ? 111.376 97.177  121.662 1.00 310.87 ? 90   TYR C CE2 1 
ATOM   7613  C CZ  . TYR C 3 90  ? 111.773 97.990  120.622 1.00 320.44 ? 90   TYR C CZ  1 
ATOM   7614  O OH  . TYR C 3 90  ? 113.063 97.913  120.147 1.00 320.39 ? 90   TYR C OH  1 
ATOM   7615  N N   . TYR C 3 91  ? 106.824 95.220  122.120 1.00 302.36 ? 91   TYR C N   1 
ATOM   7616  C CA  . TYR C 3 91  ? 107.103 93.774  122.098 1.00 308.35 ? 91   TYR C CA  1 
ATOM   7617  C C   . TYR C 3 91  ? 106.418 93.133  120.909 1.00 324.59 ? 91   TYR C C   1 
ATOM   7618  O O   . TYR C 3 91  ? 107.029 92.341  120.181 1.00 357.54 ? 91   TYR C O   1 
ATOM   7619  C CB  . TYR C 3 91  ? 106.616 93.009  123.354 1.00 298.16 ? 91   TYR C CB  1 
ATOM   7620  C CG  . TYR C 3 91  ? 106.076 91.632  122.982 1.00 309.86 ? 91   TYR C CG  1 
ATOM   7621  C CD1 . TYR C 3 91  ? 106.941 90.599  122.602 1.00 339.65 ? 91   TYR C CD1 1 
ATOM   7622  C CD2 . TYR C 3 91  ? 104.697 91.389  122.917 1.00 308.36 ? 91   TYR C CD2 1 
ATOM   7623  C CE1 . TYR C 3 91  ? 106.451 89.361  122.195 1.00 361.08 ? 91   TYR C CE1 1 
ATOM   7624  C CE2 . TYR C 3 91  ? 104.200 90.153  122.521 1.00 331.01 ? 91   TYR C CE2 1 
ATOM   7625  C CZ  . TYR C 3 91  ? 105.078 89.141  122.162 1.00 350.56 ? 91   TYR C CZ  1 
ATOM   7626  O OH  . TYR C 3 91  ? 104.592 87.909  121.785 1.00 350.50 ? 91   TYR C OH  1 
ATOM   7627  N N   . LYS C 3 92  ? 105.146 93.490  120.746 1.00 300.60 ? 92   LYS C N   1 
ATOM   7628  C CA  . LYS C 3 92  ? 104.310 92.973  119.657 1.00 315.73 ? 92   LYS C CA  1 
ATOM   7629  C C   . LYS C 3 92  ? 104.956 93.300  118.305 1.00 323.30 ? 92   LYS C C   1 
ATOM   7630  O O   . LYS C 3 92  ? 105.060 92.430  117.419 1.00 346.79 ? 92   LYS C O   1 
ATOM   7631  C CB  . LYS C 3 92  ? 102.869 93.494  119.720 1.00 318.96 ? 92   LYS C CB  1 
ATOM   7632  C CG  . LYS C 3 92  ? 102.022 92.864  120.819 1.00 337.23 ? 92   LYS C CG  1 
ATOM   7633  C CD  . LYS C 3 92  ? 101.696 91.390  120.588 1.00 339.17 ? 92   LYS C CD  1 
ATOM   7634  C CE  . LYS C 3 92  ? 100.637 91.186  119.518 1.00 353.83 ? 92   LYS C CE  1 
ATOM   7635  N NZ  . LYS C 3 92  ? 100.221 89.759  119.444 1.00 362.34 ? 92   LYS C NZ  1 
ATOM   7636  N N   . LEU C 3 93  ? 105.373 94.557  118.193 1.00 300.39 ? 93   LEU C N   1 
ATOM   7637  C CA  . LEU C 3 93  ? 106.010 95.068  116.979 1.00 327.95 ? 93   LEU C CA  1 
ATOM   7638  C C   . LEU C 3 93  ? 107.263 94.249  116.655 1.00 316.52 ? 93   LEU C C   1 
ATOM   7639  O O   . LEU C 3 93  ? 107.481 93.841  115.504 1.00 340.18 ? 93   LEU C O   1 
ATOM   7640  C CB  . LEU C 3 93  ? 106.350 96.568  117.037 1.00 343.86 ? 93   LEU C CB  1 
ATOM   7641  C CG  . LEU C 3 93  ? 105.290 97.633  116.688 1.00 366.51 ? 93   LEU C CG  1 
ATOM   7642  C CD1 . LEU C 3 93  ? 105.954 98.768  115.915 1.00 373.48 ? 93   LEU C CD1 1 
ATOM   7643  C CD2 . LEU C 3 93  ? 104.096 97.121  115.889 1.00 373.31 ? 93   LEU C CD2 1 
ATOM   7644  N N   . LEU C 3 94  ? 108.052 94.032  117.695 1.00 307.52 ? 94   LEU C N   1 
ATOM   7645  C CA  . LEU C 3 94  ? 109.300 93.271  117.598 1.00 314.71 ? 94   LEU C CA  1 
ATOM   7646  C C   . LEU C 3 94  ? 109.023 91.866  117.084 1.00 323.76 ? 94   LEU C C   1 
ATOM   7647  O O   . LEU C 3 94  ? 109.717 91.371  116.189 1.00 340.88 ? 94   LEU C O   1 
ATOM   7648  C CB  . LEU C 3 94  ? 110.066 93.287  118.920 1.00 336.79 ? 94   LEU C CB  1 
ATOM   7649  C CG  . LEU C 3 94  ? 110.686 94.648  119.286 1.00 336.05 ? 94   LEU C CG  1 
ATOM   7650  C CD1 . LEU C 3 94  ? 111.482 94.522  120.581 1.00 366.43 ? 94   LEU C CD1 1 
ATOM   7651  C CD2 . LEU C 3 94  ? 111.535 95.228  118.157 1.00 334.54 ? 94   LEU C CD2 1 
ATOM   7652  N N   . LYS C 3 95  ? 108.001 91.259  117.664 1.00 329.05 ? 95   LYS C N   1 
ATOM   7653  C CA  . LYS C 3 95  ? 107.564 89.902  117.306 1.00 348.82 ? 95   LYS C CA  1 
ATOM   7654  C C   . LYS C 3 95  ? 107.211 89.845  115.825 1.00 338.44 ? 95   LYS C C   1 
ATOM   7655  O O   . LYS C 3 95  ? 107.628 88.923  115.105 1.00 347.68 ? 95   LYS C O   1 
ATOM   7656  C CB  . LYS C 3 95  ? 106.368 89.464  118.164 1.00 382.78 ? 95   LYS C CB  1 
ATOM   7657  C CG  . LYS C 3 95  ? 106.017 87.984  118.081 1.00 411.24 ? 95   LYS C CG  1 
ATOM   7658  C CD  . LYS C 3 95  ? 107.048 87.110  118.778 1.00 429.05 ? 95   LYS C CD  1 
ATOM   7659  C CE  . LYS C 3 95  ? 106.568 85.671  118.889 1.00 455.12 ? 95   LYS C CE  1 
ATOM   7660  N NZ  . LYS C 3 95  ? 106.288 85.047  117.565 1.00 464.48 ? 95   LYS C NZ  1 
ATOM   7661  N N   . LYS C 3 96  ? 106.443 90.846  115.408 1.00 348.38 ? 96   LYS C N   1 
ATOM   7662  C CA  . LYS C 3 96  ? 105.994 90.972  114.016 1.00 358.15 ? 96   LYS C CA  1 
ATOM   7663  C C   . LYS C 3 96  ? 107.199 91.033  113.078 1.00 352.00 ? 96   LYS C C   1 
ATOM   7664  O O   . LYS C 3 96  ? 107.244 90.349  112.048 1.00 370.35 ? 96   LYS C O   1 
ATOM   7665  C CB  . LYS C 3 96  ? 105.064 92.177  113.783 1.00 360.75 ? 96   LYS C CB  1 
ATOM   7666  C CG  . LYS C 3 96  ? 103.580 91.825  113.809 1.00 394.86 ? 96   LYS C CG  1 
ATOM   7667  C CD  . LYS C 3 96  ? 102.741 92.782  112.973 1.00 422.16 ? 96   LYS C CD  1 
ATOM   7668  C CE  . LYS C 3 96  ? 101.322 92.263  112.789 1.00 430.32 ? 96   LYS C CE  1 
ATOM   7669  N NZ  . LYS C 3 96  ? 100.510 93.132  111.890 1.00 424.94 ? 96   LYS C NZ  1 
ATOM   7670  N N   . ALA C 3 97  ? 108.151 91.866  113.474 1.00 349.98 ? 97   ALA C N   1 
ATOM   7671  C CA  . ALA C 3 97  ? 109.392 92.073  112.719 1.00 361.00 ? 97   ALA C CA  1 
ATOM   7672  C C   . ALA C 3 97  ? 110.132 90.741  112.546 1.00 353.67 ? 97   ALA C C   1 
ATOM   7673  O O   . ALA C 3 97  ? 110.590 90.422  111.450 1.00 377.33 ? 97   ALA C O   1 
ATOM   7674  C CB  . ALA C 3 97  ? 110.290 93.097  113.402 1.00 357.83 ? 97   ALA C CB  1 
ATOM   7675  N N   . ASP C 3 98  ? 110.224 90.027  113.656 1.00 360.19 ? 98   ASP C N   1 
ATOM   7676  C CA  . ASP C 3 98  ? 110.900 88.733  113.717 1.00 390.99 ? 98   ASP C CA  1 
ATOM   7677  C C   . ASP C 3 98  ? 110.425 87.741  112.670 1.00 406.79 ? 98   ASP C C   1 
ATOM   7678  O O   . ASP C 3 98  ? 111.262 87.142  111.993 1.00 419.61 ? 98   ASP C O   1 
ATOM   7679  C CB  . ASP C 3 98  ? 110.774 88.118  115.124 1.00 396.22 ? 98   ASP C CB  1 
ATOM   7680  C CG  . ASP C 3 98  ? 111.815 87.042  115.394 1.00 402.88 ? 98   ASP C CG  1 
ATOM   7681  O OD1 . ASP C 3 98  ? 111.677 85.920  114.861 1.00 405.63 ? 98   ASP C OD1 1 
ATOM   7682  O OD2 . ASP C 3 98  ? 112.775 87.321  116.144 1.00 409.53 ? 98   ASP C OD2 1 
ATOM   7683  N N   . GLU C 3 99  ? 109.114 87.554  112.518 1.00 406.62 ? 99   GLU C N   1 
ATOM   7684  C CA  . GLU C 3 99  ? 108.605 86.666  111.455 1.00 419.66 ? 99   GLU C CA  1 
ATOM   7685  C C   . GLU C 3 99  ? 108.937 87.194  110.048 1.00 417.40 ? 99   GLU C C   1 
ATOM   7686  O O   . GLU C 3 99  ? 109.128 86.408  109.118 1.00 434.56 ? 99   GLU C O   1 
ATOM   7687  C CB  . GLU C 3 99  ? 107.101 86.362  111.604 1.00 440.54 ? 99   GLU C CB  1 
ATOM   7688  C CG  . GLU C 3 99  ? 106.150 87.550  111.505 1.00 446.85 ? 99   GLU C CG  1 
ATOM   7689  C CD  . GLU C 3 99  ? 104.691 87.146  111.340 1.00 456.19 ? 99   GLU C CD  1 
ATOM   7690  O OE1 . GLU C 3 99  ? 104.396 86.245  110.525 1.00 461.66 ? 99   GLU C OE1 1 
ATOM   7691  O OE2 . GLU C 3 99  ? 103.831 87.737  112.028 1.00 456.18 ? 99   GLU C OE2 1 
ATOM   7692  N N   . GLY C 3 100 ? 109.009 88.518  109.908 1.00 419.22 ? 100  GLY C N   1 
ATOM   7693  C CA  . GLY C 3 100 ? 109.471 89.165  108.678 1.00 435.20 ? 100  GLY C CA  1 
ATOM   7694  C C   . GLY C 3 100 ? 110.979 89.175  108.451 1.00 441.89 ? 100  GLY C C   1 
ATOM   7695  O O   . GLY C 3 100 ? 111.421 89.245  107.304 1.00 456.49 ? 100  GLY C O   1 
ATOM   7696  N N   . LEU C 3 101 ? 111.766 89.128  109.529 1.00 430.53 ? 101  LEU C N   1 
ATOM   7697  C CA  . LEU C 3 101 ? 113.238 89.149  109.451 1.00 428.71 ? 101  LEU C CA  1 
ATOM   7698  C C   . LEU C 3 101 ? 113.861 87.753  109.400 1.00 414.84 ? 101  LEU C C   1 
ATOM   7699  O O   . LEU C 3 101 ? 114.810 87.528  108.646 1.00 418.35 ? 101  LEU C O   1 
ATOM   7700  C CB  . LEU C 3 101 ? 113.835 89.926  110.633 1.00 448.84 ? 101  LEU C CB  1 
ATOM   7701  C CG  . LEU C 3 101 ? 113.650 91.449  110.635 1.00 468.25 ? 101  LEU C CG  1 
ATOM   7702  C CD1 . LEU C 3 101 ? 114.045 92.030  111.986 1.00 471.52 ? 101  LEU C CD1 1 
ATOM   7703  C CD2 . LEU C 3 101 ? 114.443 92.111  109.516 1.00 472.36 ? 101  LEU C CD2 1 
ATOM   7704  N N   . ALA C 3 102 ? 113.338 86.830  110.206 1.00 421.65 ? 102  ALA C N   1 
ATOM   7705  C CA  . ALA C 3 102 ? 113.883 85.468  110.300 1.00 441.32 ? 102  ALA C CA  1 
ATOM   7706  C C   . ALA C 3 102 ? 113.717 84.668  109.006 1.00 442.63 ? 102  ALA C C   1 
ATOM   7707  O O   . ALA C 3 102 ? 114.649 83.989  108.569 1.00 439.21 ? 102  ALA C O   1 
ATOM   7708  C CB  . ALA C 3 102 ? 113.240 84.719  111.461 1.00 446.44 ? 102  ALA C CB  1 
ATOM   7709  N N   . SER C 3 103 ? 112.532 84.755  108.406 1.00 445.23 ? 103  SER C N   1 
ATOM   7710  C CA  . SER C 3 103 ? 112.223 84.038  107.166 1.00 458.43 ? 103  SER C CA  1 
ATOM   7711  C C   . SER C 3 103 ? 112.945 84.612  105.941 1.00 462.95 ? 103  SER C C   1 
ATOM   7712  O O   . SER C 3 103 ? 113.446 83.855  105.107 1.00 470.66 ? 103  SER C O   1 
ATOM   7713  C CB  . SER C 3 103 ? 110.710 84.044  106.917 1.00 462.09 ? 103  SER C CB  1 
ATOM   7714  O OG  . SER C 3 103 ? 110.366 83.250  105.793 1.00 471.08 ? 103  SER C OG  1 
ATOM   7715  N N   . LEU C 3 104 ? 113.004 85.941  105.846 1.00 459.41 ? 104  LEU C N   1 
ATOM   7716  C CA  . LEU C 3 104 ? 113.463 86.621  104.627 1.00 463.89 ? 104  LEU C CA  1 
ATOM   7717  C C   . LEU C 3 104 ? 114.989 86.725  104.531 1.00 437.32 ? 104  LEU C C   1 
ATOM   7718  O O   . LEU C 3 104 ? 115.602 86.098  103.664 1.00 448.75 ? 104  LEU C O   1 
ATOM   7719  C CB  . LEU C 3 104 ? 112.833 88.020  104.508 1.00 482.39 ? 104  LEU C CB  1 
ATOM   7720  C CG  . LEU C 3 104 ? 111.360 88.130  104.075 1.00 495.39 ? 104  LEU C CG  1 
ATOM   7721  C CD1 . LEU C 3 104 ? 111.219 87.884  102.579 1.00 500.00 ? 104  LEU C CD1 1 
ATOM   7722  C CD2 . LEU C 3 104 ? 110.435 87.199  104.849 1.00 487.86 ? 104  LEU C CD2 1 
ATOM   7723  N N   . SER C 3 105 ? 115.589 87.514  105.421 1.00 410.24 ? 105  SER C N   1 
ATOM   7724  C CA  . SER C 3 105 ? 117.008 87.882  105.312 1.00 417.54 ? 105  SER C CA  1 
ATOM   7725  C C   . SER C 3 105 ? 117.959 86.752  105.721 1.00 428.19 ? 105  SER C C   1 
ATOM   7726  O O   . SER C 3 105 ? 118.746 86.269  104.902 1.00 417.56 ? 105  SER C O   1 
ATOM   7727  C CB  . SER C 3 105 ? 117.295 89.142  106.144 1.00 424.05 ? 105  SER C CB  1 
ATOM   7728  O OG  . SER C 3 105 ? 118.645 89.559  106.014 1.00 413.60 ? 105  SER C OG  1 
ATOM   7729  N N   . GLU C 3 106 ? 117.929 86.356  106.987 1.00 448.34 ? 106  GLU C N   1 
ATOM   7730  C CA  . GLU C 3 106 ? 118.858 85.333  107.463 1.00 456.69 ? 106  GLU C CA  1 
ATOM   7731  C C   . GLU C 3 106 ? 118.660 83.973  106.794 1.00 466.34 ? 106  GLU C C   1 
ATOM   7732  O O   . GLU C 3 106 ? 119.620 83.267  106.490 1.00 472.52 ? 106  GLU C O   1 
ATOM   7733  C CB  . GLU C 3 106 ? 118.787 85.193  108.984 1.00 20.00  ? 106  GLU C CB  1 
ATOM   7734  C CG  . GLU C 3 106 ? 120.149 85.054  109.646 1.00 20.00  ? 106  GLU C CG  1 
ATOM   7735  C CD  . GLU C 3 106 ? 121.131 86.121  109.196 1.00 20.00  ? 106  GLU C CD  1 
ATOM   7736  O OE1 . GLU C 3 106 ? 120.720 87.030  108.446 1.00 20.00  ? 106  GLU C OE1 1 
ATOM   7737  O OE2 . GLU C 3 106 ? 122.313 86.053  109.594 1.00 20.00  ? 106  GLU C OE2 1 
ATOM   7738  N N   . ASP C 3 107 ? 117.404 83.609  106.584 1.00 464.23 ? 107  ASP C N   1 
ATOM   7739  C CA  . ASP C 3 107 ? 117.036 82.269  106.087 1.00 461.98 ? 107  ASP C CA  1 
ATOM   7740  C C   . ASP C 3 107 ? 116.998 81.219  107.207 1.00 458.29 ? 107  ASP C C   1 
ATOM   7741  O O   . ASP C 3 107 ? 117.999 80.551  107.486 1.00 442.01 ? 107  ASP C O   1 
ATOM   7742  C CB  . ASP C 3 107 ? 117.948 81.814  104.930 1.00 468.27 ? 107  ASP C CB  1 
ATOM   7743  C CG  . ASP C 3 107 ? 117.996 82.818  103.787 1.00 470.46 ? 107  ASP C CG  1 
ATOM   7744  O OD1 . ASP C 3 107 ? 116.924 83.300  103.363 1.00 467.52 ? 107  ASP C OD1 1 
ATOM   7745  O OD2 . ASP C 3 107 ? 119.109 83.119  103.306 1.00 475.81 ? 107  ASP C OD2 1 
ATOM   7746  N N   . GLY C 3 108 ? 115.831 81.094  107.841 1.00 456.31 ? 108  GLY C N   1 
ATOM   7747  C CA  . GLY C 3 108 ? 115.595 80.114  108.905 1.00 453.92 ? 108  GLY C CA  1 
ATOM   7748  C C   . GLY C 3 108 ? 115.616 80.737  110.287 1.00 441.12 ? 108  GLY C C   1 
ATOM   7749  O O   . GLY C 3 108 ? 114.576 81.150  110.805 1.00 436.53 ? 108  GLY C O   1 
ATOM   7750  N N   . ARG C 3 109 ? 116.808 80.806  110.878 1.00 440.42 ? 109  ARG C N   1 
ATOM   7751  C CA  . ARG C 3 109 ? 116.989 81.326  112.237 1.00 438.29 ? 109  ARG C CA  1 
ATOM   7752  C C   . ARG C 3 109 ? 116.935 82.856  112.236 1.00 412.23 ? 109  ARG C C   1 
ATOM   7753  O O   . ARG C 3 109 ? 117.389 83.496  111.285 1.00 394.18 ? 109  ARG C O   1 
ATOM   7754  C CB  . ARG C 3 109 ? 118.327 80.844  112.817 1.00 458.82 ? 109  ARG C CB  1 
ATOM   7755  C CG  . ARG C 3 109 ? 118.427 80.891  114.339 1.00 464.68 ? 109  ARG C CG  1 
ATOM   7756  C CD  . ARG C 3 109 ? 117.990 79.588  114.999 1.00 477.10 ? 109  ARG C CD  1 
ATOM   7757  N NE  . ARG C 3 109 ? 116.566 79.300  114.808 1.00 489.20 ? 109  ARG C NE  1 
ATOM   7758  C CZ  . ARG C 3 109 ? 115.559 79.876  115.471 1.00 500.00 ? 109  ARG C CZ  1 
ATOM   7759  N NH1 . ARG C 3 109 ? 115.777 80.811  116.400 1.00 500.00 ? 109  ARG C NH1 1 
ATOM   7760  N NH2 . ARG C 3 109 ? 114.306 79.516  115.197 1.00 500.00 ? 109  ARG C NH2 1 
ATOM   7761  N N   . SER C 3 110 ? 116.347 83.432  113.281 1.00 407.69 ? 110  SER C N   1 
ATOM   7762  C CA  . SER C 3 110 ? 116.193 84.885  113.399 1.00 393.20 ? 110  SER C CA  1 
ATOM   7763  C C   . SER C 3 110 ? 117.489 85.621  113.710 1.00 377.90 ? 110  SER C C   1 
ATOM   7764  O O   . SER C 3 110 ? 118.375 85.079  114.376 1.00 366.18 ? 110  SER C O   1 
ATOM   7765  C CB  . SER C 3 110 ? 115.140 85.229  114.449 1.00 399.19 ? 110  SER C CB  1 
ATOM   7766  O OG  . SER C 3 110 ? 115.615 84.936  115.749 1.00 394.91 ? 110  SER C OG  1 
ATOM   7767  N N   . PRO C 3 111 ? 117.580 86.920  113.182 1.00 371.95 ? 111  PRO C N   1 
ATOM   7768  C CA  . PRO C 3 111 ? 118.850 87.593  113.520 1.00 377.85 ? 111  PRO C CA  1 
ATOM   7769  C C   . PRO C 3 111 ? 119.046 87.866  115.007 1.00 367.38 ? 111  PRO C C   1 
ATOM   7770  O O   . PRO C 3 111 ? 120.136 87.629  115.520 1.00 380.31 ? 111  PRO C O   1 
ATOM   7771  C CB  . PRO C 3 111 ? 118.776 88.919  112.762 1.00 391.53 ? 111  PRO C CB  1 
ATOM   7772  C CG  . PRO C 3 111 ? 117.337 89.237  112.713 1.00 384.44 ? 111  PRO C CG  1 
ATOM   7773  C CD  . PRO C 3 111 ? 116.750 87.921  112.345 1.00 368.10 ? 111  PRO C CD  1 
ATOM   7774  N N   . ILE C 3 112 ? 118.005 88.341  115.687 1.00 362.78 ? 112  ILE C N   1 
ATOM   7775  C CA  . ILE C 3 112 ? 118.101 88.667  117.110 1.00 351.64 ? 112  ILE C CA  1 
ATOM   7776  C C   . ILE C 3 112 ? 117.152 87.808  117.915 1.00 342.19 ? 112  ILE C C   1 
ATOM   7777  O O   . ILE C 3 112 ? 115.972 87.737  117.609 1.00 352.73 ? 112  ILE C O   1 
ATOM   7778  C CB  . ILE C 3 112 ? 117.778 90.147  117.392 1.00 328.27 ? 112  ILE C CB  1 
ATOM   7779  C CG1 . ILE C 3 112 ? 116.293 90.431  117.192 1.00 350.60 ? 112  ILE C CG1 1 
ATOM   7780  C CG2 . ILE C 3 112 ? 118.584 91.050  116.482 1.00 320.34 ? 112  ILE C CG2 1 
ATOM   7781  C CD1 . ILE C 3 112 ? 115.735 89.837  115.923 1.00 366.25 ? 112  ILE C CD1 1 
ATOM   7782  N N   . SER C 3 113 ? 117.654 87.179  118.963 1.00 357.68 ? 113  SER C N   1 
ATOM   7783  C CA  . SER C 3 113 ? 116.812 86.293  119.735 1.00 367.13 ? 113  SER C CA  1 
ATOM   7784  C C   . SER C 3 113 ? 115.722 87.139  120.339 1.00 345.25 ? 113  SER C C   1 
ATOM   7785  O O   . SER C 3 113 ? 115.927 88.309  120.615 1.00 328.08 ? 113  SER C O   1 
ATOM   7786  C CB  . SER C 3 113 ? 117.608 85.591  120.832 1.00 366.57 ? 113  SER C CB  1 
ATOM   7787  O OG  . SER C 3 113 ? 118.896 86.158  120.970 1.00 354.81 ? 113  SER C OG  1 
ATOM   7788  N N   . ILE C 3 114 ? 114.551 86.558  120.529 1.00 360.98 ? 114  ILE C N   1 
ATOM   7789  C CA  . ILE C 3 114 ? 113.461 87.291  121.131 1.00 349.12 ? 114  ILE C CA  1 
ATOM   7790  C C   . ILE C 3 114 ? 113.938 87.701  122.509 1.00 342.84 ? 114  ILE C C   1 
ATOM   7791  O O   . ILE C 3 114 ? 113.589 88.758  122.997 1.00 347.12 ? 114  ILE C O   1 
ATOM   7792  C CB  . ILE C 3 114 ? 112.193 86.442  121.253 1.00 362.63 ? 114  ILE C CB  1 
ATOM   7793  C CG1 . ILE C 3 114 ? 111.163 87.153  122.124 1.00 355.16 ? 114  ILE C CG1 1 
ATOM   7794  C CG2 . ILE C 3 114 ? 112.525 85.073  121.821 1.00 386.04 ? 114  ILE C CG2 1 
ATOM   7795  C CD1 . ILE C 3 114 ? 111.027 88.620  121.807 1.00 378.15 ? 114  ILE C CD1 1 
ATOM   7796  N N   . ARG C 3 115 ? 114.718 86.843  123.146 1.00 332.66 ? 115  ARG C N   1 
ATOM   7797  C CA  . ARG C 3 115 ? 115.266 87.157  124.456 1.00 341.64 ? 115  ARG C CA  1 
ATOM   7798  C C   . ARG C 3 115 ? 116.201 88.369  124.485 1.00 336.16 ? 115  ARG C C   1 
ATOM   7799  O O   . ARG C 3 115 ? 116.172 89.117  125.440 1.00 374.92 ? 115  ARG C O   1 
ATOM   7800  C CB  . ARG C 3 115 ? 115.938 85.939  125.072 1.00 356.88 ? 115  ARG C CB  1 
ATOM   7801  C CG  . ARG C 3 115 ? 114.950 84.953  125.669 1.00 373.23 ? 115  ARG C CG  1 
ATOM   7802  C CD  . ARG C 3 115 ? 115.586 84.134  126.776 1.00 387.46 ? 115  ARG C CD  1 
ATOM   7803  N NE  . ARG C 3 115 ? 116.123 82.871  126.281 1.00 396.30 ? 115  ARG C NE  1 
ATOM   7804  C CZ  . ARG C 3 115 ? 117.253 82.759  125.593 1.00 398.16 ? 115  ARG C CZ  1 
ATOM   7805  N NH1 . ARG C 3 115 ? 117.971 83.837  125.310 1.00 375.74 ? 115  ARG C NH1 1 
ATOM   7806  N NH2 . ARG C 3 115 ? 117.663 81.569  125.184 1.00 405.44 ? 115  ARG C NH2 1 
ATOM   7807  N N   . GLN C 3 116 ? 117.041 88.561  123.472 1.00 323.57 ? 116  GLN C N   1 
ATOM   7808  C CA  . GLN C 3 116 ? 117.923 89.724  123.450 1.00 329.29 ? 116  GLN C CA  1 
ATOM   7809  C C   . GLN C 3 116 ? 117.160 91.012  123.200 1.00 301.81 ? 116  GLN C C   1 
ATOM   7810  O O   . GLN C 3 116 ? 117.371 92.019  123.845 1.00 322.58 ? 116  GLN C O   1 
ATOM   7811  C CB  . GLN C 3 116 ? 119.009 89.554  122.396 1.00 344.13 ? 116  GLN C CB  1 
ATOM   7812  C CG  . GLN C 3 116 ? 120.073 88.538  122.771 1.00 359.21 ? 116  GLN C CG  1 
ATOM   7813  C CD  . GLN C 3 116 ? 120.725 87.906  121.559 1.00 375.37 ? 116  GLN C CD  1 
ATOM   7814  O OE1 . GLN C 3 116 ? 120.656 88.441  120.454 1.00 385.42 ? 116  GLN C OE1 1 
ATOM   7815  N NE2 . GLN C 3 116 ? 121.366 86.763  121.761 1.00 363.97 ? 116  GLN C NE2 1 
ATOM   7816  N N   . MET C 3 117 ? 116.246 90.942  122.257 1.00 311.95 ? 117  MET C N   1 
ATOM   7817  C CA  . MET C 3 117 ? 115.411 92.071  121.816 1.00 332.17 ? 117  MET C CA  1 
ATOM   7818  C C   . MET C 3 117 ? 114.729 92.716  123.007 1.00 326.59 ? 117  MET C C   1 
ATOM   7819  O O   . MET C 3 117 ? 114.718 93.944  123.144 1.00 327.96 ? 117  MET C O   1 
ATOM   7820  C CB  . MET C 3 117 ? 114.350 91.648  120.786 1.00 347.07 ? 117  MET C CB  1 
ATOM   7821  C CG  . MET C 3 117 ? 114.711 92.002  119.354 1.00 365.97 ? 117  MET C CG  1 
ATOM   7822  S SD  . MET C 3 117 ? 113.326 91.906  118.205 1.00 392.50 ? 117  MET C SD  1 
ATOM   7823  C CE  . MET C 3 117 ? 112.561 90.354  118.674 1.00 395.57 ? 117  MET C CE  1 
ATOM   7824  N N   . ALA C 3 118 ? 114.166 91.861  123.847 1.00 335.93 ? 118  ALA C N   1 
ATOM   7825  C CA  . ALA C 3 118 ? 113.454 92.276  125.064 1.00 343.21 ? 118  ALA C CA  1 
ATOM   7826  C C   . ALA C 3 118 ? 114.380 93.091  125.954 1.00 314.00 ? 118  ALA C C   1 
ATOM   7827  O O   . ALA C 3 118 ? 114.005 94.163  126.455 1.00 300.17 ? 118  ALA C O   1 
ATOM   7828  C CB  . ALA C 3 118 ? 112.971 91.059  125.835 1.00 354.22 ? 118  ALA C CB  1 
ATOM   7829  N N   . TYR C 3 119 ? 115.584 92.553  126.128 1.00 296.49 ? 119  TYR C N   1 
ATOM   7830  C CA  . TYR C 3 119 ? 116.615 93.164  126.968 1.00 297.06 ? 119  TYR C CA  1 
ATOM   7831  C C   . TYR C 3 119 ? 116.930 94.573  126.438 1.00 274.50 ? 119  TYR C C   1 
ATOM   7832  O O   . TYR C 3 119 ? 117.007 95.547  127.215 1.00 296.86 ? 119  TYR C O   1 
ATOM   7833  C CB  . TYR C 3 119 ? 117.902 92.335  127.021 1.00 309.09 ? 119  TYR C CB  1 
ATOM   7834  C CG  . TYR C 3 119 ? 119.093 93.098  127.563 1.00 299.23 ? 119  TYR C CG  1 
ATOM   7835  C CD1 . TYR C 3 119 ? 119.838 93.943  126.737 1.00 310.20 ? 119  TYR C CD1 1 
ATOM   7836  C CD2 . TYR C 3 119 ? 119.472 92.986  128.901 1.00 300.94 ? 119  TYR C CD2 1 
ATOM   7837  C CE1 . TYR C 3 119 ? 120.921 94.654  127.224 1.00 327.66 ? 119  TYR C CE1 1 
ATOM   7838  C CE2 . TYR C 3 119 ? 120.562 93.686  129.398 1.00 318.11 ? 119  TYR C CE2 1 
ATOM   7839  C CZ  . TYR C 3 119 ? 121.287 94.518  128.550 1.00 334.76 ? 119  TYR C CZ  1 
ATOM   7840  O OH  . TYR C 3 119 ? 122.368 95.225  129.016 1.00 330.79 ? 119  TYR C OH  1 
ATOM   7841  N N   . VAL C 3 120 ? 117.127 94.677  125.127 1.00 268.06 ? 120  VAL C N   1 
ATOM   7842  C CA  . VAL C 3 120 ? 117.456 95.953  124.503 1.00 287.69 ? 120  VAL C CA  1 
ATOM   7843  C C   . VAL C 3 120 ? 116.320 96.949  124.690 1.00 278.92 ? 120  VAL C C   1 
ATOM   7844  O O   . VAL C 3 120 ? 116.549 98.128  124.958 1.00 286.64 ? 120  VAL C O   1 
ATOM   7845  C CB  . VAL C 3 120 ? 117.742 95.789  122.998 1.00 300.32 ? 120  VAL C CB  1 
ATOM   7846  C CG1 . VAL C 3 120 ? 117.936 97.148  122.344 1.00 311.29 ? 120  VAL C CG1 1 
ATOM   7847  C CG2 . VAL C 3 120 ? 118.962 94.907  122.783 1.00 334.35 ? 120  VAL C CG2 1 
ATOM   7848  N N   . SER C 3 121 ? 115.092 96.461  124.551 1.00 277.40 ? 121  SER C N   1 
ATOM   7849  C CA  . SER C 3 121 ? 113.901 97.290  124.757 1.00 303.96 ? 121  SER C CA  1 
ATOM   7850  C C   . SER C 3 121 ? 113.902 97.872  126.164 1.00 294.93 ? 121  SER C C   1 
ATOM   7851  O O   . SER C 3 121 ? 113.660 99.075  126.363 1.00 302.80 ? 121  SER C O   1 
ATOM   7852  C CB  . SER C 3 121 ? 112.627 96.469  124.549 1.00 303.72 ? 121  SER C CB  1 
ATOM   7853  O OG  . SER C 3 121 ? 111.481 97.230  124.885 1.00 328.00 ? 121  SER C OG  1 
ATOM   7854  N N   . GLY C 3 122 ? 114.180 96.990  127.116 1.00 298.77 ? 122  GLY C N   1 
ATOM   7855  C CA  . GLY C 3 122 ? 114.232 97.345  128.538 1.00 320.48 ? 122  GLY C CA  1 
ATOM   7856  C C   . GLY C 3 122 ? 115.261 98.445  128.767 1.00 295.77 ? 122  GLY C C   1 
ATOM   7857  O O   . GLY C 3 122 ? 114.992 99.442  129.459 1.00 313.38 ? 122  GLY C O   1 
ATOM   7858  N N   . LEU C 3 123 ? 116.425 98.232  128.165 1.00 289.33 ? 123  LEU C N   1 
ATOM   7859  C CA  . LEU C 3 123 ? 117.547 99.173  128.264 1.00 281.08 ? 123  LEU C CA  1 
ATOM   7860  C C   . LEU C 3 123 ? 117.137 100.540 127.743 1.00 295.02 ? 123  LEU C C   1 
ATOM   7861  O O   . LEU C 3 123 ? 117.411 101.564 128.370 1.00 335.34 ? 123  LEU C O   1 
ATOM   7862  C CB  . LEU C 3 123 ? 118.835 98.684  127.584 1.00 301.71 ? 123  LEU C CB  1 
ATOM   7863  C CG  . LEU C 3 123 ? 120.185 98.914  128.307 1.00 307.65 ? 123  LEU C CG  1 
ATOM   7864  C CD1 . LEU C 3 123 ? 121.178 99.574  127.353 1.00 328.47 ? 123  LEU C CD1 1 
ATOM   7865  C CD2 . LEU C 3 123 ? 120.118 99.706  129.618 1.00 279.97 ? 123  LEU C CD2 1 
ATOM   7866  N N   . SER C 3 124 ? 116.482 100.516 126.594 1.00 298.24 ? 124  SER C N   1 
ATOM   7867  C CA  . SER C 3 124 ? 115.989 101.726 125.921 1.00 315.95 ? 124  SER C CA  1 
ATOM   7868  C C   . SER C 3 124 ? 115.053 102.490 126.842 1.00 299.18 ? 124  SER C C   1 
ATOM   7869  O O   . SER C 3 124 ? 115.176 103.720 126.999 1.00 313.26 ? 124  SER C O   1 
ATOM   7870  C CB  . SER C 3 124 ? 115.211 101.343 124.679 1.00 316.34 ? 124  SER C CB  1 
ATOM   7871  O OG  . SER C 3 124 ? 114.447 102.436 124.230 1.00 349.48 ? 124  SER C OG  1 
ATOM   7872  N N   . PHE C 3 125 ? 114.138 101.734 127.440 1.00 293.15 ? 125  PHE C N   1 
ATOM   7873  C CA  . PHE C 3 125 ? 113.143 102.289 128.365 1.00 296.87 ? 125  PHE C CA  1 
ATOM   7874  C C   . PHE C 3 125 ? 113.841 102.981 129.535 1.00 274.30 ? 125  PHE C C   1 
ATOM   7875  O O   . PHE C 3 125 ? 113.493 104.110 129.916 1.00 308.87 ? 125  PHE C O   1 
ATOM   7876  C CB  . PHE C 3 125 ? 112.079 101.287 128.800 1.00 323.84 ? 125  PHE C CB  1 
ATOM   7877  C CG  . PHE C 3 125 ? 110.837 101.340 127.953 1.00 319.47 ? 125  PHE C CG  1 
ATOM   7878  C CD1 . PHE C 3 125 ? 110.921 101.203 126.579 1.00 286.19 ? 125  PHE C CD1 1 
ATOM   7879  C CD2 . PHE C 3 125 ? 109.588 101.549 128.527 1.00 342.40 ? 125  PHE C CD2 1 
ATOM   7880  C CE1 . PHE C 3 125 ? 109.782 101.260 125.795 1.00 324.04 ? 125  PHE C CE1 1 
ATOM   7881  C CE2 . PHE C 3 125 ? 108.445 101.604 127.744 1.00 328.04 ? 125  PHE C CE2 1 
ATOM   7882  C CZ  . PHE C 3 125 ? 108.541 101.463 126.377 1.00 298.14 ? 125  PHE C CZ  1 
ATOM   7883  N N   . GLY C 3 126 ? 114.823 102.280 130.069 1.00 297.28 ? 126  GLY C N   1 
ATOM   7884  C CA  . GLY C 3 126 ? 115.622 102.762 131.206 1.00 326.03 ? 126  GLY C CA  1 
ATOM   7885  C C   . GLY C 3 126 ? 116.304 104.075 130.837 1.00 305.83 ? 126  GLY C C   1 
ATOM   7886  O O   . GLY C 3 126 ? 116.293 105.027 131.611 1.00 347.05 ? 126  GLY C O   1 
ATOM   7887  N N   . ILE C 3 127 ? 116.892 104.074 129.647 1.00 281.89 ? 127  ILE C N   1 
ATOM   7888  C CA  . ILE C 3 127 ? 117.834 105.118 129.227 1.00 296.54 ? 127  ILE C CA  1 
ATOM   7889  C C   . ILE C 3 127 ? 117.082 106.425 129.134 1.00 299.80 ? 127  ILE C C   1 
ATOM   7890  O O   . ILE C 3 127 ? 117.601 107.437 129.607 1.00 321.87 ? 127  ILE C O   1 
ATOM   7891  C CB  . ILE C 3 127 ? 118.584 104.818 127.887 1.00 295.94 ? 127  ILE C CB  1 
ATOM   7892  C CG1 . ILE C 3 127 ? 120.022 104.371 128.156 1.00 295.94 ? 127  ILE C CG1 1 
ATOM   7893  C CG2 . ILE C 3 127 ? 118.679 106.044 126.967 1.00 316.04 ? 127  ILE C CG2 1 
ATOM   7894  C CD1 . ILE C 3 127 ? 120.146 102.919 128.516 1.00 315.85 ? 127  ILE C CD1 1 
ATOM   7895  N N   . ILE C 3 128 ? 115.894 106.395 128.519 1.00 277.38 ? 128  ILE C N   1 
ATOM   7896  C CA  . ILE C 3 128 ? 115.168 107.602 128.162 1.00 296.92 ? 128  ILE C CA  1 
ATOM   7897  C C   . ILE C 3 128 ? 114.419 108.179 129.358 1.00 304.68 ? 128  ILE C C   1 
ATOM   7898  O O   . ILE C 3 128 ? 114.508 109.396 129.634 1.00 320.84 ? 128  ILE C O   1 
ATOM   7899  C CB  . ILE C 3 128 ? 114.304 107.407 126.885 1.00 288.95 ? 128  ILE C CB  1 
ATOM   7900  C CG1 . ILE C 3 128 ? 113.863 108.753 126.311 1.00 288.81 ? 128  ILE C CG1 1 
ATOM   7901  C CG2 . ILE C 3 128 ? 113.099 106.516 127.128 1.00 330.26 ? 128  ILE C CG2 1 
ATOM   7902  C CD1 . ILE C 3 128 ? 115.005 109.591 125.784 1.00 318.25 ? 128  ILE C CD1 1 
ATOM   7903  N N   . SER C 3 129 ? 113.781 107.281 130.099 1.00 285.01 ? 129  SER C N   1 
ATOM   7904  C CA  . SER C 3 129 ? 113.099 107.633 131.355 1.00 297.22 ? 129  SER C CA  1 
ATOM   7905  C C   . SER C 3 129 ? 114.094 108.255 132.331 1.00 287.84 ? 129  SER C C   1 
ATOM   7906  O O   . SER C 3 129 ? 113.820 109.291 132.953 1.00 300.23 ? 129  SER C O   1 
ATOM   7907  C CB  . SER C 3 129 ? 112.452 106.383 131.968 1.00 298.94 ? 129  SER C CB  1 
ATOM   7908  O OG  . SER C 3 129 ? 111.609 106.710 133.056 1.00 314.40 ? 129  SER C OG  1 
ATOM   7909  N N   . GLY C 3 130 ? 115.234 107.601 132.438 1.00 279.42 ? 130  GLY C N   1 
ATOM   7910  C CA  . GLY C 3 130 ? 116.333 108.027 133.315 1.00 298.33 ? 130  GLY C CA  1 
ATOM   7911  C C   . GLY C 3 130 ? 116.777 109.428 132.949 1.00 297.82 ? 130  GLY C C   1 
ATOM   7912  O O   . GLY C 3 130 ? 116.953 110.284 133.824 1.00 313.98 ? 130  GLY C O   1 
ATOM   7913  N N   . VAL C 3 131 ? 116.952 109.629 131.649 1.00 244.69 ? 131  VAL C N   1 
ATOM   7914  C CA  . VAL C 3 131 ? 117.374 110.927 131.092 1.00 284.59 ? 131  VAL C CA  1 
ATOM   7915  C C   . VAL C 3 131 ? 116.387 112.013 131.493 1.00 278.78 ? 131  VAL C C   1 
ATOM   7916  O O   . VAL C 3 131 ? 116.785 113.100 131.936 1.00 315.28 ? 131  VAL C O   1 
ATOM   7917  C CB  . VAL C 3 131 ? 117.583 110.860 129.551 1.00 301.13 ? 131  VAL C CB  1 
ATOM   7918  C CG1 . VAL C 3 131 ? 117.236 112.164 128.836 1.00 292.91 ? 131  VAL C CG1 1 
ATOM   7919  C CG2 . VAL C 3 131 ? 119.022 110.480 129.245 1.00 314.05 ? 131  VAL C CG2 1 
ATOM   7920  N N   . PHE C 3 132 ? 115.114 111.683 131.322 1.00 261.72 ? 132  PHE C N   1 
ATOM   7921  C CA  . PHE C 3 132 ? 114.017 112.601 131.647 1.00 290.13 ? 132  PHE C CA  1 
ATOM   7922  C C   . PHE C 3 132 ? 114.076 112.997 133.121 1.00 297.01 ? 132  PHE C C   1 
ATOM   7923  O O   . PHE C 3 132 ? 113.954 114.181 133.463 1.00 327.28 ? 132  PHE C O   1 
ATOM   7924  C CB  . PHE C 3 132 ? 112.646 112.139 131.160 1.00 296.16 ? 132  PHE C CB  1 
ATOM   7925  C CG  . PHE C 3 132 ? 112.339 112.604 129.762 1.00 313.58 ? 132  PHE C CG  1 
ATOM   7926  C CD1 . PHE C 3 132 ? 113.235 112.352 128.721 1.00 325.32 ? 132  PHE C CD1 1 
ATOM   7927  C CD2 . PHE C 3 132 ? 111.188 113.323 129.485 1.00 307.53 ? 132  PHE C CD2 1 
ATOM   7928  C CE1 . PHE C 3 132 ? 112.972 112.786 127.432 1.00 310.85 ? 132  PHE C CE1 1 
ATOM   7929  C CE2 . PHE C 3 132 ? 110.919 113.754 128.195 1.00 319.43 ? 132  PHE C CE2 1 
ATOM   7930  C CZ  . PHE C 3 132 ? 111.812 113.489 127.170 1.00 313.45 ? 132  PHE C CZ  1 
ATOM   7931  N N   . SER C 3 133 ? 114.279 111.987 133.952 1.00 307.36 ? 133  SER C N   1 
ATOM   7932  C CA  . SER C 3 133 ? 114.372 112.155 135.402 1.00 317.78 ? 133  SER C CA  1 
ATOM   7933  C C   . SER C 3 133 ? 115.500 113.114 135.747 1.00 305.39 ? 133  SER C C   1 
ATOM   7934  O O   . SER C 3 133 ? 115.312 114.040 136.571 1.00 330.40 ? 133  SER C O   1 
ATOM   7935  C CB  . SER C 3 133 ? 114.609 110.815 136.102 1.00 342.79 ? 133  SER C CB  1 
ATOM   7936  O OG  . SER C 3 133 ? 115.507 110.976 137.183 1.00 353.67 ? 133  SER C OG  1 
ATOM   7937  N N   . VAL C 3 134 ? 116.647 112.891 135.100 1.00 273.94 ? 134  VAL C N   1 
ATOM   7938  C CA  . VAL C 3 134 ? 117.931 113.455 135.657 1.00 292.87 ? 134  VAL C CA  1 
ATOM   7939  C C   . VAL C 3 134 ? 118.545 114.584 134.855 1.00 294.66 ? 134  VAL C C   1 
ATOM   7940  O O   . VAL C 3 134 ? 118.818 115.614 135.421 1.00 315.48 ? 134  VAL C O   1 
ATOM   7941  C CB  . VAL C 3 134 ? 118.942 112.310 135.992 1.00 298.50 ? 134  VAL C CB  1 
ATOM   7942  C CG1 . VAL C 3 134 ? 120.310 112.478 135.338 1.00 315.52 ? 134  VAL C CG1 1 
ATOM   7943  C CG2 . VAL C 3 134 ? 119.132 112.198 137.499 1.00 330.55 ? 134  VAL C CG2 1 
ATOM   7944  N N   . ILE C 3 135 ? 118.687 114.403 133.543 1.00 285.33 ? 135  ILE C N   1 
ATOM   7945  C CA  . ILE C 3 135 ? 119.455 115.309 132.664 1.00 280.38 ? 135  ILE C CA  1 
ATOM   7946  C C   . ILE C 3 135 ? 119.232 116.821 132.884 1.00 297.14 ? 135  ILE C C   1 
ATOM   7947  O O   . ILE C 3 135 ? 120.145 117.617 132.667 1.00 326.04 ? 135  ILE C O   1 
ATOM   7948  C CB  . ILE C 3 135 ? 119.201 114.963 131.172 1.00 307.32 ? 135  ILE C CB  1 
ATOM   7949  C CG1 . ILE C 3 135 ? 120.377 115.386 130.296 1.00 325.26 ? 135  ILE C CG1 1 
ATOM   7950  C CG2 . ILE C 3 135 ? 117.896 115.569 130.666 1.00 331.31 ? 135  ILE C CG2 1 
ATOM   7951  C CD1 . ILE C 3 135 ? 121.588 114.503 130.468 1.00 351.56 ? 135  ILE C CD1 1 
ATOM   7952  N N   . ASN C 3 136 ? 118.028 117.207 133.300 1.00 291.11 ? 136  ASN C N   1 
ATOM   7953  C CA  . ASN C 3 136 ? 117.731 118.600 133.628 1.00 284.33 ? 136  ASN C CA  1 
ATOM   7954  C C   . ASN C 3 136 ? 118.240 119.013 134.998 1.00 293.16 ? 136  ASN C C   1 
ATOM   7955  O O   . ASN C 3 136 ? 118.801 120.096 135.138 1.00 322.74 ? 136  ASN C O   1 
ATOM   7956  C CB  . ASN C 3 136 ? 116.236 118.854 133.548 1.00 309.27 ? 136  ASN C CB  1 
ATOM   7957  C CG  . ASN C 3 136 ? 115.718 118.737 132.139 1.00 323.25 ? 136  ASN C CG  1 
ATOM   7958  O OD1 . ASN C 3 136 ? 115.746 119.697 131.373 1.00 322.26 ? 136  ASN C OD1 1 
ATOM   7959  N ND2 . ASN C 3 136 ? 115.260 117.549 131.782 1.00 334.08 ? 136  ASN C ND2 1 
ATOM   7960  N N   . ILE C 3 137 ? 118.048 118.162 136.003 1.00 283.35 ? 137  ILE C N   1 
ATOM   7961  C CA  . ILE C 3 137 ? 118.556 118.446 137.355 1.00 292.90 ? 137  ILE C CA  1 
ATOM   7962  C C   . ILE C 3 137 ? 120.004 117.989 137.553 1.00 265.88 ? 137  ILE C C   1 
ATOM   7963  O O   . ILE C 3 137 ? 120.602 118.252 138.584 1.00 291.14 ? 137  ILE C O   1 
ATOM   7964  C CB  . ILE C 3 137 ? 117.641 117.883 138.469 1.00 311.15 ? 137  ILE C CB  1 
ATOM   7965  C CG1 . ILE C 3 137 ? 117.913 116.406 138.762 1.00 294.85 ? 137  ILE C CG1 1 
ATOM   7966  C CG2 . ILE C 3 137 ? 116.168 118.120 138.118 1.00 343.65 ? 137  ILE C CG2 1 
ATOM   7967  C CD1 . ILE C 3 137 ? 117.095 115.889 139.920 1.00 325.68 ? 137  ILE C CD1 1 
ATOM   7968  N N   . LEU C 3 138 ? 120.549 117.288 136.572 1.00 273.92 ? 138  LEU C N   1 
ATOM   7969  C CA  . LEU C 3 138 ? 121.983 117.062 136.496 1.00 292.94 ? 138  LEU C CA  1 
ATOM   7970  C C   . LEU C 3 138 ? 122.646 118.366 136.056 1.00 299.68 ? 138  LEU C C   1 
ATOM   7971  O O   . LEU C 3 138 ? 123.764 118.664 136.473 1.00 337.73 ? 138  LEU C O   1 
ATOM   7972  C CB  . LEU C 3 138 ? 122.289 115.938 135.502 1.00 321.67 ? 138  LEU C CB  1 
ATOM   7973  C CG  . LEU C 3 138 ? 123.472 115.006 135.771 1.00 337.71 ? 138  LEU C CG  1 
ATOM   7974  C CD1 . LEU C 3 138 ? 123.340 114.256 137.098 1.00 322.46 ? 138  LEU C CD1 1 
ATOM   7975  C CD2 . LEU C 3 138 ? 123.604 114.045 134.593 1.00 356.53 ? 138  LEU C CD2 1 
ATOM   7976  N N   . ALA C 3 139 ? 121.950 119.138 135.218 1.00 275.93 ? 139  ALA C N   1 
ATOM   7977  C CA  . ALA C 3 139 ? 122.410 120.465 134.807 1.00 296.31 ? 139  ALA C CA  1 
ATOM   7978  C C   . ALA C 3 139 ? 122.584 121.443 135.977 1.00 306.11 ? 139  ALA C C   1 
ATOM   7979  O O   . ALA C 3 139 ? 123.505 122.264 135.965 1.00 308.58 ? 139  ALA C O   1 
ATOM   7980  C CB  . ALA C 3 139 ? 121.470 121.061 133.766 1.00 316.13 ? 139  ALA C CB  1 
ATOM   7981  N N   . ASP C 3 140 ? 121.708 121.355 136.975 1.00 287.90 ? 140  ASP C N   1 
ATOM   7982  C CA  . ASP C 3 140 ? 121.768 122.253 138.139 1.00 304.87 ? 140  ASP C CA  1 
ATOM   7983  C C   . ASP C 3 140 ? 122.886 121.888 139.120 1.00 294.30 ? 140  ASP C C   1 
ATOM   7984  O O   . ASP C 3 140 ? 123.397 122.750 139.842 1.00 290.37 ? 140  ASP C O   1 
ATOM   7985  C CB  . ASP C 3 140 ? 120.423 122.289 138.856 1.00 301.96 ? 140  ASP C CB  1 
ATOM   7986  C CG  . ASP C 3 140 ? 119.307 122.787 137.964 1.00 355.99 ? 140  ASP C CG  1 
ATOM   7987  O OD1 . ASP C 3 140 ? 119.366 122.550 136.738 1.00 379.33 ? 140  ASP C OD1 1 
ATOM   7988  O OD2 . ASP C 3 140 ? 118.370 123.418 138.482 1.00 384.70 ? 140  ASP C OD2 1 
ATOM   7989  N N   . ALA C 3 141 ? 123.265 120.615 139.138 1.00 277.76 ? 141  ALA C N   1 
ATOM   7990  C CA  . ALA C 3 141 ? 124.405 120.167 139.923 1.00 293.03 ? 141  ALA C CA  1 
ATOM   7991  C C   . ALA C 3 141 ? 125.728 120.729 139.430 1.00 293.10 ? 141  ALA C C   1 
ATOM   7992  O O   . ALA C 3 141 ? 126.673 120.780 140.216 1.00 320.16 ? 141  ALA C O   1 
ATOM   7993  C CB  . ALA C 3 141 ? 124.470 118.647 139.960 1.00 328.06 ? 141  ALA C CB  1 
ATOM   7994  N N   . LEU C 3 142 ? 125.811 121.141 138.159 1.00 260.82 ? 142  LEU C N   1 
ATOM   7995  C CA  . LEU C 3 142 ? 127.057 121.736 137.633 1.00 294.48 ? 142  LEU C CA  1 
ATOM   7996  C C   . LEU C 3 142 ? 127.474 123.041 138.313 1.00 304.85 ? 142  LEU C C   1 
ATOM   7997  O O   . LEU C 3 142 ? 128.669 123.338 138.387 1.00 299.44 ? 142  LEU C O   1 
ATOM   7998  C CB  . LEU C 3 142 ? 126.996 121.941 136.114 1.00 311.99 ? 142  LEU C CB  1 
ATOM   7999  C CG  . LEU C 3 142 ? 127.407 120.696 135.326 1.00 345.73 ? 142  LEU C CG  1 
ATOM   8000  C CD1 . LEU C 3 142 ? 126.905 120.738 133.892 1.00 373.01 ? 142  LEU C CD1 1 
ATOM   8001  C CD2 . LEU C 3 142 ? 128.919 120.501 135.354 1.00 338.62 ? 142  LEU C CD2 1 
ATOM   8002  N N   . GLY C 3 143 ? 126.501 123.807 138.808 1.00 310.72 ? 143  GLY C N   1 
ATOM   8003  C CA  . GLY C 3 143 ? 126.784 125.040 139.544 1.00 320.62 ? 143  GLY C CA  1 
ATOM   8004  C C   . GLY C 3 143 ? 127.365 124.788 140.927 1.00 290.75 ? 143  GLY C C   1 
ATOM   8005  O O   . GLY C 3 143 ? 127.308 123.663 141.422 1.00 320.54 ? 143  GLY C O   1 
ATOM   8006  N N   . PRO C 3 144 ? 127.906 125.837 141.574 1.00 273.38 ? 144  PRO C N   1 
ATOM   8007  C CA  . PRO C 3 144 ? 128.564 125.684 142.875 1.00 284.15 ? 144  PRO C CA  1 
ATOM   8008  C C   . PRO C 3 144 ? 127.615 125.290 143.999 1.00 276.12 ? 144  PRO C C   1 
ATOM   8009  O O   . PRO C 3 144 ? 128.045 124.681 144.981 1.00 290.82 ? 144  PRO C O   1 
ATOM   8010  C CB  . PRO C 3 144 ? 129.106 127.083 143.149 1.00 293.92 ? 144  PRO C CB  1 
ATOM   8011  C CG  . PRO C 3 144 ? 128.109 127.969 142.494 1.00 304.12 ? 144  PRO C CG  1 
ATOM   8012  C CD  . PRO C 3 144 ? 127.765 127.260 141.214 1.00 290.43 ? 144  PRO C CD  1 
ATOM   8013  N N   . GLY C 3 145 ? 126.344 125.645 143.857 1.00 248.38 ? 145  GLY C N   1 
ATOM   8014  C CA  . GLY C 3 145 ? 125.363 125.400 144.889 1.00 279.21 ? 145  GLY C CA  1 
ATOM   8015  C C   . GLY C 3 145 ? 124.865 123.972 144.937 1.00 261.04 ? 145  GLY C C   1 
ATOM   8016  O O   . GLY C 3 145 ? 124.501 123.404 143.909 1.00 257.18 ? 145  GLY C O   1 
ATOM   8017  N N   . VAL C 3 146 ? 124.855 123.407 146.144 1.00 268.75 ? 146  VAL C N   1 
ATOM   8018  C CA  . VAL C 3 146 ? 124.141 122.170 146.439 1.00 276.50 ? 146  VAL C CA  1 
ATOM   8019  C C   . VAL C 3 146 ? 122.742 122.585 146.861 1.00 254.57 ? 146  VAL C C   1 
ATOM   8020  O O   . VAL C 3 146 ? 122.526 123.752 147.173 1.00 279.83 ? 146  VAL C O   1 
ATOM   8021  C CB  . VAL C 3 146 ? 124.859 121.370 147.553 1.00 296.20 ? 146  VAL C CB  1 
ATOM   8022  C CG1 . VAL C 3 146 ? 124.303 121.684 148.939 1.00 283.41 ? 146  VAL C CG1 1 
ATOM   8023  C CG2 . VAL C 3 146 ? 124.783 119.876 147.276 1.00 340.91 ? 146  VAL C CG2 1 
ATOM   8024  N N   . VAL C 3 147 ? 121.800 121.647 146.896 1.00 257.71 ? 147  VAL C N   1 
ATOM   8025  C CA  . VAL C 3 147 ? 120.417 121.972 147.275 1.00 274.32 ? 147  VAL C CA  1 
ATOM   8026  C C   . VAL C 3 147 ? 120.326 122.099 148.788 1.00 276.25 ? 147  VAL C C   1 
ATOM   8027  O O   . VAL C 3 147 ? 121.098 121.463 149.499 1.00 261.43 ? 147  VAL C O   1 
ATOM   8028  C CB  . VAL C 3 147 ? 119.424 120.908 146.777 1.00 295.59 ? 147  VAL C CB  1 
ATOM   8029  C CG1 . VAL C 3 147 ? 118.002 121.225 147.229 1.00 295.43 ? 147  VAL C CG1 1 
ATOM   8030  C CG2 . VAL C 3 147 ? 119.480 120.785 145.255 1.00 318.24 ? 147  VAL C CG2 1 
ATOM   8031  N N   . GLY C 3 148 ? 119.406 122.944 149.268 1.00 296.27 ? 148  GLY C N   1 
ATOM   8032  C CA  . GLY C 3 148 ? 119.139 123.095 150.709 1.00 318.54 ? 148  GLY C CA  1 
ATOM   8033  C C   . GLY C 3 148 ? 118.969 124.485 151.318 1.00 307.99 ? 148  GLY C C   1 
ATOM   8034  O O   . GLY C 3 148 ? 118.885 124.599 152.544 1.00 306.10 ? 148  GLY C O   1 
ATOM   8035  N N   . ILE C 3 149 ? 118.913 125.537 150.498 1.00 305.96 ? 149  ILE C N   1 
ATOM   8036  C CA  . ILE C 3 149 ? 118.651 126.898 150.998 1.00 302.69 ? 149  ILE C CA  1 
ATOM   8037  C C   . ILE C 3 149 ? 117.253 127.035 151.615 1.00 303.49 ? 149  ILE C C   1 
ATOM   8038  O O   . ILE C 3 149 ? 117.045 127.886 152.479 1.00 310.92 ? 149  ILE C O   1 
ATOM   8039  C CB  . ILE C 3 149 ? 118.857 127.960 149.888 1.00 317.64 ? 149  ILE C CB  1 
ATOM   8040  C CG1 . ILE C 3 149 ? 119.131 129.348 150.471 1.00 331.99 ? 149  ILE C CG1 1 
ATOM   8041  C CG2 . ILE C 3 149 ? 117.653 128.037 148.951 1.00 351.79 ? 149  ILE C CG2 1 
ATOM   8042  C CD1 . ILE C 3 149 ? 120.476 129.504 151.126 1.00 325.26 ? 149  ILE C CD1 1 
ATOM   8043  N N   . HIS C 3 150 ? 116.310 126.202 151.167 1.00 293.74 ? 150  HIS C N   1 
ATOM   8044  C CA  . HIS C 3 150 ? 114.965 126.157 151.739 1.00 313.80 ? 150  HIS C CA  1 
ATOM   8045  C C   . HIS C 3 150 ? 114.670 124.860 152.513 1.00 321.82 ? 150  HIS C C   1 
ATOM   8046  O O   . HIS C 3 150 ? 113.539 124.360 152.504 1.00 296.74 ? 150  HIS C O   1 
ATOM   8047  C CB  . HIS C 3 150 ? 113.944 126.366 150.628 1.00 333.86 ? 150  HIS C CB  1 
ATOM   8048  C CG  . HIS C 3 150 ? 114.121 127.650 149.887 1.00 309.06 ? 150  HIS C CG  1 
ATOM   8049  N ND1 . HIS C 3 150 ? 114.212 127.712 148.515 1.00 328.97 ? 150  HIS C ND1 1 
ATOM   8050  C CD2 . HIS C 3 150 ? 114.232 128.922 150.330 1.00 313.99 ? 150  HIS C CD2 1 
ATOM   8051  C CE1 . HIS C 3 150 ? 114.362 128.969 148.142 1.00 336.00 ? 150  HIS C CE1 1 
ATOM   8052  N NE2 . HIS C 3 150 ? 114.376 129.724 149.225 1.00 339.81 ? 150  HIS C NE2 1 
ATOM   8053  N N   . GLY C 3 151 ? 115.686 124.328 153.193 1.00 349.64 ? 151  GLY C N   1 
ATOM   8054  C CA  . GLY C 3 151 ? 115.518 123.172 154.078 1.00 369.44 ? 151  GLY C CA  1 
ATOM   8055  C C   . GLY C 3 151 ? 115.278 121.820 153.421 1.00 348.04 ? 151  GLY C C   1 
ATOM   8056  O O   . GLY C 3 151 ? 114.759 120.905 154.066 1.00 350.23 ? 151  GLY C O   1 
ATOM   8057  N N   . ASP C 3 152 ? 115.648 121.690 152.149 1.00 335.07 ? 152  ASP C N   1 
ATOM   8058  C CA  . ASP C 3 152 ? 115.653 120.396 151.466 1.00 337.09 ? 152  ASP C CA  1 
ATOM   8059  C C   . ASP C 3 152 ? 116.988 119.707 151.728 1.00 321.30 ? 152  ASP C C   1 
ATOM   8060  O O   . ASP C 3 152 ? 117.893 120.300 152.322 1.00 327.29 ? 152  ASP C O   1 
ATOM   8061  C CB  . ASP C 3 152 ? 115.419 120.575 149.964 1.00 347.28 ? 152  ASP C CB  1 
ATOM   8062  C CG  . ASP C 3 152 ? 114.012 121.041 149.651 1.00 367.09 ? 152  ASP C CG  1 
ATOM   8063  O OD1 . ASP C 3 152 ? 113.076 120.222 149.766 1.00 372.44 ? 152  ASP C OD1 1 
ATOM   8064  O OD2 . ASP C 3 152 ? 113.840 122.224 149.284 1.00 381.48 ? 152  ASP C OD2 1 
ATOM   8065  N N   . SER C 3 153 ? 117.103 118.454 151.298 1.00 308.77 ? 153  SER C N   1 
ATOM   8066  C CA  . SER C 3 153 ? 118.324 117.684 151.514 1.00 303.64 ? 153  SER C CA  1 
ATOM   8067  C C   . SER C 3 153 ? 119.501 118.266 150.743 1.00 277.31 ? 153  SER C C   1 
ATOM   8068  O O   . SER C 3 153 ? 119.326 118.743 149.626 1.00 312.49 ? 153  SER C O   1 
ATOM   8069  C CB  . SER C 3 153 ? 118.141 116.227 151.091 1.00 320.51 ? 153  SER C CB  1 
ATOM   8070  O OG  . SER C 3 153 ? 119.371 115.513 151.152 1.00 306.21 ? 153  SER C OG  1 
ATOM   8071  N N   . PRO C 3 154 ? 120.700 118.244 151.343 1.00 274.10 ? 154  PRO C N   1 
ATOM   8072  C CA  . PRO C 3 154 ? 121.901 118.458 150.548 1.00 297.46 ? 154  PRO C CA  1 
ATOM   8073  C C   . PRO C 3 154 ? 122.225 117.237 149.703 1.00 305.58 ? 154  PRO C C   1 
ATOM   8074  O O   . PRO C 3 154 ? 122.756 117.379 148.602 1.00 321.79 ? 154  PRO C O   1 
ATOM   8075  C CB  . PRO C 3 154 ? 122.983 118.697 151.600 1.00 339.35 ? 154  PRO C CB  1 
ATOM   8076  C CG  . PRO C 3 154 ? 122.500 117.964 152.797 1.00 356.91 ? 154  PRO C CG  1 
ATOM   8077  C CD  . PRO C 3 154 ? 121.009 118.099 152.777 1.00 318.06 ? 154  PRO C CD  1 
ATOM   8078  N N   . TYR C 3 155 ? 121.876 116.050 150.203 1.00 317.40 ? 155  TYR C N   1 
ATOM   8079  C CA  . TYR C 3 155 ? 122.127 114.797 149.488 1.00 318.90 ? 155  TYR C CA  1 
ATOM   8080  C C   . TYR C 3 155 ? 121.170 114.591 148.321 1.00 299.47 ? 155  TYR C C   1 
ATOM   8081  O O   . TYR C 3 155 ? 121.280 113.593 147.614 1.00 344.59 ? 155  TYR C O   1 
ATOM   8082  C CB  . TYR C 3 155 ? 122.058 113.599 150.443 1.00 323.28 ? 155  TYR C CB  1 
ATOM   8083  C CG  . TYR C 3 155 ? 122.955 113.744 151.652 1.00 333.50 ? 155  TYR C CG  1 
ATOM   8084  C CD1 . TYR C 3 155 ? 124.315 114.017 151.505 1.00 330.33 ? 155  TYR C CD1 1 
ATOM   8085  C CD2 . TYR C 3 155 ? 122.445 113.629 152.944 1.00 361.62 ? 155  TYR C CD2 1 
ATOM   8086  C CE1 . TYR C 3 155 ? 125.140 114.165 152.609 1.00 363.62 ? 155  TYR C CE1 1 
ATOM   8087  C CE2 . TYR C 3 155 ? 123.265 113.773 154.056 1.00 387.71 ? 155  TYR C CE2 1 
ATOM   8088  C CZ  . TYR C 3 155 ? 124.612 114.041 153.884 1.00 379.95 ? 155  TYR C CZ  1 
ATOM   8089  O OH  . TYR C 3 155 ? 125.434 114.183 154.981 1.00 388.58 ? 155  TYR C OH  1 
ATOM   8090  N N   . TYR C 3 156 ? 120.238 115.527 148.132 1.00 293.31 ? 156  TYR C N   1 
ATOM   8091  C CA  . TYR C 3 156 ? 119.314 115.549 146.986 1.00 289.04 ? 156  TYR C CA  1 
ATOM   8092  C C   . TYR C 3 156 ? 119.810 115.002 145.657 1.00 280.29 ? 156  TYR C C   1 
ATOM   8093  O O   . TYR C 3 156 ? 119.185 114.070 145.145 1.00 308.45 ? 156  TYR C O   1 
ATOM   8094  C CB  . TYR C 3 156 ? 118.790 116.970 146.757 1.00 292.74 ? 156  TYR C CB  1 
ATOM   8095  C CG  . TYR C 3 156 ? 117.688 117.069 145.735 1.00 281.28 ? 156  TYR C CG  1 
ATOM   8096  C CD1 . TYR C 3 156 ? 117.972 117.216 144.375 1.00 277.87 ? 156  TYR C CD1 1 
ATOM   8097  C CD2 . TYR C 3 156 ? 116.354 117.035 146.127 1.00 285.06 ? 156  TYR C CD2 1 
ATOM   8098  C CE1 . TYR C 3 156 ? 116.952 117.314 143.440 1.00 284.71 ? 156  TYR C CE1 1 
ATOM   8099  C CE2 . TYR C 3 156 ? 115.332 117.138 145.197 1.00 294.99 ? 156  TYR C CE2 1 
ATOM   8100  C CZ  . TYR C 3 156 ? 115.634 117.275 143.859 1.00 273.25 ? 156  TYR C CZ  1 
ATOM   8101  O OH  . TYR C 3 156 ? 114.609 117.365 142.952 1.00 281.24 ? 156  TYR C OH  1 
ATOM   8102  N N   . PHE C 3 157 ? 120.796 115.681 145.070 1.00 259.51 ? 157  PHE C N   1 
ATOM   8103  C CA  . PHE C 3 157 ? 121.238 115.411 143.706 1.00 293.55 ? 157  PHE C CA  1 
ATOM   8104  C C   . PHE C 3 157 ? 121.673 113.959 143.562 1.00 289.29 ? 157  PHE C C   1 
ATOM   8105  O O   . PHE C 3 157 ? 121.287 113.250 142.617 1.00 309.64 ? 157  PHE C O   1 
ATOM   8106  C CB  . PHE C 3 157 ? 122.496 116.221 143.333 1.00 286.06 ? 157  PHE C CB  1 
ATOM   8107  C CG  . PHE C 3 157 ? 122.229 117.616 142.890 1.00 271.70 ? 157  PHE C CG  1 
ATOM   8108  C CD1 . PHE C 3 157 ? 121.290 117.880 141.909 1.00 276.01 ? 157  PHE C CD1 1 
ATOM   8109  C CD2 . PHE C 3 157 ? 122.952 118.671 143.428 1.00 288.37 ? 157  PHE C CD2 1 
ATOM   8110  C CE1 . PHE C 3 157 ? 121.050 119.171 141.498 1.00 295.31 ? 157  PHE C CE1 1 
ATOM   8111  C CE2 . PHE C 3 157 ? 122.712 119.969 143.019 1.00 303.97 ? 157  PHE C CE2 1 
ATOM   8112  C CZ  . PHE C 3 157 ? 121.763 120.215 142.044 1.00 288.14 ? 157  PHE C CZ  1 
ATOM   8113  N N   . LEU C 3 158 ? 122.493 113.558 144.525 1.00 287.27 ? 158  LEU C N   1 
ATOM   8114  C CA  . LEU C 3 158 ? 123.051 112.196 144.579 1.00 291.06 ? 158  LEU C CA  1 
ATOM   8115  C C   . LEU C 3 158 ? 121.923 111.177 144.625 1.00 270.93 ? 158  LEU C C   1 
ATOM   8116  O O   . LEU C 3 158 ? 121.942 110.173 143.890 1.00 285.72 ? 158  LEU C O   1 
ATOM   8117  C CB  . LEU C 3 158 ? 123.937 112.037 145.817 1.00 307.43 ? 158  LEU C CB  1 
ATOM   8118  C CG  . LEU C 3 158 ? 124.813 110.789 145.873 1.00 322.69 ? 158  LEU C CG  1 
ATOM   8119  C CD1 . LEU C 3 158 ? 126.045 110.980 145.004 1.00 329.67 ? 158  LEU C CD1 1 
ATOM   8120  C CD2 . LEU C 3 158 ? 125.212 110.484 147.306 1.00 345.67 ? 158  LEU C CD2 1 
ATOM   8121  N N   . THR C 3 159 ? 120.960 111.464 145.499 1.00 272.87 ? 159  THR C N   1 
ATOM   8122  C CA  . THR C 3 159 ? 119.786 110.606 145.697 1.00 278.68 ? 159  THR C CA  1 
ATOM   8123  C C   . THR C 3 159 ? 119.039 110.428 144.383 1.00 275.12 ? 159  THR C C   1 
ATOM   8124  O O   . THR C 3 159 ? 118.668 109.303 144.002 1.00 301.40 ? 159  THR C O   1 
ATOM   8125  C CB  . THR C 3 159 ? 118.758 111.238 146.669 1.00 273.79 ? 159  THR C CB  1 
ATOM   8126  O OG1 . THR C 3 159 ? 119.433 111.871 147.761 1.00 325.74 ? 159  THR C OG1 1 
ATOM   8127  C CG2 . THR C 3 159 ? 117.817 110.187 147.202 1.00 284.54 ? 159  THR C CG2 1 
ATOM   8128  N N   . SER C 3 160 ? 118.836 111.559 143.719 1.00 279.58 ? 160  SER C N   1 
ATOM   8129  C CA  . SER C 3 160 ? 118.127 111.609 142.435 1.00 282.97 ? 160  SER C CA  1 
ATOM   8130  C C   . SER C 3 160 ? 118.828 110.730 141.415 1.00 267.40 ? 160  SER C C   1 
ATOM   8131  O O   . SER C 3 160 ? 118.183 109.945 140.705 1.00 300.95 ? 160  SER C O   1 
ATOM   8132  C CB  . SER C 3 160 ? 117.994 113.022 141.903 1.00 297.51 ? 160  SER C CB  1 
ATOM   8133  O OG  . SER C 3 160 ? 117.006 113.041 140.891 1.00 315.61 ? 160  SER C OG  1 
ATOM   8134  N N   . ALA C 3 161 ? 120.145 110.884 141.371 1.00 273.61 ? 161  ALA C N   1 
ATOM   8135  C CA  . ALA C 3 161 ? 121.006 110.129 140.451 1.00 294.41 ? 161  ALA C CA  1 
ATOM   8136  C C   . ALA C 3 161 ? 120.834 108.636 140.686 1.00 283.02 ? 161  ALA C C   1 
ATOM   8137  O O   . ALA C 3 161 ? 120.672 107.854 139.729 1.00 292.80 ? 161  ALA C O   1 
ATOM   8138  C CB  . ALA C 3 161 ? 122.465 110.525 140.606 1.00 318.30 ? 161  ALA C CB  1 
ATOM   8139  N N   . PHE C 3 162 ? 120.873 108.275 141.966 1.00 289.42 ? 162  PHE C N   1 
ATOM   8140  C CA  . PHE C 3 162 ? 120.732 106.877 142.388 1.00 280.25 ? 162  PHE C CA  1 
ATOM   8141  C C   . PHE C 3 162 ? 119.404 106.312 141.913 1.00 279.08 ? 162  PHE C C   1 
ATOM   8142  O O   . PHE C 3 162 ? 119.347 105.195 141.367 1.00 321.05 ? 162  PHE C O   1 
ATOM   8143  C CB  . PHE C 3 162 ? 121.019 106.599 143.862 1.00 279.70 ? 162  PHE C CB  1 
ATOM   8144  C CG  . PHE C 3 162 ? 122.462 106.290 144.109 1.00 289.19 ? 162  PHE C CG  1 
ATOM   8145  C CD1 . PHE C 3 162 ? 123.028 105.163 143.543 1.00 303.78 ? 162  PHE C CD1 1 
ATOM   8146  C CD2 . PHE C 3 162 ? 123.274 107.154 144.830 1.00 299.10 ? 162  PHE C CD2 1 
ATOM   8147  C CE1 . PHE C 3 162 ? 124.367 104.878 143.717 1.00 332.88 ? 162  PHE C CE1 1 
ATOM   8148  C CE2 . PHE C 3 162 ? 124.613 106.875 145.009 1.00 301.85 ? 162  PHE C CE2 1 
ATOM   8149  C CZ  . PHE C 3 162 ? 125.160 105.734 144.453 1.00 322.17 ? 162  PHE C CZ  1 
ATOM   8150  N N   . LEU C 3 163 ? 118.365 107.107 142.121 1.00 282.73 ? 163  LEU C N   1 
ATOM   8151  C CA  . LEU C 3 163 ? 116.998 106.744 141.734 1.00 292.71 ? 163  LEU C CA  1 
ATOM   8152  C C   . LEU C 3 163 ? 116.932 106.473 140.234 1.00 281.03 ? 163  LEU C C   1 
ATOM   8153  O O   . LEU C 3 163 ? 116.355 105.467 139.792 1.00 279.87 ? 163  LEU C O   1 
ATOM   8154  C CB  . LEU C 3 163 ? 116.034 107.835 142.203 1.00 285.49 ? 163  LEU C CB  1 
ATOM   8155  C CG  . LEU C 3 163 ? 114.561 107.499 142.353 1.00 312.96 ? 163  LEU C CG  1 
ATOM   8156  C CD1 . LEU C 3 163 ? 114.368 106.350 143.338 1.00 327.81 ? 163  LEU C CD1 1 
ATOM   8157  C CD2 . LEU C 3 163 ? 113.795 108.755 142.772 1.00 342.15 ? 163  LEU C CD2 1 
ATOM   8158  N N   . THR C 3 164 ? 117.541 107.384 139.488 1.00 266.78 ? 164  THR C N   1 
ATOM   8159  C CA  . THR C 3 164 ? 117.597 107.310 138.022 1.00 291.47 ? 164  THR C CA  1 
ATOM   8160  C C   . THR C 3 164 ? 118.252 106.011 137.590 1.00 296.04 ? 164  THR C C   1 
ATOM   8161  O O   . THR C 3 164 ? 117.747 105.307 136.700 1.00 307.88 ? 164  THR C O   1 
ATOM   8162  C CB  . THR C 3 164 ? 118.381 108.506 137.436 1.00 294.57 ? 164  THR C CB  1 
ATOM   8163  O OG1 . THR C 3 164 ? 117.578 109.681 137.536 1.00 297.26 ? 164  THR C OG1 1 
ATOM   8164  C CG2 . THR C 3 164 ? 118.760 108.289 135.969 1.00 303.25 ? 164  THR C CG2 1 
ATOM   8165  N N   . ALA C 3 165 ? 119.377 105.726 138.239 1.00 271.60 ? 165  ALA C N   1 
ATOM   8166  C CA  . ALA C 3 165 ? 120.165 104.515 137.969 1.00 295.24 ? 165  ALA C CA  1 
ATOM   8167  C C   . ALA C 3 165 ? 119.309 103.276 138.176 1.00 298.30 ? 165  ALA C C   1 
ATOM   8168  O O   . ALA C 3 165 ? 119.297 102.358 137.333 1.00 310.72 ? 165  ALA C O   1 
ATOM   8169  C CB  . ALA C 3 165 ? 121.371 104.444 138.885 1.00 312.73 ? 165  ALA C CB  1 
ATOM   8170  N N   . ALA C 3 166 ? 118.606 103.284 139.304 1.00 274.46 ? 166  ALA C N   1 
ATOM   8171  C CA  . ALA C 3 166 ? 117.724 102.179 139.695 1.00 289.25 ? 166  ALA C CA  1 
ATOM   8172  C C   . ALA C 3 166 ? 116.666 101.948 138.619 1.00 300.52 ? 166  ALA C C   1 
ATOM   8173  O O   . ALA C 3 166 ? 116.414 100.802 138.205 1.00 346.07 ? 166  ALA C O   1 
ATOM   8174  C CB  . ALA C 3 166 ? 117.069 102.443 141.040 1.00 293.85 ? 166  ALA C CB  1 
ATOM   8175  N N   . ILE C 3 167 ? 116.077 103.056 138.190 1.00 269.28 ? 167  ILE C N   1 
ATOM   8176  C CA  . ILE C 3 167 ? 115.025 103.048 137.171 1.00 296.75 ? 167  ILE C CA  1 
ATOM   8177  C C   . ILE C 3 167 ? 115.551 102.422 135.883 1.00 290.27 ? 167  ILE C C   1 
ATOM   8178  O O   . ILE C 3 167 ? 114.878 101.574 135.276 1.00 329.44 ? 167  ILE C O   1 
ATOM   8179  C CB  . ILE C 3 167 ? 114.374 104.444 136.997 1.00 318.69 ? 167  ILE C CB  1 
ATOM   8180  C CG1 . ILE C 3 167 ? 113.527 104.782 138.240 1.00 344.92 ? 167  ILE C CG1 1 
ATOM   8181  C CG2 . ILE C 3 167 ? 113.500 104.525 135.755 1.00 319.77 ? 167  ILE C CG2 1 
ATOM   8182  C CD1 . ILE C 3 167 ? 112.289 103.927 138.474 1.00 329.31 ? 167  ILE C CD1 1 
ATOM   8183  N N   . ILE C 3 168 ? 116.751 102.852 135.507 1.00 264.94 ? 168  ILE C N   1 
ATOM   8184  C CA  . ILE C 3 168 ? 117.410 102.367 134.293 1.00 272.72 ? 168  ILE C CA  1 
ATOM   8185  C C   . ILE C 3 168 ? 117.606 100.859 134.372 1.00 288.12 ? 168  ILE C C   1 
ATOM   8186  O O   . ILE C 3 168 ? 117.306 100.115 133.414 1.00 296.61 ? 168  ILE C O   1 
ATOM   8187  C CB  . ILE C 3 168 ? 118.710 103.091 133.868 1.00 290.01 ? 168  ILE C CB  1 
ATOM   8188  C CG1 . ILE C 3 168 ? 118.477 104.590 133.652 1.00 279.65 ? 168  ILE C CG1 1 
ATOM   8189  C CG2 . ILE C 3 168 ? 119.215 102.507 132.544 1.00 286.99 ? 168  ILE C CG2 1 
ATOM   8190  C CD1 . ILE C 3 168 ? 119.735 105.422 133.550 1.00 310.03 ? 168  ILE C CD1 1 
ATOM   8191  N N   . LEU C 3 169 ? 118.084 100.427 135.533 1.00 291.57 ? 169  LEU C N   1 
ATOM   8192  C CA  . LEU C 3 169 ? 118.346 99.004  135.800 1.00 289.39 ? 169  LEU C CA  1 
ATOM   8193  C C   . LEU C 3 169 ? 117.054 98.231  135.692 1.00 297.37 ? 169  LEU C C   1 
ATOM   8194  O O   . LEU C 3 169 ? 116.940 97.170  135.061 1.00 306.04 ? 169  LEU C O   1 
ATOM   8195  C CB  . LEU C 3 169 ? 118.996 98.751  137.163 1.00 275.41 ? 169  LEU C CB  1 
ATOM   8196  C CG  . LEU C 3 169 ? 120.522 98.794  137.169 1.00 327.91 ? 169  LEU C CG  1 
ATOM   8197  C CD1 . LEU C 3 169 ? 121.046 98.640  138.592 1.00 343.20 ? 169  LEU C CD1 1 
ATOM   8198  C CD2 . LEU C 3 169 ? 121.110 97.730  136.246 1.00 334.52 ? 169  LEU C CD2 1 
ATOM   8199  N N   . LEU C 3 170 ? 116.070 98.838  136.341 1.00 297.63 ? 170  LEU C N   1 
ATOM   8200  C CA  . LEU C 3 170 ? 114.796 98.236  136.622 1.00 304.02 ? 170  LEU C CA  1 
ATOM   8201  C C   . LEU C 3 170 ? 113.966 98.089  135.360 1.00 305.40 ? 170  LEU C C   1 
ATOM   8202  O O   . LEU C 3 170 ? 113.302 97.051  135.203 1.00 321.94 ? 170  LEU C O   1 
ATOM   8203  C CB  . LEU C 3 170 ? 114.103 99.061  137.722 1.00 280.62 ? 170  LEU C CB  1 
ATOM   8204  C CG  . LEU C 3 170 ? 112.855 98.624  138.472 1.00 294.79 ? 170  LEU C CG  1 
ATOM   8205  C CD1 . LEU C 3 170 ? 112.665 97.121  138.500 1.00 334.01 ? 170  LEU C CD1 1 
ATOM   8206  C CD2 . LEU C 3 170 ? 112.888 99.156  139.891 1.00 298.29 ? 170  LEU C CD2 1 
ATOM   8207  N N   . HIS C 3 171 ? 114.040 99.080  134.468 1.00 284.11 ? 171  HIS C N   1 
ATOM   8208  C CA  . HIS C 3 171 ? 113.318 98.999  133.200 1.00 288.21 ? 171  HIS C CA  1 
ATOM   8209  C C   . HIS C 3 171 ? 113.783 97.809  132.386 1.00 303.19 ? 171  HIS C C   1 
ATOM   8210  O O   . HIS C 3 171 ? 112.946 97.084  131.827 1.00 301.50 ? 171  HIS C O   1 
ATOM   8211  C CB  . HIS C 3 171 ? 113.403 100.268 132.350 1.00 282.35 ? 171  HIS C CB  1 
ATOM   8212  C CG  . HIS C 3 171 ? 112.278 101.218 132.585 1.00 278.37 ? 171  HIS C CG  1 
ATOM   8213  N ND1 . HIS C 3 171 ? 111.016 101.017 132.075 1.00 268.98 ? 171  HIS C ND1 1 
ATOM   8214  C CD2 . HIS C 3 171 ? 112.220 102.368 133.294 1.00 306.50 ? 171  HIS C CD2 1 
ATOM   8215  C CE1 . HIS C 3 171 ? 110.230 102.009 132.451 1.00 316.38 ? 171  HIS C CE1 1 
ATOM   8216  N NE2 . HIS C 3 171 ? 110.935 102.843 133.195 1.00 312.95 ? 171  HIS C NE2 1 
ATOM   8217  N N   . THR C 3 172 ? 115.099 97.609  132.365 1.00 286.88 ? 172  THR C N   1 
ATOM   8218  C CA  . THR C 3 172 ? 115.720 96.498  131.646 1.00 291.13 ? 172  THR C CA  1 
ATOM   8219  C C   . THR C 3 172 ? 115.164 95.164  132.184 1.00 282.69 ? 172  THR C C   1 
ATOM   8220  O O   . THR C 3 172 ? 114.789 94.267  131.409 1.00 306.65 ? 172  THR C O   1 
ATOM   8221  C CB  . THR C 3 172 ? 117.257 96.545  131.777 1.00 292.37 ? 172  THR C CB  1 
ATOM   8222  O OG1 . THR C 3 172 ? 117.745 97.732  131.144 1.00 266.85 ? 172  THR C OG1 1 
ATOM   8223  C CG2 . THR C 3 172 ? 117.919 95.339  131.125 1.00 315.27 ? 172  THR C CG2 1 
ATOM   8224  N N   . PHE C 3 173 ? 115.129 95.081  133.505 1.00 275.35 ? 173  PHE C N   1 
ATOM   8225  C CA  . PHE C 3 173 ? 114.650 93.860  134.153 1.00 278.23 ? 173  PHE C CA  1 
ATOM   8226  C C   . PHE C 3 173 ? 113.200 93.601  133.814 1.00 298.03 ? 173  PHE C C   1 
ATOM   8227  O O   . PHE C 3 173 ? 112.843 92.450  133.519 1.00 336.03 ? 173  PHE C O   1 
ATOM   8228  C CB  . PHE C 3 173 ? 114.946 93.870  135.649 1.00 276.96 ? 173  PHE C CB  1 
ATOM   8229  C CG  . PHE C 3 173 ? 116.404 94.105  135.970 1.00 284.21 ? 173  PHE C CG  1 
ATOM   8230  C CD1 . PHE C 3 173 ? 117.420 93.805  135.040 1.00 269.28 ? 173  PHE C CD1 1 
ATOM   8231  C CD2 . PHE C 3 173 ? 116.769 94.637  137.200 1.00 276.71 ? 173  PHE C CD2 1 
ATOM   8232  C CE1 . PHE C 3 173 ? 118.750 94.027  135.349 1.00 292.45 ? 173  PHE C CE1 1 
ATOM   8233  C CE2 . PHE C 3 173 ? 118.102 94.854  137.509 1.00 306.00 ? 173  PHE C CE2 1 
ATOM   8234  C CZ  . PHE C 3 173 ? 119.092 94.550  136.584 1.00 306.41 ? 173  PHE C CZ  1 
ATOM   8235  N N   . TRP C 3 174 ? 112.405 94.664  133.810 1.00 298.50 ? 174  TRP C N   1 
ATOM   8236  C CA  . TRP C 3 174 ? 110.984 94.590  133.449 1.00 314.18 ? 174  TRP C CA  1 
ATOM   8237  C C   . TRP C 3 174 ? 110.829 94.034  132.043 1.00 309.16 ? 174  TRP C C   1 
ATOM   8238  O O   . TRP C 3 174 ? 110.001 93.145  131.799 1.00 341.66 ? 174  TRP C O   1 
ATOM   8239  C CB  . TRP C 3 174 ? 110.253 95.936  133.584 1.00 306.98 ? 174  TRP C CB  1 
ATOM   8240  C CG  . TRP C 3 174 ? 110.046 96.396  134.999 1.00 314.27 ? 174  TRP C CG  1 
ATOM   8241  C CD1 . TRP C 3 174 ? 109.835 95.612  136.094 1.00 327.95 ? 174  TRP C CD1 1 
ATOM   8242  C CD2 . TRP C 3 174 ? 110.004 97.750  135.463 1.00 321.31 ? 174  TRP C CD2 1 
ATOM   8243  N NE1 . TRP C 3 174 ? 109.677 96.389  137.215 1.00 329.82 ? 174  TRP C NE1 1 
ATOM   8244  C CE2 . TRP C 3 174 ? 109.771 97.706  136.854 1.00 330.03 ? 174  TRP C CE2 1 
ATOM   8245  C CE3 . TRP C 3 174 ? 110.139 98.999  134.840 1.00 316.05 ? 174  TRP C CE3 1 
ATOM   8246  C CZ2 . TRP C 3 174 ? 109.673 98.858  137.629 1.00 324.19 ? 174  TRP C CZ2 1 
ATOM   8247  C CZ3 . TRP C 3 174 ? 110.043 100.144 135.608 1.00 297.55 ? 174  TRP C CZ3 1 
ATOM   8248  C CH2 . TRP C 3 174 ? 109.815 100.068 136.990 1.00 322.71 ? 174  TRP C CH2 1 
ATOM   8249  N N   . GLY C 3 175 ? 111.641 94.576  131.145 1.00 313.58 ? 175  GLY C N   1 
ATOM   8250  C CA  . GLY C 3 175 ? 111.650 94.176  129.733 1.00 343.24 ? 175  GLY C CA  1 
ATOM   8251  C C   . GLY C 3 175 ? 111.937 92.685  129.613 1.00 329.07 ? 175  GLY C C   1 
ATOM   8252  O O   . GLY C 3 175 ? 111.246 91.954  128.878 1.00 330.25 ? 175  GLY C O   1 
ATOM   8253  N N   . VAL C 3 176 ? 112.958 92.268  130.354 1.00 300.56 ? 176  VAL C N   1 
ATOM   8254  C CA  . VAL C 3 176 ? 113.400 90.870  130.375 1.00 302.62 ? 176  VAL C CA  1 
ATOM   8255  C C   . VAL C 3 176 ? 112.257 89.965  130.820 1.00 295.30 ? 176  VAL C C   1 
ATOM   8256  O O   . VAL C 3 176 ? 111.998 88.920  130.201 1.00 330.15 ? 176  VAL C O   1 
ATOM   8257  C CB  . VAL C 3 176 ? 114.693 90.673  131.189 1.00 316.92 ? 176  VAL C CB  1 
ATOM   8258  C CG1 . VAL C 3 176 ? 114.961 89.198  131.457 1.00 334.32 ? 176  VAL C CG1 1 
ATOM   8259  C CG2 . VAL C 3 176 ? 115.864 91.288  130.430 1.00 325.69 ? 176  VAL C CG2 1 
ATOM   8260  N N   . VAL C 3 177 ? 111.588 90.399  131.882 1.00 280.59 ? 177  VAL C N   1 
ATOM   8261  C CA  . VAL C 3 177 ? 110.451 89.678  132.453 1.00 301.86 ? 177  VAL C CA  1 
ATOM   8262  C C   . VAL C 3 177 ? 109.203 89.794  131.584 1.00 298.32 ? 177  VAL C C   1 
ATOM   8263  O O   . VAL C 3 177 ? 108.536 88.781  131.389 1.00 328.24 ? 177  VAL C O   1 
ATOM   8264  C CB  . VAL C 3 177 ? 110.118 90.100  133.904 1.00 288.24 ? 177  VAL C CB  1 
ATOM   8265  C CG1 . VAL C 3 177 ? 108.898 89.343  134.407 1.00 287.43 ? 177  VAL C CG1 1 
ATOM   8266  C CG2 . VAL C 3 177 ? 111.291 89.815  134.838 1.00 293.42 ? 177  VAL C CG2 1 
ATOM   8267  N N   . PHE C 3 178 ? 108.845 91.018  131.240 1.00 302.66 ? 178  PHE C N   1 
ATOM   8268  C CA  . PHE C 3 178 ? 107.562 91.338  130.618 1.00 315.56 ? 178  PHE C CA  1 
ATOM   8269  C C   . PHE C 3 178 ? 107.403 90.555  129.317 1.00 313.47 ? 178  PHE C C   1 
ATOM   8270  O O   . PHE C 3 178 ? 106.356 89.929  129.055 1.00 333.52 ? 178  PHE C O   1 
ATOM   8271  C CB  . PHE C 3 178 ? 107.522 92.850  130.321 1.00 324.10 ? 178  PHE C CB  1 
ATOM   8272  C CG  . PHE C 3 178 ? 106.186 93.377  129.894 1.00 309.96 ? 178  PHE C CG  1 
ATOM   8273  C CD1 . PHE C 3 178 ? 105.740 93.230  128.583 1.00 311.08 ? 178  PHE C CD1 1 
ATOM   8274  C CD2 . PHE C 3 178 ? 105.399 94.086  130.793 1.00 306.14 ? 178  PHE C CD2 1 
ATOM   8275  C CE1 . PHE C 3 178 ? 104.518 93.744  128.191 1.00 317.33 ? 178  PHE C CE1 1 
ATOM   8276  C CE2 . PHE C 3 178 ? 104.176 94.600  130.407 1.00 334.49 ? 178  PHE C CE2 1 
ATOM   8277  C CZ  . PHE C 3 178 ? 103.732 94.427  129.105 1.00 340.72 ? 178  PHE C CZ  1 
ATOM   8278  N N   . PHE C 3 179 ? 108.473 90.622  128.525 1.00 305.75 ? 179  PHE C N   1 
ATOM   8279  C CA  . PHE C 3 179 ? 108.508 89.951  127.212 1.00 333.17 ? 179  PHE C CA  1 
ATOM   8280  C C   . PHE C 3 179 ? 108.312 88.454  127.393 1.00 333.74 ? 179  PHE C C   1 
ATOM   8281  O O   . PHE C 3 179 ? 107.530 87.833  126.654 1.00 348.93 ? 179  PHE C O   1 
ATOM   8282  C CB  . PHE C 3 179 ? 109.793 90.238  126.439 1.00 332.72 ? 179  PHE C CB  1 
ATOM   8283  C CG  . PHE C 3 179 ? 109.778 91.537  125.670 1.00 315.80 ? 179  PHE C CG  1 
ATOM   8284  C CD1 . PHE C 3 179 ? 109.527 92.750  126.305 1.00 337.98 ? 179  PHE C CD1 1 
ATOM   8285  C CD2 . PHE C 3 179 ? 110.075 91.553  124.312 1.00 319.66 ? 179  PHE C CD2 1 
ATOM   8286  C CE1 . PHE C 3 179 ? 109.547 93.943  125.594 1.00 337.72 ? 179  PHE C CE1 1 
ATOM   8287  C CE2 . PHE C 3 179 ? 110.108 92.742  123.601 1.00 316.71 ? 179  PHE C CE2 1 
ATOM   8288  C CZ  . PHE C 3 179 ? 109.840 93.940  124.240 1.00 315.83 ? 179  PHE C CZ  1 
ATOM   8289  N N   . ASP C 3 180 ? 109.019 87.909  128.379 1.00 303.04 ? 180  ASP C N   1 
ATOM   8290  C CA  . ASP C 3 180 ? 108.953 86.480  128.703 1.00 326.36 ? 180  ASP C CA  1 
ATOM   8291  C C   . ASP C 3 180 ? 107.519 86.083  129.037 1.00 307.99 ? 180  ASP C C   1 
ATOM   8292  O O   . ASP C 3 180 ? 107.011 85.064  128.546 1.00 352.41 ? 180  ASP C O   1 
ATOM   8293  C CB  . ASP C 3 180 ? 109.881 86.119  129.872 1.00 362.92 ? 180  ASP C CB  1 
ATOM   8294  C CG  . ASP C 3 180 ? 109.874 84.626  130.192 1.00 361.56 ? 180  ASP C CG  1 
ATOM   8295  O OD1 . ASP C 3 180 ? 110.453 83.840  129.409 1.00 346.91 ? 180  ASP C OD1 1 
ATOM   8296  O OD2 . ASP C 3 180 ? 109.293 84.244  131.232 1.00 351.57 ? 180  ASP C OD2 1 
ATOM   8297  N N   . ALA C 3 181 ? 106.903 86.909  129.870 1.00 291.78 ? 181  ALA C N   1 
ATOM   8298  C CA  . ALA C 3 181 ? 105.524 86.708  130.321 1.00 312.28 ? 181  ALA C CA  1 
ATOM   8299  C C   . ALA C 3 181 ? 104.585 86.656  129.117 1.00 316.02 ? 181  ALA C C   1 
ATOM   8300  O O   . ALA C 3 181 ? 103.723 85.762  129.014 1.00 358.39 ? 181  ALA C O   1 
ATOM   8301  C CB  . ALA C 3 181 ? 105.104 87.814  131.277 1.00 328.40 ? 181  ALA C CB  1 
ATOM   8302  N N   . CYS C 3 182 ? 104.785 87.625  128.230 1.00 303.87 ? 182  CYS C N   1 
ATOM   8303  C CA  . CYS C 3 182 ? 103.982 87.754  127.012 1.00 332.65 ? 182  CYS C CA  1 
ATOM   8304  C C   . CYS C 3 182 ? 104.098 86.483  126.169 1.00 330.95 ? 182  CYS C C   1 
ATOM   8305  O O   . CYS C 3 182 ? 103.088 85.947  125.686 1.00 345.48 ? 182  CYS C O   1 
ATOM   8306  C CB  . CYS C 3 182 ? 104.300 89.023  126.219 1.00 358.47 ? 182  CYS C CB  1 
ATOM   8307  S SG  . CYS C 3 182 ? 105.780 88.927  125.204 1.00 385.65 ? 182  CYS C SG  1 
ATOM   8308  N N   . GLU C 3 183 ? 105.336 86.030  126.028 1.00 329.39 ? 183  GLU C N   1 
ATOM   8309  C CA  . GLU C 3 183 ? 105.653 84.822  125.264 1.00 344.46 ? 183  GLU C CA  1 
ATOM   8310  C C   . GLU C 3 183 ? 104.916 83.620  125.831 1.00 356.96 ? 183  GLU C C   1 
ATOM   8311  O O   . GLU C 3 183 ? 104.302 82.836  125.086 1.00 376.12 ? 183  GLU C O   1 
ATOM   8312  C CB  . GLU C 3 183 ? 107.163 84.555  125.187 1.00 356.57 ? 183  GLU C CB  1 
ATOM   8313  C CG  . GLU C 3 183 ? 107.875 85.386  124.133 1.00 364.90 ? 183  GLU C CG  1 
ATOM   8314  C CD  . GLU C 3 183 ? 107.458 85.017  122.721 1.00 376.52 ? 183  GLU C CD  1 
ATOM   8315  O OE1 . GLU C 3 183 ? 107.696 83.861  122.310 1.00 393.89 ? 183  GLU C OE1 1 
ATOM   8316  O OE2 . GLU C 3 183 ? 106.888 85.883  122.023 1.00 385.41 ? 183  GLU C OE2 1 
ATOM   8317  N N   . ARG C 3 184 ? 105.025 83.437  127.145 1.00 371.14 ? 184  ARG C N   1 
ATOM   8318  C CA  . ARG C 3 184 ? 104.473 82.256  127.818 1.00 391.19 ? 184  ARG C CA  1 
ATOM   8319  C C   . ARG C 3 184 ? 102.952 82.308  128.016 1.00 383.78 ? 184  ARG C C   1 
ATOM   8320  O O   . ARG C 3 184 ? 102.363 81.325  128.471 1.00 384.17 ? 184  ARG C O   1 
ATOM   8321  C CB  . ARG C 3 184 ? 105.147 82.061  129.183 1.00 400.35 ? 184  ARG C CB  1 
ATOM   8322  C CG  . ARG C 3 184 ? 106.654 81.839  129.142 1.00 412.35 ? 184  ARG C CG  1 
ATOM   8323  C CD  . ARG C 3 184 ? 107.027 80.492  128.548 1.00 430.12 ? 184  ARG C CD  1 
ATOM   8324  N NE  . ARG C 3 184 ? 108.457 80.214  128.703 1.00 449.17 ? 184  ARG C NE  1 
ATOM   8325  C CZ  . ARG C 3 184 ? 109.050 79.792  129.824 1.00 465.61 ? 184  ARG C CZ  1 
ATOM   8326  N NH1 . ARG C 3 184 ? 108.356 79.582  130.944 1.00 468.19 ? 184  ARG C NH1 1 
ATOM   8327  N NH2 . ARG C 3 184 ? 110.364 79.577  129.827 1.00 474.44 ? 184  ARG C NH2 1 
ATOM   8328  N N   . ARG C 3 185 ? 102.331 83.449  127.695 1.00 370.01 ? 185  ARG C N   1 
ATOM   8329  C CA  . ARG C 3 185 ? 100.912 83.709  127.950 1.00 372.41 ? 185  ARG C CA  1 
ATOM   8330  C C   . ARG C 3 185 ? 100.605 83.778  129.456 1.00 378.61 ? 185  ARG C C   1 
ATOM   8331  O O   . ARG C 3 185 ? 99.440  83.704  129.855 1.00 410.80 ? 185  ARG C O   1 
ATOM   8332  C CB  . ARG C 3 185 ? 100.023 82.671  127.241 1.00 394.08 ? 185  ARG C CB  1 
ATOM   8333  C CG  . ARG C 3 185 ? 98.647  83.185  126.836 1.00 423.70 ? 185  ARG C CG  1 
ATOM   8334  C CD  . ARG C 3 185 ? 97.808  82.092  126.191 1.00 436.93 ? 185  ARG C CD  1 
ATOM   8335  N NE  . ARG C 3 185 ? 96.391  82.458  126.102 1.00 445.77 ? 185  ARG C NE  1 
ATOM   8336  C CZ  . ARG C 3 185 ? 95.855  83.295  125.207 1.00 449.29 ? 185  ARG C CZ  1 
ATOM   8337  N NH1 . ARG C 3 185 ? 96.601  83.901  124.280 1.00 448.51 ? 185  ARG C NH1 1 
ATOM   8338  N NH2 . ARG C 3 185 ? 94.545  83.536  125.242 1.00 445.14 ? 185  ARG C NH2 1 
ATOM   8339  N N   . ARG C 3 186 ? 101.644 83.949  130.281 1.00 370.72 ? 186  ARG C N   1 
ATOM   8340  C CA  . ARG C 3 186 ? 101.487 83.989  131.735 1.00 381.74 ? 186  ARG C CA  1 
ATOM   8341  C C   . ARG C 3 186 ? 101.278 85.449  132.142 1.00 368.13 ? 186  ARG C C   1 
ATOM   8342  O O   . ARG C 3 186 ? 102.216 86.174  132.467 1.00 363.09 ? 186  ARG C O   1 
ATOM   8343  C CB  . ARG C 3 186 ? 102.653 83.289  132.474 1.00 378.10 ? 186  ARG C CB  1 
ATOM   8344  C CG  . ARG C 3 186 ? 104.035 83.920  132.356 1.00 371.43 ? 186  ARG C CG  1 
ATOM   8345  C CD  . ARG C 3 186 ? 105.170 82.914  132.518 1.00 381.95 ? 186  ARG C CD  1 
ATOM   8346  N NE  . ARG C 3 186 ? 105.373 82.467  133.897 1.00 381.92 ? 186  ARG C NE  1 
ATOM   8347  C CZ  . ARG C 3 186 ? 106.355 81.652  134.292 1.00 388.40 ? 186  ARG C CZ  1 
ATOM   8348  N NH1 . ARG C 3 186 ? 107.254 81.184  133.425 1.00 391.81 ? 186  ARG C NH1 1 
ATOM   8349  N NH2 . ARG C 3 186 ? 106.447 81.305  135.573 1.00 392.72 ? 186  ARG C NH2 1 
ATOM   8350  N N   . TYR C 3 187 ? 100.015 85.864  132.094 1.00 378.26 ? 187  TYR C N   1 
ATOM   8351  C CA  . TYR C 3 187 ? 99.609  87.241  132.395 1.00 378.66 ? 187  TYR C CA  1 
ATOM   8352  C C   . TYR C 3 187 ? 99.913  87.676  133.820 1.00 359.29 ? 187  TYR C C   1 
ATOM   8353  O O   . TYR C 3 187 ? 100.038 88.887  134.074 1.00 346.55 ? 187  TYR C O   1 
ATOM   8354  C CB  . TYR C 3 187 ? 98.108  87.431  132.119 1.00 405.62 ? 187  TYR C CB  1 
ATOM   8355  C CG  . TYR C 3 187 ? 97.745  87.487  130.650 1.00 426.28 ? 187  TYR C CG  1 
ATOM   8356  C CD1 . TYR C 3 187 ? 97.437  86.326  129.937 1.00 430.92 ? 187  TYR C CD1 1 
ATOM   8357  C CD2 . TYR C 3 187 ? 97.699  88.707  129.970 1.00 439.58 ? 187  TYR C CD2 1 
ATOM   8358  C CE1 . TYR C 3 187 ? 97.102  86.378  128.589 1.00 446.87 ? 187  TYR C CE1 1 
ATOM   8359  C CE2 . TYR C 3 187 ? 97.364  88.770  128.623 1.00 447.93 ? 187  TYR C CE2 1 
ATOM   8360  C CZ  . TYR C 3 187 ? 97.067  87.605  127.936 1.00 450.93 ? 187  TYR C CZ  1 
ATOM   8361  O OH  . TYR C 3 187 ? 96.735  87.663  126.601 1.00 443.26 ? 187  TYR C OH  1 
ATOM   8362  N N   . TRP C 3 188 ? 100.016 86.695  134.730 1.00 357.40 ? 188  TRP C N   1 
ATOM   8363  C CA  . TRP C 3 188 ? 100.306 86.961  136.123 1.00 365.27 ? 188  TRP C CA  1 
ATOM   8364  C C   . TRP C 3 188 ? 101.635 87.699  136.264 1.00 345.51 ? 188  TRP C C   1 
ATOM   8365  O O   . TRP C 3 188 ? 101.725 88.684  137.016 1.00 359.86 ? 188  TRP C O   1 
ATOM   8366  C CB  . TRP C 3 188 ? 100.227 85.697  137.002 1.00 379.21 ? 188  TRP C CB  1 
ATOM   8367  C CG  . TRP C 3 188 ? 101.424 84.807  136.989 1.00 390.25 ? 188  TRP C CG  1 
ATOM   8368  C CD1 . TRP C 3 188 ? 101.691 83.808  136.105 1.00 409.50 ? 188  TRP C CD1 1 
ATOM   8369  C CD2 . TRP C 3 188 ? 102.509 84.820  137.924 1.00 408.94 ? 188  TRP C CD2 1 
ATOM   8370  N NE1 . TRP C 3 188 ? 102.882 83.199  136.422 1.00 425.49 ? 188  TRP C NE1 1 
ATOM   8371  C CE2 . TRP C 3 188 ? 103.406 83.800  137.536 1.00 418.99 ? 188  TRP C CE2 1 
ATOM   8372  C CE3 . TRP C 3 188 ? 102.814 85.598  139.050 1.00 411.06 ? 188  TRP C CE3 1 
ATOM   8373  C CZ2 . TRP C 3 188 ? 104.593 83.536  138.235 1.00 412.60 ? 188  TRP C CZ2 1 
ATOM   8374  C CZ3 . TRP C 3 188 ? 103.996 85.335  139.747 1.00 413.10 ? 188  TRP C CZ3 1 
ATOM   8375  C CH2 . TRP C 3 188 ? 104.869 84.311  139.333 1.00 410.04 ? 188  TRP C CH2 1 
ATOM   8376  N N   . ALA C 3 189 ? 102.626 87.213  135.523 1.00 339.82 ? 189  ALA C N   1 
ATOM   8377  C CA  . ALA C 3 189 ? 103.967 87.802  135.529 1.00 341.12 ? 189  ALA C CA  1 
ATOM   8378  C C   . ALA C 3 189 ? 103.902 89.267  135.101 1.00 327.15 ? 189  ALA C C   1 
ATOM   8379  O O   . ALA C 3 189 ? 104.510 90.142  135.733 1.00 314.05 ? 189  ALA C O   1 
ATOM   8380  C CB  . ALA C 3 189 ? 104.921 87.013  134.643 1.00 352.53 ? 189  ALA C CB  1 
ATOM   8381  N N   . LEU C 3 190 ? 103.153 89.492  134.031 1.00 334.18 ? 190  LEU C N   1 
ATOM   8382  C CA  . LEU C 3 190 ? 102.953 90.826  133.458 1.00 335.00 ? 190  LEU C CA  1 
ATOM   8383  C C   . LEU C 3 190 ? 102.360 91.762  134.512 1.00 342.15 ? 190  LEU C C   1 
ATOM   8384  O O   . LEU C 3 190 ? 102.824 92.902  134.696 1.00 356.62 ? 190  LEU C O   1 
ATOM   8385  C CB  . LEU C 3 190 ? 102.003 90.745  132.250 1.00 339.29 ? 190  LEU C CB  1 
ATOM   8386  C CG  . LEU C 3 190 ? 102.330 91.657  131.069 1.00 371.14 ? 190  LEU C CG  1 
ATOM   8387  C CD1 . LEU C 3 190 ? 103.547 91.128  130.320 1.00 377.53 ? 190  LEU C CD1 1 
ATOM   8388  C CD2 . LEU C 3 190 ? 101.134 91.780  130.133 1.00 385.38 ? 190  LEU C CD2 1 
ATOM   8389  N N   . GLY C 3 191 ? 101.335 91.244  135.179 1.00 337.47 ? 191  GLY C N   1 
ATOM   8390  C CA  . GLY C 3 191 ? 100.623 91.975  136.232 1.00 353.99 ? 191  GLY C CA  1 
ATOM   8391  C C   . GLY C 3 191 ? 101.588 92.385  137.334 1.00 338.73 ? 191  GLY C C   1 
ATOM   8392  O O   . GLY C 3 191 ? 101.583 93.533  137.795 1.00 342.36 ? 191  GLY C O   1 
ATOM   8393  N N   . LEU C 3 192 ? 102.403 91.419  137.733 1.00 319.04 ? 192  LEU C N   1 
ATOM   8394  C CA  . LEU C 3 192 ? 103.411 91.605  138.786 1.00 327.69 ? 192  LEU C CA  1 
ATOM   8395  C C   . LEU C 3 192 ? 104.364 92.728  138.399 1.00 317.93 ? 192  LEU C C   1 
ATOM   8396  O O   . LEU C 3 192 ? 104.669 93.606  139.213 1.00 348.76 ? 192  LEU C O   1 
ATOM   8397  C CB  . LEU C 3 192 ? 104.183 90.310  139.086 1.00 337.06 ? 192  LEU C CB  1 
ATOM   8398  C CG  . LEU C 3 192 ? 104.499 90.034  140.564 1.00 338.98 ? 192  LEU C CG  1 
ATOM   8399  C CD1 . LEU C 3 192 ? 105.347 88.778  140.686 1.00 355.93 ? 192  LEU C CD1 1 
ATOM   8400  C CD2 . LEU C 3 192 ? 105.196 91.204  141.243 1.00 350.52 ? 192  LEU C CD2 1 
ATOM   8401  N N   . VAL C 3 193 ? 104.813 92.665  137.155 1.00 314.89 ? 193  VAL C N   1 
ATOM   8402  C CA  . VAL C 3 193 ? 105.742 93.649  136.590 1.00 323.67 ? 193  VAL C CA  1 
ATOM   8403  C C   . VAL C 3 193 ? 105.129 95.054  136.676 1.00 324.74 ? 193  VAL C C   1 
ATOM   8404  O O   . VAL C 3 193 ? 105.791 96.015  137.100 1.00 349.98 ? 193  VAL C O   1 
ATOM   8405  C CB  . VAL C 3 193 ? 106.181 93.300  135.145 1.00 346.05 ? 193  VAL C CB  1 
ATOM   8406  C CG1 . VAL C 3 193 ? 106.866 94.476  134.452 1.00 362.59 ? 193  VAL C CG1 1 
ATOM   8407  C CG2 . VAL C 3 193 ? 107.120 92.107  135.161 1.00 362.90 ? 193  VAL C CG2 1 
ATOM   8408  N N   . VAL C 3 194 ? 103.867 95.119  136.269 1.00 309.63 ? 194  VAL C N   1 
ATOM   8409  C CA  . VAL C 3 194 ? 103.104 96.368  136.268 1.00 303.56 ? 194  VAL C CA  1 
ATOM   8410  C C   . VAL C 3 194 ? 103.045 96.949  137.685 1.00 312.00 ? 194  VAL C C   1 
ATOM   8411  O O   . VAL C 3 194 ? 103.275 98.152  137.893 1.00 316.41 ? 194  VAL C O   1 
ATOM   8412  C CB  . VAL C 3 194 ? 101.709 96.230  135.620 1.00 330.17 ? 194  VAL C CB  1 
ATOM   8413  C CG1 . VAL C 3 194 ? 100.886 97.502  135.810 1.00 339.50 ? 194  VAL C CG1 1 
ATOM   8414  C CG2 . VAL C 3 194 ? 101.847 95.909  134.134 1.00 344.20 ? 194  VAL C CG2 1 
ATOM   8415  N N   . GLY C 3 195 ? 102.746 96.066  138.624 1.00 338.49 ? 195  GLY C N   1 
ATOM   8416  C CA  . GLY C 3 195 ? 102.650 96.415  140.044 1.00 362.81 ? 195  GLY C CA  1 
ATOM   8417  C C   . GLY C 3 195 ? 103.958 97.003  140.535 1.00 334.28 ? 195  GLY C C   1 
ATOM   8418  O O   . GLY C 3 195 ? 103.979 98.017  141.223 1.00 353.62 ? 195  GLY C O   1 
ATOM   8419  N N   . SER C 3 196 ? 105.038 96.330  140.165 1.00 301.93 ? 196  SER C N   1 
ATOM   8420  C CA  . SER C 3 196 ? 106.405 96.732  140.528 1.00 321.07 ? 196  SER C CA  1 
ATOM   8421  C C   . SER C 3 196 ? 106.680 98.133  140.019 1.00 316.15 ? 196  SER C C   1 
ATOM   8422  O O   . SER C 3 196 ? 107.214 98.969  140.769 1.00 323.11 ? 196  SER C O   1 
ATOM   8423  C CB  . SER C 3 196 ? 107.449 95.743  140.010 1.00 338.59 ? 196  SER C CB  1 
ATOM   8424  O OG  . SER C 3 196 ? 107.317 94.500  140.676 1.00 366.71 ? 196  SER C OG  1 
ATOM   8425  N N   . HIS C 3 197 ? 106.307 98.362  138.761 1.00 300.19 ? 197  HIS C N   1 
ATOM   8426  C CA  . HIS C 3 197 ? 106.487 99.676  138.126 1.00 303.66 ? 197  HIS C CA  1 
ATOM   8427  C C   . HIS C 3 197 ? 105.754 100.766 138.926 1.00 298.96 ? 197  HIS C C   1 
ATOM   8428  O O   . HIS C 3 197 ? 106.297 101.848 139.284 1.00 310.93 ? 197  HIS C O   1 
ATOM   8429  C CB  . HIS C 3 197 ? 106.066 99.698  136.659 1.00 300.61 ? 197  HIS C CB  1 
ATOM   8430  C CG  . HIS C 3 197 ? 106.692 100.804 135.860 1.00 298.75 ? 197  HIS C CG  1 
ATOM   8431  N ND1 . HIS C 3 197 ? 107.268 101.923 136.428 1.00 300.24 ? 197  HIS C ND1 1 
ATOM   8432  C CD2 . HIS C 3 197 ? 106.788 100.978 134.521 1.00 316.29 ? 197  HIS C CD2 1 
ATOM   8433  C CE1 . HIS C 3 197 ? 107.714 102.721 135.476 1.00 309.21 ? 197  HIS C CE1 1 
ATOM   8434  N NE2 . HIS C 3 197 ? 107.432 102.173 134.309 1.00 325.20 ? 197  HIS C NE2 1 
ATOM   8435  N N   . LEU C 3 198 ? 104.511 100.427 139.212 1.00 289.04 ? 198  LEU C N   1 
ATOM   8436  C CA  . LEU C 3 198 ? 103.608 101.317 139.983 1.00 299.88 ? 198  LEU C CA  1 
ATOM   8437  C C   . LEU C 3 198 ? 104.199 101.569 141.350 1.00 301.10 ? 198  LEU C C   1 
ATOM   8438  O O   . LEU C 3 198 ? 104.209 102.703 141.832 1.00 314.05 ? 198  LEU C O   1 
ATOM   8439  C CB  . LEU C 3 198 ? 102.190 100.739 140.128 1.00 301.45 ? 198  LEU C CB  1 
ATOM   8440  C CG  . LEU C 3 198 ? 101.094 101.488 139.359 1.00 331.72 ? 198  LEU C CG  1 
ATOM   8441  C CD1 . LEU C 3 198 ? 101.138 101.197 137.865 1.00 326.49 ? 198  LEU C CD1 1 
ATOM   8442  C CD2 . LEU C 3 198 ? 99.725  101.149 139.934 1.00 375.63 ? 198  LEU C CD2 1 
ATOM   8443  N N   . LEU C 3 199 ? 104.714 100.507 141.978 1.00 302.82 ? 199  LEU C N   1 
ATOM   8444  C CA  . LEU C 3 199 ? 105.289 100.529 143.305 1.00 303.10 ? 199  LEU C CA  1 
ATOM   8445  C C   . LEU C 3 199 ? 106.451 101.447 143.299 1.00 292.04 ? 199  LEU C C   1 
ATOM   8446  O O   . LEU C 3 199 ? 106.507 102.170 144.295 1.00 330.68 ? 199  LEU C O   1 
ATOM   8447  C CB  . LEU C 3 199 ? 105.752 99.134  143.753 1.00 316.36 ? 199  LEU C CB  1 
ATOM   8448  C CG  . LEU C 3 199 ? 106.732 99.036  144.931 1.00 316.46 ? 199  LEU C CG  1 
ATOM   8449  C CD1 . LEU C 3 199 ? 106.065 99.489  146.219 1.00 345.21 ? 199  LEU C CD1 1 
ATOM   8450  C CD2 . LEU C 3 199 ? 107.260 97.618  145.075 1.00 329.24 ? 199  LEU C CD2 1 
ATOM   8451  N N   . THR C 3 200 ? 107.304 101.462 142.271 1.00 295.02 ? 200  THR C N   1 
ATOM   8452  C CA  . THR C 3 200 ? 108.462 102.354 142.271 1.00 320.35 ? 200  THR C CA  1 
ATOM   8453  C C   . THR C 3 200 ? 108.021 103.821 142.370 1.00 314.78 ? 200  THR C C   1 
ATOM   8454  O O   . THR C 3 200 ? 108.551 104.618 143.159 1.00 322.59 ? 200  THR C O   1 
ATOM   8455  C CB  . THR C 3 200 ? 109.390 102.208 141.047 1.00 320.39 ? 200  THR C CB  1 
ATOM   8456  O OG1 . THR C 3 200 ? 108.667 102.478 139.840 1.00 313.71 ? 200  THR C OG1 1 
ATOM   8457  C CG2 . THR C 3 200 ? 110.014 100.824 140.999 1.00 340.22 ? 200  THR C CG2 1 
ATOM   8458  N N   . SER C 3 201 ? 107.027 104.121 141.547 1.00 308.16 ? 201  SER C N   1 
ATOM   8459  C CA  . SER C 3 201 ? 106.430 105.465 141.475 1.00 328.90 ? 201  SER C CA  1 
ATOM   8460  C C   . SER C 3 201 ? 105.887 105.866 142.843 1.00 338.65 ? 201  SER C C   1 
ATOM   8461  O O   . SER C 3 201 ? 106.122 106.989 143.311 1.00 333.71 ? 201  SER C O   1 
ATOM   8462  C CB  . SER C 3 201 ? 105.357 105.563 140.389 1.00 323.15 ? 201  SER C CB  1 
ATOM   8463  O OG  . SER C 3 201 ? 105.965 105.629 139.115 1.00 319.22 ? 201  SER C OG  1 
ATOM   8464  N N   . GLY C 3 202 ? 105.171 104.926 143.449 1.00 316.22 ? 202  GLY C N   1 
ATOM   8465  C CA  . GLY C 3 202 ? 104.567 105.111 144.769 1.00 338.31 ? 202  GLY C CA  1 
ATOM   8466  C C   . GLY C 3 202 ? 105.641 105.461 145.797 1.00 334.96 ? 202  GLY C C   1 
ATOM   8467  O O   . GLY C 3 202 ? 105.490 106.396 146.595 1.00 353.41 ? 202  GLY C O   1 
ATOM   8468  N N   . LEU C 3 203 ? 106.712 104.682 145.745 1.00 313.41 ? 203  LEU C N   1 
ATOM   8469  C CA  . LEU C 3 203 ? 107.857 104.842 146.648 1.00 309.62 ? 203  LEU C CA  1 
ATOM   8470  C C   . LEU C 3 203 ? 108.443 106.240 146.504 1.00 318.66 ? 203  LEU C C   1 
ATOM   8471  O O   . LEU C 3 203 ? 108.716 106.924 147.508 1.00 344.43 ? 203  LEU C O   1 
ATOM   8472  C CB  . LEU C 3 203 ? 108.893 103.733 146.459 1.00 338.57 ? 203  LEU C CB  1 
ATOM   8473  C CG  . LEU C 3 203 ? 108.439 102.371 147.010 1.00 355.00 ? 203  LEU C CG  1 
ATOM   8474  C CD1 . LEU C 3 203 ? 109.282 101.227 146.458 1.00 369.37 ? 203  LEU C CD1 1 
ATOM   8475  C CD2 . LEU C 3 203 ? 108.464 102.346 148.530 1.00 360.73 ? 203  LEU C CD2 1 
ATOM   8476  N N   . THR C 3 204 ? 108.609 106.640 145.249 1.00 301.76 ? 204  THR C N   1 
ATOM   8477  C CA  . THR C 3 204 ? 109.160 107.954 144.906 1.00 308.48 ? 204  THR C CA  1 
ATOM   8478  C C   . THR C 3 204 ? 108.305 109.052 145.493 1.00 319.46 ? 204  THR C C   1 
ATOM   8479  O O   . THR C 3 204 ? 108.842 110.007 146.085 1.00 306.87 ? 204  THR C O   1 
ATOM   8480  C CB  . THR C 3 204 ? 109.452 108.165 143.410 1.00 298.89 ? 204  THR C CB  1 
ATOM   8481  O OG1 . THR C 3 204 ? 108.328 107.776 142.620 1.00 309.90 ? 204  THR C OG1 1 
ATOM   8482  C CG2 . THR C 3 204 ? 110.679 107.387 142.986 1.00 310.01 ? 204  THR C CG2 1 
ATOM   8483  N N   . PHE C 3 205 ? 106.988 108.894 145.343 1.00 324.43 ? 205  PHE C N   1 
ATOM   8484  C CA  . PHE C 3 205 ? 106.046 109.853 145.992 1.00 334.28 ? 205  PHE C CA  1 
ATOM   8485  C C   . PHE C 3 205 ? 106.364 110.180 147.473 1.00 322.55 ? 205  PHE C C   1 
ATOM   8486  O O   . PHE C 3 205 ? 106.005 111.257 147.946 1.00 340.09 ? 205  PHE C O   1 
ATOM   8487  C CB  . PHE C 3 205 ? 104.562 109.435 145.916 1.00 320.12 ? 205  PHE C CB  1 
ATOM   8488  C CG  . PHE C 3 205 ? 104.017 109.277 144.522 1.00 331.40 ? 205  PHE C CG  1 
ATOM   8489  C CD1 . PHE C 3 205 ? 104.380 110.134 143.489 1.00 314.40 ? 205  PHE C CD1 1 
ATOM   8490  C CD2 . PHE C 3 205 ? 103.084 108.282 144.257 1.00 377.37 ? 205  PHE C CD2 1 
ATOM   8491  C CE1 . PHE C 3 205 ? 103.856 109.977 142.214 1.00 333.98 ? 205  PHE C CE1 1 
ATOM   8492  C CE2 . PHE C 3 205 ? 102.555 108.116 142.986 1.00 388.44 ? 205  PHE C CE2 1 
ATOM   8493  C CZ  . PHE C 3 205 ? 102.939 108.965 141.964 1.00 372.51 ? 205  PHE C CZ  1 
ATOM   8494  N N   . LEU C 3 206 ? 107.028 109.272 148.191 1.00 294.40 ? 206  LEU C N   1 
ATOM   8495  C CA  . LEU C 3 206 ? 107.534 109.545 149.551 1.00 301.17 ? 206  LEU C CA  1 
ATOM   8496  C C   . LEU C 3 206 ? 108.859 110.337 149.601 1.00 310.80 ? 206  LEU C C   1 
ATOM   8497  O O   . LEU C 3 206 ? 109.414 110.528 150.689 1.00 308.60 ? 206  LEU C O   1 
ATOM   8498  C CB  . LEU C 3 206 ? 107.744 108.221 150.311 1.00 297.81 ? 206  LEU C CB  1 
ATOM   8499  C CG  . LEU C 3 206 ? 106.560 107.397 150.836 1.00 320.04 ? 206  LEU C CG  1 
ATOM   8500  C CD1 . LEU C 3 206 ? 105.286 107.533 150.007 1.00 340.26 ? 206  LEU C CD1 1 
ATOM   8501  C CD2 . LEU C 3 206 ? 106.965 105.932 150.972 1.00 304.49 ? 206  LEU C CD2 1 
ATOM   8502  N N   . ASN C 3 207 ? 109.330 110.843 148.459 1.00 311.00 ? 207  ASN C N   1 
ATOM   8503  C CA  . ASN C 3 207 ? 110.774 111.044 148.236 1.00 321.53 ? 207  ASN C CA  1 
ATOM   8504  C C   . ASN C 3 207 ? 111.582 111.754 149.313 1.00 337.61 ? 207  ASN C C   1 
ATOM   8505  O O   . ASN C 3 207 ? 112.584 111.209 149.758 1.00 360.76 ? 207  ASN C O   1 
ATOM   8506  C CB  . ASN C 3 207 ? 111.075 111.725 146.898 1.00 317.73 ? 207  ASN C CB  1 
ATOM   8507  C CG  . ASN C 3 207 ? 112.088 110.955 146.087 1.00 317.70 ? 207  ASN C CG  1 
ATOM   8508  O OD1 . ASN C 3 207 ? 113.170 110.630 146.572 1.00 304.43 ? 207  ASN C OD1 1 
ATOM   8509  N ND2 . ASN C 3 207 ? 111.732 110.633 144.857 1.00 347.53 ? 207  ASN C ND2 1 
ATOM   8510  N N   . PRO C 3 208 ? 111.167 112.966 149.723 1.00 337.01 ? 208  PRO C N   1 
ATOM   8511  C CA  . PRO C 3 208 ? 111.960 113.689 150.725 1.00 346.36 ? 208  PRO C CA  1 
ATOM   8512  C C   . PRO C 3 208 ? 112.459 112.768 151.843 1.00 334.34 ? 208  PRO C C   1 
ATOM   8513  O O   . PRO C 3 208 ? 113.645 112.788 152.177 1.00 332.28 ? 208  PRO C O   1 
ATOM   8514  C CB  . PRO C 3 208 ? 110.978 114.734 151.254 1.00 370.64 ? 208  PRO C CB  1 
ATOM   8515  C CG  . PRO C 3 208 ? 110.072 114.998 150.096 1.00 373.31 ? 208  PRO C CG  1 
ATOM   8516  C CD  . PRO C 3 208 ? 109.946 113.704 149.345 1.00 329.73 ? 208  PRO C CD  1 
ATOM   8517  N N   . TRP C 3 209 ? 111.550 111.945 152.367 1.00 327.63 ? 209  TRP C N   1 
ATOM   8518  C CA  . TRP C 3 209 ? 111.883 110.867 153.300 1.00 340.78 ? 209  TRP C CA  1 
ATOM   8519  C C   . TRP C 3 209 ? 112.521 109.696 152.539 1.00 308.38 ? 209  TRP C C   1 
ATOM   8520  O O   . TRP C 3 209 ? 111.835 108.749 152.152 1.00 302.49 ? 209  TRP C O   1 
ATOM   8521  C CB  . TRP C 3 209 ? 110.614 110.435 154.050 1.00 350.59 ? 209  TRP C CB  1 
ATOM   8522  C CG  . TRP C 3 209 ? 110.781 109.319 155.036 1.00 348.86 ? 209  TRP C CG  1 
ATOM   8523  C CD1 . TRP C 3 209 ? 111.912 108.982 155.721 1.00 356.66 ? 209  TRP C CD1 1 
ATOM   8524  C CD2 . TRP C 3 209 ? 109.762 108.419 155.474 1.00 367.05 ? 209  TRP C CD2 1 
ATOM   8525  N NE1 . TRP C 3 209 ? 111.665 107.910 156.545 1.00 374.14 ? 209  TRP C NE1 1 
ATOM   8526  C CE2 . TRP C 3 209 ? 110.351 107.546 156.417 1.00 383.32 ? 209  TRP C CE2 1 
ATOM   8527  C CE3 . TRP C 3 209 ? 108.404 108.258 155.155 1.00 369.66 ? 209  TRP C CE3 1 
ATOM   8528  C CZ2 . TRP C 3 209 ? 109.631 106.521 157.045 1.00 399.14 ? 209  TRP C CZ2 1 
ATOM   8529  C CZ3 . TRP C 3 209 ? 107.686 107.239 155.779 1.00 389.15 ? 209  TRP C CZ3 1 
ATOM   8530  C CH2 . TRP C 3 209 ? 108.303 106.383 156.714 1.00 413.42 ? 209  TRP C CH2 1 
ATOM   8531  N N   . TYR C 3 210 ? 113.838 109.772 152.339 1.00 299.21 ? 210  TYR C N   1 
ATOM   8532  C CA  . TYR C 3 210 ? 114.547 108.839 151.449 1.00 300.18 ? 210  TYR C CA  1 
ATOM   8533  C C   . TYR C 3 210 ? 114.585 107.403 151.935 1.00 321.78 ? 210  TYR C C   1 
ATOM   8534  O O   . TYR C 3 210 ? 114.636 106.487 151.113 1.00 335.70 ? 210  TYR C O   1 
ATOM   8535  C CB  . TYR C 3 210 ? 115.979 109.306 151.168 1.00 294.45 ? 210  TYR C CB  1 
ATOM   8536  C CG  . TYR C 3 210 ? 116.058 110.613 150.417 1.00 306.87 ? 210  TYR C CG  1 
ATOM   8537  C CD1 . TYR C 3 210 ? 115.351 110.804 149.234 1.00 310.76 ? 210  TYR C CD1 1 
ATOM   8538  C CD2 . TYR C 3 210 ? 116.844 111.659 150.880 1.00 319.42 ? 210  TYR C CD2 1 
ATOM   8539  C CE1 . TYR C 3 210 ? 115.411 112.002 148.546 1.00 300.86 ? 210  TYR C CE1 1 
ATOM   8540  C CE2 . TYR C 3 210 ? 116.912 112.858 150.191 1.00 327.14 ? 210  TYR C CE2 1 
ATOM   8541  C CZ  . TYR C 3 210 ? 116.196 113.022 149.022 1.00 303.48 ? 210  TYR C CZ  1 
ATOM   8542  O OH  . TYR C 3 210 ? 116.259 114.208 148.327 1.00 325.81 ? 210  TYR C OH  1 
ATOM   8543  N N   . GLU C 3 211 ? 114.564 107.198 153.250 1.00 342.24 ? 211  GLU C N   1 
ATOM   8544  C CA  . GLU C 3 211 ? 114.515 105.844 153.801 1.00 350.44 ? 211  GLU C CA  1 
ATOM   8545  C C   . GLU C 3 211 ? 113.328 105.088 153.206 1.00 322.42 ? 211  GLU C C   1 
ATOM   8546  O O   . GLU C 3 211 ? 113.486 103.975 152.717 1.00 334.91 ? 211  GLU C O   1 
ATOM   8547  C CB  . GLU C 3 211 ? 114.435 105.867 155.336 1.00 369.20 ? 211  GLU C CB  1 
ATOM   8548  C CG  . GLU C 3 211 ? 114.681 104.515 156.009 1.00 406.34 ? 211  GLU C CG  1 
ATOM   8549  C CD  . GLU C 3 211 ? 113.458 103.601 156.042 1.00 428.53 ? 211  GLU C CD  1 
ATOM   8550  O OE1 . GLU C 3 211 ? 112.370 104.055 156.457 1.00 436.05 ? 211  GLU C OE1 1 
ATOM   8551  O OE2 . GLU C 3 211 ? 113.587 102.416 155.661 1.00 408.00 ? 211  GLU C OE2 1 
ATOM   8552  N N   . ALA C 3 212 ? 112.155 105.713 153.222 1.00 319.48 ? 212  ALA C N   1 
ATOM   8553  C CA  . ALA C 3 212 ? 110.924 105.062 152.774 1.00 332.99 ? 212  ALA C CA  1 
ATOM   8554  C C   . ALA C 3 212 ? 110.788 104.952 151.259 1.00 326.12 ? 212  ALA C C   1 
ATOM   8555  O O   . ALA C 3 212 ? 109.915 104.225 150.782 1.00 315.89 ? 212  ALA C O   1 
ATOM   8556  C CB  . ALA C 3 212 ? 109.714 105.778 153.348 1.00 355.83 ? 212  ALA C CB  1 
ATOM   8557  N N   . SER C 3 213 ? 111.615 105.685 150.513 1.00 326.96 ? 213  SER C N   1 
ATOM   8558  C CA  . SER C 3 213 ? 111.611 105.631 149.053 1.00 322.95 ? 213  SER C CA  1 
ATOM   8559  C C   . SER C 3 213 ? 112.735 104.773 148.505 1.00 321.78 ? 213  SER C C   1 
ATOM   8560  O O   . SER C 3 213 ? 112.488 103.818 147.767 1.00 343.96 ? 213  SER C O   1 
ATOM   8561  C CB  . SER C 3 213 ? 111.750 107.037 148.464 1.00 316.23 ? 213  SER C CB  1 
ATOM   8562  O OG  . SER C 3 213 ? 111.829 106.990 147.047 1.00 305.26 ? 213  SER C OG  1 
ATOM   8563  N N   . LEU C 3 214 ? 113.968 105.098 148.885 1.00 316.23 ? 214  LEU C N   1 
ATOM   8564  C CA  . LEU C 3 214 ? 115.096 104.829 148.001 1.00 311.38 ? 214  LEU C CA  1 
ATOM   8565  C C   . LEU C 3 214 ? 115.591 103.410 148.187 1.00 319.00 ? 214  LEU C C   1 
ATOM   8566  O O   . LEU C 3 214 ? 115.799 102.665 147.201 1.00 347.68 ? 214  LEU C O   1 
ATOM   8567  C CB  . LEU C 3 214 ? 116.229 105.813 148.263 1.00 308.39 ? 214  LEU C CB  1 
ATOM   8568  C CG  . LEU C 3 214 ? 117.128 106.023 147.053 1.00 320.37 ? 214  LEU C CG  1 
ATOM   8569  C CD1 . LEU C 3 214 ? 116.457 107.003 146.102 1.00 342.18 ? 214  LEU C CD1 1 
ATOM   8570  C CD2 . LEU C 3 214 ? 118.502 106.519 147.478 1.00 338.21 ? 214  LEU C CD2 1 
ATOM   8571  N N   . LEU C 3 215 ? 115.751 103.045 149.461 1.00 324.42 ? 215  LEU C N   1 
ATOM   8572  C CA  . LEU C 3 215 ? 116.200 101.687 149.826 1.00 321.99 ? 215  LEU C CA  1 
ATOM   8573  C C   . LEU C 3 215 ? 115.211 100.662 149.298 1.00 313.67 ? 215  LEU C C   1 
ATOM   8574  O O   . LEU C 3 215 ? 115.636 99.639  148.728 1.00 344.64 ? 215  LEU C O   1 
ATOM   8575  C CB  . LEU C 3 215 ? 116.487 101.518 151.329 1.00 328.42 ? 215  LEU C CB  1 
ATOM   8576  C CG  . LEU C 3 215 ? 117.912 101.887 151.747 1.00 371.81 ? 215  LEU C CG  1 
ATOM   8577  C CD1 . LEU C 3 215 ? 118.155 103.382 151.590 1.00 384.34 ? 215  LEU C CD1 1 
ATOM   8578  C CD2 . LEU C 3 215 ? 118.181 101.448 153.178 1.00 403.09 ? 215  LEU C CD2 1 
ATOM   8579  N N   . PRO C 3 216 ? 113.911 100.963 149.482 1.00 312.95 ? 216  PRO C N   1 
ATOM   8580  C CA  . PRO C 3 216 ? 112.853 100.069 149.016 1.00 327.39 ? 216  PRO C CA  1 
ATOM   8581  C C   . PRO C 3 216 ? 112.944 99.860  147.518 1.00 334.68 ? 216  PRO C C   1 
ATOM   8582  O O   . PRO C 3 216 ? 112.842 98.723  147.032 1.00 341.57 ? 216  PRO C O   1 
ATOM   8583  C CB  . PRO C 3 216 ? 111.586 100.826 149.373 1.00 326.26 ? 216  PRO C CB  1 
ATOM   8584  C CG  . PRO C 3 216 ? 111.936 101.407 150.679 1.00 342.62 ? 216  PRO C CG  1 
ATOM   8585  C CD  . PRO C 3 216 ? 113.371 101.836 150.546 1.00 329.85 ? 216  PRO C CD  1 
ATOM   8586  N N   . ILE C 3 217 ? 113.146 100.970 146.818 1.00 323.23 ? 217  ILE C N   1 
ATOM   8587  C CA  . ILE C 3 217 ? 113.266 100.972 145.352 1.00 328.21 ? 217  ILE C CA  1 
ATOM   8588  C C   . ILE C 3 217 ? 114.420 100.071 144.925 1.00 323.18 ? 217  ILE C C   1 
ATOM   8589  O O   . ILE C 3 217 ? 114.276 99.254  144.002 1.00 349.32 ? 217  ILE C O   1 
ATOM   8590  C CB  . ILE C 3 217 ? 113.363 102.399 144.744 1.00 322.58 ? 217  ILE C CB  1 
ATOM   8591  C CG1 . ILE C 3 217 ? 111.950 102.972 144.589 1.00 349.13 ? 217  ILE C CG1 1 
ATOM   8592  C CG2 . ILE C 3 217 ? 114.031 102.391 143.373 1.00 306.71 ? 217  ILE C CG2 1 
ATOM   8593  C CD1 . ILE C 3 217 ? 111.881 104.477 144.476 1.00 363.85 ? 217  ILE C CD1 1 
ATOM   8594  N N   . TYR C 3 218 ? 115.540 100.246 145.617 1.00 312.90 ? 218  TYR C N   1 
ATOM   8595  C CA  . TYR C 3 218 ? 116.756 99.473  145.344 1.00 309.19 ? 218  TYR C CA  1 
ATOM   8596  C C   . TYR C 3 218 ? 116.485 97.985  145.509 1.00 325.16 ? 218  TYR C C   1 
ATOM   8597  O O   . TYR C 3 218 ? 116.880 97.174  144.659 1.00 360.35 ? 218  TYR C O   1 
ATOM   8598  C CB  . TYR C 3 218 ? 118.017 99.971  146.052 1.00 314.62 ? 218  TYR C CB  1 
ATOM   8599  C CG  . TYR C 3 218 ? 118.954 100.594 145.042 1.00 323.60 ? 218  TYR C CG  1 
ATOM   8600  C CD1 . TYR C 3 218 ? 118.702 101.860 144.521 1.00 323.60 ? 218  TYR C CD1 1 
ATOM   8601  C CD2 . TYR C 3 218 ? 120.046 99.887  144.548 1.00 364.94 ? 218  TYR C CD2 1 
ATOM   8602  C CE1 . TYR C 3 218 ? 119.541 102.425 143.573 1.00 331.47 ? 218  TYR C CE1 1 
ATOM   8603  C CE2 . TYR C 3 218 ? 120.891 100.442 143.596 1.00 371.82 ? 218  TYR C CE2 1 
ATOM   8604  C CZ  . TYR C 3 218 ? 120.633 101.710 143.111 1.00 359.58 ? 218  TYR C CZ  1 
ATOM   8605  O OH  . TYR C 3 218 ? 121.470 102.262 142.169 1.00 388.45 ? 218  TYR C OH  1 
ATOM   8606  N N   . ALA C 3 219 ? 115.803 97.666  146.600 1.00 329.94 ? 219  ALA C N   1 
ATOM   8607  C CA  . ALA C 3 219 ? 115.433 96.285  146.933 1.00 340.44 ? 219  ALA C CA  1 
ATOM   8608  C C   . ALA C 3 219 ? 114.600 95.681  145.808 1.00 331.05 ? 219  ALA C C   1 
ATOM   8609  O O   . ALA C 3 219 ? 114.849 94.546  145.365 1.00 349.77 ? 219  ALA C O   1 
ATOM   8610  C CB  . ALA C 3 219 ? 114.675 96.216  148.251 1.00 359.75 ? 219  ALA C CB  1 
ATOM   8611  N N   . VAL C 3 220 ? 113.624 96.467  145.371 1.00 293.46 ? 220  VAL C N   1 
ATOM   8612  C CA  . VAL C 3 220 ? 112.708 96.071  144.294 1.00 320.51 ? 220  VAL C CA  1 
ATOM   8613  C C   . VAL C 3 220 ? 113.494 95.750  143.030 1.00 306.01 ? 220  VAL C C   1 
ATOM   8614  O O   . VAL C 3 220 ? 113.258 94.730  142.371 1.00 343.29 ? 220  VAL C O   1 
ATOM   8615  C CB  . VAL C 3 220 ? 111.597 97.115  144.015 1.00 326.66 ? 220  VAL C CB  1 
ATOM   8616  C CG1 . VAL C 3 220 ? 110.814 96.776  142.747 1.00 307.16 ? 220  VAL C CG1 1 
ATOM   8617  C CG2 . VAL C 3 220 ? 110.638 97.194  145.197 1.00 371.01 ? 220  VAL C CG2 1 
ATOM   8618  N N   . THR C 3 221 ? 114.420 96.648  142.721 1.00 303.69 ? 221  THR C N   1 
ATOM   8619  C CA  . THR C 3 221 ? 115.289 96.530  141.543 1.00 317.40 ? 221  THR C CA  1 
ATOM   8620  C C   . THR C 3 221 ? 116.066 95.227  141.597 1.00 314.37 ? 221  THR C C   1 
ATOM   8621  O O   . THR C 3 221 ? 116.154 94.503  140.605 1.00 339.48 ? 221  THR C O   1 
ATOM   8622  C CB  . THR C 3 221 ? 116.322 97.685  141.450 1.00 327.79 ? 221  THR C CB  1 
ATOM   8623  O OG1 . THR C 3 221 ? 115.690 98.940  141.728 1.00 347.16 ? 221  THR C OG1 1 
ATOM   8624  C CG2 . THR C 3 221 ? 116.966 97.738  140.066 1.00 328.78 ? 221  THR C CG2 1 
ATOM   8625  N N   . VAL C 3 222 ? 116.630 94.970  142.773 1.00 315.68 ? 222  VAL C N   1 
ATOM   8626  C CA  . VAL C 3 222 ? 117.424 93.765  143.034 1.00 328.89 ? 222  VAL C CA  1 
ATOM   8627  C C   . VAL C 3 222 ? 116.579 92.519  142.762 1.00 317.78 ? 222  VAL C C   1 
ATOM   8628  O O   . VAL C 3 222 ? 117.010 91.572  142.060 1.00 321.90 ? 222  VAL C O   1 
ATOM   8629  C CB  . VAL C 3 222 ? 118.034 93.742  144.460 1.00 339.48 ? 222  VAL C CB  1 
ATOM   8630  C CG1 . VAL C 3 222 ? 118.516 92.346  144.852 1.00 350.95 ? 222  VAL C CG1 1 
ATOM   8631  C CG2 . VAL C 3 222 ? 119.185 94.737  144.550 1.00 349.80 ? 222  VAL C CG2 1 
ATOM   8632  N N   . SER C 3 223 ? 115.380 92.557  143.314 1.00 292.83 ? 223  SER C N   1 
ATOM   8633  C CA  . SER C 3 223 ? 114.407 91.459  143.176 1.00 315.54 ? 223  SER C CA  1 
ATOM   8634  C C   . SER C 3 223 ? 114.088 91.245  141.702 1.00 318.96 ? 223  SER C C   1 
ATOM   8635  O O   . SER C 3 223 ? 114.084 90.122  141.164 1.00 350.69 ? 223  SER C O   1 
ATOM   8636  C CB  . SER C 3 223 ? 113.127 91.758  143.966 1.00 328.22 ? 223  SER C CB  1 
ATOM   8637  O OG  . SER C 3 223 ? 112.151 90.745  143.780 1.00 347.55 ? 223  SER C OG  1 
ATOM   8638  N N   . MET C 3 224 ? 113.814 92.387  141.058 1.00 306.11 ? 224  MET C N   1 
ATOM   8639  C CA  . MET C 3 224 ? 113.474 92.411  139.615 1.00 301.31 ? 224  MET C CA  1 
ATOM   8640  C C   . MET C 3 224 ? 114.632 91.860  138.829 1.00 302.14 ? 224  MET C C   1 
ATOM   8641  O O   . MET C 3 224 ? 114.384 91.068  137.911 1.00 325.79 ? 224  MET C O   1 
ATOM   8642  C CB  . MET C 3 224 ? 113.065 93.798  139.121 1.00 320.69 ? 224  MET C CB  1 
ATOM   8643  C CG  . MET C 3 224 ? 112.153 93.753  137.901 1.00 320.35 ? 224  MET C CG  1 
ATOM   8644  S SD  . MET C 3 224 ? 110.641 92.789  138.100 1.00 326.15 ? 224  MET C SD  1 
ATOM   8645  C CE  . MET C 3 224 ? 110.156 93.169  139.783 1.00 340.57 ? 224  MET C CE  1 
ATOM   8646  N N   . GLY C 3 225 ? 115.851 92.256  139.181 1.00 301.30 ? 225  GLY C N   1 
ATOM   8647  C CA  . GLY C 3 225 ? 117.061 91.784  138.507 1.00 313.46 ? 225  GLY C CA  1 
ATOM   8648  C C   . GLY C 3 225 ? 117.152 90.269  138.577 1.00 331.55 ? 225  GLY C C   1 
ATOM   8649  O O   . GLY C 3 225 ? 117.424 89.597  137.571 1.00 349.74 ? 225  GLY C O   1 
ATOM   8650  N N   . LEU C 3 226 ? 116.915 89.766  139.782 1.00 321.63 ? 226  LEU C N   1 
ATOM   8651  C CA  . LEU C 3 226 ? 116.953 88.326  140.067 1.00 328.70 ? 226  LEU C CA  1 
ATOM   8652  C C   . LEU C 3 226 ? 115.954 87.593  139.174 1.00 300.65 ? 226  LEU C C   1 
ATOM   8653  O O   . LEU C 3 226 ? 116.278 86.560  138.566 1.00 326.76 ? 226  LEU C O   1 
ATOM   8654  C CB  . LEU C 3 226 ? 116.655 88.041  141.544 1.00 356.53 ? 226  LEU C CB  1 
ATOM   8655  C CG  . LEU C 3 226 ? 117.262 86.744  142.087 1.00 372.88 ? 226  LEU C CG  1 
ATOM   8656  C CD1 . LEU C 3 226 ? 118.740 86.941  142.401 1.00 375.98 ? 226  LEU C CD1 1 
ATOM   8657  C CD2 . LEU C 3 226 ? 116.510 86.266  143.322 1.00 379.05 ? 226  LEU C CD2 1 
ATOM   8658  N N   . TRP C 3 227 ? 114.754 88.159  139.124 1.00 284.73 ? 227  TRP C N   1 
ATOM   8659  C CA  . TRP C 3 227 ? 113.653 87.608  138.328 1.00 307.48 ? 227  TRP C CA  1 
ATOM   8660  C C   . TRP C 3 227 ? 114.060 87.517  136.858 1.00 312.26 ? 227  TRP C C   1 
ATOM   8661  O O   . TRP C 3 227 ? 113.846 86.492  136.199 1.00 354.08 ? 227  TRP C O   1 
ATOM   8662  C CB  . TRP C 3 227 ? 112.347 88.390  138.521 1.00 317.31 ? 227  TRP C CB  1 
ATOM   8663  C CG  . TRP C 3 227 ? 111.112 87.698  137.987 1.00 307.49 ? 227  TRP C CG  1 
ATOM   8664  C CD1 . TRP C 3 227 ? 111.006 86.408  137.544 1.00 326.88 ? 227  TRP C CD1 1 
ATOM   8665  C CD2 . TRP C 3 227 ? 109.801 88.260  137.880 1.00 301.13 ? 227  TRP C CD2 1 
ATOM   8666  N NE1 . TRP C 3 227 ? 109.723 86.146  137.147 1.00 346.65 ? 227  TRP C NE1 1 
ATOM   8667  C CE2 . TRP C 3 227 ? 108.959 87.263  137.346 1.00 315.71 ? 227  TRP C CE2 1 
ATOM   8668  C CE3 . TRP C 3 227 ? 109.258 89.512  138.179 1.00 330.03 ? 227  TRP C CE3 1 
ATOM   8669  C CZ2 . TRP C 3 227 ? 107.601 87.478  137.101 1.00 320.72 ? 227  TRP C CZ2 1 
ATOM   8670  C CZ3 . TRP C 3 227 ? 107.905 89.730  137.938 1.00 343.30 ? 227  TRP C CZ3 1 
ATOM   8671  C CH2 . TRP C 3 227 ? 107.093 88.713  137.402 1.00 337.72 ? 227  TRP C CH2 1 
ATOM   8672  N N   . ALA C 3 228 ? 114.648 88.606  136.387 1.00 312.82 ? 228  ALA C N   1 
ATOM   8673  C CA  . ALA C 3 228 ? 115.120 88.724  135.003 1.00 344.51 ? 228  ALA C CA  1 
ATOM   8674  C C   . ALA C 3 228 ? 116.126 87.626  134.695 1.00 353.66 ? 228  ALA C C   1 
ATOM   8675  O O   . ALA C 3 228 ? 116.048 86.961  133.654 1.00 380.52 ? 228  ALA C O   1 
ATOM   8676  C CB  . ALA C 3 228 ? 115.732 90.096  134.750 1.00 348.00 ? 228  ALA C CB  1 
ATOM   8677  N N   . PHE C 3 229 ? 117.058 87.465  135.625 1.00 327.81 ? 229  PHE C N   1 
ATOM   8678  C CA  . PHE C 3 229 ? 118.123 86.459  135.526 1.00 339.24 ? 229  PHE C CA  1 
ATOM   8679  C C   . PHE C 3 229 ? 117.511 85.066  135.388 1.00 353.32 ? 229  PHE C C   1 
ATOM   8680  O O   . PHE C 3 229 ? 117.923 84.271  134.536 1.00 388.25 ? 229  PHE C O   1 
ATOM   8681  C CB  . PHE C 3 229 ? 119.029 86.517  136.762 1.00 355.35 ? 229  PHE C CB  1 
ATOM   8682  C CG  . PHE C 3 229 ? 120.301 85.734  136.627 1.00 346.57 ? 229  PHE C CG  1 
ATOM   8683  C CD1 . PHE C 3 229 ? 120.324 84.366  136.882 1.00 336.87 ? 229  PHE C CD1 1 
ATOM   8684  C CD2 . PHE C 3 229 ? 121.484 86.368  136.263 1.00 348.91 ? 229  PHE C CD2 1 
ATOM   8685  C CE1 . PHE C 3 229 ? 121.499 83.643  136.759 1.00 359.08 ? 229  PHE C CE1 1 
ATOM   8686  C CE2 . PHE C 3 229 ? 122.664 85.652  136.142 1.00 364.52 ? 229  PHE C CE2 1 
ATOM   8687  C CZ  . PHE C 3 229 ? 122.672 84.287  136.390 1.00 372.26 ? 229  PHE C CZ  1 
ATOM   8688  N N   . ILE C 3 230 ? 116.535 84.813  136.251 1.00 342.14 ? 230  ILE C N   1 
ATOM   8689  C CA  . ILE C 3 230 ? 115.826 83.533  136.294 1.00 356.15 ? 230  ILE C CA  1 
ATOM   8690  C C   . ILE C 3 230 ? 115.173 83.255  134.929 1.00 354.86 ? 230  ILE C C   1 
ATOM   8691  O O   . ILE C 3 230 ? 115.297 82.126  134.406 1.00 380.45 ? 230  ILE C O   1 
ATOM   8692  C CB  . ILE C 3 230 ? 114.827 83.449  137.473 1.00 377.07 ? 230  ILE C CB  1 
ATOM   8693  C CG1 . ILE C 3 230 ? 115.600 83.369  138.798 1.00 379.81 ? 230  ILE C CG1 1 
ATOM   8694  C CG2 . ILE C 3 230 ? 113.907 82.234  137.340 1.00 388.30 ? 230  ILE C CG2 1 
ATOM   8695  C CD1 . ILE C 3 230 ? 114.802 83.805  140.010 1.00 400.98 ? 230  ILE C CD1 1 
ATOM   8696  N N   . THR C 3 231 ? 114.516 84.287  134.417 1.00 320.12 ? 231  THR C N   1 
ATOM   8697  C CA  . THR C 3 231 ? 113.587 84.080  133.275 1.00 332.77 ? 231  THR C CA  1 
ATOM   8698  C C   . THR C 3 231 ? 114.394 83.677  132.058 1.00 343.16 ? 231  THR C C   1 
ATOM   8699  O O   . THR C 3 231 ? 114.005 82.749  131.332 1.00 375.05 ? 231  THR C O   1 
ATOM   8700  C CB  . THR C 3 231 ? 112.769 85.331  132.912 1.00 349.00 ? 231  THR C CB  1 
ATOM   8701  O OG1 . THR C 3 231 ? 113.652 86.420  132.620 1.00 333.33 ? 231  THR C OG1 1 
ATOM   8702  C CG2 . THR C 3 231 ? 111.809 85.707  134.043 1.00 378.98 ? 231  THR C CG2 1 
ATOM   8703  N N   . ALA C 3 232 ? 115.519 84.362  131.844 1.00 337.97 ? 232  ALA C N   1 
ATOM   8704  C CA  . ALA C 3 232 ? 116.280 84.286  130.614 1.00 368.40 ? 232  ALA C CA  1 
ATOM   8705  C C   . ALA C 3 232 ? 117.630 83.664  130.879 1.00 372.86 ? 232  ALA C C   1 
ATOM   8706  O O   . ALA C 3 232 ? 118.627 84.060  130.282 1.00 362.45 ? 232  ALA C O   1 
ATOM   8707  C CB  . ALA C 3 232 ? 116.435 85.683  130.028 1.00 383.62 ? 232  ALA C CB  1 
ATOM   8708  N N   . GLY C 3 233 ? 117.659 82.689  131.788 1.00 363.35 ? 233  GLY C N   1 
ATOM   8709  C CA  . GLY C 3 233 ? 118.915 82.215  132.334 1.00 351.12 ? 233  GLY C CA  1 
ATOM   8710  C C   . GLY C 3 233 ? 118.833 81.179  133.428 1.00 343.52 ? 233  GLY C C   1 
ATOM   8711  O O   . GLY C 3 233 ? 117.758 80.662  133.736 1.00 356.25 ? 233  GLY C O   1 
ATOM   8712  N N   . GLY C 3 234 ? 119.992 80.894  134.017 1.00 356.18 ? 234  GLY C N   1 
ATOM   8713  C CA  . GLY C 3 234 ? 120.138 79.837  135.014 1.00 382.89 ? 234  GLY C CA  1 
ATOM   8714  C C   . GLY C 3 234 ? 119.934 80.315  136.438 1.00 373.86 ? 234  GLY C C   1 
ATOM   8715  O O   . GLY C 3 234 ? 119.220 81.292  136.680 1.00 349.80 ? 234  GLY C O   1 
ATOM   8716  N N   . SER C 3 235 ? 120.567 79.608  137.375 1.00 385.34 ? 235  SER C N   1 
ATOM   8717  C CA  . SER C 3 235 ? 120.478 79.912  138.803 1.00 395.51 ? 235  SER C CA  1 
ATOM   8718  C C   . SER C 3 235 ? 121.883 79.828  139.435 1.00 384.27 ? 235  SER C C   1 
ATOM   8719  O O   . SER C 3 235 ? 122.825 80.406  138.892 1.00 349.46 ? 235  SER C O   1 
ATOM   8720  C CB  . SER C 3 235 ? 119.450 78.983  139.468 1.00 398.82 ? 235  SER C CB  1 
ATOM   8721  O OG  . SER C 3 235 ? 119.920 77.646  139.532 1.00 394.24 ? 235  SER C OG  1 
ATOM   8722  N N   . LEU C 3 236 ? 122.030 79.121  140.558 1.00 387.36 ? 236  LEU C N   1 
ATOM   8723  C CA  . LEU C 3 236 ? 123.290 79.049  141.274 1.00 394.68 ? 236  LEU C CA  1 
ATOM   8724  C C   . LEU C 3 236 ? 124.309 78.241  140.504 1.00 387.91 ? 236  LEU C C   1 
ATOM   8725  O O   . LEU C 3 236 ? 125.487 78.604  140.523 1.00 386.38 ? 236  LEU C O   1 
ATOM   8726  C CB  . LEU C 3 236 ? 123.095 78.446  142.673 1.00 421.61 ? 236  LEU C CB  1 
ATOM   8727  C CG  . LEU C 3 236 ? 122.208 79.233  143.647 1.00 439.46 ? 236  LEU C CG  1 
ATOM   8728  C CD1 . LEU C 3 236 ? 121.882 78.396  144.876 1.00 453.59 ? 236  LEU C CD1 1 
ATOM   8729  C CD2 . LEU C 3 236 ? 122.863 80.546  144.054 1.00 441.04 ? 236  LEU C CD2 1 
ATOM   8730  N N   . ARG C 3 237 ? 123.855 77.155  139.871 1.00 418.05 ? 237  ARG C N   1 
ATOM   8731  C CA  . ARG C 3 237 ? 124.720 76.261  139.119 1.00 436.07 ? 237  ARG C CA  1 
ATOM   8732  C C   . ARG C 3 237 ? 125.453 77.029  138.021 1.00 417.73 ? 237  ARG C C   1 
ATOM   8733  O O   . ARG C 3 237 ? 126.676 76.882  137.847 1.00 391.43 ? 237  ARG C O   1 
ATOM   8734  C CB  . ARG C 3 237 ? 123.920 75.103  138.506 1.00 455.94 ? 237  ARG C CB  1 
ATOM   8735  C CG  . ARG C 3 237 ? 123.393 74.104  139.527 1.00 469.36 ? 237  ARG C CG  1 
ATOM   8736  C CD  . ARG C 3 237 ? 122.368 73.160  138.918 1.00 490.08 ? 237  ARG C CD  1 
ATOM   8737  N NE  . ARG C 3 237 ? 121.730 72.314  139.928 1.00 500.00 ? 237  ARG C NE  1 
ATOM   8738  C CZ  . ARG C 3 237 ? 120.761 71.426  139.689 1.00 500.00 ? 237  ARG C CZ  1 
ATOM   8739  N NH1 . ARG C 3 237 ? 120.285 71.239  138.457 1.00 500.00 ? 237  ARG C NH1 1 
ATOM   8740  N NH2 . ARG C 3 237 ? 120.259 70.714  140.696 1.00 500.00 ? 237  ARG C NH2 1 
ATOM   8741  N N   . SER C 3 238 ? 124.673 77.838  137.308 1.00 425.79 ? 238  SER C N   1 
ATOM   8742  C CA  . SER C 3 238 ? 125.191 78.654  136.205 1.00 431.99 ? 238  SER C CA  1 
ATOM   8743  C C   . SER C 3 238 ? 126.287 79.586  136.712 1.00 419.37 ? 238  SER C C   1 
ATOM   8744  O O   . SER C 3 238 ? 127.355 79.708  136.092 1.00 383.30 ? 238  SER C O   1 
ATOM   8745  C CB  . SER C 3 238 ? 124.073 79.451  135.526 1.00 428.89 ? 238  SER C CB  1 
ATOM   8746  O OG  . SER C 3 238 ? 123.429 80.324  136.434 1.00 409.43 ? 238  SER C OG  1 
ATOM   8747  N N   . ILE C 3 239 ? 125.989 80.220  137.840 1.00 425.89 ? 239  ILE C N   1 
ATOM   8748  C CA  . ILE C 3 239 ? 126.909 81.160  138.490 1.00 430.62 ? 239  ILE C CA  1 
ATOM   8749  C C   . ILE C 3 239 ? 128.226 80.458  138.818 1.00 435.11 ? 239  ILE C C   1 
ATOM   8750  O O   . ILE C 3 239 ? 129.314 80.991  138.552 1.00 429.75 ? 239  ILE C O   1 
ATOM   8751  C CB  . ILE C 3 239 ? 126.287 81.832  139.744 1.00 439.74 ? 239  ILE C CB  1 
ATOM   8752  C CG1 . ILE C 3 239 ? 125.119 82.744  139.337 1.00 434.47 ? 239  ILE C CG1 1 
ATOM   8753  C CG2 . ILE C 3 239 ? 127.325 82.663  140.502 1.00 452.68 ? 239  ILE C CG2 1 
ATOM   8754  C CD1 . ILE C 3 239 ? 124.157 83.063  140.463 1.00 437.72 ? 239  ILE C CD1 1 
ATOM   8755  N N   . GLN C 3 240 ? 128.085 79.271  139.391 1.00 441.17 ? 240  GLN C N   1 
ATOM   8756  C CA  . GLN C 3 240 ? 129.224 78.438  139.785 1.00 442.32 ? 240  GLN C CA  1 
ATOM   8757  C C   . GLN C 3 240 ? 130.101 78.140  138.571 1.00 461.28 ? 240  GLN C C   1 
ATOM   8758  O O   . GLN C 3 240 ? 131.334 78.263  138.626 1.00 466.50 ? 240  GLN C O   1 
ATOM   8759  C CB  . GLN C 3 240 ? 128.777 77.145  140.485 1.00 433.54 ? 240  GLN C CB  1 
ATOM   8760  C CG  . GLN C 3 240 ? 128.327 77.358  141.926 1.00 432.54 ? 240  GLN C CG  1 
ATOM   8761  C CD  . GLN C 3 240 ? 127.792 76.096  142.589 1.00 430.42 ? 240  GLN C CD  1 
ATOM   8762  O OE1 . GLN C 3 240 ? 127.150 75.261  141.949 1.00 429.36 ? 240  GLN C OE1 1 
ATOM   8763  N NE2 . GLN C 3 240 ? 128.046 75.960  143.886 1.00 422.37 ? 240  GLN C NE2 1 
ATOM   8764  N N   . ARG C 3 241 ? 129.428 77.756  137.494 1.00 465.36 ? 241  ARG C N   1 
ATOM   8765  C CA  . ARG C 3 241 ? 130.080 77.423  136.224 1.00 459.74 ? 241  ARG C CA  1 
ATOM   8766  C C   . ARG C 3 241 ? 130.893 78.615  135.724 1.00 438.47 ? 241  ARG C C   1 
ATOM   8767  O O   . ARG C 3 241 ? 132.055 78.471  135.316 1.00 427.34 ? 241  ARG C O   1 
ATOM   8768  C CB  . ARG C 3 241 ? 129.052 76.993  135.168 1.00 467.76 ? 241  ARG C CB  1 
ATOM   8769  C CG  . ARG C 3 241 ? 129.652 76.330  133.936 1.00 478.70 ? 241  ARG C CG  1 
ATOM   8770  C CD  . ARG C 3 241 ? 128.578 75.954  132.925 1.00 483.53 ? 241  ARG C CD  1 
ATOM   8771  N NE  . ARG C 3 241 ? 127.670 74.920  133.427 1.00 494.88 ? 241  ARG C NE  1 
ATOM   8772  C CZ  . ARG C 3 241 ? 126.627 74.424  132.756 1.00 500.00 ? 241  ARG C CZ  1 
ATOM   8773  N NH1 . ARG C 3 241 ? 126.330 74.853  131.529 1.00 500.00 ? 241  ARG C NH1 1 
ATOM   8774  N NH2 . ARG C 3 241 ? 125.871 73.484  133.319 1.00 500.00 ? 241  ARG C NH2 1 
ATOM   8775  N N   . SER C 3 242 ? 130.372 79.812  135.913 1.00 443.43 ? 242  SER C N   1 
ATOM   8776  C CA  . SER C 3 242 ? 131.036 80.969  135.357 1.00 453.61 ? 242  SER C CA  1 
ATOM   8777  C C   . SER C 3 242 ? 132.460 81.001  135.894 1.00 469.64 ? 242  SER C C   1 
ATOM   8778  O O   . SER C 3 242 ? 133.376 81.444  135.201 1.00 473.53 ? 242  SER C O   1 
ATOM   8779  C CB  . SER C 3 242 ? 130.295 82.251  135.740 1.00 460.24 ? 242  SER C CB  1 
ATOM   8780  O OG  . SER C 3 242 ? 130.426 83.237  134.731 1.00 456.79 ? 242  SER C OG  1 
ATOM   8781  N N   . LEU C 3 243 ? 132.649 80.555  137.132 1.00 500.00 ? 243  LEU C N   1 
ATOM   8782  C CA  . LEU C 3 243 ? 133.931 80.768  137.808 1.00 500.00 ? 243  LEU C CA  1 
ATOM   8783  C C   . LEU C 3 243 ? 135.137 80.520  136.905 1.00 500.00 ? 243  LEU C C   1 
ATOM   8784  O O   . LEU C 3 243 ? 136.106 81.272  136.934 1.00 500.00 ? 243  LEU C O   1 
ATOM   8785  C CB  . LEU C 3 243 ? 134.037 79.885  139.054 1.00 20.00  ? 243  LEU C CB  1 
ATOM   8786  C CG  . LEU C 3 243 ? 134.955 80.378  140.175 1.00 20.00  ? 243  LEU C CG  1 
ATOM   8787  C CD1 . LEU C 3 243 ? 135.533 79.207  140.954 1.00 20.00  ? 243  LEU C CD1 1 
ATOM   8788  C CD2 . LEU C 3 243 ? 136.064 81.268  139.638 1.00 20.00  ? 243  LEU C CD2 1 
ATOM   8789  N N   . LEU C 3 244 ? 135.065 79.461  136.105 1.00 500.00 ? 244  LEU C N   1 
ATOM   8790  C CA  . LEU C 3 244 ? 136.149 79.113  135.194 1.00 500.00 ? 244  LEU C CA  1 
ATOM   8791  C C   . LEU C 3 244 ? 136.532 80.299  134.316 1.00 500.00 ? 244  LEU C C   1 
ATOM   8792  O O   . LEU C 3 244 ? 135.860 80.596  133.328 1.00 500.00 ? 244  LEU C O   1 
ATOM   8793  C CB  . LEU C 3 244 ? 135.754 77.919  134.323 1.00 20.00  ? 244  LEU C CB  1 
ATOM   8794  C CG  . LEU C 3 244 ? 136.813 76.829  134.147 1.00 20.00  ? 244  LEU C CG  1 
ATOM   8795  C CD1 . LEU C 3 244 ? 136.359 75.530  134.794 1.00 20.00  ? 244  LEU C CD1 1 
ATOM   8796  C CD2 . LEU C 3 244 ? 137.127 76.618  132.674 1.00 20.00  ? 244  LEU C CD2 1 
ATOM   8797  N N   . ASN D 4 2   ? 136.943 103.042 98.886  1.00 444.88 ? 2    ASN D N   1 
ATOM   8798  C CA  . ASN D 4 2   ? 138.116 102.951 99.803  1.00 441.14 ? 2    ASN D CA  1 
ATOM   8799  C C   . ASN D 4 2   ? 139.439 103.036 99.038  1.00 423.27 ? 2    ASN D C   1 
ATOM   8800  O O   . ASN D 4 2   ? 139.459 103.022 97.804  1.00 398.49 ? 2    ASN D O   1 
ATOM   8801  C CB  . ASN D 4 2   ? 138.060 101.662 100.624 1.00 20.00  ? 2    ASN D CB  1 
ATOM   8802  C CG  . ASN D 4 2   ? 136.966 101.686 101.674 1.00 20.00  ? 2    ASN D CG  1 
ATOM   8803  O OD1 . ASN D 4 2   ? 136.521 102.752 102.099 1.00 20.00  ? 2    ASN D OD1 1 
ATOM   8804  N ND2 . ASN D 4 2   ? 136.527 100.507 102.098 1.00 20.00  ? 2    ASN D ND2 1 
ATOM   8805  N N   . LEU D 4 3   ? 140.537 103.120 99.787  1.00 427.38 ? 3    LEU D N   1 
ATOM   8806  C CA  . LEU D 4 3   ? 141.884 103.203 99.212  1.00 434.55 ? 3    LEU D CA  1 
ATOM   8807  C C   . LEU D 4 3   ? 142.380 101.875 98.617  1.00 452.91 ? 3    LEU D C   1 
ATOM   8808  O O   . LEU D 4 3   ? 143.275 101.884 97.771  1.00 455.44 ? 3    LEU D O   1 
ATOM   8809  C CB  . LEU D 4 3   ? 142.880 103.704 100.270 1.00 433.50 ? 3    LEU D CB  1 
ATOM   8810  C CG  . LEU D 4 3   ? 144.298 104.087 99.824  1.00 424.08 ? 3    LEU D CG  1 
ATOM   8811  C CD1 . LEU D 4 3   ? 144.276 105.215 98.802  1.00 422.32 ? 3    LEU D CD1 1 
ATOM   8812  C CD2 . LEU D 4 3   ? 145.144 104.476 101.027 1.00 412.65 ? 3    LEU D CD2 1 
ATOM   8813  N N   . GLU D 4 4   ? 141.806 100.747 99.043  1.00 452.76 ? 4    GLU D N   1 
ATOM   8814  C CA  . GLU D 4 4   ? 142.248 99.421  98.573  1.00 445.82 ? 4    GLU D CA  1 
ATOM   8815  C C   . GLU D 4 4   ? 141.947 99.144  97.092  1.00 428.95 ? 4    GLU D C   1 
ATOM   8816  O O   . GLU D 4 4   ? 142.650 98.350  96.461  1.00 428.72 ? 4    GLU D O   1 
ATOM   8817  C CB  . GLU D 4 4   ? 141.652 98.305  99.445  1.00 454.14 ? 4    GLU D CB  1 
ATOM   8818  C CG  . GLU D 4 4   ? 142.101 98.331  100.904 1.00 467.62 ? 4    GLU D CG  1 
ATOM   8819  C CD  . GLU D 4 4   ? 143.603 98.166  101.078 1.00 480.96 ? 4    GLU D CD  1 
ATOM   8820  O OE1 . GLU D 4 4   ? 144.196 97.294  100.408 1.00 482.85 ? 4    GLU D OE1 1 
ATOM   8821  O OE2 . GLU D 4 4   ? 144.194 98.916  101.884 1.00 488.01 ? 4    GLU D OE2 1 
ATOM   8822  N N   . ARG D 4 5   ? 140.917 99.792  96.543  1.00 420.71 ? 5    ARG D N   1 
ATOM   8823  C CA  . ARG D 4 5   ? 140.630 99.724  95.101  1.00 425.96 ? 5    ARG D CA  1 
ATOM   8824  C C   . ARG D 4 5   ? 141.645 100.491 94.239  1.00 415.12 ? 5    ARG D C   1 
ATOM   8825  O O   . ARG D 4 5   ? 141.760 100.227 93.040  1.00 418.57 ? 5    ARG D O   1 
ATOM   8826  C CB  . ARG D 4 5   ? 139.222 100.252 94.795  1.00 430.48 ? 5    ARG D CB  1 
ATOM   8827  C CG  . ARG D 4 5   ? 138.091 99.450  95.424  1.00 439.94 ? 5    ARG D CG  1 
ATOM   8828  C CD  . ARG D 4 5   ? 136.826 99.493  94.575  1.00 445.44 ? 5    ARG D CD  1 
ATOM   8829  N NE  . ARG D 4 5   ? 136.443 100.857 94.199  1.00 458.85 ? 5    ARG D NE  1 
ATOM   8830  C CZ  . ARG D 4 5   ? 135.804 101.732 94.980  1.00 471.11 ? 5    ARG D CZ  1 
ATOM   8831  N NH1 . ARG D 4 5   ? 135.448 101.424 96.229  1.00 482.01 ? 5    ARG D NH1 1 
ATOM   8832  N NH2 . ARG D 4 5   ? 135.517 102.944 94.505  1.00 466.81 ? 5    ARG D NH2 1 
ATOM   8833  N N   . VAL D 4 6   ? 142.371 101.429 94.849  1.00 400.36 ? 6    VAL D N   1 
ATOM   8834  C CA  . VAL D 4 6   ? 143.280 102.325 94.133  1.00 399.96 ? 6    VAL D CA  1 
ATOM   8835  C C   . VAL D 4 6   ? 144.576 101.593 93.764  1.00 397.59 ? 6    VAL D C   1 
ATOM   8836  O O   . VAL D 4 6   ? 145.073 100.770 94.538  1.00 388.14 ? 6    VAL D O   1 
ATOM   8837  C CB  . VAL D 4 6   ? 143.595 103.590 94.979  1.00 411.38 ? 6    VAL D CB  1 
ATOM   8838  C CG1 . VAL D 4 6   ? 144.535 104.530 94.237  1.00 417.99 ? 6    VAL D CG1 1 
ATOM   8839  C CG2 . VAL D 4 6   ? 142.307 104.318 95.361  1.00 426.39 ? 6    VAL D CG2 1 
ATOM   8840  N N   . SER D 4 7   ? 145.108 101.897 92.578  1.00 403.63 ? 7    SER D N   1 
ATOM   8841  C CA  . SER D 4 7   ? 146.359 101.300 92.088  1.00 406.54 ? 7    SER D CA  1 
ATOM   8842  C C   . SER D 4 7   ? 147.580 101.858 92.822  1.00 392.61 ? 7    SER D C   1 
ATOM   8843  O O   . SER D 4 7   ? 147.505 102.916 93.445  1.00 385.96 ? 7    SER D O   1 
ATOM   8844  C CB  . SER D 4 7   ? 146.506 101.532 90.580  1.00 415.80 ? 7    SER D CB  1 
ATOM   8845  O OG  . SER D 4 7   ? 146.434 102.911 90.262  1.00 397.77 ? 7    SER D OG  1 
ATOM   8846  N N   . ASN D 4 8   ? 148.676 101.102 92.804  1.00 397.74 ? 8    ASN D N   1 
ATOM   8847  C CA  . ASN D 4 8   ? 149.886 101.462 93.547  1.00 404.71 ? 8    ASN D CA  1 
ATOM   8848  C C   . ASN D 4 8   ? 150.544 102.757 93.080  1.00 407.02 ? 8    ASN D C   1 
ATOM   8849  O O   . ASN D 4 8   ? 150.971 103.578 93.892  1.00 412.90 ? 8    ASN D O   1 
ATOM   8850  C CB  . ASN D 4 8   ? 150.899 100.316 93.503  1.00 414.03 ? 8    ASN D CB  1 
ATOM   8851  C CG  . ASN D 4 8   ? 152.007 100.479 94.525  1.00 401.15 ? 8    ASN D CG  1 
ATOM   8852  O OD1 . ASN D 4 8   ? 152.072 101.483 95.234  1.00 386.02 ? 8    ASN D OD1 1 
ATOM   8853  N ND2 . ASN D 4 8   ? 152.888 99.488  94.606  1.00 410.13 ? 8    ASN D ND2 1 
ATOM   8854  N N   . GLU D 4 9   ? 150.615 102.934 91.766  1.00 421.83 ? 9    GLU D N   1 
ATOM   8855  C CA  . GLU D 4 9   ? 151.129 104.177 91.167  1.00 432.08 ? 9    GLU D CA  1 
ATOM   8856  C C   . GLU D 4 9   ? 150.290 105.361 91.636  1.00 429.11 ? 9    GLU D C   1 
ATOM   8857  O O   . GLU D 4 9   ? 150.838 106.405 92.029  1.00 428.51 ? 9    GLU D O   1 
ATOM   8858  C CB  . GLU D 4 9   ? 151.121 104.100 89.635  1.00 448.23 ? 9    GLU D CB  1 
ATOM   8859  C CG  . GLU D 4 9   ? 152.126 103.119 89.036  1.00 456.63 ? 9    GLU D CG  1 
ATOM   8860  C CD  . GLU D 4 9   ? 153.579 103.511 89.261  1.00 455.85 ? 9    GLU D CD  1 
ATOM   8861  O OE1 . GLU D 4 9   ? 153.873 104.716 89.428  1.00 450.76 ? 9    GLU D OE1 1 
ATOM   8862  O OE2 . GLU D 4 9   ? 154.437 102.602 89.270  1.00 461.67 ? 9    GLU D OE2 1 
ATOM   8863  N N   . GLU D 4 10  ? 148.974 105.162 91.584  1.00 419.08 ? 10   GLU D N   1 
ATOM   8864  C CA  . GLU D 4 10  ? 148.015 106.197 91.990  1.00 427.22 ? 10   GLU D CA  1 
ATOM   8865  C C   . GLU D 4 10  ? 148.245 106.583 93.446  1.00 407.31 ? 10   GLU D C   1 
ATOM   8866  O O   . GLU D 4 10  ? 148.270 107.774 93.784  1.00 387.36 ? 10   GLU D O   1 
ATOM   8867  C CB  . GLU D 4 10  ? 146.569 105.766 91.723  1.00 439.92 ? 10   GLU D CB  1 
ATOM   8868  C CG  . GLU D 4 10  ? 145.540 106.860 91.999  1.00 449.53 ? 10   GLU D CG  1 
ATOM   8869  C CD  . GLU D 4 10  ? 144.176 106.599 91.375  1.00 463.24 ? 10   GLU D CD  1 
ATOM   8870  O OE1 . GLU D 4 10  ? 143.929 105.481 90.869  1.00 474.50 ? 10   GLU D OE1 1 
ATOM   8871  O OE2 . GLU D 4 10  ? 143.338 107.525 91.395  1.00 476.00 ? 10   GLU D OE2 1 
ATOM   8872  N N   . LYS D 4 11  ? 148.405 105.582 94.306  1.00 388.80 ? 11   LYS D N   1 
ATOM   8873  C CA  . LYS D 4 11  ? 148.621 105.822 95.728  1.00 368.81 ? 11   LYS D CA  1 
ATOM   8874  C C   . LYS D 4 11  ? 149.921 106.586 95.948  1.00 357.32 ? 11   LYS D C   1 
ATOM   8875  O O   . LYS D 4 11  ? 149.988 107.493 96.778  1.00 378.50 ? 11   LYS D O   1 
ATOM   8876  C CB  . LYS D 4 11  ? 148.650 104.501 96.497  1.00 371.29 ? 11   LYS D CB  1 
ATOM   8877  C CG  . LYS D 4 11  ? 147.274 103.934 96.810  1.00 368.67 ? 11   LYS D CG  1 
ATOM   8878  C CD  . LYS D 4 11  ? 147.363 102.782 97.798  1.00 365.92 ? 11   LYS D CD  1 
ATOM   8879  C CE  . LYS D 4 11  ? 146.101 101.936 97.773  1.00 373.20 ? 11   LYS D CE  1 
ATOM   8880  N NZ  . LYS D 4 11  ? 146.179 100.794 98.726  1.00 377.13 ? 11   LYS D NZ  1 
ATOM   8881  N N   . LEU D 4 12  ? 150.949 106.214 95.194  1.00 366.42 ? 12   LEU D N   1 
ATOM   8882  C CA  . LEU D 4 12  ? 152.245 106.899 95.258  1.00 380.93 ? 12   LEU D CA  1 
ATOM   8883  C C   . LEU D 4 12  ? 152.074 108.379 94.930  1.00 392.14 ? 12   LEU D C   1 
ATOM   8884  O O   . LEU D 4 12  ? 152.598 109.255 95.633  1.00 394.08 ? 12   LEU D O   1 
ATOM   8885  C CB  . LEU D 4 12  ? 153.276 106.259 94.317  1.00 408.48 ? 12   LEU D CB  1 
ATOM   8886  C CG  . LEU D 4 12  ? 154.641 106.948 94.168  1.00 431.95 ? 12   LEU D CG  1 
ATOM   8887  C CD1 . LEU D 4 12  ? 155.319 107.133 95.518  1.00 450.40 ? 12   LEU D CD1 1 
ATOM   8888  C CD2 . LEU D 4 12  ? 155.532 106.156 93.223  1.00 455.44 ? 12   LEU D CD2 1 
ATOM   8889  N N   . ASN D 4 13  ? 151.330 108.615 93.856  1.00 400.02 ? 13   ASN D N   1 
ATOM   8890  C CA  . ASN D 4 13  ? 151.041 109.968 93.372  1.00 402.08 ? 13   ASN D CA  1 
ATOM   8891  C C   . ASN D 4 13  ? 150.346 110.783 94.465  1.00 392.84 ? 13   ASN D C   1 
ATOM   8892  O O   . ASN D 4 13  ? 150.711 111.931 94.739  1.00 396.13 ? 13   ASN D O   1 
ATOM   8893  C CB  . ASN D 4 13  ? 150.185 109.940 92.099  1.00 425.66 ? 13   ASN D CB  1 
ATOM   8894  C CG  . ASN D 4 13  ? 149.958 111.324 91.509  1.00 445.71 ? 13   ASN D CG  1 
ATOM   8895  O OD1 . ASN D 4 13  ? 150.862 112.160 91.483  1.00 457.55 ? 13   ASN D OD1 1 
ATOM   8896  N ND2 . ASN D 4 13  ? 148.744 111.569 91.026  1.00 453.19 ? 13   ASN D ND2 1 
ATOM   8897  N N   . LEU D 4 14  ? 149.335 110.154 95.072  1.00 377.02 ? 14   LEU D N   1 
ATOM   8898  C CA  . LEU D 4 14  ? 148.437 110.790 96.053  1.00 362.98 ? 14   LEU D CA  1 
ATOM   8899  C C   . LEU D 4 14  ? 149.162 111.215 97.339  1.00 344.04 ? 14   LEU D C   1 
ATOM   8900  O O   . LEU D 4 14  ? 148.958 112.324 97.831  1.00 357.46 ? 14   LEU D O   1 
ATOM   8901  C CB  . LEU D 4 14  ? 147.264 109.850 96.401  1.00 361.49 ? 14   LEU D CB  1 
ATOM   8902  C CG  . LEU D 4 14  ? 145.861 110.457 96.504  1.00 394.73 ? 14   LEU D CG  1 
ATOM   8903  C CD1 . LEU D 4 14  ? 145.834 111.672 97.419  1.00 417.80 ? 14   LEU D CD1 1 
ATOM   8904  C CD2 . LEU D 4 14  ? 145.330 110.814 95.121  1.00 398.21 ? 14   LEU D CD2 1 
ATOM   8905  N N   . CYS D 4 15  ? 149.992 110.321 97.871  1.00 326.43 ? 15   CYS D N   1 
ATOM   8906  C CA  . CYS D 4 15  ? 150.802 110.584 99.056  1.00 322.99 ? 15   CYS D CA  1 
ATOM   8907  C C   . CYS D 4 15  ? 151.780 111.721 98.796  1.00 325.13 ? 15   CYS D C   1 
ATOM   8908  O O   . CYS D 4 15  ? 151.946 112.615 99.640  1.00 341.71 ? 15   CYS D O   1 
ATOM   8909  C CB  . CYS D 4 15  ? 151.565 109.317 99.458  1.00 316.78 ? 15   CYS D CB  1 
ATOM   8910  S SG  . CYS D 4 15  ? 152.395 109.394 101.060 1.00 361.86 ? 15   CYS D SG  1 
ATOM   8911  N N   . ARG D 4 16  ? 152.407 111.659 97.620  1.00 330.76 ? 16   ARG D N   1 
ATOM   8912  C CA  . ARG D 4 16  ? 153.378 112.671 97.192  1.00 344.17 ? 16   ARG D CA  1 
ATOM   8913  C C   . ARG D 4 16  ? 152.723 114.044 97.167  1.00 331.34 ? 16   ARG D C   1 
ATOM   8914  O O   . ARG D 4 16  ? 153.308 115.022 97.662  1.00 334.81 ? 16   ARG D O   1 
ATOM   8915  C CB  . ARG D 4 16  ? 153.988 112.318 95.819  1.00 368.39 ? 16   ARG D CB  1 
ATOM   8916  C CG  . ARG D 4 16  ? 155.291 113.038 95.462  1.00 356.44 ? 16   ARG D CG  1 
ATOM   8917  C CD  . ARG D 4 16  ? 155.081 114.317 94.663  1.00 370.59 ? 16   ARG D CD  1 
ATOM   8918  N NE  . ARG D 4 16  ? 154.512 114.075 93.336  1.00 378.74 ? 16   ARG D NE  1 
ATOM   8919  C CZ  . ARG D 4 16  ? 155.183 113.618 92.275  1.00 407.70 ? 16   ARG D CZ  1 
ATOM   8920  N NH1 . ARG D 4 16  ? 156.485 113.324 92.344  1.00 409.75 ? 16   ARG D NH1 1 
ATOM   8921  N NH2 . ARG D 4 16  ? 154.540 113.446 91.120  1.00 424.04 ? 16   ARG D NH2 1 
ATOM   8922  N N   . LYS D 4 17  ? 151.518 114.082 96.597  1.00 312.83 ? 17   LYS D N   1 
ATOM   8923  C CA  . LYS D 4 17  ? 150.745 115.321 96.485  1.00 340.80 ? 17   LYS D CA  1 
ATOM   8924  C C   . LYS D 4 17  ? 150.497 115.914 97.869  1.00 345.68 ? 17   LYS D C   1 
ATOM   8925  O O   . LYS D 4 17  ? 150.678 117.123 98.086  1.00 354.03 ? 17   LYS D O   1 
ATOM   8926  C CB  . LYS D 4 17  ? 149.410 115.102 95.753  1.00 359.62 ? 17   LYS D CB  1 
ATOM   8927  C CG  . LYS D 4 17  ? 149.517 115.123 94.232  1.00 382.40 ? 17   LYS D CG  1 
ATOM   8928  C CD  . LYS D 4 17  ? 148.166 115.350 93.562  1.00 398.37 ? 17   LYS D CD  1 
ATOM   8929  C CE  . LYS D 4 17  ? 147.767 116.824 93.533  1.00 403.96 ? 17   LYS D CE  1 
ATOM   8930  N NZ  . LYS D 4 17  ? 148.592 117.658 92.611  1.00 393.43 ? 17   LYS D NZ  1 
ATOM   8931  N N   . TYR D 4 18  ? 150.087 115.033 98.773  1.00 337.48 ? 18   TYR D N   1 
ATOM   8932  C CA  . TYR D 4 18  ? 149.797 115.409 100.163 1.00 333.55 ? 18   TYR D CA  1 
ATOM   8933  C C   . TYR D 4 18  ? 151.028 116.024 100.813 1.00 316.46 ? 18   TYR D C   1 
ATOM   8934  O O   . TYR D 4 18  ? 150.941 117.067 101.474 1.00 326.53 ? 18   TYR D O   1 
ATOM   8935  C CB  . TYR D 4 18  ? 149.229 114.250 100.981 1.00 322.19 ? 18   TYR D CB  1 
ATOM   8936  C CG  . TYR D 4 18  ? 147.720 114.219 100.943 1.00 327.24 ? 18   TYR D CG  1 
ATOM   8937  C CD1 . TYR D 4 18  ? 147.038 114.233 99.726  1.00 336.35 ? 18   TYR D CD1 1 
ATOM   8938  C CD2 . TYR D 4 18  ? 146.967 114.218 102.115 1.00 333.50 ? 18   TYR D CD2 1 
ATOM   8939  C CE1 . TYR D 4 18  ? 145.657 114.216 99.676  1.00 342.48 ? 18   TYR D CE1 1 
ATOM   8940  C CE2 . TYR D 4 18  ? 145.581 114.203 102.071 1.00 340.63 ? 18   TYR D CE2 1 
ATOM   8941  C CZ  . TYR D 4 18  ? 144.935 114.202 100.849 1.00 331.85 ? 18   TYR D CZ  1 
ATOM   8942  O OH  . TYR D 4 18  ? 143.568 114.178 100.795 1.00 337.19 ? 18   TYR D OH  1 
ATOM   8943  N N   . TYR D 4 19  ? 152.152 115.356 100.599 1.00 314.10 ? 19   TYR D N   1 
ATOM   8944  C CA  . TYR D 4 19  ? 153.449 115.784 101.135 1.00 329.31 ? 19   TYR D CA  1 
ATOM   8945  C C   . TYR D 4 19  ? 153.776 117.196 100.645 1.00 332.73 ? 19   TYR D C   1 
ATOM   8946  O O   . TYR D 4 19  ? 154.183 118.068 101.430 1.00 345.02 ? 19   TYR D O   1 
ATOM   8947  C CB  . TYR D 4 19  ? 154.549 114.785 100.765 1.00 356.96 ? 19   TYR D CB  1 
ATOM   8948  C CG  . TYR D 4 19  ? 155.961 115.256 101.026 1.00 368.58 ? 19   TYR D CG  1 
ATOM   8949  C CD1 . TYR D 4 19  ? 156.483 115.276 102.320 1.00 365.73 ? 19   TYR D CD1 1 
ATOM   8950  C CD2 . TYR D 4 19  ? 156.785 115.661 99.973  1.00 374.95 ? 19   TYR D CD2 1 
ATOM   8951  C CE1 . TYR D 4 19  ? 157.781 115.697 102.563 1.00 380.30 ? 19   TYR D CE1 1 
ATOM   8952  C CE2 . TYR D 4 19  ? 158.085 116.081 100.204 1.00 405.52 ? 19   TYR D CE2 1 
ATOM   8953  C CZ  . TYR D 4 19  ? 158.581 116.095 101.499 1.00 416.87 ? 19   TYR D CZ  1 
ATOM   8954  O OH  . TYR D 4 19  ? 159.869 116.522 101.724 1.00 433.08 ? 19   TYR D OH  1 
ATOM   8955  N N   . LEU D 4 20  ? 153.611 117.415 99.344  1.00 333.82 ? 20   LEU D N   1 
ATOM   8956  C CA  . LEU D 4 20  ? 153.904 118.711 98.743  1.00 361.28 ? 20   LEU D CA  1 
ATOM   8957  C C   . LEU D 4 20  ? 152.993 119.785 99.322  1.00 362.45 ? 20   LEU D C   1 
ATOM   8958  O O   . LEU D 4 20  ? 153.429 120.904 99.596  1.00 361.95 ? 20   LEU D O   1 
ATOM   8959  C CB  . LEU D 4 20  ? 153.743 118.647 97.223  1.00 390.59 ? 20   LEU D CB  1 
ATOM   8960  C CG  . LEU D 4 20  ? 154.238 119.862 96.437  1.00 418.52 ? 20   LEU D CG  1 
ATOM   8961  C CD1 . LEU D 4 20  ? 155.581 120.338 96.970  1.00 423.13 ? 20   LEU D CD1 1 
ATOM   8962  C CD2 . LEU D 4 20  ? 154.329 119.542 94.953  1.00 439.28 ? 20   LEU D CD2 1 
ATOM   8963  N N   . GLY D 4 21  ? 151.726 119.434 99.509  1.00 354.83 ? 21   GLY D N   1 
ATOM   8964  C CA  . GLY D 4 21  ? 150.751 120.349 100.112 1.00 352.25 ? 21   GLY D CA  1 
ATOM   8965  C C   . GLY D 4 21  ? 151.210 120.775 101.493 1.00 330.51 ? 21   GLY D C   1 
ATOM   8966  O O   . GLY D 4 21  ? 151.188 121.965 101.844 1.00 300.17 ? 21   GLY D O   1 
ATOM   8967  N N   . GLY D 4 22  ? 151.645 119.781 102.261 1.00 332.18 ? 22   GLY D N   1 
ATOM   8968  C CA  . GLY D 4 22  ? 152.143 119.975 103.627 1.00 337.02 ? 22   GLY D CA  1 
ATOM   8969  C C   . GLY D 4 22  ? 153.394 120.841 103.790 1.00 332.23 ? 22   GLY D C   1 
ATOM   8970  O O   . GLY D 4 22  ? 153.889 120.977 104.909 1.00 276.45 ? 22   GLY D O   1 
ATOM   8971  N N   . PHE D 4 23  ? 153.915 121.426 102.705 1.00 351.61 ? 23   PHE D N   1 
ATOM   8972  C CA  . PHE D 4 23  ? 154.837 122.572 102.788 1.00 353.93 ? 23   PHE D CA  1 
ATOM   8973  C C   . PHE D 4 23  ? 154.159 123.932 102.556 1.00 350.82 ? 23   PHE D C   1 
ATOM   8974  O O   . PHE D 4 23  ? 154.839 124.962 102.565 1.00 376.02 ? 23   PHE D O   1 
ATOM   8975  C CB  . PHE D 4 23  ? 155.992 122.419 101.788 1.00 360.18 ? 23   PHE D CB  1 
ATOM   8976  C CG  . PHE D 4 23  ? 157.014 121.394 102.183 1.00 368.11 ? 23   PHE D CG  1 
ATOM   8977  C CD1 . PHE D 4 23  ? 157.652 121.458 103.420 1.00 372.68 ? 23   PHE D CD1 1 
ATOM   8978  C CD2 . PHE D 4 23  ? 157.374 120.384 101.300 1.00 397.02 ? 23   PHE D CD2 1 
ATOM   8979  C CE1 . PHE D 4 23  ? 158.610 120.519 103.775 1.00 398.80 ? 23   PHE D CE1 1 
ATOM   8980  C CE2 . PHE D 4 23  ? 158.328 119.445 101.649 1.00 410.70 ? 23   PHE D CE2 1 
ATOM   8981  C CZ  . PHE D 4 23  ? 158.947 119.508 102.889 1.00 407.83 ? 23   PHE D CZ  1 
ATOM   8982  N N   . ALA D 4 24  ? 152.837 123.952 102.378 1.00 325.69 ? 24   ALA D N   1 
ATOM   8983  C CA  . ALA D 4 24  ? 152.099 125.196 102.138 1.00 349.48 ? 24   ALA D CA  1 
ATOM   8984  C C   . ALA D 4 24  ? 151.390 125.689 103.403 1.00 347.58 ? 24   ALA D C   1 
ATOM   8985  O O   . ALA D 4 24  ? 150.334 126.320 103.320 1.00 356.92 ? 24   ALA D O   1 
ATOM   8986  C CB  . ALA D 4 24  ? 151.100 124.995 101.007 1.00 371.58 ? 24   ALA D CB  1 
ATOM   8987  N N   . PHE D 4 25  ? 152.004 125.436 104.560 1.00 350.60 ? 25   PHE D N   1 
ATOM   8988  C CA  . PHE D 4 25  ? 151.395 125.653 105.873 1.00 357.74 ? 25   PHE D CA  1 
ATOM   8989  C C   . PHE D 4 25  ? 150.144 124.797 106.083 1.00 328.18 ? 25   PHE D C   1 
ATOM   8990  O O   . PHE D 4 25  ? 149.092 125.299 106.492 1.00 322.47 ? 25   PHE D O   1 
ATOM   8991  C CB  . PHE D 4 25  ? 151.088 127.143 106.131 1.00 376.19 ? 25   PHE D CB  1 
ATOM   8992  C CG  . PHE D 4 25  ? 152.234 128.070 105.835 1.00 360.01 ? 25   PHE D CG  1 
ATOM   8993  C CD1 . PHE D 4 25  ? 153.499 127.822 106.350 1.00 369.04 ? 25   PHE D CD1 1 
ATOM   8994  C CD2 . PHE D 4 25  ? 152.040 129.212 105.062 1.00 392.30 ? 25   PHE D CD2 1 
ATOM   8995  C CE1 . PHE D 4 25  ? 154.557 128.678 106.086 1.00 403.68 ? 25   PHE D CE1 1 
ATOM   8996  C CE2 . PHE D 4 25  ? 153.092 130.076 104.796 1.00 417.34 ? 25   PHE D CE2 1 
ATOM   8997  C CZ  . PHE D 4 25  ? 154.354 129.809 105.308 1.00 421.93 ? 25   PHE D CZ  1 
ATOM   8998  N N   . LEU D 4 26  ? 150.262 123.501 105.806 1.00 294.91 ? 26   LEU D N   1 
ATOM   8999  C CA  . LEU D 4 26  ? 149.210 122.549 106.159 1.00 302.22 ? 26   LEU D CA  1 
ATOM   9000  C C   . LEU D 4 26  ? 149.745 121.319 106.923 1.00 296.66 ? 26   LEU D C   1 
ATOM   9001  O O   . LEU D 4 26  ? 149.782 120.215 106.376 1.00 321.58 ? 26   LEU D O   1 
ATOM   9002  C CB  . LEU D 4 26  ? 148.441 122.104 104.916 1.00 334.54 ? 26   LEU D CB  1 
ATOM   9003  C CG  . LEU D 4 26  ? 147.448 123.030 104.202 1.00 356.23 ? 26   LEU D CG  1 
ATOM   9004  C CD1 . LEU D 4 26  ? 148.121 124.219 103.530 1.00 368.81 ? 26   LEU D CD1 1 
ATOM   9005  C CD2 . LEU D 4 26  ? 146.643 122.206 103.196 1.00 369.83 ? 26   LEU D CD2 1 
ATOM   9006  N N   . PRO D 4 27  ? 150.174 121.508 108.188 1.00 305.15 ? 27   PRO D N   1 
ATOM   9007  C CA  . PRO D 4 27  ? 150.472 120.445 109.130 1.00 324.79 ? 27   PRO D CA  1 
ATOM   9008  C C   . PRO D 4 27  ? 149.351 119.446 109.226 1.00 327.93 ? 27   PRO D C   1 
ATOM   9009  O O   . PRO D 4 27  ? 149.629 118.243 109.312 1.00 352.78 ? 27   PRO D O   1 
ATOM   9010  C CB  . PRO D 4 27  ? 150.620 121.190 110.453 1.00 347.73 ? 27   PRO D CB  1 
ATOM   9011  C CG  . PRO D 4 27  ? 151.173 122.506 110.058 1.00 345.10 ? 27   PRO D CG  1 
ATOM   9012  C CD  . PRO D 4 27  ? 150.696 122.801 108.668 1.00 316.69 ? 27   PRO D CD  1 
ATOM   9013  N N   . PHE D 4 28  ? 148.108 119.939 109.166 1.00 340.65 ? 28   PHE D N   1 
ATOM   9014  C CA  . PHE D 4 28  ? 146.926 119.075 109.190 1.00 360.46 ? 28   PHE D CA  1 
ATOM   9015  C C   . PHE D 4 28  ? 146.968 118.098 108.025 1.00 324.87 ? 28   PHE D C   1 
ATOM   9016  O O   . PHE D 4 28  ? 146.706 116.899 108.213 1.00 337.26 ? 28   PHE D O   1 
ATOM   9017  C CB  . PHE D 4 28  ? 145.608 119.861 109.199 1.00 374.71 ? 28   PHE D CB  1 
ATOM   9018  C CG  . PHE D 4 28  ? 144.464 119.112 109.833 1.00 382.05 ? 28   PHE D CG  1 
ATOM   9019  C CD1 . PHE D 4 28  ? 143.825 118.077 109.156 1.00 354.57 ? 28   PHE D CD1 1 
ATOM   9020  C CD2 . PHE D 4 28  ? 144.038 119.427 111.122 1.00 405.47 ? 28   PHE D CD2 1 
ATOM   9021  C CE1 . PHE D 4 28  ? 142.773 117.385 109.741 1.00 355.34 ? 28   PHE D CE1 1 
ATOM   9022  C CE2 . PHE D 4 28  ? 142.989 118.736 111.713 1.00 416.90 ? 28   PHE D CE2 1 
ATOM   9023  C CZ  . PHE D 4 28  ? 142.355 117.713 111.020 1.00 391.80 ? 28   PHE D CZ  1 
ATOM   9024  N N   . LEU D 4 29  ? 147.306 118.629 106.853 1.00 312.09 ? 29   LEU D N   1 
ATOM   9025  C CA  . LEU D 4 29  ? 147.398 117.827 105.629 1.00 322.75 ? 29   LEU D CA  1 
ATOM   9026  C C   . LEU D 4 29  ? 148.415 116.707 105.806 1.00 313.68 ? 29   LEU D C   1 
ATOM   9027  O O   . LEU D 4 29  ? 148.150 115.548 105.455 1.00 329.06 ? 29   LEU D O   1 
ATOM   9028  C CB  . LEU D 4 29  ? 147.755 118.681 104.414 1.00 317.19 ? 29   LEU D CB  1 
ATOM   9029  C CG  . LEU D 4 29  ? 147.411 118.082 103.053 1.00 331.44 ? 29   LEU D CG  1 
ATOM   9030  C CD1 . LEU D 4 29  ? 145.915 118.155 102.787 1.00 313.86 ? 29   LEU D CD1 1 
ATOM   9031  C CD2 . LEU D 4 29  ? 148.165 118.795 101.945 1.00 357.43 ? 29   LEU D CD2 1 
ATOM   9032  N N   . TRP D 4 30  ? 149.559 117.089 106.359 1.00 313.76 ? 30   TRP D N   1 
ATOM   9033  C CA  . TRP D 4 30  ? 150.663 116.153 106.622 1.00 323.82 ? 30   TRP D CA  1 
ATOM   9034  C C   . TRP D 4 30  ? 150.193 115.028 107.529 1.00 311.64 ? 30   TRP D C   1 
ATOM   9035  O O   . TRP D 4 30  ? 150.465 113.848 107.270 1.00 345.18 ? 30   TRP D O   1 
ATOM   9036  C CB  . TRP D 4 30  ? 151.890 116.827 107.256 1.00 340.96 ? 30   TRP D CB  1 
ATOM   9037  C CG  . TRP D 4 30  ? 152.985 117.217 106.309 1.00 340.35 ? 30   TRP D CG  1 
ATOM   9038  C CD1 . TRP D 4 30  ? 153.188 116.768 105.032 1.00 344.38 ? 30   TRP D CD1 1 
ATOM   9039  C CD2 . TRP D 4 30  ? 154.073 118.098 106.599 1.00 343.70 ? 30   TRP D CD2 1 
ATOM   9040  N NE1 . TRP D 4 30  ? 154.312 117.344 104.502 1.00 356.60 ? 30   TRP D NE1 1 
ATOM   9041  C CE2 . TRP D 4 30  ? 154.879 118.159 105.444 1.00 344.96 ? 30   TRP D CE2 1 
ATOM   9042  C CE3 . TRP D 4 30  ? 154.441 118.849 107.725 1.00 330.20 ? 30   TRP D CE3 1 
ATOM   9043  C CZ2 . TRP D 4 30  ? 156.029 118.943 105.376 1.00 358.86 ? 30   TRP D CZ2 1 
ATOM   9044  C CZ3 . TRP D 4 30  ? 155.583 119.634 107.656 1.00 332.52 ? 30   TRP D CZ3 1 
ATOM   9045  C CH2 . TRP D 4 30  ? 156.366 119.673 106.488 1.00 362.66 ? 30   TRP D CH2 1 
ATOM   9046  N N   . LEU D 4 31  ? 149.495 115.428 108.582 1.00 297.17 ? 31   LEU D N   1 
ATOM   9047  C CA  . LEU D 4 31  ? 148.947 114.502 109.581 1.00 301.82 ? 31   LEU D CA  1 
ATOM   9048  C C   . LEU D 4 31  ? 148.027 113.490 108.903 1.00 305.64 ? 31   LEU D C   1 
ATOM   9049  O O   . LEU D 4 31  ? 148.113 112.277 109.150 1.00 324.84 ? 31   LEU D O   1 
ATOM   9050  C CB  . LEU D 4 31  ? 148.173 115.254 110.666 1.00 308.97 ? 31   LEU D CB  1 
ATOM   9051  C CG  . LEU D 4 31  ? 147.792 114.407 111.884 1.00 335.88 ? 31   LEU D CG  1 
ATOM   9052  C CD1 . LEU D 4 31  ? 148.984 114.194 112.814 1.00 339.47 ? 31   LEU D CD1 1 
ATOM   9053  C CD2 . LEU D 4 31  ? 146.619 115.038 112.622 1.00 368.91 ? 31   LEU D CD2 1 
ATOM   9054  N N   . VAL D 4 32  ? 147.156 114.030 108.059 1.00 306.90 ? 32   VAL D N   1 
ATOM   9055  C CA  . VAL D 4 32  ? 146.179 113.234 107.305 1.00 318.09 ? 32   VAL D CA  1 
ATOM   9056  C C   . VAL D 4 32  ? 146.897 112.191 106.456 1.00 310.47 ? 32   VAL D C   1 
ATOM   9057  O O   . VAL D 4 32  ? 146.516 111.015 106.434 1.00 346.55 ? 32   VAL D O   1 
ATOM   9058  C CB  . VAL D 4 32  ? 145.255 114.117 106.421 1.00 329.23 ? 32   VAL D CB  1 
ATOM   9059  C CG1 . VAL D 4 32  ? 144.493 113.291 105.390 1.00 326.54 ? 32   VAL D CG1 1 
ATOM   9060  C CG2 . VAL D 4 32  ? 144.266 114.875 107.292 1.00 366.39 ? 32   VAL D CG2 1 
ATOM   9061  N N   . ASN D 4 33  ? 147.927 112.663 105.772 1.00 305.11 ? 33   ASN D N   1 
ATOM   9062  C CA  . ASN D 4 33  ? 148.757 111.831 104.893 1.00 320.23 ? 33   ASN D CA  1 
ATOM   9063  C C   . ASN D 4 33  ? 149.355 110.670 105.684 1.00 301.85 ? 33   ASN D C   1 
ATOM   9064  O O   . ASN D 4 33  ? 149.318 109.509 105.248 1.00 313.21 ? 33   ASN D O   1 
ATOM   9065  C CB  . ASN D 4 33  ? 149.869 112.710 104.312 1.00 327.32 ? 33   ASN D CB  1 
ATOM   9066  C CG  . ASN D 4 33  ? 150.762 111.976 103.351 1.00 338.09 ? 33   ASN D CG  1 
ATOM   9067  O OD1 . ASN D 4 33  ? 150.330 111.571 102.277 1.00 366.78 ? 33   ASN D OD1 1 
ATOM   9068  N ND2 . ASN D 4 33  ? 152.026 111.809 103.728 1.00 349.71 ? 33   ASN D ND2 1 
ATOM   9069  N N   . ILE D 4 34  ? 149.896 111.025 106.841 1.00 290.49 ? 34   ILE D N   1 
ATOM   9070  C CA  . ILE D 4 34  ? 150.529 110.067 107.752 1.00 303.57 ? 34   ILE D CA  1 
ATOM   9071  C C   . ILE D 4 34  ? 149.528 108.983 108.150 1.00 311.69 ? 34   ILE D C   1 
ATOM   9072  O O   . ILE D 4 34  ? 149.839 107.782 108.122 1.00 341.84 ? 34   ILE D O   1 
ATOM   9073  C CB  . ILE D 4 34  ? 151.090 110.747 109.017 1.00 322.82 ? 34   ILE D CB  1 
ATOM   9074  C CG1 . ILE D 4 34  ? 152.281 111.638 108.651 1.00 336.52 ? 34   ILE D CG1 1 
ATOM   9075  C CG2 . ILE D 4 34  ? 151.509 109.723 110.074 1.00 344.27 ? 34   ILE D CG2 1 
ATOM   9076  C CD1 . ILE D 4 34  ? 152.340 112.885 109.497 1.00 356.33 ? 34   ILE D CD1 1 
ATOM   9077  N N   . PHE D 4 35  ? 148.338 109.447 108.508 1.00 315.30 ? 35   PHE D N   1 
ATOM   9078  C CA  . PHE D 4 35  ? 147.241 108.572 108.929 1.00 327.68 ? 35   PHE D CA  1 
ATOM   9079  C C   . PHE D 4 35  ? 146.897 107.590 107.817 1.00 321.59 ? 35   PHE D C   1 
ATOM   9080  O O   . PHE D 4 35  ? 146.751 106.379 108.021 1.00 350.71 ? 35   PHE D O   1 
ATOM   9081  C CB  . PHE D 4 35  ? 146.008 109.361 109.393 1.00 357.36 ? 35   PHE D CB  1 
ATOM   9082  C CG  . PHE D 4 35  ? 145.991 109.638 110.874 1.00 362.86 ? 35   PHE D CG  1 
ATOM   9083  C CD1 . PHE D 4 35  ? 147.078 110.249 111.494 1.00 366.77 ? 35   PHE D CD1 1 
ATOM   9084  C CD2 . PHE D 4 35  ? 144.888 109.291 111.652 1.00 387.73 ? 35   PHE D CD2 1 
ATOM   9085  C CE1 . PHE D 4 35  ? 147.066 110.506 112.857 1.00 394.52 ? 35   PHE D CE1 1 
ATOM   9086  C CE2 . PHE D 4 35  ? 144.870 109.547 113.016 1.00 403.00 ? 35   PHE D CE2 1 
ATOM   9087  C CZ  . PHE D 4 35  ? 145.961 110.156 113.620 1.00 403.90 ? 35   PHE D CZ  1 
ATOM   9088  N N   . TRP D 4 36  ? 146.735 108.176 106.634 1.00 313.98 ? 36   TRP D N   1 
ATOM   9089  C CA  . TRP D 4 36  ? 146.134 107.537 105.469 1.00 330.98 ? 36   TRP D CA  1 
ATOM   9090  C C   . TRP D 4 36  ? 147.150 106.796 104.588 1.00 322.66 ? 36   TRP D C   1 
ATOM   9091  O O   . TRP D 4 36  ? 146.815 106.348 103.489 1.00 294.95 ? 36   TRP D O   1 
ATOM   9092  C CB  . TRP D 4 36  ? 145.433 108.636 104.672 1.00 331.80 ? 36   TRP D CB  1 
ATOM   9093  C CG  . TRP D 4 36  ? 144.500 108.198 103.634 1.00 315.35 ? 36   TRP D CG  1 
ATOM   9094  C CD1 . TRP D 4 36  ? 143.590 107.191 103.713 1.00 326.61 ? 36   TRP D CD1 1 
ATOM   9095  C CD2 . TRP D 4 36  ? 144.341 108.793 102.350 1.00 306.61 ? 36   TRP D CD2 1 
ATOM   9096  N NE1 . TRP D 4 36  ? 142.883 107.106 102.537 1.00 349.17 ? 36   TRP D NE1 1 
ATOM   9097  C CE2 . TRP D 4 36  ? 143.325 108.084 101.685 1.00 326.85 ? 36   TRP D CE2 1 
ATOM   9098  C CE3 . TRP D 4 36  ? 144.968 109.855 101.691 1.00 325.82 ? 36   TRP D CE3 1 
ATOM   9099  C CZ2 . TRP D 4 36  ? 142.929 108.394 100.384 1.00 340.90 ? 36   TRP D CZ2 1 
ATOM   9100  C CZ3 . TRP D 4 36  ? 144.569 110.170 100.401 1.00 328.38 ? 36   TRP D CZ3 1 
ATOM   9101  C CH2 . TRP D 4 36  ? 143.557 109.445 99.762  1.00 335.38 ? 36   TRP D CH2 1 
ATOM   9102  N N   . PHE D 4 37  ? 148.392 106.702 105.062 1.00 328.42 ? 37   PHE D N   1 
ATOM   9103  C CA  . PHE D 4 37  ? 149.398 105.821 104.484 1.00 327.10 ? 37   PHE D CA  1 
ATOM   9104  C C   . PHE D 4 37  ? 150.225 105.083 105.559 1.00 352.49 ? 37   PHE D C   1 
ATOM   9105  O O   . PHE D 4 37  ? 151.333 104.627 105.275 1.00 370.54 ? 37   PHE D O   1 
ATOM   9106  C CB  . PHE D 4 37  ? 150.301 106.639 103.551 1.00 307.63 ? 37   PHE D CB  1 
ATOM   9107  C CG  . PHE D 4 37  ? 149.601 107.130 102.320 1.00 315.28 ? 37   PHE D CG  1 
ATOM   9108  C CD1 . PHE D 4 37  ? 149.266 106.243 101.305 1.00 362.70 ? 37   PHE D CD1 1 
ATOM   9109  C CD2 . PHE D 4 37  ? 149.252 108.464 102.178 1.00 330.97 ? 37   PHE D CD2 1 
ATOM   9110  C CE1 . PHE D 4 37  ? 148.607 106.682 100.165 1.00 384.17 ? 37   PHE D CE1 1 
ATOM   9111  C CE2 . PHE D 4 37  ? 148.595 108.912 101.041 1.00 354.96 ? 37   PHE D CE2 1 
ATOM   9112  C CZ  . PHE D 4 37  ? 148.271 108.019 100.033 1.00 375.89 ? 37   PHE D CZ  1 
ATOM   9113  N N   . PHE D 4 38  ? 149.855 105.294 106.817 1.00 355.47 ? 38   PHE D N   1 
ATOM   9114  C CA  . PHE D 4 38  ? 150.574 104.626 107.875 1.00 369.40 ? 38   PHE D CA  1 
ATOM   9115  C C   . PHE D 4 38  ? 150.190 103.188 107.755 1.00 388.91 ? 38   PHE D C   1 
ATOM   9116  O O   . PHE D 4 38  ? 151.033 102.289 107.787 1.00 396.84 ? 38   PHE D O   1 
ATOM   9117  C CB  . PHE D 4 38  ? 150.169 105.159 109.261 1.00 395.04 ? 38   PHE D CB  1 
ATOM   9118  C CG  . PHE D 4 38  ? 150.447 104.198 110.399 1.00 403.19 ? 38   PHE D CG  1 
ATOM   9119  C CD1 . PHE D 4 38  ? 151.539 103.354 110.342 1.00 407.37 ? 38   PHE D CD1 1 
ATOM   9120  C CD2 . PHE D 4 38  ? 149.592 104.109 111.483 1.00 413.49 ? 38   PHE D CD2 1 
ATOM   9121  C CE1 . PHE D 4 38  ? 151.798 102.462 111.362 1.00 408.51 ? 38   PHE D CE1 1 
ATOM   9122  C CE2 . PHE D 4 38  ? 149.844 103.219 112.509 1.00 424.18 ? 38   PHE D CE2 1 
ATOM   9123  C CZ  . PHE D 4 38  ? 150.950 102.393 112.447 1.00 421.70 ? 38   PHE D CZ  1 
ATOM   9124  N N   . ARG D 4 39  ? 148.885 102.981 107.636 1.00 399.73 ? 39   ARG D N   1 
ATOM   9125  C CA  . ARG D 4 39  ? 148.409 101.636 107.761 1.00 401.28 ? 39   ARG D CA  1 
ATOM   9126  C C   . ARG D 4 39  ? 148.980 100.870 106.611 1.00 391.17 ? 39   ARG D C   1 
ATOM   9127  O O   . ARG D 4 39  ? 149.734 99.951  106.824 1.00 402.99 ? 39   ARG D O   1 
ATOM   9128  C CB  . ARG D 4 39  ? 146.881 101.598 107.721 1.00 411.03 ? 39   ARG D CB  1 
ATOM   9129  C CG  . ARG D 4 39  ? 146.234 101.074 108.994 1.00 423.12 ? 39   ARG D CG  1 
ATOM   9130  C CD  . ARG D 4 39  ? 145.350 102.129 109.637 1.00 435.41 ? 39   ARG D CD  1 
ATOM   9131  N NE  . ARG D 4 39  ? 144.483 101.567 110.668 1.00 449.17 ? 39   ARG D NE  1 
ATOM   9132  C CZ  . ARG D 4 39  ? 143.391 100.853 110.419 1.00 458.86 ? 39   ARG D CZ  1 
ATOM   9133  N NH1 . ARG D 4 39  ? 143.030 100.606 109.168 1.00 458.61 ? 39   ARG D NH1 1 
ATOM   9134  N NH2 . ARG D 4 39  ? 142.658 100.388 111.421 1.00 467.35 ? 39   ARG D NH2 1 
ATOM   9135  N N   . GLU D 4 40  ? 148.803 101.376 105.400 1.00 377.34 ? 40   GLU D N   1 
ATOM   9136  C CA  . GLU D 4 40  ? 149.184 100.580 104.255 1.00 374.30 ? 40   GLU D CA  1 
ATOM   9137  C C   . GLU D 4 40  ? 150.673 100.353 104.322 1.00 358.86 ? 40   GLU D C   1 
ATOM   9138  O O   . GLU D 4 40  ? 151.152 99.220  104.236 1.00 367.67 ? 40   GLU D O   1 
ATOM   9139  C CB  . GLU D 4 40  ? 148.802 101.285 102.958 1.00 384.82 ? 40   GLU D CB  1 
ATOM   9140  C CG  . GLU D 4 40  ? 147.559 100.710 102.298 1.00 409.69 ? 40   GLU D CG  1 
ATOM   9141  C CD  . GLU D 4 40  ? 146.271 101.210 102.925 1.00 421.39 ? 40   GLU D CD  1 
ATOM   9142  O OE1 . GLU D 4 40  ? 145.784 102.278 102.506 1.00 399.04 ? 40   GLU D OE1 1 
ATOM   9143  O OE2 . GLU D 4 40  ? 145.740 100.534 103.829 1.00 446.87 ? 40   GLU D OE2 1 
ATOM   9144  N N   . ALA D 4 41  ? 151.403 101.423 104.588 1.00 370.11 ? 41   ALA D N   1 
ATOM   9145  C CA  . ALA D 4 41  ? 152.835 101.337 104.485 1.00 382.16 ? 41   ALA D CA  1 
ATOM   9146  C C   . ALA D 4 41  ? 153.420 100.350 105.468 1.00 385.51 ? 41   ALA D C   1 
ATOM   9147  O O   . ALA D 4 41  ? 154.252 99.533  105.072 1.00 389.57 ? 41   ALA D O   1 
ATOM   9148  C CB  . ALA D 4 41  ? 153.458 102.706 104.685 1.00 387.35 ? 41   ALA D CB  1 
ATOM   9149  N N   . PHE D 4 42  ? 153.012 100.407 106.736 1.00 398.32 ? 42   PHE D N   1 
ATOM   9150  C CA  . PHE D 4 42  ? 153.569 99.430  107.682 1.00 420.25 ? 42   PHE D CA  1 
ATOM   9151  C C   . PHE D 4 42  ? 153.006 98.042  107.443 1.00 417.22 ? 42   PHE D C   1 
ATOM   9152  O O   . PHE D 4 42  ? 153.700 97.026  107.486 1.00 404.96 ? 42   PHE D O   1 
ATOM   9153  C CB  . PHE D 4 42  ? 153.433 99.867  109.137 1.00 439.98 ? 42   PHE D CB  1 
ATOM   9154  C CG  . PHE D 4 42  ? 154.754 100.061 109.821 1.00 482.41 ? 42   PHE D CG  1 
ATOM   9155  C CD1 . PHE D 4 42  ? 155.568 101.129 109.489 1.00 495.38 ? 42   PHE D CD1 1 
ATOM   9156  C CD2 . PHE D 4 42  ? 155.193 99.165  110.778 1.00 500.00 ? 42   PHE D CD2 1 
ATOM   9157  C CE1 . PHE D 4 42  ? 156.788 101.311 110.109 1.00 500.00 ? 42   PHE D CE1 1 
ATOM   9158  C CE2 . PHE D 4 42  ? 156.413 99.339  111.401 1.00 500.00 ? 42   PHE D CE2 1 
ATOM   9159  C CZ  . PHE D 4 42  ? 157.212 100.413 111.065 1.00 500.00 ? 42   PHE D CZ  1 
ATOM   9160  N N   . LEU D 4 43  ? 151.692 98.083  107.238 1.00 415.75 ? 43   LEU D N   1 
ATOM   9161  C CA  . LEU D 4 43  ? 150.834 96.931  107.075 1.00 420.58 ? 43   LEU D CA  1 
ATOM   9162  C C   . LEU D 4 43  ? 151.148 96.109  105.845 1.00 408.13 ? 43   LEU D C   1 
ATOM   9163  O O   . LEU D 4 43  ? 151.136 94.881  105.925 1.00 413.67 ? 43   LEU D O   1 
ATOM   9164  C CB  . LEU D 4 43  ? 149.365 97.364  107.047 1.00 425.60 ? 43   LEU D CB  1 
ATOM   9165  C CG  . LEU D 4 43  ? 148.337 96.303  107.446 1.00 437.94 ? 43   LEU D CG  1 
ATOM   9166  C CD1 . LEU D 4 43  ? 147.764 96.602  108.823 1.00 435.12 ? 43   LEU D CD1 1 
ATOM   9167  C CD2 . LEU D 4 43  ? 147.229 96.211  106.408 1.00 448.53 ? 43   LEU D CD2 1 
ATOM   9168  N N   . VAL D 4 44  ? 151.430 96.730  104.699 1.00 395.40 ? 44   VAL D N   1 
ATOM   9169  C CA  . VAL D 4 44  ? 151.702 95.820  103.595 1.00 408.43 ? 44   VAL D CA  1 
ATOM   9170  C C   . VAL D 4 44  ? 152.857 94.878  103.907 1.00 421.92 ? 44   VAL D C   1 
ATOM   9171  O O   . VAL D 4 44  ? 153.869 95.301  104.478 1.00 430.74 ? 44   VAL D O   1 
ATOM   9172  C CB  . VAL D 4 44  ? 152.026 96.580  102.295 1.00 411.03 ? 44   VAL D CB  1 
ATOM   9173  C CG1 . VAL D 4 44  ? 151.716 95.711  101.087 1.00 424.27 ? 44   VAL D CG1 1 
ATOM   9174  C CG2 . VAL D 4 44  ? 151.254 97.887  102.233 1.00 404.27 ? 44   VAL D CG2 1 
ATOM   9175  N N   . PRO D 4 45  ? 152.675 93.542  103.504 1.00 428.62 ? 45   PRO D N   1 
ATOM   9176  C CA  . PRO D 4 45  ? 153.875 92.714  103.714 1.00 422.16 ? 45   PRO D CA  1 
ATOM   9177  C C   . PRO D 4 45  ? 154.971 93.245  102.816 1.00 413.89 ? 45   PRO D C   1 
ATOM   9178  O O   . PRO D 4 45  ? 156.124 93.383  103.214 1.00 397.77 ? 45   PRO D O   1 
ATOM   9179  C CB  . PRO D 4 45  ? 153.445 91.330  103.235 1.00 423.40 ? 45   PRO D CB  1 
ATOM   9180  C CG  . PRO D 4 45  ? 152.468 91.608  102.160 1.00 428.90 ? 45   PRO D CG  1 
ATOM   9181  C CD  . PRO D 4 45  ? 151.625 92.632  102.832 1.00 426.04 ? 45   PRO D CD  1 
ATOM   9182  N N   . ALA D 4 46  ? 154.581 93.544  101.585 1.00 411.76 ? 46   ALA D N   1 
ATOM   9183  C CA  . ALA D 4 46  ? 155.414 94.276  100.655 1.00 405.52 ? 46   ALA D CA  1 
ATOM   9184  C C   . ALA D 4 46  ? 154.526 94.937  99.613  1.00 384.70 ? 46   ALA D C   1 
ATOM   9185  O O   . ALA D 4 46  ? 153.421 94.476  99.341  1.00 387.20 ? 46   ALA D O   1 
ATOM   9186  C CB  . ALA D 4 46  ? 156.422 93.353  99.995  1.00 419.08 ? 46   ALA D CB  1 
ATOM   9187  N N   . TYR D 4 47  ? 155.026 96.011  99.025  1.00 379.37 ? 47   TYR D N   1 
ATOM   9188  C CA  . TYR D 4 47  ? 154.380 96.665  97.904  1.00 370.93 ? 47   TYR D CA  1 
ATOM   9189  C C   . TYR D 4 47  ? 155.565 96.954  97.003  1.00 385.49 ? 47   TYR D C   1 
ATOM   9190  O O   . TYR D 4 47  ? 156.700 96.997  97.472  1.00 401.54 ? 47   TYR D O   1 
ATOM   9191  C CB  . TYR D 4 47  ? 153.698 97.972  98.335  1.00 20.00  ? 47   TYR D CB  1 
ATOM   9192  C CG  . TYR D 4 47  ? 152.164 98.000  98.303  1.00 20.00  ? 47   TYR D CG  1 
ATOM   9193  C CD1 . TYR D 4 47  ? 151.400 96.848  98.486  1.00 20.00  ? 47   TYR D CD1 1 
ATOM   9194  C CD2 . TYR D 4 47  ? 151.482 99.198  98.115  1.00 20.00  ? 47   TYR D CD2 1 
ATOM   9195  C CE1 . TYR D 4 47  ? 150.003 96.891  98.468  1.00 20.00  ? 47   TYR D CE1 1 
ATOM   9196  C CE2 . TYR D 4 47  ? 150.092 99.251  98.097  1.00 20.00  ? 47   TYR D CE2 1 
ATOM   9197  C CZ  . TYR D 4 47  ? 149.343 98.101  98.272  1.00 20.00  ? 47   TYR D CZ  1 
ATOM   9198  O OH  . TYR D 4 47  ? 147.940 98.177  98.259  1.00 20.00  ? 47   TYR D OH  1 
ATOM   9199  N N   . THR D 4 48  ? 155.324 97.129  95.714  1.00 413.19 ? 48   THR D N   1 
ATOM   9200  C CA  . THR D 4 48  ? 156.403 97.470  94.804  1.00 436.22 ? 48   THR D CA  1 
ATOM   9201  C C   . THR D 4 48  ? 156.989 98.817  95.216  1.00 438.74 ? 48   THR D C   1 
ATOM   9202  O O   . THR D 4 48  ? 158.201 99.021  95.219  1.00 443.05 ? 48   THR D O   1 
ATOM   9203  C CB  . THR D 4 48  ? 155.873 97.574  93.367  1.00 443.49 ? 48   THR D CB  1 
ATOM   9204  O OG1 . THR D 4 48  ? 155.188 98.821  93.198  1.00 434.50 ? 48   THR D OG1 1 
ATOM   9205  C CG2 . THR D 4 48  ? 154.904 96.441  93.083  1.00 439.02 ? 48   THR D CG2 1 
ATOM   9206  N N   . GLU D 4 49  ? 156.087 99.720  95.578  1.00 425.52 ? 49   GLU D N   1 
ATOM   9207  C CA  . GLU D 4 49  ? 156.376 101.094 95.978  1.00 411.69 ? 49   GLU D CA  1 
ATOM   9208  C C   . GLU D 4 49  ? 156.169 101.310 97.475  1.00 396.40 ? 49   GLU D C   1 
ATOM   9209  O O   . GLU D 4 49  ? 156.190 102.443 97.955  1.00 389.43 ? 49   GLU D O   1 
ATOM   9210  C CB  . GLU D 4 49  ? 155.513 102.075 95.182  1.00 20.00  ? 49   GLU D CB  1 
ATOM   9211  C CG  . GLU D 4 49  ? 155.438 101.770 93.695  1.00 20.00  ? 49   GLU D CG  1 
ATOM   9212  C CD  . GLU D 4 49  ? 156.678 102.218 92.946  1.00 20.00  ? 49   GLU D CD  1 
ATOM   9213  O OE1 . GLU D 4 49  ? 156.812 103.432 92.686  1.00 20.00  ? 49   GLU D OE1 1 
ATOM   9214  O OE2 . GLU D 4 49  ? 157.520 101.355 92.617  1.00 20.00  ? 49   GLU D OE2 1 
ATOM   9215  N N   . GLN D 4 50  ? 155.959 100.220 98.205  1.00 401.95 ? 50   GLN D N   1 
ATOM   9216  C CA  . GLN D 4 50  ? 155.626 100.295 99.624  1.00 401.69 ? 50   GLN D CA  1 
ATOM   9217  C C   . GLN D 4 50  ? 156.733 100.958 100.436 1.00 392.99 ? 50   GLN D C   1 
ATOM   9218  O O   . GLN D 4 50  ? 156.460 101.730 101.356 1.00 402.38 ? 50   GLN D O   1 
ATOM   9219  C CB  . GLN D 4 50  ? 155.333 98.899  100.178 1.00 401.46 ? 50   GLN D CB  1 
ATOM   9220  C CG  . GLN D 4 50  ? 155.068 98.868  101.674 1.00 405.69 ? 50   GLN D CG  1 
ATOM   9221  C CD  . GLN D 4 50  ? 156.344 98.800  102.491 1.00 435.38 ? 50   GLN D CD  1 
ATOM   9222  O OE1 . GLN D 4 50  ? 156.801 99.805  103.034 1.00 442.83 ? 50   GLN D OE1 1 
ATOM   9223  N NE2 . GLN D 4 50  ? 156.926 97.610  102.581 1.00 458.69 ? 50   GLN D NE2 1 
ATOM   9224  N N   . SER D 4 51  ? 157.980 100.655 100.096 1.00 412.58 ? 51   SER D N   1 
ATOM   9225  C CA  . SER D 4 51  ? 159.122 101.215 100.809 1.00 433.80 ? 51   SER D CA  1 
ATOM   9226  C C   . SER D 4 51  ? 159.166 102.737 100.682 1.00 420.24 ? 51   SER D C   1 
ATOM   9227  O O   . SER D 4 51  ? 159.483 103.438 101.643 1.00 414.30 ? 51   SER D O   1 
ATOM   9228  C CB  . SER D 4 51  ? 160.427 100.607 100.292 1.00 457.98 ? 51   SER D CB  1 
ATOM   9229  O OG  . SER D 4 51  ? 161.493 100.845 101.194 1.00 465.29 ? 51   SER D OG  1 
ATOM   9230  N N   . GLN D 4 52  ? 158.849 103.241 99.494  1.00 400.25 ? 52   GLN D N   1 
ATOM   9231  C CA  . GLN D 4 52  ? 158.887 104.678 99.236  1.00 398.84 ? 52   GLN D CA  1 
ATOM   9232  C C   . GLN D 4 52  ? 157.897 105.452 100.105 1.00 379.76 ? 52   GLN D C   1 
ATOM   9233  O O   . GLN D 4 52  ? 158.215 106.529 100.609 1.00 354.68 ? 52   GLN D O   1 
ATOM   9234  C CB  . GLN D 4 52  ? 158.619 104.962 97.756  1.00 393.06 ? 52   GLN D CB  1 
ATOM   9235  C CG  . GLN D 4 52  ? 159.807 105.548 97.011  1.00 395.22 ? 52   GLN D CG  1 
ATOM   9236  C CD  . GLN D 4 52  ? 159.484 105.878 95.567  1.00 422.89 ? 52   GLN D CD  1 
ATOM   9237  O OE1 . GLN D 4 52  ? 159.273 107.039 95.216  1.00 425.16 ? 52   GLN D OE1 1 
ATOM   9238  N NE2 . GLN D 4 52  ? 159.444 104.855 94.721  1.00 435.46 ? 52   GLN D NE2 1 
ATOM   9239  N N   . ILE D 4 53  ? 156.700 104.901 100.278 1.00 369.17 ? 53   ILE D N   1 
ATOM   9240  C CA  . ILE D 4 53  ? 155.670 105.545 101.096 1.00 353.32 ? 53   ILE D CA  1 
ATOM   9241  C C   . ILE D 4 53  ? 156.045 105.567 102.577 1.00 359.84 ? 53   ILE D C   1 
ATOM   9242  O O   . ILE D 4 53  ? 155.901 106.601 103.232 1.00 367.74 ? 53   ILE D O   1 
ATOM   9243  C CB  . ILE D 4 53  ? 154.288 104.860 100.903 1.00 340.96 ? 53   ILE D CB  1 
ATOM   9244  C CG1 . ILE D 4 53  ? 153.881 104.855 99.420  1.00 330.44 ? 53   ILE D CG1 1 
ATOM   9245  C CG2 . ILE D 4 53  ? 153.211 105.538 101.741 1.00 351.77 ? 53   ILE D CG2 1 
ATOM   9246  C CD1 . ILE D 4 53  ? 154.053 106.179 98.710  1.00 315.74 ? 53   ILE D CD1 1 
ATOM   9247  N N   . LYS D 4 54  ? 156.525 104.440 103.100 1.00 382.66 ? 54   LYS D N   1 
ATOM   9248  C CA  . LYS D 4 54  ? 156.950 104.354 104.509 1.00 403.44 ? 54   LYS D CA  1 
ATOM   9249  C C   . LYS D 4 54  ? 158.101 105.302 104.879 1.00 405.59 ? 54   LYS D C   1 
ATOM   9250  O O   . LYS D 4 54  ? 158.298 105.596 106.060 1.00 404.31 ? 54   LYS D O   1 
ATOM   9251  C CB  . LYS D 4 54  ? 157.302 102.907 104.892 1.00 419.01 ? 54   LYS D CB  1 
ATOM   9252  C CG  . LYS D 4 54  ? 158.574 102.356 104.259 1.00 441.45 ? 54   LYS D CG  1 
ATOM   9253  C CD  . LYS D 4 54  ? 158.593 100.832 104.236 1.00 467.54 ? 54   LYS D CD  1 
ATOM   9254  C CE  . LYS D 4 54  ? 158.615 100.231 105.634 1.00 489.00 ? 54   LYS D CE  1 
ATOM   9255  N NZ  . LYS D 4 54  ? 158.788 98.751  105.602 1.00 489.59 ? 54   LYS D NZ  1 
ATOM   9256  N N   . GLY D 4 55  ? 158.854 105.767 103.879 1.00 400.65 ? 55   GLY D N   1 
ATOM   9257  C CA  . GLY D 4 55  ? 159.829 106.839 104.066 1.00 385.22 ? 55   GLY D CA  1 
ATOM   9258  C C   . GLY D 4 55  ? 159.146 108.191 104.042 1.00 375.37 ? 55   GLY D C   1 
ATOM   9259  O O   . GLY D 4 55  ? 159.440 109.056 104.879 1.00 357.57 ? 55   GLY D O   1 
ATOM   9260  N N   . TYR D 4 56  ? 158.246 108.350 103.068 1.00 364.81 ? 56   TYR D N   1 
ATOM   9261  C CA  . TYR D 4 56  ? 157.484 109.591 102.892 1.00 367.35 ? 56   TYR D CA  1 
ATOM   9262  C C   . TYR D 4 56  ? 156.703 109.914 104.156 1.00 354.10 ? 56   TYR D C   1 
ATOM   9263  O O   . TYR D 4 56  ? 156.711 111.061 104.631 1.00 374.36 ? 56   TYR D O   1 
ATOM   9264  C CB  . TYR D 4 56  ? 156.502 109.498 101.717 1.00 365.62 ? 56   TYR D CB  1 
ATOM   9265  C CG  . TYR D 4 56  ? 156.997 110.121 100.434 1.00 369.97 ? 56   TYR D CG  1 
ATOM   9266  C CD1 . TYR D 4 56  ? 158.246 109.788 99.903  1.00 366.83 ? 56   TYR D CD1 1 
ATOM   9267  C CD2 . TYR D 4 56  ? 156.206 111.033 99.733  1.00 347.89 ? 56   TYR D CD2 1 
ATOM   9268  C CE1 . TYR D 4 56  ? 158.695 110.358 98.718  1.00 374.15 ? 56   TYR D CE1 1 
ATOM   9269  C CE2 . TYR D 4 56  ? 156.647 111.600 98.550  1.00 352.39 ? 56   TYR D CE2 1 
ATOM   9270  C CZ  . TYR D 4 56  ? 157.887 111.266 98.044  1.00 365.74 ? 56   TYR D CZ  1 
ATOM   9271  O OH  . TYR D 4 56  ? 158.308 111.844 96.867  1.00 363.76 ? 56   TYR D OH  1 
ATOM   9272  N N   . VAL D 4 57  ? 156.044 108.883 104.672 1.00 341.99 ? 57   VAL D N   1 
ATOM   9273  C CA  . VAL D 4 57  ? 155.227 108.993 105.888 1.00 346.29 ? 57   VAL D CA  1 
ATOM   9274  C C   . VAL D 4 57  ? 156.088 109.478 107.051 1.00 363.15 ? 57   VAL D C   1 
ATOM   9275  O O   . VAL D 4 57  ? 155.693 110.385 107.800 1.00 382.03 ? 57   VAL D O   1 
ATOM   9276  C CB  . VAL D 4 57  ? 154.534 107.649 106.229 1.00 355.04 ? 57   VAL D CB  1 
ATOM   9277  C CG1 . VAL D 4 57  ? 153.935 107.654 107.635 1.00 361.81 ? 57   VAL D CG1 1 
ATOM   9278  C CG2 . VAL D 4 57  ? 153.455 107.334 105.198 1.00 372.74 ? 57   VAL D CG2 1 
ATOM   9279  N N   . TRP D 4 58  ? 157.251 108.854 107.169 1.00 367.44 ? 58   TRP D N   1 
ATOM   9280  C CA  . TRP D 4 58  ? 158.222 109.169 108.222 1.00 375.51 ? 58   TRP D CA  1 
ATOM   9281  C C   . TRP D 4 58  ? 158.620 110.641 108.142 1.00 376.55 ? 58   TRP D C   1 
ATOM   9282  O O   . TRP D 4 58  ? 158.652 111.348 109.159 1.00 387.97 ? 58   TRP D O   1 
ATOM   9283  C CB  . TRP D 4 58  ? 159.447 108.237 108.143 1.00 399.72 ? 58   TRP D CB  1 
ATOM   9284  C CG  . TRP D 4 58  ? 160.653 108.683 108.928 1.00 422.48 ? 58   TRP D CG  1 
ATOM   9285  C CD1 . TRP D 4 58  ? 161.802 109.226 108.424 1.00 422.49 ? 58   TRP D CD1 1 
ATOM   9286  C CD2 . TRP D 4 58  ? 160.832 108.613 110.347 1.00 452.56 ? 58   TRP D CD2 1 
ATOM   9287  N NE1 . TRP D 4 58  ? 162.683 109.502 109.441 1.00 439.80 ? 58   TRP D NE1 1 
ATOM   9288  C CE2 . TRP D 4 58  ? 162.115 109.137 110.633 1.00 455.10 ? 58   TRP D CE2 1 
ATOM   9289  C CE3 . TRP D 4 58  ? 160.033 108.161 111.408 1.00 468.64 ? 58   TRP D CE3 1 
ATOM   9290  C CZ2 . TRP D 4 58  ? 162.619 109.223 111.939 1.00 458.68 ? 58   TRP D CZ2 1 
ATOM   9291  C CZ3 . TRP D 4 58  ? 160.535 108.247 112.711 1.00 466.42 ? 58   TRP D CZ3 1 
ATOM   9292  C CH2 . TRP D 4 58  ? 161.817 108.774 112.961 1.00 455.68 ? 58   TRP D CH2 1 
ATOM   9293  N N   . ARG D 4 59  ? 158.907 111.068 106.918 1.00 365.03 ? 59   ARG D N   1 
ATOM   9294  C CA  . ARG D 4 59  ? 159.330 112.435 106.628 1.00 385.78 ? 59   ARG D CA  1 
ATOM   9295  C C   . ARG D 4 59  ? 158.233 113.410 107.072 1.00 362.47 ? 59   ARG D C   1 
ATOM   9296  O O   . ARG D 4 59  ? 158.460 114.428 107.756 1.00 369.00 ? 59   ARG D O   1 
ATOM   9297  C CB  . ARG D 4 59  ? 159.628 112.593 105.128 1.00 409.08 ? 59   ARG D CB  1 
ATOM   9298  C CG  . ARG D 4 59  ? 160.471 113.802 104.765 1.00 429.07 ? 59   ARG D CG  1 
ATOM   9299  C CD  . ARG D 4 59  ? 160.716 113.870 103.264 1.00 437.98 ? 59   ARG D CD  1 
ATOM   9300  N NE  . ARG D 4 59  ? 161.492 112.735 102.754 1.00 444.19 ? 59   ARG D NE  1 
ATOM   9301  C CZ  . ARG D 4 59  ? 162.825 112.631 102.756 1.00 449.92 ? 59   ARG D CZ  1 
ATOM   9302  N NH1 . ARG D 4 59  ? 163.604 113.595 103.255 1.00 448.97 ? 59   ARG D NH1 1 
ATOM   9303  N NH2 . ARG D 4 59  ? 163.393 111.536 102.254 1.00 456.61 ? 59   ARG D NH2 1 
ATOM   9304  N N   . SER D 4 60  ? 157.035 113.086 106.574 1.00 345.33 ? 60   SER D N   1 
ATOM   9305  C CA  . SER D 4 60  ? 155.837 113.907 106.803 1.00 329.94 ? 60   SER D CA  1 
ATOM   9306  C C   . SER D 4 60  ? 155.575 114.038 108.286 1.00 298.71 ? 60   SER D C   1 
ATOM   9307  O O   . SER D 4 60  ? 155.297 115.148 108.768 1.00 336.90 ? 60   SER D O   1 
ATOM   9308  C CB  . SER D 4 60  ? 154.594 113.333 106.110 1.00 359.01 ? 60   SER D CB  1 
ATOM   9309  O OG  . SER D 4 60  ? 154.574 113.659 104.733 1.00 368.44 ? 60   SER D OG  1 
ATOM   9310  N N   . ALA D 4 61  ? 155.669 112.909 108.983 1.00 310.86 ? 61   ALA D N   1 
ATOM   9311  C CA  . ALA D 4 61  ? 155.450 112.853 110.433 1.00 336.34 ? 61   ALA D CA  1 
ATOM   9312  C C   . ALA D 4 61  ? 156.410 113.790 111.149 1.00 340.05 ? 61   ALA D C   1 
ATOM   9313  O O   . ALA D 4 61  ? 156.007 114.563 112.034 1.00 332.61 ? 61   ALA D O   1 
ATOM   9314  C CB  . ALA D 4 61  ? 155.605 111.429 110.954 1.00 340.95 ? 61   ALA D CB  1 
ATOM   9315  N N   . VAL D 4 62  ? 157.668 113.696 110.738 1.00 360.85 ? 62   VAL D N   1 
ATOM   9316  C CA  . VAL D 4 62  ? 158.752 114.512 111.304 1.00 383.47 ? 62   VAL D CA  1 
ATOM   9317  C C   . VAL D 4 62  ? 158.432 115.994 111.134 1.00 354.66 ? 62   VAL D C   1 
ATOM   9318  O O   . VAL D 4 62  ? 158.565 116.790 112.080 1.00 369.74 ? 62   VAL D O   1 
ATOM   9319  C CB  . VAL D 4 62  ? 160.137 114.160 110.689 1.00 405.77 ? 62   VAL D CB  1 
ATOM   9320  C CG1 . VAL D 4 62  ? 161.195 115.217 111.017 1.00 406.47 ? 62   VAL D CG1 1 
ATOM   9321  C CG2 . VAL D 4 62  ? 160.597 112.785 111.167 1.00 422.79 ? 62   VAL D CG2 1 
ATOM   9322  N N   . GLY D 4 63  ? 158.013 116.323 109.918 1.00 342.21 ? 63   GLY D N   1 
ATOM   9323  C CA  . GLY D 4 63  ? 157.657 117.695 109.547 1.00 365.05 ? 63   GLY D CA  1 
ATOM   9324  C C   . GLY D 4 63  ? 156.551 118.218 110.456 1.00 332.08 ? 63   GLY D C   1 
ATOM   9325  O O   . GLY D 4 63  ? 156.624 119.344 110.976 1.00 369.14 ? 63   GLY D O   1 
ATOM   9326  N N   . PHE D 4 64  ? 155.543 117.370 110.623 1.00 313.16 ? 64   PHE D N   1 
ATOM   9327  C CA  . PHE D 4 64  ? 154.375 117.681 111.458 1.00 318.98 ? 64   PHE D CA  1 
ATOM   9328  C C   . PHE D 4 64  ? 154.815 117.984 112.881 1.00 333.22 ? 64   PHE D C   1 
ATOM   9329  O O   . PHE D 4 64  ? 154.370 118.972 113.486 1.00 366.32 ? 64   PHE D O   1 
ATOM   9330  C CB  . PHE D 4 64  ? 153.340 116.555 111.427 1.00 346.03 ? 64   PHE D CB  1 
ATOM   9331  C CG  . PHE D 4 64  ? 152.218 116.732 112.409 1.00 334.11 ? 64   PHE D CG  1 
ATOM   9332  C CD1 . PHE D 4 64  ? 151.205 117.650 112.162 1.00 314.74 ? 64   PHE D CD1 1 
ATOM   9333  C CD2 . PHE D 4 64  ? 152.171 115.978 113.582 1.00 333.79 ? 64   PHE D CD2 1 
ATOM   9334  C CE1 . PHE D 4 64  ? 150.163 117.815 113.062 1.00 321.83 ? 64   PHE D CE1 1 
ATOM   9335  C CE2 . PHE D 4 64  ? 151.129 116.138 114.485 1.00 343.36 ? 64   PHE D CE2 1 
ATOM   9336  C CZ  . PHE D 4 64  ? 150.122 117.058 114.224 1.00 322.58 ? 64   PHE D CZ  1 
ATOM   9337  N N   . LEU D 4 65  ? 155.689 117.120 113.381 1.00 346.82 ? 65   LEU D N   1 
ATOM   9338  C CA  . LEU D 4 65  ? 156.236 117.235 114.739 1.00 367.61 ? 65   LEU D CA  1 
ATOM   9339  C C   . LEU D 4 65  ? 156.933 118.578 114.907 1.00 350.04 ? 65   LEU D C   1 
ATOM   9340  O O   . LEU D 4 65  ? 156.726 119.282 115.910 1.00 340.24 ? 65   LEU D O   1 
ATOM   9341  C CB  . LEU D 4 65  ? 157.181 116.071 115.066 1.00 388.62 ? 65   LEU D CB  1 
ATOM   9342  C CG  . LEU D 4 65  ? 157.781 116.051 116.483 1.00 411.23 ? 65   LEU D CG  1 
ATOM   9343  C CD1 . LEU D 4 65  ? 157.723 114.656 117.092 1.00 435.37 ? 65   LEU D CD1 1 
ATOM   9344  C CD2 . LEU D 4 65  ? 159.211 116.581 116.505 1.00 413.37 ? 65   LEU D CD2 1 
ATOM   9345  N N   . PHE D 4 66  ? 157.750 118.899 113.910 1.00 342.66 ? 66   PHE D N   1 
ATOM   9346  C CA  . PHE D 4 66  ? 158.519 120.148 113.880 1.00 363.98 ? 66   PHE D CA  1 
ATOM   9347  C C   . PHE D 4 66  ? 157.575 121.344 113.968 1.00 340.26 ? 66   PHE D C   1 
ATOM   9348  O O   . PHE D 4 66  ? 157.803 122.284 114.752 1.00 351.40 ? 66   PHE D O   1 
ATOM   9349  C CB  . PHE D 4 66  ? 159.375 120.236 112.605 1.00 386.18 ? 66   PHE D CB  1 
ATOM   9350  C CG  . PHE D 4 66  ? 159.957 121.601 112.345 1.00 393.97 ? 66   PHE D CG  1 
ATOM   9351  C CD1 . PHE D 4 66  ? 159.233 122.561 111.636 1.00 375.38 ? 66   PHE D CD1 1 
ATOM   9352  C CD2 . PHE D 4 66  ? 161.235 121.923 112.794 1.00 417.94 ? 66   PHE D CD2 1 
ATOM   9353  C CE1 . PHE D 4 66  ? 159.770 123.817 111.393 1.00 409.62 ? 66   PHE D CE1 1 
ATOM   9354  C CE2 . PHE D 4 66  ? 161.778 123.179 112.551 1.00 431.18 ? 66   PHE D CE2 1 
ATOM   9355  C CZ  . PHE D 4 66  ? 161.044 124.127 111.849 1.00 427.69 ? 66   PHE D CZ  1 
ATOM   9356  N N   . TRP D 4 67  ? 156.530 121.271 113.151 1.00 340.48 ? 67   TRP D N   1 
ATOM   9357  C CA  . TRP D 4 67  ? 155.511 122.324 113.080 1.00 333.09 ? 67   TRP D CA  1 
ATOM   9358  C C   . TRP D 4 67  ? 154.871 122.531 114.444 1.00 340.38 ? 67   TRP D C   1 
ATOM   9359  O O   . TRP D 4 67  ? 154.710 123.671 114.904 1.00 370.16 ? 67   TRP D O   1 
ATOM   9360  C CB  . TRP D 4 67  ? 154.446 122.096 111.999 1.00 323.09 ? 67   TRP D CB  1 
ATOM   9361  C CG  . TRP D 4 67  ? 154.488 123.155 110.951 1.00 334.12 ? 67   TRP D CG  1 
ATOM   9362  C CD1 . TRP D 4 67  ? 154.788 122.997 109.632 1.00 355.89 ? 67   TRP D CD1 1 
ATOM   9363  C CD2 . TRP D 4 67  ? 154.229 124.549 111.140 1.00 357.01 ? 67   TRP D CD2 1 
ATOM   9364  N NE1 . TRP D 4 67  ? 154.725 124.207 108.982 1.00 362.31 ? 67   TRP D NE1 1 
ATOM   9365  C CE2 . TRP D 4 67  ? 154.385 125.177 109.887 1.00 354.96 ? 67   TRP D CE2 1 
ATOM   9366  C CE3 . TRP D 4 67  ? 153.878 125.330 112.250 1.00 383.31 ? 67   TRP D CE3 1 
ATOM   9367  C CZ2 . TRP D 4 67  ? 154.203 126.552 109.712 1.00 379.25 ? 67   TRP D CZ2 1 
ATOM   9368  C CZ3 . TRP D 4 67  ? 153.701 126.697 112.077 1.00 403.44 ? 67   TRP D CZ3 1 
ATOM   9369  C CH2 . TRP D 4 67  ? 153.862 127.293 110.814 1.00 409.29 ? 67   TRP D CH2 1 
ATOM   9370  N N   . VAL D 4 68  ? 154.526 121.410 115.063 1.00 320.60 ? 68   VAL D N   1 
ATOM   9371  C CA  . VAL D 4 68  ? 153.893 121.392 116.387 1.00 325.62 ? 68   VAL D CA  1 
ATOM   9372  C C   . VAL D 4 68  ? 154.791 122.085 117.403 1.00 348.35 ? 68   VAL D C   1 
ATOM   9373  O O   . VAL D 4 68  ? 154.319 122.950 118.189 1.00 378.56 ? 68   VAL D O   1 
ATOM   9374  C CB  . VAL D 4 68  ? 153.499 119.959 116.834 1.00 333.02 ? 68   VAL D CB  1 
ATOM   9375  C CG1 . VAL D 4 68  ? 153.333 119.840 118.349 1.00 333.56 ? 68   VAL D CG1 1 
ATOM   9376  C CG2 . VAL D 4 68  ? 152.214 119.544 116.133 1.00 349.79 ? 68   VAL D CG2 1 
ATOM   9377  N N   . ILE D 4 69  ? 156.066 121.724 117.346 1.00 353.94 ? 69   ILE D N   1 
ATOM   9378  C CA  . ILE D 4 69  ? 157.082 122.277 118.244 1.00 374.42 ? 69   ILE D CA  1 
ATOM   9379  C C   . ILE D 4 69  ? 157.155 123.786 118.092 1.00 362.61 ? 69   ILE D C   1 
ATOM   9380  O O   . ILE D 4 69  ? 157.183 124.527 119.091 1.00 368.31 ? 69   ILE D O   1 
ATOM   9381  C CB  . ILE D 4 69  ? 158.468 121.566 118.103 1.00 391.96 ? 69   ILE D CB  1 
ATOM   9382  C CG1 . ILE D 4 69  ? 158.645 120.519 119.215 1.00 394.81 ? 69   ILE D CG1 1 
ATOM   9383  C CG2 . ILE D 4 69  ? 159.650 122.534 118.191 1.00 390.44 ? 69   ILE D CG2 1 
ATOM   9384  C CD1 . ILE D 4 69  ? 157.578 119.444 119.271 1.00 397.70 ? 69   ILE D CD1 1 
ATOM   9385  N N   . VAL D 4 70  ? 157.165 124.221 116.833 1.00 330.23 ? 70   VAL D N   1 
ATOM   9386  C CA  . VAL D 4 70  ? 157.215 125.647 116.491 1.00 325.75 ? 70   VAL D CA  1 
ATOM   9387  C C   . VAL D 4 70  ? 155.957 126.326 117.066 1.00 323.74 ? 70   VAL D C   1 
ATOM   9388  O O   . VAL D 4 70  ? 156.012 127.393 117.707 1.00 338.34 ? 70   VAL D O   1 
ATOM   9389  C CB  . VAL D 4 70  ? 157.349 125.890 114.973 1.00 347.64 ? 70   VAL D CB  1 
ATOM   9390  C CG1 . VAL D 4 70  ? 157.074 127.348 114.609 1.00 362.35 ? 70   VAL D CG1 1 
ATOM   9391  C CG2 . VAL D 4 70  ? 158.742 125.491 114.506 1.00 369.68 ? 70   VAL D CG2 1 
ATOM   9392  N N   . LEU D 4 71  ? 154.832 125.720 116.711 1.00 321.93 ? 71   LEU D N   1 
ATOM   9393  C CA  . LEU D 4 71  ? 153.507 126.236 117.036 1.00 325.70 ? 71   LEU D CA  1 
ATOM   9394  C C   . LEU D 4 71  ? 153.354 126.401 118.539 1.00 324.21 ? 71   LEU D C   1 
ATOM   9395  O O   . LEU D 4 71  ? 152.891 127.448 119.032 1.00 352.08 ? 71   LEU D O   1 
ATOM   9396  C CB  . LEU D 4 71  ? 152.381 125.353 116.486 1.00 342.65 ? 71   LEU D CB  1 
ATOM   9397  C CG  . LEU D 4 71  ? 151.003 126.024 116.412 1.00 344.02 ? 71   LEU D CG  1 
ATOM   9398  C CD1 . LEU D 4 71  ? 150.957 127.047 115.286 1.00 330.16 ? 71   LEU D CD1 1 
ATOM   9399  C CD2 . LEU D 4 71  ? 149.904 124.988 116.227 1.00 371.01 ? 71   LEU D CD2 1 
ATOM   9400  N N   . THR D 4 72  ? 153.759 125.341 119.237 1.00 318.48 ? 72   THR D N   1 
ATOM   9401  C CA  . THR D 4 72  ? 153.680 125.301 120.710 1.00 327.86 ? 72   THR D CA  1 
ATOM   9402  C C   . THR D 4 72  ? 154.496 126.434 121.302 1.00 324.26 ? 72   THR D C   1 
ATOM   9403  O O   . THR D 4 72  ? 154.025 127.132 122.216 1.00 349.93 ? 72   THR D O   1 
ATOM   9404  C CB  . THR D 4 72  ? 154.151 123.971 121.326 1.00 338.07 ? 72   THR D CB  1 
ATOM   9405  O OG1 . THR D 4 72  ? 155.375 123.560 120.712 1.00 351.09 ? 72   THR D OG1 1 
ATOM   9406  C CG2 . THR D 4 72  ? 153.095 122.892 121.153 1.00 358.50 ? 72   THR D CG2 1 
ATOM   9407  N N   . SER D 4 73  ? 155.701 126.596 120.764 1.00 319.36 ? 73   SER D N   1 
ATOM   9408  C CA  . SER D 4 73  ? 156.630 127.644 121.207 1.00 358.73 ? 73   SER D CA  1 
ATOM   9409  C C   . SER D 4 73  ? 155.987 129.015 121.056 1.00 332.61 ? 73   SER D C   1 
ATOM   9410  O O   . SER D 4 73  ? 156.042 129.849 121.972 1.00 334.72 ? 73   SER D O   1 
ATOM   9411  C CB  . SER D 4 73  ? 157.950 127.597 120.426 1.00 377.26 ? 73   SER D CB  1 
ATOM   9412  O OG  . SER D 4 73  ? 158.584 126.338 120.566 1.00 405.94 ? 73   SER D OG  1 
ATOM   9413  N N   . TRP D 4 74  ? 155.388 129.209 119.889 1.00 331.17 ? 74   TRP D N   1 
ATOM   9414  C CA  . TRP D 4 74  ? 154.713 130.466 119.543 1.00 332.78 ? 74   TRP D CA  1 
ATOM   9415  C C   . TRP D 4 74  ? 153.613 130.766 120.554 1.00 301.78 ? 74   TRP D C   1 
ATOM   9416  O O   . TRP D 4 74  ? 153.497 131.897 121.052 1.00 321.43 ? 74   TRP D O   1 
ATOM   9417  C CB  . TRP D 4 74  ? 154.172 130.416 118.120 1.00 346.29 ? 74   TRP D CB  1 
ATOM   9418  C CG  . TRP D 4 74  ? 153.382 131.597 117.732 1.00 341.78 ? 74   TRP D CG  1 
ATOM   9419  C CD1 . TRP D 4 74  ? 152.092 131.598 117.318 1.00 354.88 ? 74   TRP D CD1 1 
ATOM   9420  C CD2 . TRP D 4 74  ? 153.817 132.958 117.712 1.00 344.64 ? 74   TRP D CD2 1 
ATOM   9421  N NE1 . TRP D 4 74  ? 151.689 132.871 117.027 1.00 351.11 ? 74   TRP D NE1 1 
ATOM   9422  C CE2 . TRP D 4 74  ? 152.726 133.733 117.264 1.00 351.72 ? 74   TRP D CE2 1 
ATOM   9423  C CE3 . TRP D 4 74  ? 155.021 133.600 118.025 1.00 372.58 ? 74   TRP D CE3 1 
ATOM   9424  C CZ2 . TRP D 4 74  ? 152.797 135.123 117.122 1.00 350.94 ? 74   TRP D CZ2 1 
ATOM   9425  C CZ3 . TRP D 4 74  ? 155.095 134.987 117.884 1.00 408.73 ? 74   TRP D CZ3 1 
ATOM   9426  C CH2 . TRP D 4 74  ? 153.985 135.731 117.436 1.00 395.25 ? 74   TRP D CH2 1 
ATOM   9427  N N   . ILE D 4 75  ? 152.834 129.728 120.834 1.00 296.17 ? 75   ILE D N   1 
ATOM   9428  C CA  . ILE D 4 75  ? 151.716 129.814 121.779 1.00 322.73 ? 75   ILE D CA  1 
ATOM   9429  C C   . ILE D 4 75  ? 152.223 130.248 123.153 1.00 331.96 ? 75   ILE D C   1 
ATOM   9430  O O   . ILE D 4 75  ? 151.642 131.141 123.792 1.00 359.98 ? 75   ILE D O   1 
ATOM   9431  C CB  . ILE D 4 75  ? 150.841 128.542 121.793 1.00 337.08 ? 75   ILE D CB  1 
ATOM   9432  C CG1 . ILE D 4 75  ? 150.014 128.504 120.502 1.00 333.33 ? 75   ILE D CG1 1 
ATOM   9433  C CG2 . ILE D 4 75  ? 149.911 128.516 123.005 1.00 343.81 ? 75   ILE D CG2 1 
ATOM   9434  C CD1 . ILE D 4 75  ? 149.303 127.194 120.244 1.00 366.21 ? 75   ILE D CD1 1 
ATOM   9435  N N   . THR D 4 76  ? 153.307 129.606 123.565 1.00 301.58 ? 76   THR D N   1 
ATOM   9436  C CA  . THR D 4 76  ? 153.949 129.878 124.853 1.00 321.16 ? 76   THR D CA  1 
ATOM   9437  C C   . THR D 4 76  ? 154.361 131.345 124.936 1.00 308.05 ? 76   THR D C   1 
ATOM   9438  O O   . THR D 4 76  ? 154.113 132.024 125.944 1.00 301.30 ? 76   THR D O   1 
ATOM   9439  C CB  . THR D 4 76  ? 155.176 128.972 125.080 1.00 364.52 ? 76   THR D CB  1 
ATOM   9440  O OG1 . THR D 4 76  ? 154.794 127.602 124.908 1.00 389.93 ? 76   THR D OG1 1 
ATOM   9441  C CG2 . THR D 4 76  ? 155.755 129.164 126.482 1.00 388.68 ? 76   THR D CG2 1 
ATOM   9442  N N   . ILE D 4 77  ? 154.983 131.796 123.856 1.00 305.15 ? 77   ILE D N   1 
ATOM   9443  C CA  . ILE D 4 77  ? 155.464 133.177 123.729 1.00 314.16 ? 77   ILE D CA  1 
ATOM   9444  C C   . ILE D 4 77  ? 154.302 134.151 123.899 1.00 332.12 ? 77   ILE D C   1 
ATOM   9445  O O   . ILE D 4 77  ? 154.402 135.144 124.641 1.00 362.13 ? 77   ILE D O   1 
ATOM   9446  C CB  . ILE D 4 77  ? 156.197 133.399 122.378 1.00 320.16 ? 77   ILE D CB  1 
ATOM   9447  C CG1 . ILE D 4 77  ? 157.564 132.707 122.400 1.00 344.93 ? 77   ILE D CG1 1 
ATOM   9448  C CG2 . ILE D 4 77  ? 156.384 134.884 122.069 1.00 340.27 ? 77   ILE D CG2 1 
ATOM   9449  C CD1 . ILE D 4 77  ? 158.152 132.453 121.026 1.00 369.03 ? 77   ILE D CD1 1 
ATOM   9450  N N   . PHE D 4 78  ? 153.215 133.833 123.206 1.00 324.40 ? 78   PHE D N   1 
ATOM   9451  C CA  . PHE D 4 78  ? 151.994 134.638 123.231 1.00 304.31 ? 78   PHE D CA  1 
ATOM   9452  C C   . PHE D 4 78  ? 151.289 134.537 124.584 1.00 297.23 ? 78   PHE D C   1 
ATOM   9453  O O   . PHE D 4 78  ? 150.844 135.545 125.109 1.00 325.15 ? 78   PHE D O   1 
ATOM   9454  C CB  . PHE D 4 78  ? 151.076 134.260 122.080 1.00 300.75 ? 78   PHE D CB  1 
ATOM   9455  C CG  . PHE D 4 78  ? 149.866 135.121 121.980 1.00 307.07 ? 78   PHE D CG  1 
ATOM   9456  C CD1 . PHE D 4 78  ? 149.982 136.463 121.631 1.00 305.37 ? 78   PHE D CD1 1 
ATOM   9457  C CD2 . PHE D 4 78  ? 148.604 134.596 122.239 1.00 325.85 ? 78   PHE D CD2 1 
ATOM   9458  C CE1 . PHE D 4 78  ? 148.855 137.270 121.548 1.00 330.71 ? 78   PHE D CE1 1 
ATOM   9459  C CE2 . PHE D 4 78  ? 147.476 135.393 122.151 1.00 346.18 ? 78   PHE D CE2 1 
ATOM   9460  C CZ  . PHE D 4 78  ? 147.599 136.729 121.800 1.00 361.47 ? 78   PHE D CZ  1 
ATOM   9461  N N   . GLN D 4 79  ? 151.211 133.344 125.164 1.00 289.90 ? 79   GLN D N   1 
ATOM   9462  C CA  . GLN D 4 79  ? 150.555 133.182 126.467 1.00 321.13 ? 79   GLN D CA  1 
ATOM   9463  C C   . GLN D 4 79  ? 151.368 133.671 127.666 1.00 322.93 ? 79   GLN D C   1 
ATOM   9464  O O   . GLN D 4 79  ? 150.824 133.752 128.771 1.00 342.30 ? 79   GLN D O   1 
ATOM   9465  C CB  . GLN D 4 79  ? 150.130 131.725 126.691 1.00 348.67 ? 79   GLN D CB  1 
ATOM   9466  C CG  . GLN D 4 79  ? 149.041 131.247 125.747 1.00 342.07 ? 79   GLN D CG  1 
ATOM   9467  C CD  . GLN D 4 79  ? 147.797 132.095 125.820 1.00 317.83 ? 79   GLN D CD  1 
ATOM   9468  O OE1 . GLN D 4 79  ? 146.978 131.949 126.728 1.00 325.20 ? 79   GLN D OE1 1 
ATOM   9469  N NE2 . GLN D 4 79  ? 147.648 132.993 124.860 1.00 326.07 ? 79   GLN D NE2 1 
ATOM   9470  N N   . ILE D 4 80  ? 152.648 133.989 127.469 1.00 321.31 ? 80   ILE D N   1 
ATOM   9471  C CA  . ILE D 4 80  ? 153.442 134.642 128.515 1.00 343.67 ? 80   ILE D CA  1 
ATOM   9472  C C   . ILE D 4 80  ? 153.583 136.133 128.210 1.00 319.22 ? 80   ILE D C   1 
ATOM   9473  O O   . ILE D 4 80  ? 153.194 136.968 129.026 1.00 333.91 ? 80   ILE D O   1 
ATOM   9474  C CB  . ILE D 4 80  ? 154.826 133.978 128.702 1.00 360.00 ? 80   ILE D CB  1 
ATOM   9475  C CG1 . ILE D 4 80  ? 154.658 132.505 129.103 1.00 376.90 ? 80   ILE D CG1 1 
ATOM   9476  C CG2 . ILE D 4 80  ? 155.621 134.680 129.798 1.00 370.84 ? 80   ILE D CG2 1 
ATOM   9477  C CD1 . ILE D 4 80  ? 155.920 131.674 128.976 1.00 387.86 ? 80   ILE D CD1 1 
ATOM   9478  N N   . TYR D 4 81  ? 154.116 136.466 127.038 1.00 304.22 ? 81   TYR D N   1 
ATOM   9479  C CA  . TYR D 4 81  ? 154.503 137.849 126.742 1.00 342.37 ? 81   TYR D CA  1 
ATOM   9480  C C   . TYR D 4 81  ? 153.398 138.795 126.244 1.00 339.54 ? 81   TYR D C   1 
ATOM   9481  O O   . TYR D 4 81  ? 153.628 140.003 126.210 1.00 356.91 ? 81   TYR D O   1 
ATOM   9482  C CB  . TYR D 4 81  ? 155.700 137.887 125.771 1.00 358.15 ? 81   TYR D CB  1 
ATOM   9483  C CG  . TYR D 4 81  ? 156.926 137.092 126.210 1.00 362.94 ? 81   TYR D CG  1 
ATOM   9484  C CD1 . TYR D 4 81  ? 157.255 136.930 127.562 1.00 370.56 ? 81   TYR D CD1 1 
ATOM   9485  C CD2 . TYR D 4 81  ? 157.780 136.530 125.265 1.00 400.30 ? 81   TYR D CD2 1 
ATOM   9486  C CE1 . TYR D 4 81  ? 158.377 136.212 127.950 1.00 401.32 ? 81   TYR D CE1 1 
ATOM   9487  C CE2 . TYR D 4 81  ? 158.907 135.813 125.644 1.00 424.91 ? 81   TYR D CE2 1 
ATOM   9488  C CZ  . TYR D 4 81  ? 159.202 135.656 126.987 1.00 426.84 ? 81   TYR D CZ  1 
ATOM   9489  O OH  . TYR D 4 81  ? 160.319 134.946 127.367 1.00 446.76 ? 81   TYR D OH  1 
ATOM   9490  N N   . ARG D 4 82  ? 152.221 138.284 125.873 1.00 341.67 ? 82   ARG D N   1 
ATOM   9491  C CA  . ARG D 4 82  ? 151.113 139.144 125.386 1.00 328.78 ? 82   ARG D CA  1 
ATOM   9492  C C   . ARG D 4 82  ? 150.816 140.330 126.309 1.00 323.86 ? 82   ARG D C   1 
ATOM   9493  O O   . ARG D 4 82  ? 150.714 141.455 125.826 1.00 341.76 ? 82   ARG D O   1 
ATOM   9494  C CB  . ARG D 4 82  ? 149.835 138.324 125.134 1.00 325.75 ? 82   ARG D CB  1 
ATOM   9495  C CG  . ARG D 4 82  ? 148.555 139.112 124.898 1.00 329.00 ? 82   ARG D CG  1 
ATOM   9496  C CD  . ARG D 4 82  ? 147.360 138.176 124.917 1.00 341.75 ? 82   ARG D CD  1 
ATOM   9497  N NE  . ARG D 4 82  ? 147.058 137.695 126.264 1.00 321.88 ? 82   ARG D NE  1 
ATOM   9498  C CZ  . ARG D 4 82  ? 146.420 138.389 127.206 1.00 321.39 ? 82   ARG D CZ  1 
ATOM   9499  N NH1 . ARG D 4 82  ? 146.001 139.638 126.985 1.00 317.40 ? 82   ARG D NH1 1 
ATOM   9500  N NH2 . ARG D 4 82  ? 146.208 137.831 128.395 1.00 333.47 ? 82   ARG D NH2 1 
ATOM   9501  N N   . PRO D 4 83  ? 150.646 140.082 127.625 1.00 325.13 ? 83   PRO D N   1 
ATOM   9502  C CA  . PRO D 4 83  ? 150.587 141.209 128.559 1.00 343.65 ? 83   PRO D CA  1 
ATOM   9503  C C   . PRO D 4 83  ? 151.819 142.122 128.511 1.00 347.06 ? 83   PRO D C   1 
ATOM   9504  O O   . PRO D 4 83  ? 151.667 143.344 128.482 1.00 371.19 ? 83   PRO D O   1 
ATOM   9505  C CB  . PRO D 4 83  ? 150.471 140.536 129.941 1.00 358.37 ? 83   PRO D CB  1 
ATOM   9506  C CG  . PRO D 4 83  ? 150.487 139.063 129.706 1.00 345.74 ? 83   PRO D CG  1 
ATOM   9507  C CD  . PRO D 4 83  ? 150.193 138.834 128.261 1.00 321.97 ? 83   PRO D CD  1 
ATOM   9508  N N   . ARG D 4 84  ? 153.013 141.532 128.504 1.00 328.24 ? 84   ARG D N   1 
ATOM   9509  C CA  . ARG D 4 84  ? 154.261 142.305 128.474 1.00 339.36 ? 84   ARG D CA  1 
ATOM   9510  C C   . ARG D 4 84  ? 154.451 143.110 127.180 1.00 338.23 ? 84   ARG D C   1 
ATOM   9511  O O   . ARG D 4 84  ? 155.039 144.195 127.212 1.00 352.77 ? 84   ARG D O   1 
ATOM   9512  C CB  . ARG D 4 84  ? 155.473 141.402 128.718 1.00 353.15 ? 84   ARG D CB  1 
ATOM   9513  C CG  . ARG D 4 84  ? 155.539 140.816 130.118 1.00 365.95 ? 84   ARG D CG  1 
ATOM   9514  C CD  . ARG D 4 84  ? 156.754 139.913 130.273 1.00 387.27 ? 84   ARG D CD  1 
ATOM   9515  N NE  . ARG D 4 84  ? 156.777 139.226 131.566 1.00 418.02 ? 84   ARG D NE  1 
ATOM   9516  C CZ  . ARG D 4 84  ? 156.015 138.182 131.905 1.00 433.04 ? 84   ARG D CZ  1 
ATOM   9517  N NH1 . ARG D 4 84  ? 155.124 137.663 131.058 1.00 435.60 ? 84   ARG D NH1 1 
ATOM   9518  N NH2 . ARG D 4 84  ? 156.140 137.649 133.120 1.00 448.22 ? 84   ARG D NH2 1 
ATOM   9519  N N   . TRP D 4 85  ? 153.975 142.579 126.053 1.00 342.37 ? 85   TRP D N   1 
ATOM   9520  C CA  . TRP D 4 85  ? 153.889 143.354 124.813 1.00 359.33 ? 85   TRP D CA  1 
ATOM   9521  C C   . TRP D 4 85  ? 152.810 144.407 125.040 1.00 344.86 ? 85   TRP D C   1 
ATOM   9522  O O   . TRP D 4 85  ? 151.751 144.098 125.585 1.00 345.13 ? 85   TRP D O   1 
ATOM   9523  C CB  . TRP D 4 85  ? 153.512 142.474 123.608 1.00 397.65 ? 85   TRP D CB  1 
ATOM   9524  C CG  . TRP D 4 85  ? 154.527 141.409 123.217 1.00 392.75 ? 85   TRP D CG  1 
ATOM   9525  C CD1 . TRP D 4 85  ? 154.349 140.052 123.252 1.00 362.00 ? 85   TRP D CD1 1 
ATOM   9526  C CD2 . TRP D 4 85  ? 155.851 141.622 122.712 1.00 416.27 ? 85   TRP D CD2 1 
ATOM   9527  N NE1 . TRP D 4 85  ? 155.479 139.410 122.818 1.00 354.96 ? 85   TRP D NE1 1 
ATOM   9528  C CE2 . TRP D 4 85  ? 156.418 140.347 122.477 1.00 408.11 ? 85   TRP D CE2 1 
ATOM   9529  C CE3 . TRP D 4 85  ? 156.617 142.765 122.441 1.00 448.60 ? 85   TRP D CE3 1 
ATOM   9530  C CZ2 . TRP D 4 85  ? 157.720 140.183 121.982 1.00 439.38 ? 85   TRP D CZ2 1 
ATOM   9531  C CZ3 . TRP D 4 85  ? 157.916 142.602 121.946 1.00 447.06 ? 85   TRP D CZ3 1 
ATOM   9532  C CH2 . TRP D 4 85  ? 158.450 141.318 121.723 1.00 443.94 ? 85   TRP D CH2 1 
ATOM   9533  N N   . GLY D 4 86  ? 153.084 145.647 124.646 1.00 358.37 ? 86   GLY D N   1 
ATOM   9534  C CA  . GLY D 4 86  ? 152.177 146.763 124.928 1.00 358.07 ? 86   GLY D CA  1 
ATOM   9535  C C   . GLY D 4 86  ? 150.970 146.772 124.013 1.00 338.28 ? 86   GLY D C   1 
ATOM   9536  O O   . GLY D 4 86  ? 150.028 145.999 124.207 1.00 318.47 ? 86   GLY D O   1 
ATOM   9537  N N   . ALA D 4 87  ? 151.001 147.655 123.017 1.00 354.28 ? 87   ALA D N   1 
ATOM   9538  C CA  . ALA D 4 87  ? 149.943 147.740 122.012 1.00 366.84 ? 87   ALA D CA  1 
ATOM   9539  C C   . ALA D 4 87  ? 149.967 146.532 121.086 1.00 350.66 ? 87   ALA D C   1 
ATOM   9540  O O   . ALA D 4 87  ? 148.913 146.009 120.728 1.00 354.90 ? 87   ALA D O   1 
ATOM   9541  C CB  . ALA D 4 87  ? 150.078 149.022 121.203 1.00 402.55 ? 87   ALA D CB  1 
ATOM   9542  N N   . LEU D 4 88  ? 151.172 146.092 120.715 1.00 375.80 ? 88   LEU D N   1 
ATOM   9543  C CA  . LEU D 4 88  ? 151.353 144.944 119.814 1.00 392.76 ? 88   LEU D CA  1 
ATOM   9544  C C   . LEU D 4 88  ? 150.646 143.683 120.318 1.00 354.90 ? 88   LEU D C   1 
ATOM   9545  O O   . LEU D 4 88  ? 150.011 142.977 119.533 1.00 347.06 ? 88   LEU D O   1 
ATOM   9546  C CB  . LEU D 4 88  ? 152.844 144.661 119.570 1.00 421.66 ? 88   LEU D CB  1 
ATOM   9547  C CG  . LEU D 4 88  ? 153.629 145.722 118.783 1.00 449.38 ? 88   LEU D CG  1 
ATOM   9548  C CD1 . LEU D 4 88  ? 155.102 145.343 118.711 1.00 468.73 ? 88   LEU D CD1 1 
ATOM   9549  C CD2 . LEU D 4 88  ? 153.064 145.927 117.381 1.00 448.89 ? 88   LEU D CD2 1 
ATOM   9550  N N   . GLY D 4 89  ? 150.729 143.431 121.623 1.00 330.80 ? 89   GLY D N   1 
ATOM   9551  C CA  . GLY D 4 89  ? 150.013 142.321 122.257 1.00 342.83 ? 89   GLY D CA  1 
ATOM   9552  C C   . GLY D 4 89  ? 148.510 142.354 122.031 1.00 345.27 ? 89   GLY D C   1 
ATOM   9553  O O   . GLY D 4 89  ? 147.903 141.331 121.704 1.00 331.90 ? 89   GLY D O   1 
ATOM   9554  N N   . ASP D 4 90  ? 147.917 143.533 122.207 1.00 360.30 ? 90   ASP D N   1 
ATOM   9555  C CA  . ASP D 4 90  ? 146.492 143.749 121.919 1.00 358.11 ? 90   ASP D CA  1 
ATOM   9556  C C   . ASP D 4 90  ? 146.197 143.808 120.414 1.00 321.93 ? 90   ASP D C   1 
ATOM   9557  O O   . ASP D 4 90  ? 145.067 143.538 119.996 1.00 296.36 ? 90   ASP D O   1 
ATOM   9558  C CB  . ASP D 4 90  ? 145.980 145.026 122.608 1.00 362.93 ? 90   ASP D CB  1 
ATOM   9559  C CG  . ASP D 4 90  ? 145.976 144.917 124.131 1.00 377.17 ? 90   ASP D CG  1 
ATOM   9560  O OD1 . ASP D 4 90  ? 146.586 143.972 124.679 1.00 407.88 ? 90   ASP D OD1 1 
ATOM   9561  O OD2 . ASP D 4 90  ? 145.362 145.785 124.789 1.00 345.42 ? 90   ASP D OD2 1 
ATOM   9562  N N   . TYR D 4 91  ? 147.199 144.177 119.615 1.00 306.16 ? 91   TYR D N   1 
ATOM   9563  C CA  . TYR D 4 91  ? 147.062 144.205 118.155 1.00 319.84 ? 91   TYR D CA  1 
ATOM   9564  C C   . TYR D 4 91  ? 146.979 142.799 117.561 1.00 326.55 ? 91   TYR D C   1 
ATOM   9565  O O   . TYR D 4 91  ? 145.959 142.441 116.963 1.00 326.06 ? 91   TYR D O   1 
ATOM   9566  C CB  . TYR D 4 91  ? 148.194 145.011 117.488 1.00 320.21 ? 91   TYR D CB  1 
ATOM   9567  C CG  . TYR D 4 91  ? 147.775 146.388 117.015 1.00 337.66 ? 91   TYR D CG  1 
ATOM   9568  C CD1 . TYR D 4 91  ? 147.855 147.497 117.858 1.00 355.78 ? 91   TYR D CD1 1 
ATOM   9569  C CD2 . TYR D 4 91  ? 147.294 146.584 115.719 1.00 354.98 ? 91   TYR D CD2 1 
ATOM   9570  C CE1 . TYR D 4 91  ? 147.469 148.760 117.426 1.00 378.55 ? 91   TYR D CE1 1 
ATOM   9571  C CE2 . TYR D 4 91  ? 146.905 147.842 115.277 1.00 365.44 ? 91   TYR D CE2 1 
ATOM   9572  C CZ  . TYR D 4 91  ? 146.994 148.929 116.136 1.00 382.48 ? 91   TYR D CZ  1 
ATOM   9573  O OH  . TYR D 4 91  ? 146.611 150.179 115.704 1.00 388.86 ? 91   TYR D OH  1 
ATOM   9574  N N   . LEU D 4 92  ? 148.037 142.006 117.734 1.00 312.66 ? 92   LEU D N   1 
ATOM   9575  C CA  . LEU D 4 92  ? 148.112 140.677 117.100 1.00 315.63 ? 92   LEU D CA  1 
ATOM   9576  C C   . LEU D 4 92  ? 147.183 139.630 117.725 1.00 297.04 ? 92   LEU D C   1 
ATOM   9577  O O   . LEU D 4 92  ? 147.014 138.551 117.164 1.00 317.84 ? 92   LEU D O   1 
ATOM   9578  C CB  . LEU D 4 92  ? 149.565 140.164 117.018 1.00 316.78 ? 92   LEU D CB  1 
ATOM   9579  C CG  . LEU D 4 92  ? 150.375 139.835 118.284 1.00 333.44 ? 92   LEU D CG  1 
ATOM   9580  C CD1 . LEU D 4 92  ? 150.154 138.412 118.766 1.00 336.12 ? 92   LEU D CD1 1 
ATOM   9581  C CD2 . LEU D 4 92  ? 151.861 140.043 118.025 1.00 347.92 ? 92   LEU D CD2 1 
ATOM   9582  N N   . SER D 4 93  ? 146.605 139.929 118.883 1.00 311.82 ? 93   SER D N   1 
ATOM   9583  C CA  . SER D 4 93  ? 145.530 139.112 119.440 1.00 316.43 ? 93   SER D CA  1 
ATOM   9584  C C   . SER D 4 93  ? 144.266 139.310 118.618 1.00 307.74 ? 93   SER D C   1 
ATOM   9585  O O   . SER D 4 93  ? 144.017 140.417 118.134 1.00 330.05 ? 93   SER D O   1 
ATOM   9586  C CB  . SER D 4 93  ? 145.260 139.514 120.891 1.00 341.77 ? 93   SER D CB  1 
ATOM   9587  O OG  . SER D 4 93  ? 145.000 140.903 120.988 1.00 349.05 ? 93   SER D OG  1 
ATOM   9588  N N   . PHE D 4 94  ? 143.492 138.240 118.435 1.00 304.00 ? 94   PHE D N   1 
ATOM   9589  C CA  . PHE D 4 94  ? 142.126 138.344 117.890 1.00 309.35 ? 94   PHE D CA  1 
ATOM   9590  C C   . PHE D 4 94  ? 141.051 137.959 118.914 1.00 299.74 ? 94   PHE D C   1 
ATOM   9591  O O   . PHE D 4 94  ? 139.853 137.987 118.617 1.00 305.73 ? 94   PHE D O   1 
ATOM   9592  C CB  . PHE D 4 94  ? 142.006 137.552 116.574 1.00 319.22 ? 94   PHE D CB  1 
ATOM   9593  C CG  . PHE D 4 94  ? 141.290 136.244 116.685 1.00 301.59 ? 94   PHE D CG  1 
ATOM   9594  C CD1 . PHE D 4 94  ? 141.750 135.264 117.532 1.00 312.94 ? 94   PHE D CD1 1 
ATOM   9595  C CD2 . PHE D 4 94  ? 140.156 135.989 115.912 1.00 306.19 ? 94   PHE D CD2 1 
ATOM   9596  C CE1 . PHE D 4 94  ? 141.083 134.063 117.645 1.00 336.51 ? 94   PHE D CE1 1 
ATOM   9597  C CE2 . PHE D 4 94  ? 139.493 134.779 116.002 1.00 297.60 ? 94   PHE D CE2 1 
ATOM   9598  C CZ  . PHE D 4 94  ? 139.966 133.808 116.866 1.00 318.28 ? 94   PHE D CZ  1 
ATOM   9599  N N   . THR D 4 95  ? 141.495 137.590 120.111 1.00 317.15 ? 95   THR D N   1 
ATOM   9600  C CA  . THR D 4 95  ? 140.621 137.306 121.231 1.00 320.36 ? 95   THR D CA  1 
ATOM   9601  C C   . THR D 4 95  ? 141.377 137.758 122.475 1.00 325.30 ? 95   THR D C   1 
ATOM   9602  O O   . THR D 4 95  ? 142.275 137.060 122.944 1.00 307.38 ? 95   THR D O   1 
ATOM   9603  C CB  . THR D 4 95  ? 140.292 135.805 121.301 1.00 319.33 ? 95   THR D CB  1 
ATOM   9604  O OG1 . THR D 4 95  ? 139.596 135.416 120.112 1.00 302.02 ? 95   THR D OG1 1 
ATOM   9605  C CG2 . THR D 4 95  ? 139.429 135.487 122.522 1.00 356.81 ? 95   THR D CG2 1 
ATOM   9606  N N   . ILE D 4 96  ? 141.042 138.944 122.967 1.00 312.51 ? 96   ILE D N   1 
ATOM   9607  C CA  . ILE D 4 96  ? 141.718 139.480 124.131 1.00 294.88 ? 96   ILE D CA  1 
ATOM   9608  C C   . ILE D 4 96  ? 140.901 139.067 125.334 1.00 288.33 ? 96   ILE D C   1 
ATOM   9609  O O   . ILE D 4 96  ? 139.728 139.418 125.455 1.00 314.73 ? 96   ILE D O   1 
ATOM   9610  C CB  . ILE D 4 96  ? 141.813 141.014 124.078 1.00 353.53 ? 96   ILE D CB  1 
ATOM   9611  C CG1 . ILE D 4 96  ? 142.245 141.474 122.684 1.00 375.27 ? 96   ILE D CG1 1 
ATOM   9612  C CG2 . ILE D 4 96  ? 142.779 141.525 125.136 1.00 378.08 ? 96   ILE D CG2 1 
ATOM   9613  C CD1 . ILE D 4 96  ? 142.207 142.975 122.497 1.00 381.01 ? 96   ILE D CD1 1 
ATOM   9614  N N   . PRO D 4 97  ? 141.527 138.308 126.222 1.00 291.02 ? 97   PRO D N   1 
ATOM   9615  C CA  . PRO D 4 97  ? 140.812 137.762 127.371 1.00 319.10 ? 97   PRO D CA  1 
ATOM   9616  C C   . PRO D 4 97  ? 140.142 138.888 128.126 1.00 321.61 ? 97   PRO D C   1 
ATOM   9617  O O   . PRO D 4 97  ? 140.832 139.802 128.550 1.00 351.02 ? 97   PRO D O   1 
ATOM   9618  C CB  . PRO D 4 97  ? 141.931 137.164 128.203 1.00 338.25 ? 97   PRO D CB  1 
ATOM   9619  C CG  . PRO D 4 97  ? 143.105 138.025 127.904 1.00 329.30 ? 97   PRO D CG  1 
ATOM   9620  C CD  . PRO D 4 97  ? 142.926 138.614 126.537 1.00 298.85 ? 97   PRO D CD  1 
ATOM   9621  N N   . LEU D 4 98  ? 138.825 138.854 128.278 1.00 290.72 ? 98   LEU D N   1 
ATOM   9622  C CA  . LEU D 4 98  ? 138.145 140.030 128.775 1.00 295.68 ? 98   LEU D CA  1 
ATOM   9623  C C   . LEU D 4 98  ? 138.533 140.448 130.179 1.00 298.68 ? 98   LEU D C   1 
ATOM   9624  O O   . LEU D 4 98  ? 138.857 141.602 130.415 1.00 309.86 ? 98   LEU D O   1 
ATOM   9625  C CB  . LEU D 4 98  ? 136.639 139.788 128.747 1.00 280.04 ? 98   LEU D CB  1 
ATOM   9626  C CG  . LEU D 4 98  ? 135.823 140.364 127.595 1.00 293.77 ? 98   LEU D CG  1 
ATOM   9627  C CD1 . LEU D 4 98  ? 136.686 141.010 126.527 1.00 293.78 ? 98   LEU D CD1 1 
ATOM   9628  C CD2 . LEU D 4 98  ? 134.912 139.318 126.988 1.00 303.16 ? 98   LEU D CD2 1 
ATOM   9629  N N   . GLY D 4 99  ? 138.540 139.512 131.109 1.00 291.49 ? 99   GLY D N   1 
ATOM   9630  C CA  . GLY D 4 99  ? 138.820 139.865 132.486 1.00 320.38 ? 99   GLY D CA  1 
ATOM   9631  C C   . GLY D 4 99  ? 140.232 140.334 132.735 1.00 330.83 ? 99   GLY D C   1 
ATOM   9632  O O   . GLY D 4 99  ? 140.474 141.323 133.409 1.00 361.16 ? 99   GLY D O   1 
ATOM   9633  N N   . THR D 4 100 ? 141.165 139.603 132.149 1.00 315.42 ? 100  THR D N   1 
ATOM   9634  C CA  . THR D 4 100 ? 142.572 139.671 132.488 1.00 316.23 ? 100  THR D CA  1 
ATOM   9635  C C   . THR D 4 100 ? 143.285 140.888 131.978 1.00 329.08 ? 100  THR D C   1 
ATOM   9636  O O   . THR D 4 100 ? 142.894 141.464 130.966 1.00 319.52 ? 100  THR D O   1 
ATOM   9637  C CB  . THR D 4 100 ? 143.310 138.449 131.950 1.00 349.40 ? 100  THR D CB  1 
ATOM   9638  O OG1 . THR D 4 100 ? 142.917 138.224 130.595 1.00 360.32 ? 100  THR D OG1 1 
ATOM   9639  C CG2 . THR D 4 100 ? 142.965 137.229 132.774 1.00 388.45 ? 100  THR D CG2 1 
ATOM   9640  N N   . PRO D 4 101 ? 144.406 141.265 132.732 1.00 335.97 ? 101  PRO D N   1 
ATOM   9641  C CA  . PRO D 4 101 ? 145.142 142.392 132.138 1.00 350.47 ? 101  PRO D CA  1 
ATOM   9642  C C   . PRO D 4 101 ? 145.731 142.012 130.788 1.00 350.91 ? 101  PRO D C   1 
ATOM   9643  O O   . PRO D 4 101 ? 145.479 142.704 129.805 1.00 323.42 ? 101  PRO D O   1 
ATOM   9644  C CB  . PRO D 4 101 ? 146.269 142.660 133.136 1.00 370.97 ? 101  PRO D CB  1 
ATOM   9645  C CG  . PRO D 4 101 ? 146.543 141.349 133.754 1.00 366.18 ? 101  PRO D CG  1 
ATOM   9646  C CD  . PRO D 4 101 ? 145.161 140.874 134.023 1.00 348.86 ? 101  PRO D CD  1 
HETATM 9647  C C1  . NAG E 5 .   ? 114.384 138.054 144.957 1.00 335.93 ? 1699 NAG A C1  1 
HETATM 9648  C C2  . NAG E 5 .   ? 113.995 137.544 146.338 1.00 348.54 ? 1699 NAG A C2  1 
HETATM 9649  C C3  . NAG E 5 .   ? 113.254 136.203 146.318 1.00 358.47 ? 1699 NAG A C3  1 
HETATM 9650  C C4  . NAG E 5 .   ? 112.383 135.961 145.084 1.00 367.03 ? 1699 NAG A C4  1 
HETATM 9651  C C5  . NAG E 5 .   ? 112.968 136.578 143.816 1.00 350.28 ? 1699 NAG A C5  1 
HETATM 9652  C C6  . NAG E 5 .   ? 111.989 136.524 142.643 1.00 369.65 ? 1699 NAG A C6  1 
HETATM 9653  C C7  . NAG E 5 .   ? 115.534 138.186 148.160 1.00 340.70 ? 1699 NAG A C7  1 
HETATM 9654  C C8  . NAG E 5 .   ? 116.813 137.835 148.858 1.00 342.06 ? 1699 NAG A C8  1 
HETATM 9655  N N2  . NAG E 5 .   ? 115.196 137.390 147.143 1.00 347.26 ? 1699 NAG A N2  1 
HETATM 9656  O O3  . NAG E 5 .   ? 112.456 136.123 147.479 1.00 382.09 ? 1699 NAG A O3  1 
HETATM 9657  O O4  . NAG E 5 .   ? 112.243 134.568 144.860 1.00 396.86 ? 1699 NAG A O4  1 
HETATM 9658  O O5  . NAG E 5 .   ? 113.298 137.923 144.069 1.00 334.71 ? 1699 NAG A O5  1 
HETATM 9659  O O6  . NAG E 5 .   ? 112.565 135.818 141.565 1.00 386.36 ? 1699 NAG A O6  1 
HETATM 9660  O O7  . NAG E 5 .   ? 114.876 139.153 148.543 1.00 356.77 ? 1699 NAG A O7  1 
HETATM 9661  C C1  . NAG F 5 .   ? 111.280 133.907 145.709 1.00 399.42 ? 1700 NAG A C1  1 
HETATM 9662  C C2  . NAG F 5 .   ? 110.641 132.754 144.941 1.00 406.80 ? 1700 NAG A C2  1 
HETATM 9663  C C3  . NAG F 5 .   ? 109.623 132.023 145.813 1.00 431.32 ? 1700 NAG A C3  1 
HETATM 9664  C C4  . NAG F 5 .   ? 110.176 131.699 147.201 1.00 454.47 ? 1700 NAG A C4  1 
HETATM 9665  C C5  . NAG F 5 .   ? 110.961 132.863 147.813 1.00 450.07 ? 1700 NAG A C5  1 
HETATM 9666  C C6  . NAG F 5 .   ? 111.722 132.409 149.057 1.00 451.74 ? 1700 NAG A C6  1 
HETATM 9667  C C7  . NAG F 5 .   ? 110.529 133.189 142.481 1.00 371.22 ? 1700 NAG A C7  1 
HETATM 9668  C C8  . NAG F 5 .   ? 111.891 132.593 142.235 1.00 356.49 ? 1700 NAG A C8  1 
HETATM 9669  N N2  . NAG F 5 .   ? 110.008 133.235 143.718 1.00 390.72 ? 1700 NAG A N2  1 
HETATM 9670  O O3  . NAG F 5 .   ? 109.237 130.826 145.175 1.00 437.86 ? 1700 NAG A O3  1 
HETATM 9671  O O4  . NAG F 5 .   ? 109.102 131.362 148.052 1.00 458.90 ? 1700 NAG A O4  1 
HETATM 9672  O O5  . NAG F 5 .   ? 111.883 133.391 146.877 1.00 416.61 ? 1700 NAG A O5  1 
HETATM 9673  O O6  . NAG F 5 .   ? 112.507 133.465 149.569 1.00 440.72 ? 1700 NAG A O6  1 
HETATM 9674  O O7  . NAG F 5 .   ? 109.899 133.631 141.520 1.00 358.49 ? 1700 NAG A O7  1 
HETATM 9675  C C1  . NAG G 5 .   ? 143.330 158.165 138.033 1.00 273.39 ? 1701 NAG A C1  1 
HETATM 9676  C C2  . NAG G 5 .   ? 144.493 159.160 138.080 1.00 288.95 ? 1701 NAG A C2  1 
HETATM 9677  C C3  . NAG G 5 .   ? 145.554 158.818 139.127 1.00 301.01 ? 1701 NAG A C3  1 
HETATM 9678  C C4  . NAG G 5 .   ? 144.911 158.559 140.477 1.00 301.17 ? 1701 NAG A C4  1 
HETATM 9679  C C5  . NAG G 5 .   ? 143.773 157.547 140.344 1.00 322.35 ? 1701 NAG A C5  1 
HETATM 9680  C C6  . NAG G 5 .   ? 142.991 157.447 141.649 1.00 332.64 ? 1701 NAG A C6  1 
HETATM 9681  C C7  . NAG G 5 .   ? 145.232 160.421 136.065 1.00 322.95 ? 1701 NAG A C7  1 
HETATM 9682  C C8  . NAG G 5 .   ? 144.795 161.720 136.671 1.00 346.13 ? 1701 NAG A C8  1 
HETATM 9683  N N2  . NAG G 5 .   ? 145.078 159.283 136.749 1.00 303.02 ? 1701 NAG A N2  1 
HETATM 9684  O O3  . NAG G 5 .   ? 146.486 159.869 139.266 1.00 288.96 ? 1701 NAG A O3  1 
HETATM 9685  O O4  . NAG G 5 .   ? 145.892 158.016 141.337 1.00 296.79 ? 1701 NAG A O4  1 
HETATM 9686  O O5  . NAG G 5 .   ? 142.841 157.892 139.330 1.00 304.92 ? 1701 NAG A O5  1 
HETATM 9687  O O6  . NAG G 5 .   ? 142.299 158.657 141.890 1.00 339.88 ? 1701 NAG A O6  1 
HETATM 9688  O O7  . NAG G 5 .   ? 145.733 160.436 134.944 1.00 326.32 ? 1701 NAG A O7  1 
HETATM 9689  C C1  . NAG H 5 .   ? 146.277 158.875 142.430 1.00 318.62 ? 1702 NAG A C1  1 
HETATM 9690  C C2  . NAG H 5 .   ? 146.833 158.003 143.551 1.00 334.60 ? 1702 NAG A C2  1 
HETATM 9691  C C3  . NAG H 5 .   ? 147.301 158.847 144.727 1.00 352.21 ? 1702 NAG A C3  1 
HETATM 9692  C C4  . NAG H 5 .   ? 148.246 159.942 144.256 1.00 355.65 ? 1702 NAG A C4  1 
HETATM 9693  C C5  . NAG H 5 .   ? 147.650 160.699 143.073 1.00 352.31 ? 1702 NAG A C5  1 
HETATM 9694  C C6  . NAG H 5 .   ? 148.662 161.691 142.514 1.00 389.32 ? 1702 NAG A C6  1 
HETATM 9695  C C7  . NAG H 5 .   ? 145.868 155.745 143.633 1.00 338.48 ? 1702 NAG A C7  1 
HETATM 9696  C C8  . NAG H 5 .   ? 144.792 154.856 144.185 1.00 351.60 ? 1702 NAG A C8  1 
HETATM 9697  N N2  . NAG H 5 .   ? 145.854 157.029 144.007 1.00 332.28 ? 1702 NAG A N2  1 
HETATM 9698  O O3  . NAG H 5 .   ? 147.963 158.025 145.662 1.00 370.41 ? 1702 NAG A O3  1 
HETATM 9699  O O4  . NAG H 5 .   ? 148.458 160.842 145.326 1.00 385.65 ? 1702 NAG A O4  1 
HETATM 9700  O O5  . NAG H 5 .   ? 147.261 159.810 142.043 1.00 325.12 ? 1702 NAG A O5  1 
HETATM 9701  O O6  . NAG H 5 .   ? 148.850 162.744 143.434 1.00 412.72 ? 1702 NAG A O6  1 
HETATM 9702  O O7  . NAG H 5 .   ? 146.703 155.259 142.868 1.00 344.19 ? 1702 NAG A O7  1 
HETATM 9703  C C1  . BMA I 6 .   ? 149.811 160.824 145.823 1.00 393.47 ? 1716 BMA A C1  1 
HETATM 9704  C C2  . BMA I 6 .   ? 149.991 161.994 146.773 1.00 403.23 ? 1716 BMA A C2  1 
HETATM 9705  C C3  . BMA I 6 .   ? 151.457 162.105 147.175 1.00 411.08 ? 1716 BMA A C3  1 
HETATM 9706  C C4  . BMA I 6 .   ? 152.007 160.776 147.688 1.00 413.01 ? 1716 BMA A C4  1 
HETATM 9707  C C5  . BMA I 6 .   ? 151.533 159.552 146.888 1.00 408.73 ? 1716 BMA A C5  1 
HETATM 9708  C C6  . BMA I 6 .   ? 151.757 158.258 147.672 1.00 422.72 ? 1716 BMA A C6  1 
HETATM 9709  O O2  . BMA I 6 .   ? 149.160 161.808 147.928 1.00 394.97 ? 1716 BMA A O2  1 
HETATM 9710  O O3  . BMA I 6 .   ? 151.583 163.091 148.217 1.00 433.18 ? 1716 BMA A O3  1 
HETATM 9711  O O4  . BMA I 6 .   ? 153.437 160.825 147.641 1.00 420.90 ? 1716 BMA A O4  1 
HETATM 9712  O O5  . BMA I 6 .   ? 150.148 159.631 146.529 1.00 391.33 ? 1716 BMA A O5  1 
HETATM 9713  O O6  . BMA I 6 .   ? 151.025 158.292 148.914 1.00 434.40 ? 1716 BMA A O6  1 
HETATM 9714  C C1  . BMA J 6 .   ? 151.780 157.803 150.046 1.00 428.70 ? 1717 BMA A C1  1 
HETATM 9715  C C2  . BMA J 6 .   ? 151.173 158.323 151.345 1.00 428.54 ? 1717 BMA A C2  1 
HETATM 9716  C C3  . BMA J 6 .   ? 149.792 157.720 151.585 1.00 427.75 ? 1717 BMA A C3  1 
HETATM 9717  C C4  . BMA J 6 .   ? 149.839 156.194 151.528 1.00 438.20 ? 1717 BMA A C4  1 
HETATM 9718  C C5  . BMA J 6 .   ? 150.680 155.615 150.377 1.00 434.52 ? 1717 BMA A C5  1 
HETATM 9719  C C6  . BMA J 6 .   ? 149.836 155.415 149.114 1.00 436.70 ? 1717 BMA A C6  1 
HETATM 9720  O O2  . BMA J 6 .   ? 151.085 159.753 151.311 1.00 412.80 ? 1717 BMA A O2  1 
HETATM 9721  O O3  . BMA J 6 .   ? 148.853 158.220 150.624 1.00 435.36 ? 1717 BMA A O3  1 
HETATM 9722  O O4  . BMA J 6 .   ? 150.363 155.714 152.773 1.00 454.62 ? 1717 BMA A O4  1 
HETATM 9723  O O5  . BMA J 6 .   ? 151.872 156.374 150.088 1.00 429.33 ? 1717 BMA A O5  1 
HETATM 9724  O O6  . BMA J 6 .   ? 150.667 155.008 148.019 1.00 435.00 ? 1717 BMA A O6  1 
HETATM 9725  C C1  . BMA K 6 .   ? 152.461 164.186 147.883 1.00 446.29 ? 1718 BMA A C1  1 
HETATM 9726  C C2  . BMA K 6 .   ? 151.743 165.183 146.978 1.00 452.09 ? 1718 BMA A C2  1 
HETATM 9727  C C3  . BMA K 6 .   ? 152.667 166.348 146.624 1.00 473.11 ? 1718 BMA A C3  1 
HETATM 9728  C C4  . BMA K 6 .   ? 153.319 166.952 147.867 1.00 482.81 ? 1718 BMA A C4  1 
HETATM 9729  C C5  . BMA K 6 .   ? 153.893 165.875 148.790 1.00 479.11 ? 1718 BMA A C5  1 
HETATM 9730  C C6  . BMA K 6 .   ? 154.355 166.478 150.112 1.00 484.59 ? 1718 BMA A C6  1 
HETATM 9731  O O2  . BMA K 6 .   ? 150.569 165.667 147.644 1.00 412.70 ? 1718 BMA A O2  1 
HETATM 9732  O O3  . BMA K 6 .   ? 151.928 167.362 145.932 1.00 486.68 ? 1718 BMA A O3  1 
HETATM 9733  O O4  . BMA K 6 .   ? 154.369 167.838 147.463 1.00 484.96 ? 1718 BMA A O4  1 
HETATM 9734  O O5  . BMA K 6 .   ? 152.912 164.867 149.055 1.00 462.98 ? 1718 BMA A O5  1 
HETATM 9735  O O6  . BMA K 6 .   ? 155.495 167.318 149.893 1.00 484.97 ? 1718 BMA A O6  1 
HETATM 9736  C C1  . NAG L 5 .   ? 145.766 184.959 133.746 1.00 384.17 ? 1703 NAG A C1  1 
HETATM 9737  C C2  . NAG L 5 .   ? 146.776 184.106 132.952 1.00 381.65 ? 1703 NAG A C2  1 
HETATM 9738  C C3  . NAG L 5 .   ? 147.948 183.551 133.770 1.00 384.07 ? 1703 NAG A C3  1 
HETATM 9739  C C4  . NAG L 5 .   ? 148.484 184.575 134.753 1.00 384.16 ? 1703 NAG A C4  1 
HETATM 9740  C C5  . NAG L 5 .   ? 147.331 185.093 135.598 1.00 379.18 ? 1703 NAG A C5  1 
HETATM 9741  C C6  . NAG L 5 .   ? 147.796 186.128 136.618 1.00 404.15 ? 1703 NAG A C6  1 
HETATM 9742  C C7  . NAG L 5 .   ? 145.440 182.030 132.749 1.00 350.49 ? 1703 NAG A C7  1 
HETATM 9743  C C8  . NAG L 5 .   ? 144.883 181.011 131.800 1.00 369.70 ? 1703 NAG A C8  1 
HETATM 9744  N N2  . NAG L 5 .   ? 146.147 183.023 132.200 1.00 365.88 ? 1703 NAG A N2  1 
HETATM 9745  O O3  . NAG L 5 .   ? 148.980 183.126 132.906 1.00 396.83 ? 1703 NAG A O3  1 
HETATM 9746  O O4  . NAG L 5 .   ? 149.480 183.967 135.551 1.00 395.89 ? 1703 NAG A O4  1 
HETATM 9747  O O5  . NAG L 5 .   ? 146.408 185.734 134.747 1.00 379.09 ? 1703 NAG A O5  1 
HETATM 9748  O O6  . NAG L 5 .   ? 148.731 185.579 137.518 1.00 411.36 ? 1703 NAG A O6  1 
HETATM 9749  O O7  . NAG L 5 .   ? 145.215 181.920 133.952 1.00 340.30 ? 1703 NAG A O7  1 
HETATM 9750  C C1  . NAG M 5 .   ? 150.786 184.538 135.338 1.00 413.67 ? 1704 NAG A C1  1 
HETATM 9751  C C2  . NAG M 5 .   ? 151.757 183.842 136.286 1.00 424.31 ? 1704 NAG A C2  1 
HETATM 9752  C C3  . NAG M 5 .   ? 153.225 184.129 135.933 1.00 439.14 ? 1704 NAG A C3  1 
HETATM 9753  C C4  . NAG M 5 .   ? 153.416 185.227 134.879 1.00 451.63 ? 1704 NAG A C4  1 
HETATM 9754  C C5  . NAG M 5 .   ? 152.399 185.174 133.724 1.00 444.66 ? 1704 NAG A C5  1 
HETATM 9755  C C6  . NAG M 5 .   ? 153.032 184.679 132.425 1.00 442.18 ? 1704 NAG A C6  1 
HETATM 9756  C C7  . NAG M 5 .   ? 151.765 183.499 138.750 1.00 418.73 ? 1704 NAG A C7  1 
HETATM 9757  C C8  . NAG M 5 .   ? 152.492 182.188 138.615 1.00 419.21 ? 1704 NAG A C8  1 
HETATM 9758  N N2  . NAG M 5 .   ? 151.454 184.219 137.664 1.00 419.21 ? 1704 NAG A N2  1 
HETATM 9759  O O3  . NAG M 5 .   ? 153.844 182.945 135.479 1.00 445.92 ? 1704 NAG A O3  1 
HETATM 9760  O O4  . NAG M 5 .   ? 153.324 186.483 135.517 1.00 460.75 ? 1704 NAG A O4  1 
HETATM 9761  O O5  . NAG M 5 .   ? 151.266 184.376 134.020 1.00 425.97 ? 1704 NAG A O5  1 
HETATM 9762  O O6  . NAG M 5 .   ? 153.424 183.331 132.563 1.00 435.41 ? 1704 NAG A O6  1 
HETATM 9763  O O7  . NAG M 5 .   ? 151.468 183.892 139.877 1.00 434.31 ? 1704 NAG A O7  1 
HETATM 9764  C C1  . NAG N 5 .   ? 146.192 190.762 133.398 1.00 423.15 ? 1705 NAG A C1  1 
HETATM 9765  C C2  . NAG N 5 .   ? 145.376 191.411 132.277 1.00 430.01 ? 1705 NAG A C2  1 
HETATM 9766  C C3  . NAG N 5 .   ? 146.055 191.165 130.925 1.00 437.94 ? 1705 NAG A C3  1 
HETATM 9767  C C4  . NAG N 5 .   ? 147.555 191.461 130.961 1.00 470.46 ? 1705 NAG A C4  1 
HETATM 9768  C C5  . NAG N 5 .   ? 148.232 190.931 132.225 1.00 475.24 ? 1705 NAG A C5  1 
HETATM 9769  C C6  . NAG N 5 .   ? 149.648 191.479 132.355 1.00 489.94 ? 1705 NAG A C6  1 
HETATM 9770  C C7  . NAG N 5 .   ? 143.001 191.460 131.634 1.00 416.13 ? 1705 NAG A C7  1 
HETATM 9771  C C8  . NAG N 5 .   ? 141.667 190.780 131.723 1.00 422.27 ? 1705 NAG A C8  1 
HETATM 9772  N N2  . NAG N 5 .   ? 144.021 190.875 132.271 1.00 421.63 ? 1705 NAG A N2  1 
HETATM 9773  O O3  . NAG N 5 .   ? 145.479 191.969 129.917 1.00 429.67 ? 1705 NAG A O3  1 
HETATM 9774  O O4  . NAG N 5 .   ? 148.164 190.879 129.829 1.00 484.59 ? 1705 NAG A O4  1 
HETATM 9775  O O5  . NAG N 5 .   ? 147.490 191.319 133.364 1.00 438.30 ? 1705 NAG A O5  1 
HETATM 9776  O O6  . NAG N 5 .   ? 150.457 190.950 131.329 1.00 499.56 ? 1705 NAG A O6  1 
HETATM 9777  O O7  . NAG N 5 .   ? 143.102 192.504 130.988 1.00 404.04 ? 1705 NAG A O7  1 
HETATM 9778  C C1  . NAG O 5 .   ? 104.863 174.311 133.743 1.00 325.03 ? 1706 NAG A C1  1 
HETATM 9779  C C2  . NAG O 5 .   ? 104.082 174.595 132.468 1.00 317.87 ? 1706 NAG A C2  1 
HETATM 9780  C C3  . NAG O 5 .   ? 102.698 175.086 132.857 1.00 355.38 ? 1706 NAG A C3  1 
HETATM 9781  C C4  . NAG O 5 .   ? 102.031 173.995 133.698 1.00 369.44 ? 1706 NAG A C4  1 
HETATM 9782  C C5  . NAG O 5 .   ? 102.926 173.561 134.878 1.00 346.71 ? 1706 NAG A C5  1 
HETATM 9783  C C6  . NAG O 5 .   ? 102.362 172.365 135.640 1.00 363.06 ? 1706 NAG A C6  1 
HETATM 9784  C C7  . NAG O 5 .   ? 105.294 175.277 130.437 1.00 323.24 ? 1706 NAG A C7  1 
HETATM 9785  C C8  . NAG O 5 .   ? 105.996 176.396 129.719 1.00 326.82 ? 1706 NAG A C8  1 
HETATM 9786  N N2  . NAG O 5 .   ? 104.787 175.563 131.642 1.00 318.79 ? 1706 NAG A N2  1 
HETATM 9787  O O3  . NAG O 5 .   ? 101.937 175.327 131.695 1.00 378.64 ? 1706 NAG A O3  1 
HETATM 9788  O O4  . NAG O 5 .   ? 100.676 174.291 134.049 1.00 397.91 ? 1706 NAG A O4  1 
HETATM 9789  O O5  . NAG O 5 .   ? 104.238 173.248 134.432 1.00 330.49 ? 1706 NAG A O5  1 
HETATM 9790  O O6  . NAG O 5 .   ? 102.545 172.573 137.023 1.00 375.97 ? 1706 NAG A O6  1 
HETATM 9791  O O7  . NAG O 5 .   ? 105.213 174.173 129.891 1.00 308.36 ? 1706 NAG A O7  1 
HETATM 9792  C C1  . NAG P 5 .   ? 100.090 175.154 135.031 1.00 405.51 ? 1707 NAG A C1  1 
HETATM 9793  C C2  . NAG P 5 .   ? 99.143  176.328 134.753 1.00 407.79 ? 1707 NAG A C2  1 
HETATM 9794  C C3  . NAG P 5 .   ? 98.316  176.721 135.979 1.00 433.35 ? 1707 NAG A C3  1 
HETATM 9795  C C4  . NAG P 5 .   ? 97.724  175.510 136.689 1.00 458.22 ? 1707 NAG A C4  1 
HETATM 9796  C C5  . NAG P 5 .   ? 98.792  174.442 136.906 1.00 470.35 ? 1707 NAG A C5  1 
HETATM 9797  C C6  . NAG P 5 .   ? 98.183  173.185 137.517 1.00 489.54 ? 1707 NAG A C6  1 
HETATM 9798  C C7  . NAG P 5 .   ? 100.083 177.794 132.968 1.00 402.01 ? 1707 NAG A C7  1 
HETATM 9799  C C8  . NAG P 5 .   ? 99.585  176.883 131.878 1.00 408.51 ? 1707 NAG A C8  1 
HETATM 9800  N N2  . NAG P 5 .   ? 99.858  177.498 134.255 1.00 404.11 ? 1707 NAG A N2  1 
HETATM 9801  O O3  . NAG P 5 .   ? 97.275  177.589 135.587 1.00 431.74 ? 1707 NAG A O3  1 
HETATM 9802  O O4  . NAG P 5 .   ? 97.193  175.914 137.931 1.00 459.71 ? 1707 NAG A O4  1 
HETATM 9803  O O5  . NAG P 5 .   ? 99.377  174.107 135.662 1.00 433.80 ? 1707 NAG A O5  1 
HETATM 9804  O O6  . NAG P 5 .   ? 97.891  173.418 138.877 1.00 494.34 ? 1707 NAG A O6  1 
HETATM 9805  O O7  . NAG P 5 .   ? 100.700 178.811 132.651 1.00 392.20 ? 1707 NAG A O7  1 
HETATM 9806  C C1  . NAG Q 5 .   ? 104.576 155.721 136.909 1.00 400.57 ? 1708 NAG A C1  1 
HETATM 9807  C C2  . NAG Q 5 .   ? 104.612 154.205 136.761 1.00 406.35 ? 1708 NAG A C2  1 
HETATM 9808  C C3  . NAG Q 5 .   ? 103.388 153.683 136.006 1.00 412.13 ? 1708 NAG A C3  1 
HETATM 9809  C C4  . NAG Q 5 .   ? 102.068 154.377 136.376 1.00 427.58 ? 1708 NAG A C4  1 
HETATM 9810  C C5  . NAG Q 5 .   ? 102.228 155.862 136.709 1.00 414.64 ? 1708 NAG A C5  1 
HETATM 9811  C C6  . NAG Q 5 .   ? 101.000 156.400 137.437 1.00 411.00 ? 1708 NAG A C6  1 
HETATM 9812  C C7  . NAG Q 5 .   ? 106.951 153.427 136.699 1.00 394.72 ? 1708 NAG A C7  1 
HETATM 9813  C C8  . NAG Q 5 .   ? 108.096 153.021 135.818 1.00 408.85 ? 1708 NAG A C8  1 
HETATM 9814  N N2  . NAG Q 5 .   ? 105.825 153.780 136.074 1.00 405.58 ? 1708 NAG A N2  1 
HETATM 9815  O O3  . NAG Q 5 .   ? 103.300 152.294 136.243 1.00 425.61 ? 1708 NAG A O3  1 
HETATM 9816  O O4  . NAG Q 5 .   ? 101.144 154.277 135.302 1.00 449.90 ? 1708 NAG A O4  1 
HETATM 9817  O O5  . NAG Q 5 .   ? 103.358 156.073 137.530 1.00 410.01 ? 1708 NAG A O5  1 
HETATM 9818  O O6  . NAG Q 5 .   ? 101.134 157.791 137.630 1.00 418.55 ? 1708 NAG A O6  1 
HETATM 9819  O O7  . NAG Q 5 .   ? 107.095 153.426 137.922 1.00 384.99 ? 1708 NAG A O7  1 
HETATM 9820  C C1  . NAG R 5 .   ? 100.418 153.029 135.239 1.00 461.45 ? 1709 NAG A C1  1 
HETATM 9821  C C2  . NAG R 5 .   ? 98.918  153.328 135.311 1.00 455.82 ? 1709 NAG A C2  1 
HETATM 9822  C C3  . NAG R 5 .   ? 97.995  152.198 134.802 1.00 477.05 ? 1709 NAG A C3  1 
HETATM 9823  C C4  . NAG R 5 .   ? 98.679  150.960 134.184 1.00 481.79 ? 1709 NAG A C4  1 
HETATM 9824  C C5  . NAG R 5 .   ? 100.207 151.018 134.040 1.00 473.94 ? 1709 NAG A C5  1 
HETATM 9825  C C6  . NAG R 5 .   ? 100.669 150.341 132.753 1.00 482.38 ? 1709 NAG A C6  1 
HETATM 9826  C C7  . NAG R 5 .   ? 98.549  153.243 137.831 1.00 414.18 ? 1709 NAG A C7  1 
HETATM 9827  C C8  . NAG R 5 .   ? 99.097  151.856 138.040 1.00 404.65 ? 1709 NAG A C8  1 
HETATM 9828  N N2  . NAG R 5 .   ? 98.496  153.838 136.622 1.00 440.64 ? 1709 NAG A N2  1 
HETATM 9829  O O3  . NAG R 5 .   ? 97.106  152.737 133.842 1.00 482.93 ? 1709 NAG A O3  1 
HETATM 9830  O O4  . NAG R 5 .   ? 98.345  149.815 134.944 1.00 480.64 ? 1709 NAG A O4  1 
HETATM 9831  O O5  . NAG R 5 .   ? 100.678 152.350 134.034 1.00 461.69 ? 1709 NAG A O5  1 
HETATM 9832  O O6  . NAG R 5 .   ? 102.077 150.242 132.751 1.00 475.75 ? 1709 NAG A O6  1 
HETATM 9833  O O7  . NAG R 5 .   ? 98.142  153.838 138.829 1.00 400.02 ? 1709 NAG A O7  1 
HETATM 9834  C C1  . NAG S 5 .   ? 116.643 155.479 134.926 1.00 295.36 ? 1710 NAG A C1  1 
HETATM 9835  C C2  . NAG S 5 .   ? 116.240 154.555 136.072 1.00 331.13 ? 1710 NAG A C2  1 
HETATM 9836  C C3  . NAG S 5 .   ? 116.069 153.082 135.674 1.00 349.21 ? 1710 NAG A C3  1 
HETATM 9837  C C4  . NAG S 5 .   ? 115.390 152.958 134.316 1.00 335.26 ? 1710 NAG A C4  1 
HETATM 9838  C C5  . NAG S 5 .   ? 116.201 153.799 133.345 1.00 304.53 ? 1710 NAG A C5  1 
HETATM 9839  C C6  . NAG S 5 .   ? 115.779 153.676 131.889 1.00 317.81 ? 1710 NAG A C6  1 
HETATM 9840  C C7  . NAG S 5 .   ? 117.206 155.792 137.961 1.00 354.12 ? 1710 NAG A C7  1 
HETATM 9841  C C8  . NAG S 5 .   ? 118.272 155.791 139.015 1.00 368.67 ? 1710 NAG A C8  1 
HETATM 9842  N N2  . NAG S 5 .   ? 117.200 154.724 137.152 1.00 347.92 ? 1710 NAG A N2  1 
HETATM 9843  O O3  . NAG S 5 .   ? 115.298 152.411 136.647 1.00 372.52 ? 1710 NAG A O3  1 
HETATM 9844  O O4  . NAG S 5 .   ? 115.308 151.605 133.896 1.00 368.92 ? 1710 NAG A O4  1 
HETATM 9845  O O5  . NAG S 5 .   ? 115.962 155.117 133.749 1.00 306.38 ? 1710 NAG A O5  1 
HETATM 9846  O O6  . NAG S 5 .   ? 116.649 154.467 131.114 1.00 299.97 ? 1710 NAG A O6  1 
HETATM 9847  O O7  . NAG S 5 .   ? 116.418 156.745 137.893 1.00 279.41 ? 1710 NAG A O7  1 
HETATM 9848  C C1  . NAG T 5 .   ? 113.956 151.094 133.934 1.00 374.75 ? 1711 NAG A C1  1 
HETATM 9849  C C2  . NAG T 5 .   ? 113.886 149.783 133.158 1.00 368.66 ? 1711 NAG A C2  1 
HETATM 9850  C C3  . NAG T 5 .   ? 112.496 149.163 133.249 1.00 391.96 ? 1711 NAG A C3  1 
HETATM 9851  C C4  . NAG T 5 .   ? 112.033 149.080 134.701 1.00 416.32 ? 1711 NAG A C4  1 
HETATM 9852  C C5  . NAG T 5 .   ? 112.184 150.443 135.379 1.00 420.82 ? 1711 NAG A C5  1 
HETATM 9853  C C6  . NAG T 5 .   ? 111.802 150.403 136.856 1.00 427.15 ? 1711 NAG A C6  1 
HETATM 9854  C C7  . NAG T 5 .   ? 115.480 149.776 131.283 1.00 396.16 ? 1711 NAG A C7  1 
HETATM 9855  C C8  . NAG T 5 .   ? 115.671 150.040 129.819 1.00 396.53 ? 1711 NAG A C8  1 
HETATM 9856  N N2  . NAG T 5 .   ? 114.249 149.989 131.765 1.00 371.86 ? 1711 NAG A N2  1 
HETATM 9857  O O3  . NAG T 5 .   ? 112.517 147.872 132.681 1.00 405.18 ? 1711 NAG A O3  1 
HETATM 9858  O O4  . NAG T 5 .   ? 110.684 148.668 134.731 1.00 434.48 ? 1711 NAG A O4  1 
HETATM 9859  O O5  . NAG T 5 .   ? 113.522 150.889 135.264 1.00 402.30 ? 1711 NAG A O5  1 
HETATM 9860  O O6  . NAG T 5 .   ? 112.658 149.529 137.558 1.00 436.55 ? 1711 NAG A O6  1 
HETATM 9861  O O7  . NAG T 5 .   ? 116.436 149.392 131.959 1.00 400.74 ? 1711 NAG A O7  1 
HETATM 9862  C C1  . NAG U 5 .   ? 114.763 169.302 159.540 1.00 441.53 ? 1712 NAG A C1  1 
HETATM 9863  C C2  . NAG U 5 .   ? 113.348 169.437 160.092 1.00 460.88 ? 1712 NAG A C2  1 
HETATM 9864  C C3  . NAG U 5 .   ? 113.397 170.245 161.388 1.00 460.48 ? 1712 NAG A C3  1 
HETATM 9865  C C4  . NAG U 5 .   ? 114.399 169.650 162.378 1.00 465.06 ? 1712 NAG A C4  1 
HETATM 9866  C C5  . NAG U 5 .   ? 115.731 169.293 161.708 1.00 462.07 ? 1712 NAG A C5  1 
HETATM 9867  C C6  . NAG U 5 .   ? 116.621 168.459 162.629 1.00 461.79 ? 1712 NAG A C6  1 
HETATM 9868  C C7  . NAG U 5 .   ? 111.177 169.794 158.985 1.00 465.09 ? 1712 NAG A C7  1 
HETATM 9869  C C8  . NAG U 5 .   ? 110.435 170.555 157.926 1.00 469.03 ? 1712 NAG A C8  1 
HETATM 9870  N N2  . NAG U 5 .   ? 112.479 170.077 159.117 1.00 462.93 ? 1712 NAG A N2  1 
HETATM 9871  O O3  . NAG U 5 .   ? 112.119 170.291 161.984 1.00 469.66 ? 1712 NAG A O3  1 
HETATM 9872  O O4  . NAG U 5 .   ? 114.627 170.584 163.410 1.00 463.31 ? 1712 NAG A O4  1 
HETATM 9873  O O5  . NAG U 5 .   ? 115.515 168.580 160.500 1.00 449.71 ? 1712 NAG A O5  1 
HETATM 9874  O O6  . NAG U 5 .   ? 116.080 167.168 162.811 1.00 461.91 ? 1712 NAG A O6  1 
HETATM 9875  O O7  . NAG U 5 .   ? 110.571 168.968 159.671 1.00 457.79 ? 1712 NAG A O7  1 
HETATM 9876  C C1  . NAG V 5 .   ? 114.501 202.312 134.575 1.00 500.00 ? 1713 NAG A C1  1 
HETATM 9877  C C2  . NAG V 5 .   ? 113.346 203.243 134.190 1.00 500.00 ? 1713 NAG A C2  1 
HETATM 9878  C C3  . NAG V 5 .   ? 113.668 203.982 132.886 1.00 500.00 ? 1713 NAG A C3  1 
HETATM 9879  C C4  . NAG V 5 .   ? 115.053 204.629 132.923 1.00 500.00 ? 1713 NAG A C4  1 
HETATM 9880  C C5  . NAG V 5 .   ? 116.117 203.703 133.516 1.00 500.00 ? 1713 NAG A C5  1 
HETATM 9881  C C6  . NAG V 5 .   ? 117.405 204.459 133.823 1.00 500.00 ? 1713 NAG A C6  1 
HETATM 9882  C C7  . NAG V 5 .   ? 110.886 203.099 134.226 1.00 500.00 ? 1713 NAG A C7  1 
HETATM 9883  C C8  . NAG V 5 .   ? 109.691 202.199 134.104 1.00 500.00 ? 1713 NAG A C8  1 
HETATM 9884  N N2  . NAG V 5 .   ? 112.084 202.516 134.098 1.00 500.00 ? 1713 NAG A N2  1 
HETATM 9885  O O3  . NAG V 5 .   ? 112.717 204.995 132.642 1.00 500.00 ? 1713 NAG A O3  1 
HETATM 9886  O O4  . NAG V 5 .   ? 115.414 204.990 131.608 1.00 500.00 ? 1713 NAG A O4  1 
HETATM 9887  O O5  . NAG V 5 .   ? 115.651 203.126 134.721 1.00 500.00 ? 1713 NAG A O5  1 
HETATM 9888  O O6  . NAG V 5 .   ? 118.484 203.550 133.859 1.00 500.00 ? 1713 NAG A O6  1 
HETATM 9889  O O7  . NAG V 5 .   ? 110.721 204.303 134.423 1.00 500.00 ? 1713 NAG A O7  1 
HETATM 9890  C C1  . NAG W 5 .   ? 121.208 183.334 112.636 1.00 457.89 ? 1714 NAG A C1  1 
HETATM 9891  C C2  . NAG W 5 .   ? 121.882 183.157 111.278 1.00 464.72 ? 1714 NAG A C2  1 
HETATM 9892  C C3  . NAG W 5 .   ? 121.197 184.020 110.224 1.00 487.51 ? 1714 NAG A C3  1 
HETATM 9893  C C4  . NAG W 5 .   ? 119.683 183.818 110.237 1.00 490.46 ? 1714 NAG A C4  1 
HETATM 9894  C C5  . NAG W 5 .   ? 119.111 183.857 111.659 1.00 474.44 ? 1714 NAG A C5  1 
HETATM 9895  C C6  . NAG W 5 .   ? 117.637 183.457 111.695 1.00 456.67 ? 1714 NAG A C6  1 
HETATM 9896  C C7  . NAG W 5 .   ? 124.171 182.619 111.946 1.00 447.95 ? 1714 NAG A C7  1 
HETATM 9897  C C8  . NAG W 5 .   ? 125.605 183.063 111.967 1.00 446.45 ? 1714 NAG A C8  1 
HETATM 9898  N N2  . NAG W 5 .   ? 123.302 183.453 111.372 1.00 460.27 ? 1714 NAG A N2  1 
HETATM 9899  O O3  . NAG W 5 .   ? 121.707 183.694 108.949 1.00 488.38 ? 1714 NAG A O3  1 
HETATM 9900  O O4  . NAG W 5 .   ? 119.086 184.835 109.463 1.00 500.00 ? 1714 NAG A O4  1 
HETATM 9901  O O5  . NAG W 5 .   ? 119.839 182.999 112.518 1.00 465.26 ? 1714 NAG A O5  1 
HETATM 9902  O O6  . NAG W 5 .   ? 117.487 182.090 111.381 1.00 438.06 ? 1714 NAG A O6  1 
HETATM 9903  O O7  . NAG W 5 .   ? 123.860 181.536 112.445 1.00 444.07 ? 1714 NAG A O7  1 
HETATM 9904  C C1  . NAG X 5 .   ? 110.243 143.899 153.072 1.00 455.83 ? 1715 NAG A C1  1 
HETATM 9905  C C2  . NAG X 5 .   ? 109.128 144.332 152.122 1.00 472.55 ? 1715 NAG A C2  1 
HETATM 9906  C C3  . NAG X 5 .   ? 108.066 145.140 152.868 1.00 475.11 ? 1715 NAG A C3  1 
HETATM 9907  C C4  . NAG X 5 .   ? 107.606 144.447 154.149 1.00 483.85 ? 1715 NAG A C4  1 
HETATM 9908  C C5  . NAG X 5 .   ? 108.801 143.945 154.963 1.00 479.54 ? 1715 NAG A C5  1 
HETATM 9909  C C6  . NAG X 5 .   ? 108.362 143.099 156.157 1.00 481.43 ? 1715 NAG A C6  1 
HETATM 9910  C C7  . NAG X 5 .   ? 110.055 144.591 149.854 1.00 489.13 ? 1715 NAG A C7  1 
HETATM 9911  C C8  . NAG X 5 .   ? 110.576 145.560 148.833 1.00 494.97 ? 1715 NAG A C8  1 
HETATM 9912  N N2  . NAG X 5 .   ? 109.661 145.117 151.018 1.00 477.07 ? 1715 NAG A N2  1 
HETATM 9913  O O3  . NAG X 5 .   ? 106.955 145.352 152.025 1.00 487.01 ? 1715 NAG A O3  1 
HETATM 9914  O O4  . NAG X 5 .   ? 106.874 145.374 154.920 1.00 492.12 ? 1715 NAG A O4  1 
HETATM 9915  O O5  . NAG X 5 .   ? 109.662 143.177 154.143 1.00 467.28 ? 1715 NAG A O5  1 
HETATM 9916  O O6  . NAG X 5 .   ? 107.715 141.924 155.720 1.00 471.70 ? 1715 NAG A O6  1 
HETATM 9917  O O7  . NAG X 5 .   ? 110.019 143.388 149.587 1.00 498.16 ? 1715 NAG A O7  1 
HETATM 9918  O O12 . PC1 Y 7 .   ? 121.696 125.123 131.777 1.00 423.99 ? 1468 PC1 B O12 1 
HETATM 9919  P P   . PC1 Y 7 .   ? 122.803 125.563 130.846 1.00 427.28 ? 1468 PC1 B P   1 
HETATM 9920  O O14 . PC1 Y 7 .   ? 122.463 126.253 129.546 1.00 401.19 ? 1468 PC1 B O14 1 
HETATM 9921  O O13 . PC1 Y 7 .   ? 123.812 126.516 131.668 1.00 451.20 ? 1468 PC1 B O13 1 
HETATM 9922  C C11 . PC1 Y 7 .   ? 125.022 126.994 131.077 1.00 458.95 ? 1468 PC1 B C11 1 
HETATM 9923  C C12 . PC1 Y 7 .   ? 125.705 128.017 131.992 1.00 470.34 ? 1468 PC1 B C12 1 
HETATM 9924  N N   . PC1 Y 7 .   ? 126.606 127.483 133.046 1.00 486.68 ? 1468 PC1 B N   1 
HETATM 9925  C C13 . PC1 Y 7 .   ? 125.862 126.682 134.037 1.00 486.77 ? 1468 PC1 B C13 1 
HETATM 9926  C C14 . PC1 Y 7 .   ? 127.175 128.644 133.760 1.00 500.00 ? 1468 PC1 B C14 1 
HETATM 9927  C C15 . PC1 Y 7 .   ? 127.720 126.690 132.487 1.00 488.44 ? 1468 PC1 B C15 1 
HETATM 9928  O O11 . PC1 Y 7 .   ? 123.714 124.274 130.525 1.00 389.21 ? 1468 PC1 B O11 1 
HETATM 9929  C C1  . PC1 Y 7 .   ? 124.392 123.585 131.576 1.00 352.90 ? 1468 PC1 B C1  1 
HETATM 9930  C C2  . PC1 Y 7 .   ? 124.957 122.258 131.078 1.00 325.19 ? 1468 PC1 B C2  1 
HETATM 9931  O O21 . PC1 Y 7 .   ? 125.516 122.411 129.769 1.00 321.69 ? 1468 PC1 B O21 1 
HETATM 9932  C C21 . PC1 Y 7 .   ? 126.925 122.791 129.783 1.00 353.97 ? 1468 PC1 B C21 1 
HETATM 9933  O O22 . PC1 Y 7 .   ? 127.264 123.850 130.292 1.00 341.27 ? 1468 PC1 B O22 1 
HETATM 9934  C C22 . PC1 Y 7 .   ? 127.967 121.881 129.168 1.00 374.69 ? 1468 PC1 B C22 1 
HETATM 9935  C C23 . PC1 Y 7 .   ? 127.716 121.703 127.671 1.00 376.28 ? 1468 PC1 B C23 1 
HETATM 9936  C C24 . PC1 Y 7 .   ? 126.847 120.477 127.382 1.00 363.45 ? 1468 PC1 B C24 1 
HETATM 9937  C C25 . PC1 Y 7 .   ? 127.678 119.210 127.165 1.00 361.33 ? 1468 PC1 B C25 1 
HETATM 9938  C C26 . PC1 Y 7 .   ? 127.700 118.755 125.704 1.00 340.98 ? 1468 PC1 B C26 1 
HETATM 9939  C C27 . PC1 Y 7 .   ? 126.725 117.613 125.425 1.00 341.21 ? 1468 PC1 B C27 1 
HETATM 9940  C C28 . PC1 Y 7 .   ? 126.075 117.696 124.044 1.00 332.29 ? 1468 PC1 B C28 1 
HETATM 9941  C C29 . PC1 Y 7 .   ? 124.843 116.795 123.931 1.00 345.05 ? 1468 PC1 B C29 1 
HETATM 9942  C C2A . PC1 Y 7 .   ? 125.080 115.561 123.071 1.00 353.76 ? 1468 PC1 B C2A 1 
HETATM 9943  C C2B . PC1 Y 7 .   ? 123.789 114.760 122.912 1.00 375.12 ? 1468 PC1 B C2B 1 
HETATM 9944  C C2C . PC1 Y 7 .   ? 122.968 115.239 121.717 1.00 393.46 ? 1468 PC1 B C2C 1 
HETATM 9945  C C2D . PC1 Y 7 .   ? 121.472 115.102 121.969 1.00 379.43 ? 1468 PC1 B C2D 1 
HETATM 9946  C C2E . PC1 Y 7 .   ? 120.694 115.471 120.716 1.00 359.53 ? 1468 PC1 B C2E 1 
HETATM 9947  C C3  . PC1 Y 7 .   ? 123.836 121.222 131.113 1.00 328.57 ? 1468 PC1 B C3  1 
HETATM 9948  O O31 . PC1 Y 7 .   ? 124.067 120.137 130.214 1.00 326.33 ? 1468 PC1 B O31 1 
HETATM 9949  C C31 . PC1 Y 7 .   ? 124.819 118.958 130.617 1.00 318.74 ? 1468 PC1 B C31 1 
HETATM 9950  O O32 . PC1 Y 7 .   ? 125.300 118.890 131.738 1.00 331.51 ? 1468 PC1 B O32 1 
HETATM 9951  C C32 . PC1 Y 7 .   ? 125.019 117.824 129.641 1.00 322.61 ? 1468 PC1 B C32 1 
HETATM 9952  C C33 . PC1 Y 7 .   ? 124.149 116.625 130.013 1.00 336.34 ? 1468 PC1 B C33 1 
HETATM 9953  C C34 . PC1 Y 7 .   ? 124.762 115.299 129.549 1.00 356.08 ? 1468 PC1 B C34 1 
HETATM 9954  C C35 . PC1 Y 7 .   ? 124.434 114.989 128.088 1.00 370.53 ? 1468 PC1 B C35 1 
HETATM 9955  C C36 . PC1 Y 7 .   ? 124.698 113.521 127.745 1.00 384.03 ? 1468 PC1 B C36 1 
HETATM 9956  C C37 . PC1 Y 7 .   ? 123.426 112.683 127.588 1.00 374.49 ? 1468 PC1 B C37 1 
HETATM 9957  C C38 . PC1 Y 7 .   ? 122.597 113.099 126.371 1.00 352.86 ? 1468 PC1 B C38 1 
HETATM 9958  C C39 . PC1 Y 7 .   ? 122.220 111.927 125.467 1.00 363.17 ? 1468 PC1 B C39 1 
HETATM 9959  C C3A . PC1 Y 7 .   ? 120.965 111.211 125.963 1.00 363.51 ? 1468 PC1 B C3A 1 
HETATM 9960  C C3B . PC1 Y 7 .   ? 120.924 109.754 125.513 1.00 344.20 ? 1468 PC1 B C3B 1 
HETATM 9961  O O12 . PC1 Z 7 .   ? 120.212 84.531  124.502 1.00 415.01 ? 1245 PC1 C O12 1 
HETATM 9962  P P   . PC1 Z 7 .   ? 121.701 84.385  124.722 1.00 418.94 ? 1245 PC1 C P   1 
HETATM 9963  O O14 . PC1 Z 7 .   ? 122.233 83.186  125.471 1.00 424.56 ? 1245 PC1 C O14 1 
HETATM 9964  O O13 . PC1 Z 7 .   ? 122.466 84.469  123.302 1.00 435.59 ? 1245 PC1 C O13 1 
HETATM 9965  C C11 . PC1 Z 7 .   ? 121.966 83.848  122.114 1.00 442.96 ? 1245 PC1 C C11 1 
HETATM 9966  C C12 . PC1 Z 7 .   ? 122.431 82.392  122.037 1.00 451.11 ? 1245 PC1 C C12 1 
HETATM 9967  N N   . PC1 Z 7 .   ? 121.596 81.506  121.187 1.00 467.09 ? 1245 PC1 C N   1 
HETATM 9968  C C13 . PC1 Z 7 .   ? 121.243 82.134  119.895 1.00 471.74 ? 1245 PC1 C C13 1 
HETATM 9969  C C14 . PC1 Z 7 .   ? 120.363 81.102  121.889 1.00 464.06 ? 1245 PC1 C C14 1 
HETATM 9970  C C15 . PC1 Z 7 .   ? 122.371 80.283  120.906 1.00 482.79 ? 1245 PC1 C C15 1 
HETATM 9971  O O11 . PC1 Z 7 .   ? 122.228 85.706  125.477 1.00 396.77 ? 1245 PC1 C O11 1 
HETATM 9972  C C1  . PC1 Z 7 .   ? 121.501 86.281  126.565 1.00 393.61 ? 1245 PC1 C C1  1 
HETATM 9973  C C2  . PC1 Z 7 .   ? 120.592 87.414  126.082 1.00 406.94 ? 1245 PC1 C C2  1 
HETATM 9974  O O21 . PC1 Z 7 .   ? 121.245 88.694  126.024 1.00 395.09 ? 1245 PC1 C O21 1 
HETATM 9975  C C21 . PC1 Z 7 .   ? 122.635 88.717  125.570 1.00 375.22 ? 1245 PC1 C C21 1 
HETATM 9976  O O22 . PC1 Z 7 .   ? 122.901 88.447  124.409 1.00 327.75 ? 1245 PC1 C O22 1 
HETATM 9977  C C22 . PC1 Z 7 .   ? 123.744 89.042  126.543 1.00 398.22 ? 1245 PC1 C C22 1 
HETATM 9978  C C23 . PC1 Z 7 .   ? 123.340 90.146  127.523 1.00 396.30 ? 1245 PC1 C C23 1 
HETATM 9979  C C24 . PC1 Z 7 .   ? 124.217 90.129  128.774 1.00 399.79 ? 1245 PC1 C C24 1 
HETATM 9980  C C25 . PC1 Z 7 .   ? 124.875 91.472  129.084 1.00 407.58 ? 1245 PC1 C C25 1 
HETATM 9981  C C26 . PC1 Z 7 .   ? 123.933 92.415  129.829 1.00 391.76 ? 1245 PC1 C C26 1 
HETATM 9982  C C27 . PC1 Z 7 .   ? 124.104 92.343  131.345 1.00 376.24 ? 1245 PC1 C C27 1 
HETATM 9983  C C28 . PC1 Z 7 .   ? 123.250 93.386  132.063 1.00 358.66 ? 1245 PC1 C C28 1 
HETATM 9984  C C29 . PC1 Z 7 .   ? 123.870 93.796  133.397 1.00 356.67 ? 1245 PC1 C C29 1 
HETATM 9985  C C2A . PC1 Z 7 .   ? 122.824 94.324  134.374 1.00 359.30 ? 1245 PC1 C C2A 1 
HETATM 9986  C C2B . PC1 Z 7 .   ? 123.423 94.594  135.753 1.00 374.37 ? 1245 PC1 C C2B 1 
HETATM 9987  C C2C . PC1 Z 7 .   ? 124.266 95.869  135.779 1.00 389.58 ? 1245 PC1 C C2C 1 
HETATM 9988  C C2D . PC1 Z 7 .   ? 124.565 96.331  137.206 1.00 390.30 ? 1245 PC1 C C2D 1 
HETATM 9989  C C2E . PC1 Z 7 .   ? 124.962 97.804  137.244 1.00 355.29 ? 1245 PC1 C C2E 1 
HETATM 9990  C C3  . PC1 Z 7 .   ? 119.375 87.522  127.007 1.00 391.66 ? 1245 PC1 C C3  1 
HETATM 9991  O O31 . PC1 Z 7 .   ? 119.777 87.599  128.380 1.00 375.79 ? 1245 PC1 C O31 1 
HETATM 9992  C C31 . PC1 Z 7 .   ? 119.558 88.796  129.184 1.00 362.50 ? 1245 PC1 C C31 1 
HETATM 9993  O O32 . PC1 Z 7 .   ? 119.740 89.886  128.663 1.00 384.43 ? 1245 PC1 C O32 1 
HETATM 9994  C C32 . PC1 Z 7 .   ? 119.120 88.676  130.633 1.00 332.46 ? 1245 PC1 C C32 1 
HETATM 9995  C C33 . PC1 Z 7 .   ? 119.462 89.944  131.415 1.00 325.97 ? 1245 PC1 C C33 1 
HETATM 9996  C C34 . PC1 Z 7 .   ? 119.334 89.779  132.929 1.00 337.78 ? 1245 PC1 C C34 1 
HETATM 9997  C C35 . PC1 Z 7 .   ? 120.611 90.243  133.633 1.00 351.69 ? 1245 PC1 C C35 1 
HETATM 9998  C C36 . PC1 Z 7 .   ? 120.453 90.257  135.150 1.00 350.63 ? 1245 PC1 C C36 1 
HETATM 9999  C C37 . PC1 Z 7 .   ? 121.794 90.478  135.852 1.00 354.76 ? 1245 PC1 C C37 1 
HETATM 10000 C C38 . PC1 Z 7 .   ? 121.718 91.555  136.933 1.00 369.23 ? 1245 PC1 C C38 1 
HETATM 10001 C C39 . PC1 Z 7 .   ? 120.785 91.156  138.076 1.00 371.66 ? 1245 PC1 C C39 1 
HETATM 10002 C C3A . PC1 Z 7 .   ? 121.071 91.913  139.375 1.00 383.19 ? 1245 PC1 C C3A 1 
HETATM 10003 C C3B . PC1 Z 7 .   ? 120.485 93.322  139.369 1.00 366.23 ? 1245 PC1 C C3B 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   THR 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  ASP 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  SER 14  14  ?   ?   ?   A . n 
A 1 15  ARG 15  15  ?   ?   ?   A . n 
A 1 16  GLY 16  16  ?   ?   ?   A . n 
A 1 17  LEU 17  17  ?   ?   ?   A . n 
A 1 18  LEU 18  18  ?   ?   ?   A . n 
A 1 19  ARG 19  19  ?   ?   ?   A . n 
A 1 20  LEU 20  20  ?   ?   ?   A . n 
A 1 21  LEU 21  21  ?   ?   ?   A . n 
A 1 22  SER 22  22  ?   ?   ?   A . n 
A 1 23  PHE 23  23  ?   ?   ?   A . n 
A 1 24  CYS 24  24  ?   ?   ?   A . n 
A 1 25  VAL 25  25  ?   ?   ?   A . n 
A 1 26  LEU 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  ALA 28  28  ?   ?   ?   A . n 
A 1 29  GLY 29  29  ?   ?   ?   A . n 
A 1 30  LEU 30  30  ?   ?   ?   A . n 
A 1 31  CYS 31  31  ?   ?   ?   A . n 
A 1 32  ARG 32  32  ?   ?   ?   A . n 
A 1 33  GLY 33  33  ?   ?   ?   A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  CYS 50  50  50  CYS CYS A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 MET 108 108 108 MET MET A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 PHE 134 134 134 PHE PHE A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 PHE 181 181 181 PHE PHE A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 CYS 195 195 195 CYS CYS A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 HIS 199 199 199 HIS HIS A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 GLN 203 203 203 GLN GLN A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 SER 206 206 206 SER SER A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 PHE 210 210 210 PHE PHE A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 CYS 213 213 213 CYS CYS A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 GLN 216 216 216 GLN GLN A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 PHE 218 218 218 PHE PHE A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 HIS 220 220 220 HIS HIS A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 HIS 222 222 222 HIS HIS A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 CYS 230 230 230 CYS CYS A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 SER 234 234 234 SER SER A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 GLN 237 237 237 GLN GLN A . n 
A 1 238 SER 238 238 238 SER SER A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ILE 242 242 242 ILE ILE A . n 
A 1 243 ASN 243 243 243 ASN ASN A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 CYS 248 248 248 CYS CYS A . n 
A 1 249 ASP 249 249 249 ASP ASP A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 ASP 253 253 253 ASP ASP A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 VAL 256 256 256 VAL VAL A . n 
A 1 257 TRP 257 257 257 TRP TRP A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 MET 259 259 259 MET MET A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 LYS 261 261 261 LYS LYS A . n 
A 1 262 PRO 262 262 262 PRO PRO A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 THR 265 265 265 THR THR A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 ASP 272 272 272 ASP ASP A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 ARG 281 281 281 ARG ARG A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 PHE 287 287 287 PHE PHE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 TRP 289 289 289 TRP TRP A . n 
A 1 290 ASN 290 290 290 ASN ASN A . n 
A 1 291 VAL 291 291 291 VAL VAL A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 VAL 299 299 299 VAL VAL A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 SER 301 301 301 SER SER A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 THR 304 304 304 THR THR A . n 
A 1 305 GLN 305 305 305 GLN GLN A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ALA 308 308 308 ALA ALA A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 GLU 310 310 310 GLU GLU A . n 
A 1 311 ALA 311 311 311 ALA ALA A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 GLN 313 313 313 GLN GLN A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 PRO 316 316 316 PRO PRO A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 THR 319 319 319 THR THR A . n 
A 1 320 THR 320 320 320 THR THR A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 PRO 322 322 322 PRO PRO A . n 
A 1 323 ARG 323 323 323 ARG ARG A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 MET 326 326 326 MET MET A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 PHE 329 329 329 PHE PHE A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 PHE 335 335 335 PHE PHE A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 ILE 338 338 338 ILE ILE A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 SER 341 341 341 SER SER A . n 
A 1 342 ARG 342 342 342 ARG ARG A . n 
A 1 343 MET 343 343 343 MET MET A . n 
A 1 344 VAL 344 344 344 VAL VAL A . n 
A 1 345 TYR 345 345 345 TYR TYR A . n 
A 1 346 ASP 346 346 346 ASP ASP A . n 
A 1 347 MET 347 347 347 MET MET A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LYS 349 349 349 LYS LYS A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 LYS 351 351 351 LYS LYS A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 PRO 353 353 353 PRO PRO A . n 
A 1 354 VAL 354 354 354 VAL VAL A . n 
A 1 355 GLN 355 355 355 GLN GLN A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 ASN 358 358 358 ASN ASN A . n 
A 1 359 VAL 359 359 359 VAL VAL A . n 
A 1 360 ASP 360 360 360 ASP ASP A . n 
A 1 361 SER 361 361 361 SER SER A . n 
A 1 362 PHE 362 362 362 PHE PHE A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 GLU 364 364 364 GLU GLU A . n 
A 1 365 LEU 365 365 365 LEU LEU A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 ALA 369 369 369 ALA ALA A . n 
A 1 370 LEU 370 370 370 LEU LEU A . n 
A 1 371 ARG 371 371 371 ARG ARG A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 SER 373 373 373 SER SER A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 GLU 375 375 375 GLU GLU A . n 
A 1 376 LEU 376 376 376 LEU LEU A . n 
A 1 377 TRP 377 377 377 TRP TRP A . n 
A 1 378 MET 378 378 378 MET MET A . n 
A 1 379 HIS 379 379 379 HIS HIS A . n 
A 1 380 THR 380 380 380 THR THR A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 PRO 382 382 382 PRO PRO A . n 
A 1 383 VAL 383 383 383 VAL VAL A . n 
A 1 384 SER 384 384 384 SER SER A . n 
A 1 385 GLN 385 385 385 GLN GLN A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 GLU 388 388 388 GLU GLU A . n 
A 1 389 SER 389 389 389 SER SER A . n 
A 1 390 VAL 390 390 390 VAL VAL A . n 
A 1 391 ARG 391 391 391 ARG ARG A . n 
A 1 392 ASN 392 392 392 ASN ASN A . n 
A 1 393 GLN 393 393 393 GLN GLN A . n 
A 1 394 VAL 394 394 394 VAL VAL A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 LEU 397 397 397 LEU LEU A . n 
A 1 398 LEU 398 398 398 LEU LEU A . n 
A 1 399 ALA 399 399 399 ALA ALA A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 LEU 401 401 401 LEU LEU A . n 
A 1 402 GLU 402 402 402 GLU GLU A . n 
A 1 403 LYS 403 403 403 LYS LYS A . n 
A 1 404 SER 404 404 404 SER SER A . n 
A 1 405 GLY 405 405 405 GLY GLY A . n 
A 1 406 ALA 406 406 406 ALA ALA A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 PRO 409 409 409 PRO PRO A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 LEU 413 413 413 LEU LEU A . n 
A 1 414 ARG 414 414 414 ARG ARG A . n 
A 1 415 ARG 415 415 415 ARG ARG A . n 
A 1 416 PRO 416 416 416 PRO PRO A . n 
A 1 417 ASN 417 417 417 ASN ASN A . n 
A 1 418 GLN 418 418 418 GLN GLN A . n 
A 1 419 SER 419 419 419 SER SER A . n 
A 1 420 GLN 420 420 420 GLN GLN A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 PRO 424 424 424 PRO PRO A . n 
A 1 425 SER 425 425 425 SER SER A . n 
A 1 426 SER 426 426 426 SER SER A . n 
A 1 427 LEU 427 427 427 LEU LEU A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 ARG 429 429 429 ARG ARG A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 LEU 431 431 431 LEU LEU A . n 
A 1 432 ARG 432 432 432 ARG ARG A . n 
A 1 433 ALA 433 433 433 ALA ALA A . n 
A 1 434 ARG 434 434 434 ARG ARG A . n 
A 1 435 ASN 435 435 435 ASN ASN A . n 
A 1 436 ILE 436 436 436 ILE ILE A . n 
A 1 437 SER 437 437 437 SER SER A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 VAL 439 439 439 VAL VAL A . n 
A 1 440 VAL 440 440 440 VAL VAL A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 ALA 442 442 442 ALA ALA A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 HIS 444 444 444 HIS HIS A . n 
A 1 445 SER 445 445 445 SER SER A . n 
A 1 446 GLY 446 446 446 GLY GLY A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 HIS 449 449 449 HIS HIS A . n 
A 1 450 ASN 450 450 450 ASN ASN A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 TYR 452 452 452 TYR TYR A . n 
A 1 453 TYR 453 453 453 TYR TYR A . n 
A 1 454 GLN 454 454 454 GLN GLN A . n 
A 1 455 SER 455 455 455 SER SER A . n 
A 1 456 ILE 456 456 456 ILE ILE A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 ASP 458 458 458 ASP ASP A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 ASN 462 462 462 ASN ASN A . n 
A 1 463 ILE 463 463 463 ILE ILE A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 VAL 465 465 465 VAL VAL A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 TYR 467 467 467 TYR TYR A . n 
A 1 468 PRO 468 468 468 PRO PRO A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 TRP 470 470 470 TRP TRP A . n 
A 1 471 LEU 471 471 471 LEU LEU A . n 
A 1 472 SER 472 472 472 SER SER A . n 
A 1 473 PRO 473 473 473 PRO PRO A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 GLU 475 475 475 GLU GLU A . n 
A 1 476 ASP 476 476 476 ASP ASP A . n 
A 1 477 LEU 477 477 477 LEU LEU A . n 
A 1 478 ASN 478 478 478 ASN ASN A . n 
A 1 479 PHE 479 479 479 PHE PHE A . n 
A 1 480 VAL 480 480 480 VAL VAL A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASP 482 482 482 ASP ASP A . n 
A 1 483 THR 483 483 483 THR THR A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 LYS 485 485 485 LYS LYS A . n 
A 1 486 ALA 486 486 486 ALA ALA A . n 
A 1 487 LEU 487 487 487 LEU LEU A . n 
A 1 488 ALA 488 488 488 ALA ALA A . n 
A 1 489 ASP 489 489 489 ASP ASP A . n 
A 1 490 VAL 490 490 490 VAL VAL A . n 
A 1 491 ALA 491 491 491 ALA ALA A . n 
A 1 492 THR 492 492 492 THR THR A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 GLY 495 495 495 GLY GLY A . n 
A 1 496 ARG 496 496 496 ARG ARG A . n 
A 1 497 ALA 497 497 497 ALA ALA A . n 
A 1 498 LEU 498 498 498 LEU LEU A . n 
A 1 499 TYR 499 499 499 TYR TYR A . n 
A 1 500 GLU 500 500 500 GLU GLU A . n 
A 1 501 LEU 501 501 501 LEU LEU A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 GLY 503 503 503 GLY GLY A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 PHE 507 507 507 PHE PHE A . n 
A 1 508 SER 508 508 508 SER SER A . n 
A 1 509 ASP 509 509 509 ASP ASP A . n 
A 1 510 THR 510 510 510 THR THR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 GLN 512 512 512 GLN GLN A . n 
A 1 513 ALA 513 513 513 ALA ALA A . n 
A 1 514 ASP 514 514 514 ASP ASP A . n 
A 1 515 PRO 515 515 515 PRO PRO A . n 
A 1 516 GLN 516 516 516 GLN GLN A . n 
A 1 517 THR 517 517 517 THR THR A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 LEU 521 521 521 LEU LEU A . n 
A 1 522 LEU 522 522 522 LEU LEU A . n 
A 1 523 TYR 523 523 523 TYR TYR A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 LEU 526 526 526 LEU LEU A . n 
A 1 527 ILE 527 527 527 ILE ILE A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 ALA 529 529 529 ALA ALA A . n 
A 1 530 ASN 530 530 530 ASN ASN A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 SER 532 532 532 SER SER A . n 
A 1 533 TRP 533 533 533 TRP TRP A . n 
A 1 534 PHE 534 534 534 PHE PHE A . n 
A 1 535 GLN 535 535 535 GLN GLN A . n 
A 1 536 SER 536 536 536 SER SER A . n 
A 1 537 ILE 537 537 537 ILE ILE A . n 
A 1 538 LEU 538 538 538 LEU LEU A . n 
A 1 539 ARG 539 539 539 ARG ARG A . n 
A 1 540 GLN 540 540 540 GLN GLN A . n 
A 1 541 ASP 541 541 541 ASP ASP A . n 
A 1 542 LEU 542 542 542 LEU LEU A . n 
A 1 543 ARG 543 543 543 ARG ARG A . n 
A 1 544 SER 544 544 544 SER SER A . n 
A 1 545 TYR 545 545 545 TYR TYR A . n 
A 1 546 LEU 546 546 546 LEU LEU A . n 
A 1 547 GLY 547 547 547 GLY GLY A . n 
A 1 548 ASP 548 548 548 ASP ASP A . n 
A 1 549 GLY 549 549 549 GLY GLY A . n 
A 1 550 PRO 550 550 550 PRO PRO A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 GLN 552 552 552 GLN GLN A . n 
A 1 553 HIS 553 553 553 HIS HIS A . n 
A 1 554 TYR 554 554 554 TYR TYR A . n 
A 1 555 ILE 555 555 555 ILE ILE A . n 
A 1 556 ALA 556 556 556 ALA ALA A . n 
A 1 557 VAL 557 557 557 VAL VAL A . n 
A 1 558 SER 558 558 558 SER SER A . n 
A 1 559 SER 559 559 559 SER SER A . n 
A 1 560 PRO 560 560 560 PRO PRO A . n 
A 1 561 THR 561 561 561 THR THR A . n 
A 1 562 ASN 562 562 562 ASN ASN A . n 
A 1 563 THR 563 563 563 THR THR A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 TYR 565 565 565 TYR TYR A . n 
A 1 566 VAL 566 566 566 VAL VAL A . n 
A 1 567 VAL 567 567 567 VAL VAL A . n 
A 1 568 GLN 568 568 568 GLN GLN A . n 
A 1 569 TYR 569 569 569 TYR TYR A . n 
A 1 570 ALA 570 570 570 ALA ALA A . n 
A 1 571 LEU 571 571 571 LEU LEU A . n 
A 1 572 ALA 572 572 572 ALA ALA A . n 
A 1 573 ASN 573 573 573 ASN ASN A . n 
A 1 574 LEU 574 574 574 LEU LEU A . n 
A 1 575 THR 575 575 575 THR THR A . n 
A 1 576 GLY 576 576 576 GLY GLY A . n 
A 1 577 THR 577 577 577 THR THR A . n 
A 1 578 VAL 578 578 578 VAL VAL A . n 
A 1 579 VAL 579 579 579 VAL VAL A . n 
A 1 580 ASN 580 580 580 ASN ASN A . n 
A 1 581 LEU 581 581 581 LEU LEU A . n 
A 1 582 THR 582 582 582 THR THR A . n 
A 1 583 ARG 583 583 583 ARG ARG A . n 
A 1 584 GLU 584 584 584 GLU GLU A . n 
A 1 585 GLN 585 585 585 GLN GLN A . n 
A 1 586 CYS 586 586 586 CYS CYS A . n 
A 1 587 GLN 587 587 587 GLN GLN A . n 
A 1 588 ASP 588 588 588 ASP ASP A . n 
A 1 589 PRO 589 589 589 PRO PRO A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 LYS 591 591 591 LYS LYS A . n 
A 1 592 VAL 592 592 592 VAL VAL A . n 
A 1 593 PRO 593 593 593 PRO PRO A . n 
A 1 594 SER 594 594 594 SER SER A . n 
A 1 595 GLU 595 595 595 GLU GLU A . n 
A 1 596 ASN 596 596 596 ASN ASN A . n 
A 1 597 LYS 597 597 597 LYS LYS A . n 
A 1 598 ASP 598 598 598 ASP ASP A . n 
A 1 599 LEU 599 599 599 LEU LEU A . n 
A 1 600 TYR 600 600 600 TYR TYR A . n 
A 1 601 GLU 601 601 601 GLU GLU A . n 
A 1 602 TYR 602 602 602 TYR TYR A . n 
A 1 603 SER 603 603 603 SER SER A . n 
A 1 604 TRP 604 604 604 TRP TRP A . n 
A 1 605 VAL 605 605 605 VAL VAL A . n 
A 1 606 GLN 606 606 606 GLN GLN A . n 
A 1 607 GLY 607 607 607 GLY GLY A . n 
A 1 608 PRO 608 608 608 PRO PRO A . n 
A 1 609 LEU 609 609 609 LEU LEU A . n 
A 1 610 HIS 610 610 610 HIS HIS A . n 
A 1 611 SER 611 611 611 SER SER A . n 
A 1 612 ASN 612 612 612 ASN ASN A . n 
A 1 613 GLU 613 613 613 GLU GLU A . n 
A 1 614 THR 614 614 614 THR THR A . n 
A 1 615 ASP 615 615 615 ASP ASP A . n 
A 1 616 ARG 616 616 616 ARG ARG A . n 
A 1 617 LEU 617 617 617 LEU LEU A . n 
A 1 618 PRO 618 618 618 PRO PRO A . n 
A 1 619 ARG 619 619 619 ARG ARG A . n 
A 1 620 CYS 620 620 620 CYS CYS A . n 
A 1 621 VAL 621 621 621 VAL VAL A . n 
A 1 622 ARG 622 622 622 ARG ARG A . n 
A 1 623 SER 623 623 623 SER SER A . n 
A 1 624 THR 624 624 624 THR THR A . n 
A 1 625 ALA 625 625 625 ALA ALA A . n 
A 1 626 ARG 626 626 626 ARG ARG A . n 
A 1 627 LEU 627 627 627 LEU LEU A . n 
A 1 628 ALA 628 628 628 ALA ALA A . n 
A 1 629 ARG 629 629 629 ARG ARG A . n 
A 1 630 ALA 630 630 630 ALA ALA A . n 
A 1 631 LEU 631 631 631 LEU LEU A . n 
A 1 632 SER 632 632 632 SER SER A . n 
A 1 633 PRO 633 633 633 PRO PRO A . n 
A 1 634 ALA 634 634 634 ALA ALA A . n 
A 1 635 PHE 635 635 635 PHE PHE A . n 
A 1 636 GLU 636 636 636 GLU GLU A . n 
A 1 637 LEU 637 637 637 LEU LEU A . n 
A 1 638 SER 638 638 638 SER SER A . n 
A 1 639 GLN 639 639 639 GLN GLN A . n 
A 1 640 TRP 640 640 640 TRP TRP A . n 
A 1 641 SER 641 641 641 SER SER A . n 
A 1 642 SER 642 642 642 SER SER A . n 
A 1 643 THR 643 643 643 THR THR A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 TYR 645 645 645 TYR TYR A . n 
A 1 646 SER 646 646 646 SER SER A . n 
A 1 647 THR 647 647 647 THR THR A . n 
A 1 648 TRP 648 648 648 TRP TRP A . n 
A 1 649 THR 649 649 649 THR THR A . n 
A 1 650 GLU 650 650 650 GLU GLU A . n 
A 1 651 SER 651 651 651 SER SER A . n 
A 1 652 ARG 652 652 652 ARG ARG A . n 
A 1 653 TRP 653 653 653 TRP TRP A . n 
A 1 654 LYS 654 654 654 LYS LYS A . n 
A 1 655 ASP 655 655 655 ASP ASP A . n 
A 1 656 ILE 656 656 656 ILE ILE A . n 
A 1 657 ARG 657 657 657 ARG ARG A . n 
A 1 658 ALA 658 658 658 ALA ALA A . n 
A 1 659 ARG 659 659 659 ARG ARG A . n 
A 1 660 ILE 660 660 660 ILE ILE A . n 
A 1 661 PHE 661 661 661 PHE PHE A . n 
A 1 662 LEU 662 662 662 LEU LEU A . n 
A 1 663 ILE 663 663 663 ILE ILE A . n 
A 1 664 ALA 664 664 664 ALA ALA A . n 
A 1 665 SER 665 665 665 SER SER A . n 
A 1 666 LYS 666 666 666 LYS LYS A . n 
A 1 667 GLU 667 667 667 GLU GLU A . n 
A 1 668 LEU 668 668 668 LEU LEU A . n 
A 1 669 GLU 669 669 669 GLU GLU A . n 
A 1 670 LEU 670 670 670 LEU LEU A . n 
A 1 671 ILE 671 671 671 ILE ILE A . n 
A 1 672 THR 672 672 672 THR THR A . n 
A 1 673 LEU 673 673 673 LEU LEU A . n 
A 1 674 THR 674 674 674 THR THR A . n 
A 1 675 VAL 675 675 675 VAL VAL A . n 
A 1 676 GLY 676 676 676 GLY GLY A . n 
A 1 677 PHE 677 677 677 PHE PHE A . n 
A 1 678 GLY 678 678 678 GLY GLY A . n 
A 1 679 ILE 679 679 679 ILE ILE A . n 
A 1 680 LEU 680 680 680 LEU LEU A . n 
A 1 681 ILE 681 681 681 ILE ILE A . n 
A 1 682 PHE 682 682 682 PHE PHE A . n 
A 1 683 SER 683 683 683 SER SER A . n 
A 1 684 LEU 684 684 684 LEU LEU A . n 
A 1 685 ILE 685 685 685 ILE ILE A . n 
A 1 686 VAL 686 686 686 VAL VAL A . n 
A 1 687 THR 687 687 687 THR THR A . n 
A 1 688 TYR 688 688 688 TYR TYR A . n 
A 1 689 CYS 689 689 689 CYS CYS A . n 
A 1 690 ILE 690 690 690 ILE ILE A . n 
A 1 691 ASN 691 691 691 ASN ASN A . n 
A 1 692 ALA 692 692 692 ALA ALA A . n 
A 1 693 LYS 693 693 693 LYS LYS A . n 
A 1 694 ALA 694 694 694 ALA ALA A . n 
A 1 695 ASP 695 695 695 ASP ASP A . n 
A 1 696 VAL 696 696 696 VAL VAL A . n 
A 1 697 LEU 697 697 697 LEU LEU A . n 
A 1 698 PHE 698 698 698 PHE PHE A . n 
A 1 699 ILE 699 699 ?   ?   ?   A . n 
A 1 700 ALA 700 700 ?   ?   ?   A . n 
A 1 701 PRO 701 701 ?   ?   ?   A . n 
A 1 702 ARG 702 702 ?   ?   ?   A . n 
A 1 703 GLU 703 703 ?   ?   ?   A . n 
A 1 704 PRO 704 704 ?   ?   ?   A . n 
A 1 705 GLY 705 705 ?   ?   ?   A . n 
A 1 706 ALA 706 706 ?   ?   ?   A . n 
A 1 707 VAL 707 707 ?   ?   ?   A . n 
A 1 708 SER 708 708 ?   ?   ?   A . n 
A 1 709 TYR 709 709 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   THR 2   2   ?   ?   ?   B . n 
B 2 3   GLU 3   3   ?   ?   ?   B . n 
B 2 4   LEU 4   4   ?   ?   ?   B . n 
B 2 5   PRO 5   5   ?   ?   ?   B . n 
B 2 6   ALA 6   6   ?   ?   ?   B . n 
B 2 7   PRO 7   7   ?   ?   ?   B . n 
B 2 8   LEU 8   8   ?   ?   ?   B . n 
B 2 9   SER 9   9   ?   ?   ?   B . n 
B 2 10  TYR 10  10  ?   ?   ?   B . n 
B 2 11  PHE 11  11  ?   ?   ?   B . n 
B 2 12  GLN 12  12  ?   ?   ?   B . n 
B 2 13  ASN 13  13  ?   ?   ?   B . n 
B 2 14  ALA 14  14  ?   ?   ?   B . n 
B 2 15  GLN 15  15  ?   ?   ?   B . n 
B 2 16  MET 16  16  ?   ?   ?   B . n 
B 2 17  SER 17  17  ?   ?   ?   B . n 
B 2 18  GLU 18  18  ?   ?   ?   B . n 
B 2 19  ASP 19  19  ?   ?   ?   B . n 
B 2 20  ASN 20  20  ?   ?   ?   B . n 
B 2 21  HIS 21  21  ?   ?   ?   B . n 
B 2 22  LEU 22  22  ?   ?   ?   B . n 
B 2 23  SER 23  23  ?   ?   ?   B . n 
B 2 24  ASN 24  24  ?   ?   ?   B . n 
B 2 25  THR 25  25  ?   ?   ?   B . n 
B 2 26  VAL 26  26  ?   ?   ?   B . n 
B 2 27  ARG 27  27  ?   ?   ?   B . n 
B 2 28  SER 28  28  ?   ?   ?   B . n 
B 2 29  GLN 29  29  ?   ?   ?   B . n 
B 2 30  ASN 30  30  ?   ?   ?   B . n 
B 2 31  ASP 31  31  ?   ?   ?   B . n 
B 2 32  ASN 32  32  ?   ?   ?   B . n 
B 2 33  ARG 33  33  ?   ?   ?   B . n 
B 2 34  GLU 34  34  ?   ?   ?   B . n 
B 2 35  ARG 35  35  ?   ?   ?   B . n 
B 2 36  GLN 36  36  ?   ?   ?   B . n 
B 2 37  GLU 37  37  ?   ?   ?   B . n 
B 2 38  HIS 38  38  ?   ?   ?   B . n 
B 2 39  ASN 39  39  ?   ?   ?   B . n 
B 2 40  ASP 40  40  ?   ?   ?   B . n 
B 2 41  ARG 41  41  ?   ?   ?   B . n 
B 2 42  ARG 42  42  ?   ?   ?   B . n 
B 2 43  SER 43  43  ?   ?   ?   B . n 
B 2 44  LEU 44  44  ?   ?   ?   B . n 
B 2 45  GLY 45  45  ?   ?   ?   B . n 
B 2 46  HIS 46  46  ?   ?   ?   B . n 
B 2 47  PRO 47  47  ?   ?   ?   B . n 
B 2 48  GLU 48  48  ?   ?   ?   B . n 
B 2 49  PRO 49  49  ?   ?   ?   B . n 
B 2 50  LEU 50  50  ?   ?   ?   B . n 
B 2 51  SER 51  51  ?   ?   ?   B . n 
B 2 52  ASN 52  52  ?   ?   ?   B . n 
B 2 53  GLY 53  53  ?   ?   ?   B . n 
B 2 54  ARG 54  54  ?   ?   ?   B . n 
B 2 55  PRO 55  55  ?   ?   ?   B . n 
B 2 56  GLN 56  56  ?   ?   ?   B . n 
B 2 57  GLY 57  57  ?   ?   ?   B . n 
B 2 58  ASN 58  58  ?   ?   ?   B . n 
B 2 59  SER 59  59  ?   ?   ?   B . n 
B 2 60  ARG 60  60  ?   ?   ?   B . n 
B 2 61  GLN 61  61  ?   ?   ?   B . n 
B 2 62  VAL 62  62  ?   ?   ?   B . n 
B 2 63  VAL 63  63  ?   ?   ?   B . n 
B 2 64  GLU 64  64  ?   ?   ?   B . n 
B 2 65  GLN 65  65  ?   ?   ?   B . n 
B 2 66  ASP 66  66  ?   ?   ?   B . n 
B 2 67  GLU 67  67  ?   ?   ?   B . n 
B 2 68  GLU 68  68  ?   ?   ?   B . n 
B 2 69  GLU 69  69  ?   ?   ?   B . n 
B 2 70  ASP 70  70  ?   ?   ?   B . n 
B 2 71  GLU 71  71  ?   ?   ?   B . n 
B 2 72  GLU 72  72  ?   ?   ?   B . n 
B 2 73  LEU 73  73  ?   ?   ?   B . n 
B 2 74  THR 74  74  ?   ?   ?   B . n 
B 2 75  LEU 75  75  ?   ?   ?   B . n 
B 2 76  LYS 76  76  ?   ?   ?   B . n 
B 2 77  TYR 77  77  ?   ?   ?   B . n 
B 2 78  GLY 78  78  78  GLY GLY B . n 
B 2 79  ALA 79  79  79  ALA ALA B . n 
B 2 80  LYS 80  80  80  LYS LYS B . n 
B 2 81  HIS 81  81  81  HIS HIS B . n 
B 2 82  VAL 82  82  82  VAL VAL B . n 
B 2 83  ILE 83  83  83  ILE ILE B . n 
B 2 84  MET 84  84  84  MET MET B . n 
B 2 85  LEU 85  85  85  LEU LEU B . n 
B 2 86  PHE 86  86  86  PHE PHE B . n 
B 2 87  VAL 87  87  87  VAL VAL B . n 
B 2 88  PRO 88  88  88  PRO PRO B . n 
B 2 89  VAL 89  89  89  VAL VAL B . n 
B 2 90  THR 90  90  90  THR THR B . n 
B 2 91  LEU 91  91  91  LEU LEU B . n 
B 2 92  CYS 92  92  92  CYS CYS B . n 
B 2 93  MET 93  93  93  MET MET B . n 
B 2 94  VAL 94  94  94  VAL VAL B . n 
B 2 95  VAL 95  95  95  VAL VAL B . n 
B 2 96  VAL 96  96  96  VAL VAL B . n 
B 2 97  VAL 97  97  97  VAL VAL B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  THR 99  99  99  THR THR B . n 
B 2 100 ILE 100 100 100 ILE ILE B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 SER 102 102 102 SER SER B . n 
B 2 103 VAL 103 103 103 VAL VAL B . n 
B 2 104 SER 104 104 104 SER SER B . n 
B 2 105 PHE 105 105 105 PHE PHE B . n 
B 2 106 TYR 106 106 106 TYR TYR B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 ARG 108 108 108 ARG ARG B . n 
B 2 109 LYS 109 109 ?   ?   ?   B . n 
B 2 110 ASP 110 110 ?   ?   ?   B . n 
B 2 111 GLY 111 111 ?   ?   ?   B . n 
B 2 112 GLN 112 112 ?   ?   ?   B . n 
B 2 113 LEU 113 113 ?   ?   ?   B . n 
B 2 114 ILE 114 114 ?   ?   ?   B . n 
B 2 115 TYR 115 115 ?   ?   ?   B . n 
B 2 116 THR 116 116 ?   ?   ?   B . n 
B 2 117 PRO 117 117 ?   ?   ?   B . n 
B 2 118 PHE 118 118 ?   ?   ?   B . n 
B 2 119 THR 119 119 ?   ?   ?   B . n 
B 2 120 GLU 120 120 ?   ?   ?   B . n 
B 2 121 ASP 121 121 ?   ?   ?   B . n 
B 2 122 THR 122 122 ?   ?   ?   B . n 
B 2 123 GLU 123 123 ?   ?   ?   B . n 
B 2 124 THR 124 124 ?   ?   ?   B . n 
B 2 125 VAL 125 125 ?   ?   ?   B . n 
B 2 126 GLY 126 126 ?   ?   ?   B . n 
B 2 127 GLN 127 127 ?   ?   ?   B . n 
B 2 128 ARG 128 128 ?   ?   ?   B . n 
B 2 129 ALA 129 129 ?   ?   ?   B . n 
B 2 130 LEU 130 130 ?   ?   ?   B . n 
B 2 131 HIS 131 131 ?   ?   ?   B . n 
B 2 132 SER 132 132 ?   ?   ?   B . n 
B 2 133 ILE 133 133 ?   ?   ?   B . n 
B 2 134 LEU 134 134 ?   ?   ?   B . n 
B 2 135 ASN 135 135 ?   ?   ?   B . n 
B 2 136 ALA 136 136 ?   ?   ?   B . n 
B 2 137 ALA 137 137 ?   ?   ?   B . n 
B 2 138 ILE 138 138 ?   ?   ?   B . n 
B 2 139 MET 139 139 ?   ?   ?   B . n 
B 2 140 ILE 140 140 ?   ?   ?   B . n 
B 2 141 SER 141 141 ?   ?   ?   B . n 
B 2 142 VAL 142 142 ?   ?   ?   B . n 
B 2 143 ILE 143 143 ?   ?   ?   B . n 
B 2 144 VAL 144 144 ?   ?   ?   B . n 
B 2 145 VAL 145 145 ?   ?   ?   B . n 
B 2 146 MET 146 146 ?   ?   ?   B . n 
B 2 147 THR 147 147 ?   ?   ?   B . n 
B 2 148 ILE 148 148 ?   ?   ?   B . n 
B 2 149 LEU 149 149 ?   ?   ?   B . n 
B 2 150 LEU 150 150 ?   ?   ?   B . n 
B 2 151 VAL 151 151 ?   ?   ?   B . n 
B 2 152 VAL 152 152 ?   ?   ?   B . n 
B 2 153 LEU 153 153 ?   ?   ?   B . n 
B 2 154 TYR 154 154 ?   ?   ?   B . n 
B 2 155 LYS 155 155 ?   ?   ?   B . n 
B 2 156 TYR 156 156 ?   ?   ?   B . n 
B 2 157 ARG 157 157 ?   ?   ?   B . n 
B 2 158 CYS 158 158 ?   ?   ?   B . n 
B 2 159 TYR 159 159 ?   ?   ?   B . n 
B 2 160 LYS 160 160 ?   ?   ?   B . n 
B 2 161 VAL 161 161 ?   ?   ?   B . n 
B 2 162 ILE 162 162 ?   ?   ?   B . n 
B 2 163 HIS 163 163 ?   ?   ?   B . n 
B 2 164 ALA 164 164 ?   ?   ?   B . n 
B 2 165 TRP 165 165 ?   ?   ?   B . n 
B 2 166 LEU 166 166 ?   ?   ?   B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 ILE 168 168 168 ILE ILE B . n 
B 2 169 SER 169 169 169 SER SER B . n 
B 2 170 SER 170 170 170 SER SER B . n 
B 2 171 LEU 171 171 171 LEU LEU B . n 
B 2 172 LEU 172 172 172 LEU LEU B . n 
B 2 173 LEU 173 173 173 LEU LEU B . n 
B 2 174 LEU 174 174 174 LEU LEU B . n 
B 2 175 PHE 175 175 175 PHE PHE B . n 
B 2 176 PHE 176 176 176 PHE PHE B . n 
B 2 177 PHE 177 177 177 PHE PHE B . n 
B 2 178 SER 178 178 178 SER SER B . n 
B 2 179 PHE 179 179 179 PHE PHE B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 TYR 181 181 181 TYR TYR B . n 
B 2 182 LEU 182 182 182 LEU LEU B . n 
B 2 183 GLY 183 183 183 GLY GLY B . n 
B 2 184 GLU 184 184 184 GLU GLU B . n 
B 2 185 VAL 185 185 185 VAL VAL B . n 
B 2 186 PHE 186 186 186 PHE PHE B . n 
B 2 187 LYS 187 187 187 LYS LYS B . n 
B 2 188 THR 188 188 188 THR THR B . n 
B 2 189 TYR 189 189 189 TYR TYR B . n 
B 2 190 ASN 190 190 190 ASN ASN B . n 
B 2 191 VAL 191 191 191 VAL VAL B . n 
B 2 192 ALA 192 192 192 ALA ALA B . n 
B 2 193 VAL 193 193 193 VAL VAL B . n 
B 2 194 ASP 194 194 194 ASP ASP B . n 
B 2 195 TYR 195 195 195 TYR TYR B . n 
B 2 196 ILE 196 196 196 ILE ILE B . n 
B 2 197 THR 197 197 197 THR THR B . n 
B 2 198 VAL 198 198 198 VAL VAL B . n 
B 2 199 ALA 199 199 199 ALA ALA B . n 
B 2 200 LEU 200 200 200 LEU LEU B . n 
B 2 201 LEU 201 201 201 LEU LEU B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 TRP 203 203 203 TRP TRP B . n 
B 2 204 ASN 204 204 204 ASN ASN B . n 
B 2 205 PHE 205 205 205 PHE PHE B . n 
B 2 206 GLY 206 206 206 GLY GLY B . n 
B 2 207 VAL 207 207 207 VAL VAL B . n 
B 2 208 VAL 208 208 208 VAL VAL B . n 
B 2 209 GLY 209 209 209 GLY GLY B . n 
B 2 210 MET 210 210 210 MET MET B . n 
B 2 211 ILE 211 211 211 ILE ILE B . n 
B 2 212 SER 212 212 212 SER SER B . n 
B 2 213 ILE 213 213 213 ILE ILE B . n 
B 2 214 HIS 214 214 214 HIS HIS B . n 
B 2 215 TRP 215 215 215 TRP TRP B . n 
B 2 216 LYS 216 216 216 LYS LYS B . n 
B 2 217 GLY 217 217 217 GLY GLY B . n 
B 2 218 PRO 218 218 218 PRO PRO B . n 
B 2 219 LEU 219 219 219 LEU LEU B . n 
B 2 220 ARG 220 220 220 ARG ARG B . n 
B 2 221 LEU 221 221 221 LEU LEU B . n 
B 2 222 GLN 222 222 222 GLN GLN B . n 
B 2 223 GLN 223 223 223 GLN GLN B . n 
B 2 224 ALA 224 224 224 ALA ALA B . n 
B 2 225 TYR 225 225 225 TYR TYR B . n 
B 2 226 LEU 226 226 226 LEU LEU B . n 
B 2 227 ILE 227 227 227 ILE ILE B . n 
B 2 228 MET 228 228 228 MET MET B . n 
B 2 229 ILE 229 229 229 ILE ILE B . n 
B 2 230 SER 230 230 230 SER SER B . n 
B 2 231 ALA 231 231 231 ALA ALA B . n 
B 2 232 LEU 232 232 232 LEU LEU B . n 
B 2 233 MET 233 233 233 MET MET B . n 
B 2 234 ALA 234 234 234 ALA ALA B . n 
B 2 235 LEU 235 235 235 LEU LEU B . n 
B 2 236 VAL 236 236 236 VAL VAL B . n 
B 2 237 PHE 237 237 237 PHE PHE B . n 
B 2 238 ILE 238 238 238 ILE ILE B . n 
B 2 239 LYS 239 239 239 LYS LYS B . n 
B 2 240 TYR 240 240 240 TYR TYR B . n 
B 2 241 LEU 241 241 241 LEU LEU B . n 
B 2 242 PRO 242 242 242 PRO PRO B . n 
B 2 243 GLU 243 243 243 GLU GLU B . n 
B 2 244 TRP 244 244 244 TRP TRP B . n 
B 2 245 THR 245 245 245 THR THR B . n 
B 2 246 ALA 246 246 246 ALA ALA B . n 
B 2 247 TRP 247 247 247 TRP TRP B . n 
B 2 248 LEU 248 248 248 LEU LEU B . n 
B 2 249 ILE 249 249 249 ILE ILE B . n 
B 2 250 LEU 250 250 250 LEU LEU B . n 
B 2 251 ALA 251 251 251 ALA ALA B . n 
B 2 252 VAL 252 252 252 VAL VAL B . n 
B 2 253 ILE 253 253 253 ILE ILE B . n 
B 2 254 SER 254 254 254 SER SER B . n 
B 2 255 VAL 255 255 255 VAL VAL B . n 
B 2 256 TYR 256 256 256 TYR TYR B . n 
B 2 257 ASP 257 257 257 ASP ASP B . n 
B 2 258 LEU 258 258 258 LEU LEU B . n 
B 2 259 VAL 259 259 259 VAL VAL B . n 
B 2 260 ALA 260 260 260 ALA ALA B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 LEU 262 262 ?   ?   ?   B . n 
B 2 263 CYS 263 263 ?   ?   ?   B . n 
B 2 264 PRO 264 264 ?   ?   ?   B . n 
B 2 265 LYS 265 265 ?   ?   ?   B . n 
B 2 266 GLY 266 266 ?   ?   ?   B . n 
B 2 267 PRO 267 267 ?   ?   ?   B . n 
B 2 268 LEU 268 268 ?   ?   ?   B . n 
B 2 269 ARG 269 269 ?   ?   ?   B . n 
B 2 270 MET 270 270 ?   ?   ?   B . n 
B 2 271 LEU 271 271 ?   ?   ?   B . n 
B 2 272 VAL 272 272 ?   ?   ?   B . n 
B 2 273 GLU 273 273 ?   ?   ?   B . n 
B 2 274 THR 274 274 ?   ?   ?   B . n 
B 2 275 ALA 275 275 ?   ?   ?   B . n 
B 2 276 GLN 276 276 ?   ?   ?   B . n 
B 2 277 GLU 277 277 ?   ?   ?   B . n 
B 2 278 ARG 278 278 ?   ?   ?   B . n 
B 2 279 ASN 279 279 ?   ?   ?   B . n 
B 2 280 GLU 280 280 ?   ?   ?   B . n 
B 2 281 THR 281 281 ?   ?   ?   B . n 
B 2 282 LEU 282 282 ?   ?   ?   B . n 
B 2 283 PHE 283 283 ?   ?   ?   B . n 
B 2 284 PRO 284 284 ?   ?   ?   B . n 
B 2 285 ALA 285 285 ?   ?   ?   B . n 
B 2 286 LEU 286 286 ?   ?   ?   B . n 
B 2 287 ILE 287 287 ?   ?   ?   B . n 
B 2 288 TYR 288 288 ?   ?   ?   B . n 
B 2 289 SER 289 289 ?   ?   ?   B . n 
B 2 290 SER 290 290 ?   ?   ?   B . n 
B 2 291 THR 291 291 ?   ?   ?   B . n 
B 2 292 MET 292 292 ?   ?   ?   B . n 
B 2 293 VAL 293 293 ?   ?   ?   B . n 
B 2 294 TRP 294 294 ?   ?   ?   B . n 
B 2 295 LEU 295 295 ?   ?   ?   B . n 
B 2 296 VAL 296 296 ?   ?   ?   B . n 
B 2 297 ASN 297 297 ?   ?   ?   B . n 
B 2 298 MET 298 298 ?   ?   ?   B . n 
B 2 299 ALA 299 299 ?   ?   ?   B . n 
B 2 300 GLU 300 300 ?   ?   ?   B . n 
B 2 301 GLY 301 301 ?   ?   ?   B . n 
B 2 302 ASP 302 302 ?   ?   ?   B . n 
B 2 303 PRO 303 303 ?   ?   ?   B . n 
B 2 304 GLU 304 304 ?   ?   ?   B . n 
B 2 305 ALA 305 305 ?   ?   ?   B . n 
B 2 306 GLN 306 306 ?   ?   ?   B . n 
B 2 307 ARG 307 307 ?   ?   ?   B . n 
B 2 308 ARG 308 308 ?   ?   ?   B . n 
B 2 309 VAL 309 309 ?   ?   ?   B . n 
B 2 310 SER 310 310 ?   ?   ?   B . n 
B 2 311 LYS 311 311 ?   ?   ?   B . n 
B 2 312 ASN 312 312 ?   ?   ?   B . n 
B 2 313 SER 313 313 ?   ?   ?   B . n 
B 2 314 LYS 314 314 ?   ?   ?   B . n 
B 2 315 TYR 315 315 ?   ?   ?   B . n 
B 2 316 ASN 316 316 ?   ?   ?   B . n 
B 2 317 ALA 317 317 ?   ?   ?   B . n 
B 2 318 GLU 318 318 ?   ?   ?   B . n 
B 2 319 SER 319 319 ?   ?   ?   B . n 
B 2 320 THR 320 320 ?   ?   ?   B . n 
B 2 321 GLU 321 321 ?   ?   ?   B . n 
B 2 322 ARG 322 322 ?   ?   ?   B . n 
B 2 323 GLU 323 323 ?   ?   ?   B . n 
B 2 324 SER 324 324 ?   ?   ?   B . n 
B 2 325 GLN 325 325 ?   ?   ?   B . n 
B 2 326 ASP 326 326 ?   ?   ?   B . n 
B 2 327 THR 327 327 ?   ?   ?   B . n 
B 2 328 VAL 328 328 ?   ?   ?   B . n 
B 2 329 ALA 329 329 ?   ?   ?   B . n 
B 2 330 GLU 330 330 ?   ?   ?   B . n 
B 2 331 ASN 331 331 ?   ?   ?   B . n 
B 2 332 ASP 332 332 ?   ?   ?   B . n 
B 2 333 ASP 333 333 ?   ?   ?   B . n 
B 2 334 GLY 334 334 ?   ?   ?   B . n 
B 2 335 GLY 335 335 ?   ?   ?   B . n 
B 2 336 PHE 336 336 ?   ?   ?   B . n 
B 2 337 SER 337 337 ?   ?   ?   B . n 
B 2 338 GLU 338 338 ?   ?   ?   B . n 
B 2 339 GLU 339 339 ?   ?   ?   B . n 
B 2 340 TRP 340 340 ?   ?   ?   B . n 
B 2 341 GLU 341 341 ?   ?   ?   B . n 
B 2 342 ALA 342 342 ?   ?   ?   B . n 
B 2 343 GLN 343 343 ?   ?   ?   B . n 
B 2 344 ARG 344 344 ?   ?   ?   B . n 
B 2 345 ASP 345 345 ?   ?   ?   B . n 
B 2 346 SER 346 346 ?   ?   ?   B . n 
B 2 347 HIS 347 347 ?   ?   ?   B . n 
B 2 348 LEU 348 348 ?   ?   ?   B . n 
B 2 349 GLY 349 349 ?   ?   ?   B . n 
B 2 350 PRO 350 350 ?   ?   ?   B . n 
B 2 351 HIS 351 351 ?   ?   ?   B . n 
B 2 352 ARG 352 352 ?   ?   ?   B . n 
B 2 353 SER 353 353 ?   ?   ?   B . n 
B 2 354 THR 354 354 ?   ?   ?   B . n 
B 2 355 PRO 355 355 ?   ?   ?   B . n 
B 2 356 GLU 356 356 ?   ?   ?   B . n 
B 2 357 SER 357 357 ?   ?   ?   B . n 
B 2 358 ARG 358 358 ?   ?   ?   B . n 
B 2 359 ALA 359 359 ?   ?   ?   B . n 
B 2 360 ALA 360 360 ?   ?   ?   B . n 
B 2 361 VAL 361 361 ?   ?   ?   B . n 
B 2 362 GLN 362 362 ?   ?   ?   B . n 
B 2 363 GLU 363 363 ?   ?   ?   B . n 
B 2 364 LEU 364 364 ?   ?   ?   B . n 
B 2 365 SER 365 365 ?   ?   ?   B . n 
B 2 366 SER 366 366 ?   ?   ?   B . n 
B 2 367 SER 367 367 ?   ?   ?   B . n 
B 2 368 ILE 368 368 ?   ?   ?   B . n 
B 2 369 LEU 369 369 ?   ?   ?   B . n 
B 2 370 ALA 370 370 ?   ?   ?   B . n 
B 2 371 GLY 371 371 ?   ?   ?   B . n 
B 2 372 GLU 372 372 ?   ?   ?   B . n 
B 2 373 ASP 373 373 ?   ?   ?   B . n 
B 2 374 PRO 374 374 ?   ?   ?   B . n 
B 2 375 GLU 375 375 ?   ?   ?   B . n 
B 2 376 GLU 376 376 ?   ?   ?   B . n 
B 2 377 ARG 377 377 ?   ?   ?   B . n 
B 2 378 GLY 378 378 ?   ?   ?   B . n 
B 2 379 VAL 379 379 379 VAL VAL B . n 
B 2 380 LYS 380 380 380 LYS LYS B . n 
B 2 381 LEU 381 381 381 LEU LEU B . n 
B 2 382 GLY 382 382 382 GLY GLY B . n 
B 2 383 LEU 383 383 383 LEU LEU B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 ASP 385 385 385 ASP ASP B . n 
B 2 386 PHE 386 386 386 PHE PHE B . n 
B 2 387 ILE 387 387 387 ILE ILE B . n 
B 2 388 PHE 388 388 388 PHE PHE B . n 
B 2 389 TYR 389 389 389 TYR TYR B . n 
B 2 390 SER 390 390 390 SER SER B . n 
B 2 391 VAL 391 391 391 VAL VAL B . n 
B 2 392 LEU 392 392 392 LEU LEU B . n 
B 2 393 VAL 393 393 393 VAL VAL B . n 
B 2 394 GLY 394 394 394 GLY GLY B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 ALA 396 396 396 ALA ALA B . n 
B 2 397 SER 397 397 397 SER SER B . n 
B 2 398 ALA 398 398 398 ALA ALA B . n 
B 2 399 THR 399 399 399 THR THR B . n 
B 2 400 ALA 400 400 400 ALA ALA B . n 
B 2 401 SER 401 401 401 SER SER B . n 
B 2 402 GLY 402 402 402 GLY GLY B . n 
B 2 403 ASP 403 403 403 ASP ASP B . n 
B 2 404 TRP 404 404 404 TRP TRP B . n 
B 2 405 ASN 405 405 405 ASN ASN B . n 
B 2 406 THR 406 406 406 THR THR B . n 
B 2 407 THR 407 407 407 THR THR B . n 
B 2 408 ILE 408 408 408 ILE ILE B . n 
B 2 409 ALA 409 409 409 ALA ALA B . n 
B 2 410 CYS 410 410 410 CYS CYS B . n 
B 2 411 PHE 411 411 411 PHE PHE B . n 
B 2 412 VAL 412 412 412 VAL VAL B . n 
B 2 413 ALA 413 413 413 ALA ALA B . n 
B 2 414 ILE 414 414 414 ILE ILE B . n 
B 2 415 LEU 415 415 415 LEU LEU B . n 
B 2 416 ILE 416 416 416 ILE ILE B . n 
B 2 417 GLY 417 417 417 GLY GLY B . n 
B 2 418 LEU 418 418 418 LEU LEU B . n 
B 2 419 CYS 419 419 419 CYS CYS B . n 
B 2 420 LEU 420 420 420 LEU LEU B . n 
B 2 421 THR 421 421 421 THR THR B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 LEU 423 423 423 LEU LEU B . n 
B 2 424 LEU 424 424 424 LEU LEU B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 ALA 426 426 426 ALA ALA B . n 
B 2 427 ILE 427 427 427 ILE ILE B . n 
B 2 428 PHE 428 428 428 PHE PHE B . n 
B 2 429 LYS 429 429 429 LYS LYS B . n 
B 2 430 LYS 430 430 430 LYS LYS B . n 
B 2 431 ALA 431 431 431 ALA ALA B . n 
B 2 432 LEU 432 432 432 LEU LEU B . n 
B 2 433 PRO 433 433 433 PRO PRO B . n 
B 2 434 ALA 434 434 434 ALA ALA B . n 
B 2 435 LEU 435 435 435 LEU LEU B . n 
B 2 436 PRO 436 436 436 PRO PRO B . n 
B 2 437 ILE 437 437 437 ILE ILE B . n 
B 2 438 SER 438 438 438 SER SER B . n 
B 2 439 ILE 439 439 439 ILE ILE B . n 
B 2 440 THR 440 440 440 THR THR B . n 
B 2 441 PHE 441 441 441 PHE PHE B . n 
B 2 442 GLY 442 442 442 GLY GLY B . n 
B 2 443 LEU 443 443 443 LEU LEU B . n 
B 2 444 VAL 444 444 444 VAL VAL B . n 
B 2 445 PHE 445 445 445 PHE PHE B . n 
B 2 446 TYR 446 446 446 TYR TYR B . n 
B 2 447 PHE 447 447 447 PHE PHE B . n 
B 2 448 ALA 448 448 448 ALA ALA B . n 
B 2 449 THR 449 449 449 THR THR B . n 
B 2 450 ASP 450 450 450 ASP ASP B . n 
B 2 451 TYR 451 451 451 TYR TYR B . n 
B 2 452 LEU 452 452 452 LEU LEU B . n 
B 2 453 VAL 453 453 453 VAL VAL B . n 
B 2 454 GLN 454 454 454 GLN GLN B . n 
B 2 455 PRO 455 455 455 PRO PRO B . n 
B 2 456 PHE 456 456 456 PHE PHE B . n 
B 2 457 MET 457 457 457 MET MET B . n 
B 2 458 ASP 458 458 458 ASP ASP B . n 
B 2 459 GLN 459 459 459 GLN GLN B . n 
B 2 460 LEU 460 460 460 LEU LEU B . n 
B 2 461 ALA 461 461 461 ALA ALA B . n 
B 2 462 PHE 462 462 462 PHE PHE B . n 
B 2 463 HIS 463 463 463 HIS HIS B . n 
B 2 464 GLN 464 464 464 GLN GLN B . n 
B 2 465 PHE 465 465 465 PHE PHE B . n 
B 2 466 TYR 466 466 466 TYR TYR B . n 
B 2 467 ILE 467 467 467 ILE ILE B . n 
C 3 1   MET 1   1   ?   ?   ?   C . n 
C 3 2   GLY 2   2   2   GLY GLY C . n 
C 3 3   ALA 3   3   3   ALA ALA C . n 
C 3 4   ALA 4   4   4   ALA ALA C . n 
C 3 5   VAL 5   5   5   VAL VAL C . n 
C 3 6   PHE 6   6   6   PHE PHE C . n 
C 3 7   PHE 7   7   7   PHE PHE C . n 
C 3 8   GLY 8   8   8   GLY GLY C . n 
C 3 9   CYS 9   9   9   CYS CYS C . n 
C 3 10  THR 10  10  10  THR THR C . n 
C 3 11  PHE 11  11  11  PHE PHE C . n 
C 3 12  VAL 12  12  12  VAL VAL C . n 
C 3 13  ALA 13  13  13  ALA ALA C . n 
C 3 14  PHE 14  14  14  PHE PHE C . n 
C 3 15  GLY 15  15  15  GLY GLY C . n 
C 3 16  PRO 16  16  16  PRO PRO C . n 
C 3 17  ALA 17  17  17  ALA ALA C . n 
C 3 18  PHE 18  18  18  PHE PHE C . n 
C 3 19  ALA 19  19  19  ALA ALA C . n 
C 3 20  LEU 20  20  20  LEU LEU C . n 
C 3 21  PHE 21  21  21  PHE PHE C . n 
C 3 22  LEU 22  22  22  LEU LEU C . n 
C 3 23  ILE 23  23  23  ILE ILE C . n 
C 3 24  THR 24  24  24  THR THR C . n 
C 3 25  VAL 25  25  25  VAL VAL C . n 
C 3 26  ALA 26  26  26  ALA ALA C . n 
C 3 27  GLY 27  27  27  GLY GLY C . n 
C 3 28  ASP 28  28  28  ASP ASP C . n 
C 3 29  PRO 29  29  29  PRO PRO C . n 
C 3 30  LEU 30  30  30  LEU LEU C . n 
C 3 31  ARG 31  31  31  ARG ARG C . n 
C 3 32  VAL 32  32  32  VAL VAL C . n 
C 3 33  ILE 33  33  33  ILE ILE C . n 
C 3 34  ILE 34  34  34  ILE ILE C . n 
C 3 35  LEU 35  35  35  LEU LEU C . n 
C 3 36  VAL 36  36  36  VAL VAL C . n 
C 3 37  ALA 37  37  37  ALA ALA C . n 
C 3 38  GLY 38  38  38  GLY GLY C . n 
C 3 39  ALA 39  39  39  ALA ALA C . n 
C 3 40  PHE 40  40  40  PHE PHE C . n 
C 3 41  PHE 41  41  41  PHE PHE C . n 
C 3 42  TRP 42  42  42  TRP TRP C . n 
C 3 43  LEU 43  43  43  LEU LEU C . n 
C 3 44  VAL 44  44  44  VAL VAL C . n 
C 3 45  SER 45  45  45  SER SER C . n 
C 3 46  LEU 46  46  46  LEU LEU C . n 
C 3 47  LEU 47  47  47  LEU LEU C . n 
C 3 48  LEU 48  48  48  LEU LEU C . n 
C 3 49  ALA 49  49  49  ALA ALA C . n 
C 3 50  SER 50  50  50  SER SER C . n 
C 3 51  VAL 51  51  51  VAL VAL C . n 
C 3 52  VAL 52  52  52  VAL VAL C . n 
C 3 53  TRP 53  53  53  TRP TRP C . n 
C 3 54  PHE 54  54  54  PHE PHE C . n 
C 3 55  ILE 55  55  55  ILE ILE C . n 
C 3 56  LEU 56  56  56  LEU LEU C . n 
C 3 57  VAL 57  57  57  VAL VAL C . n 
C 3 58  HIS 58  58  58  HIS HIS C . n 
C 3 59  VAL 59  59  59  VAL VAL C . n 
C 3 60  THR 60  60  60  THR THR C . n 
C 3 61  ASP 61  61  61  ASP ASP C . n 
C 3 62  ARG 62  62  62  ARG ARG C . n 
C 3 63  SER 63  63  63  SER SER C . n 
C 3 64  ASP 64  64  64  ASP ASP C . n 
C 3 65  ALA 65  65  65  ALA ALA C . n 
C 3 66  ARG 66  66  66  ARG ARG C . n 
C 3 67  LEU 67  67  67  LEU LEU C . n 
C 3 68  GLN 68  68  68  GLN GLN C . n 
C 3 69  TYR 69  69  69  TYR TYR C . n 
C 3 70  GLY 70  70  70  GLY GLY C . n 
C 3 71  LEU 71  71  71  LEU LEU C . n 
C 3 72  LEU 72  72  72  LEU LEU C . n 
C 3 73  ILE 73  73  73  ILE ILE C . n 
C 3 74  PHE 74  74  74  PHE PHE C . n 
C 3 75  GLY 75  75  75  GLY GLY C . n 
C 3 76  ALA 76  76  76  ALA ALA C . n 
C 3 77  ALA 77  77  77  ALA ALA C . n 
C 3 78  VAL 78  78  78  VAL VAL C . n 
C 3 79  SER 79  79  79  SER SER C . n 
C 3 80  VAL 80  80  80  VAL VAL C . n 
C 3 81  LEU 81  81  81  LEU LEU C . n 
C 3 82  LEU 82  82  82  LEU LEU C . n 
C 3 83  GLN 83  83  83  GLN GLN C . n 
C 3 84  GLU 84  84  84  GLU GLU C . n 
C 3 85  VAL 85  85  85  VAL VAL C . n 
C 3 86  PHE 86  86  86  PHE PHE C . n 
C 3 87  ARG 87  87  87  ARG ARG C . n 
C 3 88  PHE 88  88  88  PHE PHE C . n 
C 3 89  ALA 89  89  89  ALA ALA C . n 
C 3 90  TYR 90  90  90  TYR TYR C . n 
C 3 91  TYR 91  91  91  TYR TYR C . n 
C 3 92  LYS 92  92  92  LYS LYS C . n 
C 3 93  LEU 93  93  93  LEU LEU C . n 
C 3 94  LEU 94  94  94  LEU LEU C . n 
C 3 95  LYS 95  95  95  LYS LYS C . n 
C 3 96  LYS 96  96  96  LYS LYS C . n 
C 3 97  ALA 97  97  97  ALA ALA C . n 
C 3 98  ASP 98  98  98  ASP ASP C . n 
C 3 99  GLU 99  99  99  GLU GLU C . n 
C 3 100 GLY 100 100 100 GLY GLY C . n 
C 3 101 LEU 101 101 101 LEU LEU C . n 
C 3 102 ALA 102 102 102 ALA ALA C . n 
C 3 103 SER 103 103 103 SER SER C . n 
C 3 104 LEU 104 104 104 LEU LEU C . n 
C 3 105 SER 105 105 105 SER SER C . n 
C 3 106 GLU 106 106 106 GLU GLU C . n 
C 3 107 ASP 107 107 107 ASP ASP C . n 
C 3 108 GLY 108 108 108 GLY GLY C . n 
C 3 109 ARG 109 109 109 ARG ARG C . n 
C 3 110 SER 110 110 110 SER SER C . n 
C 3 111 PRO 111 111 111 PRO PRO C . n 
C 3 112 ILE 112 112 112 ILE ILE C . n 
C 3 113 SER 113 113 113 SER SER C . n 
C 3 114 ILE 114 114 114 ILE ILE C . n 
C 3 115 ARG 115 115 115 ARG ARG C . n 
C 3 116 GLN 116 116 116 GLN GLN C . n 
C 3 117 MET 117 117 117 MET MET C . n 
C 3 118 ALA 118 118 118 ALA ALA C . n 
C 3 119 TYR 119 119 119 TYR TYR C . n 
C 3 120 VAL 120 120 120 VAL VAL C . n 
C 3 121 SER 121 121 121 SER SER C . n 
C 3 122 GLY 122 122 122 GLY GLY C . n 
C 3 123 LEU 123 123 123 LEU LEU C . n 
C 3 124 SER 124 124 124 SER SER C . n 
C 3 125 PHE 125 125 125 PHE PHE C . n 
C 3 126 GLY 126 126 126 GLY GLY C . n 
C 3 127 ILE 127 127 127 ILE ILE C . n 
C 3 128 ILE 128 128 128 ILE ILE C . n 
C 3 129 SER 129 129 129 SER SER C . n 
C 3 130 GLY 130 130 130 GLY GLY C . n 
C 3 131 VAL 131 131 131 VAL VAL C . n 
C 3 132 PHE 132 132 132 PHE PHE C . n 
C 3 133 SER 133 133 133 SER SER C . n 
C 3 134 VAL 134 134 134 VAL VAL C . n 
C 3 135 ILE 135 135 135 ILE ILE C . n 
C 3 136 ASN 136 136 136 ASN ASN C . n 
C 3 137 ILE 137 137 137 ILE ILE C . n 
C 3 138 LEU 138 138 138 LEU LEU C . n 
C 3 139 ALA 139 139 139 ALA ALA C . n 
C 3 140 ASP 140 140 140 ASP ASP C . n 
C 3 141 ALA 141 141 141 ALA ALA C . n 
C 3 142 LEU 142 142 142 LEU LEU C . n 
C 3 143 GLY 143 143 143 GLY GLY C . n 
C 3 144 PRO 144 144 144 PRO PRO C . n 
C 3 145 GLY 145 145 145 GLY GLY C . n 
C 3 146 VAL 146 146 146 VAL VAL C . n 
C 3 147 VAL 147 147 147 VAL VAL C . n 
C 3 148 GLY 148 148 148 GLY GLY C . n 
C 3 149 ILE 149 149 149 ILE ILE C . n 
C 3 150 HIS 150 150 150 HIS HIS C . n 
C 3 151 GLY 151 151 151 GLY GLY C . n 
C 3 152 ASP 152 152 152 ASP ASP C . n 
C 3 153 SER 153 153 153 SER SER C . n 
C 3 154 PRO 154 154 154 PRO PRO C . n 
C 3 155 TYR 155 155 155 TYR TYR C . n 
C 3 156 TYR 156 156 156 TYR TYR C . n 
C 3 157 PHE 157 157 157 PHE PHE C . n 
C 3 158 LEU 158 158 158 LEU LEU C . n 
C 3 159 THR 159 159 159 THR THR C . n 
C 3 160 SER 160 160 160 SER SER C . n 
C 3 161 ALA 161 161 161 ALA ALA C . n 
C 3 162 PHE 162 162 162 PHE PHE C . n 
C 3 163 LEU 163 163 163 LEU LEU C . n 
C 3 164 THR 164 164 164 THR THR C . n 
C 3 165 ALA 165 165 165 ALA ALA C . n 
C 3 166 ALA 166 166 166 ALA ALA C . n 
C 3 167 ILE 167 167 167 ILE ILE C . n 
C 3 168 ILE 168 168 168 ILE ILE C . n 
C 3 169 LEU 169 169 169 LEU LEU C . n 
C 3 170 LEU 170 170 170 LEU LEU C . n 
C 3 171 HIS 171 171 171 HIS HIS C . n 
C 3 172 THR 172 172 172 THR THR C . n 
C 3 173 PHE 173 173 173 PHE PHE C . n 
C 3 174 TRP 174 174 174 TRP TRP C . n 
C 3 175 GLY 175 175 175 GLY GLY C . n 
C 3 176 VAL 176 176 176 VAL VAL C . n 
C 3 177 VAL 177 177 177 VAL VAL C . n 
C 3 178 PHE 178 178 178 PHE PHE C . n 
C 3 179 PHE 179 179 179 PHE PHE C . n 
C 3 180 ASP 180 180 180 ASP ASP C . n 
C 3 181 ALA 181 181 181 ALA ALA C . n 
C 3 182 CYS 182 182 182 CYS CYS C . n 
C 3 183 GLU 183 183 183 GLU GLU C . n 
C 3 184 ARG 184 184 184 ARG ARG C . n 
C 3 185 ARG 185 185 185 ARG ARG C . n 
C 3 186 ARG 186 186 186 ARG ARG C . n 
C 3 187 TYR 187 187 187 TYR TYR C . n 
C 3 188 TRP 188 188 188 TRP TRP C . n 
C 3 189 ALA 189 189 189 ALA ALA C . n 
C 3 190 LEU 190 190 190 LEU LEU C . n 
C 3 191 GLY 191 191 191 GLY GLY C . n 
C 3 192 LEU 192 192 192 LEU LEU C . n 
C 3 193 VAL 193 193 193 VAL VAL C . n 
C 3 194 VAL 194 194 194 VAL VAL C . n 
C 3 195 GLY 195 195 195 GLY GLY C . n 
C 3 196 SER 196 196 196 SER SER C . n 
C 3 197 HIS 197 197 197 HIS HIS C . n 
C 3 198 LEU 198 198 198 LEU LEU C . n 
C 3 199 LEU 199 199 199 LEU LEU C . n 
C 3 200 THR 200 200 200 THR THR C . n 
C 3 201 SER 201 201 201 SER SER C . n 
C 3 202 GLY 202 202 202 GLY GLY C . n 
C 3 203 LEU 203 203 203 LEU LEU C . n 
C 3 204 THR 204 204 204 THR THR C . n 
C 3 205 PHE 205 205 205 PHE PHE C . n 
C 3 206 LEU 206 206 206 LEU LEU C . n 
C 3 207 ASN 207 207 207 ASN ASN C . n 
C 3 208 PRO 208 208 208 PRO PRO C . n 
C 3 209 TRP 209 209 209 TRP TRP C . n 
C 3 210 TYR 210 210 210 TYR TYR C . n 
C 3 211 GLU 211 211 211 GLU GLU C . n 
C 3 212 ALA 212 212 212 ALA ALA C . n 
C 3 213 SER 213 213 213 SER SER C . n 
C 3 214 LEU 214 214 214 LEU LEU C . n 
C 3 215 LEU 215 215 215 LEU LEU C . n 
C 3 216 PRO 216 216 216 PRO PRO C . n 
C 3 217 ILE 217 217 217 ILE ILE C . n 
C 3 218 TYR 218 218 218 TYR TYR C . n 
C 3 219 ALA 219 219 219 ALA ALA C . n 
C 3 220 VAL 220 220 220 VAL VAL C . n 
C 3 221 THR 221 221 221 THR THR C . n 
C 3 222 VAL 222 222 222 VAL VAL C . n 
C 3 223 SER 223 223 223 SER SER C . n 
C 3 224 MET 224 224 224 MET MET C . n 
C 3 225 GLY 225 225 225 GLY GLY C . n 
C 3 226 LEU 226 226 226 LEU LEU C . n 
C 3 227 TRP 227 227 227 TRP TRP C . n 
C 3 228 ALA 228 228 228 ALA ALA C . n 
C 3 229 PHE 229 229 229 PHE PHE C . n 
C 3 230 ILE 230 230 230 ILE ILE C . n 
C 3 231 THR 231 231 231 THR THR C . n 
C 3 232 ALA 232 232 232 ALA ALA C . n 
C 3 233 GLY 233 233 233 GLY GLY C . n 
C 3 234 GLY 234 234 234 GLY GLY C . n 
C 3 235 SER 235 235 235 SER SER C . n 
C 3 236 LEU 236 236 236 LEU LEU C . n 
C 3 237 ARG 237 237 237 ARG ARG C . n 
C 3 238 SER 238 238 238 SER SER C . n 
C 3 239 ILE 239 239 239 ILE ILE C . n 
C 3 240 GLN 240 240 240 GLN GLN C . n 
C 3 241 ARG 241 241 241 ARG ARG C . n 
C 3 242 SER 242 242 242 SER SER C . n 
C 3 243 LEU 243 243 243 LEU LEU C . n 
C 3 244 LEU 244 244 244 LEU LEU C . n 
C 3 245 CYS 245 245 ?   ?   ?   C . n 
C 3 246 ARG 246 246 ?   ?   ?   C . n 
C 3 247 ARG 247 247 ?   ?   ?   C . n 
C 3 248 GLN 248 248 ?   ?   ?   C . n 
C 3 249 GLU 249 249 ?   ?   ?   C . n 
C 3 250 ASP 250 250 ?   ?   ?   C . n 
C 3 251 SER 251 251 ?   ?   ?   C . n 
C 3 252 ARG 252 252 ?   ?   ?   C . n 
C 3 253 VAL 253 253 ?   ?   ?   C . n 
C 3 254 MET 254 254 ?   ?   ?   C . n 
C 3 255 VAL 255 255 ?   ?   ?   C . n 
C 3 256 TYR 256 256 ?   ?   ?   C . n 
C 3 257 SER 257 257 ?   ?   ?   C . n 
C 3 258 ALA 258 258 ?   ?   ?   C . n 
C 3 259 LEU 259 259 ?   ?   ?   C . n 
C 3 260 ARG 260 260 ?   ?   ?   C . n 
C 3 261 ILE 261 261 ?   ?   ?   C . n 
C 3 262 PRO 262 262 ?   ?   ?   C . n 
C 3 263 PRO 263 263 ?   ?   ?   C . n 
C 3 264 GLU 264 264 ?   ?   ?   C . n 
C 3 265 ASP 265 265 ?   ?   ?   C . n 
D 4 1   MET 1   1   ?   ?   ?   D . n 
D 4 2   ASN 2   2   2   ASN ASN D . n 
D 4 3   LEU 3   3   3   LEU LEU D . n 
D 4 4   GLU 4   4   4   GLU GLU D . n 
D 4 5   ARG 5   5   5   ARG ARG D . n 
D 4 6   VAL 6   6   6   VAL VAL D . n 
D 4 7   SER 7   7   7   SER SER D . n 
D 4 8   ASN 8   8   8   ASN ASN D . n 
D 4 9   GLU 9   9   9   GLU GLU D . n 
D 4 10  GLU 10  10  10  GLU GLU D . n 
D 4 11  LYS 11  11  11  LYS LYS D . n 
D 4 12  LEU 12  12  12  LEU LEU D . n 
D 4 13  ASN 13  13  13  ASN ASN D . n 
D 4 14  LEU 14  14  14  LEU LEU D . n 
D 4 15  CYS 15  15  15  CYS CYS D . n 
D 4 16  ARG 16  16  16  ARG ARG D . n 
D 4 17  LYS 17  17  17  LYS LYS D . n 
D 4 18  TYR 18  18  18  TYR TYR D . n 
D 4 19  TYR 19  19  19  TYR TYR D . n 
D 4 20  LEU 20  20  20  LEU LEU D . n 
D 4 21  GLY 21  21  21  GLY GLY D . n 
D 4 22  GLY 22  22  22  GLY GLY D . n 
D 4 23  PHE 23  23  23  PHE PHE D . n 
D 4 24  ALA 24  24  24  ALA ALA D . n 
D 4 25  PHE 25  25  25  PHE PHE D . n 
D 4 26  LEU 26  26  26  LEU LEU D . n 
D 4 27  PRO 27  27  27  PRO PRO D . n 
D 4 28  PHE 28  28  28  PHE PHE D . n 
D 4 29  LEU 29  29  29  LEU LEU D . n 
D 4 30  TRP 30  30  30  TRP TRP D . n 
D 4 31  LEU 31  31  31  LEU LEU D . n 
D 4 32  VAL 32  32  32  VAL VAL D . n 
D 4 33  ASN 33  33  33  ASN ASN D . n 
D 4 34  ILE 34  34  34  ILE ILE D . n 
D 4 35  PHE 35  35  35  PHE PHE D . n 
D 4 36  TRP 36  36  36  TRP TRP D . n 
D 4 37  PHE 37  37  37  PHE PHE D . n 
D 4 38  PHE 38  38  38  PHE PHE D . n 
D 4 39  ARG 39  39  39  ARG ARG D . n 
D 4 40  GLU 40  40  40  GLU GLU D . n 
D 4 41  ALA 41  41  41  ALA ALA D . n 
D 4 42  PHE 42  42  42  PHE PHE D . n 
D 4 43  LEU 43  43  43  LEU LEU D . n 
D 4 44  VAL 44  44  44  VAL VAL D . n 
D 4 45  PRO 45  45  45  PRO PRO D . n 
D 4 46  ALA 46  46  46  ALA ALA D . n 
D 4 47  TYR 47  47  47  TYR TYR D . n 
D 4 48  THR 48  48  48  THR THR D . n 
D 4 49  GLU 49  49  49  GLU GLU D . n 
D 4 50  GLN 50  50  50  GLN GLN D . n 
D 4 51  SER 51  51  51  SER SER D . n 
D 4 52  GLN 52  52  52  GLN GLN D . n 
D 4 53  ILE 53  53  53  ILE ILE D . n 
D 4 54  LYS 54  54  54  LYS LYS D . n 
D 4 55  GLY 55  55  55  GLY GLY D . n 
D 4 56  TYR 56  56  56  TYR TYR D . n 
D 4 57  VAL 57  57  57  VAL VAL D . n 
D 4 58  TRP 58  58  58  TRP TRP D . n 
D 4 59  ARG 59  59  59  ARG ARG D . n 
D 4 60  SER 60  60  60  SER SER D . n 
D 4 61  ALA 61  61  61  ALA ALA D . n 
D 4 62  VAL 62  62  62  VAL VAL D . n 
D 4 63  GLY 63  63  63  GLY GLY D . n 
D 4 64  PHE 64  64  64  PHE PHE D . n 
D 4 65  LEU 65  65  65  LEU LEU D . n 
D 4 66  PHE 66  66  66  PHE PHE D . n 
D 4 67  TRP 67  67  67  TRP TRP D . n 
D 4 68  VAL 68  68  68  VAL VAL D . n 
D 4 69  ILE 69  69  69  ILE ILE D . n 
D 4 70  VAL 70  70  70  VAL VAL D . n 
D 4 71  LEU 71  71  71  LEU LEU D . n 
D 4 72  THR 72  72  72  THR THR D . n 
D 4 73  SER 73  73  73  SER SER D . n 
D 4 74  TRP 74  74  74  TRP TRP D . n 
D 4 75  ILE 75  75  75  ILE ILE D . n 
D 4 76  THR 76  76  76  THR THR D . n 
D 4 77  ILE 77  77  77  ILE ILE D . n 
D 4 78  PHE 78  78  78  PHE PHE D . n 
D 4 79  GLN 79  79  79  GLN GLN D . n 
D 4 80  ILE 80  80  80  ILE ILE D . n 
D 4 81  TYR 81  81  81  TYR TYR D . n 
D 4 82  ARG 82  82  82  ARG ARG D . n 
D 4 83  PRO 83  83  83  PRO PRO D . n 
D 4 84  ARG 84  84  84  ARG ARG D . n 
D 4 85  TRP 85  85  85  TRP TRP D . n 
D 4 86  GLY 86  86  86  GLY GLY D . n 
D 4 87  ALA 87  87  87  ALA ALA D . n 
D 4 88  LEU 88  88  88  LEU LEU D . n 
D 4 89  GLY 89  89  89  GLY GLY D . n 
D 4 90  ASP 90  90  90  ASP ASP D . n 
D 4 91  TYR 91  91  91  TYR TYR D . n 
D 4 92  LEU 92  92  92  LEU LEU D . n 
D 4 93  SER 93  93  93  SER SER D . n 
D 4 94  PHE 94  94  94  PHE PHE D . n 
D 4 95  THR 95  95  95  THR THR D . n 
D 4 96  ILE 96  96  96  ILE ILE D . n 
D 4 97  PRO 97  97  97  PRO PRO D . n 
D 4 98  LEU 98  98  98  LEU LEU D . n 
D 4 99  GLY 99  99  99  GLY GLY D . n 
D 4 100 THR 100 100 100 THR THR D . n 
D 4 101 PRO 101 101 101 PRO PRO D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 NAG 1 1699 1699 NAG NAG A . 
F 5 NAG 2 1700 1700 NAG NAG A . 
G 5 NAG 1 1701 1701 NAG NAG A . 
H 5 NAG 2 1702 1702 NAG NAG A . 
I 6 BMA 3 1716 1716 BMA BMA A . 
J 6 BMA 4 1717 1717 BMA BMA A . 
K 6 BMA 5 1718 1718 BMA BMA A . 
L 5 NAG 1 1703 1703 NAG NAG A . 
M 5 NAG 2 1704 1704 NAG NAG A . 
N 5 NAG 1 1705 1705 NAG NAG A . 
O 5 NAG 1 1706 1706 NAG NAG A . 
P 5 NAG 2 1707 1707 NAG NAG A . 
Q 5 NAG 1 1708 1708 NAG NAG A . 
R 5 NAG 2 1709 1709 NAG NAG A . 
S 5 NAG 1 1710 1710 NAG NAG A . 
T 5 NAG 2 1711 1711 NAG NAG A . 
U 5 NAG 1 1712 1712 NAG NAG A . 
V 5 NAG 1 1713 1713 NAG NAG A . 
W 5 NAG 1 1714 1714 NAG NAG A . 
X 5 NAG 1 1715 1715 NAG NAG A . 
Y 7 PC1 1 1468 1468 PC1 PC1 B . 
Z 7 PC1 1 1245 1245 PC1 PC1 C . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A ASN 45  A ASN 45  ? ASN 'GLYCOSYLATION SITE' 
2  A ASN 55  A ASN 55  ? ASN 'GLYCOSYLATION SITE' 
3  A ASN 187 A ASN 187 ? ASN 'GLYCOSYLATION SITE' 
4  A ASN 264 A ASN 264 ? ASN 'GLYCOSYLATION SITE' 
5  A ASN 387 A ASN 387 ? ASN 'GLYCOSYLATION SITE' 
6  A ASN 435 A ASN 435 ? ASN 'GLYCOSYLATION SITE' 
7  A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
8  A ASN 506 A ASN 506 ? ASN 'GLYCOSYLATION SITE' 
9  A ASN 530 A ASN 530 ? ASN 'GLYCOSYLATION SITE' 
10 A ASN 562 A ASN 562 ? ASN 'GLYCOSYLATION SITE' 
11 A ASN 573 A ASN 573 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-08-05 
2 'Structure model' 1 1 2015-08-19 
3 'Structure model' 1 2 2015-08-26 
4 'Structure model' 1 3 2015-09-16 
5 'Structure model' 1 4 2016-12-28 
6 'Structure model' 1 5 2017-08-02 
7 'Structure model' 1 6 2019-09-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'  
2  3 'Structure model' 'Database references'  
3  4 'Structure model' 'Database references'  
4  4 'Structure model' 'Structure summary'    
5  5 'Structure model' Other                  
6  6 'Structure model' 'Data collection'      
7  7 'Structure model' 'Data collection'      
8  7 'Structure model' 'Database references'  
9  7 'Structure model' 'Derived calculations' 
10 7 'Structure model' 'Source and taxonomy'  
11 7 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 6 'Structure model' em_image_scans  
2 6 'Structure model' em_software     
3 7 'Structure model' entity          
4 7 'Structure model' entity_name_com 
5 7 'Structure model' entity_src_gen  
6 7 'Structure model' struct_conn     
7 7 'Structure model' struct_ref      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  6 'Structure model' '_em_software.image_processing_id'              
2  6 'Structure model' '_em_software.name'                             
3  7 'Structure model' '_entity.pdbx_description'                      
4  7 'Structure model' '_entity_name_com.name'                         
5  7 'Structure model' '_entity_src_gen.gene_src_common_name'          
6  7 'Structure model' '_entity_src_gen.pdbx_beg_seq_num'              
7  7 'Structure model' '_entity_src_gen.pdbx_end_seq_num'              
8  7 'Structure model' '_entity_src_gen.pdbx_gene_src_gene'            
9  7 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 
10 7 'Structure model' '_entity_src_gen.pdbx_seq_type'                 
11 7 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'           
12 7 'Structure model' '_struct_ref.pdbx_align_begin'                  
13 7 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'          
# 
_em_3d_reconstruction.entry_id                    5A63 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.symmetry_type               POINT 
_em_3d_reconstruction.num_particles               159549 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.resolution                  3.4 
_em_3d_reconstruction.magnification_calibration   'CROSS- -CORRELATION DENSITIES WITHIN SPHERICAL SHELL' 
_em_3d_reconstruction.details                     
'SUBMISSION BASED ON EXPERIMENTAL DATA FROM EMDB EMD-3061. (DEPOSITION ID: 13527).' 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.resolution_method           ? 
_em_3d_reconstruction.algorithm                   ? 
# 
_em_buffer.id            1 
_em_buffer.specimen_id   1 
_em_buffer.name          '25 MM HEPES, PH 7.4, 150 MM NACL AND AMPHIPOL A8-35' 
_em_buffer.pH            7.4 
_em_buffer.details       '25 MM HEPES, PH 7.4, 150 MM NACL AND AMPHIPOL A8-35' 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.name                 'HUMAN GAMMA-SECRETASE' 
_em_entity_assembly.type                 COMPLEX 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.details              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_imaging.entry_id                        5A63 
_em_imaging.id                              1 
_em_imaging.specimen_id                     1 
_em_imaging.date                            2014-10-02 
_em_imaging.temperature                     85 
_em_imaging.microscope_model                'FEI TECNAI F30' 
_em_imaging.nominal_defocus_min             700 
_em_imaging.nominal_defocus_max             3200 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.nominal_cs                      2.7 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.nominal_magnification           81000 
_em_imaging.calibrated_magnification        35714 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.accelerating_voltage            300 
_em_imaging.details                         ? 
_em_imaging.specimen_holder_type            . 
_em_imaging.specimen_holder_model           . 
_em_imaging.citation_id                     ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          'HOLEY CARBON' 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
_em_sample_support.grid_material    ? 
_em_sample_support.grid_mesh_size   ? 
_em_sample_support.grid_type        ? 
# 
_em_vitrification.entry_id              5A63 
_em_vitrification.id                    1 
_em_vitrification.instrument            'FEI VITROBOT MARK IV' 
_em_vitrification.cryogen_name          ETHANE 
_em_vitrification.specimen_id           1 
_em_vitrification.details               
;VITRIFICATION 1 -- CRYOGEN- ETHANE, HUMIDITY- 100, TEMPERATURE- 85, INSTRUMENT- FEI VITROBOT MARK IV, METHOD- BLOT FOR 4 SECONDS BEFORE PLUNGING,
;
_em_vitrification.citation_id           ? 
_em_vitrification.humidity              ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                5A63 
_em_experiment.id                      1 
_em_experiment.aggregation_state       PARTICLE 
_em_experiment.entity_assembly_id      1 
_em_experiment.reconstruction_method   'SINGLE PARTICLE' 
# 
_em_single_particle_entity.entry_id              5A63 
_em_single_particle_entity.id                    1 
_em_single_particle_entity.point_symmetry        C1 
_em_single_particle_entity.image_processing_id   1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG A CYS 586  ? ? SG A CYS 620  ? ? 1.12 
2 1 O4 A NAG 1706 ? ? O5 A NAG 1707 ? ? 2.08 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A PRO 423 ? ? N A PRO 424 ? ? CD A PRO 424 ? ? 141.11 128.40 12.71 2.10 Y 
2 1 C A SER 559 ? ? N A PRO 560 ? ? CD A PRO 560 ? ? 142.25 128.40 13.85 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 45  ? ? -94.20  -61.67  
2  1 THR A 57  ? ? -97.60  -74.62  
3  1 SER A 67  ? ? 57.10   76.23   
4  1 LYS A 78  ? ? 179.97  172.26  
5  1 ASP A 88  ? ? -84.05  -126.04 
6  1 SER A 129 ? ? 89.30   153.87  
7  1 TYR A 152 ? ? -104.52 -84.85  
8  1 GLN A 163 ? ? 63.93   98.13   
9  1 HIS A 199 ? ? -137.97 -63.72  
10 1 SER A 206 ? ? -146.12 -76.70  
11 1 PHE A 210 ? ? -96.50  43.69   
12 1 PRO A 211 ? ? -105.77 74.52   
13 1 ALA A 223 ? ? 89.48   145.77  
14 1 ILE A 225 ? ? 78.09   -71.52  
15 1 ASN A 243 ? ? 56.58   75.47   
16 1 THR A 265 ? ? 83.91   -60.73  
17 1 ALA A 295 ? ? -57.98  -73.25  
18 1 ALA A 298 ? ? -125.98 -54.35  
19 1 ASP A 317 ? ? -90.93  56.53   
20 1 GLU A 333 ? ? -33.00  -31.70  
21 1 ASP A 336 ? ? -66.41  69.03   
22 1 PHE A 352 ? ? -176.24 143.65  
23 1 PRO A 353 ? ? -58.53  -70.25  
24 1 ARG A 371 ? ? 44.97   95.34   
25 1 ARG A 434 ? ? -121.37 -60.04  
26 1 ASN A 435 ? ? 100.62  127.60  
27 1 GLN A 454 ? ? 11.99   74.05   
28 1 SER A 472 ? ? -169.09 -57.26  
29 1 PRO A 473 ? ? -87.78  -125.76 
30 1 VAL A 480 ? ? -65.78  84.18   
31 1 THR A 505 ? ? 75.97   -9.63   
32 1 ILE A 527 ? ? -131.18 -59.90  
33 1 ASN A 530 ? ? -65.64  92.32   
34 1 SER A 536 ? ? -66.10  4.30    
35 1 SER A 559 ? ? -24.97  -94.57  
36 1 GLU A 595 ? ? 66.74   88.81   
37 1 ASN A 612 ? ? 60.09   -76.70  
38 1 SER A 646 ? ? 84.08   103.40  
39 1 ASP A 655 ? ? 55.86   88.11   
40 1 LYS A 693 ? ? -103.10 47.50   
41 1 SER B 104 ? ? 72.99   -64.79  
42 1 PHE B 105 ? ? -23.32  -48.83  
43 1 ASN B 204 ? ? -58.98  -72.61  
44 1 TRP B 215 ? ? -158.98 51.02   
45 1 LYS B 216 ? ? 54.31   -86.09  
46 1 ASP B 403 ? ? 53.90   -73.13  
47 1 GLN B 464 ? ? 95.13   -3.00   
48 1 ASP C 61  ? ? 85.95   4.06    
49 1 ARG C 62  ? ? 80.57   28.36   
50 1 ASP C 107 ? ? 81.88   88.51   
51 1 SER C 235 ? ? -135.88 -131.17 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY A 68  ? ? ASP A 69  ? ? 148.67  
2 1 PHE A 210 ? ? PRO A 211 ? ? 142.45  
3 1 VAL A 256 ? ? TRP A 257 ? ? -146.99 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 B PC1 1468 ? C2F ? Y PC1 1 C2F 
2  1 N 1 B PC1 1468 ? C2G ? Y PC1 1 C2G 
3  1 N 1 B PC1 1468 ? C2H ? Y PC1 1 C2H 
4  1 N 1 B PC1 1468 ? C2I ? Y PC1 1 C2I 
5  1 N 1 B PC1 1468 ? C3C ? Y PC1 1 C3C 
6  1 N 1 B PC1 1468 ? C3D ? Y PC1 1 C3D 
7  1 N 1 B PC1 1468 ? C3E ? Y PC1 1 C3E 
8  1 N 1 B PC1 1468 ? C3F ? Y PC1 1 C3F 
9  1 N 1 B PC1 1468 ? C3G ? Y PC1 1 C3G 
10 1 N 1 B PC1 1468 ? C3H ? Y PC1 1 C3H 
11 1 N 1 B PC1 1468 ? C3I ? Y PC1 1 C3I 
12 1 N 1 C PC1 1245 ? C2F ? Z PC1 1 C2F 
13 1 N 1 C PC1 1245 ? C2G ? Z PC1 1 C2G 
14 1 N 1 C PC1 1245 ? C