data_5A7R
# 
_entry.id   5A7R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5A7R         
PDBE  EBI-64323    
WWPDB D_1290064323 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5A7R 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-07-09 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lambrecht, M.J.'    1 
'Brichacek, M.'      2 
'Barkauskaite, E.'   3 
'Ariza, A.'          4 
'Ahel, I.'           5 
'Hergenrother, P.J.' 6 
# 
_citation.id                        primary 
_citation.title                     'Synthesis of Dimeric Adp-Ribose and its Structure with Human Poly(Adp-Ribose) Glycohydrolase.' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            137 
_citation.page_first                3558 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25706250 
_citation.pdbx_database_id_DOI      10.1021/JA512528P 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lambrecht, M.J.'    1 
primary 'Brichacek, M.'      2 
primary 'Barkauskaite, E.'   3 
primary 'Ariza, A.'          4 
primary 'Ahel, I.'           5 
primary 'Hergenrother, P.J.' 6 
# 
_cell.entry_id           5A7R 
_cell.length_a           67.457 
_cell.length_b           91.277 
_cell.length_c           96.123 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5A7R 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'POLY(ADP-RIBOSE) GLYCOHYDROLASE' 60929.242 1   3.2.1.143 YES ? ? 
2 non-polymer syn 
;[(2R,3S,4R,5R)-5-(6-AMINOPURIN-9-YL)-3,4-DIHYDROXY-OXOLAN-2-YL]METHYL [HYDROXY-[[(2R,3S,4R,5S)-3,4,5-TRIHYDROXYOXOLAN-2-YL]METHOXY]PHOSPHORYL] HYDROGEN PHOSPHATE
;
559.316   2   ?         ?   ? ? 
3 non-polymer syn BETA-MERCAPTOETHANOL 78.133    1   ?         ?   ? ? 
4 non-polymer syn 'SULFATE ION' 96.063    7   ?         ?   ? ? 
5 non-polymer syn GLYCEROL 92.094    11  ?         ?   ? ? 
6 non-polymer syn 'PROPANOIC ACID' 74.079    6   ?         ?   ? ? 
7 water       nat water 18.015    422 ?         ?   ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSPDKKWLGTPIEEMRRMPRCGIRLPLLRPSANHTVTIRVDLLRAGEVPKPFPTHYKDLWDNKHVKMPCSEQNLYPVED
ENGERTAGSRWELIQTALLNKFTRPQNLKDAILKYNVAYSKKWDFTALIDFWDKVLEEAEAQHLYQSILPDMVKIALCLP
NICTQPIPLLAAAMNHSITMSQEQIASLLANAFFCTFPRRNAKMKSEYSSYPDINFNRLFEGRSSRKPEKLKTLFCYFRR
VTAAAPTGLVTFTRQSLEDFPEWERCEKPLTRLHVTYEGTIEENGQGMLQVDFANRFVGGGVTSAGLVQENIRFLINPEL
IISRLFTEVLDHNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEKMRREL
NKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYFTFGDSELMRDIYSMHIFLTERKLTV
GDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSPDKKWLGTPIEEMRRMPRCGIRLPLLRPSANHTVTIRVDLLRAGEVPKPFPTHYKDLWDNKHVKMPCSEQNLYPVED
ENGERTAGSRWELIQTALLNKFTRPQNLKDAILKYNVAYSKKWDFTALIDFWDKVLEEAEAQHLYQSILPDMVKIALCLP
NICTQPIPLLAAAMNHSITMSQEQIASLLANAFFCTFPRRNAKMKSEYSSYPDINFNRLFEGRSSRKPEKLKTLFCYFRR
VTAAAPTGLVTFTRQSLEDFPEWERCEKPLTRLHVTYEGTIEENGQGMLQVDFANRFVGGGVTSAGLVQENIRFLINPEL
IISRLFTEVLDHNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEKMRREL
NKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYFTFGDSELMRDIYSMHIFLTERKLTV
GDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   PRO n 
1 5   ASP n 
1 6   LYS n 
1 7   LYS n 
1 8   TRP n 
1 9   LEU n 
1 10  GLY n 
1 11  THR n 
1 12  PRO n 
1 13  ILE n 
1 14  GLU n 
1 15  GLU n 
1 16  MET n 
1 17  ARG n 
1 18  ARG n 
1 19  MET n 
1 20  PRO n 
1 21  ARG n 
1 22  CYS n 
1 23  GLY n 
1 24  ILE n 
1 25  ARG n 
1 26  LEU n 
1 27  PRO n 
1 28  LEU n 
1 29  LEU n 
1 30  ARG n 
1 31  PRO n 
1 32  SER n 
1 33  ALA n 
1 34  ASN n 
1 35  HIS n 
1 36  THR n 
1 37  VAL n 
1 38  THR n 
1 39  ILE n 
1 40  ARG n 
1 41  VAL n 
1 42  ASP n 
1 43  LEU n 
1 44  LEU n 
1 45  ARG n 
1 46  ALA n 
1 47  GLY n 
1 48  GLU n 
1 49  VAL n 
1 50  PRO n 
1 51  LYS n 
1 52  PRO n 
1 53  PHE n 
1 54  PRO n 
1 55  THR n 
1 56  HIS n 
1 57  TYR n 
1 58  LYS n 
1 59  ASP n 
1 60  LEU n 
1 61  TRP n 
1 62  ASP n 
1 63  ASN n 
1 64  LYS n 
1 65  HIS n 
1 66  VAL n 
1 67  LYS n 
1 68  MET n 
1 69  PRO n 
1 70  CYS n 
1 71  SER n 
1 72  GLU n 
1 73  GLN n 
1 74  ASN n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  VAL n 
1 79  GLU n 
1 80  ASP n 
1 81  GLU n 
1 82  ASN n 
1 83  GLY n 
1 84  GLU n 
1 85  ARG n 
1 86  THR n 
1 87  ALA n 
1 88  GLY n 
1 89  SER n 
1 90  ARG n 
1 91  TRP n 
1 92  GLU n 
1 93  LEU n 
1 94  ILE n 
1 95  GLN n 
1 96  THR n 
1 97  ALA n 
1 98  LEU n 
1 99  LEU n 
1 100 ASN n 
1 101 LYS n 
1 102 PHE n 
1 103 THR n 
1 104 ARG n 
1 105 PRO n 
1 106 GLN n 
1 107 ASN n 
1 108 LEU n 
1 109 LYS n 
1 110 ASP n 
1 111 ALA n 
1 112 ILE n 
1 113 LEU n 
1 114 LYS n 
1 115 TYR n 
1 116 ASN n 
1 117 VAL n 
1 118 ALA n 
1 119 TYR n 
1 120 SER n 
1 121 LYS n 
1 122 LYS n 
1 123 TRP n 
1 124 ASP n 
1 125 PHE n 
1 126 THR n 
1 127 ALA n 
1 128 LEU n 
1 129 ILE n 
1 130 ASP n 
1 131 PHE n 
1 132 TRP n 
1 133 ASP n 
1 134 LYS n 
1 135 VAL n 
1 136 LEU n 
1 137 GLU n 
1 138 GLU n 
1 139 ALA n 
1 140 GLU n 
1 141 ALA n 
1 142 GLN n 
1 143 HIS n 
1 144 LEU n 
1 145 TYR n 
1 146 GLN n 
1 147 SER n 
1 148 ILE n 
1 149 LEU n 
1 150 PRO n 
1 151 ASP n 
1 152 MET n 
1 153 VAL n 
1 154 LYS n 
1 155 ILE n 
1 156 ALA n 
1 157 LEU n 
1 158 CYS n 
1 159 LEU n 
1 160 PRO n 
1 161 ASN n 
1 162 ILE n 
1 163 CYS n 
1 164 THR n 
1 165 GLN n 
1 166 PRO n 
1 167 ILE n 
1 168 PRO n 
1 169 LEU n 
1 170 LEU n 
1 171 ALA n 
1 172 ALA n 
1 173 ALA n 
1 174 MET n 
1 175 ASN n 
1 176 HIS n 
1 177 SER n 
1 178 ILE n 
1 179 THR n 
1 180 MET n 
1 181 SER n 
1 182 GLN n 
1 183 GLU n 
1 184 GLN n 
1 185 ILE n 
1 186 ALA n 
1 187 SER n 
1 188 LEU n 
1 189 LEU n 
1 190 ALA n 
1 191 ASN n 
1 192 ALA n 
1 193 PHE n 
1 194 PHE n 
1 195 CYS n 
1 196 THR n 
1 197 PHE n 
1 198 PRO n 
1 199 ARG n 
1 200 ARG n 
1 201 ASN n 
1 202 ALA n 
1 203 LYS n 
1 204 MET n 
1 205 LYS n 
1 206 SER n 
1 207 GLU n 
1 208 TYR n 
1 209 SER n 
1 210 SER n 
1 211 TYR n 
1 212 PRO n 
1 213 ASP n 
1 214 ILE n 
1 215 ASN n 
1 216 PHE n 
1 217 ASN n 
1 218 ARG n 
1 219 LEU n 
1 220 PHE n 
1 221 GLU n 
1 222 GLY n 
1 223 ARG n 
1 224 SER n 
1 225 SER n 
1 226 ARG n 
1 227 LYS n 
1 228 PRO n 
1 229 GLU n 
1 230 LYS n 
1 231 LEU n 
1 232 LYS n 
1 233 THR n 
1 234 LEU n 
1 235 PHE n 
1 236 CYS n 
1 237 TYR n 
1 238 PHE n 
1 239 ARG n 
1 240 ARG n 
1 241 VAL n 
1 242 THR n 
1 243 ALA n 
1 244 ALA n 
1 245 ALA n 
1 246 PRO n 
1 247 THR n 
1 248 GLY n 
1 249 LEU n 
1 250 VAL n 
1 251 THR n 
1 252 PHE n 
1 253 THR n 
1 254 ARG n 
1 255 GLN n 
1 256 SER n 
1 257 LEU n 
1 258 GLU n 
1 259 ASP n 
1 260 PHE n 
1 261 PRO n 
1 262 GLU n 
1 263 TRP n 
1 264 GLU n 
1 265 ARG n 
1 266 CYS n 
1 267 GLU n 
1 268 LYS n 
1 269 PRO n 
1 270 LEU n 
1 271 THR n 
1 272 ARG n 
1 273 LEU n 
1 274 HIS n 
1 275 VAL n 
1 276 THR n 
1 277 TYR n 
1 278 GLU n 
1 279 GLY n 
1 280 THR n 
1 281 ILE n 
1 282 GLU n 
1 283 GLU n 
1 284 ASN n 
1 285 GLY n 
1 286 GLN n 
1 287 GLY n 
1 288 MET n 
1 289 LEU n 
1 290 GLN n 
1 291 VAL n 
1 292 ASP n 
1 293 PHE n 
1 294 ALA n 
1 295 ASN n 
1 296 ARG n 
1 297 PHE n 
1 298 VAL n 
1 299 GLY n 
1 300 GLY n 
1 301 GLY n 
1 302 VAL n 
1 303 THR n 
1 304 SER n 
1 305 ALA n 
1 306 GLY n 
1 307 LEU n 
1 308 VAL n 
1 309 GLN n 
1 310 GLU n 
1 311 ASN n 
1 312 ILE n 
1 313 ARG n 
1 314 PHE n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 PRO n 
1 319 GLU n 
1 320 LEU n 
1 321 ILE n 
1 322 ILE n 
1 323 SER n 
1 324 ARG n 
1 325 LEU n 
1 326 PHE n 
1 327 THR n 
1 328 GLU n 
1 329 VAL n 
1 330 LEU n 
1 331 ASP n 
1 332 HIS n 
1 333 ASN n 
1 334 GLU n 
1 335 CYS n 
1 336 LEU n 
1 337 ILE n 
1 338 ILE n 
1 339 THR n 
1 340 GLY n 
1 341 THR n 
1 342 GLU n 
1 343 GLN n 
1 344 TYR n 
1 345 SER n 
1 346 GLU n 
1 347 TYR n 
1 348 THR n 
1 349 GLY n 
1 350 TYR n 
1 351 ALA n 
1 352 GLU n 
1 353 THR n 
1 354 TYR n 
1 355 ARG n 
1 356 TRP n 
1 357 SER n 
1 358 ARG n 
1 359 SER n 
1 360 HIS n 
1 361 GLU n 
1 362 ASP n 
1 363 GLY n 
1 364 SER n 
1 365 GLU n 
1 366 ARG n 
1 367 ASP n 
1 368 ASP n 
1 369 TRP n 
1 370 GLN n 
1 371 ARG n 
1 372 ARG n 
1 373 CYS n 
1 374 THR n 
1 375 GLU n 
1 376 ILE n 
1 377 VAL n 
1 378 ALA n 
1 379 ILE n 
1 380 ASP n 
1 381 ALA n 
1 382 LEU n 
1 383 HIS n 
1 384 PHE n 
1 385 ARG n 
1 386 ARG n 
1 387 TYR n 
1 388 LEU n 
1 389 ASP n 
1 390 GLN n 
1 391 PHE n 
1 392 VAL n 
1 393 PRO n 
1 394 GLU n 
1 395 LYS n 
1 396 MET n 
1 397 ARG n 
1 398 ARG n 
1 399 GLU n 
1 400 LEU n 
1 401 ASN n 
1 402 LYS n 
1 403 ALA n 
1 404 TYR n 
1 405 CYS n 
1 406 GLY n 
1 407 PHE n 
1 408 LEU n 
1 409 ARG n 
1 410 PRO n 
1 411 GLY n 
1 412 VAL n 
1 413 SER n 
1 414 SER n 
1 415 GLU n 
1 416 ASN n 
1 417 LEU n 
1 418 SER n 
1 419 ALA n 
1 420 VAL n 
1 421 ALA n 
1 422 THR n 
1 423 GLY n 
1 424 ASN n 
1 425 TRP n 
1 426 GLY n 
1 427 CYS n 
1 428 GLY n 
1 429 ALA n 
1 430 PHE n 
1 431 GLY n 
1 432 GLY n 
1 433 ASP n 
1 434 ALA n 
1 435 ARG n 
1 436 LEU n 
1 437 LYS n 
1 438 ALA n 
1 439 LEU n 
1 440 ILE n 
1 441 GLN n 
1 442 ILE n 
1 443 LEU n 
1 444 ALA n 
1 445 ALA n 
1 446 ALA n 
1 447 ALA n 
1 448 ALA n 
1 449 GLU n 
1 450 ARG n 
1 451 ASP n 
1 452 VAL n 
1 453 VAL n 
1 454 TYR n 
1 455 PHE n 
1 456 THR n 
1 457 PHE n 
1 458 GLY n 
1 459 ASP n 
1 460 SER n 
1 461 GLU n 
1 462 LEU n 
1 463 MET n 
1 464 ARG n 
1 465 ASP n 
1 466 ILE n 
1 467 TYR n 
1 468 SER n 
1 469 MET n 
1 470 HIS n 
1 471 ILE n 
1 472 PHE n 
1 473 LEU n 
1 474 THR n 
1 475 GLU n 
1 476 ARG n 
1 477 LYS n 
1 478 LEU n 
1 479 THR n 
1 480 VAL n 
1 481 GLY n 
1 482 ASP n 
1 483 VAL n 
1 484 TYR n 
1 485 LYS n 
1 486 LEU n 
1 487 LEU n 
1 488 LEU n 
1 489 ARG n 
1 490 TYR n 
1 491 TYR n 
1 492 ASN n 
1 493 GLU n 
1 494 GLU n 
1 495 CYS n 
1 496 ARG n 
1 497 ASN n 
1 498 CYS n 
1 499 SER n 
1 500 THR n 
1 501 PRO n 
1 502 GLY n 
1 503 PRO n 
1 504 ASP n 
1 505 ILE n 
1 506 LYS n 
1 507 LEU n 
1 508 TYR n 
1 509 PRO n 
1 510 PHE n 
1 511 ILE n 
1 512 TYR n 
1 513 HIS n 
1 514 ALA n 
1 515 VAL n 
1 516 GLU n 
1 517 SER n 
1 518 CYS n 
1 519 ALA n 
1 520 GLU n 
1 521 THR n 
1 522 ALA n 
1 523 ASP n 
1 524 HIS n 
1 525 SER n 
1 526 GLY n 
1 527 GLN n 
1 528 ARG n 
1 529 THR n 
1 530 GLY n 
1 531 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'ROSETTA PLYSS' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PARG_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q86W56 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5A7R 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 531 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q86W56 
_struct_ref_seq.db_align_beg                  448 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  976 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       448 
_struct_ref_seq.pdbx_auth_seq_align_end       976 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5A7R GLY A 1   ? UNP Q86W56 ?   ?   'expression tag'      446 1 
1 5A7R SER A 2   ? UNP Q86W56 ?   ?   'expression tag'      447 2 
1 5A7R ALA A 171 ? UNP Q86W56 LYS 616 'engineered mutation' 616 3 
1 5A7R ALA A 172 ? UNP Q86W56 GLN 617 'engineered mutation' 617 4 
1 5A7R ALA A 173 ? UNP Q86W56 LYS 618 'engineered mutation' 618 5 
1 5A7R ALA A 243 ? UNP Q86W56 GLU 688 'engineered mutation' 688 6 
1 5A7R ALA A 244 ? UNP Q86W56 LYS 689 'engineered mutation' 689 7 
1 5A7R ALA A 245 ? UNP Q86W56 LYS 690 'engineered mutation' 690 8 
1 5A7R ASN A 311 ? UNP Q86W56 GLU 756 'engineered mutation' 756 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'        89.093  
AR6 non-polymer         . 
;[(2R,3S,4R,5R)-5-(6-AMINOPURIN-9-YL)-3,4-DIHYDROXY-OXOLAN-2-YL]METHYL [HYDROXY-[[(2R,3S,4R,5S)-3,4,5-TRIHYDROXYOXOLAN-2-YL]METHOXY]PHOSPHORYL] HYDROGEN PHOSPHATE
;
?                               'C15 H23 N5 O14 P2' 559.316 
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'        133.103 
BME non-polymer         . BETA-MERCAPTOETHANOL ?                               'C2 H6 O S'         78.133  
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'       165.189 
PPI non-polymer         . 'PROPANOIC ACID' ?                               'C3 H6 O2'          74.079  
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION' ?                               'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          5A7R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   51 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20% PEG3350, 0.2 M AMMONIUM SULFATE, 0.1 M PCTP PH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 2M' 
_diffrn_detector.pdbx_collection_date   2014-08-01 
_diffrn_detector.details                'TORROIDAL MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SINGLE BOUNCE MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9200 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_wavelength             0.9200 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5A7R 
_reflns.observed_criterion_sigma_I   . 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             55.22 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   44881 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.40 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.58 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.90 
_reflns_shell.pdbx_redundancy        12.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5A7R 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     41801 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             66.19 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    99.88 
_refine.ls_R_factor_obs                          0.13928 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.13730 
_refine.ls_R_factor_R_free                       0.17890 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  2131 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.970 
_refine.correlation_coeff_Fo_to_Fc_free          0.952 
_refine.B_iso_mean                               22.196 
_refine.aniso_B[1][1]                            -1.49 
_refine.aniso_B[2][2]                            -0.27 
_refine.aniso_B[3][3]                            1.76 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WERE REFINED INDIVIDUALLY' 
_refine.pdbx_starting_model                      'PDB ENTRY 4A0D' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.126 
_refine.pdbx_overall_ESU_R_Free                  0.121 
_refine.overall_SU_ML                            0.078 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             2.749 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4097 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         197 
_refine_hist.number_atoms_solvent             422 
_refine_hist.number_atoms_total               4716 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        66.19 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.019  ? 4508 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 4236 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.547  1.999  ? 6123 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.053  3.000  ? 9765 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.674  5.000  ? 541  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.762 23.019 ? 212  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.914 15.000 ? 762  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.860 15.000 ? 40   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.106  0.200  ? 667  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.011  0.021  ? 4951 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 1063 'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.001  1.885  ? 2062 'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.991  1.884  ? 2061 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.944  2.812  ? 2585 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.355  2.354  ? 2446 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.029  3.365  ? 3521 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.950 
_refine_ls_shell.d_res_low                        2.001 
_refine_ls_shell.number_reflns_R_work             3038 
_refine_ls_shell.R_factor_R_work                  0.205 
_refine_ls_shell.percent_reflns_obs               99.66 
_refine_ls_shell.R_factor_R_free                  0.247 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             147 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  5A7R 
_struct.title                     'Human poly(ADP-ribose) glycohydrolase in complex with synthetic dimeric ADP-ribose' 
_struct.pdbx_descriptor           'POLY(ADP-RIBOSE) GLYCOHYDROLASE (E.C.3.2.1.143)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5A7R 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, PARG, ADP-RIBOSE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 4 ? 
F  N N 4 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 5 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 6 ? 
X  N N 6 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 6 ? 
CA N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 12  ? MET A 16  ? PRO A 457 MET A 461 5 ? 5  
HELX_P HELX_P2  2  ARG A 40  ? LEU A 44  ? ARG A 485 LEU A 489 5 ? 5  
HELX_P HELX_P3  3  ARG A 90  ? LEU A 99  ? ARG A 535 LEU A 544 1 ? 10 
HELX_P HELX_P4  4  ARG A 104 ? TYR A 115 ? ARG A 549 TYR A 560 1 ? 12 
HELX_P HELX_P5  5  ASN A 116 ? SER A 120 ? ASN A 561 SER A 565 5 ? 5  
HELX_P HELX_P6  6  PHE A 125 ? VAL A 135 ? PHE A 570 VAL A 580 1 ? 11 
HELX_P HELX_P7  7  GLU A 137 ? SER A 147 ? GLU A 582 SER A 592 1 ? 11 
HELX_P HELX_P8  8  SER A 147 ? CYS A 158 ? SER A 592 CYS A 603 1 ? 12 
HELX_P HELX_P9  9  CYS A 158 ? CYS A 163 ? CYS A 603 CYS A 608 1 ? 6  
HELX_P HELX_P10 10 GLN A 182 ? PHE A 194 ? GLN A 627 PHE A 639 1 ? 13 
HELX_P HELX_P11 11 PHE A 216 ? GLU A 221 ? PHE A 661 GLU A 666 5 ? 6  
HELX_P HELX_P12 12 ARG A 226 ? ALA A 244 ? ARG A 671 ALA A 689 1 ? 19 
HELX_P HELX_P13 13 GLU A 262 ? CYS A 266 ? GLU A 707 CYS A 711 5 ? 5  
HELX_P HELX_P14 14 THR A 280 ? GLY A 285 ? THR A 725 GLY A 730 1 ? 6  
HELX_P HELX_P15 15 GLY A 299 ? SER A 304 ? GLY A 744 SER A 749 5 ? 6  
HELX_P HELX_P16 16 VAL A 308 ? ASN A 317 ? VAL A 753 ASN A 762 1 ? 10 
HELX_P HELX_P17 17 PRO A 318 ? ILE A 321 ? PRO A 763 ILE A 766 5 ? 4  
HELX_P HELX_P18 18 ILE A 322 ? THR A 327 ? ILE A 767 THR A 772 1 ? 6  
HELX_P HELX_P19 19 TYR A 350 ? TYR A 354 ? TYR A 795 TYR A 799 5 ? 5  
HELX_P HELX_P20 20 ARG A 386 ? PHE A 391 ? ARG A 831 PHE A 836 5 ? 6  
HELX_P HELX_P21 21 VAL A 392 ? LEU A 408 ? VAL A 837 LEU A 853 1 ? 17 
HELX_P HELX_P22 22 SER A 413 ? LEU A 417 ? SER A 858 LEU A 862 5 ? 5  
HELX_P HELX_P23 23 ASP A 433 ? ALA A 448 ? ASP A 878 ALA A 893 1 ? 16 
HELX_P HELX_P24 24 ASP A 459 ? ARG A 476 ? ASP A 904 ARG A 921 1 ? 18 
HELX_P HELX_P25 25 THR A 479 ? CYS A 495 ? THR A 924 CYS A 940 1 ? 17 
HELX_P HELX_P26 26 LYS A 506 ? SER A 517 ? LYS A 951 SER A 962 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A CYS 158 SG  A ? ? 1_555 D BME . S2    ? ? A CYS 603  A BME 1966 1_555 ? ? ? ? ? ? ? 1.935 ? 
covale2 covale ? ? B AR6 .   C1D ? ? ? 1_555 C AR6 . "O2'" ? ? A AR6 1964 A AR6 1965 1_555 ? ? ? ? ? ? ? 1.551 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 MET 19 A . ? MET 464 A PRO 20 A ? PRO 465 A 1 -2.71 
2 PHE 53 A . ? PHE 498 A PRO 54 A ? PRO 499 A 1 -0.83 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 10 ? 
AB ? 2  ? 
AC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2  ? anti-parallel 
AA 2 3  ? parallel      
AA 3 4  ? parallel      
AA 4 5  ? parallel      
AA 5 6  ? parallel      
AA 6 7  ? anti-parallel 
AA 7 8  ? anti-parallel 
AA 8 9  ? anti-parallel 
AA 9 10 ? parallel      
AB 1 2  ? anti-parallel 
AC 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  TRP A 8   ? GLY A 10  ? TRP A 453 GLY A 455 
AA 2  LEU A 273 ? THR A 276 ? LEU A 718 THR A 721 
AA 3  VAL A 452 ? PHE A 455 ? VAL A 897 PHE A 900 
AA 4  VAL A 420 ? GLY A 423 ? VAL A 865 GLY A 868 
AA 5  LEU A 289 ? ALA A 294 ? LEU A 734 ALA A 739 
AA 6  GLU A 375 ? ASP A 380 ? GLU A 820 ASP A 825 
AA 7  GLU A 334 ? THR A 339 ? GLU A 779 THR A 784 
AA 8  LEU A 249 ? SER A 256 ? LEU A 694 SER A 701 
AA 9  HIS A 176 ? SER A 181 ? HIS A 621 SER A 626 
AA 10 HIS A 35  ? VAL A 37  ? HIS A 480 VAL A 482 
AB 1  LEU A 75  ? TYR A 76  ? LEU A 520 TYR A 521 
AB 2  GLY A 88  ? SER A 89  ? GLY A 533 SER A 534 
AC 1  SER A 345 ? THR A 348 ? SER A 790 THR A 793 
AC 2  ARG A 355 ? SER A 359 ? ARG A 800 SER A 804 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2  N LEU A 9   ? N LEU A 454 O VAL A 275 ? O VAL A 720 
AA 2 3  N HIS A 274 ? N HIS A 719 O VAL A 452 ? O VAL A 897 
AA 3 4  N VAL A 453 ? N VAL A 898 O VAL A 420 ? O VAL A 865 
AA 4 5  N ALA A 421 ? N ALA A 866 O LEU A 289 ? O LEU A 734 
AA 5 6  N GLN A 290 ? N GLN A 735 O GLU A 375 ? O GLU A 820 
AA 6 7  N ALA A 378 ? N ALA A 823 O LEU A 336 ? O LEU A 781 
AA 7 8  N THR A 339 ? N THR A 784 O THR A 251 ? O THR A 696 
AA 8 9  N ARG A 254 ? N ARG A 699 O HIS A 176 ? O HIS A 621 
AA 9 10 N THR A 179 ? N THR A 624 O THR A 36  ? O THR A 481 
AB 1 2  N TYR A 76  ? N TYR A 521 O GLY A 88  ? O GLY A 533 
AC 1 2  N THR A 348 ? N THR A 793 O ARG A 355 ? O ARG A 800 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE BME A 1966'               
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 1967'               
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 1968'               
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 1969'               
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 1970'               
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 1971'               
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 1972'               
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 1973'               
AC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 1974'               
BC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 1975'               
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 1976'               
BC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 1977'               
BC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 1978'               
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 1979'               
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 1980'               
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 1981'               
BC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 1982'               
BC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 1983'               
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 1984'               
CC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE PPI A 1985'               
CC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PPI A 1986'               
CC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PPI A 1987'               
CC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PPI A 1988'               
CC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PPI A 1989'               
CC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PPI A 1990'               
CC8 Software ? ? ? ? 35 'Binding site for residues AR6 A1964 and AR6 A1965' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  ASP A  130 ? ASP A 575  . ? 4_455 ? 
2   AC1 4  CYS A  158 ? CYS A 603  . ? 1_555 ? 
3   AC1 4  PRO A  228 ? PRO A 673  . ? 4_455 ? 
4   AC1 4  HOH CA .   ? HOH A 2212 . ? 4_455 ? 
5   AC2 6  ILE A  39  ? ILE A 484  . ? 1_555 ? 
6   AC2 6  ARG A  40  ? ARG A 485  . ? 1_555 ? 
7   AC2 6  VAL A  41  ? VAL A 486  . ? 1_555 ? 
8   AC2 6  ASP A  42  ? ASP A 487  . ? 1_555 ? 
9   AC2 6  PHE A  53  ? PHE A 498  . ? 1_555 ? 
10  AC2 6  HOH CA .   ? HOH A 2041 . ? 1_555 ? 
11  AC3 5  LYS A  122 ? LYS A 567  . ? 1_555 ? 
12  AC3 5  PRO A  393 ? PRO A 838  . ? 3_655 ? 
13  AC3 5  ARG A  397 ? ARG A 842  . ? 3_655 ? 
14  AC3 5  HOH CA .   ? HOH A 2356 . ? 3_655 ? 
15  AC3 5  HOH CA .   ? HOH A 2417 . ? 1_555 ? 
16  AC4 2  ALA A  305 ? ALA A 750  . ? 1_555 ? 
17  AC4 2  AR6 C  .   ? AR6 A 1965 . ? 1_555 ? 
18  AC5 4  GLU A  14  ? GLU A 459  . ? 1_555 ? 
19  AC5 4  MET A  16  ? MET A 461  . ? 1_555 ? 
20  AC5 4  ARG A  17  ? ARG A 462  . ? 1_555 ? 
21  AC5 4  ARG A  21  ? ARG A 466  . ? 1_555 ? 
22  AC6 3  GLU A  394 ? GLU A 839  . ? 1_555 ? 
23  AC6 3  LYS A  395 ? LYS A 840  . ? 1_555 ? 
24  AC6 3  ARG A  398 ? ARG A 843  . ? 1_555 ? 
25  AC7 6  TYR A  119 ? TYR A 564  . ? 1_555 ? 
26  AC7 6  ARG A  199 ? ARG A 644  . ? 1_555 ? 
27  AC7 6  ASN A  201 ? ASN A 646  . ? 1_555 ? 
28  AC7 6  ARG A  496 ? ARG A 941  . ? 3_655 ? 
29  AC7 6  HOH CA .   ? HOH A 2127 . ? 1_555 ? 
30  AC7 6  HOH CA .   ? HOH A 2186 . ? 1_555 ? 
31  AC8 2  TRP A  61  ? TRP A 506  . ? 1_555 ? 
32  AC8 2  ARG A  199 ? ARG A 644  . ? 1_555 ? 
33  AC9 10 GLU A  282 ? GLU A 727  . ? 1_555 ? 
34  AC9 10 GLN A  290 ? GLN A 735  . ? 1_555 ? 
35  AC9 10 ARG A  313 ? ARG A 758  . ? 1_555 ? 
36  AC9 10 ASN A  317 ? ASN A 762  . ? 1_555 ? 
37  AC9 10 GLN A  343 ? GLN A 788  . ? 1_555 ? 
38  AC9 10 SER A  364 ? SER A 809  . ? 1_555 ? 
39  AC9 10 HOH CA .   ? HOH A 2268 . ? 1_555 ? 
40  AC9 10 HOH CA .   ? HOH A 2275 . ? 1_555 ? 
41  AC9 10 HOH CA .   ? HOH A 2314 . ? 1_555 ? 
42  AC9 10 HOH CA .   ? HOH A 2331 . ? 1_555 ? 
43  BC1 7  GLU A  264 ? GLU A 709  . ? 1_555 ? 
44  BC1 7  CYS A  266 ? CYS A 711  . ? 1_555 ? 
45  BC1 7  GLU A  267 ? GLU A 712  . ? 1_555 ? 
46  BC1 7  THR A  479 ? THR A 924  . ? 1_555 ? 
47  BC1 7  ASP A  482 ? ASP A 927  . ? 1_555 ? 
48  BC1 7  LYS A  485 ? LYS A 930  . ? 1_555 ? 
49  BC1 7  HOH CA .   ? HOH A 2418 . ? 1_555 ? 
50  BC2 5  ASN A  424 ? ASN A 869  . ? 1_555 ? 
51  BC2 5  CYS A  427 ? CYS A 872  . ? 1_555 ? 
52  BC2 5  ASP A  459 ? ASP A 904  . ? 1_555 ? 
53  BC2 5  AR6 B  .   ? AR6 A 1964 . ? 1_555 ? 
54  BC2 5  HOH CA .   ? HOH A 2378 . ? 1_555 ? 
55  BC3 4  ALA A  351 ? ALA A 796  . ? 1_555 ? 
56  BC3 4  GLU A  352 ? GLU A 797  . ? 1_555 ? 
57  BC3 4  AR6 C  .   ? AR6 A 1965 . ? 1_555 ? 
58  BC3 4  HOH CA .   ? HOH A 2325 . ? 1_555 ? 
59  BC4 7  HIS A  383 ? HIS A 828  . ? 1_555 ? 
60  BC4 7  PHE A  384 ? PHE A 829  . ? 1_555 ? 
61  BC4 7  ARG A  385 ? ARG A 830  . ? 1_555 ? 
62  BC4 7  ARG A  386 ? ARG A 831  . ? 1_555 ? 
63  BC4 7  ASP A  389 ? ASP A 834  . ? 1_555 ? 
64  BC4 7  LYS A  395 ? LYS A 840  . ? 1_555 ? 
65  BC4 7  HOH CA .   ? HOH A 2419 . ? 1_555 ? 
66  BC5 3  ARG A  240 ? ARG A 685  . ? 1_555 ? 
67  BC5 3  ALA A  244 ? ALA A 689  . ? 1_555 ? 
68  BC5 3  GLU A  342 ? GLU A 787  . ? 1_555 ? 
69  BC6 6  ASN A  63  ? ASN A 508  . ? 1_555 ? 
70  BC6 6  LEU A  169 ? LEU A 614  . ? 1_555 ? 
71  BC6 6  GLU A  207 ? GLU A 652  . ? 1_555 ? 
72  BC6 6  HOH CA .   ? HOH A 2075 . ? 1_555 ? 
73  BC6 6  HOH CA .   ? HOH A 2200 . ? 1_555 ? 
74  BC6 6  HOH CA .   ? HOH A 2420 . ? 1_555 ? 
75  BC7 6  ASN A  295 ? ASN A 740  . ? 1_555 ? 
76  BC7 6  HIS A  383 ? HIS A 828  . ? 1_555 ? 
77  BC7 6  PHE A  430 ? PHE A 875  . ? 1_555 ? 
78  BC7 6  AR6 C  .   ? AR6 A 1965 . ? 1_555 ? 
79  BC7 6  HOH CA .   ? HOH A 2286 . ? 1_555 ? 
80  BC7 6  HOH CA .   ? HOH A 2421 . ? 1_555 ? 
81  BC8 3  GLU A  140 ? GLU A 585  . ? 1_555 ? 
82  BC8 3  LEU A  144 ? LEU A 589  . ? 1_555 ? 
83  BC8 3  HOH CA .   ? HOH A 2220 . ? 1_555 ? 
84  BC9 6  HIS A  56  ? HIS A 501  . ? 1_555 ? 
85  BC9 6  TYR A  57  ? TYR A 502  . ? 1_555 ? 
86  BC9 6  PRO A  160 ? PRO A 605  . ? 1_555 ? 
87  BC9 6  ASN A  161 ? ASN A 606  . ? 1_555 ? 
88  BC9 6  PPI Y  .   ? PPI A 1987 . ? 1_555 ? 
89  BC9 6  HOH CA .   ? HOH A 2062 . ? 1_555 ? 
90  CC1 5  GLY A  47  ? GLY A 492  . ? 4_555 ? 
91  CC1 5  GLN A  106 ? GLN A 551  . ? 1_555 ? 
92  CC1 5  LYS A  109 ? LYS A 554  . ? 1_555 ? 
93  CC1 5  ALA A  245 ? ALA A 690  . ? 4_555 ? 
94  CC1 5  HOH CA .   ? HOH A 2113 . ? 1_555 ? 
95  CC2 7  TYR A  76  ? TYR A 521  . ? 1_555 ? 
96  CC2 7  ARG A  90  ? ARG A 535  . ? 1_555 ? 
97  CC2 7  TYR A  115 ? TYR A 560  . ? 1_555 ? 
98  CC2 7  ASN A  116 ? ASN A 561  . ? 1_555 ? 
99  CC2 7  VAL A  117 ? VAL A 562  . ? 1_555 ? 
100 CC2 7  HOH CA .   ? HOH A 2125 . ? 1_555 ? 
101 CC2 7  HOH CA .   ? HOH A 2195 . ? 1_555 ? 
102 CC3 4  LEU A  26  ? LEU A 471  . ? 1_555 ? 
103 CC3 4  ARG A  371 ? ARG A 816  . ? 1_555 ? 
104 CC3 4  HOH CA .   ? HOH A 2235 . ? 1_555 ? 
105 CC3 4  HOH CA .   ? HOH A 2313 . ? 1_555 ? 
106 CC4 4  CYS A  70  ? CYS A 515  . ? 1_555 ? 
107 CC4 4  GLU A  72  ? GLU A 517  . ? 1_555 ? 
108 CC4 4  GOL U  .   ? GOL A 1983 . ? 1_555 ? 
109 CC4 4  HOH CA .   ? HOH A 2092 . ? 1_555 ? 
110 CC5 3  GLY A  279 ? GLY A 724  . ? 1_555 ? 
111 CC5 3  PPI BA .   ? PPI A 1990 . ? 1_555 ? 
112 CC5 3  HOH CA .   ? HOH A 2264 . ? 1_555 ? 
113 CC6 3  SER A  210 ? SER A 655  . ? 1_555 ? 
114 CC6 3  ARG A  296 ? ARG A 741  . ? 1_555 ? 
115 CC6 3  HOH CA .   ? HOH A 2199 . ? 1_555 ? 
116 CC7 6  THR A  280 ? THR A 725  . ? 1_555 ? 
117 CC7 6  TYR A  347 ? TYR A 792  . ? 1_555 ? 
118 CC7 6  GLY A  349 ? GLY A 794  . ? 1_555 ? 
119 CC7 6  PPI Z  .   ? PPI A 1988 . ? 1_555 ? 
120 CC7 6  HOH CA .   ? HOH A 2318 . ? 1_555 ? 
121 CC7 6  HOH CA .   ? HOH A 2323 . ? 1_555 ? 
122 CC8 35 ARG A  218 ? ARG A 663  . ? 1_555 ? 
123 CC8 35 ILE A  281 ? ILE A 726  . ? 1_555 ? 
124 CC8 35 GLU A  282 ? GLU A 727  . ? 1_555 ? 
125 CC8 35 PHE A  293 ? PHE A 738  . ? 1_555 ? 
126 CC8 35 ASN A  295 ? ASN A 740  . ? 1_555 ? 
127 CC8 35 GLY A  300 ? GLY A 745  . ? 1_555 ? 
128 CC8 35 SER A  304 ? SER A 749  . ? 1_555 ? 
129 CC8 35 ALA A  305 ? ALA A 750  . ? 1_555 ? 
130 CC8 35 GLY A  306 ? GLY A 751  . ? 1_555 ? 
131 CC8 35 LEU A  307 ? LEU A 752  . ? 1_555 ? 
132 CC8 35 VAL A  308 ? VAL A 753  . ? 1_555 ? 
133 CC8 35 GLN A  309 ? GLN A 754  . ? 1_555 ? 
134 CC8 35 GLU A  310 ? GLU A 755  . ? 1_555 ? 
135 CC8 35 ASN A  311 ? ASN A 756  . ? 1_555 ? 
136 CC8 35 TYR A  350 ? TYR A 795  . ? 1_555 ? 
137 CC8 35 ASN A  424 ? ASN A 869  . ? 1_555 ? 
138 CC8 35 GLY A  426 ? GLY A 871  . ? 1_555 ? 
139 CC8 35 CYS A  427 ? CYS A 872  . ? 1_555 ? 
140 CC8 35 GLY A  428 ? GLY A 873  . ? 1_555 ? 
141 CC8 35 ALA A  429 ? ALA A 874  . ? 1_555 ? 
142 CC8 35 PHE A  430 ? PHE A 875  . ? 1_555 ? 
143 CC8 35 PHE A  457 ? PHE A 902  . ? 1_555 ? 
144 CC8 35 SO4 G  .   ? SO4 A 1969 . ? 1_555 ? 
145 CC8 35 GOL N  .   ? GOL A 1976 . ? 1_555 ? 
146 CC8 35 GOL O  .   ? GOL A 1977 . ? 1_555 ? 
147 CC8 35 GOL S  .   ? GOL A 1981 . ? 1_555 ? 
148 CC8 35 HOH CA .   ? HOH A 2284 . ? 1_555 ? 
149 CC8 35 HOH CA .   ? HOH A 2285 . ? 1_555 ? 
150 CC8 35 HOH CA .   ? HOH A 2288 . ? 1_555 ? 
151 CC8 35 HOH CA .   ? HOH A 2320 . ? 1_555 ? 
152 CC8 35 HOH CA .   ? HOH A 2325 . ? 1_555 ? 
153 CC8 35 HOH CA .   ? HOH A 2326 . ? 1_555 ? 
154 CC8 35 HOH CA .   ? HOH A 2327 . ? 1_555 ? 
155 CC8 35 HOH CA .   ? HOH A 2365 . ? 1_555 ? 
156 CC8 35 HOH CA .   ? HOH A 2416 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5A7R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5A7R 
_atom_sites.fract_transf_matrix[1][1]   0.014824 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010956 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010403 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    C CA    . ASP A  1 5   ? 30.899  -19.510 -13.966 1.00 53.46  ? 450  ASP A CA    1 
ATOM   2    C C     . ASP A  1 5   ? 29.564  -18.969 -13.360 1.00 52.27  ? 450  ASP A C     1 
ATOM   3    O O     . ASP A  1 5   ? 29.097  -17.883 -13.737 1.00 58.63  ? 450  ASP A O     1 
ATOM   4    N N     . LYS A  1 6   ? 29.009  -19.714 -12.390 1.00 39.59  ? 451  LYS A N     1 
ATOM   5    C CA    . LYS A  1 6   ? 27.617  -19.535 -11.860 1.00 36.10  ? 451  LYS A CA    1 
ATOM   6    C C     . LYS A  1 6   ? 27.352  -18.131 -11.228 1.00 28.51  ? 451  LYS A C     1 
ATOM   7    O O     . LYS A  1 6   ? 28.233  -17.597 -10.575 1.00 27.02  ? 451  LYS A O     1 
ATOM   8    C CB    . LYS A  1 6   ? 27.379  -20.589 -10.785 1.00 43.17  ? 451  LYS A CB    1 
ATOM   9    C CG    . LYS A  1 6   ? 27.257  -22.012 -11.314 1.00 49.52  ? 451  LYS A CG    1 
ATOM   10   C CD    . LYS A  1 6   ? 25.882  -22.216 -11.924 1.00 59.08  ? 451  LYS A CD    1 
ATOM   11   C CE    . LYS A  1 6   ? 25.672  -23.647 -12.389 1.00 67.85  ? 451  LYS A CE    1 
ATOM   12   N NZ    . LYS A  1 6   ? 26.082  -24.640 -11.358 1.00 70.13  ? 451  LYS A NZ    1 
ATOM   13   N N     . LYS A  1 7   ? 26.140  -17.557 -11.406 1.00 25.41  ? 452  LYS A N     1 
ATOM   14   C CA    . LYS A  1 7   ? 25.827  -16.235 -10.818 1.00 24.34  ? 452  LYS A CA    1 
ATOM   15   C C     . LYS A  1 7   ? 25.307  -16.346 -9.340  1.00 20.37  ? 452  LYS A C     1 
ATOM   16   O O     . LYS A  1 7   ? 25.276  -15.332 -8.605  1.00 18.97  ? 452  LYS A O     1 
ATOM   17   C CB    . LYS A  1 7   ? 24.740  -15.504 -11.644 1.00 29.65  ? 452  LYS A CB    1 
ATOM   18   C CG    . LYS A  1 7   ? 25.134  -15.103 -13.083 1.00 35.00  ? 452  LYS A CG    1 
ATOM   19   C CD    . LYS A  1 7   ? 26.525  -14.495 -13.162 1.00 35.23  ? 452  LYS A CD    1 
ATOM   20   C CE    . LYS A  1 7   ? 26.919  -14.195 -14.603 1.00 40.43  ? 452  LYS A CE    1 
ATOM   21   N NZ    . LYS A  1 7   ? 25.871  -13.416 -15.327 1.00 41.04  ? 452  LYS A NZ    1 
ATOM   22   N N     . TRP A  1 8   ? 24.785  -17.516 -8.979  1.00 17.80  ? 453  TRP A N     1 
ATOM   23   C CA    . TRP A  1 8   ? 24.213  -17.715 -7.685  1.00 16.05  ? 453  TRP A CA    1 
ATOM   24   C C     . TRP A  1 8   ? 24.413  -19.158 -7.358  1.00 18.23  ? 453  TRP A C     1 
ATOM   25   O O     . TRP A  1 8   ? 24.550  -19.982 -8.279  1.00 15.08  ? 453  TRP A O     1 
ATOM   26   C CB    . TRP A  1 8   ? 22.733  -17.376 -7.641  1.00 16.80  ? 453  TRP A CB    1 
ATOM   27   C CG    . TRP A  1 8   ? 21.870  -18.233 -8.539  1.00 18.11  ? 453  TRP A CG    1 
ATOM   28   C CD1   . TRP A  1 8   ? 21.523  -17.953 -9.831  1.00 20.53  ? 453  TRP A CD1   1 
ATOM   29   C CD2   . TRP A  1 8   ? 21.264  -19.492 -8.231  1.00 18.80  ? 453  TRP A CD2   1 
ATOM   30   N NE1   . TRP A  1 8   ? 20.754  -18.959 -10.327 1.00 18.85  ? 453  TRP A NE1   1 
ATOM   31   C CE2   . TRP A  1 8   ? 20.567  -19.903 -9.365  1.00 19.84  ? 453  TRP A CE2   1 
ATOM   32   C CE3   . TRP A  1 8   ? 21.197  -20.291 -7.075  1.00 18.10  ? 453  TRP A CE3   1 
ATOM   33   C CZ2   . TRP A  1 8   ? 19.842  -21.122 -9.410  1.00 20.81  ? 453  TRP A CZ2   1 
ATOM   34   C CZ3   . TRP A  1 8   ? 20.478  -21.471 -7.112  1.00 19.61  ? 453  TRP A CZ3   1 
ATOM   35   C CH2   . TRP A  1 8   ? 19.818  -21.884 -8.274  1.00 20.82  ? 453  TRP A CH2   1 
ATOM   36   N N     . LEU A  1 9   ? 24.464  -19.472 -6.051  1.00 15.12  ? 454  LEU A N     1 
ATOM   37   C CA    . LEU A  1 9   ? 24.617  -20.843 -5.568  1.00 16.53  ? 454  LEU A CA    1 
ATOM   38   C C     . LEU A  1 9   ? 23.702  -21.100 -4.357  1.00 17.48  ? 454  LEU A C     1 
ATOM   39   O O     . LEU A  1 9   ? 23.264  -20.148 -3.661  1.00 14.51  ? 454  LEU A O     1 
ATOM   40   C CB    . LEU A  1 9   ? 26.062  -21.059 -5.142  1.00 17.71  ? 454  LEU A CB    1 
ATOM   41   C CG    . LEU A  1 9   ? 27.133  -20.920 -6.228  1.00 18.03  ? 454  LEU A CG    1 
ATOM   42   C CD1   . LEU A  1 9   ? 28.474  -20.901 -5.523  1.00 17.93  ? 454  LEU A CD1   1 
ATOM   43   C CD2   . LEU A  1 9   ? 27.082  -22.061 -7.288  1.00 19.15  ? 454  LEU A CD2   1 
ATOM   44   N N     . GLY A  1 10  ? 23.393  -22.379 -4.117  1.00 16.11  ? 455  GLY A N     1 
ATOM   45   C CA    . GLY A  1 10  ? 22.627  -22.793 -2.963  1.00 15.84  ? 455  GLY A CA    1 
ATOM   46   C C     . GLY A  1 10  ? 21.174  -23.069 -3.285  1.00 16.10  ? 455  GLY A C     1 
ATOM   47   O O     . GLY A  1 10  ? 20.853  -23.539 -4.376  1.00 16.29  ? 455  GLY A O     1 
ATOM   48   N N     . THR A  1 11  ? 20.293  -22.744 -2.358  1.00 14.61  ? 456  THR A N     1 
ATOM   49   C CA    . THR A  1 11  ? 18.839  -22.929 -2.551  1.00 16.69  ? 456  THR A CA    1 
ATOM   50   C C     . THR A  1 11  ? 18.296  -21.896 -3.565  1.00 17.58  ? 456  THR A C     1 
ATOM   51   O O     . THR A  1 11  ? 18.611  -20.693 -3.478  1.00 16.68  ? 456  THR A O     1 
ATOM   52   C CB    . THR A  1 11  ? 18.096  -22.770 -1.218  1.00 17.21  ? 456  THR A CB    1 
ATOM   53   O OG1   . THR A  1 11  ? 18.476  -23.816 -0.310  1.00 15.71  ? 456  THR A OG1   1 
ATOM   54   C CG2   . THR A  1 11  ? 16.586  -22.770 -1.382  1.00 18.40  ? 456  THR A CG2   1 
ATOM   55   N N     . PRO A  1 12  ? 17.498  -22.353 -4.549  1.00 20.09  ? 457  PRO A N     1 
ATOM   56   C CA    . PRO A  1 12  ? 16.887  -21.392 -5.460  1.00 19.36  ? 457  PRO A CA    1 
ATOM   57   C C     . PRO A  1 12  ? 16.110  -20.304 -4.728  1.00 18.25  ? 457  PRO A C     1 
ATOM   58   O O     . PRO A  1 12  ? 15.459  -20.572 -3.712  1.00 18.79  ? 457  PRO A O     1 
ATOM   59   C CB    . PRO A  1 12  ? 15.954  -22.245 -6.306  1.00 21.41  ? 457  PRO A CB    1 
ATOM   60   C CG    . PRO A  1 12  ? 16.468  -23.619 -6.198  1.00 21.24  ? 457  PRO A CG    1 
ATOM   61   C CD    . PRO A  1 12  ? 17.126  -23.745 -4.872  1.00 21.73  ? 457  PRO A CD    1 
ATOM   62   N N     . ILE A  1 13  ? 16.185  -19.074 -5.214  1.00 18.02  ? 458  ILE A N     1 
ATOM   63   C CA    . ILE A  1 13  ? 15.578  -17.999 -4.489  1.00 20.07  ? 458  ILE A CA    1 
ATOM   64   C C     . ILE A  1 13  ? 14.029  -18.112 -4.478  1.00 20.55  ? 458  ILE A C     1 
ATOM   65   O O     . ILE A  1 13  ? 13.395  -17.591 -3.563  1.00 20.23  ? 458  ILE A O     1 
ATOM   66   C CB    . ILE A  1 13  ? 16.049  -16.592 -4.982  1.00 23.98  ? 458  ILE A CB    1 
ATOM   67   C CG1   . ILE A  1 13  ? 15.905  -15.545 -3.821  1.00 23.23  ? 458  ILE A CG1   1 
ATOM   68   C CG2   . ILE A  1 13  ? 15.364  -16.247 -6.279  1.00 22.98  ? 458  ILE A CG2   1 
ATOM   69   C CD1   . ILE A  1 13  ? 16.480  -14.171 -4.131  1.00 27.81  ? 458  ILE A CD1   1 
ATOM   70   N N     . GLU A  1 14  ? 13.454  -18.851 -5.443  1.00 19.63  ? 459  GLU A N     1 
ATOM   71   C CA    . GLU A  1 14  ? 11.983  -19.090 -5.474  1.00 23.22  ? 459  GLU A CA    1 
ATOM   72   C C     . GLU A  1 14  ? 11.478  -19.909 -4.284  1.00 22.94  ? 459  GLU A C     1 
ATOM   73   O O     . GLU A  1 14  ? 10.309  -19.811 -3.903  1.00 20.69  ? 459  GLU A O     1 
ATOM   74   C CB    . GLU A  1 14  ? 11.578  -19.799 -6.779  1.00 26.66  ? 459  GLU A CB    1 
ATOM   75   C CG    . GLU A  1 14  ? 11.837  -18.957 -8.042  1.00 31.72  ? 459  GLU A CG    1 
ATOM   76   C CD    . GLU A  1 14  ? 13.243  -19.153 -8.647  1.00 37.95  ? 459  GLU A CD    1 
ATOM   77   O OE1   . GLU A  1 14  ? 14.196  -19.560 -7.927  1.00 32.84  ? 459  GLU A OE1   1 
ATOM   78   O OE2   . GLU A  1 14  ? 13.378  -18.912 -9.854  1.00 40.42  ? 459  GLU A OE2   1 
ATOM   79   N N     . GLU A  1 15  ? 12.361  -20.669 -3.659  1.00 24.45  ? 460  GLU A N     1 
ATOM   80   C CA    . GLU A  1 15  ? 11.977  -21.461 -2.526  1.00 26.72  ? 460  GLU A CA    1 
ATOM   81   C C     . GLU A  1 15  ? 12.008  -20.696 -1.174  1.00 26.99  ? 460  GLU A C     1 
ATOM   82   O O     . GLU A  1 15  ? 11.499  -21.195 -0.183  1.00 23.38  ? 460  GLU A O     1 
ATOM   83   C CB    . GLU A  1 15  ? 12.766  -22.807 -2.504  1.00 30.37  ? 460  GLU A CB    1 
ATOM   84   C CG    . GLU A  1 15  ? 12.792  -23.425 -3.917  1.00 37.10  ? 460  GLU A CG    1 
ATOM   85   C CD    . GLU A  1 15  ? 12.699  -24.956 -4.018  1.00 51.66  ? 460  GLU A CD    1 
ATOM   86   O OE1   . GLU A  1 15  ? 13.687  -25.629 -3.604  1.00 56.02  ? 460  GLU A OE1   1 
ATOM   87   O OE2   . GLU A  1 15  ? 11.667  -25.482 -4.644  1.00 50.79  ? 460  GLU A OE2   1 
ATOM   88   N N     . MET A  1 16  ? 12.497  -19.447 -1.176  1.00 23.33  ? 461  MET A N     1 
ATOM   89   C CA    . MET A  1 16  ? 12.611  -18.642 0.065   1.00 23.52  ? 461  MET A CA    1 
ATOM   90   C C     . MET A  1 16  ? 11.274  -17.930 0.419   1.00 24.91  ? 461  MET A C     1 
ATOM   91   O O     . MET A  1 16  ? 10.498  -17.497 -0.485  1.00 22.80  ? 461  MET A O     1 
ATOM   92   C CB    . MET A  1 16  ? 13.726  -17.602 -0.078  1.00 23.12  ? 461  MET A CB    1 
ATOM   93   C CG    . MET A  1 16  ? 15.126  -18.226 -0.305  1.00 24.65  ? 461  MET A CG    1 
ATOM   94   S SD    . MET A  1 16  ? 15.608  -19.198 1.163   1.00 26.88  ? 461  MET A SD    1 
ATOM   95   C CE    . MET A  1 16  ? 17.322  -19.519 0.894   1.00 23.70  ? 461  MET A CE    1 
ATOM   96   N N     . ARG A  1 17  ? 10.996  -17.814 1.710   1.00 23.31  ? 462  ARG A N     1 
ATOM   97   C CA    . ARG A  1 17  ? 9.732   -17.108 2.178   1.00 26.29  ? 462  ARG A CA    1 
ATOM   98   C C     . ARG A  1 17  ? 9.794   -15.544 2.040   1.00 25.12  ? 462  ARG A C     1 
ATOM   99   O O     . ARG A  1 17  ? 10.855  -14.922 2.296   1.00 19.50  ? 462  ARG A O     1 
ATOM   100  C CB    . ARG A  1 17  ? 9.413   -17.510 3.609   1.00 28.42  ? 462  ARG A CB    1 
ATOM   101  C CG    . ARG A  1 17  ? 9.041   -18.984 3.702   1.00 29.35  ? 462  ARG A CG    1 
ATOM   102  C CD    . ARG A  1 17  ? 8.563   -19.395 5.066   1.00 30.98  ? 462  ARG A CD    1 
ATOM   103  N NE    . ARG A  1 17  ? 9.616   -19.451 6.046   1.00 32.88  ? 462  ARG A NE    1 
ATOM   104  C CZ    . ARG A  1 17  ? 10.549  -20.413 6.154   1.00 36.93  ? 462  ARG A CZ    1 
ATOM   105  N NH1   . ARG A  1 17  ? 10.618  -21.413 5.313   1.00 40.41  ? 462  ARG A NH1   1 
ATOM   106  N NH2   . ARG A  1 17  ? 11.448  -20.341 7.130   1.00 40.53  ? 462  ARG A NH2   1 
ATOM   107  N N     . ARG A  1 18  ? 8.665   -14.951 1.600   1.00 21.47  ? 463  ARG A N     1 
ATOM   108  C CA    . ARG A  1 18  ? 8.520   -13.490 1.391   1.00 23.32  ? 463  ARG A CA    1 
ATOM   109  C C     . ARG A  1 18  ? 7.156   -12.972 1.905   1.00 23.90  ? 463  ARG A C     1 
ATOM   110  O O     . ARG A  1 18  ? 6.140   -13.688 1.818   1.00 27.48  ? 463  ARG A O     1 
ATOM   111  C CB    . ARG A  1 18  ? 8.602   -13.153 -0.105  1.00 24.20  ? 463  ARG A CB    1 
ATOM   112  C CG    . ARG A  1 18  ? 9.954   -13.438 -0.778  1.00 26.83  ? 463  ARG A CG    1 
ATOM   113  C CD    . ARG A  1 18  ? 9.855   -12.995 -2.245  1.00 26.76  ? 463  ARG A CD    1 
ATOM   114  N NE    . ARG A  1 18  ? 10.924  -13.463 -3.116  1.00 28.45  ? 463  ARG A NE    1 
ATOM   115  C CZ    . ARG A  1 18  ? 11.852  -12.687 -3.707  1.00 30.27  ? 463  ARG A CZ    1 
ATOM   116  N NH1   . ARG A  1 18  ? 11.969  -11.386 -3.409  1.00 26.48  ? 463  ARG A NH1   1 
ATOM   117  N NH2   . ARG A  1 18  ? 12.714  -13.242 -4.601  1.00 33.18  ? 463  ARG A NH2   1 
ATOM   118  N N     . MET A  1 19  ? 7.156   -11.740 2.436   1.00 25.22  ? 464  MET A N     1 
ATOM   119  C CA    . MET A  1 19  ? 5.932   -10.918 2.721   1.00 27.64  ? 464  MET A CA    1 
ATOM   120  C C     . MET A  1 19  ? 5.326   -10.265 1.418   1.00 28.51  ? 464  MET A C     1 
ATOM   121  O O     . MET A  1 19  ? 6.007   -10.123 0.435   1.00 26.70  ? 464  MET A O     1 
ATOM   122  C CB    . MET A  1 19  ? 6.294   -9.790  3.726   1.00 28.87  ? 464  MET A CB    1 
ATOM   123  C CG    . MET A  1 19  ? 6.644   -10.287 5.144   1.00 31.78  ? 464  MET A CG    1 
ATOM   124  S SD    . MET A  1 19  ? 5.160   -11.039 5.927   1.00 38.13  ? 464  MET A SD    1 
ATOM   125  C CE    . MET A  1 19  ? 4.196   -9.509  6.192   1.00 36.57  ? 464  MET A CE    1 
ATOM   126  N N     . PRO A  1 20  ? 4.009   -9.962  1.419   1.00 30.44  ? 465  PRO A N     1 
ATOM   127  C CA    . PRO A  1 20  ? 3.021   -10.218 2.492   1.00 33.12  ? 465  PRO A CA    1 
ATOM   128  C C     . PRO A  1 20  ? 2.581   -11.755 2.634   1.00 31.92  ? 465  PRO A C     1 
ATOM   129  O O     . PRO A  1 20  ? 1.956   -12.152 3.658   1.00 27.79  ? 465  PRO A O     1 
ATOM   130  C CB    . PRO A  1 20  ? 1.819   -9.401  2.015   1.00 34.47  ? 465  PRO A CB    1 
ATOM   131  C CG    . PRO A  1 20  ? 1.863   -9.655  0.512   1.00 31.91  ? 465  PRO A CG    1 
ATOM   132  C CD    . PRO A  1 20  ? 3.343   -9.464  0.199   1.00 32.76  ? 465  PRO A CD    1 
ATOM   133  N N     . ARG A  1 21  ? 2.910   -12.585 1.647   1.00 28.75  ? 466  ARG A N     1 
ATOM   134  C CA    . ARG A  1 21  ? 2.263   -13.899 1.557   1.00 29.80  ? 466  ARG A CA    1 
ATOM   135  C C     . ARG A  1 21  ? 2.630   -14.831 2.702   1.00 28.26  ? 466  ARG A C     1 
ATOM   136  O O     . ARG A  1 21  ? 1.793   -15.601 3.146   1.00 26.75  ? 466  ARG A O     1 
ATOM   137  C CB    . ARG A  1 21  ? 2.574   -14.537 0.227   1.00 35.00  ? 466  ARG A CB    1 
ATOM   138  C CG    . ARG A  1 21  ? 1.622   -15.653 -0.140  1.00 36.50  ? 466  ARG A CG    1 
ATOM   139  C CD    . ARG A  1 21  ? 1.727   -16.022 -1.621  1.00 33.48  ? 466  ARG A CD    1 
ATOM   140  N NE    . ARG A  1 21  ? 3.057   -15.889 -2.193  1.00 29.89  ? 466  ARG A NE    1 
ATOM   141  C CZ    . ARG A  1 21  ? 4.039   -16.747 -2.016  1.00 29.53  ? 466  ARG A CZ    1 
ATOM   142  N NH1   . ARG A  1 21  ? 3.883   -17.780 -1.233  1.00 30.61  ? 466  ARG A NH1   1 
ATOM   143  N NH2   . ARG A  1 21  ? 5.188   -16.559 -2.615  1.00 33.03  ? 466  ARG A NH2   1 
ATOM   144  N N     . CYS A  1 22  ? 3.862   -14.757 3.240   1.00 28.55  ? 467  CYS A N     1 
ATOM   145  C CA    . CYS A  1 22  ? 4.202   -15.592 4.430   1.00 27.56  ? 467  CYS A CA    1 
ATOM   146  C C     . CYS A  1 22  ? 3.683   -15.021 5.777   1.00 31.89  ? 467  CYS A C     1 
ATOM   147  O O     . CYS A  1 22  ? 3.801   -15.691 6.809   1.00 30.21  ? 467  CYS A O     1 
ATOM   148  C CB    . CYS A  1 22  ? 5.705   -15.814 4.543   1.00 29.91  ? 467  CYS A CB    1 
ATOM   149  S SG    . CYS A  1 22  ? 6.635   -14.325 5.090   1.00 29.21  ? 467  CYS A SG    1 
ATOM   150  N N     . GLY A  1 23  ? 3.078   -13.822 5.761   1.00 33.05  ? 468  GLY A N     1 
ATOM   151  C CA    . GLY A  1 23  ? 2.829   -13.047 7.007   1.00 34.20  ? 468  GLY A CA    1 
ATOM   152  C C     . GLY A  1 23  ? 1.760   -13.597 7.970   1.00 35.64  ? 468  GLY A C     1 
ATOM   153  O O     . GLY A  1 23  ? 0.799   -14.230 7.563   1.00 30.30  ? 468  GLY A O     1 
ATOM   154  N N     . ILE A  1 24  ? 1.926   -13.320 9.255   1.00 33.16  ? 469  ILE A N     1 
ATOM   155  C CA    . ILE A  1 24  ? 0.821   -13.457 10.201  1.00 40.09  ? 469  ILE A CA    1 
ATOM   156  C C     . ILE A  1 24  ? -0.350  -12.516 9.785   1.00 36.12  ? 469  ILE A C     1 
ATOM   157  O O     . ILE A  1 24  ? -0.142  -11.516 9.103   1.00 35.19  ? 469  ILE A O     1 
ATOM   158  C CB    . ILE A  1 24  ? 1.271   -13.108 11.649  1.00 43.03  ? 469  ILE A CB    1 
ATOM   159  C CG1   . ILE A  1 24  ? 1.702   -11.598 11.753  1.00 46.35  ? 469  ILE A CG1   1 
ATOM   160  C CG2   . ILE A  1 24  ? 2.393   -14.055 12.086  1.00 45.14  ? 469  ILE A CG2   1 
ATOM   161  C CD1   . ILE A  1 24  ? 1.856   -11.069 13.177  1.00 44.11  ? 469  ILE A CD1   1 
ATOM   162  N N     . ARG A  1 25  ? -1.572  -12.858 10.156  1.00 35.14  ? 470  ARG A N     1 
ATOM   163  C CA    . ARG A  1 25  ? -2.667  -11.928 9.952   1.00 33.55  ? 470  ARG A CA    1 
ATOM   164  C C     . ARG A  1 25  ? -2.425  -10.832 10.964  1.00 29.36  ? 470  ARG A C     1 
ATOM   165  O O     . ARG A  1 25  ? -2.236  -11.120 12.149  1.00 30.54  ? 470  ARG A O     1 
ATOM   166  C CB    . ARG A  1 25  ? -4.007  -12.630 10.194  1.00 45.43  ? 470  ARG A CB    1 
ATOM   167  C CG    . ARG A  1 25  ? -5.214  -11.697 10.179  1.00 56.00  ? 470  ARG A CG    1 
ATOM   168  C CD    . ARG A  1 25  ? -6.507  -12.438 10.488  1.00 66.78  ? 470  ARG A CD    1 
ATOM   169  N NE    . ARG A  1 25  ? -6.825  -13.455 9.473   1.00 73.34  ? 470  ARG A NE    1 
ATOM   170  C CZ    . ARG A  1 25  ? -7.231  -13.190 8.229   1.00 76.72  ? 470  ARG A CZ    1 
ATOM   171  N NH1   . ARG A  1 25  ? -7.358  -11.928 7.807   1.00 76.62  ? 470  ARG A NH1   1 
ATOM   172  N NH2   . ARG A  1 25  ? -7.504  -14.194 7.393   1.00 77.47  ? 470  ARG A NH2   1 
ATOM   173  N N     . LEU A  1 26  ? -2.367  -9.567  10.532  1.00 26.42  ? 471  LEU A N     1 
ATOM   174  C CA    . LEU A  1 26  ? -2.135  -8.478  11.489  1.00 24.27  ? 471  LEU A CA    1 
ATOM   175  C C     . LEU A  1 26  ? -3.316  -8.354  12.467  1.00 23.99  ? 471  LEU A C     1 
ATOM   176  O O     . LEU A  1 26  ? -4.440  -8.409  12.069  1.00 22.85  ? 471  LEU A O     1 
ATOM   177  C CB    . LEU A  1 26  ? -1.932  -7.121  10.745  1.00 23.61  ? 471  LEU A CB    1 
ATOM   178  C CG    . LEU A  1 26  ? -0.584  -6.990  10.024  1.00 26.25  ? 471  LEU A CG    1 
ATOM   179  C CD1   . LEU A  1 26  ? -0.529  -5.723  9.188   1.00 25.47  ? 471  LEU A CD1   1 
ATOM   180  C CD2   . LEU A  1 26  ? 0.577   -6.991  11.037  1.00 27.86  ? 471  LEU A CD2   1 
ATOM   181  N N     . PRO A  1 27  ? -3.040  -8.200  13.740  1.00 25.97  ? 472  PRO A N     1 
ATOM   182  C CA    . PRO A  1 27  ? -4.149  -7.795  14.606  1.00 29.89  ? 472  PRO A CA    1 
ATOM   183  C C     . PRO A  1 27  ? -4.641  -6.388  14.265  1.00 32.50  ? 472  PRO A C     1 
ATOM   184  O O     . PRO A  1 27  ? -4.015  -5.670  13.456  1.00 26.30  ? 472  PRO A O     1 
ATOM   185  C CB    . PRO A  1 27  ? -3.534  -7.801  15.983  1.00 30.42  ? 472  PRO A CB    1 
ATOM   186  C CG    . PRO A  1 27  ? -2.067  -7.598  15.758  1.00 32.05  ? 472  PRO A CG    1 
ATOM   187  C CD    . PRO A  1 27  ? -1.735  -8.143  14.409  1.00 28.40  ? 472  PRO A CD    1 
ATOM   188  N N     . LEU A  1 28  ? -5.756  -6.004  14.848  1.00 30.97  ? 473  LEU A N     1 
ATOM   189  C CA    . LEU A  1 28  ? -6.249  -4.656  14.692  1.00 32.15  ? 473  LEU A CA    1 
ATOM   190  C C     . LEU A  1 28  ? -5.200  -3.665  15.178  1.00 24.44  ? 473  LEU A C     1 
ATOM   191  O O     . LEU A  1 28  ? -4.581  -3.825  16.267  1.00 28.02  ? 473  LEU A O     1 
ATOM   192  C CB    . LEU A  1 28  ? -7.580  -4.464  15.475  1.00 38.88  ? 473  LEU A CB    1 
ATOM   193  C CG    . LEU A  1 28  ? -8.800  -5.234  14.901  1.00 43.56  ? 473  LEU A CG    1 
ATOM   194  C CD1   . LEU A  1 28  ? -10.023 -5.062  15.791  1.00 46.16  ? 473  LEU A CD1   1 
ATOM   195  C CD2   . LEU A  1 28  ? -9.132  -4.834  13.451  1.00 44.00  ? 473  LEU A CD2   1 
ATOM   196  N N     . LEU A  1 29  ? -5.006  -2.613  14.397  1.00 22.14  ? 474  LEU A N     1 
ATOM   197  C CA    . LEU A  1 29  ? -4.100  -1.538  14.803  1.00 20.11  ? 474  LEU A CA    1 
ATOM   198  C C     . LEU A  1 29  ? -4.765  -0.747  15.898  1.00 20.57  ? 474  LEU A C     1 
ATOM   199  O O     . LEU A  1 29  ? -5.839  -0.180  15.686  1.00 20.35  ? 474  LEU A O     1 
ATOM   200  C CB    . LEU A  1 29  ? -3.818  -0.622  13.593  1.00 19.96  ? 474  LEU A CB    1 
ATOM   201  C CG    . LEU A  1 29  ? -2.930  0.610   13.863  1.00 20.19  ? 474  LEU A CG    1 
ATOM   202  C CD1   . LEU A  1 29  ? -1.607  0.164   14.475  1.00 20.48  ? 474  LEU A CD1   1 
ATOM   203  C CD2   . LEU A  1 29  ? -2.699  1.414   12.578  1.00 19.78  ? 474  LEU A CD2   1 
ATOM   204  N N     . ARG A  1 30  ? -4.135  -0.632  17.028  1.00 22.84  ? 475  ARG A N     1 
ATOM   205  C CA    . ARG A  1 30  ? -4.669  0.227   18.074  1.00 26.13  ? 475  ARG A CA    1 
ATOM   206  C C     . ARG A  1 30  ? -3.583  0.712   18.986  1.00 22.58  ? 475  ARG A C     1 
ATOM   207  O O     . ARG A  1 30  ? -2.581  0.059   19.158  1.00 21.48  ? 475  ARG A O     1 
ATOM   208  C CB    . ARG A  1 30  ? -5.765  -0.485  18.866  1.00 33.17  ? 475  ARG A CB    1 
ATOM   209  C CG    . ARG A  1 30  ? -5.302  -1.703  19.592  1.00 41.86  ? 475  ARG A CG    1 
ATOM   210  C CD    . ARG A  1 30  ? -6.109  -1.958  20.877  1.00 55.76  ? 475  ARG A CD    1 
ATOM   211  N NE    . ARG A  1 30  ? -5.430  -2.948  21.724  1.00 63.09  ? 475  ARG A NE    1 
ATOM   212  C CZ    . ARG A  1 30  ? -4.790  -2.675  22.863  1.00 65.38  ? 475  ARG A CZ    1 
ATOM   213  N NH1   . ARG A  1 30  ? -4.765  -1.438  23.365  1.00 66.89  ? 475  ARG A NH1   1 
ATOM   214  N NH2   . ARG A  1 30  ? -4.184  -3.659  23.521  1.00 74.83  ? 475  ARG A NH2   1 
ATOM   215  N N     . PRO A  1 31  ? -3.766  1.874   19.569  1.00 23.31  ? 476  PRO A N     1 
ATOM   216  C CA    . PRO A  1 31  ? -2.792  2.370   20.523  1.00 22.35  ? 476  PRO A CA    1 
ATOM   217  C C     . PRO A  1 31  ? -2.836  1.600   21.823  1.00 26.12  ? 476  PRO A C     1 
ATOM   218  O O     . PRO A  1 31  ? -3.872  1.040   22.168  1.00 23.54  ? 476  PRO A O     1 
ATOM   219  C CB    . PRO A  1 31  ? -3.204  3.829   20.727  1.00 22.82  ? 476  PRO A CB    1 
ATOM   220  C CG    . PRO A  1 31  ? -4.596  3.922   20.277  1.00 21.86  ? 476  PRO A CG    1 
ATOM   221  C CD    . PRO A  1 31  ? -4.821  2.860   19.269  1.00 24.03  ? 476  PRO A CD    1 
ATOM   222  N N     . SER A  1 32  ? -1.696  1.530   22.503  1.00 25.32  ? 477  SER A N     1 
ATOM   223  C CA    . SER A  1 32  ? -1.555  0.781   23.742  1.00 27.81  ? 477  SER A CA    1 
ATOM   224  C C     . SER A  1 32  ? -0.334  1.278   24.405  1.00 27.99  ? 477  SER A C     1 
ATOM   225  O O     . SER A  1 32  ? 0.331   2.179   23.895  1.00 23.35  ? 477  SER A O     1 
ATOM   226  C CB    . SER A  1 32  ? -1.456  -0.754  23.487  1.00 30.47  ? 477  SER A CB    1 
ATOM   227  O OG    . SER A  1 32  ? -0.168  -1.130  22.962  1.00 31.56  ? 477  SER A OG    1 
ATOM   228  N N     . ALA A  1 33  ? -0.016  0.714   25.562  1.00 29.60  ? 478  ALA A N     1 
ATOM   229  C CA    . ALA A  1 33  ? 1.051   1.241   26.384  1.00 29.69  ? 478  ALA A CA    1 
ATOM   230  C C     . ALA A  1 33  ? 2.414   1.126   25.666  1.00 23.06  ? 478  ALA A C     1 
ATOM   231  O O     . ALA A  1 33  ? 3.328   1.921   25.923  1.00 25.64  ? 478  ALA A O     1 
ATOM   232  C CB    . ALA A  1 33  ? 1.103   0.500   27.739  1.00 32.34  ? 478  ALA A CB    1 
ATOM   233  N N     . ASN A  1 34  ? 2.559   0.160   24.798  1.00 21.34  ? 479  ASN A N     1 
ATOM   234  C CA    . ASN A  1 34  ? 3.847   0.007   24.090  1.00 21.93  ? 479  ASN A CA    1 
ATOM   235  C C     . ASN A  1 34  ? 3.781   0.310   22.585  1.00 21.70  ? 479  ASN A C     1 
ATOM   236  O O     . ASN A  1 34  ? 4.716   -0.012  21.829  1.00 21.18  ? 479  ASN A O     1 
ATOM   237  C CB    . ASN A  1 34  ? 4.436   -1.370  24.338  1.00 24.93  ? 479  ASN A CB    1 
ATOM   238  C CG    . ASN A  1 34  ? 3.659   -2.459  23.680  1.00 29.23  ? 479  ASN A CG    1 
ATOM   239  O OD1   . ASN A  1 34  ? 2.616   -2.218  23.021  1.00 34.88  ? 479  ASN A OD1   1 
ATOM   240  N ND2   . ASN A  1 34  ? 4.157   -3.685  23.815  1.00 35.91  ? 479  ASN A ND2   1 
ATOM   241  N N     . HIS A  1 35  ? 2.694   0.953   22.165  1.00 20.04  ? 480  HIS A N     1 
ATOM   242  C CA    . HIS A  1 35  ? 2.493   1.294   20.759  1.00 18.54  ? 480  HIS A CA    1 
ATOM   243  C C     . HIS A  1 35  ? 1.765   2.616   20.644  1.00 19.19  ? 480  HIS A C     1 
ATOM   244  O O     . HIS A  1 35  ? 0.547   2.698   20.925  1.00 20.54  ? 480  HIS A O     1 
ATOM   245  C CB    . HIS A  1 35  ? 1.706   0.229   20.077  1.00 17.33  ? 480  HIS A CB    1 
ATOM   246  C CG    . HIS A  1 35  ? 1.758   0.292   18.587  1.00 18.49  ? 480  HIS A CG    1 
ATOM   247  N ND1   . HIS A  1 35  ? 1.240   -0.703  17.783  1.00 20.90  ? 480  HIS A ND1   1 
ATOM   248  C CD2   . HIS A  1 35  ? 2.289   1.221   17.739  1.00 17.07  ? 480  HIS A CD2   1 
ATOM   249  C CE1   . HIS A  1 35  ? 1.445   -0.398  16.512  1.00 21.00  ? 480  HIS A CE1   1 
ATOM   250  N NE2   . HIS A  1 35  ? 2.086   0.764   16.460  1.00 16.98  ? 480  HIS A NE2   1 
ATOM   251  N N     . THR A  1 36  ? 2.498   3.624   20.235  1.00 16.38  ? 481  THR A N     1 
ATOM   252  C CA    . THR A  1 36  ? 1.965   4.952   19.970  1.00 17.07  ? 481  THR A CA    1 
ATOM   253  C C     . THR A  1 36  ? 1.445   4.989   18.520  1.00 16.60  ? 481  THR A C     1 
ATOM   254  O O     . THR A  1 36  ? 2.187   4.669   17.574  1.00 15.38  ? 481  THR A O     1 
ATOM   255  C CB    . THR A  1 36  ? 3.081   5.981   20.149  1.00 16.33  ? 481  THR A CB    1 
ATOM   256  O OG1   . THR A  1 36  ? 3.647   5.868   21.468  1.00 17.85  ? 481  THR A OG1   1 
ATOM   257  C CG2   . THR A  1 36  ? 2.636   7.385   19.921  1.00 16.44  ? 481  THR A CG2   1 
ATOM   258  N N     . VAL A  1 37  ? 0.204   5.442   18.325  1.00 16.20  ? 482  VAL A N     1 
ATOM   259  C CA    . VAL A  1 37  ? -0.408  5.533   16.998  1.00 14.58  ? 482  VAL A CA    1 
ATOM   260  C C     . VAL A  1 37  ? -0.962  6.944   16.836  1.00 16.15  ? 482  VAL A C     1 
ATOM   261  O O     . VAL A  1 37  ? -1.804  7.387   17.652  1.00 14.23  ? 482  VAL A O     1 
ATOM   262  C CB    . VAL A  1 37  ? -1.537  4.491   16.816  1.00 16.48  ? 482  VAL A CB    1 
ATOM   263  C CG1   . VAL A  1 37  ? -2.131  4.588   15.446  1.00 16.15  ? 482  VAL A CG1   1 
ATOM   264  C CG2   . VAL A  1 37  ? -1.015  3.068   17.039  1.00 16.03  ? 482  VAL A CG2   1 
ATOM   265  N N     . THR A  1 38  ? -0.456  7.684   15.823  1.00 15.71  ? 483  THR A N     1 
ATOM   266  C CA    . THR A  1 38  ? -0.687  9.133   15.706  1.00 15.60  ? 483  THR A CA    1 
ATOM   267  C C     . THR A  1 38  ? -1.814  9.501   14.731  1.00 15.41  ? 483  THR A C     1 
ATOM   268  O O     . THR A  1 38  ? -2.024  10.670  14.421  1.00 16.34  ? 483  THR A O     1 
ATOM   269  C CB    . THR A  1 38  ? 0.616   9.881   15.344  1.00 16.20  ? 483  THR A CB    1 
ATOM   270  O OG1   . THR A  1 38  ? 1.139   9.390   14.095  1.00 15.69  ? 483  THR A OG1   1 
ATOM   271  C CG2   . THR A  1 38  ? 1.657   9.684   16.440  1.00 16.83  ? 483  THR A CG2   1 
ATOM   272  N N     . ILE A  1 39  ? -2.609  8.508   14.329  1.00 15.23  ? 484  ILE A N     1 
ATOM   273  C CA    . ILE A  1 39  ? -3.690  8.730   13.405  1.00 15.32  ? 484  ILE A CA    1 
ATOM   274  C C     . ILE A  1 39  ? -4.958  8.033   13.896  1.00 15.93  ? 484  ILE A C     1 
ATOM   275  O O     . ILE A  1 39  ? -4.909  7.256   14.863  1.00 15.24  ? 484  ILE A O     1 
ATOM   276  C CB    . ILE A  1 39  ? -3.321  8.291   11.985  1.00 16.09  ? 484  ILE A CB    1 
ATOM   277  C CG1   . ILE A  1 39  ? -2.829  6.849   11.953  1.00 16.97  ? 484  ILE A CG1   1 
ATOM   278  C CG2   . ILE A  1 39  ? -2.224  9.200   11.433  1.00 16.27  ? 484  ILE A CG2   1 
ATOM   279  C CD1   . ILE A  1 39  ? -3.909  5.830   11.843  1.00 18.11  ? 484  ILE A CD1   1 
ATOM   280  N N     . ARG A  1 40  ? -6.091  8.372   13.266  1.00 16.51  ? 485  ARG A N     1 
ATOM   281  C CA    . ARG A  1 40  ? -7.405  7.741   13.564  1.00 17.02  ? 485  ARG A CA    1 
ATOM   282  C C     . ARG A  1 40  ? -7.538  6.363   12.932  1.00 16.45  ? 485  ARG A C     1 
ATOM   283  O O     . ARG A  1 40  ? -7.817  6.224   11.742  1.00 16.10  ? 485  ARG A O     1 
ATOM   284  C CB    . ARG A  1 40  ? -8.537  8.635   13.070  1.00 15.91  ? 485  ARG A CB    1 
ATOM   285  C CG    . ARG A  1 40  ? -8.630  9.943   13.871  1.00 18.10  ? 485  ARG A CG    1 
ATOM   286  C CD    . ARG A  1 40  ? -9.376  9.756   15.196  1.00 19.02  ? 485  ARG A CD    1 
ATOM   287  N NE    . ARG A  1 40  ? -10.770 9.333   14.948  1.00 20.32  ? 485  ARG A NE    1 
ATOM   288  C CZ    . ARG A  1 40  ? -11.787 10.156  14.680  1.00 23.47  ? 485  ARG A CZ    1 
ATOM   289  N NH1   . ARG A  1 40  ? -11.614 11.454  14.606  1.00 22.25  ? 485  ARG A NH1   1 
ATOM   290  N NH2   . ARG A  1 40  ? -12.999 9.668   14.527  1.00 23.31  ? 485  ARG A NH2   1 
ATOM   291  N N     . VAL A  1 41  ? -7.385  5.324   13.743  1.00 18.29  ? 486  VAL A N     1 
ATOM   292  C CA    A VAL A  1 41  ? -7.482  3.952   13.268  0.70 18.38  ? 486  VAL A CA    1 
ATOM   293  C CA    B VAL A  1 41  ? -7.471  3.970   13.198  0.30 18.62  ? 486  VAL A CA    1 
ATOM   294  C C     . VAL A  1 41  ? -8.867  3.628   12.721  1.00 19.56  ? 486  VAL A C     1 
ATOM   295  O O     . VAL A  1 41  ? -9.012  2.844   11.805  1.00 18.78  ? 486  VAL A O     1 
ATOM   296  C CB    A VAL A  1 41  ? -7.046  2.946   14.395  0.70 19.64  ? 486  VAL A CB    1 
ATOM   297  C CB    B VAL A  1 41  ? -7.008  2.885   14.178  0.30 19.38  ? 486  VAL A CB    1 
ATOM   298  C CG1   A VAL A  1 41  ? -5.608  3.232   14.807  0.70 19.66  ? 486  VAL A CG1   1 
ATOM   299  C CG1   B VAL A  1 41  ? -7.004  1.533   13.458  0.30 19.37  ? 486  VAL A CG1   1 
ATOM   300  C CG2   A VAL A  1 41  ? -7.978  2.987   15.614  0.70 19.97  ? 486  VAL A CG2   1 
ATOM   301  C CG2   B VAL A  1 41  ? -5.624  3.211   14.717  0.30 19.25  ? 486  VAL A CG2   1 
ATOM   302  N N     . ASP A  1 42  ? -9.903  4.267   13.296  1.00 20.98  ? 487  ASP A N     1 
ATOM   303  C CA    . ASP A  1 42  ? -11.263 4.037   12.860  1.00 19.86  ? 487  ASP A CA    1 
ATOM   304  C C     . ASP A  1 42  ? -11.549 4.614   11.482  1.00 21.25  ? 487  ASP A C     1 
ATOM   305  O O     . ASP A  1 42  ? -12.528 4.240   10.867  1.00 20.75  ? 487  ASP A O     1 
ATOM   306  C CB    . ASP A  1 42  ? -12.273 4.573   13.920  1.00 22.80  ? 487  ASP A CB    1 
ATOM   307  C CG    . ASP A  1 42  ? -12.071 6.062   14.241  1.00 24.78  ? 487  ASP A CG    1 
ATOM   308  O OD1   . ASP A  1 42  ? -10.883 6.533   14.422  1.00 23.67  ? 487  ASP A OD1   1 
ATOM   309  O OD2   . ASP A  1 42  ? -13.112 6.776   14.342  1.00 27.78  ? 487  ASP A OD2   1 
ATOM   310  N N     . LEU A  1 43  ? -10.694 5.528   10.995  1.00 18.39  ? 488  LEU A N     1 
ATOM   311  C CA    . LEU A  1 43  ? -10.898 6.183   9.737   1.00 17.93  ? 488  LEU A CA    1 
ATOM   312  C C     . LEU A  1 43  ? -9.842  5.809   8.676   1.00 18.08  ? 488  LEU A C     1 
ATOM   313  O O     . LEU A  1 43  ? -9.787  6.411   7.615   1.00 20.58  ? 488  LEU A O     1 
ATOM   314  C CB    . LEU A  1 43  ? -10.862 7.727   9.919   1.00 18.09  ? 488  LEU A CB    1 
ATOM   315  C CG    . LEU A  1 43  ? -11.896 8.347   10.891  1.00 18.54  ? 488  LEU A CG    1 
ATOM   316  C CD1   . LEU A  1 43  ? -11.793 9.868   10.902  1.00 18.84  ? 488  LEU A CD1   1 
ATOM   317  C CD2   . LEU A  1 43  ? -13.293 7.884   10.492  1.00 18.54  ? 488  LEU A CD2   1 
ATOM   318  N N     . LEU A  1 44  ? -9.007  4.834   8.962   1.00 18.11  ? 489  LEU A N     1 
ATOM   319  C CA    . LEU A  1 44  ? -7.937  4.476   8.030   1.00 17.61  ? 489  LEU A CA    1 
ATOM   320  C C     . LEU A  1 44  ? -8.501  3.724   6.884   1.00 18.49  ? 489  LEU A C     1 
ATOM   321  O O     . LEU A  1 44  ? -9.140  2.734   7.107   1.00 20.38  ? 489  LEU A O     1 
ATOM   322  C CB    . LEU A  1 44  ? -6.896  3.608   8.768   1.00 18.64  ? 489  LEU A CB    1 
ATOM   323  C CG    . LEU A  1 44  ? -5.653  3.151   7.984   1.00 18.94  ? 489  LEU A CG    1 
ATOM   324  C CD1   . LEU A  1 44  ? -4.800  4.358   7.701   1.00 18.29  ? 489  LEU A CD1   1 
ATOM   325  C CD2   . LEU A  1 44  ? -4.890  2.135   8.846   1.00 20.31  ? 489  LEU A CD2   1 
ATOM   326  N N     . ARG A  1 45  ? -8.285  4.200   5.652   1.00 17.40  ? 490  ARG A N     1 
ATOM   327  C CA    . ARG A  1 45  ? -8.812  3.576   4.437   1.00 20.40  ? 490  ARG A CA    1 
ATOM   328  C C     . ARG A  1 45  ? -7.820  3.661   3.320   1.00 20.45  ? 490  ARG A C     1 
ATOM   329  O O     . ARG A  1 45  ? -7.226  4.710   3.103   1.00 16.17  ? 490  ARG A O     1 
ATOM   330  C CB    . ARG A  1 45  ? -10.123 4.276   3.894   1.00 24.85  ? 490  ARG A CB    1 
ATOM   331  C CG    . ARG A  1 45  ? -11.215 4.567   4.898   1.00 31.65  ? 490  ARG A CG    1 
ATOM   332  C CD    . ARG A  1 45  ? -12.421 3.664   4.757   1.00 42.76  ? 490  ARG A CD    1 
ATOM   333  N NE    . ARG A  1 45  ? -12.398 2.641   5.795   1.00 54.71  ? 490  ARG A NE    1 
ATOM   334  C CZ    . ARG A  1 45  ? -12.682 2.849   7.089   1.00 64.85  ? 490  ARG A CZ    1 
ATOM   335  N NH1   . ARG A  1 45  ? -13.059 4.050   7.530   1.00 70.44  ? 490  ARG A NH1   1 
ATOM   336  N NH2   . ARG A  1 45  ? -12.597 1.841   7.946   1.00 72.21  ? 490  ARG A NH2   1 
ATOM   337  N N     . ALA A  1 46  ? -7.756  2.615   2.507   1.00 20.22  ? 491  ALA A N     1 
ATOM   338  C CA    . ALA A  1 46  ? -6.884  2.613   1.357   1.00 21.12  ? 491  ALA A CA    1 
ATOM   339  C C     . ALA A  1 46  ? -7.144  3.806   0.388   1.00 20.94  ? 491  ALA A C     1 
ATOM   340  O O     . ALA A  1 46  ? -8.286  4.115   0.058   1.00 20.98  ? 491  ALA A O     1 
ATOM   341  C CB    . ALA A  1 46  ? -7.012  1.285   0.615   1.00 21.48  ? 491  ALA A CB    1 
ATOM   342  N N     . GLY A  1 47  ? -6.081  4.479   -0.015  1.00 18.21  ? 492  GLY A N     1 
ATOM   343  C CA    . GLY A  1 47  ? -6.168  5.611   -0.951  1.00 20.25  ? 492  GLY A CA    1 
ATOM   344  C C     . GLY A  1 47  ? -6.661  6.932   -0.329  1.00 20.29  ? 492  GLY A C     1 
ATOM   345  O O     . GLY A  1 47  ? -6.867  7.894   -1.027  1.00 21.34  ? 492  GLY A O     1 
ATOM   346  N N     . GLU A  1 48  ? -6.905  6.954   0.975   1.00 18.25  ? 493  GLU A N     1 
ATOM   347  C CA    . GLU A  1 48  ? -7.257  8.209   1.670   1.00 18.80  ? 493  GLU A CA    1 
ATOM   348  C C     . GLU A  1 48  ? -6.104  8.684   2.585   1.00 17.96  ? 493  GLU A C     1 
ATOM   349  O O     . GLU A  1 48  ? -5.483  7.879   3.265   1.00 15.67  ? 493  GLU A O     1 
ATOM   350  C CB    . GLU A  1 48  ? -8.486  7.972   2.536   1.00 19.65  ? 493  GLU A CB    1 
ATOM   351  C CG    . GLU A  1 48  ? -9.760  7.786   1.749   1.00 18.68  ? 493  GLU A CG    1 
ATOM   352  C CD    . GLU A  1 48  ? -11.030 7.818   2.616   1.00 19.19  ? 493  GLU A CD    1 
ATOM   353  O OE1   . GLU A  1 48  ? -11.032 8.316   3.753   1.00 20.43  ? 493  GLU A OE1   1 
ATOM   354  O OE2   . GLU A  1 48  ? -12.040 7.239   2.170   1.00 25.22  ? 493  GLU A OE2   1 
ATOM   355  N N     . VAL A  1 49  ? -5.889  10.000  2.657   1.00 16.34  ? 494  VAL A N     1 
ATOM   356  C CA    . VAL A  1 49  ? -4.959  10.581  3.620   1.00 14.86  ? 494  VAL A CA    1 
ATOM   357  C C     . VAL A  1 49  ? -5.418  10.333  5.057   1.00 14.26  ? 494  VAL A C     1 
ATOM   358  O O     . VAL A  1 49  ? -6.512  10.667  5.403   1.00 13.58  ? 494  VAL A O     1 
ATOM   359  C CB    . VAL A  1 49  ? -4.774  12.129  3.365   1.00 15.95  ? 494  VAL A CB    1 
ATOM   360  C CG1   . VAL A  1 49  ? -3.758  12.727  4.345   1.00 16.84  ? 494  VAL A CG1   1 
ATOM   361  C CG2   . VAL A  1 49  ? -4.319  12.377  1.907   1.00 16.12  ? 494  VAL A CG2   1 
ATOM   362  N N     . PRO A  1 50  ? -4.564  9.711   5.912   1.00 16.75  ? 495  PRO A N     1 
ATOM   363  C CA    . PRO A  1 50  ? -4.995  9.485   7.315   1.00 15.43  ? 495  PRO A CA    1 
ATOM   364  C C     . PRO A  1 50  ? -5.252  10.793  8.079   1.00 15.05  ? 495  PRO A C     1 
ATOM   365  O O     . PRO A  1 50  ? -4.624  11.817  7.779   1.00 13.32  ? 495  PRO A O     1 
ATOM   366  C CB    . PRO A  1 50  ? -3.803  8.720   7.946   1.00 16.62  ? 495  PRO A CB    1 
ATOM   367  C CG    . PRO A  1 50  ? -3.043  8.146   6.770   1.00 17.81  ? 495  PRO A CG    1 
ATOM   368  C CD    . PRO A  1 50  ? -3.226  9.129   5.640   1.00 16.86  ? 495  PRO A CD    1 
ATOM   369  N N     . LYS A  1 51  ? -6.200  10.735  9.010   1.00 14.23  ? 496  LYS A N     1 
ATOM   370  C CA    . LYS A  1 51  ? -6.568  11.861  9.868   1.00 14.82  ? 496  LYS A CA    1 
ATOM   371  C C     . LYS A  1 51  ? -5.794  11.812  11.153  1.00 13.49  ? 496  LYS A C     1 
ATOM   372  O O     . LYS A  1 51  ? -5.767  10.756  11.838  1.00 15.46  ? 496  LYS A O     1 
ATOM   373  C CB    . LYS A  1 51  ? -8.080  11.830  10.190  1.00 15.45  ? 496  LYS A CB    1 
ATOM   374  C CG    . LYS A  1 51  ? -8.600  13.082  10.899  1.00 16.98  ? 496  LYS A CG    1 
ATOM   375  C CD    . LYS A  1 51  ? -10.093 12.959  11.233  1.00 19.27  ? 496  LYS A CD    1 
ATOM   376  C CE    . LYS A  1 51  ? -10.811 14.291  11.370  1.00 20.08  ? 496  LYS A CE    1 
ATOM   377  N NZ    . LYS A  1 51  ? -10.328 15.150  12.452  1.00 19.09  ? 496  LYS A NZ    1 
ATOM   378  N N     . PRO A  1 52  ? -5.171  12.930  11.536  1.00 13.97  ? 497  PRO A N     1 
ATOM   379  C CA    . PRO A  1 52  ? -4.402  12.948  12.755  1.00 14.59  ? 497  PRO A CA    1 
ATOM   380  C C     . PRO A  1 52  ? -5.289  12.730  13.970  1.00 16.57  ? 497  PRO A C     1 
ATOM   381  O O     . PRO A  1 52  ? -6.497  13.153  13.961  1.00 15.53  ? 497  PRO A O     1 
ATOM   382  C CB    . PRO A  1 52  ? -3.814  14.382  12.754  1.00 15.48  ? 497  PRO A CB    1 
ATOM   383  C CG    . PRO A  1 52  ? -3.692  14.711  11.304  1.00 15.02  ? 497  PRO A CG    1 
ATOM   384  C CD    . PRO A  1 52  ? -4.924  14.137  10.724  1.00 14.62  ? 497  PRO A CD    1 
ATOM   385  N N     . PHE A  1 53  ? -4.750  12.038  14.975  1.00 16.10  ? 498  PHE A N     1 
ATOM   386  C CA    . PHE A  1 53  ? -5.387  11.932  16.262  1.00 18.51  ? 498  PHE A CA    1 
ATOM   387  C C     . PHE A  1 53  ? -4.413  12.324  17.344  1.00 17.81  ? 498  PHE A C     1 
ATOM   388  O O     . PHE A  1 53  ? -3.274  11.786  17.386  1.00 19.05  ? 498  PHE A O     1 
ATOM   389  C CB    . PHE A  1 53  ? -5.883  10.489  16.574  1.00 20.85  ? 498  PHE A CB    1 
ATOM   390  C CG    . PHE A  1 53  ? -6.489  10.367  17.954  1.00 22.47  ? 498  PHE A CG    1 
ATOM   391  C CD1   . PHE A  1 53  ? -7.767  10.884  18.209  1.00 24.65  ? 498  PHE A CD1   1 
ATOM   392  C CD2   . PHE A  1 53  ? -5.763  9.865   19.015  1.00 25.99  ? 498  PHE A CD2   1 
ATOM   393  C CE1   . PHE A  1 53  ? -8.326  10.819  19.490  1.00 25.94  ? 498  PHE A CE1   1 
ATOM   394  C CE2   . PHE A  1 53  ? -6.327  9.802   20.300  1.00 30.32  ? 498  PHE A CE2   1 
ATOM   395  C CZ    . PHE A  1 53  ? -7.615  10.265  20.522  1.00 27.77  ? 498  PHE A CZ    1 
ATOM   396  N N     . PRO A  1 54  ? -4.812  13.243  18.253  1.00 18.12  ? 499  PRO A N     1 
ATOM   397  C CA    . PRO A  1 54  ? -6.101  13.959  18.339  1.00 18.78  ? 499  PRO A CA    1 
ATOM   398  C C     . PRO A  1 54  ? -6.311  15.010  17.277  1.00 19.46  ? 499  PRO A C     1 
ATOM   399  O O     . PRO A  1 54  ? -5.418  15.321  16.451  1.00 17.97  ? 499  PRO A O     1 
ATOM   400  C CB    . PRO A  1 54  ? -6.024  14.655  19.723  1.00 19.48  ? 499  PRO A CB    1 
ATOM   401  C CG    . PRO A  1 54  ? -4.552  14.908  19.919  1.00 20.30  ? 499  PRO A CG    1 
ATOM   402  C CD    . PRO A  1 54  ? -3.840  13.749  19.242  1.00 17.62  ? 499  PRO A CD    1 
ATOM   403  N N     . THR A  1 55  ? -7.466  15.630  17.334  1.00 18.66  ? 500  THR A N     1 
ATOM   404  C CA    . THR A  1 55  ? -7.862  16.555  16.300  1.00 21.95  ? 500  THR A CA    1 
ATOM   405  C C     . THR A  1 55  ? -7.083  17.884  16.443  1.00 21.43  ? 500  THR A C     1 
ATOM   406  O O     . THR A  1 55  ? -6.654  18.437  15.452  1.00 25.15  ? 500  THR A O     1 
ATOM   407  C CB    . THR A  1 55  ? -9.409  16.793  16.358  1.00 23.43  ? 500  THR A CB    1 
ATOM   408  O OG1   . THR A  1 55  ? -10.087 15.541  16.109  1.00 23.25  ? 500  THR A OG1   1 
ATOM   409  C CG2   . THR A  1 55  ? -9.841  17.824  15.338  1.00 24.46  ? 500  THR A CG2   1 
ATOM   410  N N     . HIS A  1 56  ? -6.873  18.335  17.688  1.00 21.74  ? 501  HIS A N     1 
ATOM   411  C CA    A HIS A  1 56  ? -6.119  19.567  17.903  0.50 21.51  ? 501  HIS A CA    1 
ATOM   412  C CA    B HIS A  1 56  ? -6.182  19.613  18.042  0.50 23.24  ? 501  HIS A CA    1 
ATOM   413  C C     . HIS A  1 56  ? -4.788  19.283  18.600  1.00 20.63  ? 501  HIS A C     1 
ATOM   414  O O     . HIS A  1 56  ? -4.649  18.362  19.377  1.00 18.73  ? 501  HIS A O     1 
ATOM   415  C CB    A HIS A  1 56  ? -6.945  20.606  18.688  0.50 23.44  ? 501  HIS A CB    1 
ATOM   416  C CB    B HIS A  1 56  ? -7.004  20.351  19.161  0.50 27.73  ? 501  HIS A CB    1 
ATOM   417  C CG    A HIS A  1 56  ? -8.337  20.782  18.166  0.50 23.94  ? 501  HIS A CG    1 
ATOM   418  C CG    B HIS A  1 56  ? -6.488  21.726  19.533  0.50 32.85  ? 501  HIS A CG    1 
ATOM   419  N ND1   A HIS A  1 56  ? -8.606  21.358  16.941  0.50 23.66  ? 501  HIS A ND1   1 
ATOM   420  N ND1   B HIS A  1 56  ? -7.306  22.840  19.567  0.50 37.17  ? 501  HIS A ND1   1 
ATOM   421  C CD2   A HIS A  1 56  ? -9.529  20.373  18.661  0.50 24.11  ? 501  HIS A CD2   1 
ATOM   422  C CD2   B HIS A  1 56  ? -5.264  22.151  19.941  0.50 34.26  ? 501  HIS A CD2   1 
ATOM   423  C CE1   A HIS A  1 56  ? -9.905  21.324  16.723  0.50 24.26  ? 501  HIS A CE1   1 
ATOM   424  C CE1   B HIS A  1 56  ? -6.601  23.891  19.957  0.50 36.51  ? 501  HIS A CE1   1 
ATOM   425  N NE2   A HIS A  1 56  ? -10.486 20.724  17.750  0.50 24.46  ? 501  HIS A NE2   1 
ATOM   426  N NE2   B HIS A  1 56  ? -5.357  23.501  20.177  0.50 35.22  ? 501  HIS A NE2   1 
ATOM   427  N N     . TYR A  1 57  ? -3.808  20.113  18.284  1.00 20.23  ? 502  TYR A N     1 
ATOM   428  C CA    . TYR A  1 57  ? -2.447  19.993  18.807  1.00 19.49  ? 502  TYR A CA    1 
ATOM   429  C C     . TYR A  1 57  ? -2.410  19.865  20.342  1.00 21.21  ? 502  TYR A C     1 
ATOM   430  O O     . TYR A  1 57  ? -3.044  20.640  21.090  1.00 19.07  ? 502  TYR A O     1 
ATOM   431  C CB    . TYR A  1 57  ? -1.612  21.234  18.327  1.00 20.67  ? 502  TYR A CB    1 
ATOM   432  C CG    . TYR A  1 57  ? -0.147  21.124  18.717  1.00 20.75  ? 502  TYR A CG    1 
ATOM   433  C CD1   . TYR A  1 57  ? 0.738   20.326  17.966  1.00 18.77  ? 502  TYR A CD1   1 
ATOM   434  C CD2   . TYR A  1 57  ? 0.348   21.783  19.864  1.00 20.40  ? 502  TYR A CD2   1 
ATOM   435  C CE1   . TYR A  1 57  ? 2.068   20.170  18.347  1.00 19.43  ? 502  TYR A CE1   1 
ATOM   436  C CE2   . TYR A  1 57  ? 1.712   21.701  20.211  1.00 22.93  ? 502  TYR A CE2   1 
ATOM   437  C CZ    . TYR A  1 57  ? 2.562   20.875  19.462  1.00 20.95  ? 502  TYR A CZ    1 
ATOM   438  O OH    . TYR A  1 57  ? 3.885   20.742  19.842  1.00 20.52  ? 502  TYR A OH    1 
ATOM   439  N N     . LYS A  1 58  ? -1.692  18.878  20.812  1.00 20.80  ? 503  LYS A N     1 
ATOM   440  C CA    . LYS A  1 58  ? -1.354  18.755  22.239  1.00 23.69  ? 503  LYS A CA    1 
ATOM   441  C C     . LYS A  1 58  ? 0.162   18.709  22.372  1.00 24.55  ? 503  LYS A C     1 
ATOM   442  O O     . LYS A  1 58  ? 0.833   18.040  21.557  1.00 21.49  ? 503  LYS A O     1 
ATOM   443  C CB    . LYS A  1 58  ? -1.985  17.490  22.806  1.00 30.60  ? 503  LYS A CB    1 
ATOM   444  C CG    . LYS A  1 58  ? -1.341  17.011  24.094  1.00 40.21  ? 503  LYS A CG    1 
ATOM   445  C CD    . LYS A  1 58  ? -2.070  15.816  24.709  1.00 49.06  ? 503  LYS A CD    1 
ATOM   446  C CE    . LYS A  1 58  ? -1.198  15.166  25.791  1.00 57.58  ? 503  LYS A CE    1 
ATOM   447  N NZ    . LYS A  1 58  ? -1.881  14.032  26.462  1.00 61.94  ? 503  LYS A NZ    1 
ATOM   448  N N     . ASP A  1 59  ? 0.701   19.512  23.305  1.00 23.34  ? 504  ASP A N     1 
ATOM   449  C CA    . ASP A  1 59  ? 2.146   19.714  23.460  1.00 23.83  ? 504  ASP A CA    1 
ATOM   450  C C     . ASP A  1 59  ? 2.645   19.013  24.687  1.00 26.11  ? 504  ASP A C     1 
ATOM   451  O O     . ASP A  1 59  ? 1.988   19.049  25.731  1.00 23.02  ? 504  ASP A O     1 
ATOM   452  C CB    . ASP A  1 59  ? 2.462   21.192  23.606  1.00 24.89  ? 504  ASP A CB    1 
ATOM   453  C CG    . ASP A  1 59  ? 3.955   21.494  23.431  1.00 27.06  ? 504  ASP A CG    1 
ATOM   454  O OD1   . ASP A  1 59  ? 4.536   21.226  22.336  1.00 26.63  ? 504  ASP A OD1   1 
ATOM   455  O OD2   . ASP A  1 59  ? 4.553   22.056  24.379  1.00 27.57  ? 504  ASP A OD2   1 
ATOM   456  N N     . LEU A  1 60  ? 3.799   18.334  24.568  1.00 21.34  ? 505  LEU A N     1 
ATOM   457  C CA    . LEU A  1 60  ? 4.600   17.968  25.728  1.00 22.56  ? 505  LEU A CA    1 
ATOM   458  C C     . LEU A  1 60  ? 5.996   18.427  25.490  1.00 23.92  ? 505  LEU A C     1 
ATOM   459  O O     . LEU A  1 60  ? 6.559   18.217  24.390  1.00 24.51  ? 505  LEU A O     1 
ATOM   460  C CB    . LEU A  1 60  ? 4.590   16.450  25.983  1.00 24.79  ? 505  LEU A CB    1 
ATOM   461  C CG    . LEU A  1 60  ? 3.302   15.787  26.478  1.00 24.33  ? 505  LEU A CG    1 
ATOM   462  C CD1   . LEU A  1 60  ? 3.470   14.275  26.514  1.00 24.42  ? 505  LEU A CD1   1 
ATOM   463  C CD2   . LEU A  1 60  ? 2.899   16.327  27.833  1.00 28.36  ? 505  LEU A CD2   1 
ATOM   464  N N     . TRP A  1 61  ? 6.588   19.036  26.523  1.00 22.64  ? 506  TRP A N     1 
ATOM   465  C CA    . TRP A  1 61  ? 7.940   19.578  26.455  1.00 22.86  ? 506  TRP A CA    1 
ATOM   466  C C     . TRP A  1 61  ? 8.685   19.065  27.687  1.00 26.86  ? 506  TRP A C     1 
ATOM   467  O O     . TRP A  1 61  ? 8.678   19.709  28.772  1.00 24.07  ? 506  TRP A O     1 
ATOM   468  C CB    . TRP A  1 61  ? 7.878   21.100  26.414  1.00 22.87  ? 506  TRP A CB    1 
ATOM   469  C CG    . TRP A  1 61  ? 9.187   21.830  26.237  1.00 22.52  ? 506  TRP A CG    1 
ATOM   470  C CD1   . TRP A  1 61  ? 9.983   22.320  27.235  1.00 23.02  ? 506  TRP A CD1   1 
ATOM   471  C CD2   . TRP A  1 61  ? 9.739   22.330  25.012  1.00 22.16  ? 506  TRP A CD2   1 
ATOM   472  N NE1   . TRP A  1 61  ? 11.043  22.984  26.711  1.00 23.03  ? 506  TRP A NE1   1 
ATOM   473  C CE2   . TRP A  1 61  ? 10.910  23.028  25.343  1.00 22.78  ? 506  TRP A CE2   1 
ATOM   474  C CE3   . TRP A  1 61  ? 9.392   22.193  23.670  1.00 21.73  ? 506  TRP A CE3   1 
ATOM   475  C CZ2   . TRP A  1 61  ? 11.745  23.582  24.388  1.00 23.79  ? 506  TRP A CZ2   1 
ATOM   476  C CZ3   . TRP A  1 61  ? 10.191  22.758  22.724  1.00 21.29  ? 506  TRP A CZ3   1 
ATOM   477  C CH2   . TRP A  1 61  ? 11.377  23.448  23.078  1.00 23.43  ? 506  TRP A CH2   1 
ATOM   478  N N     . ASP A  1 62  ? 9.274   17.883  27.552  1.00 22.44  ? 507  ASP A N     1 
ATOM   479  C CA    . ASP A  1 62  ? 9.841   17.176  28.698  1.00 23.81  ? 507  ASP A CA    1 
ATOM   480  C C     . ASP A  1 62  ? 10.919  16.254  28.192  1.00 25.29  ? 507  ASP A C     1 
ATOM   481  O O     . ASP A  1 62  ? 11.245  16.275  26.951  1.00 24.08  ? 507  ASP A O     1 
ATOM   482  C CB    . ASP A  1 62  ? 8.749   16.443  29.505  1.00 22.62  ? 507  ASP A CB    1 
ATOM   483  C CG    . ASP A  1 62  ? 8.000   15.339  28.699  1.00 24.52  ? 507  ASP A CG    1 
ATOM   484  O OD1   . ASP A  1 62  ? 8.614   14.596  27.835  1.00 22.55  ? 507  ASP A OD1   1 
ATOM   485  O OD2   . ASP A  1 62  ? 6.830   15.114  29.037  1.00 23.05  ? 507  ASP A OD2   1 
ATOM   486  N N     . ASN A  1 63  ? 11.480  15.437  29.085  1.00 24.26  ? 508  ASN A N     1 
ATOM   487  C CA    . ASN A  1 63  ? 12.629  14.657  28.715  1.00 26.22  ? 508  ASN A CA    1 
ATOM   488  C C     . ASN A  1 63  ? 12.286  13.270  28.171  1.00 23.24  ? 508  ASN A C     1 
ATOM   489  O O     . ASN A  1 63  ? 13.175  12.435  27.986  1.00 23.70  ? 508  ASN A O     1 
ATOM   490  C CB    . ASN A  1 63  ? 13.660  14.617  29.857  1.00 31.64  ? 508  ASN A CB    1 
ATOM   491  C CG    . ASN A  1 63  ? 13.206  13.808  31.028  1.00 39.79  ? 508  ASN A CG    1 
ATOM   492  O OD1   . ASN A  1 63  ? 12.071  13.333  31.075  1.00 45.04  ? 508  ASN A OD1   1 
ATOM   493  N ND2   . ASN A  1 63  ? 14.111  13.644  32.027  1.00 47.10  ? 508  ASN A ND2   1 
ATOM   494  N N     . LYS A  1 64  ? 11.010  13.040  27.881  1.00 21.55  ? 509  LYS A N     1 
ATOM   495  C CA    . LYS A  1 64  ? 10.557  11.794  27.357  1.00 21.35  ? 509  LYS A CA    1 
ATOM   496  C C     . LYS A  1 64  ? 9.891   11.908  25.964  1.00 18.74  ? 509  LYS A C     1 
ATOM   497  O O     . LYS A  1 64  ? 9.456   10.888  25.397  1.00 19.12  ? 509  LYS A O     1 
ATOM   498  C CB    . LYS A  1 64  ? 9.603   11.112  28.328  1.00 24.95  ? 509  LYS A CB    1 
ATOM   499  C CG    . LYS A  1 64  ? 10.284  10.534  29.578  1.00 30.48  ? 509  LYS A CG    1 
ATOM   500  C CD    . LYS A  1 64  ? 9.320   9.706   30.391  1.00 34.51  ? 509  LYS A CD    1 
ATOM   501  C CE    . LYS A  1 64  ? 10.060  8.723   31.274  1.00 45.81  ? 509  LYS A CE    1 
ATOM   502  N NZ    . LYS A  1 64  ? 9.508   8.761   32.654  1.00 53.65  ? 509  LYS A NZ    1 
ATOM   503  N N     . HIS A  1 65  ? 9.823   13.108  25.433  1.00 18.57  ? 510  HIS A N     1 
ATOM   504  C CA    . HIS A  1 65  ? 9.213   13.356  24.151  1.00 18.66  ? 510  HIS A CA    1 
ATOM   505  C C     . HIS A  1 65  ? 10.049  14.262  23.282  1.00 18.24  ? 510  HIS A C     1 
ATOM   506  O O     . HIS A  1 65  ? 10.873  15.080  23.757  1.00 16.73  ? 510  HIS A O     1 
ATOM   507  C CB    . HIS A  1 65  ? 7.794   13.914  24.324  1.00 18.90  ? 510  HIS A CB    1 
ATOM   508  C CG    . HIS A  1 65  ? 6.893   12.993  25.049  1.00 18.22  ? 510  HIS A CG    1 
ATOM   509  N ND1   . HIS A  1 65  ? 6.914   12.861  26.421  1.00 20.71  ? 510  HIS A ND1   1 
ATOM   510  C CD2   . HIS A  1 65  ? 5.984   12.110  24.602  1.00 18.64  ? 510  HIS A CD2   1 
ATOM   511  C CE1   . HIS A  1 65  ? 6.089   11.904  26.776  1.00 19.91  ? 510  HIS A CE1   1 
ATOM   512  N NE2   . HIS A  1 65  ? 5.518   11.425  25.691  1.00 20.00  ? 510  HIS A NE2   1 
ATOM   513  N N     . VAL A  1 66  ? 9.777   14.195  21.976  1.00 18.25  ? 511  VAL A N     1 
ATOM   514  C CA    . VAL A  1 66  ? 10.368  15.110  21.035  1.00 16.34  ? 511  VAL A CA    1 
ATOM   515  C C     . VAL A  1 66  ? 9.958   16.566  21.436  1.00 18.50  ? 511  VAL A C     1 
ATOM   516  O O     . VAL A  1 66  ? 8.755   16.852  21.743  1.00 16.98  ? 511  VAL A O     1 
ATOM   517  C CB    . VAL A  1 66  ? 9.884   14.823  19.567  1.00 17.04  ? 511  VAL A CB    1 
ATOM   518  C CG1   . VAL A  1 66  ? 10.341  15.960  18.646  1.00 16.54  ? 511  VAL A CG1   1 
ATOM   519  C CG2   . VAL A  1 66  ? 10.348  13.456  19.093  1.00 16.69  ? 511  VAL A CG2   1 
ATOM   520  N N     . LYS A  1 67  ? 10.928  17.482  21.404  1.00 16.58  ? 512  LYS A N     1 
ATOM   521  C CA    A LYS A  1 67  ? 10.635  18.887  21.588  0.50 18.18  ? 512  LYS A CA    1 
ATOM   522  C CA    B LYS A  1 67  ? 10.626  18.883  21.589  0.50 17.98  ? 512  LYS A CA    1 
ATOM   523  C C     . LYS A  1 67  ? 10.268  19.507  20.245  1.00 17.11  ? 512  LYS A C     1 
ATOM   524  O O     . LYS A  1 67  ? 11.109  19.696  19.405  1.00 17.61  ? 512  LYS A O     1 
ATOM   525  C CB    A LYS A  1 67  ? 11.833  19.608  22.244  0.50 18.60  ? 512  LYS A CB    1 
ATOM   526  C CB    B LYS A  1 67  ? 11.799  19.610  22.283  0.50 18.11  ? 512  LYS A CB    1 
ATOM   527  C CG    A LYS A  1 67  ? 12.037  19.223  23.712  0.50 18.49  ? 512  LYS A CG    1 
ATOM   528  C CG    B LYS A  1 67  ? 11.867  19.319  23.786  0.50 17.69  ? 512  LYS A CG    1 
ATOM   529  C CD    A LYS A  1 67  ? 13.009  20.155  24.432  0.50 18.97  ? 512  LYS A CD    1 
ATOM   530  C CD    B LYS A  1 67  ? 13.020  20.041  24.481  0.50 17.87  ? 512  LYS A CD    1 
ATOM   531  C CE    A LYS A  1 67  ? 12.796  20.098  25.947  0.50 19.21  ? 512  LYS A CE    1 
ATOM   532  C CE    B LYS A  1 67  ? 12.894  19.932  26.006  0.50 17.83  ? 512  LYS A CE    1 
ATOM   533  N NZ    A LYS A  1 67  ? 13.065  18.735  26.486  0.50 18.87  ? 512  LYS A NZ    1 
ATOM   534  N NZ    B LYS A  1 67  ? 14.130  20.383  26.710  0.50 17.27  ? 512  LYS A NZ    1 
ATOM   535  N N     . MET A  1 68  ? 8.976   19.779  20.032  1.00 16.59  ? 513  MET A N     1 
ATOM   536  C CA    A MET A  1 68  ? 8.523   20.248  18.736  0.50 16.03  ? 513  MET A CA    1 
ATOM   537  C CA    B MET A  1 68  ? 8.498   20.266  18.732  0.50 16.11  ? 513  MET A CA    1 
ATOM   538  C C     . MET A  1 68  ? 8.825   21.725  18.505  1.00 16.35  ? 513  MET A C     1 
ATOM   539  O O     . MET A  1 68  ? 8.741   22.522  19.412  1.00 18.31  ? 513  MET A O     1 
ATOM   540  C CB    A MET A  1 68  ? 7.029   19.970  18.585  0.50 16.34  ? 513  MET A CB    1 
ATOM   541  C CB    B MET A  1 68  ? 6.981   20.085  18.610  0.50 16.58  ? 513  MET A CB    1 
ATOM   542  C CG    A MET A  1 68  ? 6.658   18.511  18.774  0.50 16.36  ? 513  MET A CG    1 
ATOM   543  C CG    B MET A  1 68  ? 6.513   18.658  18.494  0.50 16.66  ? 513  MET A CG    1 
ATOM   544  S SD    A MET A  1 68  ? 7.171   17.502  17.356  0.50 17.72  ? 513  MET A SD    1 
ATOM   545  S SD    B MET A  1 68  ? 6.955   17.911  16.903  0.50 17.70  ? 513  MET A SD    1 
ATOM   546  C CE    A MET A  1 68  ? 5.854   18.003  16.254  0.50 17.56  ? 513  MET A CE    1 
ATOM   547  C CE    B MET A  1 68  ? 6.160   16.322  17.117  0.50 18.64  ? 513  MET A CE    1 
ATOM   548  N N     . PRO A  1 69  ? 9.130   22.103  17.252  1.00 16.92  ? 514  PRO A N     1 
ATOM   549  C CA    . PRO A  1 69  ? 9.406   23.487  17.003  1.00 18.21  ? 514  PRO A CA    1 
ATOM   550  C C     . PRO A  1 69  ? 8.180   24.370  17.266  1.00 18.33  ? 514  PRO A C     1 
ATOM   551  O O     . PRO A  1 69  ? 8.340   25.579  17.464  1.00 18.13  ? 514  PRO A O     1 
ATOM   552  C CB    . PRO A  1 69  ? 9.774   23.559  15.515  1.00 18.11  ? 514  PRO A CB    1 
ATOM   553  C CG    . PRO A  1 69  ? 9.605   22.197  14.969  1.00 20.59  ? 514  PRO A CG    1 
ATOM   554  C CD    . PRO A  1 69  ? 9.430   21.236  16.088  1.00 19.61  ? 514  PRO A CD    1 
ATOM   555  N N     . CYS A  1 70  ? 6.983   23.802  17.178  1.00 18.73  ? 515  CYS A N     1 
ATOM   556  C CA    . CYS A  1 70  ? 5.772   24.615  17.286  1.00 18.74  ? 515  CYS A CA    1 
ATOM   557  C C     . CYS A  1 70  ? 5.274   24.729  18.733  1.00 21.03  ? 515  CYS A C     1 
ATOM   558  O O     . CYS A  1 70  ? 4.169   25.281  18.972  1.00 19.33  ? 515  CYS A O     1 
ATOM   559  C CB    . CYS A  1 70  ? 4.645   24.080  16.360  1.00 19.16  ? 515  CYS A CB    1 
ATOM   560  S SG    . CYS A  1 70  ? 4.395   22.272  16.399  1.00 20.81  ? 515  CYS A SG    1 
ATOM   561  N N     . SER A  1 71  ? 6.041   24.191  19.680  1.00 20.36  ? 516  SER A N     1 
ATOM   562  C CA    . SER A  1 71  ? 5.709   24.292  21.150  1.00 19.98  ? 516  SER A CA    1 
ATOM   563  C C     . SER A  1 71  ? 5.650   25.740  21.599  1.00 21.01  ? 516  SER A C     1 
ATOM   564  O O     . SER A  1 71  ? 6.515   26.495  21.266  1.00 17.49  ? 516  SER A O     1 
ATOM   565  C CB    . SER A  1 71  ? 6.778   23.623  21.976  1.00 20.66  ? 516  SER A CB    1 
ATOM   566  O OG    . SER A  1 71  ? 6.437   23.637  23.379  1.00 20.36  ? 516  SER A OG    1 
ATOM   567  N N     . GLU A  1 72  ? 4.662   26.111  22.407  1.00 20.70  ? 517  GLU A N     1 
ATOM   568  C CA    . GLU A  1 72  ? 4.719   27.430  23.070  1.00 25.26  ? 517  GLU A CA    1 
ATOM   569  C C     . GLU A  1 72  ? 5.927   27.577  24.032  1.00 24.16  ? 517  GLU A C     1 
ATOM   570  O O     . GLU A  1 72  ? 6.262   28.680  24.422  1.00 25.05  ? 517  GLU A O     1 
ATOM   571  C CB    . GLU A  1 72  ? 3.383   27.686  23.831  1.00 29.76  ? 517  GLU A CB    1 
ATOM   572  C CG    . GLU A  1 72  ? 2.226   27.778  22.860  1.00 36.80  ? 517  GLU A CG    1 
ATOM   573  C CD    . GLU A  1 72  ? 0.880   28.039  23.507  1.00 46.26  ? 517  GLU A CD    1 
ATOM   574  O OE1   . GLU A  1 72  ? 0.863   28.496  24.675  1.00 45.29  ? 517  GLU A OE1   1 
ATOM   575  O OE2   . GLU A  1 72  ? -0.163  27.775  22.828  1.00 44.95  ? 517  GLU A OE2   1 
ATOM   576  N N     . GLN A  1 73  ? 6.562   26.465  24.423  1.00 23.26  ? 518  GLN A N     1 
ATOM   577  C CA    . GLN A  1 73  ? 7.797   26.513  25.244  1.00 25.77  ? 518  GLN A CA    1 
ATOM   578  C C     . GLN A  1 73  ? 9.048   26.712  24.437  1.00 26.47  ? 518  GLN A C     1 
ATOM   579  O O     . GLN A  1 73  ? 10.135  26.810  25.001  1.00 25.71  ? 518  GLN A O     1 
ATOM   580  C CB    . GLN A  1 73  ? 8.007   25.222  26.007  1.00 29.28  ? 518  GLN A CB    1 
ATOM   581  C CG    . GLN A  1 73  ? 6.795   24.684  26.660  1.00 32.46  ? 518  GLN A CG    1 
ATOM   582  C CD    . GLN A  1 73  ? 6.355   25.582  27.711  1.00 41.57  ? 518  GLN A CD    1 
ATOM   583  O OE1   . GLN A  1 73  ? 5.270   26.156  27.639  1.00 46.38  ? 518  GLN A OE1   1 
ATOM   584  N NE2   . GLN A  1 73  ? 7.230   25.799  28.689  1.00 46.91  ? 518  GLN A NE2   1 
ATOM   585  N N     . ASN A  1 74  ? 8.933   26.685  23.117  1.00 24.61  ? 519  ASN A N     1 
ATOM   586  C CA    . ASN A  1 74  ? 10.066  26.946  22.269  1.00 22.63  ? 519  ASN A CA    1 
ATOM   587  C C     . ASN A  1 74  ? 10.271  28.466  22.087  1.00 21.03  ? 519  ASN A C     1 
ATOM   588  O O     . ASN A  1 74  ? 9.635   29.103  21.251  1.00 21.55  ? 519  ASN A O     1 
ATOM   589  C CB    . ASN A  1 74  ? 9.911   26.230  20.902  1.00 22.78  ? 519  ASN A CB    1 
ATOM   590  C CG    . ASN A  1 74  ? 11.122  26.428  20.018  1.00 23.72  ? 519  ASN A CG    1 
ATOM   591  O OD1   . ASN A  1 74  ? 12.226  26.613  20.525  1.00 23.04  ? 519  ASN A OD1   1 
ATOM   592  N ND2   . ASN A  1 74  ? 10.934  26.386  18.704  1.00 23.02  ? 519  ASN A ND2   1 
ATOM   593  N N     . LEU A  1 75  ? 11.124  29.025  22.943  1.00 25.89  ? 520  LEU A N     1 
ATOM   594  C CA    . LEU A  1 75  ? 11.273  30.468  23.125  1.00 29.49  ? 520  LEU A CA    1 
ATOM   595  C C     . LEU A  1 75  ? 12.664  30.903  22.690  1.00 34.42  ? 520  LEU A C     1 
ATOM   596  O O     . LEU A  1 75  ? 13.585  30.081  22.625  1.00 36.78  ? 520  LEU A O     1 
ATOM   597  C CB    . LEU A  1 75  ? 11.074  30.822  24.610  1.00 34.60  ? 520  LEU A CB    1 
ATOM   598  C CG    . LEU A  1 75  ? 9.659   30.539  25.203  1.00 34.38  ? 520  LEU A CG    1 
ATOM   599  C CD1   . LEU A  1 75  ? 9.601   30.833  26.685  1.00 37.62  ? 520  LEU A CD1   1 
ATOM   600  C CD2   . LEU A  1 75  ? 8.559   31.312  24.479  1.00 35.41  ? 520  LEU A CD2   1 
ATOM   601  N N     . TYR A  1 76  ? 12.806  32.169  22.311  1.00 39.03  ? 521  TYR A N     1 
ATOM   602  C CA    . TYR A  1 76  ? 14.132  32.757  22.162  1.00 39.36  ? 521  TYR A CA    1 
ATOM   603  C C     . TYR A  1 76  ? 14.258  34.019  23.060  1.00 50.47  ? 521  TYR A C     1 
ATOM   604  O O     . TYR A  1 76  ? 13.376  34.923  23.010  1.00 43.21  ? 521  TYR A O     1 
ATOM   605  C CB    . TYR A  1 76  ? 14.442  33.090  20.701  1.00 33.96  ? 521  TYR A CB    1 
ATOM   606  C CG    . TYR A  1 76  ? 13.616  34.163  20.104  1.00 36.06  ? 521  TYR A CG    1 
ATOM   607  C CD1   . TYR A  1 76  ? 12.368  33.897  19.613  1.00 34.80  ? 521  TYR A CD1   1 
ATOM   608  C CD2   . TYR A  1 76  ? 14.091  35.471  20.007  1.00 40.98  ? 521  TYR A CD2   1 
ATOM   609  C CE1   . TYR A  1 76  ? 11.596  34.876  19.025  1.00 34.65  ? 521  TYR A CE1   1 
ATOM   610  C CE2   . TYR A  1 76  ? 13.326  36.466  19.420  1.00 39.77  ? 521  TYR A CE2   1 
ATOM   611  C CZ    . TYR A  1 76  ? 12.071  36.153  18.933  1.00 38.56  ? 521  TYR A CZ    1 
ATOM   612  O OH    . TYR A  1 76  ? 11.276  37.107  18.369  1.00 42.24  ? 521  TYR A OH    1 
ATOM   613  N N     . PRO A  1 77  ? 15.328  34.063  23.906  1.00 56.47  ? 522  PRO A N     1 
ATOM   614  C CA    . PRO A  1 77  ? 15.730  35.290  24.606  1.00 60.97  ? 522  PRO A CA    1 
ATOM   615  C C     . PRO A  1 77  ? 15.904  36.448  23.662  1.00 53.04  ? 522  PRO A C     1 
ATOM   616  O O     . PRO A  1 77  ? 16.746  36.385  22.793  1.00 54.91  ? 522  PRO A O     1 
ATOM   617  C CB    . PRO A  1 77  ? 17.057  34.892  25.245  1.00 63.48  ? 522  PRO A CB    1 
ATOM   618  C CG    . PRO A  1 77  ? 16.847  33.454  25.605  1.00 64.82  ? 522  PRO A CG    1 
ATOM   619  C CD    . PRO A  1 77  ? 15.991  32.877  24.493  1.00 63.18  ? 522  PRO A CD    1 
ATOM   620  N N     . VAL A  1 78  ? 15.043  37.465  23.809  1.00 59.83  ? 523  VAL A N     1 
ATOM   621  C CA    . VAL A  1 78  ? 14.972  38.620  22.900  1.00 58.64  ? 523  VAL A CA    1 
ATOM   622  C C     . VAL A  1 78  ? 15.935  39.729  23.363  1.00 68.23  ? 523  VAL A C     1 
ATOM   623  O O     . VAL A  1 78  ? 15.601  40.542  24.231  1.00 67.09  ? 523  VAL A O     1 
ATOM   624  C CB    . VAL A  1 78  ? 13.535  39.221  22.847  1.00 63.41  ? 523  VAL A CB    1 
ATOM   625  C CG1   . VAL A  1 78  ? 13.371  40.178  21.656  1.00 60.85  ? 523  VAL A CG1   1 
ATOM   626  C CG2   . VAL A  1 78  ? 12.492  38.120  22.775  1.00 66.89  ? 523  VAL A CG2   1 
ATOM   627  N N     . ALA A  1 87  ? 11.516  37.067  26.343  1.00 52.48  ? 532  ALA A N     1 
ATOM   628  C CA    . ALA A  1 87  ? 11.137  35.802  25.692  1.00 49.62  ? 532  ALA A CA    1 
ATOM   629  C C     . ALA A  1 87  ? 10.164  36.025  24.548  1.00 45.81  ? 532  ALA A C     1 
ATOM   630  O O     . ALA A  1 87  ? 9.089   36.554  24.731  1.00 46.60  ? 532  ALA A O     1 
ATOM   631  C CB    . ALA A  1 87  ? 10.546  34.847  26.701  1.00 49.94  ? 532  ALA A CB    1 
ATOM   632  N N     . GLY A  1 88  ? 10.567  35.646  23.352  1.00 38.27  ? 533  GLY A N     1 
ATOM   633  C CA    . GLY A  1 88  ? 9.680   35.687  22.202  1.00 32.83  ? 533  GLY A CA    1 
ATOM   634  C C     . GLY A  1 88  ? 9.428   34.247  21.748  1.00 30.50  ? 533  GLY A C     1 
ATOM   635  O O     . GLY A  1 88  ? 10.141  33.299  22.185  1.00 26.64  ? 533  GLY A O     1 
ATOM   636  N N     . SER A  1 89  ? 8.406   34.072  20.933  1.00 28.62  ? 534  SER A N     1 
ATOM   637  C CA    . SER A  1 89  ? 8.065   32.742  20.421  1.00 27.86  ? 534  SER A CA    1 
ATOM   638  C C     . SER A  1 89  ? 8.940   32.383  19.200  1.00 23.62  ? 534  SER A C     1 
ATOM   639  O O     . SER A  1 89  ? 8.886   33.029  18.162  1.00 20.98  ? 534  SER A O     1 
ATOM   640  C CB    . SER A  1 89  ? 6.630   32.699  20.001  1.00 29.71  ? 534  SER A CB    1 
ATOM   641  O OG    . SER A  1 89  ? 6.413   31.562  19.163  1.00 28.74  ? 534  SER A OG    1 
ATOM   642  N N     . ARG A  1 90  ? 9.720   31.344  19.325  1.00 24.23  ? 535  ARG A N     1 
ATOM   643  C CA    . ARG A  1 90  ? 10.534  30.930  18.184  1.00 22.93  ? 535  ARG A CA    1 
ATOM   644  C C     . ARG A  1 90  ? 9.653   30.419  16.996  1.00 19.41  ? 535  ARG A C     1 
ATOM   645  O O     . ARG A  1 90  ? 9.988   30.636  15.833  1.00 20.75  ? 535  ARG A O     1 
ATOM   646  C CB    . ARG A  1 90  ? 11.562  29.906  18.634  1.00 24.93  ? 535  ARG A CB    1 
ATOM   647  C CG    . ARG A  1 90  ? 12.596  29.638  17.589  1.00 32.12  ? 535  ARG A CG    1 
ATOM   648  C CD    . ARG A  1 90  ? 13.976  29.739  18.151  1.00 36.33  ? 535  ARG A CD    1 
ATOM   649  N NE    . ARG A  1 90  ? 14.227  28.761  19.153  1.00 41.04  ? 535  ARG A NE    1 
ATOM   650  C CZ    . ARG A  1 90  ? 15.106  28.919  20.123  1.00 49.15  ? 535  ARG A CZ    1 
ATOM   651  N NH1   . ARG A  1 90  ? 15.766  30.073  20.254  1.00 54.85  ? 535  ARG A NH1   1 
ATOM   652  N NH2   . ARG A  1 90  ? 15.319  27.936  20.981  1.00 54.81  ? 535  ARG A NH2   1 
ATOM   653  N N     . TRP A  1 91  ? 8.519   29.761  17.281  1.00 17.29  ? 536  TRP A N     1 
ATOM   654  C CA    . TRP A  1 91  ? 7.619   29.339  16.166  1.00 17.60  ? 536  TRP A CA    1 
ATOM   655  C C     . TRP A  1 91  ? 7.149   30.521  15.385  1.00 18.86  ? 536  TRP A C     1 
ATOM   656  O O     . TRP A  1 91  ? 7.119   30.497  14.129  1.00 18.06  ? 536  TRP A O     1 
ATOM   657  C CB    . TRP A  1 91  ? 6.462   28.517  16.688  1.00 18.03  ? 536  TRP A CB    1 
ATOM   658  C CG    . TRP A  1 91  ? 5.601   27.902  15.623  1.00 18.00  ? 536  TRP A CG    1 
ATOM   659  C CD1   . TRP A  1 91  ? 4.252   28.125  15.438  1.00 18.38  ? 536  TRP A CD1   1 
ATOM   660  C CD2   . TRP A  1 91  ? 5.988   26.939  14.619  1.00 17.72  ? 536  TRP A CD2   1 
ATOM   661  N NE1   . TRP A  1 91  ? 3.785   27.384  14.381  1.00 18.75  ? 536  TRP A NE1   1 
ATOM   662  C CE2   . TRP A  1 91  ? 4.807   26.634  13.862  1.00 18.28  ? 536  TRP A CE2   1 
ATOM   663  C CE3   . TRP A  1 91  ? 7.195   26.294  14.288  1.00 17.14  ? 536  TRP A CE3   1 
ATOM   664  C CZ2   . TRP A  1 91  ? 4.814   25.755  12.763  1.00 17.61  ? 536  TRP A CZ2   1 
ATOM   665  C CZ3   . TRP A  1 91  ? 7.194   25.399  13.213  1.00 16.89  ? 536  TRP A CZ3   1 
ATOM   666  C CH2   . TRP A  1 91  ? 5.999   25.138  12.458  1.00 16.34  ? 536  TRP A CH2   1 
ATOM   667  N N     . GLU A  1 92  ? 6.802   31.625  16.090  1.00 19.16  ? 537  GLU A N     1 
ATOM   668  C CA    . GLU A  1 92  ? 6.400   32.850  15.350  1.00 20.77  ? 537  GLU A CA    1 
ATOM   669  C C     . GLU A  1 92  ? 7.536   33.380  14.479  1.00 18.06  ? 537  GLU A C     1 
ATOM   670  O O     . GLU A  1 92  ? 7.324   33.823  13.359  1.00 19.58  ? 537  GLU A O     1 
ATOM   671  C CB    . GLU A  1 92  ? 5.906   33.925  16.325  1.00 23.17  ? 537  GLU A CB    1 
ATOM   672  C CG    . GLU A  1 92  ? 4.528   33.606  16.863  1.00 27.73  ? 537  GLU A CG    1 
ATOM   673  C CD    . GLU A  1 92  ? 3.996   34.721  17.809  1.00 39.62  ? 537  GLU A CD    1 
ATOM   674  O OE1   . GLU A  1 92  ? 4.596   35.834  17.841  1.00 40.95  ? 537  GLU A OE1   1 
ATOM   675  O OE2   . GLU A  1 92  ? 2.993   34.468  18.517  1.00 46.27  ? 537  GLU A OE2   1 
ATOM   676  N N     . LEU A  1 93  ? 8.738   33.355  15.019  1.00 20.28  ? 538  LEU A N     1 
ATOM   677  C CA    . LEU A  1 93  ? 9.932   33.808  14.284  1.00 21.03  ? 538  LEU A CA    1 
ATOM   678  C C     . LEU A  1 93  ? 10.210  32.920  13.048  1.00 19.86  ? 538  LEU A C     1 
ATOM   679  O O     . LEU A  1 93  ? 10.473  33.408  11.971  1.00 19.76  ? 538  LEU A O     1 
ATOM   680  C CB    . LEU A  1 93  ? 11.111  33.787  15.208  1.00 22.36  ? 538  LEU A CB    1 
ATOM   681  C CG    . LEU A  1 93  ? 12.482  34.249  14.692  1.00 24.65  ? 538  LEU A CG    1 
ATOM   682  C CD1   . LEU A  1 93  ? 12.393  35.655  14.111  1.00 27.43  ? 538  LEU A CD1   1 
ATOM   683  C CD2   . LEU A  1 93  ? 13.484  34.179  15.824  1.00 23.72  ? 538  LEU A CD2   1 
ATOM   684  N N     . ILE A  1 94  ? 10.088  31.597  13.238  1.00 19.85  ? 539  ILE A N     1 
ATOM   685  C CA    . ILE A  1 94  ? 10.180  30.644  12.109  1.00 15.79  ? 539  ILE A CA    1 
ATOM   686  C C     . ILE A  1 94  ? 9.209   31.033  10.996  1.00 16.82  ? 539  ILE A C     1 
ATOM   687  O O     . ILE A  1 94  ? 9.573   31.075  9.809   1.00 16.78  ? 539  ILE A O     1 
ATOM   688  C CB    . ILE A  1 94  ? 9.987   29.186  12.601  1.00 15.50  ? 539  ILE A CB    1 
ATOM   689  C CG1   . ILE A  1 94  ? 11.171  28.769  13.428  1.00 14.88  ? 539  ILE A CG1   1 
ATOM   690  C CG2   . ILE A  1 94  ? 9.785   28.207  11.406  1.00 16.76  ? 539  ILE A CG2   1 
ATOM   691  C CD1   . ILE A  1 94  ? 10.936  27.572  14.335  1.00 15.46  ? 539  ILE A CD1   1 
ATOM   692  N N     . GLN A  1 95  ? 7.950   31.281  11.360  1.00 17.42  ? 540  GLN A N     1 
ATOM   693  C CA    . GLN A  1 95  ? 6.939   31.619  10.352  1.00 18.19  ? 540  GLN A CA    1 
ATOM   694  C C     . GLN A  1 95  ? 7.321   32.888  9.602   1.00 18.64  ? 540  GLN A C     1 
ATOM   695  O O     . GLN A  1 95  ? 7.293   32.918  8.391   1.00 17.20  ? 540  GLN A O     1 
ATOM   696  C CB    . GLN A  1 95  ? 5.543   31.791  10.998  1.00 20.40  ? 540  GLN A CB    1 
ATOM   697  C CG    . GLN A  1 95  ? 4.951   30.499  11.575  1.00 21.86  ? 540  GLN A CG    1 
ATOM   698  C CD    . GLN A  1 95  ? 3.728   30.751  12.467  1.00 25.24  ? 540  GLN A CD    1 
ATOM   699  O OE1   . GLN A  1 95  ? 3.823   30.892  13.674  1.00 28.38  ? 540  GLN A OE1   1 
ATOM   700  N NE2   . GLN A  1 95  ? 2.596   30.795  11.860  1.00 31.50  ? 540  GLN A NE2   1 
ATOM   701  N N     . THR A  1 96  ? 7.728   33.936  10.317  1.00 20.75  ? 541  THR A N     1 
ATOM   702  C CA    A THR A  1 96  ? 8.057   35.206  9.664   0.50 21.30  ? 541  THR A CA    1 
ATOM   703  C CA    B THR A  1 96  ? 8.039   35.176  9.598   0.50 21.65  ? 541  THR A CA    1 
ATOM   704  C C     . THR A  1 96  ? 9.281   35.010  8.745   1.00 20.63  ? 541  THR A C     1 
ATOM   705  O O     . THR A  1 96  ? 9.317   35.513  7.660   1.00 19.72  ? 541  THR A O     1 
ATOM   706  C CB    A THR A  1 96  ? 8.359   36.321  10.696  0.50 21.88  ? 541  THR A CB    1 
ATOM   707  C CB    B THR A  1 96  ? 8.193   36.372  10.519  0.50 22.41  ? 541  THR A CB    1 
ATOM   708  O OG1   A THR A  1 96  ? 7.423   36.260  11.791  0.50 21.19  ? 541  THR A OG1   1 
ATOM   709  O OG1   B THR A  1 96  ? 9.147   36.072  11.553  0.50 24.97  ? 541  THR A OG1   1 
ATOM   710  C CG2   A THR A  1 96  ? 8.286   37.665  10.046  0.50 23.02  ? 541  THR A CG2   1 
ATOM   711  C CG2   B THR A  1 96  ? 6.881   36.703  11.096  0.50 22.51  ? 541  THR A CG2   1 
ATOM   712  N N     . ALA A  1 97  ? 10.268  34.228  9.228   1.00 19.91  ? 542  ALA A N     1 
ATOM   713  C CA    . ALA A  1 97  ? 11.496  33.979  8.419   1.00 19.63  ? 542  ALA A CA    1 
ATOM   714  C C     . ALA A  1 97  ? 11.237  33.247  7.065   1.00 18.53  ? 542  ALA A C     1 
ATOM   715  O O     . ALA A  1 97  ? 11.717  33.676  5.996   1.00 18.47  ? 542  ALA A O     1 
ATOM   716  C CB    . ALA A  1 97  ? 12.522  33.231  9.246   1.00 19.80  ? 542  ALA A CB    1 
ATOM   717  N N     . LEU A  1 98  ? 10.448  32.171  7.116   1.00 16.94  ? 543  LEU A N     1 
ATOM   718  C CA    . LEU A  1 98  ? 10.268  31.293  5.961   1.00 17.65  ? 543  LEU A CA    1 
ATOM   719  C C     . LEU A  1 98  ? 9.238   31.762  4.946   1.00 19.36  ? 543  LEU A C     1 
ATOM   720  O O     . LEU A  1 98  ? 9.281   31.315  3.787   1.00 20.02  ? 543  LEU A O     1 
ATOM   721  C CB    . LEU A  1 98  ? 9.932   29.850  6.436   1.00 16.65  ? 543  LEU A CB    1 
ATOM   722  C CG    . LEU A  1 98  ? 11.055  29.146  7.230   1.00 17.17  ? 543  LEU A CG    1 
ATOM   723  C CD1   . LEU A  1 98  ? 10.651  27.763  7.760   1.00 17.94  ? 543  LEU A CD1   1 
ATOM   724  C CD2   . LEU A  1 98  ? 12.335  29.056  6.413   1.00 18.33  ? 543  LEU A CD2   1 
ATOM   725  N N     . LEU A  1 99  ? 8.339   32.684  5.330   1.00 24.00  ? 544  LEU A N     1 
ATOM   726  C CA    . LEU A  1 99  ? 7.311   33.156  4.381   1.00 27.33  ? 544  LEU A CA    1 
ATOM   727  C C     . LEU A  1 99  ? 7.750   34.370  3.540   1.00 33.27  ? 544  LEU A C     1 
ATOM   728  O O     . LEU A  1 99  ? 6.956   35.154  3.140   1.00 39.21  ? 544  LEU A O     1 
ATOM   729  C CB    . LEU A  1 99  ? 5.993   33.435  5.095   1.00 28.24  ? 544  LEU A CB    1 
ATOM   730  C CG    . LEU A  1 99  ? 5.335   32.152  5.646   1.00 29.22  ? 544  LEU A CG    1 
ATOM   731  C CD1   . LEU A  1 99  ? 4.352   32.463  6.779   1.00 33.30  ? 544  LEU A CD1   1 
ATOM   732  C CD2   . LEU A  1 99  ? 4.674   31.381  4.504   1.00 29.82  ? 544  LEU A CD2   1 
ATOM   733  N N     . ASN A  1 100 ? 9.025   34.498  3.298   1.00 32.83  ? 545  ASN A N     1 
ATOM   734  C CA    . ASN A  1 100 ? 9.504   35.402  2.291   1.00 33.09  ? 545  ASN A CA    1 
ATOM   735  C C     . ASN A  1 100 ? 9.761   34.674  1.019   1.00 32.95  ? 545  ASN A C     1 
ATOM   736  O O     . ASN A  1 100 ? 10.012  33.478  1.020   1.00 32.89  ? 545  ASN A O     1 
ATOM   737  C CB    . ASN A  1 100 ? 10.766  36.032  2.788   1.00 38.68  ? 545  ASN A CB    1 
ATOM   738  C CG    . ASN A  1 100 ? 10.517  36.866  3.990   1.00 42.23  ? 545  ASN A CG    1 
ATOM   739  O OD1   . ASN A  1 100 ? 9.809   37.863  3.909   1.00 46.57  ? 545  ASN A OD1   1 
ATOM   740  N ND2   . ASN A  1 100 ? 11.000  36.431  5.122   1.00 47.85  ? 545  ASN A ND2   1 
ATOM   741  N N     . LYS A  1 101 ? 9.696   35.369  -0.081  1.00 30.61  ? 546  LYS A N     1 
ATOM   742  C CA    . LYS A  1 101 ? 10.021  34.738  -1.331  1.00 35.80  ? 546  LYS A CA    1 
ATOM   743  C C     . LYS A  1 101 ? 11.537  34.548  -1.415  1.00 32.30  ? 546  LYS A C     1 
ATOM   744  O O     . LYS A  1 101 ? 12.297  35.364  -0.916  1.00 29.51  ? 546  LYS A O     1 
ATOM   745  C CB    . LYS A  1 101 ? 9.480   35.536  -2.513  1.00 40.79  ? 546  LYS A CB    1 
ATOM   746  C CG    . LYS A  1 101 ? 10.385  36.617  -3.026  1.00 44.31  ? 546  LYS A CG    1 
ATOM   747  C CD    . LYS A  1 101 ? 9.757   37.293  -4.263  1.00 53.58  ? 546  LYS A CD    1 
ATOM   748  C CE    . LYS A  1 101 ? 9.555   36.308  -5.408  1.00 54.75  ? 546  LYS A CE    1 
ATOM   749  N NZ    . LYS A  1 101 ? 9.410   36.992  -6.717  1.00 59.82  ? 546  LYS A NZ    1 
ATOM   750  N N     . PHE A  1 102 ? 11.961  33.414  -1.960  1.00 30.88  ? 547  PHE A N     1 
ATOM   751  C CA    . PHE A  1 102 ? 13.376  33.187  -2.218  1.00 27.36  ? 547  PHE A CA    1 
ATOM   752  C C     . PHE A  1 102 ? 13.545  33.373  -3.706  1.00 27.49  ? 547  PHE A C     1 
ATOM   753  O O     . PHE A  1 102 ? 12.693  32.892  -4.513  1.00 28.61  ? 547  PHE A O     1 
ATOM   754  C CB    . PHE A  1 102 ? 13.794  31.790  -1.812  1.00 25.42  ? 547  PHE A CB    1 
ATOM   755  C CG    . PHE A  1 102 ? 13.379  31.389  -0.416  1.00 30.61  ? 547  PHE A CG    1 
ATOM   756  C CD1   . PHE A  1 102 ? 13.754  32.144  0.694   1.00 29.51  ? 547  PHE A CD1   1 
ATOM   757  C CD2   . PHE A  1 102 ? 12.607  30.239  -0.204  1.00 33.40  ? 547  PHE A CD2   1 
ATOM   758  C CE1   . PHE A  1 102 ? 13.330  31.816  1.956   1.00 30.23  ? 547  PHE A CE1   1 
ATOM   759  C CE2   . PHE A  1 102 ? 12.250  29.850  1.096   1.00 32.38  ? 547  PHE A CE2   1 
ATOM   760  C CZ    . PHE A  1 102 ? 12.595  30.646  2.174   1.00 30.36  ? 547  PHE A CZ    1 
ATOM   761  N N     . THR A  1 103 ? 14.559  34.137  -4.104  1.00 21.08  ? 548  THR A N     1 
ATOM   762  C CA    A THR A  1 103 ? 15.003  34.137  -5.540  0.50 18.87  ? 548  THR A CA    1 
ATOM   763  C CA    B THR A  1 103 ? 14.944  34.243  -5.480  0.50 21.57  ? 548  THR A CA    1 
ATOM   764  C C     . THR A  1 103 ? 16.450  33.865  -5.694  1.00 18.43  ? 548  THR A C     1 
ATOM   765  O O     . THR A  1 103 ? 16.884  33.623  -6.799  1.00 19.27  ? 548  THR A O     1 
ATOM   766  C CB    A THR A  1 103 ? 14.806  35.496  -6.307  0.50 18.65  ? 548  THR A CB    1 
ATOM   767  C CB    B THR A  1 103 ? 14.633  35.697  -5.900  0.50 24.56  ? 548  THR A CB    1 
ATOM   768  O OG1   A THR A  1 103 ? 15.215  36.607  -5.476  0.50 14.87  ? 548  THR A OG1   1 
ATOM   769  O OG1   B THR A  1 103 ? 13.188  35.880  -5.868  0.50 27.74  ? 548  THR A OG1   1 
ATOM   770  C CG2   A THR A  1 103 ? 13.316  35.646  -6.840  0.50 18.73  ? 548  THR A CG2   1 
ATOM   771  C CG2   B THR A  1 103 ? 15.195  36.034  -7.257  0.50 23.72  ? 548  THR A CG2   1 
ATOM   772  N N     . ARG A  1 104 ? 17.204  33.859  -4.594  1.00 16.90  ? 549  ARG A N     1 
ATOM   773  C CA    . ARG A  1 104 ? 18.659  33.635  -4.612  1.00 16.27  ? 549  ARG A CA    1 
ATOM   774  C C     . ARG A  1 104 ? 19.036  32.798  -3.343  1.00 14.81  ? 549  ARG A C     1 
ATOM   775  O O     . ARG A  1 104 ? 18.392  32.902  -2.333  1.00 15.25  ? 549  ARG A O     1 
ATOM   776  C CB    . ARG A  1 104 ? 19.421  35.018  -4.622  1.00 18.56  ? 549  ARG A CB    1 
ATOM   777  C CG    . ARG A  1 104 ? 19.065  35.976  -5.790  1.00 18.56  ? 549  ARG A CG    1 
ATOM   778  C CD    . ARG A  1 104 ? 19.563  35.454  -7.151  1.00 20.49  ? 549  ARG A CD    1 
ATOM   779  N NE    . ARG A  1 104 ? 21.028  35.346  -7.120  1.00 21.01  ? 549  ARG A NE    1 
ATOM   780  C CZ    . ARG A  1 104 ? 21.743  34.222  -7.293  1.00 22.16  ? 549  ARG A CZ    1 
ATOM   781  N NH1   . ARG A  1 104 ? 21.178  33.063  -7.733  1.00 20.38  ? 549  ARG A NH1   1 
ATOM   782  N NH2   . ARG A  1 104 ? 23.049  34.284  -7.108  1.00 21.76  ? 549  ARG A NH2   1 
ATOM   783  N N     . PRO A  1 105 ? 20.098  31.971  -3.412  1.00 14.22  ? 550  PRO A N     1 
ATOM   784  C CA    . PRO A  1 105 ? 20.338  31.070  -2.296  1.00 13.30  ? 550  PRO A CA    1 
ATOM   785  C C     . PRO A  1 105 ? 20.673  31.774  -0.989  1.00 12.83  ? 550  PRO A C     1 
ATOM   786  O O     . PRO A  1 105 ? 20.363  31.261  0.108   1.00 12.40  ? 550  PRO A O     1 
ATOM   787  C CB    . PRO A  1 105 ? 21.487  30.174  -2.788  1.00 14.12  ? 550  PRO A CB    1 
ATOM   788  C CG    . PRO A  1 105 ? 22.101  30.927  -3.925  1.00 15.20  ? 550  PRO A CG    1 
ATOM   789  C CD    . PRO A  1 105 ? 20.982  31.702  -4.551  1.00 14.82  ? 550  PRO A CD    1 
ATOM   790  N N     . GLN A  1 106 ? 21.300  32.951  -1.059  1.00 13.90  ? 551  GLN A N     1 
ATOM   791  C CA    . GLN A  1 106 ? 21.498  33.737  0.130   1.00 14.58  ? 551  GLN A CA    1 
ATOM   792  C C     . GLN A  1 106 ? 20.175  34.015  0.906   1.00 14.51  ? 551  GLN A C     1 
ATOM   793  O O     . GLN A  1 106 ? 20.182  34.133  2.143   1.00 15.69  ? 551  GLN A O     1 
ATOM   794  C CB    . GLN A  1 106 ? 22.202  35.070  -0.207  1.00 16.57  ? 551  GLN A CB    1 
ATOM   795  C CG    . GLN A  1 106 ? 22.671  35.839  1.026   1.00 16.07  ? 551  GLN A CG    1 
ATOM   796  C CD    . GLN A  1 106 ? 23.841  35.182  1.718   1.00 16.98  ? 551  GLN A CD    1 
ATOM   797  O OE1   . GLN A  1 106 ? 24.627  34.493  1.104   1.00 18.81  ? 551  GLN A OE1   1 
ATOM   798  N NE2   . GLN A  1 106 ? 23.949  35.385  3.006   1.00 20.65  ? 551  GLN A NE2   1 
ATOM   799  N N     . ASN A  1 107 ? 19.056  34.085  0.193   1.00 15.74  ? 552  ASN A N     1 
ATOM   800  C CA    . ASN A  1 107 ? 17.775  34.380  0.843   1.00 16.46  ? 552  ASN A CA    1 
ATOM   801  C C     . ASN A  1 107 ? 17.442  33.221  1.784   1.00 16.47  ? 552  ASN A C     1 
ATOM   802  O O     . ASN A  1 107 ? 16.920  33.417  2.887   1.00 16.79  ? 552  ASN A O     1 
ATOM   803  C CB    . ASN A  1 107 ? 16.610  34.546  -0.205  1.00 17.22  ? 552  ASN A CB    1 
ATOM   804  C CG    . ASN A  1 107 ? 16.844  35.653  -1.224  1.00 19.10  ? 552  ASN A CG    1 
ATOM   805  O OD1   . ASN A  1 107 ? 16.269  35.634  -2.303  1.00 22.65  ? 552  ASN A OD1   1 
ATOM   806  N ND2   . ASN A  1 107 ? 17.690  36.619  -0.893  1.00 21.27  ? 552  ASN A ND2   1 
ATOM   807  N N     . LEU A  1 108 ? 17.695  31.985  1.327   1.00 14.85  ? 553  LEU A N     1 
ATOM   808  C CA    . LEU A  1 108 ? 17.362  30.816  2.106   1.00 14.54  ? 553  LEU A CA    1 
ATOM   809  C C     . LEU A  1 108 ? 18.286  30.680  3.271   1.00 13.06  ? 553  LEU A C     1 
ATOM   810  O O     . LEU A  1 108 ? 17.859  30.423  4.376   1.00 15.10  ? 553  LEU A O     1 
ATOM   811  C CB    . LEU A  1 108 ? 17.348  29.561  1.204   1.00 15.65  ? 553  LEU A CB    1 
ATOM   812  C CG    . LEU A  1 108 ? 17.235  28.229  1.959   1.00 16.54  ? 553  LEU A CG    1 
ATOM   813  C CD1   . LEU A  1 108 ? 16.001  28.200  2.864   1.00 17.66  ? 553  LEU A CD1   1 
ATOM   814  C CD2   . LEU A  1 108 ? 17.221  27.058  0.994   1.00 18.13  ? 553  LEU A CD2   1 
ATOM   815  N N     . LYS A  1 109 ? 19.593  30.916  3.055   1.00 13.52  ? 554  LYS A N     1 
ATOM   816  C CA    . LYS A  1 109 ? 20.536  30.902  4.157   1.00 13.12  ? 554  LYS A CA    1 
ATOM   817  C C     . LYS A  1 109 ? 20.112  31.903  5.236   1.00 13.52  ? 554  LYS A C     1 
ATOM   818  O O     . LYS A  1 109 ? 20.101  31.594  6.419   1.00 14.00  ? 554  LYS A O     1 
ATOM   819  C CB    . LYS A  1 109 ? 21.968  31.247  3.667   1.00 14.07  ? 554  LYS A CB    1 
ATOM   820  C CG    . LYS A  1 109 ? 22.970  31.501  4.809   1.00 15.09  ? 554  LYS A CG    1 
ATOM   821  C CD    . LYS A  1 109 ? 24.372  31.897  4.309   1.00 16.09  ? 554  LYS A CD    1 
ATOM   822  C CE    . LYS A  1 109 ? 25.297  32.237  5.485   1.00 18.16  ? 554  LYS A CE    1 
ATOM   823  N NZ    . LYS A  1 109 ? 26.720  32.452  5.017   1.00 19.44  ? 554  LYS A NZ    1 
ATOM   824  N N     . ASP A  1 110 ? 19.824  33.125  4.830   1.00 15.07  ? 555  ASP A N     1 
ATOM   825  C CA    . ASP A  1 110 ? 19.510  34.217  5.856   1.00 16.92  ? 555  ASP A CA    1 
ATOM   826  C C     . ASP A  1 110 ? 18.215  33.848  6.629   1.00 16.63  ? 555  ASP A C     1 
ATOM   827  O O     . ASP A  1 110 ? 18.117  34.053  7.805   1.00 16.79  ? 555  ASP A O     1 
ATOM   828  C CB    . ASP A  1 110 ? 19.278  35.557  5.154   1.00 17.67  ? 555  ASP A CB    1 
ATOM   829  C CG    . ASP A  1 110 ? 20.558  36.196  4.625   1.00 20.40  ? 555  ASP A CG    1 
ATOM   830  O OD1   . ASP A  1 110 ? 21.663  35.763  4.977   1.00 21.91  ? 555  ASP A OD1   1 
ATOM   831  O OD2   . ASP A  1 110 ? 20.437  37.084  3.768   1.00 23.36  ? 555  ASP A OD2   1 
ATOM   832  N N     . ALA A  1 111 ? 17.249  33.254  5.933   1.00 17.27  ? 556  ALA A N     1 
ATOM   833  C CA    . ALA A  1 111 ? 16.004  32.762  6.599   1.00 16.83  ? 556  ALA A CA    1 
ATOM   834  C C     . ALA A  1 111 ? 16.244  31.708  7.704   1.00 17.57  ? 556  ALA A C     1 
ATOM   835  O O     . ALA A  1 111 ? 15.865  31.896  8.873   1.00 14.98  ? 556  ALA A O     1 
ATOM   836  C CB    . ALA A  1 111 ? 15.022  32.257  5.533   1.00 16.53  ? 556  ALA A CB    1 
ATOM   837  N N     . ILE A  1 112 ? 16.995  30.644  7.378   1.00 15.84  ? 557  ILE A N     1 
ATOM   838  C CA    . ILE A  1 112 ? 17.325  29.636  8.344   1.00 14.41  ? 557  ILE A CA    1 
ATOM   839  C C     . ILE A  1 112 ? 18.099  30.184  9.559   1.00 15.48  ? 557  ILE A C     1 
ATOM   840  O O     . ILE A  1 112 ? 17.887  29.768  10.716  1.00 15.07  ? 557  ILE A O     1 
ATOM   841  C CB    . ILE A  1 112 ? 18.117  28.510  7.649   1.00 14.99  ? 557  ILE A CB    1 
ATOM   842  C CG1   . ILE A  1 112 ? 17.163  27.743  6.706   1.00 15.16  ? 557  ILE A CG1   1 
ATOM   843  C CG2   . ILE A  1 112 ? 18.715  27.581  8.632   1.00 15.92  ? 557  ILE A CG2   1 
ATOM   844  C CD1   . ILE A  1 112 ? 17.884  26.843  5.702   1.00 14.94  ? 557  ILE A CD1   1 
ATOM   845  N N     . LEU A  1 113 ? 19.003  31.123  9.311   1.00 17.08  ? 558  LEU A N     1 
ATOM   846  C CA    . LEU A  1 113 ? 19.793  31.679  10.419  1.00 17.24  ? 558  LEU A CA    1 
ATOM   847  C C     . LEU A  1 113 ? 19.035  32.681  11.306  1.00 17.92  ? 558  LEU A C     1 
ATOM   848  O O     . LEU A  1 113 ? 19.502  32.986  12.388  1.00 18.90  ? 558  LEU A O     1 
ATOM   849  C CB    . LEU A  1 113 ? 21.074  32.328  9.902   1.00 17.35  ? 558  LEU A CB    1 
ATOM   850  C CG    . LEU A  1 113 ? 22.098  31.319  9.327   1.00 18.26  ? 558  LEU A CG    1 
ATOM   851  C CD1   . LEU A  1 113 ? 23.321  32.052  8.766   1.00 19.49  ? 558  LEU A CD1   1 
ATOM   852  C CD2   . LEU A  1 113 ? 22.519  30.320  10.391  1.00 18.23  ? 558  LEU A CD2   1 
ATOM   853  N N     . LYS A  1 114 ? 17.868  33.171  10.880  1.00 18.52  ? 559  LYS A N     1 
ATOM   854  C CA    . LYS A  1 114 ? 17.067  34.062  11.754  1.00 18.85  ? 559  LYS A CA    1 
ATOM   855  C C     . LYS A  1 114 ? 16.673  33.466  13.022  1.00 19.30  ? 559  LYS A C     1 
ATOM   856  O O     . LYS A  1 114 ? 16.601  34.170  14.026  1.00 19.22  ? 559  LYS A O     1 
ATOM   857  C CB    . LYS A  1 114 ? 15.842  34.590  11.046  1.00 22.18  ? 559  LYS A CB    1 
ATOM   858  C CG    . LYS A  1 114 ? 16.223  35.719  10.162  1.00 24.91  ? 559  LYS A CG    1 
ATOM   859  C CD    . LYS A  1 114 ? 15.112  36.135  9.281   1.00 28.59  ? 559  LYS A CD    1 
ATOM   860  C CE    . LYS A  1 114 ? 15.606  37.212  8.325   1.00 31.99  ? 559  LYS A CE    1 
ATOM   861  N NZ    . LYS A  1 114 ? 14.419  37.832  7.700   1.00 32.55  ? 559  LYS A NZ    1 
ATOM   862  N N     . TYR A  1 115 ? 16.411  32.147  13.028  1.00 17.27  ? 560  TYR A N     1 
ATOM   863  C CA    . TYR A  1 115 ? 16.039  31.445  14.235  1.00 16.17  ? 560  TYR A CA    1 
ATOM   864  C C     . TYR A  1 115 ? 17.147  30.477  14.687  1.00 16.35  ? 560  TYR A C     1 
ATOM   865  O O     . TYR A  1 115 ? 16.921  29.574  15.454  1.00 16.79  ? 560  TYR A O     1 
ATOM   866  C CB    . TYR A  1 115 ? 14.657  30.741  14.065  1.00 15.78  ? 560  TYR A CB    1 
ATOM   867  C CG    . TYR A  1 115 ? 14.513  29.943  12.806  1.00 14.45  ? 560  TYR A CG    1 
ATOM   868  C CD1   . TYR A  1 115 ? 14.970  28.632  12.744  1.00 14.14  ? 560  TYR A CD1   1 
ATOM   869  C CD2   . TYR A  1 115 ? 14.067  30.531  11.643  1.00 13.20  ? 560  TYR A CD2   1 
ATOM   870  C CE1   . TYR A  1 115 ? 14.861  27.894  11.556  1.00 14.69  ? 560  TYR A CE1   1 
ATOM   871  C CE2   . TYR A  1 115 ? 13.914  29.790  10.499  1.00 14.47  ? 560  TYR A CE2   1 
ATOM   872  C CZ    . TYR A  1 115 ? 14.375  28.459  10.461  1.00 13.46  ? 560  TYR A CZ    1 
ATOM   873  O OH    . TYR A  1 115 ? 14.290  27.727  9.282   1.00 13.49  ? 560  TYR A OH    1 
ATOM   874  N N     . ASN A  1 116 ? 18.364  30.701  14.180  1.00 15.67  ? 561  ASN A N     1 
ATOM   875  C CA    . ASN A  1 116 ? 19.537  29.939  14.571  1.00 15.74  ? 561  ASN A CA    1 
ATOM   876  C C     . ASN A  1 116 ? 20.758  30.900  14.718  1.00 17.76  ? 561  ASN A C     1 
ATOM   877  O O     . ASN A  1 116 ? 21.892  30.620  14.220  1.00 14.99  ? 561  ASN A O     1 
ATOM   878  C CB    . ASN A  1 116 ? 19.838  28.855  13.536  1.00 14.52  ? 561  ASN A CB    1 
ATOM   879  C CG    . ASN A  1 116 ? 18.913  27.690  13.665  1.00 14.20  ? 561  ASN A CG    1 
ATOM   880  O OD1   . ASN A  1 116 ? 18.904  26.988  14.677  1.00 15.19  ? 561  ASN A OD1   1 
ATOM   881  N ND2   . ASN A  1 116 ? 18.121  27.480  12.663  1.00 14.83  ? 561  ASN A ND2   1 
ATOM   882  N N     . VAL A  1 117 ? 20.526  32.040  15.370  1.00 19.20  ? 562  VAL A N     1 
ATOM   883  C CA    . VAL A  1 117 ? 21.544  33.118  15.393  1.00 20.00  ? 562  VAL A CA    1 
ATOM   884  C C     . VAL A  1 117 ? 22.841  32.651  16.035  1.00 19.13  ? 562  VAL A C     1 
ATOM   885  O O     . VAL A  1 117 ? 23.923  33.049  15.607  1.00 20.05  ? 562  VAL A O     1 
ATOM   886  C CB    . VAL A  1 117 ? 20.990  34.365  16.133  1.00 24.02  ? 562  VAL A CB    1 
ATOM   887  C CG1   . VAL A  1 117 ? 22.104  35.342  16.426  1.00 27.99  ? 562  VAL A CG1   1 
ATOM   888  C CG2   . VAL A  1 117 ? 19.941  35.032  15.271  1.00 23.64  ? 562  VAL A CG2   1 
ATOM   889  N N     . ALA A  1 118 ? 22.751  31.756  17.018  1.00 20.98  ? 563  ALA A N     1 
ATOM   890  C CA    . ALA A  1 118 ? 23.959  31.223  17.693  1.00 20.84  ? 563  ALA A CA    1 
ATOM   891  C C     . ALA A  1 118 ? 24.892  30.441  16.741  1.00 23.81  ? 563  ALA A C     1 
ATOM   892  O O     . ALA A  1 118 ? 26.076  30.253  17.048  1.00 22.30  ? 563  ALA A O     1 
ATOM   893  C CB    . ALA A  1 118 ? 23.574  30.361  18.886  1.00 24.65  ? 563  ALA A CB    1 
ATOM   894  N N     . TYR A  1 119 ? 24.402  30.103  15.537  1.00 20.70  ? 564  TYR A N     1 
ATOM   895  C CA    . TYR A  1 119 ? 25.178  29.323  14.602  1.00 20.03  ? 564  TYR A CA    1 
ATOM   896  C C     . TYR A  1 119 ? 25.518  30.081  13.352  1.00 20.46  ? 564  TYR A C     1 
ATOM   897  O O     . TYR A  1 119 ? 26.115  29.512  12.436  1.00 23.97  ? 564  TYR A O     1 
ATOM   898  C CB    . TYR A  1 119 ? 24.418  27.956  14.294  1.00 18.95  ? 564  TYR A CB    1 
ATOM   899  C CG    . TYR A  1 119 ? 24.189  27.167  15.570  1.00 16.92  ? 564  TYR A CG    1 
ATOM   900  C CD1   . TYR A  1 119 ? 25.216  26.445  16.164  1.00 18.91  ? 564  TYR A CD1   1 
ATOM   901  C CD2   . TYR A  1 119 ? 22.998  27.217  16.221  1.00 16.88  ? 564  TYR A CD2   1 
ATOM   902  C CE1   . TYR A  1 119 ? 25.045  25.797  17.377  1.00 18.11  ? 564  TYR A CE1   1 
ATOM   903  C CE2   . TYR A  1 119 ? 22.817  26.582  17.423  1.00 16.31  ? 564  TYR A CE2   1 
ATOM   904  C CZ    . TYR A  1 119 ? 23.853  25.851  17.975  1.00 19.42  ? 564  TYR A CZ    1 
ATOM   905  O OH    . TYR A  1 119 ? 23.647  25.220  19.156  1.00 22.62  ? 564  TYR A OH    1 
ATOM   906  N N     . SER A  1 120 ? 25.230  31.379  13.317  1.00 20.04  ? 565  SER A N     1 
ATOM   907  C CA    . SER A  1 120 ? 25.409  32.165  12.123  1.00 24.27  ? 565  SER A CA    1 
ATOM   908  C C     . SER A  1 120 ? 26.871  32.312  11.673  1.00 27.61  ? 565  SER A C     1 
ATOM   909  O O     . SER A  1 120 ? 27.141  32.643  10.488  1.00 27.53  ? 565  SER A O     1 
ATOM   910  C CB    . SER A  1 120 ? 24.778  33.544  12.284  1.00 29.55  ? 565  SER A CB    1 
ATOM   911  O OG    . SER A  1 120 ? 25.353  34.240  13.367  1.00 33.73  ? 565  SER A OG    1 
ATOM   912  N N     . LYS A  1 121 ? 27.809  31.990  12.562  1.00 27.12  ? 566  LYS A N     1 
ATOM   913  C CA    . LYS A  1 121 ? 29.233  32.000  12.184  1.00 32.87  ? 566  LYS A CA    1 
ATOM   914  C C     . LYS A  1 121 ? 29.852  30.626  12.284  1.00 30.20  ? 566  LYS A C     1 
ATOM   915  O O     . LYS A  1 121 ? 31.046  30.515  12.203  1.00 34.70  ? 566  LYS A O     1 
ATOM   916  C CB    . LYS A  1 121 ? 30.044  32.987  13.079  1.00 37.58  ? 566  LYS A CB    1 
ATOM   917  C CG    . LYS A  1 121 ? 29.333  34.293  13.403  1.00 44.48  ? 566  LYS A CG    1 
ATOM   918  C CD    . LYS A  1 121 ? 29.158  35.168  12.172  1.00 53.76  ? 566  LYS A CD    1 
ATOM   919  C CE    . LYS A  1 121 ? 30.243  36.228  12.116  1.00 63.47  ? 566  LYS A CE    1 
ATOM   920  N NZ    . LYS A  1 121 ? 30.175  36.987  10.852  1.00 69.33  ? 566  LYS A NZ    1 
ATOM   921  N N     . LYS A  1 122 ? 29.046  29.586  12.531  1.00 25.79  ? 567  LYS A N     1 
ATOM   922  C CA    . LYS A  1 122 ? 29.526  28.233  12.582  1.00 23.01  ? 567  LYS A CA    1 
ATOM   923  C C     . LYS A  1 122 ? 29.027  27.367  11.403  1.00 23.70  ? 567  LYS A C     1 
ATOM   924  O O     . LYS A  1 122 ? 29.767  26.535  10.881  1.00 24.24  ? 567  LYS A O     1 
ATOM   925  C CB    . LYS A  1 122 ? 29.137  27.609  13.894  1.00 27.85  ? 567  LYS A CB    1 
ATOM   926  C CG    . LYS A  1 122 ? 29.690  28.412  15.067  1.00 32.22  ? 567  LYS A CG    1 
ATOM   927  C CD    . LYS A  1 122 ? 29.410  27.770  16.397  1.00 35.93  ? 567  LYS A CD    1 
ATOM   928  C CE    . LYS A  1 122 ? 30.324  28.374  17.466  1.00 41.53  ? 567  LYS A CE    1 
ATOM   929  N NZ    . LYS A  1 122 ? 29.809  28.104  18.804  1.00 43.89  ? 567  LYS A NZ    1 
ATOM   930  N N     . TRP A  1 123 ? 27.782  27.539  11.000  1.00 19.00  ? 568  TRP A N     1 
ATOM   931  C CA    . TRP A  1 123 ? 27.223  26.703  9.904   1.00 19.75  ? 568  TRP A CA    1 
ATOM   932  C C     . TRP A  1 123 ? 27.693  27.218  8.525   1.00 19.81  ? 568  TRP A C     1 
ATOM   933  O O     . TRP A  1 123 ? 27.559  28.385  8.194   1.00 26.25  ? 568  TRP A O     1 
ATOM   934  C CB    . TRP A  1 123 ? 25.692  26.714  9.978   1.00 18.22  ? 568  TRP A CB    1 
ATOM   935  C CG    . TRP A  1 123 ? 25.102  25.980  11.167  1.00 14.76  ? 568  TRP A CG    1 
ATOM   936  C CD1   . TRP A  1 123 ? 25.764  25.256  12.104  1.00 15.03  ? 568  TRP A CD1   1 
ATOM   937  C CD2   . TRP A  1 123 ? 23.700  25.838  11.457  1.00 14.74  ? 568  TRP A CD2   1 
ATOM   938  N NE1   . TRP A  1 123 ? 24.844  24.667  13.001  1.00 15.24  ? 568  TRP A NE1   1 
ATOM   939  C CE2   . TRP A  1 123 ? 23.577  25.021  12.608  1.00 14.45  ? 568  TRP A CE2   1 
ATOM   940  C CE3   . TRP A  1 123 ? 22.538  26.302  10.833  1.00 15.16  ? 568  TRP A CE3   1 
ATOM   941  C CZ2   . TRP A  1 123 ? 22.365  24.723  13.178  1.00 14.99  ? 568  TRP A CZ2   1 
ATOM   942  C CZ3   . TRP A  1 123 ? 21.314  25.987  11.392  1.00 14.97  ? 568  TRP A CZ3   1 
ATOM   943  C CH2   . TRP A  1 123 ? 21.224  25.195  12.547  1.00 15.41  ? 568  TRP A CH2   1 
ATOM   944  N N     . ASP A  1 124 ? 28.115  26.318  7.690   1.00 20.23  ? 569  ASP A N     1 
ATOM   945  C CA    . ASP A  1 124 ? 28.525  26.642  6.329   1.00 18.88  ? 569  ASP A CA    1 
ATOM   946  C C     . ASP A  1 124 ? 27.430  26.211  5.325   1.00 17.25  ? 569  ASP A C     1 
ATOM   947  O O     . ASP A  1 124 ? 26.890  25.101  5.427   1.00 16.50  ? 569  ASP A O     1 
ATOM   948  C CB    . ASP A  1 124 ? 29.843  25.883  6.040   1.00 20.75  ? 569  ASP A CB    1 
ATOM   949  C CG    . ASP A  1 124 ? 30.268  25.959  4.597   1.00 23.41  ? 569  ASP A CG    1 
ATOM   950  O OD1   . ASP A  1 124 ? 30.162  27.008  3.970   1.00 27.84  ? 569  ASP A OD1   1 
ATOM   951  O OD2   . ASP A  1 124 ? 30.827  24.996  4.132   1.00 28.36  ? 569  ASP A OD2   1 
ATOM   952  N N     . PHE A  1 125 ? 27.188  27.066  4.336   1.00 15.02  ? 570  PHE A N     1 
ATOM   953  C CA    . PHE A  1 125 ? 26.092  26.904  3.343   1.00 15.50  ? 570  PHE A CA    1 
ATOM   954  C C     . PHE A  1 125 ? 26.653  26.796  1.954   1.00 14.40  ? 570  PHE A C     1 
ATOM   955  O O     . PHE A  1 125 ? 25.904  26.845  0.963   1.00 14.13  ? 570  PHE A O     1 
ATOM   956  C CB    . PHE A  1 125 ? 25.081  28.072  3.412   1.00 15.09  ? 570  PHE A CB    1 
ATOM   957  C CG    . PHE A  1 125 ? 24.187  28.016  4.629   1.00 14.69  ? 570  PHE A CG    1 
ATOM   958  C CD1   . PHE A  1 125 ? 24.619  28.535  5.823   1.00 15.24  ? 570  PHE A CD1   1 
ATOM   959  C CD2   . PHE A  1 125 ? 22.912  27.427  4.573   1.00 16.30  ? 570  PHE A CD2   1 
ATOM   960  C CE1   . PHE A  1 125 ? 23.816  28.463  7.003   1.00 16.69  ? 570  PHE A CE1   1 
ATOM   961  C CE2   . PHE A  1 125 ? 22.084  27.386  5.727   1.00 16.91  ? 570  PHE A CE2   1 
ATOM   962  C CZ    . PHE A  1 125 ? 22.547  27.899  6.944   1.00 17.29  ? 570  PHE A CZ    1 
ATOM   963  N N     . THR A  1 126 ? 27.980  26.616  1.854   1.00 13.55  ? 571  THR A N     1 
ATOM   964  C CA    . THR A  1 126 ? 28.640  26.608  0.536   1.00 14.32  ? 571  THR A CA    1 
ATOM   965  C C     . THR A  1 126 ? 28.031  25.613  -0.485  1.00 13.06  ? 571  THR A C     1 
ATOM   966  O O     . THR A  1 126 ? 27.830  25.937  -1.673  1.00 13.07  ? 571  THR A O     1 
ATOM   967  C CB    . THR A  1 126 ? 30.152  26.311  0.677   1.00 15.77  ? 571  THR A CB    1 
ATOM   968  O OG1   . THR A  1 126 ? 30.775  27.335  1.503   1.00 16.70  ? 571  THR A OG1   1 
ATOM   969  C CG2   . THR A  1 126 ? 30.778  26.318  -0.658  1.00 15.58  ? 571  THR A CG2   1 
ATOM   970  N N     . ALA A  1 127 ? 27.700  24.418  -0.023  1.00 12.65  ? 572  ALA A N     1 
ATOM   971  C CA    . ALA A  1 127 ? 27.094  23.411  -0.924  1.00 13.45  ? 572  ALA A CA    1 
ATOM   972  C C     . ALA A  1 127 ? 25.692  23.777  -1.384  1.00 13.37  ? 572  ALA A C     1 
ATOM   973  O O     . ALA A  1 127 ? 25.326  23.495  -2.503  1.00 13.25  ? 572  ALA A O     1 
ATOM   974  C CB    . ALA A  1 127 ? 27.079  22.048  -0.276  1.00 13.86  ? 572  ALA A CB    1 
ATOM   975  N N     . LEU A  1 128 ? 24.937  24.480  -0.547  1.00 14.91  ? 573  LEU A N     1 
ATOM   976  C CA    . LEU A  1 128 ? 23.598  24.973  -0.975  1.00 15.63  ? 573  LEU A CA    1 
ATOM   977  C C     . LEU A  1 128 ? 23.717  26.038  -2.020  1.00 16.49  ? 573  LEU A C     1 
ATOM   978  O O     . LEU A  1 128 ? 23.019  26.011  -3.017  1.00 16.05  ? 573  LEU A O     1 
ATOM   979  C CB    . LEU A  1 128 ? 22.838  25.503  0.205   1.00 17.77  ? 573  LEU A CB    1 
ATOM   980  C CG    . LEU A  1 128 ? 21.425  26.041  -0.051  1.00 21.40  ? 573  LEU A CG    1 
ATOM   981  C CD1   . LEU A  1 128 ? 20.528  24.986  -0.668  1.00 21.99  ? 573  LEU A CD1   1 
ATOM   982  C CD2   . LEU A  1 128 ? 20.843  26.479  1.289   1.00 26.56  ? 573  LEU A CD2   1 
ATOM   983  N N     . ILE A  1 129 ? 24.590  27.033  -1.776  1.00 16.87  ? 574  ILE A N     1 
ATOM   984  C CA    . ILE A  1 129 ? 24.835  28.084  -2.751  1.00 16.57  ? 574  ILE A CA    1 
ATOM   985  C C     . ILE A  1 129 ? 25.390  27.515  -4.072  1.00 15.63  ? 574  ILE A C     1 
ATOM   986  O O     . ILE A  1 129 ? 24.920  27.876  -5.155  1.00 15.54  ? 574  ILE A O     1 
ATOM   987  C CB    . ILE A  1 129 ? 25.798  29.189  -2.134  1.00 18.82  ? 574  ILE A CB    1 
ATOM   988  C CG1   . ILE A  1 129 ? 25.020  30.056  -1.162  1.00 24.85  ? 574  ILE A CG1   1 
ATOM   989  C CG2   . ILE A  1 129 ? 26.434  30.002  -3.218  1.00 19.66  ? 574  ILE A CG2   1 
ATOM   990  C CD1   . ILE A  1 129 ? 25.710  30.237  0.174   1.00 33.23  ? 574  ILE A CD1   1 
ATOM   991  N N     . ASP A  1 130 ? 26.324  26.579  -4.000  1.00 13.26  ? 575  ASP A N     1 
ATOM   992  C CA    . ASP A  1 130 ? 26.866  26.002  -5.231  1.00 15.62  ? 575  ASP A CA    1 
ATOM   993  C C     . ASP A  1 130 ? 25.839  25.167  -6.009  1.00 15.06  ? 575  ASP A C     1 
ATOM   994  O O     . ASP A  1 130 ? 25.855  25.145  -7.232  1.00 13.48  ? 575  ASP A O     1 
ATOM   995  C CB    . ASP A  1 130 ? 28.100  25.117  -4.950  1.00 16.88  ? 575  ASP A CB    1 
ATOM   996  C CG    . ASP A  1 130 ? 29.376  25.958  -4.578  1.00 20.64  ? 575  ASP A CG    1 
ATOM   997  O OD1   . ASP A  1 130 ? 29.388  27.231  -4.763  1.00 20.95  ? 575  ASP A OD1   1 
ATOM   998  O OD2   . ASP A  1 130 ? 30.383  25.315  -4.155  1.00 23.12  ? 575  ASP A OD2   1 
ATOM   999  N N     . PHE A  1 131 ? 25.012  24.426  -5.283  1.00 14.52  ? 576  PHE A N     1 
ATOM   1000 C CA    . PHE A  1 131 ? 24.005  23.616  -5.914  1.00 14.36  ? 576  PHE A CA    1 
ATOM   1001 C C     . PHE A  1 131 ? 23.070  24.515  -6.713  1.00 13.82  ? 576  PHE A C     1 
ATOM   1002 O O     . PHE A  1 131 ? 22.877  24.324  -7.961  1.00 14.12  ? 576  PHE A O     1 
ATOM   1003 C CB    . PHE A  1 131 ? 23.246  22.845  -4.870  1.00 15.27  ? 576  PHE A CB    1 
ATOM   1004 C CG    . PHE A  1 131 ? 22.158  21.986  -5.428  1.00 14.05  ? 576  PHE A CG    1 
ATOM   1005 C CD1   . PHE A  1 131 ? 22.460  20.857  -6.171  1.00 14.88  ? 576  PHE A CD1   1 
ATOM   1006 C CD2   . PHE A  1 131 ? 20.848  22.317  -5.225  1.00 15.52  ? 576  PHE A CD2   1 
ATOM   1007 C CE1   . PHE A  1 131 ? 21.435  20.020  -6.651  1.00 15.78  ? 576  PHE A CE1   1 
ATOM   1008 C CE2   . PHE A  1 131 ? 19.825  21.512  -5.726  1.00 14.91  ? 576  PHE A CE2   1 
ATOM   1009 C CZ    . PHE A  1 131 ? 20.131  20.361  -6.430  1.00 15.64  ? 576  PHE A CZ    1 
ATOM   1010 N N     . TRP A  1 132 ? 22.530  25.528  -6.044  1.00 13.96  ? 577  TRP A N     1 
ATOM   1011 C CA    . TRP A  1 132 ? 21.577  26.439  -6.668  1.00 14.42  ? 577  TRP A CA    1 
ATOM   1012 C C     . TRP A  1 132 ? 22.207  27.241  -7.841  1.00 15.50  ? 577  TRP A C     1 
ATOM   1013 O O     . TRP A  1 132 ? 21.627  27.332  -8.917  1.00 16.43  ? 577  TRP A O     1 
ATOM   1014 C CB    . TRP A  1 132 ? 21.062  27.365  -5.607  1.00 15.28  ? 577  TRP A CB    1 
ATOM   1015 C CG    . TRP A  1 132 ? 19.887  28.331  -5.904  1.00 14.74  ? 577  TRP A CG    1 
ATOM   1016 C CD1   . TRP A  1 132 ? 19.725  29.164  -6.959  1.00 15.52  ? 577  TRP A CD1   1 
ATOM   1017 C CD2   . TRP A  1 132 ? 18.867  28.696  -4.955  1.00 14.71  ? 577  TRP A CD2   1 
ATOM   1018 N NE1   . TRP A  1 132 ? 18.636  30.006  -6.737  1.00 14.61  ? 577  TRP A NE1   1 
ATOM   1019 C CE2   . TRP A  1 132 ? 18.116  29.722  -5.510  1.00 14.72  ? 577  TRP A CE2   1 
ATOM   1020 C CE3   . TRP A  1 132 ? 18.528  28.227  -3.667  1.00 15.46  ? 577  TRP A CE3   1 
ATOM   1021 C CZ2   . TRP A  1 132 ? 17.049  30.304  -4.840  1.00 15.93  ? 577  TRP A CZ2   1 
ATOM   1022 C CZ3   . TRP A  1 132 ? 17.456  28.789  -3.022  1.00 16.14  ? 577  TRP A CZ3   1 
ATOM   1023 C CH2   . TRP A  1 132 ? 16.739  29.834  -3.605  1.00 15.65  ? 577  TRP A CH2   1 
ATOM   1024 N N     . ASP A  1 133 ? 23.389  27.829  -7.612  1.00 16.78  ? 578  ASP A N     1 
ATOM   1025 C CA    . ASP A  1 133 ? 24.018  28.727  -8.594  1.00 17.03  ? 578  ASP A CA    1 
ATOM   1026 C C     . ASP A  1 133 ? 24.867  28.033  -9.641  1.00 17.88  ? 578  ASP A C     1 
ATOM   1027 O O     . ASP A  1 133 ? 25.004  28.537  -10.774 1.00 18.15  ? 578  ASP A O     1 
ATOM   1028 C CB    . ASP A  1 133 ? 24.934  29.719  -7.884  1.00 18.28  ? 578  ASP A CB    1 
ATOM   1029 C CG    . ASP A  1 133 ? 24.206  30.932  -7.366  1.00 22.52  ? 578  ASP A CG    1 
ATOM   1030 O OD1   . ASP A  1 133 ? 22.961  31.013  -7.552  1.00 23.24  ? 578  ASP A OD1   1 
ATOM   1031 O OD2   . ASP A  1 133 ? 24.900  31.833  -6.765  1.00 23.14  ? 578  ASP A OD2   1 
ATOM   1032 N N     . LYS A  1 134 ? 25.569  26.985  -9.248  1.00 15.89  ? 579  LYS A N     1 
ATOM   1033 C CA    . LYS A  1 134 ? 26.644  26.444  -10.130 1.00 16.15  ? 579  LYS A CA    1 
ATOM   1034 C C     . LYS A  1 134 ? 26.403  25.028  -10.635 1.00 15.31  ? 579  LYS A C     1 
ATOM   1035 O O     . LYS A  1 134 ? 27.175  24.534  -11.408 1.00 14.95  ? 579  LYS A O     1 
ATOM   1036 C CB    . LYS A  1 134 ? 27.998  26.494  -9.411  1.00 15.69  ? 579  LYS A CB    1 
ATOM   1037 C CG    . LYS A  1 134 ? 28.398  27.859  -8.856  1.00 15.63  ? 579  LYS A CG    1 
ATOM   1038 C CD    . LYS A  1 134 ? 29.780  27.760  -8.198  1.00 16.86  ? 579  LYS A CD    1 
ATOM   1039 C CE    . LYS A  1 134 ? 30.334  29.107  -7.721  1.00 17.98  ? 579  LYS A CE    1 
ATOM   1040 N NZ    . LYS A  1 134 ? 29.699  29.647  -6.470  1.00 19.24  ? 579  LYS A NZ    1 
ATOM   1041 N N     . VAL A  1 135 ? 25.426  24.325  -10.084 1.00 15.77  ? 580  VAL A N     1 
ATOM   1042 C CA    . VAL A  1 135 ? 25.056  23.005  -10.624 1.00 16.67  ? 580  VAL A CA    1 
ATOM   1043 C C     . VAL A  1 135 ? 23.758  23.069  -11.404 1.00 16.54  ? 580  VAL A C     1 
ATOM   1044 O O     . VAL A  1 135 ? 23.693  22.649  -12.541 1.00 17.26  ? 580  VAL A O     1 
ATOM   1045 C CB    . VAL A  1 135 ? 24.902  21.978  -9.487  1.00 17.42  ? 580  VAL A CB    1 
ATOM   1046 C CG1   . VAL A  1 135 ? 24.496  20.593  -10.040 1.00 18.58  ? 580  VAL A CG1   1 
ATOM   1047 C CG2   . VAL A  1 135 ? 26.189  21.841  -8.741  1.00 18.05  ? 580  VAL A CG2   1 
ATOM   1048 N N     . LEU A  1 136 ? 22.695  23.587  -10.799 1.00 15.98  ? 581  LEU A N     1 
ATOM   1049 C CA    . LEU A  1 136 ? 21.401  23.607  -11.488 1.00 17.53  ? 581  LEU A CA    1 
ATOM   1050 C C     . LEU A  1 136 ? 21.384  24.504  -12.748 1.00 20.87  ? 581  LEU A C     1 
ATOM   1051 O O     . LEU A  1 136 ? 21.964  25.601  -12.754 1.00 19.59  ? 581  LEU A O     1 
ATOM   1052 C CB    . LEU A  1 136 ? 20.305  24.069  -10.559 1.00 17.57  ? 581  LEU A CB    1 
ATOM   1053 C CG    . LEU A  1 136 ? 19.984  23.118  -9.429  1.00 17.51  ? 581  LEU A CG    1 
ATOM   1054 C CD1   . LEU A  1 136 ? 18.783  23.663  -8.677  1.00 18.44  ? 581  LEU A CD1   1 
ATOM   1055 C CD2   . LEU A  1 136 ? 19.707  21.700  -9.954  1.00 18.08  ? 581  LEU A CD2   1 
ATOM   1056 N N     . GLU A  1 137 ? 20.724  24.017  -13.809 1.00 20.80  ? 582  GLU A N     1 
ATOM   1057 C CA    . GLU A  1 137 ? 20.357  24.857  -14.963 1.00 24.18  ? 582  GLU A CA    1 
ATOM   1058 C C     . GLU A  1 137 ? 19.351  25.930  -14.479 1.00 23.20  ? 582  GLU A C     1 
ATOM   1059 O O     . GLU A  1 137 ? 18.683  25.725  -13.447 1.00 19.84  ? 582  GLU A O     1 
ATOM   1060 C CB    . GLU A  1 137 ? 19.715  23.987  -16.079 1.00 28.50  ? 582  GLU A CB    1 
ATOM   1061 C CG    . GLU A  1 137 ? 20.719  23.083  -16.797 1.00 33.37  ? 582  GLU A CG    1 
ATOM   1062 C CD    . GLU A  1 137 ? 20.078  21.913  -17.522 1.00 41.43  ? 582  GLU A CD    1 
ATOM   1063 O OE1   . GLU A  1 137 ? 18.835  21.885  -17.647 1.00 45.59  ? 582  GLU A OE1   1 
ATOM   1064 O OE2   . GLU A  1 137 ? 20.821  21.014  -17.970 1.00 48.50  ? 582  GLU A OE2   1 
ATOM   1065 N N     . GLU A  1 138 ? 19.202  27.027  -15.248 1.00 20.62  ? 583  GLU A N     1 
ATOM   1066 C CA    . GLU A  1 138 ? 18.338  28.136  -14.871 1.00 25.71  ? 583  GLU A CA    1 
ATOM   1067 C C     . GLU A  1 138 ? 16.856  27.699  -14.639 1.00 23.72  ? 583  GLU A C     1 
ATOM   1068 O O     . GLU A  1 138 ? 16.226  28.115  -13.670 1.00 22.48  ? 583  GLU A O     1 
ATOM   1069 C CB    . GLU A  1 138 ? 18.413  29.299  -15.910 1.00 30.79  ? 583  GLU A CB    1 
ATOM   1070 C CG    . GLU A  1 138 ? 18.111  30.691  -15.301 1.00 40.12  ? 583  GLU A CG    1 
ATOM   1071 C CD    . GLU A  1 138 ? 19.317  31.341  -14.486 1.00 46.91  ? 583  GLU A CD    1 
ATOM   1072 O OE1   . GLU A  1 138 ? 20.546  30.942  -14.619 1.00 42.88  ? 583  GLU A OE1   1 
ATOM   1073 O OE2   . GLU A  1 138 ? 19.044  32.330  -13.768 1.00 59.13  ? 583  GLU A OE2   1 
ATOM   1074 N N     . ALA A  1 139 ? 16.353  26.827  -15.494 1.00 23.35  ? 584  ALA A N     1 
ATOM   1075 C CA    . ALA A  1 139 ? 14.957  26.356  -15.397 1.00 25.51  ? 584  ALA A CA    1 
ATOM   1076 C C     . ALA A  1 139 ? 14.783  25.499  -14.151 1.00 22.34  ? 584  ALA A C     1 
ATOM   1077 O O     . ALA A  1 139 ? 13.735  25.568  -13.453 1.00 20.94  ? 584  ALA A O     1 
ATOM   1078 C CB    . ALA A  1 139 ? 14.594  25.558  -16.671 1.00 27.97  ? 584  ALA A CB    1 
ATOM   1079 N N     . GLU A  1 140 ? 15.816  24.716  -13.831 1.00 20.81  ? 585  GLU A N     1 
ATOM   1080 C CA    . GLU A  1 140 ? 15.773  23.855  -12.616 1.00 18.95  ? 585  GLU A CA    1 
ATOM   1081 C C     . GLU A  1 140 ? 15.796  24.694  -11.339 1.00 16.79  ? 585  GLU A C     1 
ATOM   1082 O O     . GLU A  1 140 ? 15.054  24.403  -10.387 1.00 15.64  ? 585  GLU A O     1 
ATOM   1083 C CB    . GLU A  1 140 ? 16.940  22.859  -12.593 1.00 22.95  ? 585  GLU A CB    1 
ATOM   1084 C CG    . GLU A  1 140 ? 16.947  21.851  -13.754 1.00 25.38  ? 585  GLU A CG    1 
ATOM   1085 C CD    . GLU A  1 140 ? 18.163  20.933  -13.721 1.00 29.05  ? 585  GLU A CD    1 
ATOM   1086 O OE1   . GLU A  1 140 ? 19.353  21.395  -13.716 1.00 27.09  ? 585  GLU A OE1   1 
ATOM   1087 O OE2   . GLU A  1 140 ? 17.932  19.731  -13.682 1.00 33.26  ? 585  GLU A OE2   1 
ATOM   1088 N N     . ALA A  1 141 ? 16.648  25.725  -11.308 1.00 16.12  ? 586  ALA A N     1 
ATOM   1089 C CA    . ALA A  1 141 ? 16.712  26.661  -10.174 1.00 17.81  ? 586  ALA A CA    1 
ATOM   1090 C C     . ALA A  1 141 ? 15.382  27.364  -9.995  1.00 17.34  ? 586  ALA A C     1 
ATOM   1091 O O     . ALA A  1 141 ? 14.881  27.510  -8.852  1.00 16.81  ? 586  ALA A O     1 
ATOM   1092 C CB    . ALA A  1 141 ? 17.845  27.687  -10.368 1.00 18.81  ? 586  ALA A CB    1 
ATOM   1093 N N     . GLN A  1 142 ? 14.772  27.804  -11.108 1.00 19.46  ? 587  GLN A N     1 
ATOM   1094 C CA    . GLN A  1 142 ? 13.484  28.506  -10.995 1.00 21.64  ? 587  GLN A CA    1 
ATOM   1095 C C     . GLN A  1 142 ? 12.430  27.574  -10.436 1.00 17.63  ? 587  GLN A C     1 
ATOM   1096 O O     . GLN A  1 142 ? 11.654  27.964  -9.636  1.00 21.03  ? 587  GLN A O     1 
ATOM   1097 C CB    . GLN A  1 142 ? 12.984  29.038  -12.354 1.00 25.43  ? 587  GLN A CB    1 
ATOM   1098 C CG    . GLN A  1 142 ? 13.813  30.168  -12.912 1.00 32.02  ? 587  GLN A CG    1 
ATOM   1099 C CD    . GLN A  1 142 ? 13.227  30.712  -14.200 1.00 40.18  ? 587  GLN A CD    1 
ATOM   1100 O OE1   . GLN A  1 142 ? 12.086  30.392  -14.573 1.00 41.57  ? 587  GLN A OE1   1 
ATOM   1101 N NE2   . GLN A  1 142 ? 13.997  31.524  -14.888 1.00 48.42  ? 587  GLN A NE2   1 
ATOM   1102 N N     . HIS A  1 143 ? 12.383  26.348  -10.915 1.00 18.30  ? 588  HIS A N     1 
ATOM   1103 C CA    . HIS A  1 143 ? 11.446  25.349  -10.331 1.00 20.85  ? 588  HIS A CA    1 
ATOM   1104 C C     . HIS A  1 143 ? 11.687  25.127  -8.789  1.00 19.17  ? 588  HIS A C     1 
ATOM   1105 O O     . HIS A  1 143 ? 10.745  24.998  -7.990  1.00 18.35  ? 588  HIS A O     1 
ATOM   1106 C CB    . HIS A  1 143 ? 11.544  24.047  -11.083 1.00 21.17  ? 588  HIS A CB    1 
ATOM   1107 C CG    . HIS A  1 143 ? 10.500  23.056  -10.682 1.00 25.55  ? 588  HIS A CG    1 
ATOM   1108 N ND1   . HIS A  1 143 ? 9.148   23.345  -10.711 1.00 27.49  ? 588  HIS A ND1   1 
ATOM   1109 C CD2   . HIS A  1 143 ? 10.602  21.778  -10.262 1.00 27.72  ? 588  HIS A CD2   1 
ATOM   1110 C CE1   . HIS A  1 143 ? 8.466   22.299  -10.293 1.00 28.17  ? 588  HIS A CE1   1 
ATOM   1111 N NE2   . HIS A  1 143 ? 9.322   21.336  -10.005 1.00 31.29  ? 588  HIS A NE2   1 
ATOM   1112 N N     . LEU A  1 144 ? 12.943  25.172  -8.372  1.00 17.90  ? 589  LEU A N     1 
ATOM   1113 C CA    . LEU A  1 144 ? 13.268  25.024  -6.948  1.00 16.57  ? 589  LEU A CA    1 
ATOM   1114 C C     . LEU A  1 144 ? 12.733  26.166  -6.106  1.00 15.09  ? 589  LEU A C     1 
ATOM   1115 O O     . LEU A  1 144 ? 12.100  25.938  -5.086  1.00 15.77  ? 589  LEU A O     1 
ATOM   1116 C CB    . LEU A  1 144 ? 14.798  24.870  -6.759  1.00 16.23  ? 589  LEU A CB    1 
ATOM   1117 C CG    . LEU A  1 144 ? 15.257  24.737  -5.315  1.00 16.38  ? 589  LEU A CG    1 
ATOM   1118 C CD1   . LEU A  1 144 ? 14.908  23.373  -4.747  1.00 16.60  ? 589  LEU A CD1   1 
ATOM   1119 C CD2   . LEU A  1 144 ? 16.760  24.964  -5.243  1.00 17.85  ? 589  LEU A CD2   1 
ATOM   1120 N N     . TYR A  1 145 ? 12.998  27.392  -6.508  1.00 15.87  ? 590  TYR A N     1 
ATOM   1121 C CA    . TYR A  1 145 ? 12.604  28.520  -5.703  1.00 15.95  ? 590  TYR A CA    1 
ATOM   1122 C C     . TYR A  1 145 ? 11.185  29.006  -5.915  1.00 16.29  ? 590  TYR A C     1 
ATOM   1123 O O     . TYR A  1 145 ? 10.602  29.586  -4.994  1.00 14.33  ? 590  TYR A O     1 
ATOM   1124 C CB    . TYR A  1 145 ? 13.634  29.672  -5.757  1.00 17.69  ? 590  TYR A CB    1 
ATOM   1125 C CG    . TYR A  1 145 ? 13.813  30.429  -7.060  1.00 19.29  ? 590  TYR A CG    1 
ATOM   1126 C CD1   . TYR A  1 145 ? 12.891  31.364  -7.465  1.00 23.83  ? 590  TYR A CD1   1 
ATOM   1127 C CD2   . TYR A  1 145 ? 14.992  30.324  -7.795  1.00 25.88  ? 590  TYR A CD2   1 
ATOM   1128 C CE1   . TYR A  1 145 ? 13.082  32.112  -8.605  1.00 24.43  ? 590  TYR A CE1   1 
ATOM   1129 C CE2   . TYR A  1 145 ? 15.189  31.080  -8.957  1.00 25.14  ? 590  TYR A CE2   1 
ATOM   1130 C CZ    . TYR A  1 145 ? 14.227  31.980  -9.329  1.00 26.43  ? 590  TYR A CZ    1 
ATOM   1131 O OH    . TYR A  1 145 ? 14.379  32.730  -10.459 1.00 32.16  ? 590  TYR A OH    1 
ATOM   1132 N N     . GLN A  1 146 ? 10.605  28.713  -7.066  1.00 17.03  ? 591  GLN A N     1 
ATOM   1133 C CA    . GLN A  1 146 ? 9.177   29.123  -7.326  1.00 18.28  ? 591  GLN A CA    1 
ATOM   1134 C C     . GLN A  1 146 ? 8.175   28.093  -6.880  1.00 19.37  ? 591  GLN A C     1 
ATOM   1135 O O     . GLN A  1 146 ? 7.041   28.450  -6.507  1.00 21.26  ? 591  GLN A O     1 
ATOM   1136 C CB    . GLN A  1 146 ? 8.948   29.431  -8.805  1.00 19.35  ? 591  GLN A CB    1 
ATOM   1137 C CG    . GLN A  1 146 ? 9.672   30.716  -9.248  1.00 23.80  ? 591  GLN A CG    1 
ATOM   1138 C CD    . GLN A  1 146 ? 9.489   31.018  -10.702 1.00 26.89  ? 591  GLN A CD    1 
ATOM   1139 O OE1   . GLN A  1 146 ? 9.110   30.161  -11.493 1.00 30.18  ? 591  GLN A OE1   1 
ATOM   1140 N NE2   . GLN A  1 146 ? 9.798   32.224  -11.072 1.00 29.44  ? 591  GLN A NE2   1 
ATOM   1141 N N     . SER A  1 147 ? 8.548   26.825  -6.861  1.00 17.11  ? 592  SER A N     1 
ATOM   1142 C CA    A SER A  1 147 ? 7.604   25.772  -6.556  0.50 16.17  ? 592  SER A CA    1 
ATOM   1143 C CA    B SER A  1 147 ? 7.580   25.799  -6.486  0.50 16.66  ? 592  SER A CA    1 
ATOM   1144 C C     . SER A  1 147 ? 8.018   24.902  -5.346  1.00 16.46  ? 592  SER A C     1 
ATOM   1145 O O     . SER A  1 147 ? 7.318   24.820  -4.342  1.00 16.84  ? 592  SER A O     1 
ATOM   1146 C CB    A SER A  1 147 ? 7.439   24.902  -7.808  0.50 16.49  ? 592  SER A CB    1 
ATOM   1147 C CB    B SER A  1 147 ? 7.180   24.952  -7.693  0.50 17.50  ? 592  SER A CB    1 
ATOM   1148 O OG    A SER A  1 147 ? 6.330   24.050  -7.695  0.50 14.50  ? 592  SER A OG    1 
ATOM   1149 O OG    B SER A  1 147 ? 6.804   25.760  -8.767  0.50 17.14  ? 592  SER A OG    1 
ATOM   1150 N N     . ILE A  1 148 ? 9.163   24.232  -5.467  1.00 15.48  ? 593  ILE A N     1 
ATOM   1151 C CA    . ILE A  1 148 ? 9.539   23.223  -4.479  1.00 14.52  ? 593  ILE A CA    1 
ATOM   1152 C C     . ILE A  1 148 ? 9.771   23.839  -3.109  1.00 14.03  ? 593  ILE A C     1 
ATOM   1153 O O     . ILE A  1 148 ? 9.166   23.407  -2.112  1.00 14.12  ? 593  ILE A O     1 
ATOM   1154 C CB    . ILE A  1 148 ? 10.778  22.421  -4.936  1.00 15.30  ? 593  ILE A CB    1 
ATOM   1155 C CG1   . ILE A  1 148 ? 10.470  21.649  -6.205  1.00 17.09  ? 593  ILE A CG1   1 
ATOM   1156 C CG2   . ILE A  1 148 ? 11.174  21.445  -3.895  1.00 15.62  ? 593  ILE A CG2   1 
ATOM   1157 C CD1   . ILE A  1 148 ? 11.682  20.950  -6.834  1.00 18.70  ? 593  ILE A CD1   1 
ATOM   1158 N N     . LEU A  1 149 ? 10.621  24.866  -3.021  1.00 12.77  ? 594  LEU A N     1 
ATOM   1159 C CA    . LEU A  1 149 ? 10.890  25.442  -1.708  1.00 13.35  ? 594  LEU A CA    1 
ATOM   1160 C C     . LEU A  1 149 ? 9.615   26.028  -1.012  1.00 13.36  ? 594  LEU A C     1 
ATOM   1161 O O     . LEU A  1 149 ? 9.364   25.758  0.159   1.00 13.94  ? 594  LEU A O     1 
ATOM   1162 C CB    . LEU A  1 149 ? 12.042  26.463  -1.776  1.00 13.69  ? 594  LEU A CB    1 
ATOM   1163 C CG    . LEU A  1 149 ? 13.420  25.832  -1.921  1.00 14.61  ? 594  LEU A CG    1 
ATOM   1164 C CD1   . LEU A  1 149 ? 14.490  26.837  -2.300  1.00 16.55  ? 594  LEU A CD1   1 
ATOM   1165 C CD2   . LEU A  1 149 ? 13.856  25.092  -0.689  1.00 16.14  ? 594  LEU A CD2   1 
ATOM   1166 N N     . PRO A  1 150 ? 8.778   26.778  -1.750  1.00 14.41  ? 595  PRO A N     1 
ATOM   1167 C CA    . PRO A  1 150 ? 7.622   27.331  -1.030  1.00 15.00  ? 595  PRO A CA    1 
ATOM   1168 C C     . PRO A  1 150 ? 6.595   26.253  -0.648  1.00 13.31  ? 595  PRO A C     1 
ATOM   1169 O O     . PRO A  1 150 ? 5.931   26.367  0.340   1.00 12.81  ? 595  PRO A O     1 
ATOM   1170 C CB    . PRO A  1 150 ? 7.016   28.379  -2.020  1.00 17.42  ? 595  PRO A CB    1 
ATOM   1171 C CG    . PRO A  1 150 ? 7.802   28.239  -3.277  1.00 18.75  ? 595  PRO A CG    1 
ATOM   1172 C CD    . PRO A  1 150 ? 9.092   27.511  -2.967  1.00 15.58  ? 595  PRO A CD    1 
ATOM   1173 N N     . ASP A  1 151 ? 6.511   25.196  -1.407  1.00 14.68  ? 596  ASP A N     1 
ATOM   1174 C CA    . ASP A  1 151 ? 5.647   24.081  -0.998  1.00 14.81  ? 596  ASP A CA    1 
ATOM   1175 C C     . ASP A  1 151 ? 6.181   23.373  0.278   1.00 14.40  ? 596  ASP A C     1 
ATOM   1176 O O     . ASP A  1 151 ? 5.413   22.864  1.152   1.00 12.16  ? 596  ASP A O     1 
ATOM   1177 C CB    . ASP A  1 151 ? 5.523   23.105  -2.161  1.00 15.80  ? 596  ASP A CB    1 
ATOM   1178 C CG    . ASP A  1 151 ? 4.571   23.635  -3.291  1.00 21.11  ? 596  ASP A CG    1 
ATOM   1179 O OD1   . ASP A  1 151 ? 3.867   24.681  -3.113  1.00 24.42  ? 596  ASP A OD1   1 
ATOM   1180 O OD2   . ASP A  1 151 ? 4.505   22.982  -4.295  1.00 22.13  ? 596  ASP A OD2   1 
ATOM   1181 N N     . MET A  1 152 ? 7.516   23.306  0.383   1.00 13.71  ? 597  MET A N     1 
ATOM   1182 C CA    . MET A  1 152 ? 8.159   22.661  1.550   1.00 11.50  ? 597  MET A CA    1 
ATOM   1183 C C     . MET A  1 152 ? 7.921   23.540  2.761   1.00 12.01  ? 597  MET A C     1 
ATOM   1184 O O     . MET A  1 152 ? 7.657   23.029  3.835   1.00 11.89  ? 597  MET A O     1 
ATOM   1185 C CB    . MET A  1 152 ? 9.669   22.460  1.330   1.00 11.27  ? 597  MET A CB    1 
ATOM   1186 C CG    . MET A  1 152 ? 10.033  21.344  0.362   1.00 12.10  ? 597  MET A CG    1 
ATOM   1187 S SD    . MET A  1 152 ? 11.772  21.323  -0.134  1.00 13.92  ? 597  MET A SD    1 
ATOM   1188 C CE    . MET A  1 152 ? 12.515  21.046  1.451   1.00 14.93  ? 597  MET A CE    1 
ATOM   1189 N N     . VAL A  1 153 ? 8.005   24.877  2.589   1.00 12.62  ? 598  VAL A N     1 
ATOM   1190 C CA    . VAL A  1 153 ? 7.725   25.797  3.709   1.00 12.45  ? 598  VAL A CA    1 
ATOM   1191 C C     . VAL A  1 153 ? 6.303   25.583  4.214   1.00 12.39  ? 598  VAL A C     1 
ATOM   1192 O O     . VAL A  1 153 ? 6.067   25.439  5.419   1.00 13.18  ? 598  VAL A O     1 
ATOM   1193 C CB    . VAL A  1 153 ? 7.896   27.269  3.282   1.00 12.98  ? 598  VAL A CB    1 
ATOM   1194 C CG1   . VAL A  1 153 ? 7.262   28.189  4.303   1.00 14.04  ? 598  VAL A CG1   1 
ATOM   1195 C CG2   . VAL A  1 153 ? 9.365   27.574  3.119   1.00 13.07  ? 598  VAL A CG2   1 
ATOM   1196 N N     . LYS A  1 154 ? 5.363   25.509  3.295   1.00 12.60  ? 599  LYS A N     1 
ATOM   1197 C CA    . LYS A  1 154 ? 3.962   25.393  3.703   1.00 13.48  ? 599  LYS A CA    1 
ATOM   1198 C C     . LYS A  1 154 ? 3.656   24.071  4.438   1.00 12.88  ? 599  LYS A C     1 
ATOM   1199 O O     . LYS A  1 154 ? 2.885   24.049  5.437   1.00 13.10  ? 599  LYS A O     1 
ATOM   1200 C CB    . LYS A  1 154 ? 3.054   25.586  2.496   1.00 14.97  ? 599  LYS A CB    1 
ATOM   1201 C CG    . LYS A  1 154 ? 2.935   27.060  2.053   1.00 18.46  ? 599  LYS A CG    1 
ATOM   1202 C CD    . LYS A  1 154 ? 2.061   27.129  0.847   1.00 22.97  ? 599  LYS A CD    1 
ATOM   1203 C CE    . LYS A  1 154 ? 2.436   28.229  -0.085  1.00 33.28  ? 599  LYS A CE    1 
ATOM   1204 N NZ    . LYS A  1 154 ? 2.218   27.758  -1.494  1.00 36.78  ? 599  LYS A NZ    1 
ATOM   1205 N N     . ILE A  1 155 ? 4.208   22.949  3.962   1.00 13.24  ? 600  ILE A N     1 
ATOM   1206 C CA    . ILE A  1 155 ? 3.989   21.692  4.722   1.00 12.74  ? 600  ILE A CA    1 
ATOM   1207 C C     . ILE A  1 155 ? 4.719   21.712  6.089   1.00 12.42  ? 600  ILE A C     1 
ATOM   1208 O O     . ILE A  1 155 ? 4.173   21.231  7.109   1.00 11.98  ? 600  ILE A O     1 
ATOM   1209 C CB    . ILE A  1 155 ? 4.272   20.404  3.892   1.00 13.53  ? 600  ILE A CB    1 
ATOM   1210 C CG1   . ILE A  1 155 ? 3.611   19.208  4.561   1.00 15.34  ? 600  ILE A CG1   1 
ATOM   1211 C CG2   . ILE A  1 155 ? 5.760   20.167  3.729   1.00 14.01  ? 600  ILE A CG2   1 
ATOM   1212 C CD1   . ILE A  1 155 ? 3.647   17.916  3.718   1.00 16.63  ? 600  ILE A CD1   1 
ATOM   1213 N N     . ALA A  1 156 ? 5.921   22.328  6.162   1.00 11.46  ? 601  ALA A N     1 
ATOM   1214 C CA    . ALA A  1 156 ? 6.589   22.462  7.432   1.00 10.97  ? 601  ALA A CA    1 
ATOM   1215 C C     . ALA A  1 156 ? 5.752   23.294  8.433   1.00 12.18  ? 601  ALA A C     1 
ATOM   1216 O O     . ALA A  1 156 ? 5.626   22.921  9.580   1.00 11.09  ? 601  ALA A O     1 
ATOM   1217 C CB    . ALA A  1 156 ? 7.960   23.100  7.272   1.00 11.76  ? 601  ALA A CB    1 
ATOM   1218 N N     . LEU A  1 157 ? 5.198   24.421  7.960   1.00 12.86  ? 602  LEU A N     1 
ATOM   1219 C CA    . LEU A  1 157 ? 4.465   25.333  8.819   1.00 14.21  ? 602  LEU A CA    1 
ATOM   1220 C C     . LEU A  1 157 ? 3.083   24.778  9.211   1.00 15.90  ? 602  LEU A C     1 
ATOM   1221 O O     . LEU A  1 157 ? 2.503   25.222  10.207  1.00 14.11  ? 602  LEU A O     1 
ATOM   1222 C CB    . LEU A  1 157 ? 4.330   26.711  8.157   1.00 15.29  ? 602  LEU A CB    1 
ATOM   1223 C CG    . LEU A  1 157 ? 5.669   27.445  7.959   1.00 14.69  ? 602  LEU A CG    1 
ATOM   1224 C CD1   . LEU A  1 157 ? 5.457   28.860  7.504   1.00 16.65  ? 602  LEU A CD1   1 
ATOM   1225 C CD2   . LEU A  1 157 ? 6.443   27.441  9.231   1.00 15.97  ? 602  LEU A CD2   1 
ATOM   1226 N N     . CYS A  1 158 ? 2.603   23.754  8.524   1.00 14.94  ? 603  CYS A N     1 
ATOM   1227 C CA    A CYS A  1 158 ? 1.336   23.124  8.943   0.50 15.94  ? 603  CYS A CA    1 
ATOM   1228 C CA    B CYS A  1 158 ? 1.356   23.071  8.910   0.50 15.43  ? 603  CYS A CA    1 
ATOM   1229 C C     . CYS A  1 158 ? 1.573   22.124  10.071  1.00 15.59  ? 603  CYS A C     1 
ATOM   1230 O O     . CYS A  1 158 ? 0.639   21.494  10.554  1.00 15.46  ? 603  CYS A O     1 
ATOM   1231 C CB    A CYS A  1 158 ? 0.641   22.440  7.761   0.50 17.99  ? 603  CYS A CB    1 
ATOM   1232 C CB    B CYS A  1 158 ? 0.827   22.265  7.729   0.50 16.81  ? 603  CYS A CB    1 
ATOM   1233 S SG    A CYS A  1 158 ? -1.051  21.848  8.136   0.50 24.23  ? 603  CYS A SG    1 
ATOM   1234 S SG    B CYS A  1 158 ? 0.058   23.254  6.457   0.50 20.36  ? 603  CYS A SG    1 
ATOM   1235 N N     . LEU A  1 159 ? 2.824   21.969  10.509  1.00 14.10  ? 604  LEU A N     1 
ATOM   1236 C CA    . LEU A  1 159 ? 3.142   20.955  11.543  1.00 14.56  ? 604  LEU A CA    1 
ATOM   1237 C C     . LEU A  1 159 ? 2.131   20.799  12.712  1.00 14.97  ? 604  LEU A C     1 
ATOM   1238 O O     . LEU A  1 159 ? 1.762   19.646  13.053  1.00 13.72  ? 604  LEU A O     1 
ATOM   1239 C CB    . LEU A  1 159 ? 4.583   21.137  12.083  1.00 14.93  ? 604  LEU A CB    1 
ATOM   1240 C CG    . LEU A  1 159 ? 5.122   20.084  13.058  1.00 15.28  ? 604  LEU A CG    1 
ATOM   1241 C CD1   . LEU A  1 159 ? 5.291   18.729  12.394  1.00 15.25  ? 604  LEU A CD1   1 
ATOM   1242 C CD2   . LEU A  1 159 ? 6.448   20.602  13.669  1.00 16.07  ? 604  LEU A CD2   1 
ATOM   1243 N N     . PRO A  1 160 ? 1.688   21.907  13.353  1.00 16.69  ? 605  PRO A N     1 
ATOM   1244 C CA    . PRO A  1 160 ? 0.787   21.690  14.474  1.00 17.17  ? 605  PRO A CA    1 
ATOM   1245 C C     . PRO A  1 160 ? -0.573  21.091  14.132  1.00 16.48  ? 605  PRO A C     1 
ATOM   1246 O O     . PRO A  1 160 ? -1.225  20.545  15.022  1.00 19.75  ? 605  PRO A O     1 
ATOM   1247 C CB    . PRO A  1 160 ? 0.578   23.125  15.063  1.00 17.14  ? 605  PRO A CB    1 
ATOM   1248 C CG    . PRO A  1 160 ? 1.039   24.042  14.020  1.00 18.06  ? 605  PRO A CG    1 
ATOM   1249 C CD    . PRO A  1 160 ? 2.136   23.305  13.304  1.00 17.55  ? 605  PRO A CD    1 
ATOM   1250 N N     . ASN A  1 161 ? -1.004  21.187  12.892  1.00 15.55  ? 606  ASN A N     1 
ATOM   1251 C CA    . ASN A  1 161 ? -2.290  20.613  12.456  1.00 15.94  ? 606  ASN A CA    1 
ATOM   1252 C C     . ASN A  1 161 ? -2.115  19.165  11.949  1.00 14.92  ? 606  ASN A C     1 
ATOM   1253 O O     . ASN A  1 161 ? -3.081  18.469  11.702  1.00 13.24  ? 606  ASN A O     1 
ATOM   1254 C CB    . ASN A  1 161 ? -2.852  21.449  11.278  1.00 17.09  ? 606  ASN A CB    1 
ATOM   1255 C CG    . ASN A  1 161 ? -3.109  22.910  11.655  1.00 22.95  ? 606  ASN A CG    1 
ATOM   1256 O OD1   . ASN A  1 161 ? -2.190  23.727  11.685  1.00 27.41  ? 606  ASN A OD1   1 
ATOM   1257 N ND2   . ASN A  1 161 ? -4.336  23.229  11.927  1.00 25.25  ? 606  ASN A ND2   1 
ATOM   1258 N N     . ILE A  1 162 ? -0.873  18.756  11.727  1.00 13.72  ? 607  ILE A N     1 
ATOM   1259 C CA    . ILE A  1 162 ? -0.552  17.427  11.110  1.00 14.57  ? 607  ILE A CA    1 
ATOM   1260 C C     . ILE A  1 162 ? -0.014  16.459  12.185  1.00 14.00  ? 607  ILE A C     1 
ATOM   1261 O O     . ILE A  1 162 ? -0.529  15.377  12.371  1.00 13.86  ? 607  ILE A O     1 
ATOM   1262 C CB    . ILE A  1 162 ? 0.485   17.624  9.979   1.00 14.94  ? 607  ILE A CB    1 
ATOM   1263 C CG1   . ILE A  1 162 ? -0.166  18.317  8.794   1.00 14.97  ? 607  ILE A CG1   1 
ATOM   1264 C CG2   . ILE A  1 162 ? 1.109   16.297  9.588   1.00 16.09  ? 607  ILE A CG2   1 
ATOM   1265 C CD1   . ILE A  1 162 ? 0.794   18.701  7.688   1.00 15.39  ? 607  ILE A CD1   1 
ATOM   1266 N N     . CYS A  1 163 ? 0.980   16.902  12.952  1.00 15.75  ? 608  CYS A N     1 
ATOM   1267 C CA    . CYS A  1 163 ? 1.517   16.134  14.086  1.00 16.37  ? 608  CYS A CA    1 
ATOM   1268 C C     . CYS A  1 163 ? 0.952   16.629  15.428  1.00 17.90  ? 608  CYS A C     1 
ATOM   1269 O O     . CYS A  1 163 ? 1.628   17.324  16.184  1.00 16.23  ? 608  CYS A O     1 
ATOM   1270 C CB    . CYS A  1 163 ? 3.044   16.170  14.133  1.00 18.96  ? 608  CYS A CB    1 
ATOM   1271 S SG    . CYS A  1 163 ? 3.858   15.390  12.692  1.00 21.45  ? 608  CYS A SG    1 
ATOM   1272 N N     . THR A  1 164 ? -0.300  16.239  15.690  1.00 16.69  ? 609  THR A N     1 
ATOM   1273 C CA    . THR A  1 164 ? -1.065  16.717  16.839  1.00 17.18  ? 609  THR A CA    1 
ATOM   1274 C C     . THR A  1 164 ? -0.730  16.023  18.183  1.00 17.12  ? 609  THR A C     1 
ATOM   1275 O O     . THR A  1 164 ? -0.991  16.594  19.256  1.00 18.34  ? 609  THR A O     1 
ATOM   1276 C CB    . THR A  1 164 ? -2.579  16.588  16.579  1.00 14.52  ? 609  THR A CB    1 
ATOM   1277 O OG1   . THR A  1 164 ? -2.909  15.234  16.287  1.00 14.73  ? 609  THR A OG1   1 
ATOM   1278 C CG2   . THR A  1 164 ? -2.990  17.470  15.413  1.00 15.16  ? 609  THR A CG2   1 
ATOM   1279 N N     . GLN A  1 165 ? -0.183  14.797  18.102  1.00 16.49  ? 610  GLN A N     1 
ATOM   1280 C CA    . GLN A  1 165 ? 0.095   13.960  19.240  1.00 17.06  ? 610  GLN A CA    1 
ATOM   1281 C C     . GLN A  1 165 ? 1.583   13.981  19.594  1.00 16.68  ? 610  GLN A C     1 
ATOM   1282 O O     . GLN A  1 165 ? 2.429   13.767  18.710  1.00 18.33  ? 610  GLN A O     1 
ATOM   1283 C CB    . GLN A  1 165 ? -0.322  12.510  18.952  1.00 16.40  ? 610  GLN A CB    1 
ATOM   1284 C CG    . GLN A  1 165 ? -0.197  11.611  20.203  1.00 17.78  ? 610  GLN A CG    1 
ATOM   1285 C CD    . GLN A  1 165 ? -0.707  10.198  20.033  1.00 16.64  ? 610  GLN A CD    1 
ATOM   1286 O OE1   . GLN A  1 165 ? -0.207  9.301   20.672  1.00 19.33  ? 610  GLN A OE1   1 
ATOM   1287 N NE2   . GLN A  1 165 ? -1.708  9.998   19.176  1.00 18.05  ? 610  GLN A NE2   1 
ATOM   1288 N N     . PRO A  1 166 ? 1.918   14.144  20.897  1.00 17.70  ? 611  PRO A N     1 
ATOM   1289 C CA    . PRO A  1 166 ? 3.339   14.107  21.258  1.00 15.59  ? 611  PRO A CA    1 
ATOM   1290 C C     . PRO A  1 166 ? 3.979   12.824  20.819  1.00 15.37  ? 611  PRO A C     1 
ATOM   1291 O O     . PRO A  1 166 ? 3.360   11.768  20.868  1.00 16.54  ? 611  PRO A O     1 
ATOM   1292 C CB    . PRO A  1 166 ? 3.317   14.231  22.811  1.00 17.22  ? 611  PRO A CB    1 
ATOM   1293 C CG    . PRO A  1 166 ? 2.075   15.036  23.075  1.00 18.32  ? 611  PRO A CG    1 
ATOM   1294 C CD    . PRO A  1 166 ? 1.068   14.582  22.048  1.00 17.01  ? 611  PRO A CD    1 
ATOM   1295 N N     . ILE A  1 167 ? 5.200   12.933  20.337  1.00 15.53  ? 612  ILE A N     1 
ATOM   1296 C CA    . ILE A  1 167 ? 5.973   11.772  19.891  1.00 17.22  ? 612  ILE A CA    1 
ATOM   1297 C C     . ILE A  1 167 ? 6.985   11.331  20.961  1.00 16.44  ? 612  ILE A C     1 
ATOM   1298 O O     . ILE A  1 167 ? 7.877   12.100  21.325  1.00 16.90  ? 612  ILE A O     1 
ATOM   1299 C CB    . ILE A  1 167 ? 6.720   12.119  18.595  1.00 17.03  ? 612  ILE A CB    1 
ATOM   1300 C CG1   . ILE A  1 167 ? 5.700   12.439  17.488  1.00 18.50  ? 612  ILE A CG1   1 
ATOM   1301 C CG2   . ILE A  1 167 ? 7.652   10.965  18.199  1.00 17.72  ? 612  ILE A CG2   1 
ATOM   1302 C CD1   . ILE A  1 167 ? 6.304   13.089  16.266  1.00 21.10  ? 612  ILE A CD1   1 
ATOM   1303 N N     . PRO A  1 168 ? 6.852   10.122  21.479  1.00 17.34  ? 613  PRO A N     1 
ATOM   1304 C CA    . PRO A  1 168 ? 7.801   9.692   22.538  1.00 18.94  ? 613  PRO A CA    1 
ATOM   1305 C C     . PRO A  1 168 ? 9.141   9.390   21.983  1.00 18.22  ? 613  PRO A C     1 
ATOM   1306 O O     . PRO A  1 168 ? 9.259   8.959   20.818  1.00 17.65  ? 613  PRO A O     1 
ATOM   1307 C CB    . PRO A  1 168 ? 7.173   8.428   23.099  1.00 20.57  ? 613  PRO A CB    1 
ATOM   1308 C CG    . PRO A  1 168 ? 6.420   7.875   21.944  1.00 22.46  ? 613  PRO A CG    1 
ATOM   1309 C CD    . PRO A  1 168 ? 5.888   9.077   21.162  1.00 20.25  ? 613  PRO A CD    1 
ATOM   1310 N N     . LEU A  1 169 ? 10.169  9.686   22.761  1.00 16.40  ? 614  LEU A N     1 
ATOM   1311 C CA    . LEU A  1 169 ? 11.490  9.199   22.449  1.00 18.01  ? 614  LEU A CA    1 
ATOM   1312 C C     . LEU A  1 169 ? 11.530  7.664   22.579  1.00 17.00  ? 614  LEU A C     1 
ATOM   1313 O O     . LEU A  1 169 ? 11.020  7.083   23.557  1.00 16.05  ? 614  LEU A O     1 
ATOM   1314 C CB    . LEU A  1 169 ? 12.562  9.884   23.309  1.00 17.42  ? 614  LEU A CB    1 
ATOM   1315 C CG    . LEU A  1 169 ? 12.556  11.445  23.273  1.00 17.42  ? 614  LEU A CG    1 
ATOM   1316 C CD1   . LEU A  1 169 ? 13.607  12.006  24.237  1.00 17.07  ? 614  LEU A CD1   1 
ATOM   1317 C CD2   . LEU A  1 169 ? 12.850  11.953  21.864  1.00 17.21  ? 614  LEU A CD2   1 
ATOM   1318 N N     . LEU A  1 170 ? 12.100  6.988   21.561  1.00 15.90  ? 615  LEU A N     1 
ATOM   1319 C CA    . LEU A  1 170 ? 12.457  5.551   21.698  1.00 15.42  ? 615  LEU A CA    1 
ATOM   1320 C C     . LEU A  1 170 ? 13.833  5.438   22.393  1.00 16.43  ? 615  LEU A C     1 
ATOM   1321 O O     . LEU A  1 170 ? 14.932  5.417   21.735  1.00 15.12  ? 615  LEU A O     1 
ATOM   1322 C CB    . LEU A  1 170 ? 12.462  4.841   20.351  1.00 15.68  ? 615  LEU A CB    1 
ATOM   1323 C CG    . LEU A  1 170 ? 11.134  4.907   19.562  1.00 15.74  ? 615  LEU A CG    1 
ATOM   1324 C CD1   . LEU A  1 170 ? 11.381  4.309   18.182  1.00 15.92  ? 615  LEU A CD1   1 
ATOM   1325 C CD2   . LEU A  1 170 ? 10.014  4.145   20.235  1.00 17.08  ? 615  LEU A CD2   1 
ATOM   1326 N N     . ALA A  1 171 ? 13.789  5.445   23.728  1.00 16.71  ? 616  ALA A N     1 
ATOM   1327 C CA    . ALA A  1 171 ? 14.972  5.632   24.518  1.00 15.95  ? 616  ALA A CA    1 
ATOM   1328 C C     . ALA A  1 171 ? 15.615  4.278   24.800  1.00 15.55  ? 616  ALA A C     1 
ATOM   1329 O O     . ALA A  1 171 ? 15.004  3.248   24.605  1.00 16.01  ? 616  ALA A O     1 
ATOM   1330 C CB    . ALA A  1 171 ? 14.622  6.323   25.810  1.00 17.11  ? 616  ALA A CB    1 
ATOM   1331 N N     . ALA A  1 172 ? 16.874  4.281   25.172  1.00 18.01  ? 617  ALA A N     1 
ATOM   1332 C CA    . ALA A  1 172 ? 17.588  3.009   25.507  1.00 21.91  ? 617  ALA A CA    1 
ATOM   1333 C C     . ALA A  1 172 ? 16.798  2.101   26.461  1.00 20.84  ? 617  ALA A C     1 
ATOM   1334 O O     . ALA A  1 172 ? 16.148  2.573   27.354  1.00 20.92  ? 617  ALA A O     1 
ATOM   1335 C CB    . ALA A  1 172 ? 18.916  3.323   26.101  1.00 26.19  ? 617  ALA A CB    1 
ATOM   1336 N N     . ALA A  1 173 ? 16.775  0.820   26.153  1.00 18.97  ? 618  ALA A N     1 
ATOM   1337 C CA    . ALA A  1 173 ? 16.053  -0.214  26.902  1.00 20.11  ? 618  ALA A CA    1 
ATOM   1338 C C     . ALA A  1 173 ? 14.559  -0.233  26.727  1.00 20.71  ? 618  ALA A C     1 
ATOM   1339 O O     . ALA A  1 173 ? 13.916  -1.083  27.269  1.00 22.06  ? 618  ALA A O     1 
ATOM   1340 C CB    . ALA A  1 173 ? 16.418  -0.148  28.418  1.00 25.50  ? 618  ALA A CB    1 
ATOM   1341 N N     . MET A  1 174 ? 13.984  0.648   25.899  1.00 20.44  ? 619  MET A N     1 
ATOM   1342 C CA    . MET A  1 174 ? 12.553  0.584   25.618  1.00 19.26  ? 619  MET A CA    1 
ATOM   1343 C C     . MET A  1 174 ? 12.236  -0.438  24.553  1.00 18.81  ? 619  MET A C     1 
ATOM   1344 O O     . MET A  1 174 ? 12.916  -0.521  23.551  1.00 20.25  ? 619  MET A O     1 
ATOM   1345 C CB    . MET A  1 174 ? 12.005  1.953   25.164  1.00 21.38  ? 619  MET A CB    1 
ATOM   1346 C CG    . MET A  1 174 ? 11.859  2.951   26.314  1.00 22.35  ? 619  MET A CG    1 
ATOM   1347 S SD    . MET A  1 174 ? 11.348  4.612   25.852  1.00 22.34  ? 619  MET A SD    1 
ATOM   1348 C CE    . MET A  1 174 ? 9.776   4.346   25.072  1.00 21.66  ? 619  MET A CE    1 
ATOM   1349 N N     . ASN A  1 175 ? 11.165  -1.187  24.771  1.00 17.95  ? 620  ASN A N     1 
ATOM   1350 C CA    . ASN A  1 175 ? 10.545  -1.985  23.734  1.00 18.02  ? 620  ASN A CA    1 
ATOM   1351 C C     . ASN A  1 175 ? 9.240   -1.312  23.377  1.00 19.96  ? 620  ASN A C     1 
ATOM   1352 O O     . ASN A  1 175 ? 8.284   -1.452  24.079  1.00 19.51  ? 620  ASN A O     1 
ATOM   1353 C CB    . ASN A  1 175 ? 10.295  -3.424  24.210  1.00 19.27  ? 620  ASN A CB    1 
ATOM   1354 C CG    . ASN A  1 175 ? 11.590  -4.304  24.166  1.00 21.98  ? 620  ASN A CG    1 
ATOM   1355 O OD1   . ASN A  1 175 ? 12.018  -4.759  23.112  1.00 18.50  ? 620  ASN A OD1   1 
ATOM   1356 N ND2   . ASN A  1 175 ? 12.227  -4.473  25.317  1.00 22.48  ? 620  ASN A ND2   1 
ATOM   1357 N N     . HIS A  1 176 ? 9.218   -0.563  22.269  1.00 16.00  ? 621  HIS A N     1 
ATOM   1358 C CA    . HIS A  1 176 ? 8.103   0.367   21.988  1.00 15.05  ? 621  HIS A CA    1 
ATOM   1359 C C     . HIS A  1 176 ? 8.044   0.633   20.486  1.00 13.87  ? 621  HIS A C     1 
ATOM   1360 O O     . HIS A  1 176 ? 9.086   0.635   19.814  1.00 12.73  ? 621  HIS A O     1 
ATOM   1361 C CB    . HIS A  1 176 ? 8.348   1.691   22.739  1.00 15.98  ? 621  HIS A CB    1 
ATOM   1362 C CG    . HIS A  1 176 ? 7.165   2.595   22.762  1.00 18.04  ? 621  HIS A CG    1 
ATOM   1363 N ND1   . HIS A  1 176 ? 6.207   2.544   23.763  1.00 22.19  ? 621  HIS A ND1   1 
ATOM   1364 C CD2   . HIS A  1 176 ? 6.803   3.618   21.948  1.00 17.79  ? 621  HIS A CD2   1 
ATOM   1365 C CE1   . HIS A  1 176 ? 5.256   3.436   23.510  1.00 20.44  ? 621  HIS A CE1   1 
ATOM   1366 N NE2   . HIS A  1 176 ? 5.586   4.095   22.407  1.00 20.10  ? 621  HIS A NE2   1 
ATOM   1367 N N     . SER A  1 177 ? 6.832   0.849   19.973  1.00 13.87  ? 622  SER A N     1 
ATOM   1368 C CA    . SER A  1 177 ? 6.579   1.141   18.583  1.00 13.89  ? 622  SER A CA    1 
ATOM   1369 C C     . SER A  1 177 ? 5.877   2.480   18.417  1.00 14.08  ? 622  SER A C     1 
ATOM   1370 O O     . SER A  1 177 ? 5.054   2.861   19.264  1.00 14.94  ? 622  SER A O     1 
ATOM   1371 C CB    . SER A  1 177 ? 5.707   0.056   17.975  1.00 13.84  ? 622  SER A CB    1 
ATOM   1372 O OG    . SER A  1 177 ? 6.407   -1.176  17.941  1.00 15.37  ? 622  SER A OG    1 
ATOM   1373 N N     . ILE A  1 178 ? 6.202   3.186   17.321  1.00 12.50  ? 623  ILE A N     1 
ATOM   1374 C CA    . ILE A  1 178 ? 5.463   4.342   16.875  1.00 13.59  ? 623  ILE A CA    1 
ATOM   1375 C C     . ILE A  1 178 ? 4.988   4.128   15.418  1.00 14.02  ? 623  ILE A C     1 
ATOM   1376 O O     . ILE A  1 178 ? 5.816   3.848   14.517  1.00 12.36  ? 623  ILE A O     1 
ATOM   1377 C CB    . ILE A  1 178 ? 6.337   5.605   16.885  1.00 14.63  ? 623  ILE A CB    1 
ATOM   1378 C CG1   . ILE A  1 178 ? 6.920   5.868   18.265  1.00 16.08  ? 623  ILE A CG1   1 
ATOM   1379 C CG2   . ILE A  1 178 ? 5.527   6.811   16.432  1.00 15.95  ? 623  ILE A CG2   1 
ATOM   1380 C CD1   . ILE A  1 178 ? 8.063   6.908   18.291  1.00 15.93  ? 623  ILE A CD1   1 
ATOM   1381 N N     . THR A  1 179 ? 3.681   4.273   15.200  1.00 12.83  ? 624  THR A N     1 
ATOM   1382 C CA    . THR A  1 179 ? 3.075   4.168   13.904  1.00 13.73  ? 624  THR A CA    1 
ATOM   1383 C C     . THR A  1 179 ? 2.470   5.542   13.549  1.00 15.05  ? 624  THR A C     1 
ATOM   1384 O O     . THR A  1 179 ? 1.608   6.052   14.291  1.00 15.99  ? 624  THR A O     1 
ATOM   1385 C CB    . THR A  1 179 ? 2.021   3.024   13.810  1.00 14.34  ? 624  THR A CB    1 
ATOM   1386 O OG1   . THR A  1 179 ? 2.671   1.750   13.994  1.00 14.92  ? 624  THR A OG1   1 
ATOM   1387 C CG2   . THR A  1 179 ? 1.329   2.985   12.415  1.00 15.11  ? 624  THR A CG2   1 
ATOM   1388 N N     . MET A  1 180 ? 3.011   6.154   12.464  1.00 12.79  ? 625  MET A N     1 
ATOM   1389 C CA    A MET A  1 180 ? 2.602   7.474   12.014  0.70 13.46  ? 625  MET A CA    1 
ATOM   1390 C CA    B MET A  1 180 ? 2.621   7.496   12.002  0.30 13.22  ? 625  MET A CA    1 
ATOM   1391 C C     . MET A  1 180 ? 2.355   7.480   10.494  1.00 13.08  ? 625  MET A C     1 
ATOM   1392 O O     . MET A  1 180 ? 2.738   6.536   9.787   1.00 12.41  ? 625  MET A O     1 
ATOM   1393 C CB    A MET A  1 180 ? 3.687   8.469   12.368  0.70 15.37  ? 625  MET A CB    1 
ATOM   1394 C CB    B MET A  1 180 ? 3.740   8.508   12.283  0.30 13.94  ? 625  MET A CB    1 
ATOM   1395 C CG    A MET A  1 180 ? 4.981   8.299   11.590  0.70 16.98  ? 625  MET A CG    1 
ATOM   1396 C CG    B MET A  1 180 ? 4.337   8.434   13.673  0.30 14.54  ? 625  MET A CG    1 
ATOM   1397 S SD    A MET A  1 180 ? 6.412   8.961   12.535  0.70 23.15  ? 625  MET A SD    1 
ATOM   1398 S SD    B MET A  1 180 ? 5.301   9.888   14.150  0.30 16.28  ? 625  MET A SD    1 
ATOM   1399 C CE    A MET A  1 180 ? 6.113   10.685  12.314  0.70 22.19  ? 625  MET A CE    1 
ATOM   1400 C CE    B MET A  1 180 ? 6.422   10.037  12.775  0.30 15.14  ? 625  MET A CE    1 
ATOM   1401 N N     . SER A  1 181 ? 1.738   8.530   9.974   1.00 12.21  ? 626  SER A N     1 
ATOM   1402 C CA    . SER A  1 181 ? 1.498   8.593   8.532   1.00 11.87  ? 626  SER A CA    1 
ATOM   1403 C C     . SER A  1 181 ? 2.742   9.129   7.754   1.00 12.40  ? 626  SER A C     1 
ATOM   1404 O O     . SER A  1 181 ? 3.570   9.893   8.299   1.00 11.40  ? 626  SER A O     1 
ATOM   1405 C CB    . SER A  1 181 ? 0.263   9.456   8.206   1.00 13.29  ? 626  SER A CB    1 
ATOM   1406 O OG    . SER A  1 181 ? 0.494   10.838  8.485   1.00 13.26  ? 626  SER A OG    1 
ATOM   1407 N N     . GLN A  1 182 ? 2.829   8.738   6.488   1.00 11.75  ? 627  GLN A N     1 
ATOM   1408 C CA    . GLN A  1 182 ? 3.851   9.262   5.571   1.00 11.60  ? 627  GLN A CA    1 
ATOM   1409 C C     . GLN A  1 182 ? 3.698   10.779  5.487   1.00 11.73  ? 627  GLN A C     1 
ATOM   1410 O O     . GLN A  1 182 ? 4.691   11.490  5.354   1.00 11.25  ? 627  GLN A O     1 
ATOM   1411 C CB    . GLN A  1 182 ? 3.709   8.626   4.165   1.00 11.40  ? 627  GLN A CB    1 
ATOM   1412 C CG    . GLN A  1 182 ? 4.097   7.134   4.109   1.00 12.26  ? 627  GLN A CG    1 
ATOM   1413 C CD    . GLN A  1 182 ? 3.906   6.547   2.733   1.00 13.73  ? 627  GLN A CD    1 
ATOM   1414 O OE1   . GLN A  1 182 ? 2.768   6.338   2.269   1.00 14.27  ? 627  GLN A OE1   1 
ATOM   1415 N NE2   . GLN A  1 182 ? 5.007   6.310   2.043   1.00 13.44  ? 627  GLN A NE2   1 
ATOM   1416 N N     . GLU A  1 183 ? 2.450   11.284  5.517   1.00 10.76  ? 628  GLU A N     1 
ATOM   1417 C CA    . GLU A  1 183 ? 2.231   12.725  5.518   1.00 11.11  ? 628  GLU A CA    1 
ATOM   1418 C C     . GLU A  1 183 ? 2.829   13.422  6.725   1.00 10.57  ? 628  GLU A C     1 
ATOM   1419 O O     . GLU A  1 183 ? 3.488   14.492  6.583   1.00 9.72   ? 628  GLU A O     1 
ATOM   1420 C CB    . GLU A  1 183 ? 0.714   13.081  5.416   1.00 13.10  ? 628  GLU A CB    1 
ATOM   1421 C CG    . GLU A  1 183 ? 0.470   14.562  5.157   1.00 15.06  ? 628  GLU A CG    1 
ATOM   1422 C CD    . GLU A  1 183 ? -1.021  14.981  5.187   1.00 18.02  ? 628  GLU A CD    1 
ATOM   1423 O OE1   . GLU A  1 183 ? -1.762  14.485  6.069   1.00 19.31  ? 628  GLU A OE1   1 
ATOM   1424 O OE2   . GLU A  1 183 ? -1.432  15.844  4.330   1.00 21.04  ? 628  GLU A OE2   1 
ATOM   1425 N N     . GLN A  1 184 ? 2.643   12.824  7.906   1.00 10.92  ? 629  GLN A N     1 
ATOM   1426 C CA    . GLN A  1 184 ? 3.241   13.338  9.111   1.00 11.30  ? 629  GLN A CA    1 
ATOM   1427 C C     . GLN A  1 184 ? 4.754   13.337  9.026   1.00 12.04  ? 629  GLN A C     1 
ATOM   1428 O O     . GLN A  1 184 ? 5.400   14.360  9.343   1.00 10.87  ? 629  GLN A O     1 
ATOM   1429 C CB    . GLN A  1 184 ? 2.775   12.569  10.322  1.00 12.49  ? 629  GLN A CB    1 
ATOM   1430 C CG    . GLN A  1 184 ? 1.340   12.913  10.764  1.00 12.43  ? 629  GLN A CG    1 
ATOM   1431 C CD    . GLN A  1 184 ? 0.699   11.908  11.724  1.00 13.62  ? 629  GLN A CD    1 
ATOM   1432 O OE1   . GLN A  1 184 ? 1.054   10.697  11.764  1.00 13.54  ? 629  GLN A OE1   1 
ATOM   1433 N NE2   . GLN A  1 184 ? -0.234  12.410  12.560  1.00 13.70  ? 629  GLN A NE2   1 
ATOM   1434 N N     . ILE A  1 185 ? 5.318   12.265  8.480   1.00 11.45  ? 630  ILE A N     1 
ATOM   1435 C CA    . ILE A  1 185 ? 6.778   12.214  8.268   1.00 10.53  ? 630  ILE A CA    1 
ATOM   1436 C C     . ILE A  1 185 ? 7.255   13.332  7.331   1.00 10.07  ? 630  ILE A C     1 
ATOM   1437 O O     . ILE A  1 185 ? 8.302   13.942  7.578   1.00 9.71   ? 630  ILE A O     1 
ATOM   1438 C CB    . ILE A  1 185 ? 7.215   10.833  7.781   1.00 11.19  ? 630  ILE A CB    1 
ATOM   1439 C CG1   . ILE A  1 185 ? 6.953   9.805   8.874   1.00 12.61  ? 630  ILE A CG1   1 
ATOM   1440 C CG2   . ILE A  1 185 ? 8.704   10.843  7.438   1.00 10.72  ? 630  ILE A CG2   1 
ATOM   1441 C CD1   . ILE A  1 185 ? 7.048   8.372   8.363   1.00 13.66  ? 630  ILE A CD1   1 
ATOM   1442 N N     . ALA A  1 186 ? 6.527   13.596  6.240   1.00 10.21  ? 631  ALA A N     1 
ATOM   1443 C CA    . ALA A  1 186 ? 6.921   14.648  5.295   1.00 10.47  ? 631  ALA A CA    1 
ATOM   1444 C C     . ALA A  1 186 ? 6.953   16.061  5.949   1.00 11.10  ? 631  ALA A C     1 
ATOM   1445 O O     . ALA A  1 186 ? 7.892   16.854  5.681   1.00 10.34  ? 631  ALA A O     1 
ATOM   1446 C CB    . ALA A  1 186 ? 5.996   14.677  4.092   1.00 11.42  ? 631  ALA A CB    1 
ATOM   1447 N N     . SER A  1 187 ? 5.960   16.359  6.795   1.00 12.24  ? 632  SER A N     1 
ATOM   1448 C CA    . SER A  1 187 ? 5.948   17.616  7.536   1.00 11.27  ? 632  SER A CA    1 
ATOM   1449 C C     . SER A  1 187 ? 7.156   17.715  8.475   1.00 11.91  ? 632  SER A C     1 
ATOM   1450 O O     . SER A  1 187 ? 7.821   18.778  8.529   1.00 12.54  ? 632  SER A O     1 
ATOM   1451 C CB    . SER A  1 187 ? 4.661   17.822  8.332   1.00 11.95  ? 632  SER A CB    1 
ATOM   1452 O OG    . SER A  1 187 ? 4.678   19.134  8.943   1.00 12.05  ? 632  SER A OG    1 
ATOM   1453 N N     . LEU A  1 188 ? 7.473   16.636  9.180   1.00 10.76  ? 633  LEU A N     1 
ATOM   1454 C CA    . LEU A  1 188 ? 8.611   16.615  10.087  1.00 11.39  ? 633  LEU A CA    1 
ATOM   1455 C C     . LEU A  1 188 ? 9.957   16.756  9.338   1.00 11.85  ? 633  LEU A C     1 
ATOM   1456 O O     . LEU A  1 188 ? 10.840  17.487  9.782   1.00 12.59  ? 633  LEU A O     1 
ATOM   1457 C CB    . LEU A  1 188 ? 8.597   15.357  10.932  1.00 11.89  ? 633  LEU A CB    1 
ATOM   1458 C CG    . LEU A  1 188 ? 7.485   15.204  11.953  1.00 12.61  ? 633  LEU A CG    1 
ATOM   1459 C CD1   . LEU A  1 188 ? 7.405   13.777  12.391  1.00 12.88  ? 633  LEU A CD1   1 
ATOM   1460 C CD2   . LEU A  1 188 ? 7.773   16.092  13.147  1.00 13.56  ? 633  LEU A CD2   1 
ATOM   1461 N N     . LEU A  1 189 ? 10.095  16.082  8.190   1.00 10.78  ? 634  LEU A N     1 
ATOM   1462 C CA    . LEU A  1 189 ? 11.327  16.164  7.401   1.00 10.85  ? 634  LEU A CA    1 
ATOM   1463 C C     . LEU A  1 189 ? 11.528  17.532  6.752   1.00 10.75  ? 634  LEU A C     1 
ATOM   1464 O O     . LEU A  1 189 ? 12.657  17.994  6.591   1.00 10.25  ? 634  LEU A O     1 
ATOM   1465 C CB    . LEU A  1 189 ? 11.384  15.023  6.361   1.00 11.36  ? 634  LEU A CB    1 
ATOM   1466 C CG    . LEU A  1 189 ? 11.687  13.627  6.939   1.00 11.55  ? 634  LEU A CG    1 
ATOM   1467 C CD1   . LEU A  1 189 ? 11.601  12.622  5.815   1.00 12.46  ? 634  LEU A CD1   1 
ATOM   1468 C CD2   . LEU A  1 189 ? 13.075  13.575  7.589   1.00 13.53  ? 634  LEU A CD2   1 
ATOM   1469 N N     . ALA A  1 190 ? 10.443  18.208  6.381   1.00 11.05  ? 635  ALA A N     1 
ATOM   1470 C CA    . ALA A  1 190 ? 10.552  19.583  5.889   1.00 11.32  ? 635  ALA A CA    1 
ATOM   1471 C C     . ALA A  1 190 ? 11.048  20.529  7.000   1.00 10.49  ? 635  ALA A C     1 
ATOM   1472 O O     . ALA A  1 190 ? 11.934  21.381  6.739   1.00 10.53  ? 635  ALA A O     1 
ATOM   1473 C CB    . ALA A  1 190 ? 9.219   20.074  5.299   1.00 11.90  ? 635  ALA A CB    1 
ATOM   1474 N N     . ASN A  1 191 ? 10.597  20.307  8.223   1.00 10.62  ? 636  ASN A N     1 
ATOM   1475 C CA    . ASN A  1 191 ? 11.176  21.029  9.375   1.00 11.75  ? 636  ASN A CA    1 
ATOM   1476 C C     . ASN A  1 191 ? 12.684  20.747  9.549   1.00 12.09  ? 636  ASN A C     1 
ATOM   1477 O O     . ASN A  1 191 ? 13.478  21.686  9.825   1.00 12.92  ? 636  ASN A O     1 
ATOM   1478 C CB    . ASN A  1 191 ? 10.411  20.742  10.659  1.00 12.10  ? 636  ASN A CB    1 
ATOM   1479 C CG    . ASN A  1 191 ? 9.189   21.647  10.799  1.00 13.51  ? 636  ASN A CG    1 
ATOM   1480 O OD1   . ASN A  1 191 ? 9.321   22.806  11.226  1.00 14.54  ? 636  ASN A OD1   1 
ATOM   1481 N ND2   . ASN A  1 191 ? 8.023   21.170  10.349  1.00 12.96  ? 636  ASN A ND2   1 
ATOM   1482 N N     . ALA A  1 192 ? 13.074  19.482  9.423   1.00 10.96  ? 637  ALA A N     1 
ATOM   1483 C CA    . ALA A  1 192 ? 14.484  19.148  9.481   1.00 12.40  ? 637  ALA A CA    1 
ATOM   1484 C C     . ALA A  1 192 ? 15.295  19.865  8.426   1.00 11.87  ? 637  ALA A C     1 
ATOM   1485 O O     . ALA A  1 192 ? 16.404  20.372  8.733   1.00 13.49  ? 637  ALA A O     1 
ATOM   1486 C CB    . ALA A  1 192 ? 14.718  17.623  9.433   1.00 12.07  ? 637  ALA A CB    1 
ATOM   1487 N N     . PHE A  1 193 ? 14.797  19.909  7.204   1.00 11.46  ? 638  PHE A N     1 
ATOM   1488 C CA    . PHE A  1 193 ? 15.477  20.636  6.114   1.00 11.27  ? 638  PHE A CA    1 
ATOM   1489 C C     . PHE A  1 193 ? 15.732  22.098  6.474   1.00 12.58  ? 638  PHE A C     1 
ATOM   1490 O O     . PHE A  1 193 ? 16.845  22.639  6.233   1.00 14.53  ? 638  PHE A O     1 
ATOM   1491 C CB    . PHE A  1 193 ? 14.683  20.558  4.799   1.00 10.70  ? 638  PHE A CB    1 
ATOM   1492 C CG    . PHE A  1 193 ? 15.311  21.309  3.683   1.00 10.42  ? 638  PHE A CG    1 
ATOM   1493 C CD1   . PHE A  1 193 ? 15.019  22.624  3.474   1.00 10.28  ? 638  PHE A CD1   1 
ATOM   1494 C CD2   . PHE A  1 193 ? 16.166  20.675  2.812   1.00 10.52  ? 638  PHE A CD2   1 
ATOM   1495 C CE1   . PHE A  1 193 ? 15.632  23.360  2.476   1.00 10.62  ? 638  PHE A CE1   1 
ATOM   1496 C CE2   . PHE A  1 193 ? 16.770  21.377  1.769   1.00 11.38  ? 638  PHE A CE2   1 
ATOM   1497 C CZ    . PHE A  1 193 ? 16.482  22.741  1.573   1.00 10.04  ? 638  PHE A CZ    1 
ATOM   1498 N N     . PHE A  1 194 ? 14.706  22.744  7.030   1.00 11.81  ? 639  PHE A N     1 
ATOM   1499 C CA    . PHE A  1 194 ? 14.784  24.174  7.436   1.00 12.26  ? 639  PHE A CA    1 
ATOM   1500 C C     . PHE A  1 194 ? 15.437  24.390  8.821   1.00 12.26  ? 639  PHE A C     1 
ATOM   1501 O O     . PHE A  1 194 ? 15.536  25.520  9.313   1.00 12.20  ? 639  PHE A O     1 
ATOM   1502 C CB    . PHE A  1 194 ? 13.392  24.819  7.357   1.00 12.38  ? 639  PHE A CB    1 
ATOM   1503 C CG    . PHE A  1 194 ? 12.868  24.965  5.952   1.00 12.44  ? 639  PHE A CG    1 
ATOM   1504 C CD1   . PHE A  1 194 ? 13.519  25.738  5.056   1.00 13.73  ? 639  PHE A CD1   1 
ATOM   1505 C CD2   . PHE A  1 194 ? 11.726  24.245  5.505   1.00 12.41  ? 639  PHE A CD2   1 
ATOM   1506 C CE1   . PHE A  1 194 ? 13.090  25.849  3.727   1.00 13.75  ? 639  PHE A CE1   1 
ATOM   1507 C CE2   . PHE A  1 194 ? 11.259  24.405  4.208   1.00 12.37  ? 639  PHE A CE2   1 
ATOM   1508 C CZ    . PHE A  1 194 ? 11.976  25.148  3.304   1.00 12.58  ? 639  PHE A CZ    1 
ATOM   1509 N N     . CYS A  1 195 ? 15.923  23.295  9.415   1.00 12.64  ? 640  CYS A N     1 
ATOM   1510 C CA    . CYS A  1 195 ? 16.680  23.286  10.626  1.00 12.64  ? 640  CYS A CA    1 
ATOM   1511 C C     . CYS A  1 195 ? 15.920  23.903  11.798  1.00 15.51  ? 640  CYS A C     1 
ATOM   1512 O O     . CYS A  1 195 ? 16.507  24.690  12.583  1.00 15.56  ? 640  CYS A O     1 
ATOM   1513 C CB    . CYS A  1 195 ? 18.030  23.968  10.442  1.00 12.53  ? 640  CYS A CB    1 
ATOM   1514 S SG    . CYS A  1 195 ? 19.098  23.294  9.111   1.00 13.41  ? 640  CYS A SG    1 
ATOM   1515 N N     . THR A  1 196 ? 14.652  23.485  11.994  1.00 13.66  ? 641  THR A N     1 
ATOM   1516 C CA    . THR A  1 196 ? 13.816  24.062  13.025  1.00 13.91  ? 641  THR A CA    1 
ATOM   1517 C C     . THR A  1 196 ? 13.775  23.344  14.348  1.00 15.10  ? 641  THR A C     1 
ATOM   1518 O O     . THR A  1 196 ? 13.146  23.846  15.277  1.00 14.76  ? 641  THR A O     1 
ATOM   1519 C CB    . THR A  1 196 ? 12.347  24.225  12.563  1.00 14.57  ? 641  THR A CB    1 
ATOM   1520 O OG1   . THR A  1 196 ? 11.785  22.934  12.353  1.00 14.51  ? 641  THR A OG1   1 
ATOM   1521 C CG2   . THR A  1 196 ? 12.265  25.048  11.334  1.00 13.69  ? 641  THR A CG2   1 
ATOM   1522 N N     . PHE A  1 197 ? 14.360  22.148  14.473  1.00 14.51  ? 642  PHE A N     1 
ATOM   1523 C CA    . PHE A  1 197 ? 14.155  21.393  15.695  1.00 14.51  ? 642  PHE A CA    1 
ATOM   1524 C C     . PHE A  1 197 ? 15.025  21.973  16.799  1.00 15.34  ? 642  PHE A C     1 
ATOM   1525 O O     . PHE A  1 197 ? 16.264  21.981  16.688  1.00 15.14  ? 642  PHE A O     1 
ATOM   1526 C CB    . PHE A  1 197 ? 14.428  19.867  15.530  1.00 14.32  ? 642  PHE A CB    1 
ATOM   1527 C CG    . PHE A  1 197 ? 13.342  19.147  14.765  1.00 13.58  ? 642  PHE A CG    1 
ATOM   1528 C CD1   . PHE A  1 197 ? 12.123  18.862  15.388  1.00 13.45  ? 642  PHE A CD1   1 
ATOM   1529 C CD2   . PHE A  1 197 ? 13.477  18.889  13.385  1.00 13.23  ? 642  PHE A CD2   1 
ATOM   1530 C CE1   . PHE A  1 197 ? 11.096  18.237  14.695  1.00 13.06  ? 642  PHE A CE1   1 
ATOM   1531 C CE2   . PHE A  1 197 ? 12.425  18.283  12.673  1.00 13.13  ? 642  PHE A CE2   1 
ATOM   1532 C CZ    . PHE A  1 197 ? 11.254  17.944  13.336  1.00 12.89  ? 642  PHE A CZ    1 
ATOM   1533 N N     . PRO A  1 198 ? 14.390  22.379  17.915  1.00 16.04  ? 643  PRO A N     1 
ATOM   1534 C CA    . PRO A  1 198 ? 15.205  23.014  18.976  1.00 17.08  ? 643  PRO A CA    1 
ATOM   1535 C C     . PRO A  1 198 ? 15.971  22.047  19.836  1.00 16.90  ? 643  PRO A C     1 
ATOM   1536 O O     . PRO A  1 198 ? 15.537  20.890  20.084  1.00 16.56  ? 643  PRO A O     1 
ATOM   1537 C CB    . PRO A  1 198 ? 14.157  23.797  19.798  1.00 17.80  ? 643  PRO A CB    1 
ATOM   1538 C CG    . PRO A  1 198 ? 12.888  23.015  19.644  1.00 16.79  ? 643  PRO A CG    1 
ATOM   1539 C CD    . PRO A  1 198 ? 12.941  22.436  18.216  1.00 15.93  ? 643  PRO A CD    1 
ATOM   1540 N N     . ARG A  1 199 ? 17.110  22.513  20.341  1.00 20.63  ? 644  ARG A N     1 
ATOM   1541 C CA    . ARG A  1 199 ? 17.947  21.723  21.252  1.00 20.59  ? 644  ARG A CA    1 
ATOM   1542 C C     . ARG A  1 199 ? 18.670  20.618  20.589  1.00 19.27  ? 644  ARG A C     1 
ATOM   1543 O O     . ARG A  1 199 ? 19.219  19.745  21.264  1.00 17.85  ? 644  ARG A O     1 
ATOM   1544 C CB    . ARG A  1 199 ? 17.133  21.115  22.427  1.00 24.26  ? 644  ARG A CB    1 
ATOM   1545 C CG    . ARG A  1 199 ? 16.330  22.116  23.177  1.00 25.73  ? 644  ARG A CG    1 
ATOM   1546 C CD    . ARG A  1 199 ? 17.230  22.967  24.059  1.00 29.77  ? 644  ARG A CD    1 
ATOM   1547 N NE    . ARG A  1 199 ? 16.428  23.908  24.824  1.00 32.74  ? 644  ARG A NE    1 
ATOM   1548 C CZ    . ARG A  1 199 ? 15.937  25.029  24.344  1.00 32.50  ? 644  ARG A CZ    1 
ATOM   1549 N NH1   . ARG A  1 199 ? 16.184  25.394  23.094  1.00 35.13  ? 644  ARG A NH1   1 
ATOM   1550 N NH2   . ARG A  1 199 ? 15.198  25.795  25.123  1.00 36.44  ? 644  ARG A NH2   1 
ATOM   1551 N N     . ARG A  1 200 ? 18.735  20.641  19.259  1.00 17.72  ? 645  ARG A N     1 
ATOM   1552 C CA    . ARG A  1 200 ? 19.368  19.537  18.553  1.00 15.94  ? 645  ARG A CA    1 
ATOM   1553 C C     . ARG A  1 200 ? 20.623  19.969  17.828  1.00 16.35  ? 645  ARG A C     1 
ATOM   1554 O O     . ARG A  1 200 ? 21.119  19.255  16.942  1.00 14.62  ? 645  ARG A O     1 
ATOM   1555 C CB    . ARG A  1 200 ? 18.376  18.878  17.588  1.00 14.97  ? 645  ARG A CB    1 
ATOM   1556 C CG    . ARG A  1 200 ? 17.122  18.346  18.280  1.00 15.59  ? 645  ARG A CG    1 
ATOM   1557 C CD    . ARG A  1 200 ? 17.425  17.168  19.179  1.00 15.98  ? 645  ARG A CD    1 
ATOM   1558 N NE    . ARG A  1 200 ? 17.896  15.965  18.462  1.00 16.40  ? 645  ARG A NE    1 
ATOM   1559 C CZ    . ARG A  1 200 ? 17.133  14.924  18.109  1.00 15.51  ? 645  ARG A CZ    1 
ATOM   1560 N NH1   . ARG A  1 200 ? 15.836  14.930  18.362  1.00 15.25  ? 645  ARG A NH1   1 
ATOM   1561 N NH2   . ARG A  1 200 ? 17.670  13.890  17.421  1.00 15.81  ? 645  ARG A NH2   1 
ATOM   1562 N N     . ASN A  1 201 ? 21.208  21.097  18.241  1.00 16.90  ? 646  ASN A N     1 
ATOM   1563 C CA    . ASN A  1 201 ? 22.307  21.686  17.504  1.00 17.48  ? 646  ASN A CA    1 
ATOM   1564 C C     . ASN A  1 201 ? 23.641  21.772  18.250  1.00 20.41  ? 646  ASN A C     1 
ATOM   1565 O O     . ASN A  1 201 ? 24.668  21.806  17.630  1.00 17.60  ? 646  ASN A O     1 
ATOM   1566 C CB    . ASN A  1 201 ? 21.894  23.088  17.066  1.00 17.97  ? 646  ASN A CB    1 
ATOM   1567 C CG    . ASN A  1 201 ? 20.618  23.070  16.209  1.00 20.04  ? 646  ASN A CG    1 
ATOM   1568 O OD1   . ASN A  1 201 ? 20.574  22.411  15.139  1.00 15.69  ? 646  ASN A OD1   1 
ATOM   1569 N ND2   . ASN A  1 201 ? 19.583  23.796  16.655  1.00 19.25  ? 646  ASN A ND2   1 
ATOM   1570 N N     . ALA A  1 202 ? 23.623  22.003  19.566  1.00 23.87  ? 647  ALA A N     1 
ATOM   1571 C CA    . ALA A  1 202 ? 24.915  22.385  20.264  1.00 28.54  ? 647  ALA A CA    1 
ATOM   1572 C C     . ALA A  1 202 ? 25.863  21.186  20.401  1.00 30.15  ? 647  ALA A C     1 
ATOM   1573 O O     . ALA A  1 202 ? 25.455  20.107  20.748  1.00 33.23  ? 647  ALA A O     1 
ATOM   1574 C CB    . ALA A  1 202 ? 24.647  23.023  21.615  1.00 28.14  ? 647  ALA A CB    1 
ATOM   1575 N N     . LYS A  1 203 ? 27.136  21.398  20.083  1.00 41.02  ? 648  LYS A N     1 
ATOM   1576 C CA    . LYS A  1 203 ? 28.142  20.323  20.193  1.00 49.61  ? 648  LYS A CA    1 
ATOM   1577 C C     . LYS A  1 203 ? 28.387  19.902  21.672  1.00 50.16  ? 648  LYS A C     1 
ATOM   1578 O O     . LYS A  1 203 ? 28.851  18.803  21.916  1.00 43.97  ? 648  LYS A O     1 
ATOM   1579 C CB    . LYS A  1 203 ? 29.475  20.755  19.535  1.00 59.09  ? 648  LYS A CB    1 
ATOM   1580 C CG    . LYS A  1 203 ? 29.424  20.961  18.004  1.00 64.74  ? 648  LYS A CG    1 
ATOM   1581 C CD    . LYS A  1 203 ? 29.588  22.444  17.611  1.00 68.95  ? 648  LYS A CD    1 
ATOM   1582 C CE    . LYS A  1 203 ? 29.296  22.715  16.123  1.00 65.37  ? 648  LYS A CE    1 
ATOM   1583 N NZ    . LYS A  1 203 ? 28.377  23.882  15.913  1.00 54.50  ? 648  LYS A NZ    1 
ATOM   1584 N N     . MET A  1 204 ? 28.068  20.799  22.632  1.00 49.55  ? 649  MET A N     1 
ATOM   1585 C CA    . MET A  1 204 ? 28.314  20.579  24.092  1.00 55.90  ? 649  MET A CA    1 
ATOM   1586 C C     . MET A  1 204 ? 26.993  20.335  24.871  1.00 63.47  ? 649  MET A C     1 
ATOM   1587 O O     . MET A  1 204 ? 26.857  20.703  26.047  1.00 62.76  ? 649  MET A O     1 
ATOM   1588 C CB    . MET A  1 204 ? 29.061  21.788  24.700  1.00 56.29  ? 649  MET A CB    1 
ATOM   1589 C CG    . MET A  1 204 ? 30.571  21.799  24.398  1.00 62.27  ? 649  MET A CG    1 
ATOM   1590 S SD    . MET A  1 204 ? 31.586  20.667  25.438  1.00 64.91  ? 649  MET A SD    1 
ATOM   1591 C CE    . MET A  1 204 ? 32.496  19.831  24.133  1.00 63.60  ? 649  MET A CE    1 
ATOM   1592 N N     . LYS A  1 205 ? 26.021  19.728  24.200  1.00 67.54  ? 650  LYS A N     1 
ATOM   1593 C CA    . LYS A  1 205 ? 24.781  19.301  24.869  1.00 64.91  ? 650  LYS A CA    1 
ATOM   1594 C C     . LYS A  1 205 ? 25.037  18.103  25.830  1.00 55.57  ? 650  LYS A C     1 
ATOM   1595 O O     . LYS A  1 205 ? 25.906  17.270  25.600  1.00 46.48  ? 650  LYS A O     1 
ATOM   1596 C CB    . LYS A  1 205 ? 23.661  18.972  23.835  1.00 67.20  ? 650  LYS A CB    1 
ATOM   1597 C CG    . LYS A  1 205 ? 24.022  17.964  22.707  1.00 65.37  ? 650  LYS A CG    1 
ATOM   1598 C CD    . LYS A  1 205 ? 23.124  18.115  21.456  1.00 65.66  ? 650  LYS A CD    1 
ATOM   1599 C CE    . LYS A  1 205 ? 23.773  17.488  20.206  1.00 62.83  ? 650  LYS A CE    1 
ATOM   1600 N NZ    . LYS A  1 205 ? 22.786  16.938  19.251  1.00 58.73  ? 650  LYS A NZ    1 
ATOM   1601 N N     . SER A  1 206 ? 24.358  18.118  26.954  1.00 48.62  ? 651  SER A N     1 
ATOM   1602 C CA    . SER A  1 206 ? 24.046  16.901  27.650  1.00 44.02  ? 651  SER A CA    1 
ATOM   1603 C C     . SER A  1 206 ? 22.780  16.333  27.001  1.00 33.91  ? 651  SER A C     1 
ATOM   1604 O O     . SER A  1 206 ? 22.765  15.216  26.539  1.00 29.99  ? 651  SER A O     1 
ATOM   1605 C CB    . SER A  1 206 ? 23.828  17.190  29.140  1.00 45.71  ? 651  SER A CB    1 
ATOM   1606 O OG    . SER A  1 206 ? 23.113  16.150  29.787  1.00 50.53  ? 651  SER A OG    1 
ATOM   1607 N N     A GLU A  1 207 ? 21.727  17.129  26.926  0.60 34.42  ? 652  GLU A N     1 
ATOM   1608 N N     B GLU A  1 207 ? 21.759  17.190  26.971  0.40 30.84  ? 652  GLU A N     1 
ATOM   1609 C CA    A GLU A  1 207 ? 20.327  16.642  26.677  0.60 32.44  ? 652  GLU A CA    1 
ATOM   1610 C CA    B GLU A  1 207 ? 20.508  16.867  26.376  0.40 27.21  ? 652  GLU A CA    1 
ATOM   1611 C C     A GLU A  1 207 ? 20.127  15.367  25.736  0.60 30.51  ? 652  GLU A C     1 
ATOM   1612 C C     B GLU A  1 207 ? 20.702  16.711  24.871  0.40 25.17  ? 652  GLU A C     1 
ATOM   1613 O O     A GLU A  1 207 ? 19.732  14.309  26.187  0.60 33.80  ? 652  GLU A O     1 
ATOM   1614 O O     B GLU A  1 207 ? 21.164  17.595  24.161  0.40 20.83  ? 652  GLU A O     1 
ATOM   1615 C CB    A GLU A  1 207 ? 19.512  17.844  26.145  0.60 36.00  ? 652  GLU A CB    1 
ATOM   1616 C CB    B GLU A  1 207 ? 19.421  17.916  26.709  0.40 27.04  ? 652  GLU A CB    1 
ATOM   1617 C CG    A GLU A  1 207 ? 18.037  17.854  26.496  0.60 37.04  ? 652  GLU A CG    1 
ATOM   1618 C CG    B GLU A  1 207 ? 18.183  17.814  25.812  0.40 26.78  ? 652  GLU A CG    1 
ATOM   1619 C CD    A GLU A  1 207 ? 17.351  19.229  26.270  0.60 37.09  ? 652  GLU A CD    1 
ATOM   1620 C CD    B GLU A  1 207 ? 16.936  18.524  26.364  0.40 27.07  ? 652  GLU A CD    1 
ATOM   1621 O OE1   A GLU A  1 207 ? 18.042  20.237  26.014  0.60 32.92  ? 652  GLU A OE1   1 
ATOM   1622 O OE1   B GLU A  1 207 ? 16.960  19.789  26.411  0.40 24.11  ? 652  GLU A OE1   1 
ATOM   1623 O OE2   A GLU A  1 207 ? 16.094  19.284  26.349  0.60 38.85  ? 652  GLU A OE2   1 
ATOM   1624 O OE2   B GLU A  1 207 ? 15.919  17.815  26.704  0.40 21.74  ? 652  GLU A OE2   1 
ATOM   1625 N N     . TYR A  1 208 ? 20.367  15.527  24.451  1.00 23.89  ? 653  TYR A N     1 
ATOM   1626 C CA    . TYR A  1 208 ? 20.337  14.908  23.134  1.00 22.76  ? 653  TYR A CA    1 
ATOM   1627 C C     . TYR A  1 208 ? 21.671  14.497  22.636  1.00 20.62  ? 653  TYR A C     1 
ATOM   1628 O O     . TYR A  1 208 ? 21.807  14.128  21.457  1.00 23.31  ? 653  TYR A O     1 
ATOM   1629 C CB    . TYR A  1 208 ? 19.643  15.845  22.156  1.00 21.36  ? 653  TYR A CB    1 
ATOM   1630 C CG    . TYR A  1 208 ? 18.146  15.860  22.336  1.00 23.42  ? 653  TYR A CG    1 
ATOM   1631 C CD1   . TYR A  1 208 ? 17.411  14.785  21.947  1.00 25.96  ? 653  TYR A CD1   1 
ATOM   1632 C CD2   . TYR A  1 208 ? 17.457  16.999  22.818  1.00 28.10  ? 653  TYR A CD2   1 
ATOM   1633 C CE1   . TYR A  1 208 ? 16.034  14.774  22.027  1.00 27.86  ? 653  TYR A CE1   1 
ATOM   1634 C CE2   . TYR A  1 208 ? 16.065  16.997  22.921  1.00 27.94  ? 653  TYR A CE2   1 
ATOM   1635 C CZ    . TYR A  1 208 ? 15.363  15.853  22.537  1.00 30.75  ? 653  TYR A CZ    1 
ATOM   1636 O OH    . TYR A  1 208 ? 13.955  15.759  22.547  1.00 32.46  ? 653  TYR A OH    1 
ATOM   1637 N N     . SER A  1 209 ? 22.682  14.481  23.517  1.00 21.13  ? 654  SER A N     1 
ATOM   1638 C CA    . SER A  1 209 ? 24.011  14.039  23.113  1.00 23.02  ? 654  SER A CA    1 
ATOM   1639 C C     . SER A  1 209 ? 23.992  12.530  22.745  1.00 19.97  ? 654  SER A C     1 
ATOM   1640 O O     . SER A  1 209 ? 24.848  12.057  22.026  1.00 22.68  ? 654  SER A O     1 
ATOM   1641 C CB    . SER A  1 209 ? 25.056  14.289  24.249  1.00 24.74  ? 654  SER A CB    1 
ATOM   1642 O OG    . SER A  1 209 ? 24.695  13.517  25.391  1.00 26.84  ? 654  SER A OG    1 
ATOM   1643 N N     . SER A  1 210 ? 23.038  11.788  23.250  1.00 18.64  ? 655  SER A N     1 
ATOM   1644 C CA    . SER A  1 210 ? 22.962  10.383  22.894  1.00 19.36  ? 655  SER A CA    1 
ATOM   1645 C C     . SER A  1 210 ? 22.011  10.083  21.694  1.00 17.68  ? 655  SER A C     1 
ATOM   1646 O O     . SER A  1 210 ? 21.626  8.928   21.495  1.00 15.73  ? 655  SER A O     1 
ATOM   1647 C CB    . SER A  1 210 ? 22.564  9.580   24.111  1.00 18.86  ? 655  SER A CB    1 
ATOM   1648 O OG    . SER A  1 210 ? 21.273  9.894   24.593  1.00 21.49  ? 655  SER A OG    1 
ATOM   1649 N N     . TYR A  1 211 ? 21.563  11.147  20.989  1.00 16.17  ? 656  TYR A N     1 
ATOM   1650 C CA    . TYR A  1 211 ? 20.657  11.027  19.834  1.00 15.86  ? 656  TYR A CA    1 
ATOM   1651 C C     . TYR A  1 211 ? 21.383  11.508  18.588  1.00 16.85  ? 656  TYR A C     1 
ATOM   1652 O O     . TYR A  1 211 ? 22.262  12.331  18.680  1.00 15.92  ? 656  TYR A O     1 
ATOM   1653 C CB    . TYR A  1 211 ? 19.373  11.870  20.052  1.00 16.14  ? 656  TYR A CB    1 
ATOM   1654 C CG    . TYR A  1 211 ? 18.458  11.231  21.029  1.00 16.67  ? 656  TYR A CG    1 
ATOM   1655 C CD1   . TYR A  1 211 ? 18.743  11.262  22.406  1.00 17.30  ? 656  TYR A CD1   1 
ATOM   1656 C CD2   . TYR A  1 211 ? 17.321  10.577  20.610  1.00 17.06  ? 656  TYR A CD2   1 
ATOM   1657 C CE1   . TYR A  1 211 ? 17.926  10.639  23.310  1.00 17.45  ? 656  TYR A CE1   1 
ATOM   1658 C CE2   . TYR A  1 211 ? 16.485  9.944   21.514  1.00 17.81  ? 656  TYR A CE2   1 
ATOM   1659 C CZ    . TYR A  1 211 ? 16.811  9.940   22.860  1.00 17.88  ? 656  TYR A CZ    1 
ATOM   1660 O OH    . TYR A  1 211 ? 15.997  9.268   23.734  1.00 16.32  ? 656  TYR A OH    1 
ATOM   1661 N N     . PRO A  1 212 ? 21.040  10.953  17.406  1.00 15.30  ? 657  PRO A N     1 
ATOM   1662 C CA    . PRO A  1 212 ? 21.648  11.415  16.177  1.00 15.10  ? 657  PRO A CA    1 
ATOM   1663 C C     . PRO A  1 212 ? 21.281  12.848  15.821  1.00 16.31  ? 657  PRO A C     1 
ATOM   1664 O O     . PRO A  1 212 ? 20.307  13.410  16.380  1.00 14.46  ? 657  PRO A O     1 
ATOM   1665 C CB    . PRO A  1 212 ? 21.056  10.429  15.082  1.00 15.35  ? 657  PRO A CB    1 
ATOM   1666 C CG    . PRO A  1 212 ? 20.396  9.344   15.833  1.00 15.85  ? 657  PRO A CG    1 
ATOM   1667 C CD    . PRO A  1 212 ? 19.993  9.932   17.173  1.00 15.79  ? 657  PRO A CD    1 
ATOM   1668 N N     . ASP A  1 213 ? 22.033  13.437  14.898  1.00 17.70  ? 658  ASP A N     1 
ATOM   1669 C CA    . ASP A  1 213 ? 21.656  14.707  14.281  1.00 18.00  ? 658  ASP A CA    1 
ATOM   1670 C C     . ASP A  1 213 ? 20.302  14.534  13.531  1.00 16.90  ? 658  ASP A C     1 
ATOM   1671 O O     . ASP A  1 213 ? 20.022  13.464  12.964  1.00 18.09  ? 658  ASP A O     1 
ATOM   1672 C CB    . ASP A  1 213 ? 22.681  15.149  13.235  1.00 20.71  ? 658  ASP A CB    1 
ATOM   1673 C CG    . ASP A  1 213 ? 24.032  15.544  13.828  1.00 27.32  ? 658  ASP A CG    1 
ATOM   1674 O OD1   . ASP A  1 213 ? 24.154  15.720  15.063  1.00 27.52  ? 658  ASP A OD1   1 
ATOM   1675 O OD2   . ASP A  1 213 ? 24.984  15.630  13.028  1.00 27.40  ? 658  ASP A OD2   1 
ATOM   1676 N N     . ILE A  1 214 ? 19.509  15.594  13.500  1.00 15.17  ? 659  ILE A N     1 
ATOM   1677 C CA    . ILE A  1 214 ? 18.265  15.625  12.713  1.00 13.08  ? 659  ILE A CA    1 
ATOM   1678 C C     . ILE A  1 214 ? 18.163  16.818  11.784  1.00 13.79  ? 659  ILE A C     1 
ATOM   1679 O O     . ILE A  1 214 ? 17.751  16.656  10.636  1.00 13.80  ? 659  ILE A O     1 
ATOM   1680 C CB    . ILE A  1 214 ? 16.958  15.446  13.613  1.00 14.22  ? 659  ILE A CB    1 
ATOM   1681 C CG1   . ILE A  1 214 ? 15.677  15.468  12.757  1.00 14.86  ? 659  ILE A CG1   1 
ATOM   1682 C CG2   . ILE A  1 214 ? 16.842  16.499  14.713  1.00 15.85  ? 659  ILE A CG2   1 
ATOM   1683 C CD1   . ILE A  1 214 ? 15.617  14.327  11.722  1.00 15.02  ? 659  ILE A CD1   1 
ATOM   1684 N N     . ASN A  1 215 ? 18.515  18.040  12.247  1.00 15.10  ? 660  ASN A N     1 
ATOM   1685 C CA    . ASN A  1 215 ? 18.510  19.192  11.363  1.00 13.11  ? 660  ASN A CA    1 
ATOM   1686 C C     . ASN A  1 215 ? 19.519  18.999  10.226  1.00 13.13  ? 660  ASN A C     1 
ATOM   1687 O O     . ASN A  1 215 ? 20.612  18.393  10.451  1.00 12.81  ? 660  ASN A O     1 
ATOM   1688 C CB    . ASN A  1 215 ? 18.775  20.501  12.137  1.00 13.65  ? 660  ASN A CB    1 
ATOM   1689 C CG    . ASN A  1 215 ? 17.624  20.877  13.096  1.00 15.12  ? 660  ASN A CG    1 
ATOM   1690 O OD1   . ASN A  1 215 ? 16.454  20.748  12.768  1.00 13.51  ? 660  ASN A OD1   1 
ATOM   1691 N ND2   . ASN A  1 215 ? 17.985  21.345  14.299  1.00 15.05  ? 660  ASN A ND2   1 
ATOM   1692 N N     . PHE A  1 216 ? 19.187  19.501  9.021   1.00 11.34  ? 661  PHE A N     1 
ATOM   1693 C CA    . PHE A  1 216 ? 19.953  19.167  7.784   1.00 11.84  ? 661  PHE A CA    1 
ATOM   1694 C C     . PHE A  1 216 ? 21.163  20.106  7.515   1.00 12.77  ? 661  PHE A C     1 
ATOM   1695 O O     . PHE A  1 216 ? 21.717  20.104  6.428   1.00 12.35  ? 661  PHE A O     1 
ATOM   1696 C CB    . PHE A  1 216 ? 19.044  19.191  6.554   1.00 11.74  ? 661  PHE A CB    1 
ATOM   1697 C CG    . PHE A  1 216 ? 18.154  17.962  6.385   1.00 12.00  ? 661  PHE A CG    1 
ATOM   1698 C CD1   . PHE A  1 216 ? 17.880  17.108  7.440   1.00 11.72  ? 661  PHE A CD1   1 
ATOM   1699 C CD2   . PHE A  1 216 ? 17.507  17.723  5.137   1.00 11.64  ? 661  PHE A CD2   1 
ATOM   1700 C CE1   . PHE A  1 216 ? 17.037  16.005  7.263   1.00 12.18  ? 661  PHE A CE1   1 
ATOM   1701 C CE2   . PHE A  1 216 ? 16.627  16.650  4.970   1.00 10.95  ? 661  PHE A CE2   1 
ATOM   1702 C CZ    . PHE A  1 216 ? 16.415  15.771  6.019   1.00 11.04  ? 661  PHE A CZ    1 
ATOM   1703 N N     . ASN A  1 217 ? 21.585  20.926  8.489   1.00 13.18  ? 662  ASN A N     1 
ATOM   1704 C CA    . ASN A  1 217 ? 22.613  21.942  8.172   1.00 14.24  ? 662  ASN A CA    1 
ATOM   1705 C C     . ASN A  1 217 ? 23.926  21.391  7.601   1.00 13.61  ? 662  ASN A C     1 
ATOM   1706 O O     . ASN A  1 217 ? 24.517  22.036  6.759   1.00 13.19  ? 662  ASN A O     1 
ATOM   1707 C CB    . ASN A  1 217 ? 22.914  22.840  9.381   1.00 14.86  ? 662  ASN A CB    1 
ATOM   1708 C CG    . ASN A  1 217 ? 23.247  22.054  10.620  1.00 17.47  ? 662  ASN A CG    1 
ATOM   1709 O OD1   . ASN A  1 217 ? 22.369  21.503  11.298  1.00 16.67  ? 662  ASN A OD1   1 
ATOM   1710 N ND2   . ASN A  1 217 ? 24.530  22.032  10.964  1.00 19.79  ? 662  ASN A ND2   1 
ATOM   1711 N N     . ARG A  1 218 ? 24.365  20.192  8.016   1.00 13.72  ? 663  ARG A N     1 
ATOM   1712 C CA    . ARG A  1 218 ? 25.607  19.620  7.421   1.00 15.33  ? 663  ARG A CA    1 
ATOM   1713 C C     . ARG A  1 218 ? 25.495  19.193  5.965   1.00 16.34  ? 663  ARG A C     1 
ATOM   1714 O O     . ARG A  1 218 ? 26.531  19.074  5.263   1.00 17.04  ? 663  ARG A O     1 
ATOM   1715 C CB    . ARG A  1 218 ? 26.198  18.531  8.290   1.00 16.88  ? 663  ARG A CB    1 
ATOM   1716 C CG    . ARG A  1 218 ? 26.525  19.043  9.692   1.00 18.86  ? 663  ARG A CG    1 
ATOM   1717 C CD    . ARG A  1 218 ? 27.415  18.099  10.440  1.00 22.13  ? 663  ARG A CD    1 
ATOM   1718 N NE    . ARG A  1 218 ? 28.670  17.862  9.727   1.00 24.03  ? 663  ARG A NE    1 
ATOM   1719 C CZ    . ARG A  1 218 ? 29.401  16.763  9.883   1.00 29.63  ? 663  ARG A CZ    1 
ATOM   1720 N NH1   . ARG A  1 218 ? 29.001  15.820  10.723  1.00 28.17  ? 663  ARG A NH1   1 
ATOM   1721 N NH2   . ARG A  1 218 ? 30.526  16.589  9.182   1.00 32.08  ? 663  ARG A NH2   1 
ATOM   1722 N N     . LEU A  1 219 ? 24.272  19.067  5.460   1.00 14.50  ? 664  LEU A N     1 
ATOM   1723 C CA    A LEU A  1 219 ? 24.087  18.819  4.033   0.70 15.76  ? 664  LEU A CA    1 
ATOM   1724 C CA    B LEU A  1 219 ? 24.027  18.819  4.047   0.30 14.88  ? 664  LEU A CA    1 
ATOM   1725 C C     . LEU A  1 219 ? 24.435  20.013  3.203   1.00 15.30  ? 664  LEU A C     1 
ATOM   1726 O O     . LEU A  1 219 ? 24.662  19.879  1.992   1.00 14.70  ? 664  LEU A O     1 
ATOM   1727 C CB    A LEU A  1 219 ? 22.643  18.403  3.727   0.70 16.09  ? 664  LEU A CB    1 
ATOM   1728 C CB    B LEU A  1 219 ? 22.531  18.533  3.835   0.30 14.48  ? 664  LEU A CB    1 
ATOM   1729 C CG    A LEU A  1 219 ? 22.295  16.963  4.119   0.70 16.91  ? 664  LEU A CG    1 
ATOM   1730 C CG    B LEU A  1 219 ? 22.025  18.179  2.438   0.30 14.44  ? 664  LEU A CG    1 
ATOM   1731 C CD1   A LEU A  1 219 ? 20.801  16.687  3.868   0.70 17.72  ? 664  LEU A CD1   1 
ATOM   1732 C CD1   B LEU A  1 219 ? 22.608  16.864  1.933   0.30 14.07  ? 664  LEU A CD1   1 
ATOM   1733 C CD2   A LEU A  1 219 ? 23.149  15.947  3.366   0.70 16.56  ? 664  LEU A CD2   1 
ATOM   1734 C CD2   B LEU A  1 219 ? 20.502  18.144  2.477   0.30 13.90  ? 664  LEU A CD2   1 
ATOM   1735 N N     . PHE A  1 220 ? 24.450  21.208  3.821   1.00 12.72  ? 665  PHE A N     1 
ATOM   1736 C CA    . PHE A  1 220 ? 24.738  22.445  3.073   1.00 12.74  ? 665  PHE A CA    1 
ATOM   1737 C C     . PHE A  1 220 ? 26.216  22.888  3.097   1.00 13.68  ? 665  PHE A C     1 
ATOM   1738 O O     . PHE A  1 220 ? 26.590  23.907  2.469   1.00 14.46  ? 665  PHE A O     1 
ATOM   1739 C CB    . PHE A  1 220 ? 23.887  23.579  3.625   1.00 12.86  ? 665  PHE A CB    1 
ATOM   1740 C CG    . PHE A  1 220 ? 22.433  23.224  3.791   1.00 13.85  ? 665  PHE A CG    1 
ATOM   1741 C CD1   . PHE A  1 220 ? 21.755  22.515  2.814   1.00 16.47  ? 665  PHE A CD1   1 
ATOM   1742 C CD2   . PHE A  1 220 ? 21.727  23.687  4.864   1.00 13.66  ? 665  PHE A CD2   1 
ATOM   1743 C CE1   . PHE A  1 220 ? 20.380  22.260  2.946   1.00 17.40  ? 665  PHE A CE1   1 
ATOM   1744 C CE2   . PHE A  1 220 ? 20.377  23.459  4.990   1.00 14.49  ? 665  PHE A CE2   1 
ATOM   1745 C CZ    . PHE A  1 220 ? 19.706  22.740  4.041   1.00 14.81  ? 665  PHE A CZ    1 
ATOM   1746 N N     . GLU A  1 221 ? 27.056  22.146  3.797   1.00 16.11  ? 666  GLU A N     1 
ATOM   1747 C CA    . GLU A  1 221 ? 28.466  22.529  3.939   1.00 17.73  ? 666  GLU A CA    1 
ATOM   1748 C C     . GLU A  1 221 ? 29.427  21.953  2.911   1.00 19.42  ? 666  GLU A C     1 
ATOM   1749 O O     . GLU A  1 221 ? 29.202  20.871  2.336   1.00 16.15  ? 666  GLU A O     1 
ATOM   1750 C CB    . GLU A  1 221 ? 28.938  22.289  5.374   1.00 23.28  ? 666  GLU A CB    1 
ATOM   1751 C CG    . GLU A  1 221 ? 29.297  20.918  5.668   1.00 28.61  ? 666  GLU A CG    1 
ATOM   1752 C CD    . GLU A  1 221 ? 29.389  20.616  7.196   1.00 32.42  ? 666  GLU A CD    1 
ATOM   1753 O OE1   . GLU A  1 221 ? 28.986  21.452  8.100   1.00 37.80  ? 666  GLU A OE1   1 
ATOM   1754 O OE2   . GLU A  1 221 ? 29.836  19.524  7.450   1.00 28.34  ? 666  GLU A OE2   1 
ATOM   1755 N N     . GLY A  1 222 ? 30.490  22.744  2.616   1.00 18.00  ? 667  GLY A N     1 
ATOM   1756 C CA    . GLY A  1 222 ? 31.639  22.276  1.854   1.00 18.71  ? 667  GLY A CA    1 
ATOM   1757 C C     . GLY A  1 222 ? 31.475  22.149  0.371   1.00 18.07  ? 667  GLY A C     1 
ATOM   1758 O O     . GLY A  1 222 ? 30.500  22.628  -0.217  1.00 19.91  ? 667  GLY A O     1 
ATOM   1759 N N     . ARG A  1 223 ? 32.461  21.529  -0.282  1.00 16.06  ? 668  ARG A N     1 
ATOM   1760 C CA    . ARG A  1 223 ? 32.436  21.434  -1.734  1.00 16.34  ? 668  ARG A CA    1 
ATOM   1761 C C     . ARG A  1 223 ? 32.580  19.978  -2.274  1.00 17.23  ? 668  ARG A C     1 
ATOM   1762 O O     . ARG A  1 223 ? 33.043  19.765  -3.386  1.00 17.37  ? 668  ARG A O     1 
ATOM   1763 C CB    . ARG A  1 223 ? 33.517  22.345  -2.350  1.00 16.23  ? 668  ARG A CB    1 
ATOM   1764 C CG    . ARG A  1 223 ? 33.297  23.804  -2.043  1.00 18.28  ? 668  ARG A CG    1 
ATOM   1765 C CD    . ARG A  1 223 ? 34.178  24.678  -2.965  1.00 18.56  ? 668  ARG A CD    1 
ATOM   1766 N NE    . ARG A  1 223 ? 34.265  26.030  -2.498  1.00 18.87  ? 668  ARG A NE    1 
ATOM   1767 C CZ    . ARG A  1 223 ? 33.662  27.056  -3.045  1.00 19.96  ? 668  ARG A CZ    1 
ATOM   1768 N NH1   . ARG A  1 223 ? 32.760  26.886  -4.044  1.00 23.62  ? 668  ARG A NH1   1 
ATOM   1769 N NH2   . ARG A  1 223 ? 33.854  28.268  -2.502  1.00 19.70  ? 668  ARG A NH2   1 
ATOM   1770 N N     . SER A  1 224 ? 32.093  18.994  -1.550  1.00 17.48  ? 669  SER A N     1 
ATOM   1771 C CA    . SER A  1 224 ? 32.148  17.614  -2.088  1.00 17.38  ? 669  SER A CA    1 
ATOM   1772 C C     . SER A  1 224 ? 31.331  17.537  -3.364  1.00 17.88  ? 669  SER A C     1 
ATOM   1773 O O     . SER A  1 224 ? 30.219  18.036  -3.408  1.00 16.83  ? 669  SER A O     1 
ATOM   1774 C CB    . SER A  1 224 ? 31.613  16.624  -1.065  1.00 19.12  ? 669  SER A CB    1 
ATOM   1775 O OG    . SER A  1 224 ? 31.247  15.427  -1.690  1.00 18.75  ? 669  SER A OG    1 
ATOM   1776 N N     . SER A  1 225 ? 31.851  16.848  -4.401  1.00 16.12  ? 670  SER A N     1 
ATOM   1777 C CA    . SER A  1 225 ? 31.098  16.663  -5.643  1.00 16.10  ? 670  SER A CA    1 
ATOM   1778 C C     . SER A  1 225 ? 29.875  15.772  -5.445  1.00 16.16  ? 670  SER A C     1 
ATOM   1779 O O     . SER A  1 225 ? 29.047  15.688  -6.326  1.00 15.40  ? 670  SER A O     1 
ATOM   1780 C CB    . SER A  1 225 ? 31.972  16.055  -6.712  1.00 17.34  ? 670  SER A CB    1 
ATOM   1781 O OG    . SER A  1 225 ? 32.313  14.716  -6.301  1.00 16.92  ? 670  SER A OG    1 
ATOM   1782 N N     . ARG A  1 226 ? 29.770  15.088  -4.299  1.00 15.95  ? 671  ARG A N     1 
ATOM   1783 C CA    . ARG A  1 226 ? 28.588  14.240  -4.053  1.00 16.52  ? 671  ARG A CA    1 
ATOM   1784 C C     . ARG A  1 226 ? 27.420  15.010  -3.377  1.00 15.25  ? 671  ARG A C     1 
ATOM   1785 O O     . ARG A  1 226 ? 26.296  14.530  -3.366  1.00 14.49  ? 671  ARG A O     1 
ATOM   1786 C CB    . ARG A  1 226 ? 28.951  13.040  -3.232  1.00 17.86  ? 671  ARG A CB    1 
ATOM   1787 C CG    . ARG A  1 226 ? 29.976  12.118  -3.862  1.00 18.00  ? 671  ARG A CG    1 
ATOM   1788 C CD    . ARG A  1 226 ? 29.562  11.601  -5.230  1.00 19.01  ? 671  ARG A CD    1 
ATOM   1789 N NE    . ARG A  1 226 ? 30.286  12.354  -6.229  1.00 19.00  ? 671  ARG A NE    1 
ATOM   1790 C CZ    . ARG A  1 226 ? 30.188  12.201  -7.539  1.00 21.95  ? 671  ARG A CZ    1 
ATOM   1791 N NH1   . ARG A  1 226 ? 29.330  11.342  -8.092  1.00 23.73  ? 671  ARG A NH1   1 
ATOM   1792 N NH2   . ARG A  1 226 ? 31.003  12.892  -8.317  1.00 22.14  ? 671  ARG A NH2   1 
ATOM   1793 N N     . LYS A  1 227 ? 27.666  16.205  -2.829  1.00 15.48  ? 672  LYS A N     1 
ATOM   1794 C CA    . LYS A  1 227 ? 26.549  16.996  -2.229  1.00 16.84  ? 672  LYS A CA    1 
ATOM   1795 C C     . LYS A  1 227 ? 25.425  17.297  -3.216  1.00 17.28  ? 672  LYS A C     1 
ATOM   1796 O O     . LYS A  1 227 ? 24.262  17.125  -2.872  1.00 18.61  ? 672  LYS A O     1 
ATOM   1797 C CB    . LYS A  1 227 ? 27.034  18.301  -1.546  1.00 18.50  ? 672  LYS A CB    1 
ATOM   1798 C CG    . LYS A  1 227 ? 27.715  18.083  -0.210  1.00 19.97  ? 672  LYS A CG    1 
ATOM   1799 C CD    . LYS A  1 227 ? 26.773  17.478  0.824   1.00 20.70  ? 672  LYS A CD    1 
ATOM   1800 C CE    . LYS A  1 227 ? 27.358  17.512  2.239   1.00 21.56  ? 672  LYS A CE    1 
ATOM   1801 N NZ    . LYS A  1 227 ? 28.706  16.966  2.256   1.00 26.52  ? 672  LYS A NZ    1 
ATOM   1802 N N     . PRO A  1 228 ? 25.747  17.662  -4.453  1.00 15.12  ? 673  PRO A N     1 
ATOM   1803 C CA    . PRO A  1 228 ? 24.609  17.865  -5.366  1.00 17.18  ? 673  PRO A CA    1 
ATOM   1804 C C     . PRO A  1 228 ? 23.801  16.605  -5.641  1.00 15.94  ? 673  PRO A C     1 
ATOM   1805 O O     . PRO A  1 228 ? 22.621  16.684  -5.943  1.00 14.74  ? 673  PRO A O     1 
ATOM   1806 C CB    . PRO A  1 228 ? 25.267  18.342  -6.676  1.00 17.10  ? 673  PRO A CB    1 
ATOM   1807 C CG    . PRO A  1 228 ? 26.614  18.897  -6.271  1.00 18.65  ? 673  PRO A CG    1 
ATOM   1808 C CD    . PRO A  1 228 ? 27.027  18.104  -5.039  1.00 18.08  ? 673  PRO A CD    1 
ATOM   1809 N N     . GLU A  1 229 ? 24.442  15.457  -5.561  1.00 14.44  ? 674  GLU A N     1 
ATOM   1810 C CA    . GLU A  1 229 ? 23.730  14.207  -5.767  1.00 14.39  ? 674  GLU A CA    1 
ATOM   1811 C C     . GLU A  1 229 ? 22.850  13.878  -4.584  1.00 13.62  ? 674  GLU A C     1 
ATOM   1812 O O     . GLU A  1 229 ? 21.702  13.431  -4.775  1.00 13.40  ? 674  GLU A O     1 
ATOM   1813 C CB    . GLU A  1 229 ? 24.722  13.057  -6.036  1.00 16.19  ? 674  GLU A CB    1 
ATOM   1814 C CG    . GLU A  1 229 ? 25.616  13.285  -7.240  1.00 15.66  ? 674  GLU A CG    1 
ATOM   1815 C CD    . GLU A  1 229 ? 24.854  13.530  -8.524  1.00 18.71  ? 674  GLU A CD    1 
ATOM   1816 O OE1   . GLU A  1 229 ? 23.697  13.025  -8.715  1.00 17.71  ? 674  GLU A OE1   1 
ATOM   1817 O OE2   . GLU A  1 229 ? 25.416  14.219  -9.395  1.00 21.08  ? 674  GLU A OE2   1 
ATOM   1818 N N     . LYS A  1 230 ? 23.333  14.114  -3.351  1.00 12.61  ? 675  LYS A N     1 
ATOM   1819 C CA    . LYS A  1 230 ? 22.476  13.956  -2.179  1.00 13.29  ? 675  LYS A CA    1 
ATOM   1820 C C     . LYS A  1 230 ? 21.289  14.905  -2.192  1.00 13.66  ? 675  LYS A C     1 
ATOM   1821 O O     . LYS A  1 230 ? 20.134  14.505  -1.887  1.00 12.05  ? 675  LYS A O     1 
ATOM   1822 C CB    . LYS A  1 230 ? 23.260  14.153  -0.891  1.00 13.16  ? 675  LYS A CB    1 
ATOM   1823 C CG    . LYS A  1 230 ? 24.392  13.113  -0.596  1.00 15.26  ? 675  LYS A CG    1 
ATOM   1824 C CD    . LYS A  1 230 ? 24.928  13.391  0.819   1.00 16.35  ? 675  LYS A CD    1 
ATOM   1825 C CE    . LYS A  1 230 ? 25.361  12.217  1.517   1.00 20.27  ? 675  LYS A CE    1 
ATOM   1826 N NZ    . LYS A  1 230 ? 25.358  12.398  2.997   1.00 22.12  ? 675  LYS A NZ    1 
ATOM   1827 N N     . LEU A  1 231 ? 21.535  16.166  -2.557  1.00 13.46  ? 676  LEU A N     1 
ATOM   1828 C CA    . LEU A  1 231 ? 20.457  17.152  -2.681  1.00 14.25  ? 676  LEU A CA    1 
ATOM   1829 C C     . LEU A  1 231 ? 19.422  16.823  -3.744  1.00 13.57  ? 676  LEU A C     1 
ATOM   1830 O O     . LEU A  1 231 ? 18.207  16.927  -3.475  1.00 13.20  ? 676  LEU A O     1 
ATOM   1831 C CB    . LEU A  1 231 ? 21.009  18.573  -2.906  1.00 15.13  ? 676  LEU A CB    1 
ATOM   1832 C CG    . LEU A  1 231 ? 21.778  19.102  -1.696  1.00 16.23  ? 676  LEU A CG    1 
ATOM   1833 C CD1   . LEU A  1 231 ? 22.594  20.349  -2.076  1.00 17.37  ? 676  LEU A CD1   1 
ATOM   1834 C CD2   . LEU A  1 231 ? 20.813  19.409  -0.562  1.00 16.85  ? 676  LEU A CD2   1 
ATOM   1835 N N     . LYS A  1 232 ? 19.864  16.391  -4.920  1.00 14.07  ? 677  LYS A N     1 
ATOM   1836 C CA    . LYS A  1 232 ? 18.931  15.925  -5.937  1.00 14.50  ? 677  LYS A CA    1 
ATOM   1837 C C     . LYS A  1 232 ? 18.046  14.797  -5.441  1.00 12.80  ? 677  LYS A C     1 
ATOM   1838 O O     . LYS A  1 232 ? 16.839  14.714  -5.820  1.00 12.13  ? 677  LYS A O     1 
ATOM   1839 C CB    . LYS A  1 232 ? 19.668  15.490  -7.210  1.00 16.23  ? 677  LYS A CB    1 
ATOM   1840 C CG    . LYS A  1 232 ? 20.102  16.699  -7.998  1.00 18.83  ? 677  LYS A CG    1 
ATOM   1841 C CD    . LYS A  1 232 ? 20.951  16.336  -9.172  1.00 22.84  ? 677  LYS A CD    1 
ATOM   1842 C CE    . LYS A  1 232 ? 21.151  17.588  -10.041 1.00 26.79  ? 677  LYS A CE    1 
ATOM   1843 N NZ    . LYS A  1 232 ? 21.914  17.338  -11.280 1.00 30.45  ? 677  LYS A NZ    1 
ATOM   1844 N N     . THR A  1 233 ? 18.654  13.883  -4.672  1.00 11.75  ? 678  THR A N     1 
ATOM   1845 C CA    . THR A  1 233 ? 17.942  12.700  -4.204  1.00 11.98  ? 678  THR A CA    1 
ATOM   1846 C C     . THR A  1 233 ? 16.833  13.158  -3.203  1.00 11.87  ? 678  THR A C     1 
ATOM   1847 O O     . THR A  1 233 ? 15.652  12.721  -3.267  1.00 11.36  ? 678  THR A O     1 
ATOM   1848 C CB    . THR A  1 233 ? 18.904  11.671  -3.558  1.00 11.16  ? 678  THR A CB    1 
ATOM   1849 O OG1   . THR A  1 233 ? 19.934  11.282  -4.487  1.00 10.34  ? 678  THR A OG1   1 
ATOM   1850 C CG2   . THR A  1 233 ? 18.157  10.408  -3.210  1.00 11.38  ? 678  THR A CG2   1 
ATOM   1851 N N     . LEU A  1 234 ? 17.203  14.056  -2.280  1.00 11.60  ? 679  LEU A N     1 
ATOM   1852 C CA    . LEU A  1 234 ? 16.214  14.563  -1.338  1.00 12.54  ? 679  LEU A CA    1 
ATOM   1853 C C     . LEU A  1 234 ? 15.141  15.430  -1.972  1.00 12.40  ? 679  LEU A C     1 
ATOM   1854 O O     . LEU A  1 234 ? 13.955  15.336  -1.576  1.00 11.34  ? 679  LEU A O     1 
ATOM   1855 C CB    . LEU A  1 234 ? 16.864  15.258  -0.136  1.00 14.06  ? 679  LEU A CB    1 
ATOM   1856 C CG    . LEU A  1 234 ? 17.629  14.265  0.733   1.00 15.23  ? 679  LEU A CG    1 
ATOM   1857 C CD1   . LEU A  1 234 ? 18.621  14.958  1.668   1.00 17.38  ? 679  LEU A CD1   1 
ATOM   1858 C CD2   . LEU A  1 234 ? 16.742  13.367  1.557   1.00 18.49  ? 679  LEU A CD2   1 
ATOM   1859 N N     . PHE A  1 235 ? 15.506  16.287  -2.939  1.00 12.21  ? 680  PHE A N     1 
ATOM   1860 C CA    . PHE A  1 235 ? 14.492  17.138  -3.590  1.00 13.09  ? 680  PHE A CA    1 
ATOM   1861 C C     . PHE A  1 235 ? 13.531  16.336  -4.460  1.00 14.08  ? 680  PHE A C     1 
ATOM   1862 O O     . PHE A  1 235 ? 12.402  16.781  -4.696  1.00 14.14  ? 680  PHE A O     1 
ATOM   1863 C CB    . PHE A  1 235 ? 15.150  18.277  -4.406  1.00 13.55  ? 680  PHE A CB    1 
ATOM   1864 C CG    . PHE A  1 235 ? 15.675  19.399  -3.533  1.00 12.65  ? 680  PHE A CG    1 
ATOM   1865 C CD1   . PHE A  1 235 ? 14.852  20.005  -2.606  1.00 13.87  ? 680  PHE A CD1   1 
ATOM   1866 C CD2   . PHE A  1 235 ? 16.975  19.817  -3.621  1.00 13.36  ? 680  PHE A CD2   1 
ATOM   1867 C CE1   . PHE A  1 235 ? 15.313  21.068  -1.827  1.00 14.46  ? 680  PHE A CE1   1 
ATOM   1868 C CE2   . PHE A  1 235 ? 17.440  20.839  -2.859  1.00 13.08  ? 680  PHE A CE2   1 
ATOM   1869 C CZ    . PHE A  1 235 ? 16.613  21.487  -1.966  1.00 14.11  ? 680  PHE A CZ    1 
ATOM   1870 N N     . CYS A  1 236 ? 13.965  15.167  -4.940  1.00 14.27  ? 681  CYS A N     1 
ATOM   1871 C CA    . CYS A  1 236 ? 13.048  14.238  -5.648  1.00 14.21  ? 681  CYS A CA    1 
ATOM   1872 C C     . CYS A  1 236 ? 11.931  13.829  -4.690  1.00 13.07  ? 681  CYS A C     1 
ATOM   1873 O O     . CYS A  1 236 ? 10.725  13.974  -4.995  1.00 12.44  ? 681  CYS A O     1 
ATOM   1874 C CB    . CYS A  1 236 ? 13.823  13.034  -6.165  1.00 14.77  ? 681  CYS A CB    1 
ATOM   1875 S SG    . CYS A  1 236 ? 12.803  11.746  -6.956  1.00 15.39  ? 681  CYS A SG    1 
ATOM   1876 N N     . TYR A  1 237 ? 12.311  13.388  -3.489  1.00 12.00  ? 682  TYR A N     1 
ATOM   1877 C CA    . TYR A  1 237 ? 11.343  13.097  -2.451  1.00 11.63  ? 682  TYR A CA    1 
ATOM   1878 C C     . TYR A  1 237 ? 10.442  14.297  -2.131  1.00 12.07  ? 682  TYR A C     1 
ATOM   1879 O O     . TYR A  1 237 ? 9.187   14.178  -2.131  1.00 10.51  ? 682  TYR A O     1 
ATOM   1880 C CB    . TYR A  1 237 ? 12.043  12.605  -1.165  1.00 11.94  ? 682  TYR A CB    1 
ATOM   1881 C CG    . TYR A  1 237 ? 11.204  12.597  0.086   1.00 10.78  ? 682  TYR A CG    1 
ATOM   1882 C CD1   . TYR A  1 237 ? 10.239  11.613  0.305   1.00 10.99  ? 682  TYR A CD1   1 
ATOM   1883 C CD2   . TYR A  1 237 ? 11.371  13.579  1.064   1.00 12.39  ? 682  TYR A CD2   1 
ATOM   1884 C CE1   . TYR A  1 237 ? 9.470   11.596  1.458   1.00 10.70  ? 682  TYR A CE1   1 
ATOM   1885 C CE2   . TYR A  1 237 ? 10.593  13.600  2.215   1.00 12.00  ? 682  TYR A CE2   1 
ATOM   1886 C CZ    . TYR A  1 237 ? 9.633   12.584  2.413   1.00 12.58  ? 682  TYR A CZ    1 
ATOM   1887 O OH    . TYR A  1 237 ? 8.846   12.560  3.568   1.00 12.83  ? 682  TYR A OH    1 
ATOM   1888 N N     . PHE A  1 238 ? 11.047  15.412  -1.785  1.00 11.43  ? 683  PHE A N     1 
ATOM   1889 C CA    . PHE A  1 238 ? 10.264  16.559  -1.357  1.00 11.80  ? 683  PHE A CA    1 
ATOM   1890 C C     . PHE A  1 238 ? 9.318   17.046  -2.432  1.00 12.16  ? 683  PHE A C     1 
ATOM   1891 O O     . PHE A  1 238 ? 8.165   17.430  -2.113  1.00 12.62  ? 683  PHE A O     1 
ATOM   1892 C CB    . PHE A  1 238 ? 11.129  17.708  -0.890  1.00 12.71  ? 683  PHE A CB    1 
ATOM   1893 C CG    . PHE A  1 238 ? 11.684  17.528  0.493   1.00 12.50  ? 683  PHE A CG    1 
ATOM   1894 C CD1   . PHE A  1 238 ? 10.833  17.428  1.603   1.00 12.95  ? 683  PHE A CD1   1 
ATOM   1895 C CD2   . PHE A  1 238 ? 13.050  17.597  0.704   1.00 12.20  ? 683  PHE A CD2   1 
ATOM   1896 C CE1   . PHE A  1 238 ? 11.362  17.259  2.897   1.00 12.79  ? 683  PHE A CE1   1 
ATOM   1897 C CE2   . PHE A  1 238 ? 13.592  17.462  1.979   1.00 12.55  ? 683  PHE A CE2   1 
ATOM   1898 C CZ    . PHE A  1 238 ? 12.748  17.320  3.080   1.00 13.38  ? 683  PHE A CZ    1 
ATOM   1899 N N     . ARG A  1 239 ? 9.757   17.062  -3.679  1.00 13.60  ? 684  ARG A N     1 
ATOM   1900 C CA    . ARG A  1 239 ? 8.854   17.425  -4.811  1.00 15.90  ? 684  ARG A CA    1 
ATOM   1901 C C     . ARG A  1 239 ? 7.604   16.494  -4.911  1.00 14.85  ? 684  ARG A C     1 
ATOM   1902 O O     . ARG A  1 239 ? 6.452   16.951  -5.024  1.00 14.65  ? 684  ARG A O     1 
ATOM   1903 C CB    . ARG A  1 239 ? 9.616   17.425  -6.172  1.00 18.62  ? 684  ARG A CB    1 
ATOM   1904 C CG    . ARG A  1 239 ? 8.704   17.728  -7.386  1.00 28.46  ? 684  ARG A CG    1 
ATOM   1905 C CD    . ARG A  1 239 ? 7.335   18.381  -6.971  1.00 33.83  ? 684  ARG A CD    1 
ATOM   1906 N NE    . ARG A  1 239 ? 7.126   19.756  -7.350  1.00 45.78  ? 684  ARG A NE    1 
ATOM   1907 C CZ    . ARG A  1 239 ? 6.608   20.715  -6.558  1.00 46.46  ? 684  ARG A CZ    1 
ATOM   1908 N NH1   . ARG A  1 239 ? 6.275   20.517  -5.243  1.00 38.92  ? 684  ARG A NH1   1 
ATOM   1909 N NH2   . ARG A  1 239 ? 6.480   21.906  -7.070  1.00 53.76  ? 684  ARG A NH2   1 
ATOM   1910 N N     . ARG A  1 240 ? 7.838   15.210  -4.737  1.00 15.90  ? 685  ARG A N     1 
ATOM   1911 C CA    . ARG A  1 240 ? 6.784   14.207  -4.787  1.00 17.11  ? 685  ARG A CA    1 
ATOM   1912 C C     . ARG A  1 240 ? 5.777   14.272  -3.678  1.00 17.21  ? 685  ARG A C     1 
ATOM   1913 O O     . ARG A  1 240 ? 4.545   14.258  -3.961  1.00 19.82  ? 685  ARG A O     1 
ATOM   1914 C CB    . ARG A  1 240 ? 7.412   12.814  -4.922  1.00 17.14  ? 685  ARG A CB    1 
ATOM   1915 C CG    . ARG A  1 240 ? 8.041   12.748  -6.291  1.00 20.98  ? 685  ARG A CG    1 
ATOM   1916 C CD    . ARG A  1 240 ? 8.348   11.415  -6.844  1.00 22.41  ? 685  ARG A CD    1 
ATOM   1917 N NE    . ARG A  1 240 ? 7.327   10.405  -6.634  1.00 21.39  ? 685  ARG A NE    1 
ATOM   1918 C CZ    . ARG A  1 240 ? 7.635   9.120   -6.544  1.00 19.96  ? 685  ARG A CZ    1 
ATOM   1919 N NH1   . ARG A  1 240 ? 8.877   8.772   -6.649  1.00 19.49  ? 685  ARG A NH1   1 
ATOM   1920 N NH2   . ARG A  1 240 ? 6.717   8.199   -6.314  1.00 19.05  ? 685  ARG A NH2   1 
ATOM   1921 N N     . VAL A  1 241 ? 6.231   14.390  -2.438  1.00 13.86  ? 686  VAL A N     1 
ATOM   1922 C CA    . VAL A  1 241 ? 5.301   14.411  -1.318  1.00 15.30  ? 686  VAL A CA    1 
ATOM   1923 C C     . VAL A  1 241 ? 4.595   15.716  -1.107  1.00 17.76  ? 686  VAL A C     1 
ATOM   1924 O O     . VAL A  1 241 ? 3.560   15.721  -0.475  1.00 19.10  ? 686  VAL A O     1 
ATOM   1925 C CB    . VAL A  1 241 ? 5.906   13.913  0.033   1.00 15.65  ? 686  VAL A CB    1 
ATOM   1926 C CG1   . VAL A  1 241 ? 6.369   12.449  -0.102  1.00 15.75  ? 686  VAL A CG1   1 
ATOM   1927 C CG2   . VAL A  1 241 ? 7.035   14.783  0.499   1.00 16.25  ? 686  VAL A CG2   1 
ATOM   1928 N N     . THR A  1 242 ? 5.142   16.821  -1.623  1.00 18.68  ? 687  THR A N     1 
ATOM   1929 C CA    . THR A  1 242 ? 4.431   18.119  -1.542  1.00 19.34  ? 687  THR A CA    1 
ATOM   1930 C C     . THR A  1 242 ? 3.468   18.302  -2.719  1.00 21.69  ? 687  THR A C     1 
ATOM   1931 O O     . THR A  1 242 ? 2.475   18.966  -2.581  1.00 29.06  ? 687  THR A O     1 
ATOM   1932 C CB    . THR A  1 242 ? 5.396   19.340  -1.472  1.00 18.05  ? 687  THR A CB    1 
ATOM   1933 O OG1   . THR A  1 242 ? 6.240   19.377  -2.611  1.00 16.64  ? 687  THR A OG1   1 
ATOM   1934 C CG2   . THR A  1 242 ? 6.222   19.316  -0.245  1.00 18.30  ? 687  THR A CG2   1 
ATOM   1935 N N     . ALA A  1 243 ? 3.754   17.705  -3.865  1.00 22.87  ? 688  ALA A N     1 
ATOM   1936 C CA    . ALA A  1 243 ? 2.856   17.752  -5.042  1.00 23.48  ? 688  ALA A CA    1 
ATOM   1937 C C     . ALA A  1 243 ? 1.597   16.888  -4.823  1.00 28.14  ? 688  ALA A C     1 
ATOM   1938 O O     . ALA A  1 243 ? 0.508   17.265  -5.214  1.00 30.33  ? 688  ALA A O     1 
ATOM   1939 C CB    . ALA A  1 243 ? 3.572   17.248  -6.262  1.00 23.24  ? 688  ALA A CB    1 
ATOM   1940 N N     . ALA A  1 244 ? 1.758   15.736  -4.190  1.00 24.12  ? 689  ALA A N     1 
ATOM   1941 C CA    . ALA A  1 244 ? 0.620   14.881  -3.867  1.00 23.04  ? 689  ALA A CA    1 
ATOM   1942 C C     . ALA A  1 244 ? 0.897   14.157  -2.565  1.00 21.45  ? 689  ALA A C     1 
ATOM   1943 O O     . ALA A  1 244 ? 1.843   13.373  -2.494  1.00 21.96  ? 689  ALA A O     1 
ATOM   1944 C CB    . ALA A  1 244 ? 0.417   13.861  -4.987  1.00 22.59  ? 689  ALA A CB    1 
ATOM   1945 N N     . ALA A  1 245 ? 0.002   14.302  -1.598  1.00 20.75  ? 690  ALA A N     1 
ATOM   1946 C CA    . ALA A  1 245 ? 0.204   13.740  -0.268  1.00 18.99  ? 690  ALA A CA    1 
ATOM   1947 C C     . ALA A  1 245 ? 0.214   12.207  -0.302  1.00 20.04  ? 690  ALA A C     1 
ATOM   1948 O O     . ALA A  1 245 ? -0.674  11.572  -0.905  1.00 17.90  ? 690  ALA A O     1 
ATOM   1949 C CB    . ALA A  1 245 ? -0.865  14.239  0.666   1.00 20.44  ? 690  ALA A CB    1 
ATOM   1950 N N     . PRO A  1 246 ? 1.217   11.604  0.307   1.00 17.75  ? 691  PRO A N     1 
ATOM   1951 C CA    . PRO A  1 246 ? 1.242   10.161  0.452   1.00 18.68  ? 691  PRO A CA    1 
ATOM   1952 C C     . PRO A  1 246 ? 0.184   9.654   1.435   1.00 15.57  ? 691  PRO A C     1 
ATOM   1953 O O     . PRO A  1 246 ? -0.278  10.413  2.292   1.00 16.23  ? 691  PRO A O     1 
ATOM   1954 C CB    . PRO A  1 246 ? 2.670   9.888   0.929   1.00 19.65  ? 691  PRO A CB    1 
ATOM   1955 C CG    . PRO A  1 246 ? 3.051   11.107  1.675   1.00 20.20  ? 691  PRO A CG    1 
ATOM   1956 C CD    . PRO A  1 246 ? 2.309   12.260  1.058   1.00 20.13  ? 691  PRO A CD    1 
ATOM   1957 N N     . THR A  1 247 ? -0.344  8.454   1.201   1.00 14.64  ? 692  THR A N     1 
ATOM   1958 C CA    . THR A  1 247 ? -1.509  7.964   1.946   1.00 14.70  ? 692  THR A CA    1 
ATOM   1959 C C     . THR A  1 247 ? -1.246  6.853   2.964   1.00 15.70  ? 692  THR A C     1 
ATOM   1960 O O     . THR A  1 247 ? -2.162  6.451   3.665   1.00 15.76  ? 692  THR A O     1 
ATOM   1961 C CB    . THR A  1 247 ? -2.642  7.442   0.979   1.00 17.22  ? 692  THR A CB    1 
ATOM   1962 O OG1   . THR A  1 247 ? -2.111  6.403   0.164   1.00 16.41  ? 692  THR A OG1   1 
ATOM   1963 C CG2   . THR A  1 247 ? -3.149  8.547   0.069   1.00 18.74  ? 692  THR A CG2   1 
ATOM   1964 N N     . GLY A  1 248 ? -0.039  6.319   3.025   1.00 14.69  ? 693  GLY A N     1 
ATOM   1965 C CA    . GLY A  1 248 ? 0.219   5.175   3.888   1.00 14.60  ? 693  GLY A CA    1 
ATOM   1966 C C     . GLY A  1 248 ? 0.757   5.506   5.275   1.00 13.33  ? 693  GLY A C     1 
ATOM   1967 O O     . GLY A  1 248 ? 0.912   6.686   5.641   1.00 12.63  ? 693  GLY A O     1 
ATOM   1968 N N     . LEU A  1 249 ? 1.149   4.444   5.986   1.00 12.48  ? 694  LEU A N     1 
ATOM   1969 C CA    . LEU A  1 249 ? 1.681   4.500   7.347   1.00 11.96  ? 694  LEU A CA    1 
ATOM   1970 C C     . LEU A  1 249 ? 3.079   3.837   7.404   1.00 11.40  ? 694  LEU A C     1 
ATOM   1971 O O     . LEU A  1 249 ? 3.465   3.049   6.518   1.00 11.44  ? 694  LEU A O     1 
ATOM   1972 C CB    . LEU A  1 249 ? 0.772   3.795   8.350   1.00 12.50  ? 694  LEU A CB    1 
ATOM   1973 C CG    . LEU A  1 249 ? -0.717  4.263   8.440   1.00 13.13  ? 694  LEU A CG    1 
ATOM   1974 C CD1   . LEU A  1 249 ? -1.402  3.584   9.648   1.00 12.81  ? 694  LEU A CD1   1 
ATOM   1975 C CD2   . LEU A  1 249 ? -0.848  5.756   8.575   1.00 12.31  ? 694  LEU A CD2   1 
ATOM   1976 N N     . VAL A  1 250 ? 3.812   4.177   8.446   1.00 10.98  ? 695  VAL A N     1 
ATOM   1977 C CA    . VAL A  1 250 ? 5.159   3.649   8.699   1.00 11.50  ? 695  VAL A CA    1 
ATOM   1978 C C     . VAL A  1 250 ? 5.260   3.347   10.177  1.00 11.47  ? 695  VAL A C     1 
ATOM   1979 O O     . VAL A  1 250 ? 4.870   4.162   10.994  1.00 13.22  ? 695  VAL A O     1 
ATOM   1980 C CB    . VAL A  1 250 ? 6.277   4.618   8.305   1.00 11.32  ? 695  VAL A CB    1 
ATOM   1981 C CG1   . VAL A  1 250 ? 7.628   3.934   8.435   1.00 12.11  ? 695  VAL A CG1   1 
ATOM   1982 C CG2   . VAL A  1 250 ? 6.109   5.068   6.869   1.00 12.30  ? 695  VAL A CG2   1 
ATOM   1983 N N     . THR A  1 251 ? 5.822   2.202   10.523  1.00 11.18  ? 696  THR A N     1 
ATOM   1984 C CA    . THR A  1 251 ? 6.008   1.819   11.950  1.00 11.15  ? 696  THR A CA    1 
ATOM   1985 C C     . THR A  1 251 ? 7.502   1.761   12.247  1.00 11.03  ? 696  THR A C     1 
ATOM   1986 O O     . THR A  1 251 ? 8.316   1.239   11.421  1.00 11.15  ? 696  THR A O     1 
ATOM   1987 C CB    . THR A  1 251 ? 5.412   0.431   12.253  1.00 12.06  ? 696  THR A CB    1 
ATOM   1988 O OG1   . THR A  1 251 ? 3.995   0.427   12.006  1.00 12.32  ? 696  THR A OG1   1 
ATOM   1989 C CG2   . THR A  1 251 ? 5.686   0.004   13.731  1.00 11.93  ? 696  THR A CG2   1 
ATOM   1990 N N     . PHE A  1 252 ? 7.869   2.327   13.376  1.00 13.01  ? 697  PHE A N     1 
ATOM   1991 C CA    . PHE A  1 252 ? 9.228   2.318   13.893  1.00 12.45  ? 697  PHE A CA    1 
ATOM   1992 C C     . PHE A  1 252 ? 9.217   1.580   15.223  1.00 13.87  ? 697  PHE A C     1 
ATOM   1993 O O     . PHE A  1 252 ? 8.514   2.015   16.184  1.00 14.10  ? 697  PHE A O     1 
ATOM   1994 C CB    . PHE A  1 252 ? 9.762   3.751   14.131  1.00 12.22  ? 697  PHE A CB    1 
ATOM   1995 C CG    . PHE A  1 252 ? 9.766   4.637   12.896  1.00 12.93  ? 697  PHE A CG    1 
ATOM   1996 C CD1   . PHE A  1 252 ? 8.628   5.274   12.475  1.00 13.29  ? 697  PHE A CD1   1 
ATOM   1997 C CD2   . PHE A  1 252 ? 10.938  4.835   12.164  1.00 11.93  ? 697  PHE A CD2   1 
ATOM   1998 C CE1   . PHE A  1 252 ? 8.642   6.037   11.293  1.00 12.16  ? 697  PHE A CE1   1 
ATOM   1999 C CE2   . PHE A  1 252 ? 10.936  5.626   11.046  1.00 12.16  ? 697  PHE A CE2   1 
ATOM   2000 C CZ    . PHE A  1 252 ? 9.781   6.200   10.617  1.00 11.53  ? 697  PHE A CZ    1 
ATOM   2001 N N     . THR A  1 253 ? 10.029  0.525   15.340  1.00 12.94  ? 698  THR A N     1 
ATOM   2002 C CA    . THR A  1 253 ? 10.037  -0.310  16.561  1.00 13.93  ? 698  THR A CA    1 
ATOM   2003 C C     . THR A  1 253 ? 11.425  -0.474  17.126  1.00 14.78  ? 698  THR A C     1 
ATOM   2004 O O     . THR A  1 253 ? 12.304  -0.971  16.436  1.00 13.99  ? 698  THR A O     1 
ATOM   2005 C CB    . THR A  1 253 ? 9.476   -1.703  16.287  1.00 14.60  ? 698  THR A CB    1 
ATOM   2006 O OG1   . THR A  1 253 ? 8.099   -1.608  15.944  1.00 15.60  ? 698  THR A OG1   1 
ATOM   2007 C CG2   . THR A  1 253 ? 9.647   -2.671  17.536  1.00 15.32  ? 698  THR A CG2   1 
ATOM   2008 N N     . ARG A  1 254 ? 11.635  -0.060  18.404  1.00 13.72  ? 699  ARG A N     1 
ATOM   2009 C CA    . ARG A  1 254 ? 12.887  -0.379  19.116  1.00 14.14  ? 699  ARG A CA    1 
ATOM   2010 C C     . ARG A  1 254 ? 12.721  -1.722  19.828  1.00 14.55  ? 699  ARG A C     1 
ATOM   2011 O O     . ARG A  1 254 ? 11.706  -1.979  20.494  1.00 14.90  ? 699  ARG A O     1 
ATOM   2012 C CB    . ARG A  1 254 ? 13.240  0.683   20.137  1.00 15.11  ? 699  ARG A CB    1 
ATOM   2013 C CG    . ARG A  1 254 ? 14.696  0.678   20.611  1.00 15.67  ? 699  ARG A CG    1 
ATOM   2014 C CD    . ARG A  1 254 ? 14.922  1.647   21.767  1.00 14.75  ? 699  ARG A CD    1 
ATOM   2015 N NE    . ARG A  1 254 ? 16.333  1.688   22.094  1.00 13.39  ? 699  ARG A NE    1 
ATOM   2016 C CZ    . ARG A  1 254 ? 17.184  2.554   21.563  1.00 15.25  ? 699  ARG A CZ    1 
ATOM   2017 N NH1   . ARG A  1 254 ? 16.757  3.464   20.735  1.00 14.54  ? 699  ARG A NH1   1 
ATOM   2018 N NH2   . ARG A  1 254 ? 18.477  2.509   21.853  1.00 16.27  ? 699  ARG A NH2   1 
ATOM   2019 N N     . GLN A  1 255 ? 13.684  -2.588  19.625  1.00 14.62  ? 700  GLN A N     1 
ATOM   2020 C CA    . GLN A  1 255 ? 13.680  -3.910  20.239  1.00 14.71  ? 700  GLN A CA    1 
ATOM   2021 C C     . GLN A  1 255 ? 14.975  -4.089  21.027  1.00 17.20  ? 700  GLN A C     1 
ATOM   2022 O O     . GLN A  1 255 ? 16.101  -3.914  20.466  1.00 15.06  ? 700  GLN A O     1 
ATOM   2023 C CB    . GLN A  1 255 ? 13.584  -5.006  19.193  1.00 16.54  ? 700  GLN A CB    1 
ATOM   2024 C CG    . GLN A  1 255 ? 13.699  -6.447  19.756  1.00 16.59  ? 700  GLN A CG    1 
ATOM   2025 C CD    . GLN A  1 255 ? 13.093  -7.486  18.799  1.00 19.27  ? 700  GLN A CD    1 
ATOM   2026 O OE1   . GLN A  1 255 ? 11.903  -7.635  18.750  1.00 19.53  ? 700  GLN A OE1   1 
ATOM   2027 N NE2   . GLN A  1 255 ? 13.951  -8.207  18.028  1.00 17.81  ? 700  GLN A NE2   1 
ATOM   2028 N N     . SER A  1 256 ? 14.808  -4.494  22.302  1.00 18.74  ? 701  SER A N     1 
ATOM   2029 C CA    . SER A  1 256 ? 15.904  -4.573  23.303  1.00 22.23  ? 701  SER A CA    1 
ATOM   2030 C C     . SER A  1 256 ? 15.729  -5.909  23.998  1.00 25.08  ? 701  SER A C     1 
ATOM   2031 O O     . SER A  1 256 ? 14.694  -6.141  24.618  1.00 26.07  ? 701  SER A O     1 
ATOM   2032 C CB    . SER A  1 256 ? 15.733  -3.425  24.318  1.00 28.85  ? 701  SER A CB    1 
ATOM   2033 O OG    . SER A  1 256 ? 16.859  -3.267  25.154  1.00 31.89  ? 701  SER A OG    1 
ATOM   2034 N N     . LEU A  1 257 ? 16.647  -6.853  23.794  1.00 24.90  ? 702  LEU A N     1 
ATOM   2035 C CA    . LEU A  1 257 ? 16.458  -8.187  24.340  1.00 26.04  ? 702  LEU A CA    1 
ATOM   2036 C C     . LEU A  1 257 ? 17.310  -8.358  25.588  1.00 28.37  ? 702  LEU A C     1 
ATOM   2037 O O     . LEU A  1 257 ? 18.417  -7.792  25.692  1.00 27.13  ? 702  LEU A O     1 
ATOM   2038 C CB    . LEU A  1 257 ? 16.815  -9.287  23.329  1.00 26.07  ? 702  LEU A CB    1 
ATOM   2039 C CG    . LEU A  1 257 ? 16.074  -9.315  21.989  1.00 26.22  ? 702  LEU A CG    1 
ATOM   2040 C CD1   . LEU A  1 257 ? 16.577  -10.510 21.143  1.00 27.49  ? 702  LEU A CD1   1 
ATOM   2041 C CD2   . LEU A  1 257 ? 14.587  -9.420  22.174  1.00 26.91  ? 702  LEU A CD2   1 
ATOM   2042 N N     . GLU A  1 258 ? 16.808  -9.198  26.486  1.00 28.66  ? 703  GLU A N     1 
ATOM   2043 C CA    . GLU A  1 258 ? 17.453  -9.495  27.765  1.00 34.89  ? 703  GLU A CA    1 
ATOM   2044 C C     . GLU A  1 258 ? 18.205  -10.803 27.673  1.00 31.33  ? 703  GLU A C     1 
ATOM   2045 O O     . GLU A  1 258 ? 19.376  -10.885 28.052  1.00 31.53  ? 703  GLU A O     1 
ATOM   2046 C CB    . GLU A  1 258 ? 16.360  -9.662  28.826  1.00 41.14  ? 703  GLU A CB    1 
ATOM   2047 C CG    . GLU A  1 258 ? 16.884  -9.816  30.249  1.00 47.76  ? 703  GLU A CG    1 
ATOM   2048 C CD    . GLU A  1 258 ? 17.039  -8.472  30.929  1.00 49.76  ? 703  GLU A CD    1 
ATOM   2049 O OE1   . GLU A  1 258 ? 16.052  -7.677  30.901  1.00 43.98  ? 703  GLU A OE1   1 
ATOM   2050 O OE2   . GLU A  1 258 ? 18.143  -8.201  31.451  1.00 42.30  ? 703  GLU A OE2   1 
ATOM   2051 N N     . ASP A  1 259 ? 17.521  -11.828 27.159  1.00 29.16  ? 704  ASP A N     1 
ATOM   2052 C CA    . ASP A  1 259 ? 18.042  -13.185 27.158  1.00 35.05  ? 704  ASP A CA    1 
ATOM   2053 C C     . ASP A  1 259 ? 18.599  -13.569 25.781  1.00 32.15  ? 704  ASP A C     1 
ATOM   2054 O O     . ASP A  1 259 ? 17.862  -13.549 24.757  1.00 35.82  ? 704  ASP A O     1 
ATOM   2055 C CB    . ASP A  1 259 ? 16.951  -14.162 27.540  1.00 36.53  ? 704  ASP A CB    1 
ATOM   2056 C CG    . ASP A  1 259 ? 16.501  -14.017 29.008  1.00 41.35  ? 704  ASP A CG    1 
ATOM   2057 O OD1   . ASP A  1 259 ? 17.342  -13.717 29.922  1.00 44.13  ? 704  ASP A OD1   1 
ATOM   2058 O OD2   . ASP A  1 259 ? 15.300  -14.233 29.241  1.00 46.61  ? 704  ASP A OD2   1 
ATOM   2059 N N     . PHE A  1 260 ? 19.883  -13.898 25.760  1.00 26.94  ? 705  PHE A N     1 
ATOM   2060 C CA    . PHE A  1 260 ? 20.596  -14.320 24.531  1.00 27.75  ? 705  PHE A CA    1 
ATOM   2061 C C     . PHE A  1 260 ? 21.011  -15.795 24.632  1.00 30.36  ? 705  PHE A C     1 
ATOM   2062 O O     . PHE A  1 260 ? 21.049  -16.337 25.710  1.00 25.92  ? 705  PHE A O     1 
ATOM   2063 C CB    . PHE A  1 260 ? 21.805  -13.425 24.310  1.00 24.77  ? 705  PHE A CB    1 
ATOM   2064 C CG    . PHE A  1 260 ? 21.428  -12.028 23.864  1.00 25.79  ? 705  PHE A CG    1 
ATOM   2065 C CD1   . PHE A  1 260 ? 21.065  -11.788 22.535  1.00 26.19  ? 705  PHE A CD1   1 
ATOM   2066 C CD2   . PHE A  1 260 ? 21.328  -10.985 24.782  1.00 27.33  ? 705  PHE A CD2   1 
ATOM   2067 C CE1   . PHE A  1 260 ? 20.651  -10.523 22.121  1.00 24.24  ? 705  PHE A CE1   1 
ATOM   2068 C CE2   . PHE A  1 260 ? 20.902  -9.706  24.374  1.00 28.29  ? 705  PHE A CE2   1 
ATOM   2069 C CZ    . PHE A  1 260 ? 20.595  -9.474  23.023  1.00 23.73  ? 705  PHE A CZ    1 
ATOM   2070 N N     . PRO A  1 261 ? 21.261  -16.448 23.495  1.00 25.88  ? 706  PRO A N     1 
ATOM   2071 C CA    . PRO A  1 261 ? 21.567  -17.876 23.589  1.00 26.93  ? 706  PRO A CA    1 
ATOM   2072 C C     . PRO A  1 261 ? 22.858  -18.115 24.288  1.00 26.89  ? 706  PRO A C     1 
ATOM   2073 O O     . PRO A  1 261 ? 23.756  -17.248 24.287  1.00 24.60  ? 706  PRO A O     1 
ATOM   2074 C CB    . PRO A  1 261 ? 21.696  -18.309 22.135  1.00 28.03  ? 706  PRO A CB    1 
ATOM   2075 C CG    . PRO A  1 261 ? 20.867  -17.319 21.372  1.00 27.39  ? 706  PRO A CG    1 
ATOM   2076 C CD    . PRO A  1 261 ? 21.029  -16.018 22.104  1.00 26.59  ? 706  PRO A CD    1 
ATOM   2077 N N     . GLU A  1 262 ? 22.982  -19.301 24.886  1.00 28.24  ? 707  GLU A N     1 
ATOM   2078 C CA    . GLU A  1 262 ? 24.287  -19.840 25.249  1.00 27.89  ? 707  GLU A CA    1 
ATOM   2079 C C     . GLU A  1 262 ? 24.783  -20.563 24.043  1.00 22.76  ? 707  GLU A C     1 
ATOM   2080 O O     . GLU A  1 262 ? 24.409  -21.711 23.812  1.00 20.36  ? 707  GLU A O     1 
ATOM   2081 C CB    . GLU A  1 262 ? 24.162  -20.836 26.398  1.00 34.41  ? 707  GLU A CB    1 
ATOM   2082 C CG    . GLU A  1 262 ? 23.794  -20.201 27.713  1.00 44.73  ? 707  GLU A CG    1 
ATOM   2083 C CD    . GLU A  1 262 ? 23.754  -21.222 28.813  1.00 55.07  ? 707  GLU A CD    1 
ATOM   2084 O OE1   . GLU A  1 262 ? 24.855  -21.599 29.294  1.00 59.52  ? 707  GLU A OE1   1 
ATOM   2085 O OE2   . GLU A  1 262 ? 22.634  -21.699 29.125  1.00 51.97  ? 707  GLU A OE2   1 
ATOM   2086 N N     . TRP A  1 263 ? 25.621  -19.901 23.268  1.00 22.31  ? 708  TRP A N     1 
ATOM   2087 C CA    . TRP A  1 263 ? 25.818  -20.296 21.872  1.00 21.46  ? 708  TRP A CA    1 
ATOM   2088 C C     . TRP A  1 263 ? 26.469  -21.687 21.772  1.00 20.55  ? 708  TRP A C     1 
ATOM   2089 O O     . TRP A  1 263 ? 26.142  -22.476 20.907  1.00 19.44  ? 708  TRP A O     1 
ATOM   2090 C CB    . TRP A  1 263 ? 26.670  -19.230 21.138  1.00 19.45  ? 708  TRP A CB    1 
ATOM   2091 C CG    . TRP A  1 263 ? 25.890  -17.938 20.893  1.00 19.08  ? 708  TRP A CG    1 
ATOM   2092 C CD1   . TRP A  1 263 ? 25.916  -16.811 21.653  1.00 18.37  ? 708  TRP A CD1   1 
ATOM   2093 C CD2   . TRP A  1 263 ? 24.945  -17.696 19.852  1.00 17.59  ? 708  TRP A CD2   1 
ATOM   2094 N NE1   . TRP A  1 263 ? 25.030  -15.880 21.143  1.00 19.84  ? 708  TRP A NE1   1 
ATOM   2095 C CE2   . TRP A  1 263 ? 24.434  -16.410 20.035  1.00 18.40  ? 708  TRP A CE2   1 
ATOM   2096 C CE3   . TRP A  1 263 ? 24.517  -18.422 18.766  1.00 18.35  ? 708  TRP A CE3   1 
ATOM   2097 C CZ2   . TRP A  1 263 ? 23.496  -15.851 19.172  1.00 19.21  ? 708  TRP A CZ2   1 
ATOM   2098 C CZ3   . TRP A  1 263 ? 23.584  -17.855 17.900  1.00 18.85  ? 708  TRP A CZ3   1 
ATOM   2099 C CH2   . TRP A  1 263 ? 23.079  -16.615 18.119  1.00 18.36  ? 708  TRP A CH2   1 
ATOM   2100 N N     . GLU A  1 264 ? 27.429  -21.929 22.642  1.00 22.24  ? 709  GLU A N     1 
ATOM   2101 C CA    A GLU A  1 264 ? 28.152  -23.194 22.678  0.50 24.13  ? 709  GLU A CA    1 
ATOM   2102 C CA    B GLU A  1 264 ? 28.154  -23.207 22.663  0.50 25.60  ? 709  GLU A CA    1 
ATOM   2103 C C     . GLU A  1 264 ? 27.199  -24.373 22.890  1.00 24.54  ? 709  GLU A C     1 
ATOM   2104 O O     . GLU A  1 264 ? 27.471  -25.493 22.461  1.00 27.62  ? 709  GLU A O     1 
ATOM   2105 C CB    A GLU A  1 264 ? 29.199  -23.143 23.794  0.50 24.50  ? 709  GLU A CB    1 
ATOM   2106 C CB    B GLU A  1 264 ? 29.275  -23.196 23.734  0.50 28.33  ? 709  GLU A CB    1 
ATOM   2107 C CG    A GLU A  1 264 ? 28.597  -23.085 25.191  0.50 25.41  ? 709  GLU A CG    1 
ATOM   2108 C CG    B GLU A  1 264 ? 29.942  -24.559 23.931  0.50 32.90  ? 709  GLU A CG    1 
ATOM   2109 C CD    A GLU A  1 264 ? 28.564  -21.696 25.807  0.50 27.34  ? 709  GLU A CD    1 
ATOM   2110 C CD    B GLU A  1 264 ? 31.162  -24.538 24.856  0.50 35.58  ? 709  GLU A CD    1 
ATOM   2111 O OE1   A GLU A  1 264 ? 28.304  -20.668 25.101  0.50 23.70  ? 709  GLU A OE1   1 
ATOM   2112 O OE1   B GLU A  1 264 ? 32.053  -23.682 24.680  0.50 36.00  ? 709  GLU A OE1   1 
ATOM   2113 O OE2   A GLU A  1 264 ? 28.806  -21.638 27.039  0.50 30.30  ? 709  GLU A OE2   1 
ATOM   2114 O OE2   B GLU A  1 264 ? 31.233  -25.420 25.755  0.50 41.13  ? 709  GLU A OE2   1 
ATOM   2115 N N     . ARG A  1 265 ? 26.061  -24.125 23.547  1.00 24.07  ? 710  ARG A N     1 
ATOM   2116 C CA    . ARG A  1 265 ? 25.136  -25.217 23.841  1.00 29.10  ? 710  ARG A CA    1 
ATOM   2117 C C     . ARG A  1 265 ? 24.018  -25.328 22.814  1.00 26.99  ? 710  ARG A C     1 
ATOM   2118 O O     . ARG A  1 265 ? 23.145  -26.195 22.946  1.00 26.89  ? 710  ARG A O     1 
ATOM   2119 C CB    . ARG A  1 265 ? 24.524  -25.067 25.251  1.00 33.49  ? 710  ARG A CB    1 
ATOM   2120 C CG    . ARG A  1 265 ? 25.519  -25.254 26.393  1.00 39.17  ? 710  ARG A CG    1 
ATOM   2121 C CD    . ARG A  1 265 ? 24.908  -24.824 27.726  1.00 45.85  ? 710  ARG A CD    1 
ATOM   2122 N NE    . ARG A  1 265 ? 24.432  -25.947 28.530  1.00 58.83  ? 710  ARG A NE    1 
ATOM   2123 C CZ    . ARG A  1 265 ? 23.440  -25.886 29.439  1.00 71.03  ? 710  ARG A CZ    1 
ATOM   2124 N NH1   . ARG A  1 265 ? 22.756  -24.753 29.640  1.00 71.76  ? 710  ARG A NH1   1 
ATOM   2125 N NH2   . ARG A  1 265 ? 23.111  -26.978 30.141  1.00 69.04  ? 710  ARG A NH2   1 
ATOM   2126 N N     . CYS A  1 266 ? 24.016  -24.475 21.779  1.00 23.59  ? 711  CYS A N     1 
ATOM   2127 C CA    . CYS A  1 266 ? 22.852  -24.426 20.895  1.00 19.93  ? 711  CYS A CA    1 
ATOM   2128 C C     . CYS A  1 266 ? 22.821  -25.616 19.921  1.00 20.56  ? 711  CYS A C     1 
ATOM   2129 O O     . CYS A  1 266 ? 23.761  -25.840 19.153  1.00 22.43  ? 711  CYS A O     1 
ATOM   2130 C CB    . CYS A  1 266 ? 22.746  -23.056 20.179  1.00 23.04  ? 711  CYS A CB    1 
ATOM   2131 S SG    . CYS A  1 266 ? 21.389  -22.938 18.990  1.00 26.02  ? 711  CYS A SG    1 
ATOM   2132 N N     . GLU A  1 267 ? 21.730  -26.389 19.968  1.00 19.77  ? 712  GLU A N     1 
ATOM   2133 C CA    . GLU A  1 267 ? 21.558  -27.609 19.166  1.00 21.62  ? 712  GLU A CA    1 
ATOM   2134 C C     . GLU A  1 267 ? 20.768  -27.421 17.864  1.00 22.06  ? 712  GLU A C     1 
ATOM   2135 O O     . GLU A  1 267 ? 20.532  -28.381 17.129  1.00 23.34  ? 712  GLU A O     1 
ATOM   2136 C CB    . GLU A  1 267 ? 20.852  -28.702 20.039  1.00 27.65  ? 712  GLU A CB    1 
ATOM   2137 C CG    . GLU A  1 267 ? 21.697  -29.081 21.260  1.00 34.15  ? 712  GLU A CG    1 
ATOM   2138 C CD    . GLU A  1 267 ? 21.010  -30.075 22.227  1.00 47.01  ? 712  GLU A CD    1 
ATOM   2139 O OE1   . GLU A  1 267 ? 20.068  -30.805 21.796  1.00 42.73  ? 712  GLU A OE1   1 
ATOM   2140 O OE2   . GLU A  1 267 ? 21.457  -30.151 23.405  1.00 46.82  ? 712  GLU A OE2   1 
ATOM   2141 N N     . LYS A  1 268 ? 20.373  -26.205 17.558  1.00 22.99  ? 713  LYS A N     1 
ATOM   2142 C CA    . LYS A  1 268 ? 19.705  -25.940 16.244  1.00 25.21  ? 713  LYS A CA    1 
ATOM   2143 C C     . LYS A  1 268 ? 20.616  -26.228 15.070  1.00 21.23  ? 713  LYS A C     1 
ATOM   2144 O O     . LYS A  1 268 ? 21.792  -25.983 15.131  1.00 20.85  ? 713  LYS A O     1 
ATOM   2145 C CB    . LYS A  1 268 ? 19.162  -24.506 16.189  1.00 25.06  ? 713  LYS A CB    1 
ATOM   2146 C CG    . LYS A  1 268 ? 17.983  -24.370 17.126  1.00 28.14  ? 713  LYS A CG    1 
ATOM   2147 C CD    . LYS A  1 268 ? 17.352  -23.032 17.138  1.00 29.88  ? 713  LYS A CD    1 
ATOM   2148 C CE    . LYS A  1 268 ? 16.199  -23.063 18.095  1.00 34.14  ? 713  LYS A CE    1 
ATOM   2149 N NZ    . LYS A  1 268 ? 15.350  -21.852 17.935  1.00 39.26  ? 713  LYS A NZ    1 
ATOM   2150 N N     . PRO A  1 269 ? 20.073  -26.820 14.038  1.00 21.82  ? 714  PRO A N     1 
ATOM   2151 C CA    . PRO A  1 269 ? 20.747  -27.019 12.772  1.00 20.96  ? 714  PRO A CA    1 
ATOM   2152 C C     . PRO A  1 269 ? 20.815  -25.679 11.955  1.00 19.67  ? 714  PRO A C     1 
ATOM   2153 O O     . PRO A  1 269 ? 20.094  -24.754 12.266  1.00 18.83  ? 714  PRO A O     1 
ATOM   2154 C CB    . PRO A  1 269 ? 19.850  -28.042 12.073  1.00 24.19  ? 714  PRO A CB    1 
ATOM   2155 C CG    . PRO A  1 269 ? 18.477  -27.701 12.573  1.00 25.83  ? 714  PRO A CG    1 
ATOM   2156 C CD    . PRO A  1 269 ? 18.666  -27.277 14.007  1.00 23.86  ? 714  PRO A CD    1 
ATOM   2157 N N     . LEU A  1 270 ? 21.713  -25.594 10.976  1.00 17.88  ? 715  LEU A N     1 
ATOM   2158 C CA    . LEU A  1 270 ? 21.757  -24.422 10.061  1.00 19.04  ? 715  LEU A CA    1 
ATOM   2159 C C     . LEU A  1 270 ? 20.498  -24.405 9.173   1.00 18.66  ? 715  LEU A C     1 
ATOM   2160 O O     . LEU A  1 270 ? 19.846  -25.451 8.974   1.00 17.66  ? 715  LEU A O     1 
ATOM   2161 C CB    . LEU A  1 270 ? 23.000  -24.459 9.194   1.00 21.30  ? 715  LEU A CB    1 
ATOM   2162 C CG    . LEU A  1 270 ? 24.343  -24.427 9.933   1.00 23.39  ? 715  LEU A CG    1 
ATOM   2163 C CD1   . LEU A  1 270 ? 25.512  -24.218 8.985   1.00 27.19  ? 715  LEU A CD1   1 
ATOM   2164 C CD2   . LEU A  1 270 ? 24.353  -23.370 10.955  1.00 23.84  ? 715  LEU A CD2   1 
ATOM   2165 N N     . THR A  1 271 ? 20.125  -23.223 8.672   1.00 15.81  ? 716  THR A N     1 
ATOM   2166 C CA    . THR A  1 271 ? 18.947  -23.108 7.805   1.00 14.98  ? 716  THR A CA    1 
ATOM   2167 C C     . THR A  1 271 ? 19.439  -23.017 6.349   1.00 15.57  ? 716  THR A C     1 
ATOM   2168 O O     . THR A  1 271 ? 20.617  -23.292 6.081   1.00 17.00  ? 716  THR A O     1 
ATOM   2169 C CB    . THR A  1 271 ? 18.117  -21.901 8.251   1.00 15.34  ? 716  THR A CB    1 
ATOM   2170 O OG1   . THR A  1 271 ? 18.940  -20.702 8.259   1.00 14.81  ? 716  THR A OG1   1 
ATOM   2171 C CG2   . THR A  1 271 ? 17.551  -22.164 9.672   1.00 14.89  ? 716  THR A CG2   1 
ATOM   2172 N N     . ARG A  1 272 ? 18.571  -22.646 5.408   1.00 14.42  ? 717  ARG A N     1 
ATOM   2173 C CA    . ARG A  1 272 ? 18.940  -22.596 3.999   1.00 14.39  ? 717  ARG A CA    1 
ATOM   2174 C C     . ARG A  1 272 ? 19.667  -21.264 3.634   1.00 13.83  ? 717  ARG A C     1 
ATOM   2175 O O     . ARG A  1 272 ? 19.463  -20.203 4.307   1.00 13.50  ? 717  ARG A O     1 
ATOM   2176 C CB    . ARG A  1 272 ? 17.721  -22.811 3.124   1.00 15.16  ? 717  ARG A CB    1 
ATOM   2177 C CG    . ARG A  1 272 ? 17.067  -24.137 3.373   1.00 18.35  ? 717  ARG A CG    1 
ATOM   2178 C CD    . ARG A  1 272 ? 15.777  -24.325 2.588   1.00 20.53  ? 717  ARG A CD    1 
ATOM   2179 N NE    . ARG A  1 272 ? 14.771  -23.374 2.988   1.00 21.56  ? 717  ARG A NE    1 
ATOM   2180 C CZ    . ARG A  1 272 ? 13.639  -23.158 2.332   1.00 27.11  ? 717  ARG A CZ    1 
ATOM   2181 N NH1   . ARG A  1 272 ? 13.358  -23.852 1.228   1.00 30.34  ? 717  ARG A NH1   1 
ATOM   2182 N NH2   . ARG A  1 272 ? 12.800  -22.250 2.771   1.00 25.14  ? 717  ARG A NH2   1 
ATOM   2183 N N     . LEU A  1 273 ? 20.507  -21.355 2.599   1.00 14.10  ? 718  LEU A N     1 
ATOM   2184 C CA    . LEU A  1 273 ? 21.290  -20.247 2.031   1.00 13.65  ? 718  LEU A CA    1 
ATOM   2185 C C     . LEU A  1 273 ? 21.115  -20.173 0.512   1.00 14.05  ? 718  LEU A C     1 
ATOM   2186 O O     . LEU A  1 273 ? 21.272  -21.187 -0.210  1.00 14.03  ? 718  LEU A O     1 
ATOM   2187 C CB    . LEU A  1 273 ? 22.785  -20.453 2.292   1.00 15.11  ? 718  LEU A CB    1 
ATOM   2188 C CG    . LEU A  1 273 ? 23.699  -19.393 1.678   1.00 16.42  ? 718  LEU A CG    1 
ATOM   2189 C CD1   . LEU A  1 273 ? 23.535  -18.057 2.427   1.00 15.81  ? 718  LEU A CD1   1 
ATOM   2190 C CD2   . LEU A  1 273 ? 25.170  -19.825 1.720   1.00 17.35  ? 718  LEU A CD2   1 
ATOM   2191 N N     . HIS A  1 274 ? 20.804  -18.980 0.021   1.00 12.02  ? 719  HIS A N     1 
ATOM   2192 C CA    . HIS A  1 274 ? 21.019  -18.560 -1.380  1.00 12.12  ? 719  HIS A CA    1 
ATOM   2193 C C     . HIS A  1 274 ? 22.060  -17.485 -1.391  1.00 12.32  ? 719  HIS A C     1 
ATOM   2194 O O     . HIS A  1 274 ? 21.924  -16.500 -0.671  1.00 11.78  ? 719  HIS A O     1 
ATOM   2195 C CB    . HIS A  1 274 ? 19.706  -17.965 -1.920  1.00 13.31  ? 719  HIS A CB    1 
ATOM   2196 C CG    . HIS A  1 274 ? 19.809  -17.441 -3.295  1.00 14.12  ? 719  HIS A CG    1 
ATOM   2197 N ND1   . HIS A  1 274 ? 19.510  -18.199 -4.394  1.00 14.29  ? 719  HIS A ND1   1 
ATOM   2198 C CD2   . HIS A  1 274 ? 20.137  -16.204 -3.762  1.00 14.59  ? 719  HIS A CD2   1 
ATOM   2199 C CE1   . HIS A  1 274 ? 19.727  -17.482 -5.495  1.00 14.83  ? 719  HIS A CE1   1 
ATOM   2200 N NE2   . HIS A  1 274 ? 20.065  -16.258 -5.136  1.00 14.55  ? 719  HIS A NE2   1 
ATOM   2201 N N     . VAL A  1 275 ? 23.148  -17.647 -2.166  1.00 11.91  ? 720  VAL A N     1 
ATOM   2202 C CA    . VAL A  1 275 ? 24.196  -16.647 -2.174  1.00 12.06  ? 720  VAL A CA    1 
ATOM   2203 C C     . VAL A  1 275 ? 24.535  -16.294 -3.621  1.00 13.38  ? 720  VAL A C     1 
ATOM   2204 O O     . VAL A  1 275 ? 24.523  -17.182 -4.513  1.00 13.39  ? 720  VAL A O     1 
ATOM   2205 C CB    . VAL A  1 275 ? 25.434  -17.083 -1.309  1.00 12.24  ? 720  VAL A CB    1 
ATOM   2206 C CG1   . VAL A  1 275 ? 26.014  -18.366 -1.804  1.00 14.71  ? 720  VAL A CG1   1 
ATOM   2207 C CG2   . VAL A  1 275 ? 26.504  -16.042 -1.246  1.00 12.49  ? 720  VAL A CG2   1 
ATOM   2208 N N     . THR A  1 276 ? 24.775  -15.011 -3.867  1.00 13.48  ? 721  THR A N     1 
ATOM   2209 C CA    . THR A  1 276 ? 24.937  -14.498 -5.211  1.00 14.55  ? 721  THR A CA    1 
ATOM   2210 C C     . THR A  1 276 ? 25.843  -13.290 -5.258  1.00 15.55  ? 721  THR A C     1 
ATOM   2211 O O     . THR A  1 276 ? 25.782  -12.412 -4.371  1.00 14.22  ? 721  THR A O     1 
ATOM   2212 C CB    . THR A  1 276 ? 23.537  -14.180 -5.840  1.00 15.13  ? 721  THR A CB    1 
ATOM   2213 O OG1   . THR A  1 276 ? 23.672  -13.742 -7.193  1.00 13.86  ? 721  THR A OG1   1 
ATOM   2214 C CG2   . THR A  1 276 ? 22.820  -13.118 -5.054  1.00 16.10  ? 721  THR A CG2   1 
ATOM   2215 N N     . TYR A  1 277 ? 26.704  -13.208 -6.292  1.00 14.63  ? 722  TYR A N     1 
ATOM   2216 C CA    . TYR A  1 277 ? 27.466  -11.982 -6.515  1.00 15.27  ? 722  TYR A CA    1 
ATOM   2217 C C     . TYR A  1 277 ? 26.801  -10.852 -7.311  1.00 14.79  ? 722  TYR A C     1 
ATOM   2218 O O     . TYR A  1 277 ? 27.412  -9.752  -7.451  1.00 13.81  ? 722  TYR A O     1 
ATOM   2219 C CB    . TYR A  1 277 ? 28.870  -12.270 -7.045  1.00 16.30  ? 722  TYR A CB    1 
ATOM   2220 C CG    . TYR A  1 277 ? 28.985  -12.615 -8.511  1.00 19.87  ? 722  TYR A CG    1 
ATOM   2221 C CD1   . TYR A  1 277 ? 28.966  -13.933 -8.929  1.00 20.58  ? 722  TYR A CD1   1 
ATOM   2222 C CD2   . TYR A  1 277 ? 29.251  -11.609 -9.480  1.00 20.97  ? 722  TYR A CD2   1 
ATOM   2223 C CE1   . TYR A  1 277 ? 29.126  -14.276 -10.290 1.00 24.52  ? 722  TYR A CE1   1 
ATOM   2224 C CE2   . TYR A  1 277 ? 29.414  -11.941 -10.834 1.00 23.60  ? 722  TYR A CE2   1 
ATOM   2225 C CZ    . TYR A  1 277 ? 29.384  -13.288 -11.220 1.00 25.49  ? 722  TYR A CZ    1 
ATOM   2226 O OH    . TYR A  1 277 ? 29.540  -13.646 -12.552 1.00 26.26  ? 722  TYR A OH    1 
ATOM   2227 N N     . GLU A  1 278 ? 25.614  -11.110 -7.852  1.00 16.13  ? 723  GLU A N     1 
ATOM   2228 C CA    . GLU A  1 278 ? 24.827  -10.070 -8.585  1.00 19.47  ? 723  GLU A CA    1 
ATOM   2229 C C     . GLU A  1 278 ? 23.689  -9.607  -7.744  1.00 18.35  ? 723  GLU A C     1 
ATOM   2230 O O     . GLU A  1 278 ? 23.218  -10.349 -6.883  1.00 17.55  ? 723  GLU A O     1 
ATOM   2231 C CB    . GLU A  1 278 ? 24.300  -10.636 -9.954  1.00 21.93  ? 723  GLU A CB    1 
ATOM   2232 C CG    . GLU A  1 278 ? 25.481  -10.965 -10.901 1.00 25.61  ? 723  GLU A CG    1 
ATOM   2233 C CD    . GLU A  1 278 ? 25.087  -11.161 -12.379 1.00 31.39  ? 723  GLU A CD    1 
ATOM   2234 O OE1   . GLU A  1 278 ? 23.972  -11.664 -12.628 1.00 32.54  ? 723  GLU A OE1   1 
ATOM   2235 O OE2   . GLU A  1 278 ? 25.942  -10.860 -13.276 1.00 36.58  ? 723  GLU A OE2   1 
ATOM   2236 N N     . GLY A  1 279 ? 23.211  -8.400  -8.004  1.00 16.27  ? 724  GLY A N     1 
ATOM   2237 C CA    . GLY A  1 279 ? 22.022  -7.886  -7.313  1.00 16.93  ? 724  GLY A CA    1 
ATOM   2238 C C     . GLY A  1 279 ? 22.365  -7.136  -5.979  1.00 15.33  ? 724  GLY A C     1 
ATOM   2239 O O     . GLY A  1 279 ? 23.524  -7.057  -5.563  1.00 13.84  ? 724  GLY A O     1 
ATOM   2240 N N     . THR A  1 280 ? 21.340  -6.528  -5.391  1.00 14.94  ? 725  THR A N     1 
ATOM   2241 C CA    . THR A  1 280 ? 21.470  -5.757  -4.137  1.00 13.88  ? 725  THR A CA    1 
ATOM   2242 C C     . THR A  1 280 ? 20.315  -6.110  -3.193  1.00 12.81  ? 725  THR A C     1 
ATOM   2243 O O     . THR A  1 280 ? 19.265  -6.658  -3.622  1.00 11.65  ? 725  THR A O     1 
ATOM   2244 C CB    . THR A  1 280 ? 21.401  -4.242  -4.347  1.00 14.89  ? 725  THR A CB    1 
ATOM   2245 O OG1   . THR A  1 280 ? 20.127  -3.904  -4.906  1.00 14.39  ? 725  THR A OG1   1 
ATOM   2246 C CG2   . THR A  1 280 ? 22.508  -3.765  -5.250  1.00 17.26  ? 725  THR A CG2   1 
ATOM   2247 N N     . ILE A  1 281 ? 20.485  -5.747  -1.925  1.00 11.85  ? 726  ILE A N     1 
ATOM   2248 C CA    . ILE A  1 281 ? 19.485  -6.036  -0.904  1.00 12.24  ? 726  ILE A CA    1 
ATOM   2249 C C     . ILE A  1 281 ? 18.179  -5.333  -1.282  1.00 13.11  ? 726  ILE A C     1 
ATOM   2250 O O     . ILE A  1 281 ? 17.091  -5.900  -1.141  1.00 12.89  ? 726  ILE A O     1 
ATOM   2251 C CB    . ILE A  1 281 ? 19.990  -5.542  0.497   1.00 12.32  ? 726  ILE A CB    1 
ATOM   2252 C CG1   . ILE A  1 281 ? 21.061  -6.527  1.018   1.00 12.26  ? 726  ILE A CG1   1 
ATOM   2253 C CG2   . ILE A  1 281 ? 18.839  -5.426  1.505   1.00 13.14  ? 726  ILE A CG2   1 
ATOM   2254 C CD1   . ILE A  1 281 ? 21.985  -5.993  2.077   1.00 11.67  ? 726  ILE A CD1   1 
ATOM   2255 N N     . GLU A  1 282 ? 18.276  -4.069  -1.701  1.00 13.71  ? 727  GLU A N     1 
ATOM   2256 C CA    . GLU A  1 282 ? 17.064  -3.266  -1.951  1.00 14.04  ? 727  GLU A CA    1 
ATOM   2257 C C     . GLU A  1 282 ? 16.350  -3.596  -3.287  1.00 16.72  ? 727  GLU A C     1 
ATOM   2258 O O     . GLU A  1 282 ? 15.172  -3.416  -3.372  1.00 16.41  ? 727  GLU A O     1 
ATOM   2259 C CB    . GLU A  1 282 ? 17.366  -1.782  -1.851  1.00 15.54  ? 727  GLU A CB    1 
ATOM   2260 C CG    . GLU A  1 282 ? 18.147  -1.135  -2.997  1.00 15.22  ? 727  GLU A CG    1 
ATOM   2261 C CD    . GLU A  1 282 ? 19.653  -1.300  -2.895  1.00 16.40  ? 727  GLU A CD    1 
ATOM   2262 O OE1   . GLU A  1 282 ? 20.135  -2.079  -1.989  1.00 15.61  ? 727  GLU A OE1   1 
ATOM   2263 O OE2   . GLU A  1 282 ? 20.370  -0.698  -3.768  1.00 16.07  ? 727  GLU A OE2   1 
ATOM   2264 N N     . GLU A  1 283 ? 17.064  -4.065  -4.305  1.00 15.96  ? 728  GLU A N     1 
ATOM   2265 C CA    A GLU A  1 283 ? 16.377  -4.442  -5.566  0.50 19.54  ? 728  GLU A CA    1 
ATOM   2266 C CA    B GLU A  1 283 ? 16.425  -4.457  -5.580  0.50 18.27  ? 728  GLU A CA    1 
ATOM   2267 C C     . GLU A  1 283 ? 15.945  -5.912  -5.562  1.00 18.71  ? 728  GLU A C     1 
ATOM   2268 O O     . GLU A  1 283 ? 14.913  -6.249  -6.123  1.00 21.41  ? 728  GLU A O     1 
ATOM   2269 C CB    A GLU A  1 283 ? 17.212  -4.123  -6.828  0.50 21.69  ? 728  GLU A CB    1 
ATOM   2270 C CB    B GLU A  1 283 ? 17.401  -4.299  -6.723  0.50 18.60  ? 728  GLU A CB    1 
ATOM   2271 C CG    A GLU A  1 283 ? 16.531  -4.608  -8.136  0.50 25.22  ? 728  GLU A CG    1 
ATOM   2272 C CG    B GLU A  1 283 ? 17.976  -2.921  -6.881  0.50 19.34  ? 728  GLU A CG    1 
ATOM   2273 C CD    A GLU A  1 283 ? 16.798  -3.725  -9.356  0.50 28.11  ? 728  GLU A CD    1 
ATOM   2274 C CD    B GLU A  1 283 ? 19.046  -2.902  -7.935  0.50 21.13  ? 728  GLU A CD    1 
ATOM   2275 O OE1   A GLU A  1 283 ? 17.614  -2.809  -9.267  0.50 31.68  ? 728  GLU A OE1   1 
ATOM   2276 O OE1   B GLU A  1 283 ? 18.695  -3.176  -9.110  0.50 25.28  ? 728  GLU A OE1   1 
ATOM   2277 O OE2   A GLU A  1 283 ? 16.165  -3.955  -10.411 0.50 31.10  ? 728  GLU A OE2   1 
ATOM   2278 O OE2   B GLU A  1 283 ? 20.223  -2.729  -7.590  0.50 17.44  ? 728  GLU A OE2   1 
ATOM   2279 N N     . ASN A  1 284 ? 16.711  -6.784  -4.916  1.00 16.28  ? 729  ASN A N     1 
ATOM   2280 C CA    . ASN A  1 284 ? 16.475  -8.234  -5.058  1.00 17.18  ? 729  ASN A CA    1 
ATOM   2281 C C     . ASN A  1 284 ? 15.943  -8.924  -3.779  1.00 18.38  ? 729  ASN A C     1 
ATOM   2282 O O     . ASN A  1 284 ? 15.798  -10.139 -3.746  1.00 20.58  ? 729  ASN A O     1 
ATOM   2283 C CB    . ASN A  1 284 ? 17.744  -8.909  -5.636  1.00 18.12  ? 729  ASN A CB    1 
ATOM   2284 C CG    . ASN A  1 284 ? 18.182  -8.263  -6.981  1.00 20.54  ? 729  ASN A CG    1 
ATOM   2285 O OD1   . ASN A  1 284 ? 18.966  -7.357  -7.028  1.00 17.55  ? 729  ASN A OD1   1 
ATOM   2286 N ND2   . ASN A  1 284 ? 17.493  -8.620  -8.020  1.00 25.28  ? 729  ASN A ND2   1 
ATOM   2287 N N     . GLY A  1 285 ? 15.628  -8.128  -2.763  1.00 15.34  ? 730  GLY A N     1 
ATOM   2288 C CA    . GLY A  1 285 ? 15.149  -8.639  -1.480  1.00 15.68  ? 730  GLY A CA    1 
ATOM   2289 C C     . GLY A  1 285 ? 13.695  -8.357  -1.200  1.00 15.47  ? 730  GLY A C     1 
ATOM   2290 O O     . GLY A  1 285 ? 13.297  -8.213  -0.036  1.00 11.40  ? 730  GLY A O     1 
ATOM   2291 N N     . GLN A  1 286 ? 12.867  -8.281  -2.266  1.00 17.22  ? 731  GLN A N     1 
ATOM   2292 C CA    A GLN A  1 286 ? 11.422  -7.940  -2.139  0.50 17.88  ? 731  GLN A CA    1 
ATOM   2293 C CA    B GLN A  1 286 ? 11.458  -7.869  -2.083  0.50 16.81  ? 731  GLN A CA    1 
ATOM   2294 C C     . GLN A  1 286 ? 10.727  -8.875  -1.171  1.00 15.97  ? 731  GLN A C     1 
ATOM   2295 O O     . GLN A  1 286 ? 10.862  -10.088 -1.301  1.00 16.48  ? 731  GLN A O     1 
ATOM   2296 C CB    A GLN A  1 286 ? 10.721  -8.074  -3.513  0.50 19.63  ? 731  GLN A CB    1 
ATOM   2297 C CB    B GLN A  1 286 ? 10.717  -7.700  -3.444  0.50 17.31  ? 731  GLN A CB    1 
ATOM   2298 C CG    A GLN A  1 286 ? 11.315  -7.221  -4.593  0.50 20.71  ? 731  GLN A CG    1 
ATOM   2299 C CG    B GLN A  1 286 ? 9.312   -7.094  -3.320  0.50 17.04  ? 731  GLN A CG    1 
ATOM   2300 C CD    A GLN A  1 286 ? 12.237  -8.008  -5.556  0.50 22.19  ? 731  GLN A CD    1 
ATOM   2301 C CD    B GLN A  1 286 ? 9.333   -5.562  -3.260  0.50 16.17  ? 731  GLN A CD    1 
ATOM   2302 O OE1   A GLN A  1 286 ? 13.114  -8.794  -5.134  0.50 17.19  ? 731  GLN A OE1   1 
ATOM   2303 O OE1   B GLN A  1 286 ? 10.198  -4.924  -3.857  0.50 15.73  ? 731  GLN A OE1   1 
ATOM   2304 N NE2   A GLN A  1 286 ? 11.996  -7.825  -6.878  0.50 22.57  ? 731  GLN A NE2   1 
ATOM   2305 N NE2   B GLN A  1 286 ? 8.385   -4.984  -2.546  0.50 14.69  ? 731  GLN A NE2   1 
ATOM   2306 N N     . GLY A  1 287 ? 9.994   -8.330  -0.186  1.00 15.34  ? 732  GLY A N     1 
ATOM   2307 C CA    . GLY A  1 287 ? 9.309   -9.147  0.829   1.00 16.68  ? 732  GLY A CA    1 
ATOM   2308 C C     . GLY A  1 287 ? 10.192  -9.854  1.883   1.00 16.45  ? 732  GLY A C     1 
ATOM   2309 O O     . GLY A  1 287 ? 9.697   -10.653 2.671   1.00 18.86  ? 732  GLY A O     1 
ATOM   2310 N N     . MET A  1 288 ? 11.469  -9.571  1.879   1.00 14.44  ? 733  MET A N     1 
ATOM   2311 C CA    . MET A  1 288 ? 12.410  -10.185 2.827   1.00 14.42  ? 733  MET A CA    1 
ATOM   2312 C C     . MET A  1 288 ? 12.815  -9.145  3.888   1.00 13.93  ? 733  MET A C     1 
ATOM   2313 O O     . MET A  1 288 ? 12.716  -7.942  3.653   1.00 14.34  ? 733  MET A O     1 
ATOM   2314 C CB    . MET A  1 288 ? 13.657  -10.698 2.087   1.00 13.56  ? 733  MET A CB    1 
ATOM   2315 C CG    . MET A  1 288 ? 13.365  -11.833 1.135   1.00 16.32  ? 733  MET A CG    1 
ATOM   2316 S SD    . MET A  1 288 ? 14.829  -12.379 0.254   1.00 17.92  ? 733  MET A SD    1 
ATOM   2317 C CE    . MET A  1 288 ? 14.023  -13.553 -0.838  1.00 20.56  ? 733  MET A CE    1 
ATOM   2318 N N     . LEU A  1 289 ? 13.258  -9.607  5.059   1.00 12.36  ? 734  LEU A N     1 
ATOM   2319 C CA    . LEU A  1 289 ? 13.833  -8.688  6.034   1.00 12.37  ? 734  LEU A CA    1 
ATOM   2320 C C     . LEU A  1 289 ? 15.106  -8.137  5.491   1.00 12.31  ? 734  LEU A C     1 
ATOM   2321 O O     . LEU A  1 289 ? 16.103  -8.880  5.324   1.00 13.51  ? 734  LEU A O     1 
ATOM   2322 C CB    . LEU A  1 289 ? 14.064  -9.397  7.346   1.00 13.38  ? 734  LEU A CB    1 
ATOM   2323 C CG    . LEU A  1 289 ? 14.787  -8.590  8.435   1.00 13.34  ? 734  LEU A CG    1 
ATOM   2324 C CD1   . LEU A  1 289 ? 13.955  -7.369  8.808   1.00 13.24  ? 734  LEU A CD1   1 
ATOM   2325 C CD2   . LEU A  1 289 ? 15.032  -9.501  9.638   1.00 14.03  ? 734  LEU A CD2   1 
ATOM   2326 N N     . GLN A  1 290 ? 15.136  -6.826  5.237   1.00 11.96  ? 735  GLN A N     1 
ATOM   2327 C CA    . GLN A  1 290 ? 16.315  -6.196  4.630   1.00 11.47  ? 735  GLN A CA    1 
ATOM   2328 C C     . GLN A  1 290 ? 17.208  -5.593  5.681   1.00 12.06  ? 735  GLN A C     1 
ATOM   2329 O O     . GLN A  1 290 ? 16.759  -4.779  6.500   1.00 11.94  ? 735  GLN A O     1 
ATOM   2330 C CB    . GLN A  1 290 ? 15.882  -5.155  3.595   1.00 11.20  ? 735  GLN A CB    1 
ATOM   2331 C CG    . GLN A  1 290 ? 15.167  -5.798  2.422   1.00 13.02  ? 735  GLN A CG    1 
ATOM   2332 C CD    . GLN A  1 290 ? 14.401  -4.833  1.574   1.00 13.68  ? 735  GLN A CD    1 
ATOM   2333 O OE1   . GLN A  1 290 ? 14.494  -3.640  1.746   1.00 14.29  ? 735  GLN A OE1   1 
ATOM   2334 N NE2   . GLN A  1 290 ? 13.613  -5.347  0.685   1.00 15.65  ? 735  GLN A NE2   1 
ATOM   2335 N N     . VAL A  1 291 ? 18.473  -5.987  5.684   1.00 12.69  ? 736  VAL A N     1 
ATOM   2336 C CA    . VAL A  1 291 ? 19.461  -5.428  6.657   1.00 12.30  ? 736  VAL A CA    1 
ATOM   2337 C C     . VAL A  1 291 ? 20.023  -4.092  6.220   1.00 12.44  ? 736  VAL A C     1 
ATOM   2338 O O     . VAL A  1 291 ? 20.459  -3.918  5.096   1.00 12.79  ? 736  VAL A O     1 
ATOM   2339 C CB    . VAL A  1 291 ? 20.604  -6.437  6.955   1.00 12.86  ? 736  VAL A CB    1 
ATOM   2340 C CG1   . VAL A  1 291 ? 21.558  -5.882  7.974   1.00 14.51  ? 736  VAL A CG1   1 
ATOM   2341 C CG2   . VAL A  1 291 ? 20.008  -7.728  7.518   1.00 12.52  ? 736  VAL A CG2   1 
ATOM   2342 N N     . ASP A  1 292 ? 20.070  -3.183  7.184   1.00 11.62  ? 737  ASP A N     1 
ATOM   2343 C CA    . ASP A  1 292 ? 20.707  -1.874  7.087   1.00 12.81  ? 737  ASP A CA    1 
ATOM   2344 C C     . ASP A  1 292 ? 22.008  -1.944  7.924   1.00 11.64  ? 737  ASP A C     1 
ATOM   2345 O O     . ASP A  1 292 ? 21.958  -2.234  9.139   1.00 12.27  ? 737  ASP A O     1 
ATOM   2346 C CB    . ASP A  1 292 ? 19.745  -0.789  7.669   1.00 14.22  ? 737  ASP A CB    1 
ATOM   2347 C CG    . ASP A  1 292 ? 20.424  0.546   7.877   1.00 19.41  ? 737  ASP A CG    1 
ATOM   2348 O OD1   . ASP A  1 292 ? 20.880  1.102   6.890   1.00 28.07  ? 737  ASP A OD1   1 
ATOM   2349 O OD2   . ASP A  1 292 ? 20.379  1.108   8.991   1.00 20.32  ? 737  ASP A OD2   1 
ATOM   2350 N N     . PHE A  1 293 ? 23.147  -1.702  7.279   1.00 11.65  ? 738  PHE A N     1 
ATOM   2351 C CA    . PHE A  1 293 ? 24.464  -1.842  7.926   1.00 12.45  ? 738  PHE A CA    1 
ATOM   2352 C C     . PHE A  1 293 ? 24.731  -0.524  8.693   1.00 11.98  ? 738  PHE A C     1 
ATOM   2353 O O     . PHE A  1 293 ? 25.380  0.399   8.197   1.00 13.94  ? 738  PHE A O     1 
ATOM   2354 C CB    . PHE A  1 293 ? 25.558  -2.122  6.902   1.00 11.74  ? 738  PHE A CB    1 
ATOM   2355 C CG    . PHE A  1 293 ? 25.311  -3.348  6.004   1.00 11.50  ? 738  PHE A CG    1 
ATOM   2356 C CD1   . PHE A  1 293 ? 24.488  -4.365  6.385   1.00 11.87  ? 738  PHE A CD1   1 
ATOM   2357 C CD2   . PHE A  1 293 ? 25.980  -3.462  4.789   1.00 11.06  ? 738  PHE A CD2   1 
ATOM   2358 C CE1   . PHE A  1 293 ? 24.277  -5.471  5.566   1.00 12.36  ? 738  PHE A CE1   1 
ATOM   2359 C CE2   . PHE A  1 293 ? 25.782  -4.551  3.956   1.00 11.62  ? 738  PHE A CE2   1 
ATOM   2360 C CZ    . PHE A  1 293 ? 24.933  -5.568  4.358   1.00 10.91  ? 738  PHE A CZ    1 
ATOM   2361 N N     . ALA A  1 294 ? 24.157  -0.445  9.888   1.00 11.36  ? 739  ALA A N     1 
ATOM   2362 C CA    . ALA A  1 294 ? 23.978  0.798   10.610  1.00 11.57  ? 739  ALA A CA    1 
ATOM   2363 C C     . ALA A  1 294 ? 25.204  1.297   11.382  1.00 12.04  ? 739  ALA A C     1 
ATOM   2364 O O     . ALA A  1 294 ? 26.151  0.540   11.695  1.00 12.53  ? 739  ALA A O     1 
ATOM   2365 C CB    . ALA A  1 294 ? 22.788  0.672   11.547  1.00 11.96  ? 739  ALA A CB    1 
ATOM   2366 N N     . ASN A  1 295 ? 25.207  2.593   11.637  1.00 13.28  ? 740  ASN A N     1 
ATOM   2367 C CA    . ASN A  1 295 ? 25.932  3.175   12.757  1.00 14.11  ? 740  ASN A CA    1 
ATOM   2368 C C     . ASN A  1 295 ? 25.060  3.017   14.022  1.00 15.56  ? 740  ASN A C     1 
ATOM   2369 O O     . ASN A  1 295 ? 23.803  3.019   13.940  1.00 14.62  ? 740  ASN A O     1 
ATOM   2370 C CB    . ASN A  1 295 ? 26.245  4.659   12.494  1.00 14.38  ? 740  ASN A CB    1 
ATOM   2371 C CG    . ASN A  1 295 ? 27.307  5.240   13.495  1.00 15.44  ? 740  ASN A CG    1 
ATOM   2372 O OD1   . ASN A  1 295 ? 26.972  5.716   14.588  1.00 15.73  ? 740  ASN A OD1   1 
ATOM   2373 N ND2   . ASN A  1 295 ? 28.563  5.184   13.107  1.00 15.98  ? 740  ASN A ND2   1 
ATOM   2374 N N     . ARG A  1 296 ? 25.683  2.945   15.194  1.00 14.28  ? 741  ARG A N     1 
ATOM   2375 C CA    . ARG A  1 296 ? 24.882  2.925   16.423  1.00 14.82  ? 741  ARG A CA    1 
ATOM   2376 C C     . ARG A  1 296 ? 23.990  4.194   16.569  1.00 13.59  ? 741  ARG A C     1 
ATOM   2377 O O     . ARG A  1 296 ? 22.932  4.129   17.213  1.00 13.68  ? 741  ARG A O     1 
ATOM   2378 C CB    . ARG A  1 296 ? 25.743  2.722   17.657  1.00 16.33  ? 741  ARG A CB    1 
ATOM   2379 C CG    . ARG A  1 296 ? 26.828  3.745   17.848  1.00 18.18  ? 741  ARG A CG    1 
ATOM   2380 C CD    . ARG A  1 296 ? 27.697  3.339   19.029  1.00 24.24  ? 741  ARG A CD    1 
ATOM   2381 N NE    . ARG A  1 296 ? 28.618  4.376   19.289  1.00 28.01  ? 741  ARG A NE    1 
ATOM   2382 C CZ    . ARG A  1 296 ? 28.590  5.185   20.334  1.00 33.31  ? 741  ARG A CZ    1 
ATOM   2383 N NH1   . ARG A  1 296 ? 27.739  4.995   21.352  1.00 33.51  ? 741  ARG A NH1   1 
ATOM   2384 N NH2   . ARG A  1 296 ? 29.489  6.144   20.389  1.00 38.06  ? 741  ARG A NH2   1 
ATOM   2385 N N     . PHE A  1 297 ? 24.427  5.335   16.010  1.00 12.40  ? 742  PHE A N     1 
ATOM   2386 C CA    . PHE A  1 297 ? 23.524  6.475   15.760  1.00 13.39  ? 742  PHE A CA    1 
ATOM   2387 C C     . PHE A  1 297 ? 22.814  6.252   14.371  1.00 13.55  ? 742  PHE A C     1 
ATOM   2388 O O     . PHE A  1 297 ? 23.439  6.395   13.315  1.00 11.85  ? 742  PHE A O     1 
ATOM   2389 C CB    . PHE A  1 297 ? 24.305  7.837   15.736  1.00 13.80  ? 742  PHE A CB    1 
ATOM   2390 C CG    . PHE A  1 297 ? 24.864  8.255   17.109  1.00 15.95  ? 742  PHE A CG    1 
ATOM   2391 C CD1   . PHE A  1 297 ? 24.091  9.002   17.997  1.00 17.20  ? 742  PHE A CD1   1 
ATOM   2392 C CD2   . PHE A  1 297 ? 26.141  7.919   17.481  1.00 16.19  ? 742  PHE A CD2   1 
ATOM   2393 C CE1   . PHE A  1 297 ? 24.597  9.404   19.225  1.00 17.67  ? 742  PHE A CE1   1 
ATOM   2394 C CE2   . PHE A  1 297 ? 26.638  8.307   18.730  1.00 18.60  ? 742  PHE A CE2   1 
ATOM   2395 C CZ    . PHE A  1 297 ? 25.870  9.064   19.580  1.00 17.64  ? 742  PHE A CZ    1 
ATOM   2396 N N     . VAL A  1 298 ? 21.549  5.813   14.392  1.00 14.70  ? 743  VAL A N     1 
ATOM   2397 C CA    . VAL A  1 298 ? 20.985  5.235   13.182  1.00 15.40  ? 743  VAL A CA    1 
ATOM   2398 C C     . VAL A  1 298 ? 21.027  6.247   12.047  1.00 14.10  ? 743  VAL A C     1 
ATOM   2399 O O     . VAL A  1 298 ? 20.755  7.441   12.248  1.00 14.05  ? 743  VAL A O     1 
ATOM   2400 C CB    . VAL A  1 298 ? 19.559  4.666   13.398  1.00 14.95  ? 743  VAL A CB    1 
ATOM   2401 C CG1   . VAL A  1 298 ? 19.596  3.511   14.367  1.00 17.54  ? 743  VAL A CG1   1 
ATOM   2402 C CG2   . VAL A  1 298 ? 18.601  5.753   13.845  1.00 14.66  ? 743  VAL A CG2   1 
ATOM   2403 N N     . GLY A  1 299 ? 21.391  5.764   10.860  1.00 13.43  ? 744  GLY A N     1 
ATOM   2404 C CA    . GLY A  1 299 ? 21.571  6.601   9.665   1.00 12.58  ? 744  GLY A CA    1 
ATOM   2405 C C     . GLY A  1 299 ? 22.990  7.127   9.484   1.00 13.34  ? 744  GLY A C     1 
ATOM   2406 O O     . GLY A  1 299 ? 23.360  7.567   8.390   1.00 14.33  ? 744  GLY A O     1 
ATOM   2407 N N     . GLY A  1 300 ? 23.793  7.091   10.551  1.00 13.33  ? 745  GLY A N     1 
ATOM   2408 C CA    . GLY A  1 300 ? 25.193  7.530   10.477  1.00 15.02  ? 745  GLY A CA    1 
ATOM   2409 C C     . GLY A  1 300 ? 25.371  8.894   9.855   1.00 17.08  ? 745  GLY A C     1 
ATOM   2410 O O     . GLY A  1 300 ? 24.695  9.842   10.233  1.00 17.79  ? 745  GLY A O     1 
ATOM   2411 N N     . GLY A  1 301 ? 26.220  8.986   8.836   1.00 16.47  ? 746  GLY A N     1 
ATOM   2412 C CA    . GLY A  1 301 ? 26.459  10.283  8.168   1.00 16.98  ? 746  GLY A CA    1 
ATOM   2413 C C     . GLY A  1 301 ? 25.481  10.681  7.029   1.00 16.37  ? 746  GLY A C     1 
ATOM   2414 O O     . GLY A  1 301 ? 25.856  11.441  6.143   1.00 14.40  ? 746  GLY A O     1 
ATOM   2415 N N     . VAL A  1 302 ? 24.238  10.206  7.068   1.00 17.23  ? 747  VAL A N     1 
ATOM   2416 C CA    . VAL A  1 302 ? 23.341  10.498  5.982   1.00 17.34  ? 747  VAL A CA    1 
ATOM   2417 C C     . VAL A  1 302 ? 23.151  12.047  5.837   1.00 20.59  ? 747  VAL A C     1 
ATOM   2418 O O     . VAL A  1 302 ? 23.136  12.546  4.733   1.00 21.22  ? 747  VAL A O     1 
ATOM   2419 C CB    . VAL A  1 302 ? 21.980  9.785   6.088   1.00 16.84  ? 747  VAL A CB    1 
ATOM   2420 C CG1   . VAL A  1 302 ? 21.238  10.150  7.363   1.00 16.80  ? 747  VAL A CG1   1 
ATOM   2421 C CG2   . VAL A  1 302 ? 21.105  10.151  4.899   1.00 17.79  ? 747  VAL A CG2   1 
ATOM   2422 N N     . THR A  1 303 ? 23.031  12.751  6.965   1.00 22.95  ? 748  THR A N     1 
ATOM   2423 C CA    . THR A  1 303 ? 22.798  14.202  6.968   1.00 29.26  ? 748  THR A CA    1 
ATOM   2424 C C     . THR A  1 303 ? 24.152  15.001  6.789   1.00 28.07  ? 748  THR A C     1 
ATOM   2425 O O     . THR A  1 303 ? 24.152  16.208  6.917   1.00 30.38  ? 748  THR A O     1 
ATOM   2426 C CB    . THR A  1 303 ? 22.035  14.713  8.258   1.00 26.10  ? 748  THR A CB    1 
ATOM   2427 O OG1   . THR A  1 303 ? 22.736  14.325  9.482   1.00 30.06  ? 748  THR A OG1   1 
ATOM   2428 C CG2   . THR A  1 303 ? 20.612  14.201  8.344   1.00 31.64  ? 748  THR A CG2   1 
ATOM   2429 N N     . SER A  1 304 ? 25.265  14.300  6.487   1.00 23.72  ? 749  SER A N     1 
ATOM   2430 C CA    . SER A  1 304 ? 26.584  14.933  6.334   1.00 21.84  ? 749  SER A CA    1 
ATOM   2431 C C     . SER A  1 304 ? 27.341  14.384  5.102   1.00 19.14  ? 749  SER A C     1 
ATOM   2432 O O     . SER A  1 304 ? 26.852  14.532  3.999   1.00 20.80  ? 749  SER A O     1 
ATOM   2433 C CB    . SER A  1 304 ? 27.402  14.888  7.677   1.00 23.90  ? 749  SER A CB    1 
ATOM   2434 O OG    . SER A  1 304 ? 27.474  13.555  8.244   1.00 24.90  ? 749  SER A OG    1 
ATOM   2435 N N     . ALA A  1 305 ? 28.482  13.728  5.276   1.00 17.88  ? 750  ALA A N     1 
ATOM   2436 C CA    . ALA A  1 305 ? 29.279  13.188  4.165   1.00 19.04  ? 750  ALA A CA    1 
ATOM   2437 C C     . ALA A  1 305 ? 29.125  11.637  3.885   1.00 18.59  ? 750  ALA A C     1 
ATOM   2438 O O     . ALA A  1 305 ? 29.857  11.064  3.078   1.00 19.14  ? 750  ALA A O     1 
ATOM   2439 C CB    . ALA A  1 305 ? 30.747  13.502  4.393   1.00 20.34  ? 750  ALA A CB    1 
ATOM   2440 N N     . GLY A  1 306 ? 28.278  10.946  4.608   1.00 16.69  ? 751  GLY A N     1 
ATOM   2441 C CA    . GLY A  1 306 ? 28.220  9.482   4.421   1.00 14.23  ? 751  GLY A CA    1 
ATOM   2442 C C     . GLY A  1 306 ? 27.467  9.118   3.144   1.00 13.15  ? 751  GLY A C     1 
ATOM   2443 O O     . GLY A  1 306 ? 26.483  9.773   2.759   1.00 12.36  ? 751  GLY A O     1 
ATOM   2444 N N     . LEU A  1 307 ? 27.953  8.106   2.453   1.00 13.49  ? 752  LEU A N     1 
ATOM   2445 C CA    . LEU A  1 307 ? 27.361  7.699   1.200   1.00 12.79  ? 752  LEU A CA    1 
ATOM   2446 C C     . LEU A  1 307 ? 27.757  6.245   0.839   1.00 12.51  ? 752  LEU A C     1 
ATOM   2447 O O     . LEU A  1 307 ? 28.024  5.936   -0.347  1.00 12.11  ? 752  LEU A O     1 
ATOM   2448 C CB    . LEU A  1 307 ? 27.773  8.687   0.096   1.00 13.47  ? 752  LEU A CB    1 
ATOM   2449 C CG    . LEU A  1 307 ? 26.897  8.839   -1.149  1.00 13.45  ? 752  LEU A CG    1 
ATOM   2450 C CD1   . LEU A  1 307 ? 25.423  9.025   -0.826  1.00 13.51  ? 752  LEU A CD1   1 
ATOM   2451 C CD2   . LEU A  1 307 ? 27.432  9.980   -1.991  1.00 15.10  ? 752  LEU A CD2   1 
ATOM   2452 N N     . VAL A  1 308 ? 27.766  5.371   1.850   1.00 11.68  ? 753  VAL A N     1 
ATOM   2453 C CA    . VAL A  1 308 ? 27.838  3.911   1.642   1.00 11.65  ? 753  VAL A CA    1 
ATOM   2454 C C     . VAL A  1 308 ? 26.491  3.302   1.989   1.00 12.12  ? 753  VAL A C     1 
ATOM   2455 O O     . VAL A  1 308 ? 25.487  3.968   1.828   1.00 13.68  ? 753  VAL A O     1 
ATOM   2456 C CB    . VAL A  1 308 ? 29.049  3.297   2.383   1.00 12.13  ? 753  VAL A CB    1 
ATOM   2457 C CG1   . VAL A  1 308 ? 30.323  3.753   1.713   1.00 12.73  ? 753  VAL A CG1   1 
ATOM   2458 C CG2   . VAL A  1 308 ? 29.063  3.658   3.853   1.00 12.93  ? 753  VAL A CG2   1 
ATOM   2459 N N     . GLN A  1 309 ? 26.422  2.029   2.370   1.00 11.43  ? 754  GLN A N     1 
ATOM   2460 C CA    . GLN A  1 309 ? 25.171  1.250   2.258   1.00 11.64  ? 754  GLN A CA    1 
ATOM   2461 C C     . GLN A  1 309 ? 23.979  1.873   3.005   1.00 11.08  ? 754  GLN A C     1 
ATOM   2462 O O     . GLN A  1 309 ? 22.860  2.088   2.399   1.00 10.01  ? 754  GLN A O     1 
ATOM   2463 C CB    . GLN A  1 309 ? 25.403  -0.191  2.738   1.00 12.16  ? 754  GLN A CB    1 
ATOM   2464 C CG    . GLN A  1 309 ? 24.290  -1.201  2.395   1.00 12.65  ? 754  GLN A CG    1 
ATOM   2465 C CD    . GLN A  1 309 ? 23.333  -1.478  3.573   1.00 13.91  ? 754  GLN A CD    1 
ATOM   2466 O OE1   . GLN A  1 309 ? 23.397  -0.815  4.610   1.00 14.17  ? 754  GLN A OE1   1 
ATOM   2467 N NE2   . GLN A  1 309 ? 22.500  -2.507  3.434   1.00 13.80  ? 754  GLN A NE2   1 
ATOM   2468 N N     . GLU A  1 310 ? 24.177  2.196   4.277   1.00 10.92  ? 755  GLU A N     1 
ATOM   2469 C CA    . GLU A  1 310 ? 23.072  2.750   5.076   1.00 11.60  ? 755  GLU A CA    1 
ATOM   2470 C C     . GLU A  1 310 ? 22.676  4.153   4.606   1.00 11.42  ? 755  GLU A C     1 
ATOM   2471 O O     . GLU A  1 310 ? 21.511  4.512   4.652   1.00 11.78  ? 755  GLU A O     1 
ATOM   2472 C CB    . GLU A  1 310 ? 23.459  2.826   6.568   1.00 13.07  ? 755  GLU A CB    1 
ATOM   2473 C CG    . GLU A  1 310 ? 22.517  3.713   7.391   1.00 14.76  ? 755  GLU A CG    1 
ATOM   2474 C CD    . GLU A  1 310 ? 22.752  3.603   8.892   1.00 13.94  ? 755  GLU A CD    1 
ATOM   2475 O OE1   . GLU A  1 310 ? 23.818  4.053   9.380   1.00 14.64  ? 755  GLU A OE1   1 
ATOM   2476 O OE2   . GLU A  1 310 ? 21.800  3.164   9.592   1.00 16.45  ? 755  GLU A OE2   1 
ATOM   2477 N N     . ASN A  1 311 ? 23.682  4.960   4.272   1.00 11.15  ? 756  ASN A N     1 
ATOM   2478 C CA    . ASN A  1 311 ? 23.472  6.355   3.996   1.00 11.77  ? 756  ASN A CA    1 
ATOM   2479 C C     . ASN A  1 311 ? 22.695  6.459   2.656   1.00 11.55  ? 756  ASN A C     1 
ATOM   2480 O O     . ASN A  1 311 ? 21.765  7.244   2.522   1.00 10.79  ? 756  ASN A O     1 
ATOM   2481 C CB    . ASN A  1 311 ? 24.820  7.097   3.934   1.00 11.44  ? 756  ASN A CB    1 
ATOM   2482 C CG    . ASN A  1 311 ? 25.783  6.617   4.965   1.00 13.29  ? 756  ASN A CG    1 
ATOM   2483 O OD1   . ASN A  1 311 ? 26.798  5.991   4.629   1.00 12.61  ? 756  ASN A OD1   1 
ATOM   2484 N ND2   . ASN A  1 311 ? 25.420  6.782   6.258   1.00 13.08  ? 756  ASN A ND2   1 
ATOM   2485 N N     . ILE A  1 312 ? 23.097  5.650   1.681   1.00 10.17  ? 757  ILE A N     1 
ATOM   2486 C CA    . ILE A  1 312 ? 22.364  5.541   0.442   1.00 10.42  ? 757  ILE A CA    1 
ATOM   2487 C C     . ILE A  1 312 ? 20.912  5.060   0.659   1.00 10.35  ? 757  ILE A C     1 
ATOM   2488 O O     . ILE A  1 312 ? 19.950  5.700   0.124   1.00 10.84  ? 757  ILE A O     1 
ATOM   2489 C CB    . ILE A  1 312 ? 23.092  4.594   -0.575  1.00 10.85  ? 757  ILE A CB    1 
ATOM   2490 C CG1   . ILE A  1 312 ? 24.361  5.276   -1.134  1.00 10.73  ? 757  ILE A CG1   1 
ATOM   2491 C CG2   . ILE A  1 312 ? 22.170  4.193   -1.664  1.00 11.01  ? 757  ILE A CG2   1 
ATOM   2492 C CD1   . ILE A  1 312 ? 25.233  4.299   -1.918  1.00 11.37  ? 757  ILE A CD1   1 
ATOM   2493 N N     . ARG A  1 313 ? 20.707  4.043   1.487   1.00 9.60   ? 758  ARG A N     1 
ATOM   2494 C CA    . ARG A  1 313 ? 19.329  3.573   1.743   1.00 11.04  ? 758  ARG A CA    1 
ATOM   2495 C C     . ARG A  1 313 ? 18.417  4.671   2.395   1.00 11.34  ? 758  ARG A C     1 
ATOM   2496 O O     . ARG A  1 313 ? 17.228  4.829   2.001   1.00 10.35  ? 758  ARG A O     1 
ATOM   2497 C CB    . ARG A  1 313 ? 19.290  2.285   2.586   1.00 11.80  ? 758  ARG A CB    1 
ATOM   2498 C CG    . ARG A  1 313 ? 17.944  1.554   2.527   1.00 12.71  ? 758  ARG A CG    1 
ATOM   2499 C CD    . ARG A  1 313 ? 17.825  0.766   1.229   1.00 13.08  ? 758  ARG A CD    1 
ATOM   2500 N NE    . ARG A  1 313 ? 16.445  0.363   0.861   1.00 12.96  ? 758  ARG A NE    1 
ATOM   2501 C CZ    . ARG A  1 313 ? 15.889  -0.796  1.178   1.00 13.25  ? 758  ARG A CZ    1 
ATOM   2502 N NH1   . ARG A  1 313 ? 16.515  -1.663  1.984   1.00 13.06  ? 758  ARG A NH1   1 
ATOM   2503 N NH2   . ARG A  1 313 ? 14.691  -1.081  0.744   1.00 12.34  ? 758  ARG A NH2   1 
ATOM   2504 N N     . PHE A  1 314 ? 18.981  5.427   3.349   1.00 11.42  ? 759  PHE A N     1 
ATOM   2505 C CA    . PHE A  1 314 ? 18.303  6.543   3.952   1.00 11.44  ? 759  PHE A CA    1 
ATOM   2506 C C     . PHE A  1 314 ? 17.991  7.686   2.943   1.00 11.53  ? 759  PHE A C     1 
ATOM   2507 O O     . PHE A  1 314 ? 17.053  8.431   3.160   1.00 12.66  ? 759  PHE A O     1 
ATOM   2508 C CB    . PHE A  1 314 ? 19.095  7.092   5.176   1.00 11.49  ? 759  PHE A CB    1 
ATOM   2509 C CG    . PHE A  1 314 ? 18.831  6.334   6.508   1.00 11.81  ? 759  PHE A CG    1 
ATOM   2510 C CD1   . PHE A  1 314 ? 18.948  4.957   6.585   1.00 11.95  ? 759  PHE A CD1   1 
ATOM   2511 C CD2   . PHE A  1 314 ? 18.430  7.022   7.663   1.00 12.21  ? 759  PHE A CD2   1 
ATOM   2512 C CE1   . PHE A  1 314 ? 18.715  4.275   7.800   1.00 12.68  ? 759  PHE A CE1   1 
ATOM   2513 C CE2   . PHE A  1 314 ? 18.170  6.349   8.858   1.00 11.83  ? 759  PHE A CE2   1 
ATOM   2514 C CZ    . PHE A  1 314 ? 18.317  4.976   8.933   1.00 11.91  ? 759  PHE A CZ    1 
ATOM   2515 N N     . LEU A  1 315 ? 18.770  7.831   1.874   1.00 10.71  ? 760  LEU A N     1 
ATOM   2516 C CA    . LEU A  1 315 ? 18.468  8.858   0.823   1.00 11.33  ? 760  LEU A CA    1 
ATOM   2517 C C     . LEU A  1 315 ? 17.365  8.419   -0.140  1.00 11.35  ? 760  LEU A C     1 
ATOM   2518 O O     . LEU A  1 315 ? 16.507  9.224   -0.500  1.00 10.64  ? 760  LEU A O     1 
ATOM   2519 C CB    . LEU A  1 315 ? 19.711  9.203   0.031   1.00 12.17  ? 760  LEU A CB    1 
ATOM   2520 C CG    . LEU A  1 315 ? 20.776  9.906   0.844   1.00 12.67  ? 760  LEU A CG    1 
ATOM   2521 C CD1   . LEU A  1 315 ? 22.034  10.010  0.002   1.00 13.96  ? 760  LEU A CD1   1 
ATOM   2522 C CD2   . LEU A  1 315 ? 20.333  11.282  1.346   1.00 13.61  ? 760  LEU A CD2   1 
ATOM   2523 N N     . ILE A  1 316 ? 17.388  7.152   -0.560  1.00 11.75  ? 761  ILE A N     1 
ATOM   2524 C CA    . ILE A  1 316 ? 16.424  6.699   -1.514  1.00 11.67  ? 761  ILE A CA    1 
ATOM   2525 C C     . ILE A  1 316 ? 15.090  6.360   -0.885  1.00 11.88  ? 761  ILE A C     1 
ATOM   2526 O O     . ILE A  1 316 ? 14.058  6.385   -1.610  1.00 10.94  ? 761  ILE A O     1 
ATOM   2527 C CB    . ILE A  1 316 ? 16.921  5.584   -2.424  1.00 12.27  ? 761  ILE A CB    1 
ATOM   2528 C CG1   . ILE A  1 316 ? 17.105  4.264   -1.652  1.00 12.70  ? 761  ILE A CG1   1 
ATOM   2529 C CG2   . ILE A  1 316 ? 18.176  6.025   -3.180  1.00 12.97  ? 761  ILE A CG2   1 
ATOM   2530 C CD1   . ILE A  1 316 ? 17.642  3.076   -2.495  1.00 14.70  ? 761  ILE A CD1   1 
ATOM   2531 N N     . ASN A  1 317 ? 15.092  5.982   0.426   1.00 11.01  ? 762  ASN A N     1 
ATOM   2532 C CA    . ASN A  1 317 ? 13.898  5.840   1.228   1.00 11.52  ? 762  ASN A CA    1 
ATOM   2533 C C     . ASN A  1 317 ? 13.928  6.859   2.378   1.00 12.66  ? 762  ASN A C     1 
ATOM   2534 O O     . ASN A  1 317 ? 14.149  6.460   3.566   1.00 10.82  ? 762  ASN A O     1 
ATOM   2535 C CB    . ASN A  1 317 ? 13.786  4.405   1.869   1.00 11.80  ? 762  ASN A CB    1 
ATOM   2536 C CG    . ASN A  1 317 ? 13.428  3.323   0.857   1.00 12.43  ? 762  ASN A CG    1 
ATOM   2537 O OD1   . ASN A  1 317 ? 13.878  3.375   -0.307  1.00 13.34  ? 762  ASN A OD1   1 
ATOM   2538 N ND2   . ASN A  1 317 ? 12.580  2.397   1.249   1.00 10.75  ? 762  ASN A ND2   1 
ATOM   2539 N N     . PRO A  1 318 ? 13.686  8.144   2.079   1.00 12.82  ? 763  PRO A N     1 
ATOM   2540 C CA    . PRO A  1 318 ? 13.950  9.202   3.093   1.00 13.03  ? 763  PRO A CA    1 
ATOM   2541 C C     . PRO A  1 318 ? 13.113  9.176   4.332   1.00 12.44  ? 763  PRO A C     1 
ATOM   2542 O O     . PRO A  1 318 ? 13.494  9.798   5.378   1.00 12.90  ? 763  PRO A O     1 
ATOM   2543 C CB    . PRO A  1 318 ? 13.673  10.530  2.311   1.00 14.74  ? 763  PRO A CB    1 
ATOM   2544 C CG    . PRO A  1 318 ? 13.622  10.152  0.907   1.00 14.43  ? 763  PRO A CG    1 
ATOM   2545 C CD    . PRO A  1 318 ? 13.241  8.723   0.804   1.00 14.54  ? 763  PRO A CD    1 
ATOM   2546 N N     . GLU A  1 319 ? 11.992  8.464   4.310   1.00 12.69  ? 764  GLU A N     1 
ATOM   2547 C CA    . GLU A  1 319 ? 11.220  8.332   5.507   1.00 12.40  ? 764  GLU A CA    1 
ATOM   2548 C C     . GLU A  1 319 ? 12.038  7.660   6.647   1.00 12.52  ? 764  GLU A C     1 
ATOM   2549 O O     . GLU A  1 319 ? 11.745  7.866   7.839   1.00 12.03  ? 764  GLU A O     1 
ATOM   2550 C CB    . GLU A  1 319 ? 9.875   7.621   5.259   1.00 12.93  ? 764  GLU A CB    1 
ATOM   2551 C CG    . GLU A  1 319 ? 8.883   8.491   4.429   1.00 13.33  ? 764  GLU A CG    1 
ATOM   2552 C CD    . GLU A  1 319 ? 7.960   7.720   3.474   1.00 14.65  ? 764  GLU A CD    1 
ATOM   2553 O OE1   . GLU A  1 319 ? 8.198   6.518   3.226   1.00 13.82  ? 764  GLU A OE1   1 
ATOM   2554 O OE2   . GLU A  1 319 ? 7.043   8.384   2.902   1.00 14.83  ? 764  GLU A OE2   1 
ATOM   2555 N N     . LEU A  1 320 ? 13.041  6.845   6.283   1.00 11.06  ? 765  LEU A N     1 
ATOM   2556 C CA    . LEU A  1 320 ? 13.999  6.345   7.294   1.00 10.87  ? 765  LEU A CA    1 
ATOM   2557 C C     . LEU A  1 320 ? 14.665  7.443   8.169   1.00 10.30  ? 765  LEU A C     1 
ATOM   2558 O O     . LEU A  1 320 ? 15.022  7.205   9.364   1.00 10.70  ? 765  LEU A O     1 
ATOM   2559 C CB    . LEU A  1 320 ? 15.124  5.489   6.615   1.00 10.65  ? 765  LEU A CB    1 
ATOM   2560 C CG    . LEU A  1 320 ? 14.613  4.165   6.025   1.00 11.10  ? 765  LEU A CG    1 
ATOM   2561 C CD1   . LEU A  1 320 ? 15.632  3.553   5.092   1.00 12.23  ? 765  LEU A CD1   1 
ATOM   2562 C CD2   . LEU A  1 320 ? 14.282  3.158   7.117   1.00 11.98  ? 765  LEU A CD2   1 
ATOM   2563 N N     . ILE A  1 321 ? 14.956  8.589   7.551   1.00 10.72  ? 766  ILE A N     1 
ATOM   2564 C CA    . ILE A  1 321 ? 15.712  9.633   8.200   1.00 11.36  ? 766  ILE A CA    1 
ATOM   2565 C C     . ILE A  1 321 ? 15.017  10.111  9.466   1.00 11.38  ? 766  ILE A C     1 
ATOM   2566 O O     . ILE A  1 321 ? 15.675  10.564  10.391  1.00 12.12  ? 766  ILE A O     1 
ATOM   2567 C CB    . ILE A  1 321 ? 15.960  10.825  7.243   1.00 11.15  ? 766  ILE A CB    1 
ATOM   2568 C CG1   . ILE A  1 321 ? 16.930  10.406  6.189   1.00 12.94  ? 766  ILE A CG1   1 
ATOM   2569 C CG2   . ILE A  1 321 ? 16.569  12.047  7.958   1.00 12.45  ? 766  ILE A CG2   1 
ATOM   2570 C CD1   . ILE A  1 321 ? 16.941  11.325  4.989   1.00 13.45  ? 766  ILE A CD1   1 
ATOM   2571 N N     . ILE A  1 322 ? 13.681  10.063  9.507   1.00 11.24  ? 767  ILE A N     1 
ATOM   2572 C CA    . ILE A  1 322 ? 12.971  10.614  10.676  1.00 11.93  ? 767  ILE A CA    1 
ATOM   2573 C C     . ILE A  1 322 ? 13.195  9.752   11.927  1.00 12.47  ? 767  ILE A C     1 
ATOM   2574 O O     . ILE A  1 322 ? 12.978  10.246  13.082  1.00 12.62  ? 767  ILE A O     1 
ATOM   2575 C CB    . ILE A  1 322 ? 11.481  10.866  10.437  1.00 11.44  ? 767  ILE A CB    1 
ATOM   2576 C CG1   . ILE A  1 322 ? 10.955  11.942  11.422  1.00 13.18  ? 767  ILE A CG1   1 
ATOM   2577 C CG2   . ILE A  1 322 ? 10.675  9.601   10.622  1.00 12.29  ? 767  ILE A CG2   1 
ATOM   2578 C CD1   . ILE A  1 322 ? 11.595  13.288  11.218  1.00 12.85  ? 767  ILE A CD1   1 
ATOM   2579 N N     . SER A  1 323 ? 13.672  8.510   11.745  1.00 11.73  ? 768  SER A N     1 
ATOM   2580 C CA    . SER A  1 323 ? 14.064  7.713   12.906  1.00 12.76  ? 768  SER A CA    1 
ATOM   2581 C C     . SER A  1 323 ? 15.068  8.491   13.811  1.00 12.85  ? 768  SER A C     1 
ATOM   2582 O O     . SER A  1 323 ? 15.144  8.263   15.001  1.00 13.58  ? 768  SER A O     1 
ATOM   2583 C CB    . SER A  1 323 ? 14.652  6.336   12.484  1.00 12.99  ? 768  SER A CB    1 
ATOM   2584 O OG    . SER A  1 323 ? 15.860  6.472   11.835  1.00 13.52  ? 768  SER A OG    1 
ATOM   2585 N N     . ARG A  1 324 ? 15.851  9.342   13.216  1.00 12.43  ? 769  ARG A N     1 
ATOM   2586 C CA    . ARG A  1 324 ? 16.879  10.115  13.918  1.00 12.50  ? 769  ARG A CA    1 
ATOM   2587 C C     . ARG A  1 324 ? 16.317  11.174  14.881  1.00 12.96  ? 769  ARG A C     1 
ATOM   2588 O O     . ARG A  1 324 ? 16.990  11.551  15.830  1.00 12.21  ? 769  ARG A O     1 
ATOM   2589 C CB    . ARG A  1 324 ? 17.821  10.784  12.905  1.00 12.43  ? 769  ARG A CB    1 
ATOM   2590 C CG    . ARG A  1 324 ? 18.688  9.773   12.202  1.00 13.15  ? 769  ARG A CG    1 
ATOM   2591 C CD    . ARG A  1 324 ? 19.229  10.276  10.876  1.00 15.66  ? 769  ARG A CD    1 
ATOM   2592 N NE    . ARG A  1 324 ? 20.265  11.297  10.989  1.00 14.39  ? 769  ARG A NE    1 
ATOM   2593 C CZ    . ARG A  1 324 ? 21.567  11.045  11.197  1.00 16.20  ? 769  ARG A CZ    1 
ATOM   2594 N NH1   . ARG A  1 324 ? 22.012  9.811   11.367  1.00 14.86  ? 769  ARG A NH1   1 
ATOM   2595 N NH2   . ARG A  1 324 ? 22.458  12.046  11.166  1.00 18.53  ? 769  ARG A NH2   1 
ATOM   2596 N N     . LEU A  1 325 ? 15.075  11.559  14.661  1.00 12.48  ? 770  LEU A N     1 
ATOM   2597 C CA    . LEU A  1 325 ? 14.367  12.463  15.560  1.00 13.42  ? 770  LEU A CA    1 
ATOM   2598 C C     . LEU A  1 325 ? 14.152  11.900  16.945  1.00 12.94  ? 770  LEU A C     1 
ATOM   2599 O O     . LEU A  1 325 ? 14.302  12.622  17.933  1.00 14.55  ? 770  LEU A O     1 
ATOM   2600 C CB    . LEU A  1 325 ? 13.024  12.901  14.898  1.00 13.25  ? 770  LEU A CB    1 
ATOM   2601 C CG    . LEU A  1 325 ? 12.173  13.952  15.664  1.00 13.87  ? 770  LEU A CG    1 
ATOM   2602 C CD1   . LEU A  1 325 ? 12.925  15.319  15.784  1.00 13.06  ? 770  LEU A CD1   1 
ATOM   2603 C CD2   . LEU A  1 325 ? 10.843  14.107  14.944  1.00 13.62  ? 770  LEU A CD2   1 
ATOM   2604 N N     . PHE A  1 326 ? 13.858  10.600  17.044  1.00 13.89  ? 771  PHE A N     1 
ATOM   2605 C CA    . PHE A  1 326 ? 13.378  10.008  18.283  1.00 13.67  ? 771  PHE A CA    1 
ATOM   2606 C C     . PHE A  1 326 ? 14.113  8.739   18.706  1.00 13.03  ? 771  PHE A C     1 
ATOM   2607 O O     . PHE A  1 326 ? 13.755  8.155   19.699  1.00 15.38  ? 771  PHE A O     1 
ATOM   2608 C CB    . PHE A  1 326 ? 11.858  9.762   18.230  1.00 12.90  ? 771  PHE A CB    1 
ATOM   2609 C CG    . PHE A  1 326 ? 11.373  9.100   16.918  1.00 13.38  ? 771  PHE A CG    1 
ATOM   2610 C CD1   . PHE A  1 326 ? 11.585  7.747   16.684  1.00 12.80  ? 771  PHE A CD1   1 
ATOM   2611 C CD2   . PHE A  1 326 ? 10.621  9.815   16.006  1.00 13.25  ? 771  PHE A CD2   1 
ATOM   2612 C CE1   . PHE A  1 326 ? 11.119  7.147   15.515  1.00 13.23  ? 771  PHE A CE1   1 
ATOM   2613 C CE2   . PHE A  1 326 ? 10.136  9.197   14.842  1.00 14.00  ? 771  PHE A CE2   1 
ATOM   2614 C CZ    . PHE A  1 326 ? 10.384  7.871   14.613  1.00 13.40  ? 771  PHE A CZ    1 
ATOM   2615 N N     . THR A  1 327 ? 15.111  8.300   17.960  1.00 13.52  ? 772  THR A N     1 
ATOM   2616 C CA    . THR A  1 327 ? 15.765  7.027   18.278  1.00 14.45  ? 772  THR A CA    1 
ATOM   2617 C C     . THR A  1 327 ? 17.143  7.224   18.999  1.00 13.98  ? 772  THR A C     1 
ATOM   2618 O O     . THR A  1 327 ? 18.093  7.676   18.403  1.00 14.84  ? 772  THR A O     1 
ATOM   2619 C CB    . THR A  1 327 ? 15.972  6.151   17.015  1.00 13.86  ? 772  THR A CB    1 
ATOM   2620 O OG1   . THR A  1 327 ? 14.726  5.949   16.372  1.00 12.96  ? 772  THR A OG1   1 
ATOM   2621 C CG2   . THR A  1 327 ? 16.519  4.788   17.417  1.00 12.97  ? 772  THR A CG2   1 
ATOM   2622 N N     . GLU A  1 328 ? 17.225  6.851   20.272  1.00 14.51  ? 773  GLU A N     1 
ATOM   2623 C CA    . GLU A  1 328 ? 18.478  6.975   21.015  1.00 13.80  ? 773  GLU A CA    1 
ATOM   2624 C C     . GLU A  1 328 ? 19.528  5.992   20.451  1.00 14.64  ? 773  GLU A C     1 
ATOM   2625 O O     . GLU A  1 328 ? 19.181  4.934   19.866  1.00 13.50  ? 773  GLU A O     1 
ATOM   2626 C CB    . GLU A  1 328 ? 18.229  6.714   22.546  1.00 14.96  ? 773  GLU A CB    1 
ATOM   2627 C CG    . GLU A  1 328 ? 19.398  7.147   23.365  1.00 17.50  ? 773  GLU A CG    1 
ATOM   2628 C CD    . GLU A  1 328 ? 19.131  7.267   24.898  1.00 20.84  ? 773  GLU A CD    1 
ATOM   2629 O OE1   . GLU A  1 328 ? 18.137  6.738   25.370  1.00 19.64  ? 773  GLU A OE1   1 
ATOM   2630 O OE2   . GLU A  1 328 ? 20.011  7.862   25.577  1.00 21.81  ? 773  GLU A OE2   1 
ATOM   2631 N N     . VAL A  1 329 ? 20.805  6.358   20.593  1.00 15.56  ? 774  VAL A N     1 
ATOM   2632 C CA    . VAL A  1 329 ? 21.918  5.507   20.237  1.00 15.17  ? 774  VAL A CA    1 
ATOM   2633 C C     . VAL A  1 329 ? 21.679  4.041   20.668  1.00 16.05  ? 774  VAL A C     1 
ATOM   2634 O O     . VAL A  1 329 ? 21.178  3.747   21.792  1.00 13.80  ? 774  VAL A O     1 
ATOM   2635 C CB    . VAL A  1 329 ? 23.256  6.088   20.792  1.00 17.21  ? 774  VAL A CB    1 
ATOM   2636 C CG1   . VAL A  1 329 ? 23.372  5.872   22.311  1.00 20.52  ? 774  VAL A CG1   1 
ATOM   2637 C CG2   . VAL A  1 329 ? 24.455  5.455   20.093  1.00 17.59  ? 774  VAL A CG2   1 
ATOM   2638 N N     . LEU A  1 330 ? 21.961  3.110   19.757  1.00 14.86  ? 775  LEU A N     1 
ATOM   2639 C CA    . LEU A  1 330 ? 21.689  1.727   20.005  1.00 15.66  ? 775  LEU A CA    1 
ATOM   2640 C C     . LEU A  1 330 ? 22.775  1.129   20.945  1.00 15.05  ? 775  LEU A C     1 
ATOM   2641 O O     . LEU A  1 330 ? 23.979  1.339   20.727  1.00 15.74  ? 775  LEU A O     1 
ATOM   2642 C CB    . LEU A  1 330 ? 21.654  0.937   18.680  1.00 17.31  ? 775  LEU A CB    1 
ATOM   2643 C CG    . LEU A  1 330 ? 20.517  1.224   17.671  1.00 17.60  ? 775  LEU A CG    1 
ATOM   2644 C CD1   . LEU A  1 330 ? 20.684  0.336   16.422  1.00 17.37  ? 775  LEU A CD1   1 
ATOM   2645 C CD2   . LEU A  1 330 ? 19.146  1.020   18.264  1.00 17.45  ? 775  LEU A CD2   1 
ATOM   2646 N N     . ASP A  1 331 ? 22.336  0.409   21.963  1.00 15.49  ? 776  ASP A N     1 
ATOM   2647 C CA    . ASP A  1 331 ? 23.276  -0.391  22.809  1.00 17.69  ? 776  ASP A CA    1 
ATOM   2648 C C     . ASP A  1 331 ? 23.461  -1.778  22.160  1.00 17.52  ? 776  ASP A C     1 
ATOM   2649 O O     . ASP A  1 331 ? 22.802  -2.100  21.184  1.00 15.52  ? 776  ASP A O     1 
ATOM   2650 C CB    . ASP A  1 331 ? 22.728  -0.491  24.240  1.00 18.59  ? 776  ASP A CB    1 
ATOM   2651 C CG    . ASP A  1 331 ? 23.824  -0.744  25.296  1.00 24.32  ? 776  ASP A CG    1 
ATOM   2652 O OD1   . ASP A  1 331 ? 25.013  -1.014  24.940  1.00 21.32  ? 776  ASP A OD1   1 
ATOM   2653 O OD2   . ASP A  1 331 ? 23.447  -0.684  26.476  1.00 26.66  ? 776  ASP A OD2   1 
ATOM   2654 N N     . HIS A  1 332 ? 24.413  -2.561  22.683  1.00 18.43  ? 777  HIS A N     1 
ATOM   2655 C CA    . HIS A  1 332 ? 24.807  -3.882  22.112  1.00 17.28  ? 777  HIS A CA    1 
ATOM   2656 C C     . HIS A  1 332 ? 23.650  -4.875  21.969  1.00 16.09  ? 777  HIS A C     1 
ATOM   2657 O O     . HIS A  1 332 ? 23.665  -5.752  21.100  1.00 16.59  ? 777  HIS A O     1 
ATOM   2658 C CB    . HIS A  1 332 ? 25.949  -4.513  22.994  1.00 18.82  ? 777  HIS A CB    1 
ATOM   2659 C CG    . HIS A  1 332 ? 27.176  -3.662  23.113  1.00 19.22  ? 777  HIS A CG    1 
ATOM   2660 N ND1   . HIS A  1 332 ? 27.995  -3.360  22.039  1.00 20.50  ? 777  HIS A ND1   1 
ATOM   2661 C CD2   . HIS A  1 332 ? 27.753  -3.077  24.198  1.00 21.62  ? 777  HIS A CD2   1 
ATOM   2662 C CE1   . HIS A  1 332 ? 28.975  -2.573  22.439  1.00 21.05  ? 777  HIS A CE1   1 
ATOM   2663 N NE2   . HIS A  1 332 ? 28.837  -2.373  23.748  1.00 22.93  ? 777  HIS A NE2   1 
ATOM   2664 N N     . ASN A  1 333 ? 22.615  -4.722  22.777  1.00 16.61  ? 778  ASN A N     1 
ATOM   2665 C CA    . ASN A  1 333 ? 21.478  -5.659  22.768  1.00 17.15  ? 778  ASN A CA    1 
ATOM   2666 C C     . ASN A  1 333 ? 20.210  -5.129  22.048  1.00 15.36  ? 778  ASN A C     1 
ATOM   2667 O O     . ASN A  1 333 ? 19.142  -5.676  22.222  1.00 15.84  ? 778  ASN A O     1 
ATOM   2668 C CB    . ASN A  1 333 ? 21.100  -6.048  24.199  1.00 19.30  ? 778  ASN A CB    1 
ATOM   2669 C CG    . ASN A  1 333 ? 20.597  -4.855  25.019  1.00 20.02  ? 778  ASN A CG    1 
ATOM   2670 O OD1   . ASN A  1 333 ? 21.147  -3.763  24.955  1.00 19.81  ? 778  ASN A OD1   1 
ATOM   2671 N ND2   . ASN A  1 333 ? 19.574  -5.083  25.789  1.00 22.30  ? 778  ASN A ND2   1 
ATOM   2672 N N     . GLU A  1 334 ? 20.366  -4.109  21.216  1.00 16.40  ? 779  GLU A N     1 
ATOM   2673 C CA    . GLU A  1 334 ? 19.205  -3.383  20.633  1.00 15.05  ? 779  GLU A CA    1 
ATOM   2674 C C     . GLU A  1 334 ? 19.296  -3.286  19.090  1.00 13.92  ? 779  GLU A C     1 
ATOM   2675 O O     . GLU A  1 334 ? 20.357  -3.254  18.545  1.00 13.79  ? 779  GLU A O     1 
ATOM   2676 C CB    . GLU A  1 334 ? 19.137  -1.973  21.205  1.00 16.33  ? 779  GLU A CB    1 
ATOM   2677 C CG    . GLU A  1 334 ? 19.003  -1.912  22.761  1.00 17.81  ? 779  GLU A CG    1 
ATOM   2678 C CD    . GLU A  1 334 ? 18.716  -0.500  23.241  1.00 18.35  ? 779  GLU A CD    1 
ATOM   2679 O OE1   . GLU A  1 334 ? 19.610  0.338   23.070  1.00 19.01  ? 779  GLU A OE1   1 
ATOM   2680 O OE2   . GLU A  1 334 ? 17.559  -0.218  23.696  1.00 19.80  ? 779  GLU A OE2   1 
ATOM   2681 N N     . CYS A  1 335 ? 18.140  -3.121  18.466  1.00 13.95  ? 780  CYS A N     1 
ATOM   2682 C CA    . CYS A  1 335 ? 18.029  -2.799  17.085  1.00 14.60  ? 780  CYS A CA    1 
ATOM   2683 C C     . CYS A  1 335 ? 16.809  -1.893  16.893  1.00 13.63  ? 780  CYS A C     1 
ATOM   2684 O O     . CYS A  1 335 ? 16.016  -1.685  17.830  1.00 13.81  ? 780  CYS A O     1 
ATOM   2685 C CB    . CYS A  1 335 ? 17.900  -4.112  16.256  1.00 14.23  ? 780  CYS A CB    1 
ATOM   2686 S SG    . CYS A  1 335 ? 16.308  -4.925  16.266  1.00 16.48  ? 780  CYS A SG    1 
ATOM   2687 N N     . LEU A  1 336 ? 16.679  -1.363  15.682  1.00 13.67  ? 781  LEU A N     1 
ATOM   2688 C CA    . LEU A  1 336 ? 15.508  -0.623  15.219  1.00 13.08  ? 781  LEU A CA    1 
ATOM   2689 C C     . LEU A  1 336 ? 14.915  -1.269  13.935  1.00 12.78  ? 781  LEU A C     1 
ATOM   2690 O O     . LEU A  1 336 ? 15.661  -1.585  12.956  1.00 11.01  ? 781  LEU A O     1 
ATOM   2691 C CB    . LEU A  1 336 ? 15.907  0.820   14.949  1.00 14.12  ? 781  LEU A CB    1 
ATOM   2692 C CG    . LEU A  1 336 ? 14.746  1.695   14.422  1.00 15.34  ? 781  LEU A CG    1 
ATOM   2693 C CD1   . LEU A  1 336 ? 13.804  2.110   15.540  1.00 16.77  ? 781  LEU A CD1   1 
ATOM   2694 C CD2   . LEU A  1 336 ? 15.275  2.903   13.711  1.00 16.96  ? 781  LEU A CD2   1 
ATOM   2695 N N     . ILE A  1 337 ? 13.613  -1.550  13.972  1.00 12.45  ? 782  ILE A N     1 
ATOM   2696 C CA    . ILE A  1 337 ? 12.910  -2.214  12.871  1.00 12.68  ? 782  ILE A CA    1 
ATOM   2697 C C     . ILE A  1 337 ? 11.883  -1.248  12.285  1.00 12.79  ? 782  ILE A C     1 
ATOM   2698 O O     . ILE A  1 337 ? 11.093  -0.670  13.021  1.00 12.57  ? 782  ILE A O     1 
ATOM   2699 C CB    . ILE A  1 337 ? 12.205  -3.464  13.365  1.00 13.46  ? 782  ILE A CB    1 
ATOM   2700 C CG1   . ILE A  1 337 ? 13.191  -4.368  14.105  1.00 15.98  ? 782  ILE A CG1   1 
ATOM   2701 C CG2   . ILE A  1 337 ? 11.478  -4.207  12.204  1.00 13.42  ? 782  ILE A CG2   1 
ATOM   2702 C CD1   . ILE A  1 337 ? 12.471  -5.349  15.035  1.00 16.75  ? 782  ILE A CD1   1 
ATOM   2703 N N     . ILE A  1 338 ? 12.005  -0.969  10.985  1.00 12.56  ? 783  ILE A N     1 
ATOM   2704 C CA    . ILE A  1 338 ? 11.135  0.015   10.314  1.00 13.07  ? 783  ILE A CA    1 
ATOM   2705 C C     . ILE A  1 338 ? 10.348  -0.661  9.182   1.00 12.66  ? 783  ILE A C     1 
ATOM   2706 O O     . ILE A  1 338 ? 10.938  -1.223  8.226   1.00 12.86  ? 783  ILE A O     1 
ATOM   2707 C CB    . ILE A  1 338 ? 11.917  1.194   9.697   1.00 12.84  ? 783  ILE A CB    1 
ATOM   2708 C CG1   . ILE A  1 338 ? 12.987  1.743   10.649  1.00 15.96  ? 783  ILE A CG1   1 
ATOM   2709 C CG2   . ILE A  1 338 ? 10.966  2.332   9.323   1.00 13.30  ? 783  ILE A CG2   1 
ATOM   2710 C CD1   . ILE A  1 338 ? 14.369  1.069   10.471  1.00 17.69  ? 783  ILE A CD1   1 
ATOM   2711 N N     . THR A  1 339 ? 9.031   -0.582  9.272   1.00 11.95  ? 784  THR A N     1 
ATOM   2712 C CA    . THR A  1 339 ? 8.131   -1.200  8.297   1.00 11.30  ? 784  THR A CA    1 
ATOM   2713 C C     . THR A  1 339 ? 7.286   -0.190  7.593   1.00 11.81  ? 784  THR A C     1 
ATOM   2714 O O     . THR A  1 339 ? 6.579   0.613   8.244   1.00 11.48  ? 784  THR A O     1 
ATOM   2715 C CB    . THR A  1 339 ? 7.210   -2.206  8.994   1.00 11.68  ? 784  THR A CB    1 
ATOM   2716 O OG1   . THR A  1 339 ? 8.033   -3.145  9.715   1.00 12.93  ? 784  THR A OG1   1 
ATOM   2717 C CG2   . THR A  1 339 ? 6.378   -2.940  7.996   1.00 11.86  ? 784  THR A CG2   1 
ATOM   2718 N N     . GLY A  1 340 ? 7.389   -0.164  6.263   1.00 11.09  ? 785  GLY A N     1 
ATOM   2719 C CA    . GLY A  1 340 ? 6.511   0.666   5.476   1.00 12.12  ? 785  GLY A CA    1 
ATOM   2720 C C     . GLY A  1 340 ? 7.138   1.801   4.695   1.00 11.50  ? 785  GLY A C     1 
ATOM   2721 O O     . GLY A  1 340 ? 6.404   2.523   3.997   1.00 11.43  ? 785  GLY A O     1 
ATOM   2722 N N     . THR A  1 341 ? 8.469   1.997   4.806   1.00 10.88  ? 786  THR A N     1 
ATOM   2723 C CA    . THR A  1 341 ? 9.091   3.093   4.080   1.00 10.89  ? 786  THR A CA    1 
ATOM   2724 C C     . THR A  1 341 ? 8.986   2.824   2.558   1.00 11.94  ? 786  THR A C     1 
ATOM   2725 O O     . THR A  1 341 ? 8.987   1.670   2.113   1.00 13.60  ? 786  THR A O     1 
ATOM   2726 C CB    . THR A  1 341 ? 10.546  3.388   4.467   1.00 11.10  ? 786  THR A CB    1 
ATOM   2727 O OG1   . THR A  1 341 ? 11.406  2.315   4.064   1.00 10.82  ? 786  THR A OG1   1 
ATOM   2728 C CG2   . THR A  1 341 ? 10.671  3.617   5.964   1.00 11.69  ? 786  THR A CG2   1 
ATOM   2729 N N     . GLU A  1 342 ? 8.833   3.893   1.815   1.00 11.19  ? 787  GLU A N     1 
ATOM   2730 C CA    . GLU A  1 342 ? 8.668   3.877   0.373   1.00 12.23  ? 787  GLU A CA    1 
ATOM   2731 C C     . GLU A  1 342 ? 9.946   4.324   -0.343  1.00 10.99  ? 787  GLU A C     1 
ATOM   2732 O O     . GLU A  1 342 ? 10.648  5.245   0.125   1.00 11.52  ? 787  GLU A O     1 
ATOM   2733 C CB    . GLU A  1 342 ? 7.526   4.844   0.029   1.00 13.38  ? 787  GLU A CB    1 
ATOM   2734 C CG    . GLU A  1 342 ? 7.247   4.943   -1.448  1.00 16.44  ? 787  GLU A CG    1 
ATOM   2735 C CD    . GLU A  1 342 ? 5.871   5.565   -1.771  1.00 17.80  ? 787  GLU A CD    1 
ATOM   2736 O OE1   . GLU A  1 342 ? 4.941   5.535   -0.937  1.00 17.15  ? 787  GLU A OE1   1 
ATOM   2737 O OE2   . GLU A  1 342 ? 5.765   6.056   -2.866  1.00 17.21  ? 787  GLU A OE2   1 
ATOM   2738 N N     . GLN A  1 343 ? 10.278  3.666   -1.453  1.00 11.48  ? 788  GLN A N     1 
ATOM   2739 C CA    . GLN A  1 343 ? 11.410  4.081   -2.283  1.00 12.33  ? 788  GLN A CA    1 
ATOM   2740 C C     . GLN A  1 343 ? 10.991  5.180   -3.291  1.00 13.36  ? 788  GLN A C     1 
ATOM   2741 O O     . GLN A  1 343 ? 10.071  4.979   -4.096  1.00 12.89  ? 788  GLN A O     1 
ATOM   2742 C CB    . GLN A  1 343 ? 12.093  2.882   -2.980  1.00 13.39  ? 788  GLN A CB    1 
ATOM   2743 C CG    . GLN A  1 343 ? 13.371  3.255   -3.746  1.00 13.77  ? 788  GLN A CG    1 
ATOM   2744 C CD    . GLN A  1 343 ? 14.046  2.071   -4.465  1.00 14.49  ? 788  GLN A CD    1 
ATOM   2745 O OE1   . GLN A  1 343 ? 13.894  0.933   -4.065  1.00 14.61  ? 788  GLN A OE1   1 
ATOM   2746 N NE2   . GLN A  1 343 ? 14.864  2.367   -5.455  1.00 14.72  ? 788  GLN A NE2   1 
ATOM   2747 N N     . TYR A  1 344 ? 11.695  6.313   -3.259  1.00 11.30  ? 789  TYR A N     1 
ATOM   2748 C CA    . TYR A  1 344 ? 11.347  7.473   -4.110  1.00 12.37  ? 789  TYR A CA    1 
ATOM   2749 C C     . TYR A  1 344 ? 12.344  7.738   -5.217  1.00 12.80  ? 789  TYR A C     1 
ATOM   2750 O O     . TYR A  1 344 ? 12.005  8.406   -6.223  1.00 13.24  ? 789  TYR A O     1 
ATOM   2751 C CB    . TYR A  1 344 ? 11.215  8.754   -3.226  1.00 12.40  ? 789  TYR A CB    1 
ATOM   2752 C CG    . TYR A  1 344 ? 9.988   8.769   -2.358  1.00 13.10  ? 789  TYR A CG    1 
ATOM   2753 C CD1   . TYR A  1 344 ? 9.995   8.204   -1.082  1.00 12.82  ? 789  TYR A CD1   1 
ATOM   2754 C CD2   . TYR A  1 344 ? 8.791   9.419   -2.779  1.00 13.52  ? 789  TYR A CD2   1 
ATOM   2755 C CE1   . TYR A  1 344 ? 8.855   8.223   -0.286  1.00 12.92  ? 789  TYR A CE1   1 
ATOM   2756 C CE2   . TYR A  1 344 ? 7.659   9.444   -1.963  1.00 13.01  ? 789  TYR A CE2   1 
ATOM   2757 C CZ    . TYR A  1 344 ? 7.714   8.836   -0.705  1.00 13.68  ? 789  TYR A CZ    1 
ATOM   2758 O OH    . TYR A  1 344 ? 6.632   8.845   0.182   1.00 14.32  ? 789  TYR A OH    1 
ATOM   2759 N N     . SER A  1 345 ? 13.580  7.262   -5.049  1.00 12.21  ? 790  SER A N     1 
ATOM   2760 C CA    . SER A  1 345 ? 14.623  7.460   -6.071  1.00 12.34  ? 790  SER A CA    1 
ATOM   2761 C C     . SER A  1 345 ? 15.383  6.163   -6.460  1.00 12.58  ? 790  SER A C     1 
ATOM   2762 O O     . SER A  1 345 ? 15.448  5.210   -5.675  1.00 12.53  ? 790  SER A O     1 
ATOM   2763 C CB    . SER A  1 345 ? 15.676  8.462   -5.577  1.00 13.81  ? 790  SER A CB    1 
ATOM   2764 O OG    . SER A  1 345 ? 15.133  9.762   -5.311  1.00 13.26  ? 790  SER A OG    1 
ATOM   2765 N N     . GLU A  1 346 ? 15.991  6.187   -7.654  1.00 13.70  ? 791  GLU A N     1 
ATOM   2766 C CA    . GLU A  1 346 ? 16.978  5.252   -8.066  1.00 13.92  ? 791  GLU A CA    1 
ATOM   2767 C C     . GLU A  1 346 ? 18.346  5.944   -8.120  1.00 14.06  ? 791  GLU A C     1 
ATOM   2768 O O     . GLU A  1 346 ? 18.434  7.175   -8.315  1.00 14.35  ? 791  GLU A O     1 
ATOM   2769 C CB    . GLU A  1 346 ? 16.637  4.663   -9.463  1.00 16.30  ? 791  GLU A CB    1 
ATOM   2770 C CG    . GLU A  1 346 ? 15.300  3.923   -9.436  1.00 19.24  ? 791  GLU A CG    1 
ATOM   2771 C CD    . GLU A  1 346 ? 14.830  3.306   -10.756 1.00 21.36  ? 791  GLU A CD    1 
ATOM   2772 O OE1   . GLU A  1 346 ? 15.597  3.295   -11.757 1.00 20.26  ? 791  GLU A OE1   1 
ATOM   2773 O OE2   . GLU A  1 346 ? 13.642  2.827   -10.750 1.00 21.11  ? 791  GLU A OE2   1 
ATOM   2774 N N     . TYR A  1 347 ? 19.394  5.144   -8.040  1.00 13.09  ? 792  TYR A N     1 
ATOM   2775 C CA    . TYR A  1 347 ? 20.787  5.626   -8.083  1.00 13.17  ? 792  TYR A CA    1 
ATOM   2776 C C     . TYR A  1 347 ? 21.714  4.766   -8.957  1.00 13.90  ? 792  TYR A C     1 
ATOM   2777 O O     . TYR A  1 347 ? 21.411  3.634   -9.249  1.00 15.18  ? 792  TYR A O     1 
ATOM   2778 C CB    . TYR A  1 347 ? 21.357  5.724   -6.634  1.00 12.86  ? 792  TYR A CB    1 
ATOM   2779 C CG    . TYR A  1 347 ? 21.660  4.440   -5.969  1.00 13.12  ? 792  TYR A CG    1 
ATOM   2780 C CD1   . TYR A  1 347 ? 20.644  3.671   -5.356  1.00 12.53  ? 792  TYR A CD1   1 
ATOM   2781 C CD2   . TYR A  1 347 ? 22.958  3.973   -5.914  1.00 12.57  ? 792  TYR A CD2   1 
ATOM   2782 C CE1   . TYR A  1 347 ? 20.932  2.456   -4.766  1.00 13.23  ? 792  TYR A CE1   1 
ATOM   2783 C CE2   . TYR A  1 347 ? 23.270  2.760   -5.269  1.00 13.82  ? 792  TYR A CE2   1 
ATOM   2784 C CZ    . TYR A  1 347 ? 22.256  2.016   -4.705  1.00 14.40  ? 792  TYR A CZ    1 
ATOM   2785 O OH    . TYR A  1 347 ? 22.554  0.843   -4.081  1.00 15.76  ? 792  TYR A OH    1 
ATOM   2786 N N     . THR A  1 348 ? 22.861  5.319   -9.338  1.00 13.49  ? 793  THR A N     1 
ATOM   2787 C CA    . THR A  1 348 ? 23.931  4.518   -9.870  1.00 15.96  ? 793  THR A CA    1 
ATOM   2788 C C     . THR A  1 348 ? 25.186  4.805   -9.067  1.00 15.34  ? 793  THR A C     1 
ATOM   2789 O O     . THR A  1 348 ? 25.241  5.793   -8.347  1.00 15.63  ? 793  THR A O     1 
ATOM   2790 C CB    . THR A  1 348 ? 24.224  4.848   -11.378 1.00 17.09  ? 793  THR A CB    1 
ATOM   2791 O OG1   . THR A  1 348 ? 24.553  6.224   -11.491 1.00 18.32  ? 793  THR A OG1   1 
ATOM   2792 C CG2   . THR A  1 348 ? 23.003  4.553   -12.237 1.00 20.63  ? 793  THR A CG2   1 
ATOM   2793 N N     . GLY A  1 349 ? 26.207  3.945   -9.212  1.00 14.37  ? 794  GLY A N     1 
ATOM   2794 C CA    . GLY A  1 349 ? 27.440  4.113   -8.506  1.00 14.91  ? 794  GLY A CA    1 
ATOM   2795 C C     . GLY A  1 349 ? 27.335  3.810   -7.009  1.00 14.17  ? 794  GLY A C     1 
ATOM   2796 O O     . GLY A  1 349 ? 26.379  3.200   -6.546  1.00 13.01  ? 794  GLY A O     1 
ATOM   2797 N N     . TYR A  1 350 ? 28.300  4.316   -6.261  1.00 14.17  ? 795  TYR A N     1 
ATOM   2798 C CA    . TYR A  1 350 ? 28.457  3.989   -4.825  1.00 14.07  ? 795  TYR A CA    1 
ATOM   2799 C C     . TYR A  1 350 ? 29.504  4.923   -4.299  1.00 14.75  ? 795  TYR A C     1 
ATOM   2800 O O     . TYR A  1 350 ? 30.528  5.149   -4.970  1.00 15.52  ? 795  TYR A O     1 
ATOM   2801 C CB    . TYR A  1 350 ? 28.945  2.514   -4.666  1.00 13.86  ? 795  TYR A CB    1 
ATOM   2802 C CG    . TYR A  1 350 ? 28.990  1.996   -3.233  1.00 13.94  ? 795  TYR A CG    1 
ATOM   2803 C CD1   . TYR A  1 350 ? 27.821  1.706   -2.538  1.00 14.45  ? 795  TYR A CD1   1 
ATOM   2804 C CD2   . TYR A  1 350 ? 30.202  1.733   -2.606  1.00 14.59  ? 795  TYR A CD2   1 
ATOM   2805 C CE1   . TYR A  1 350 ? 27.860  1.233   -1.248  1.00 14.28  ? 795  TYR A CE1   1 
ATOM   2806 C CE2   . TYR A  1 350 ? 30.256  1.246   -1.336  1.00 13.77  ? 795  TYR A CE2   1 
ATOM   2807 C CZ    . TYR A  1 350 ? 29.088  0.971   -0.662  1.00 13.70  ? 795  TYR A CZ    1 
ATOM   2808 O OH    . TYR A  1 350 ? 29.140  0.507   0.618   1.00 12.77  ? 795  TYR A OH    1 
ATOM   2809 N N     . ALA A  1 351 ? 29.326  5.379   -3.074  1.00 14.49  ? 796  ALA A N     1 
ATOM   2810 C CA    . ALA A  1 351 ? 30.290  6.230   -2.409  1.00 16.09  ? 796  ALA A CA    1 
ATOM   2811 C C     . ALA A  1 351 ? 30.744  7.392   -3.307  1.00 18.15  ? 796  ALA A C     1 
ATOM   2812 O O     . ALA A  1 351 ? 29.917  8.178   -3.761  1.00 17.42  ? 796  ALA A O     1 
ATOM   2813 C CB    . ALA A  1 351 ? 31.472  5.395   -1.913  1.00 17.48  ? 796  ALA A CB    1 
ATOM   2814 N N     . GLU A  1 352 ? 32.032  7.493   -3.634  1.00 17.82  ? 797  GLU A N     1 
ATOM   2815 C CA    . GLU A  1 352 ? 32.505  8.631   -4.448  1.00 19.51  ? 797  GLU A CA    1 
ATOM   2816 C C     . GLU A  1 352 ? 32.034  8.641   -5.927  1.00 16.67  ? 797  GLU A C     1 
ATOM   2817 O O     . GLU A  1 352 ? 32.152  9.642   -6.564  1.00 16.10  ? 797  GLU A O     1 
ATOM   2818 C CB    . GLU A  1 352 ? 34.060  8.720   -4.399  1.00 25.55  ? 797  GLU A CB    1 
ATOM   2819 C CG    . GLU A  1 352 ? 34.724  7.605   -5.188  1.00 28.67  ? 797  GLU A CG    1 
ATOM   2820 C CD    . GLU A  1 352 ? 34.839  6.280   -4.432  1.00 33.43  ? 797  GLU A CD    1 
ATOM   2821 O OE1   . GLU A  1 352 ? 34.428  6.171   -3.225  1.00 33.12  ? 797  GLU A OE1   1 
ATOM   2822 O OE2   . GLU A  1 352 ? 35.416  5.352   -5.039  1.00 39.61  ? 797  GLU A OE2   1 
ATOM   2823 N N     . THR A  1 353 ? 31.355  7.601   -6.411  1.00 15.19  ? 798  THR A N     1 
ATOM   2824 C CA    . THR A  1 353 ? 30.729  7.659   -7.753  1.00 15.41  ? 798  THR A CA    1 
ATOM   2825 C C     . THR A  1 353 ? 29.185  7.641   -7.734  1.00 13.96  ? 798  THR A C     1 
ATOM   2826 O O     . THR A  1 353 ? 28.547  7.594   -8.782  1.00 14.22  ? 798  THR A O     1 
ATOM   2827 C CB    . THR A  1 353 ? 31.177  6.443   -8.621  1.00 17.58  ? 798  THR A CB    1 
ATOM   2828 O OG1   . THR A  1 353 ? 30.675  5.237   -8.033  1.00 17.10  ? 798  THR A OG1   1 
ATOM   2829 C CG2   . THR A  1 353 ? 32.681  6.373   -8.705  1.00 20.00  ? 798  THR A CG2   1 
ATOM   2830 N N     . TYR A  1 354 ? 28.586  7.801   -6.560  1.00 12.93  ? 799  TYR A N     1 
ATOM   2831 C CA    . TYR A  1 354 ? 27.121  7.797   -6.402  1.00 11.40  ? 799  TYR A CA    1 
ATOM   2832 C C     . TYR A  1 354 ? 26.524  8.956   -7.217  1.00 13.70  ? 799  TYR A C     1 
ATOM   2833 O O     . TYR A  1 354 ? 27.010  10.140  -7.103  1.00 12.79  ? 799  TYR A O     1 
ATOM   2834 C CB    . TYR A  1 354 ? 26.739  7.938   -4.906  1.00 12.01  ? 799  TYR A CB    1 
ATOM   2835 C CG    . TYR A  1 354 ? 25.250  8.190   -4.642  1.00 12.13  ? 799  TYR A CG    1 
ATOM   2836 C CD1   . TYR A  1 354 ? 24.709  9.492   -4.708  1.00 12.90  ? 799  TYR A CD1   1 
ATOM   2837 C CD2   . TYR A  1 354 ? 24.371  7.126   -4.421  1.00 12.61  ? 799  TYR A CD2   1 
ATOM   2838 C CE1   . TYR A  1 354 ? 23.353  9.705   -4.544  1.00 12.88  ? 799  TYR A CE1   1 
ATOM   2839 C CE2   . TYR A  1 354 ? 23.035  7.339   -4.204  1.00 11.88  ? 799  TYR A CE2   1 
ATOM   2840 C CZ    . TYR A  1 354 ? 22.523  8.615   -4.229  1.00 13.23  ? 799  TYR A CZ    1 
ATOM   2841 O OH    . TYR A  1 354 ? 21.152  8.760   -4.071  1.00 13.35  ? 799  TYR A OH    1 
ATOM   2842 N N     . ARG A  1 355 ? 25.493  8.638   -8.011  1.00 13.41  ? 800  ARG A N     1 
ATOM   2843 C CA    . ARG A  1 355 ? 24.665  9.650   -8.671  1.00 15.77  ? 800  ARG A CA    1 
ATOM   2844 C C     . ARG A  1 355 ? 23.171  9.364   -8.514  1.00 13.73  ? 800  ARG A C     1 
ATOM   2845 O O     . ARG A  1 355 ? 22.731  8.230   -8.626  1.00 13.89  ? 800  ARG A O     1 
ATOM   2846 C CB    . ARG A  1 355 ? 25.018  9.765   -10.170 1.00 18.59  ? 800  ARG A CB    1 
ATOM   2847 C CG    . ARG A  1 355 ? 26.460  10.253  -10.415 1.00 23.59  ? 800  ARG A CG    1 
ATOM   2848 C CD    . ARG A  1 355 ? 26.662  10.699  -11.849 1.00 32.71  ? 800  ARG A CD    1 
ATOM   2849 N NE    . ARG A  1 355 ? 25.807  11.855  -12.094 1.00 47.38  ? 800  ARG A NE    1 
ATOM   2850 C CZ    . ARG A  1 355 ? 25.636  12.458  -13.266 1.00 61.18  ? 800  ARG A CZ    1 
ATOM   2851 N NH1   . ARG A  1 355 ? 26.305  12.051  -14.352 1.00 62.49  ? 800  ARG A NH1   1 
ATOM   2852 N NH2   . ARG A  1 355 ? 24.800  13.498  -13.342 1.00 62.74  ? 800  ARG A NH2   1 
ATOM   2853 N N     . TRP A  1 356 ? 22.378  10.405  -8.312  1.00 13.43  ? 801  TRP A N     1 
ATOM   2854 C CA    . TRP A  1 356 ? 20.952  10.274  -8.477  1.00 14.08  ? 801  TRP A CA    1 
ATOM   2855 C C     . TRP A  1 356 ? 20.631  9.949   -9.934  1.00 16.11  ? 801  TRP A C     1 
ATOM   2856 O O     . TRP A  1 356 ? 21.099  10.658  -10.799 1.00 16.61  ? 801  TRP A O     1 
ATOM   2857 C CB    . TRP A  1 356 ? 20.251  11.574  -8.102  1.00 15.54  ? 801  TRP A CB    1 
ATOM   2858 C CG    . TRP A  1 356 ? 18.730  11.507  -8.193  1.00 14.28  ? 801  TRP A CG    1 
ATOM   2859 C CD1   . TRP A  1 356 ? 17.884  10.917  -7.310  1.00 14.11  ? 801  TRP A CD1   1 
ATOM   2860 C CD2   . TRP A  1 356 ? 17.909  12.066  -9.233  1.00 16.52  ? 801  TRP A CD2   1 
ATOM   2861 N NE1   . TRP A  1 356 ? 16.567  11.065  -7.729  1.00 13.79  ? 801  TRP A NE1   1 
ATOM   2862 C CE2   . TRP A  1 356 ? 16.560  11.756  -8.918  1.00 15.72  ? 801  TRP A CE2   1 
ATOM   2863 C CE3   . TRP A  1 356 ? 18.187  12.736  -10.424 1.00 19.54  ? 801  TRP A CE3   1 
ATOM   2864 C CZ2   . TRP A  1 356 ? 15.507  12.165  -9.702  1.00 16.75  ? 801  TRP A CZ2   1 
ATOM   2865 C CZ3   . TRP A  1 356 ? 17.133  13.150  -11.211 1.00 20.44  ? 801  TRP A CZ3   1 
ATOM   2866 C CH2   . TRP A  1 356 ? 15.803  12.859  -10.843 1.00 19.53  ? 801  TRP A CH2   1 
ATOM   2867 N N     . SER A  1 357 ? 19.789  8.964   -10.210 1.00 16.78  ? 802  SER A N     1 
ATOM   2868 C CA    . SER A  1 357 ? 19.470  8.634   -11.624 1.00 18.78  ? 802  SER A CA    1 
ATOM   2869 C C     . SER A  1 357 ? 18.111  9.068   -12.043 1.00 18.91  ? 802  SER A C     1 
ATOM   2870 O O     . SER A  1 357 ? 17.987  9.752   -13.065 1.00 18.57  ? 802  SER A O     1 
ATOM   2871 C CB    . SER A  1 357 ? 19.776  7.179   -11.997 1.00 22.84  ? 802  SER A CB    1 
ATOM   2872 O OG    . SER A  1 357 ? 19.057  6.314   -11.260 1.00 31.32  ? 802  SER A OG    1 
ATOM   2873 N N     . ARG A  1 358 ? 17.087  8.786   -11.250 1.00 16.72  ? 803  ARG A N     1 
ATOM   2874 C CA    . ARG A  1 358 ? 15.690  9.130   -11.634 1.00 17.25  ? 803  ARG A CA    1 
ATOM   2875 C C     . ARG A  1 358 ? 14.715  8.890   -10.473 1.00 17.20  ? 803  ARG A C     1 
ATOM   2876 O O     . ARG A  1 358 ? 15.061  8.201   -9.463  1.00 15.56  ? 803  ARG A O     1 
ATOM   2877 C CB    . ARG A  1 358 ? 15.241  8.304   -12.870 1.00 17.92  ? 803  ARG A CB    1 
ATOM   2878 C CG    . ARG A  1 358 ? 15.048  6.816   -12.611 1.00 21.23  ? 803  ARG A CG    1 
ATOM   2879 C CD    . ARG A  1 358 ? 14.756  6.008   -13.909 1.00 24.86  ? 803  ARG A CD    1 
ATOM   2880 N NE    . ARG A  1 358 ? 15.919  5.999   -14.749 1.00 28.97  ? 803  ARG A NE    1 
ATOM   2881 C CZ    . ARG A  1 358 ? 16.990  5.208   -14.606 1.00 34.22  ? 803  ARG A CZ    1 
ATOM   2882 N NH1   . ARG A  1 358 ? 17.080  4.310   -13.616 1.00 40.72  ? 803  ARG A NH1   1 
ATOM   2883 N NH2   . ARG A  1 358 ? 18.014  5.351   -15.445 1.00 34.31  ? 803  ARG A NH2   1 
ATOM   2884 N N     . SER A  1 359 ? 13.498  9.401   -10.626 1.00 15.80  ? 804  SER A N     1 
ATOM   2885 C CA    . SER A  1 359 ? 12.420  9.151   -9.697  1.00 17.36  ? 804  SER A CA    1 
ATOM   2886 C C     . SER A  1 359 ? 11.983  7.664   -9.828  1.00 18.37  ? 804  SER A C     1 
ATOM   2887 O O     . SER A  1 359 ? 12.012  7.122   -10.940 1.00 17.21  ? 804  SER A O     1 
ATOM   2888 C CB    . SER A  1 359 ? 11.262  10.069  -10.015 1.00 19.15  ? 804  SER A CB    1 
ATOM   2889 O OG    . SER A  1 359 ? 10.248  9.958   -9.050  1.00 22.35  ? 804  SER A OG    1 
ATOM   2890 N N     . HIS A  1 360 ? 11.621  7.019   -8.704  1.00 13.97  ? 805  HIS A N     1 
ATOM   2891 C CA    . HIS A  1 360 ? 11.237  5.609   -8.668  1.00 15.23  ? 805  HIS A CA    1 
ATOM   2892 C C     . HIS A  1 360 ? 9.780   5.526   -8.282  1.00 17.42  ? 805  HIS A C     1 
ATOM   2893 O O     . HIS A  1 360 ? 9.369   6.138   -7.297  1.00 17.37  ? 805  HIS A O     1 
ATOM   2894 C CB    . HIS A  1 360 ? 12.039  4.853   -7.586  1.00 16.23  ? 805  HIS A CB    1 
ATOM   2895 C CG    . HIS A  1 360 ? 11.736  3.381   -7.510  1.00 14.99  ? 805  HIS A CG    1 
ATOM   2896 N ND1   . HIS A  1 360 ? 12.260  2.463   -8.392  1.00 16.31  ? 805  HIS A ND1   1 
ATOM   2897 C CD2   . HIS A  1 360 ? 10.972  2.670   -6.637  1.00 16.70  ? 805  HIS A CD2   1 
ATOM   2898 C CE1   . HIS A  1 360 ? 11.842  1.246   -8.066  1.00 17.89  ? 805  HIS A CE1   1 
ATOM   2899 N NE2   . HIS A  1 360 ? 11.094  1.342   -6.976  1.00 18.53  ? 805  HIS A NE2   1 
ATOM   2900 N N     . GLU A  1 361 ? 9.012   4.733   -9.027  1.00 18.87  ? 806  GLU A N     1 
ATOM   2901 C CA    . GLU A  1 361 ? 7.624   4.495   -8.723  1.00 23.88  ? 806  GLU A CA    1 
ATOM   2902 C C     . GLU A  1 361 ? 7.523   3.186   -7.957  1.00 22.17  ? 806  GLU A C     1 
ATOM   2903 O O     . GLU A  1 361 ? 7.688   2.126   -8.536  1.00 20.38  ? 806  GLU A O     1 
ATOM   2904 C CB    . GLU A  1 361 ? 6.818   4.370   -10.019 1.00 30.50  ? 806  GLU A CB    1 
ATOM   2905 C CG    . GLU A  1 361 ? 5.392   4.733   -9.824  1.00 41.19  ? 806  GLU A CG    1 
ATOM   2906 C CD    . GLU A  1 361 ? 5.245   6.177   -9.426  1.00 49.54  ? 806  GLU A CD    1 
ATOM   2907 O OE1   . GLU A  1 361 ? 6.058   7.011   -9.914  1.00 52.32  ? 806  GLU A OE1   1 
ATOM   2908 O OE2   . GLU A  1 361 ? 4.335   6.478   -8.601  1.00 61.85  ? 806  GLU A OE2   1 
ATOM   2909 N N     . ASP A  1 362 ? 7.287   3.270   -6.652  1.00 17.14  ? 807  ASP A N     1 
ATOM   2910 C CA    . ASP A  1 362 ? 7.344   2.084   -5.766  1.00 17.44  ? 807  ASP A CA    1 
ATOM   2911 C C     . ASP A  1 362 ? 6.054   1.285   -6.000  1.00 19.51  ? 807  ASP A C     1 
ATOM   2912 O O     . ASP A  1 362 ? 4.982   1.789   -5.768  1.00 19.54  ? 807  ASP A O     1 
ATOM   2913 C CB    . ASP A  1 362 ? 7.419   2.515   -4.274  1.00 16.37  ? 807  ASP A CB    1 
ATOM   2914 C CG    . ASP A  1 362 ? 7.757   1.331   -3.305  1.00 20.05  ? 807  ASP A CG    1 
ATOM   2915 O OD1   . ASP A  1 362 ? 7.404   0.155   -3.607  1.00 19.36  ? 807  ASP A OD1   1 
ATOM   2916 O OD2   . ASP A  1 362 ? 8.366   1.591   -2.222  1.00 16.61  ? 807  ASP A OD2   1 
ATOM   2917 N N     . GLY A  1 363 ? 6.193   0.054   -6.413  1.00 20.91  ? 808  GLY A N     1 
ATOM   2918 C CA    . GLY A  1 363 ? 5.041   -0.816  -6.646  1.00 26.16  ? 808  GLY A CA    1 
ATOM   2919 C C     . GLY A  1 363 ? 4.768   -1.845  -5.545  1.00 28.03  ? 808  GLY A C     1 
ATOM   2920 O O     . GLY A  1 363 ? 3.857   -2.673  -5.691  1.00 30.61  ? 808  GLY A O     1 
ATOM   2921 N N     . SER A  1 364 ? 5.501   -1.770  -4.427  1.00 22.15  ? 809  SER A N     1 
ATOM   2922 C CA    . SER A  1 364 ? 5.236   -2.636  -3.280  1.00 21.13  ? 809  SER A CA    1 
ATOM   2923 C C     . SER A  1 364 ? 3.749   -2.576  -2.871  1.00 21.69  ? 809  SER A C     1 
ATOM   2924 O O     . SER A  1 364 ? 3.166   -1.506  -2.757  1.00 21.56  ? 809  SER A O     1 
ATOM   2925 C CB    . SER A  1 364 ? 6.105   -2.242  -2.071  1.00 20.70  ? 809  SER A CB    1 
ATOM   2926 O OG    . SER A  1 364 ? 7.497   -2.331  -2.369  1.00 22.01  ? 809  SER A OG    1 
ATOM   2927 N N     . GLU A  1 365 ? 3.163   -3.754  -2.636  1.00 20.31  ? 810  GLU A N     1 
ATOM   2928 C CA    A GLU A  1 365 ? 1.853   -3.857  -2.024  0.50 20.55  ? 810  GLU A CA    1 
ATOM   2929 C CA    B GLU A  1 365 ? 1.843   -3.890  -2.003  0.50 21.51  ? 810  GLU A CA    1 
ATOM   2930 C C     . GLU A  1 365 ? 1.831   -3.248  -0.615  1.00 20.80  ? 810  GLU A C     1 
ATOM   2931 O O     . GLU A  1 365 ? 2.876   -3.135  0.042   1.00 22.75  ? 810  GLU A O     1 
ATOM   2932 C CB    A GLU A  1 365 ? 1.476   -5.309  -1.912  0.50 22.13  ? 810  GLU A CB    1 
ATOM   2933 C CB    B GLU A  1 365 ? 1.467   -5.388  -1.872  0.50 24.68  ? 810  GLU A CB    1 
ATOM   2934 C CG    A GLU A  1 365 ? 1.241   -6.015  -3.234  0.50 23.28  ? 810  GLU A CG    1 
ATOM   2935 C CG    B GLU A  1 365 ? 0.189   -5.665  -1.055  0.50 27.87  ? 810  GLU A CG    1 
ATOM   2936 C CD    A GLU A  1 365 ? 0.824   -7.440  -2.986  0.50 23.91  ? 810  GLU A CD    1 
ATOM   2937 C CD    B GLU A  1 365 ? -0.570  -6.915  -1.503  0.50 29.90  ? 810  GLU A CD    1 
ATOM   2938 O OE1   A GLU A  1 365 ? 1.701   -8.272  -2.690  0.50 25.25  ? 810  GLU A OE1   1 
ATOM   2939 O OE1   B GLU A  1 365 ? 0.029   -7.999  -1.535  0.50 28.91  ? 810  GLU A OE1   1 
ATOM   2940 O OE2   A GLU A  1 365 ? -0.388  -7.693  -2.956  0.50 25.42  ? 810  GLU A OE2   1 
ATOM   2941 O OE2   B GLU A  1 365 ? -1.782  -6.802  -1.812  0.50 34.23  ? 810  GLU A OE2   1 
ATOM   2942 N N     . ARG A  1 366 ? 0.645   -2.814  -0.160  1.00 17.95  ? 811  ARG A N     1 
ATOM   2943 C CA    . ARG A  1 366 ? 0.465   -2.387  1.199   1.00 16.89  ? 811  ARG A CA    1 
ATOM   2944 C C     . ARG A  1 366 ? -0.213  -3.452  2.010   1.00 19.56  ? 811  ARG A C     1 
ATOM   2945 O O     . ARG A  1 366 ? -1.100  -4.182  1.493   1.00 19.94  ? 811  ARG A O     1 
ATOM   2946 C CB    . ARG A  1 366 ? -0.327  -1.085  1.260   1.00 18.61  ? 811  ARG A CB    1 
ATOM   2947 C CG    . ARG A  1 366 ? 0.398   0.131   0.653   1.00 18.58  ? 811  ARG A CG    1 
ATOM   2948 C CD    . ARG A  1 366 ? -0.346  1.405   1.036   1.00 19.99  ? 811  ARG A CD    1 
ATOM   2949 N NE    . ARG A  1 366 ? 0.194   2.593   0.436   1.00 24.06  ? 811  ARG A NE    1 
ATOM   2950 C CZ    . ARG A  1 366 ? -0.180  3.068   -0.758  1.00 34.82  ? 811  ARG A CZ    1 
ATOM   2951 N NH1   . ARG A  1 366 ? -1.086  2.418   -1.505  1.00 36.11  ? 811  ARG A NH1   1 
ATOM   2952 N NH2   . ARG A  1 366 ? 0.359   4.192   -1.230  1.00 38.12  ? 811  ARG A NH2   1 
ATOM   2953 N N     . ASP A  1 367 ? 0.157   -3.539  3.291   1.00 17.50  ? 812  ASP A N     1 
ATOM   2954 C CA    . ASP A  1 367 ? -0.488  -4.423  4.257   1.00 16.88  ? 812  ASP A CA    1 
ATOM   2955 C C     . ASP A  1 367 ? -1.799  -3.863  4.824   1.00 17.31  ? 812  ASP A C     1 
ATOM   2956 O O     . ASP A  1 367 ? -2.273  -2.765  4.391   1.00 16.51  ? 812  ASP A O     1 
ATOM   2957 C CB    . ASP A  1 367 ? 0.510   -4.883  5.367   1.00 18.40  ? 812  ASP A CB    1 
ATOM   2958 C CG    . ASP A  1 367 ? 0.905   -3.779  6.344   1.00 17.90  ? 812  ASP A CG    1 
ATOM   2959 O OD1   . ASP A  1 367 ? 0.163   -2.755  6.505   1.00 14.69  ? 812  ASP A OD1   1 
ATOM   2960 O OD2   . ASP A  1 367 ? 1.900   -4.020  7.071   1.00 17.53  ? 812  ASP A OD2   1 
ATOM   2961 N N     . ASP A  1 368 ? -2.399  -4.593  5.757   1.00 17.99  ? 813  ASP A N     1 
ATOM   2962 C CA    . ASP A  1 368 ? -3.728  -4.220  6.326   1.00 20.82  ? 813  ASP A CA    1 
ATOM   2963 C C     . ASP A  1 368 ? -3.673  -2.941  7.173   1.00 19.81  ? 813  ASP A C     1 
ATOM   2964 O O     . ASP A  1 368 ? -4.712  -2.403  7.520   1.00 18.82  ? 813  ASP A O     1 
ATOM   2965 C CB    . ASP A  1 368 ? -4.292  -5.347  7.215   1.00 25.73  ? 813  ASP A CB    1 
ATOM   2966 C CG    . ASP A  1 368 ? -4.851  -6.519  6.404   1.00 31.40  ? 813  ASP A CG    1 
ATOM   2967 O OD1   . ASP A  1 368 ? -5.108  -6.335  5.187   1.00 35.51  ? 813  ASP A OD1   1 
ATOM   2968 O OD2   . ASP A  1 368 ? -4.998  -7.637  6.986   1.00 37.97  ? 813  ASP A OD2   1 
ATOM   2969 N N     . TRP A  1 369 ? -2.462  -2.494  7.546   1.00 18.41  ? 814  TRP A N     1 
ATOM   2970 C CA    . TRP A  1 369 ? -2.266  -1.193  8.240   1.00 15.95  ? 814  TRP A CA    1 
ATOM   2971 C C     . TRP A  1 369 ? -1.821  -0.093  7.264   1.00 16.50  ? 814  TRP A C     1 
ATOM   2972 O O     . TRP A  1 369 ? -1.309  0.912   7.687   1.00 15.64  ? 814  TRP A O     1 
ATOM   2973 C CB    . TRP A  1 369 ? -1.226  -1.333  9.333   1.00 16.39  ? 814  TRP A CB    1 
ATOM   2974 C CG    . TRP A  1 369 ? -1.614  -2.188  10.502  1.00 17.01  ? 814  TRP A CG    1 
ATOM   2975 C CD1   . TRP A  1 369 ? -2.780  -2.943  10.646  1.00 17.24  ? 814  TRP A CD1   1 
ATOM   2976 C CD2   . TRP A  1 369 ? -0.816  -2.484  11.638  1.00 17.95  ? 814  TRP A CD2   1 
ATOM   2977 N NE1   . TRP A  1 369 ? -2.749  -3.631  11.792  1.00 17.70  ? 814  TRP A NE1   1 
ATOM   2978 C CE2   . TRP A  1 369 ? -1.547  -3.416  12.425  1.00 19.54  ? 814  TRP A CE2   1 
ATOM   2979 C CE3   . TRP A  1 369 ? 0.456   -2.104  12.051  1.00 17.46  ? 814  TRP A CE3   1 
ATOM   2980 C CZ2   . TRP A  1 369 ? -1.088  -3.877  13.626  1.00 19.82  ? 814  TRP A CZ2   1 
ATOM   2981 C CZ3   . TRP A  1 369 ? 0.925   -2.568  13.265  1.00 21.74  ? 814  TRP A CZ3   1 
ATOM   2982 C CH2   . TRP A  1 369 ? 0.160   -3.469  14.037  1.00 20.90  ? 814  TRP A CH2   1 
ATOM   2983 N N     . GLN A  1 370 ? -2.001  -0.322  5.962   1.00 14.14  ? 815  GLN A N     1 
ATOM   2984 C CA    . GLN A  1 370 ? -1.599  0.597   4.909   1.00 15.03  ? 815  GLN A CA    1 
ATOM   2985 C C     . GLN A  1 370 ? -0.108  0.922   4.959   1.00 14.34  ? 815  GLN A C     1 
ATOM   2986 O O     . GLN A  1 370 ? 0.295   1.991   4.526   1.00 14.04  ? 815  GLN A O     1 
ATOM   2987 C CB    . GLN A  1 370 ? -2.452  1.889   4.913   1.00 15.29  ? 815  GLN A CB    1 
ATOM   2988 C CG    . GLN A  1 370 ? -3.942  1.605   4.671   1.00 17.63  ? 815  GLN A CG    1 
ATOM   2989 C CD    . GLN A  1 370 ? -4.161  0.844   3.383   1.00 19.16  ? 815  GLN A CD    1 
ATOM   2990 O OE1   . GLN A  1 370 ? -3.665  1.211   2.338   1.00 20.16  ? 815  GLN A OE1   1 
ATOM   2991 N NE2   . GLN A  1 370 ? -4.909  -0.208  3.467   1.00 21.57  ? 815  GLN A NE2   1 
ATOM   2992 N N     . ARG A  1 371 ? 0.701   -0.080  5.344   1.00 13.52  ? 816  ARG A N     1 
ATOM   2993 C CA    . ARG A  1 371 ? 2.158   0.015   5.252   1.00 13.07  ? 816  ARG A CA    1 
ATOM   2994 C C     . ARG A  1 371 ? 2.718   -0.697  4.010   1.00 13.96  ? 816  ARG A C     1 
ATOM   2995 O O     . ARG A  1 371 ? 2.360   -1.893  3.714   1.00 14.36  ? 816  ARG A O     1 
ATOM   2996 C CB    . ARG A  1 371 ? 2.810   -0.549  6.486   1.00 11.69  ? 816  ARG A CB    1 
ATOM   2997 C CG    . ARG A  1 371 ? 2.376   0.065   7.788   1.00 13.16  ? 816  ARG A CG    1 
ATOM   2998 C CD    . ARG A  1 371 ? 2.969   -0.595  9.051   1.00 11.90  ? 816  ARG A CD    1 
ATOM   2999 N NE    . ARG A  1 371 ? 2.780   -2.045  9.076   1.00 14.28  ? 816  ARG A NE    1 
ATOM   3000 C CZ    . ARG A  1 371 ? 3.213   -2.870  10.033  1.00 15.17  ? 816  ARG A CZ    1 
ATOM   3001 N NH1   . ARG A  1 371 ? 3.815   -2.422  11.123  1.00 15.19  ? 816  ARG A NH1   1 
ATOM   3002 N NH2   . ARG A  1 371 ? 2.968   -4.175  9.926   1.00 15.74  ? 816  ARG A NH2   1 
ATOM   3003 N N     . ARG A  1 372 ? 3.577   -0.024  3.253   1.00 14.61  ? 817  ARG A N     1 
ATOM   3004 C CA    . ARG A  1 372 ? 4.319   -0.743  2.206   1.00 14.32  ? 817  ARG A CA    1 
ATOM   3005 C C     . ARG A  1 372 ? 4.909   -2.030  2.811   1.00 13.91  ? 817  ARG A C     1 
ATOM   3006 O O     . ARG A  1 372 ? 5.392   -2.031  3.966   1.00 13.01  ? 817  ARG A O     1 
ATOM   3007 C CB    . ARG A  1 372 ? 5.459   0.075   1.559   1.00 15.13  ? 817  ARG A CB    1 
ATOM   3008 C CG    . ARG A  1 372 ? 5.094   1.415   0.866   1.00 15.60  ? 817  ARG A CG    1 
ATOM   3009 C CD    . ARG A  1 372 ? 4.395   1.177   -0.452  1.00 17.75  ? 817  ARG A CD    1 
ATOM   3010 N NE    . ARG A  1 372 ? 4.052   2.425   -1.111  1.00 18.93  ? 817  ARG A NE    1 
ATOM   3011 C CZ    . ARG A  1 372 ? 3.622   2.508   -2.341  1.00 23.22  ? 817  ARG A CZ    1 
ATOM   3012 N NH1   . ARG A  1 372 ? 3.443   1.384   -3.084  1.00 25.99  ? 817  ARG A NH1   1 
ATOM   3013 N NH2   . ARG A  1 372 ? 3.315   3.678   -2.821  1.00 23.33  ? 817  ARG A NH2   1 
ATOM   3014 N N     . CYS A  1 373 ? 4.894   -3.124  2.039   1.00 14.11  ? 818  CYS A N     1 
ATOM   3015 C CA    . CYS A  1 373 ? 5.439   -4.420  2.539   1.00 17.30  ? 818  CYS A CA    1 
ATOM   3016 C C     . CYS A  1 373 ? 6.979   -4.474  2.353   1.00 16.84  ? 818  CYS A C     1 
ATOM   3017 O O     . CYS A  1 373 ? 7.501   -5.222  1.510   1.00 17.25  ? 818  CYS A O     1 
ATOM   3018 C CB    . CYS A  1 373 ? 4.765   -5.637  1.860   1.00 22.17  ? 818  CYS A CB    1 
ATOM   3019 S SG    . CYS A  1 373 ? 2.971   -5.631  2.289   1.00 29.46  ? 818  CYS A SG    1 
ATOM   3020 N N     . THR A  1 374 ? 7.647   -3.586  3.085   1.00 13.22  ? 819  THR A N     1 
ATOM   3021 C CA    . THR A  1 374 ? 9.071   -3.446  3.067   1.00 13.32  ? 819  THR A CA    1 
ATOM   3022 C C     . THR A  1 374 ? 9.493   -3.295  4.513   1.00 12.74  ? 819  THR A C     1 
ATOM   3023 O O     . THR A  1 374 ? 9.052   -2.306  5.216   1.00 13.16  ? 819  THR A O     1 
ATOM   3024 C CB    . THR A  1 374 ? 9.478   -2.229  2.252   1.00 12.65  ? 819  THR A CB    1 
ATOM   3025 O OG1   . THR A  1 374 ? 9.160   -2.482  0.888   1.00 15.00  ? 819  THR A OG1   1 
ATOM   3026 C CG2   . THR A  1 374 ? 10.939  -1.956  2.356   1.00 13.33  ? 819  THR A CG2   1 
ATOM   3027 N N     . GLU A  1 375 ? 10.272  -4.271  4.997   1.00 11.72  ? 820  GLU A N     1 
ATOM   3028 C CA    . GLU A  1 375 ? 10.755  -4.313  6.408   1.00 11.86  ? 820  GLU A CA    1 
ATOM   3029 C C     . GLU A  1 375 ? 12.295  -4.212  6.451   1.00 11.38  ? 820  GLU A C     1 
ATOM   3030 O O     . GLU A  1 375 ? 12.991  -5.029  5.854   1.00 11.58  ? 820  GLU A O     1 
ATOM   3031 C CB    . GLU A  1 375 ? 10.301  -5.621  7.091   1.00 14.23  ? 820  GLU A CB    1 
ATOM   3032 C CG    . GLU A  1 375 ? 10.663  -5.673  8.566   1.00 15.41  ? 820  GLU A CG    1 
ATOM   3033 C CD    . GLU A  1 375 ? 10.406  -7.029  9.226   1.00 19.58  ? 820  GLU A CD    1 
ATOM   3034 O OE1   . GLU A  1 375 ? 9.876   -7.982  8.543   1.00 21.60  ? 820  GLU A OE1   1 
ATOM   3035 O OE2   . GLU A  1 375 ? 10.765  -7.144  10.442  1.00 18.55  ? 820  GLU A OE2   1 
ATOM   3036 N N     . ILE A  1 376 ? 12.795  -3.155  7.068   1.00 10.50  ? 821  ILE A N     1 
ATOM   3037 C CA    . ILE A  1 376 ? 14.227  -2.882  7.184   1.00 11.75  ? 821  ILE A CA    1 
ATOM   3038 C C     . ILE A  1 376 ? 14.630  -2.941  8.668   1.00 11.75  ? 821  ILE A C     1 
ATOM   3039 O O     . ILE A  1 376 ? 13.927  -2.397  9.539   1.00 12.26  ? 821  ILE A O     1 
ATOM   3040 C CB    . ILE A  1 376 ? 14.577  -1.533  6.539   1.00 10.49  ? 821  ILE A CB    1 
ATOM   3041 C CG1   . ILE A  1 376 ? 14.184  -1.545  5.067   1.00 10.12  ? 821  ILE A CG1   1 
ATOM   3042 C CG2   . ILE A  1 376 ? 16.034  -1.219  6.683   1.00 11.67  ? 821  ILE A CG2   1 
ATOM   3043 C CD1   . ILE A  1 376 ? 14.196  -0.185  4.417   1.00 10.69  ? 821  ILE A CD1   1 
ATOM   3044 N N     . VAL A  1 377 ? 15.747  -3.630  8.969   1.00 12.02  ? 822  VAL A N     1 
ATOM   3045 C CA    . VAL A  1 377 ? 16.330  -3.615  10.327  1.00 11.21  ? 822  VAL A CA    1 
ATOM   3046 C C     . VAL A  1 377 ? 17.731  -2.982  10.366  1.00 11.92  ? 822  VAL A C     1 
ATOM   3047 O O     . VAL A  1 377 ? 18.642  -3.384  9.630   1.00 11.58  ? 822  VAL A O     1 
ATOM   3048 C CB    . VAL A  1 377 ? 16.296  -5.029  10.995  1.00 11.96  ? 822  VAL A CB    1 
ATOM   3049 C CG1   . VAL A  1 377 ? 17.140  -6.035  10.245  1.00 12.38  ? 822  VAL A CG1   1 
ATOM   3050 C CG2   . VAL A  1 377 ? 16.769  -4.958  12.450  1.00 11.69  ? 822  VAL A CG2   1 
ATOM   3051 N N     . ALA A  1 378 ? 17.878  -1.968  11.201  1.00 11.19  ? 823  ALA A N     1 
ATOM   3052 C CA    . ALA A  1 378 ? 19.168  -1.343  11.451  1.00 12.27  ? 823  ALA A CA    1 
ATOM   3053 C C     . ALA A  1 378 ? 19.866  -2.082  12.557  1.00 12.55  ? 823  ALA A C     1 
ATOM   3054 O O     . ALA A  1 378 ? 19.374  -2.080  13.759  1.00 11.85  ? 823  ALA A O     1 
ATOM   3055 C CB    . ALA A  1 378 ? 19.015  0.150   11.813  1.00 12.66  ? 823  ALA A CB    1 
ATOM   3056 N N     . ILE A  1 379 ? 21.015  -2.694  12.196  1.00 12.09  ? 824  ILE A N     1 
ATOM   3057 C CA    . ILE A  1 379 ? 21.939  -3.328  13.173  1.00 13.18  ? 824  ILE A CA    1 
ATOM   3058 C C     . ILE A  1 379 ? 23.343  -2.836  12.863  1.00 13.69  ? 824  ILE A C     1 
ATOM   3059 O O     . ILE A  1 379 ? 23.798  -2.873  11.696  1.00 13.24  ? 824  ILE A O     1 
ATOM   3060 C CB    . ILE A  1 379 ? 21.883  -4.874  13.178  1.00 14.48  ? 824  ILE A CB    1 
ATOM   3061 C CG1   . ILE A  1 379 ? 21.882  -5.460  11.737  1.00 13.87  ? 824  ILE A CG1   1 
ATOM   3062 C CG2   . ILE A  1 379 ? 20.689  -5.382  14.012  1.00 14.16  ? 824  ILE A CG2   1 
ATOM   3063 C CD1   . ILE A  1 379 ? 22.113  -6.953  11.722  1.00 14.96  ? 824  ILE A CD1   1 
ATOM   3064 N N     . ASP A  1 380 ? 23.990  -2.285  13.891  1.00 12.44  ? 825  ASP A N     1 
ATOM   3065 C CA    . ASP A  1 380 ? 25.295  -1.752  13.781  1.00 12.45  ? 825  ASP A CA    1 
ATOM   3066 C C     . ASP A  1 380 ? 26.347  -2.788  14.171  1.00 13.07  ? 825  ASP A C     1 
ATOM   3067 O O     . ASP A  1 380 ? 26.344  -3.309  15.308  1.00 12.91  ? 825  ASP A O     1 
ATOM   3068 C CB    . ASP A  1 380 ? 25.459  -0.513  14.703  1.00 13.63  ? 825  ASP A CB    1 
ATOM   3069 C CG    . ASP A  1 380 ? 25.162  -0.836  16.186  1.00 14.87  ? 825  ASP A CG    1 
ATOM   3070 O OD1   . ASP A  1 380 ? 24.000  -1.249  16.485  1.00 16.39  ? 825  ASP A OD1   1 
ATOM   3071 O OD2   . ASP A  1 380 ? 26.115  -0.710  17.042  1.00 16.25  ? 825  ASP A OD2   1 
ATOM   3072 N N     . ALA A  1 381 ? 27.232  -3.103  13.239  1.00 12.65  ? 826  ALA A N     1 
ATOM   3073 C CA    . ALA A  1 381 ? 28.415  -3.938  13.567  1.00 13.49  ? 826  ALA A CA    1 
ATOM   3074 C C     . ALA A  1 381 ? 29.414  -3.112  14.387  1.00 14.68  ? 826  ALA A C     1 
ATOM   3075 O O     . ALA A  1 381 ? 29.327  -1.873  14.448  1.00 13.50  ? 826  ALA A O     1 
ATOM   3076 C CB    . ALA A  1 381 ? 29.091  -4.393  12.278  1.00 13.73  ? 826  ALA A CB    1 
ATOM   3077 N N     . LEU A  1 382 ? 30.442  -3.789  14.888  1.00 16.19  ? 827  LEU A N     1 
ATOM   3078 C CA    . LEU A  1 382 ? 31.586  -3.129  15.554  1.00 17.38  ? 827  LEU A CA    1 
ATOM   3079 C C     . LEU A  1 382 ? 32.535  -2.595  14.508  1.00 17.35  ? 827  LEU A C     1 
ATOM   3080 O O     . LEU A  1 382 ? 32.661  -3.169  13.416  1.00 15.22  ? 827  LEU A O     1 
ATOM   3081 C CB    . LEU A  1 382 ? 32.313  -4.161  16.458  1.00 18.46  ? 827  LEU A CB    1 
ATOM   3082 C CG    . LEU A  1 382 ? 31.567  -4.514  17.739  1.00 19.55  ? 827  LEU A CG    1 
ATOM   3083 C CD1   . LEU A  1 382 ? 32.360  -5.585  18.530  1.00 20.43  ? 827  LEU A CD1   1 
ATOM   3084 C CD2   . LEU A  1 382 ? 31.318  -3.247  18.587  1.00 18.76  ? 827  LEU A CD2   1 
ATOM   3085 N N     . HIS A  1 383 ? 33.143  -1.443  14.769  1.00 16.02  ? 828  HIS A N     1 
ATOM   3086 C CA    . HIS A  1 383 ? 34.137  -0.878  13.836  1.00 17.21  ? 828  HIS A CA    1 
ATOM   3087 C C     . HIS A  1 383 ? 35.520  -1.382  14.301  1.00 18.81  ? 828  HIS A C     1 
ATOM   3088 O O     . HIS A  1 383 ? 36.035  -0.909  15.331  1.00 17.61  ? 828  HIS A O     1 
ATOM   3089 C CB    . HIS A  1 383 ? 34.091  0.675   13.899  1.00 18.74  ? 828  HIS A CB    1 
ATOM   3090 C CG    . HIS A  1 383 ? 34.940  1.371   12.885  1.00 19.53  ? 828  HIS A CG    1 
ATOM   3091 N ND1   . HIS A  1 383 ? 34.848  2.735   12.660  1.00 24.63  ? 828  HIS A ND1   1 
ATOM   3092 C CD2   . HIS A  1 383 ? 35.940  0.932   12.087  1.00 21.34  ? 828  HIS A CD2   1 
ATOM   3093 C CE1   . HIS A  1 383 ? 35.755  3.099   11.775  1.00 22.31  ? 828  HIS A CE1   1 
ATOM   3094 N NE2   . HIS A  1 383 ? 36.375  2.016   11.352  1.00 21.93  ? 828  HIS A NE2   1 
ATOM   3095 N N     . PHE A  1 384 ? 36.114  -2.283  13.536  1.00 18.13  ? 829  PHE A N     1 
ATOM   3096 C CA    . PHE A  1 384 ? 37.420  -2.910  13.878  1.00 21.75  ? 829  PHE A CA    1 
ATOM   3097 C C     . PHE A  1 384 ? 38.569  -2.115  13.263  1.00 27.88  ? 829  PHE A C     1 
ATOM   3098 O O     . PHE A  1 384 ? 38.509  -1.694  12.104  1.00 25.13  ? 829  PHE A O     1 
ATOM   3099 C CB    . PHE A  1 384 ? 37.489  -4.359  13.401  1.00 20.45  ? 829  PHE A CB    1 
ATOM   3100 C CG    . PHE A  1 384 ? 36.547  -5.260  14.123  1.00 19.31  ? 829  PHE A CG    1 
ATOM   3101 C CD1   . PHE A  1 384 ? 36.745  -5.538  15.490  1.00 19.89  ? 829  PHE A CD1   1 
ATOM   3102 C CD2   . PHE A  1 384 ? 35.380  -5.726  13.502  1.00 19.07  ? 829  PHE A CD2   1 
ATOM   3103 C CE1   . PHE A  1 384 ? 35.832  -6.281  16.215  1.00 18.12  ? 829  PHE A CE1   1 
ATOM   3104 C CE2   . PHE A  1 384 ? 34.463  -6.519  14.205  1.00 19.00  ? 829  PHE A CE2   1 
ATOM   3105 C CZ    . PHE A  1 384 ? 34.679  -6.785  15.584  1.00 18.46  ? 829  PHE A CZ    1 
ATOM   3106 N N     . ARG A  1 385 ? 39.606  -1.910  14.042  1.00 29.61  ? 830  ARG A N     1 
ATOM   3107 C CA    . ARG A  1 385 ? 40.787  -1.201  13.551  1.00 35.29  ? 830  ARG A CA    1 
ATOM   3108 C C     . ARG A  1 385 ? 42.025  -2.072  13.549  1.00 34.52  ? 830  ARG A C     1 
ATOM   3109 O O     . ARG A  1 385 ? 43.025  -1.677  13.033  1.00 34.37  ? 830  ARG A O     1 
ATOM   3110 C CB    . ARG A  1 385 ? 41.004  0.055   14.376  1.00 42.81  ? 830  ARG A CB    1 
ATOM   3111 C CG    . ARG A  1 385 ? 40.027  1.157   13.988  1.00 47.87  ? 830  ARG A CG    1 
ATOM   3112 C CD    . ARG A  1 385 ? 39.850  2.158   15.097  1.00 56.91  ? 830  ARG A CD    1 
ATOM   3113 N NE    . ARG A  1 385 ? 38.842  3.176   14.769  1.00 61.72  ? 830  ARG A NE    1 
ATOM   3114 C CZ    . ARG A  1 385 ? 37.558  3.137   15.156  1.00 68.84  ? 830  ARG A CZ    1 
ATOM   3115 N NH1   . ARG A  1 385 ? 37.072  2.100   15.883  1.00 62.03  ? 830  ARG A NH1   1 
ATOM   3116 N NH2   . ARG A  1 385 ? 36.741  4.133   14.804  1.00 70.51  ? 830  ARG A NH2   1 
ATOM   3117 N N     . ARG A  1 386 ? 41.943  -3.260  14.129  1.00 30.57  ? 831  ARG A N     1 
ATOM   3118 C CA    . ARG A  1 386 ? 42.967  -4.284  13.942  1.00 32.42  ? 831  ARG A CA    1 
ATOM   3119 C C     . ARG A  1 386 ? 42.272  -5.570  13.542  1.00 26.93  ? 831  ARG A C     1 
ATOM   3120 O O     . ARG A  1 386 ? 41.311  -5.950  14.178  1.00 25.13  ? 831  ARG A O     1 
ATOM   3121 C CB    . ARG A  1 386 ? 43.756  -4.467  15.233  1.00 36.35  ? 831  ARG A CB    1 
ATOM   3122 C CG    . ARG A  1 386 ? 44.750  -3.320  15.473  1.00 43.98  ? 831  ARG A CG    1 
ATOM   3123 C CD    . ARG A  1 386 ? 45.639  -3.547  16.690  1.00 55.30  ? 831  ARG A CD    1 
ATOM   3124 N NE    . ARG A  1 386 ? 47.023  -3.072  16.458  1.00 69.42  ? 831  ARG A NE    1 
ATOM   3125 C CZ    . ARG A  1 386 ? 47.804  -2.491  17.380  1.00 73.11  ? 831  ARG A CZ    1 
ATOM   3126 N NH1   . ARG A  1 386 ? 47.365  -2.284  18.622  1.00 71.24  ? 831  ARG A NH1   1 
ATOM   3127 N NH2   . ARG A  1 386 ? 49.036  -2.114  17.056  1.00 78.40  ? 831  ARG A NH2   1 
ATOM   3128 N N     . TYR A  1 387 ? 42.774  -6.214  12.507  1.00 23.30  ? 832  TYR A N     1 
ATOM   3129 C CA    . TYR A  1 387 ? 42.185  -7.420  11.963  1.00 28.46  ? 832  TYR A CA    1 
ATOM   3130 C C     . TYR A  1 387 ? 41.886  -8.472  13.025  1.00 29.05  ? 832  TYR A C     1 
ATOM   3131 O O     . TYR A  1 387 ? 40.796  -9.028  13.061  1.00 26.50  ? 832  TYR A O     1 
ATOM   3132 C CB    . TYR A  1 387 ? 43.118  -8.026  10.899  1.00 27.70  ? 832  TYR A CB    1 
ATOM   3133 C CG    . TYR A  1 387 ? 42.629  -9.337  10.285  1.00 27.65  ? 832  TYR A CG    1 
ATOM   3134 C CD1   . TYR A  1 387 ? 41.704  -9.336  9.254   1.00 26.05  ? 832  TYR A CD1   1 
ATOM   3135 C CD2   . TYR A  1 387 ? 43.110  -10.575 10.736  1.00 28.20  ? 832  TYR A CD2   1 
ATOM   3136 C CE1   . TYR A  1 387 ? 41.241  -10.496 8.731   1.00 26.09  ? 832  TYR A CE1   1 
ATOM   3137 C CE2   . TYR A  1 387 ? 42.660  -11.763 10.194  1.00 26.94  ? 832  TYR A CE2   1 
ATOM   3138 C CZ    . TYR A  1 387 ? 41.719  -11.715 9.192   1.00 28.21  ? 832  TYR A CZ    1 
ATOM   3139 O OH    . TYR A  1 387 ? 41.273  -12.889 8.608   1.00 26.02  ? 832  TYR A OH    1 
ATOM   3140 N N     . LEU A  1 388 ? 42.866  -8.775  13.871  1.00 29.02  ? 833  LEU A N     1 
ATOM   3141 C CA    . LEU A  1 388 ? 42.711  -9.890  14.828  1.00 28.01  ? 833  LEU A CA    1 
ATOM   3142 C C     . LEU A  1 388 ? 41.718  -9.610  15.927  1.00 22.96  ? 833  LEU A C     1 
ATOM   3143 O O     . LEU A  1 388 ? 41.224  -10.537 16.570  1.00 22.43  ? 833  LEU A O     1 
ATOM   3144 C CB    . LEU A  1 388 ? 44.082  -10.290 15.439  1.00 30.60  ? 833  LEU A CB    1 
ATOM   3145 C CG    . LEU A  1 388 ? 45.015  -11.070 14.538  1.00 34.30  ? 833  LEU A CG    1 
ATOM   3146 C CD1   . LEU A  1 388 ? 46.280  -11.411 15.330  1.00 39.86  ? 833  LEU A CD1   1 
ATOM   3147 C CD2   . LEU A  1 388 ? 44.353  -12.342 13.997  1.00 35.43  ? 833  LEU A CD2   1 
ATOM   3148 N N     . ASP A  1 389 ? 41.402  -8.331  16.165  1.00 22.81  ? 834  ASP A N     1 
ATOM   3149 C CA    . ASP A  1 389 ? 40.438  -7.947  17.224  1.00 20.80  ? 834  ASP A CA    1 
ATOM   3150 C C     . ASP A  1 389 ? 39.107  -8.624  17.076  1.00 20.34  ? 834  ASP A C     1 
ATOM   3151 O O     . ASP A  1 389 ? 38.454  -8.929  18.051  1.00 18.32  ? 834  ASP A O     1 
ATOM   3152 C CB    . ASP A  1 389 ? 40.174  -6.446  17.214  1.00 25.82  ? 834  ASP A CB    1 
ATOM   3153 C CG    . ASP A  1 389 ? 41.349  -5.619  17.765  1.00 32.81  ? 834  ASP A CG    1 
ATOM   3154 O OD1   . ASP A  1 389 ? 42.322  -6.206  18.273  1.00 32.73  ? 834  ASP A OD1   1 
ATOM   3155 O OD2   . ASP A  1 389 ? 41.288  -4.376  17.685  1.00 31.92  ? 834  ASP A OD2   1 
ATOM   3156 N N     . GLN A  1 390 ? 38.684  -8.881  15.841  1.00 18.81  ? 835  GLN A N     1 
ATOM   3157 C CA    . GLN A  1 390 ? 37.312  -9.389  15.621  1.00 16.65  ? 835  GLN A CA    1 
ATOM   3158 C C     . GLN A  1 390 ? 37.141  -10.852 15.989  1.00 17.11  ? 835  GLN A C     1 
ATOM   3159 O O     . GLN A  1 390 ? 35.972  -11.357 16.123  1.00 16.69  ? 835  GLN A O     1 
ATOM   3160 C CB    . GLN A  1 390 ? 36.880  -9.156  14.158  1.00 16.91  ? 835  GLN A CB    1 
ATOM   3161 C CG    . GLN A  1 390 ? 37.657  -9.921  13.125  1.00 17.75  ? 835  GLN A CG    1 
ATOM   3162 C CD    . GLN A  1 390 ? 37.407  -9.361  11.732  1.00 21.76  ? 835  GLN A CD    1 
ATOM   3163 O OE1   . GLN A  1 390 ? 36.263  -9.276  11.285  1.00 19.56  ? 835  GLN A OE1   1 
ATOM   3164 N NE2   . GLN A  1 390 ? 38.470  -9.035  11.024  1.00 21.76  ? 835  GLN A NE2   1 
ATOM   3165 N N     . PHE A  1 391 ? 38.265  -11.581 16.137  1.00 17.00  ? 836  PHE A N     1 
ATOM   3166 C CA    . PHE A  1 391 ? 38.188  -13.008 16.549  1.00 18.25  ? 836  PHE A CA    1 
ATOM   3167 C C     . PHE A  1 391 ? 38.228  -13.252 18.040  1.00 19.12  ? 836  PHE A C     1 
ATOM   3168 O O     . PHE A  1 391 ? 38.071  -14.384 18.480  1.00 19.95  ? 836  PHE A O     1 
ATOM   3169 C CB    . PHE A  1 391 ? 39.292  -13.828 15.843  1.00 19.84  ? 836  PHE A CB    1 
ATOM   3170 C CG    . PHE A  1 391 ? 39.219  -13.777 14.345  1.00 19.09  ? 836  PHE A CG    1 
ATOM   3171 C CD1   . PHE A  1 391 ? 38.457  -14.703 13.654  1.00 20.93  ? 836  PHE A CD1   1 
ATOM   3172 C CD2   . PHE A  1 391 ? 39.956  -12.857 13.628  1.00 21.58  ? 836  PHE A CD2   1 
ATOM   3173 C CE1   . PHE A  1 391 ? 38.419  -14.691 12.277  1.00 21.44  ? 836  PHE A CE1   1 
ATOM   3174 C CE2   . PHE A  1 391 ? 39.896  -12.812 12.243  1.00 22.54  ? 836  PHE A CE2   1 
ATOM   3175 C CZ    . PHE A  1 391 ? 39.127  -13.732 11.569  1.00 22.84  ? 836  PHE A CZ    1 
ATOM   3176 N N     . VAL A  1 392 ? 38.319  -12.185 18.835  1.00 20.75  ? 837  VAL A N     1 
ATOM   3177 C CA    . VAL A  1 392 ? 38.203  -12.299 20.314  1.00 20.44  ? 837  VAL A CA    1 
ATOM   3178 C C     . VAL A  1 392 ? 36.792  -12.763 20.660  1.00 22.99  ? 837  VAL A C     1 
ATOM   3179 O O     . VAL A  1 392 ? 35.802  -12.158 20.178  1.00 21.62  ? 837  VAL A O     1 
ATOM   3180 C CB    . VAL A  1 392 ? 38.495  -10.942 20.991  1.00 21.82  ? 837  VAL A CB    1 
ATOM   3181 C CG1   . VAL A  1 392 ? 38.212  -11.008 22.480  1.00 25.15  ? 837  VAL A CG1   1 
ATOM   3182 C CG2   . VAL A  1 392 ? 39.899  -10.482 20.699  1.00 23.03  ? 837  VAL A CG2   1 
ATOM   3183 N N     . PRO A  1 393 ? 36.651  -13.821 21.506  1.00 21.88  ? 838  PRO A N     1 
ATOM   3184 C CA    . PRO A  1 393 ? 35.319  -14.416 21.764  1.00 21.92  ? 838  PRO A CA    1 
ATOM   3185 C C     . PRO A  1 393 ? 34.227  -13.454 22.197  1.00 21.26  ? 838  PRO A C     1 
ATOM   3186 O O     . PRO A  1 393 ? 33.088  -13.554 21.726  1.00 17.29  ? 838  PRO A O     1 
ATOM   3187 C CB    . PRO A  1 393 ? 35.614  -15.425 22.887  1.00 23.13  ? 838  PRO A CB    1 
ATOM   3188 C CG    . PRO A  1 393 ? 36.971  -15.938 22.505  1.00 22.67  ? 838  PRO A CG    1 
ATOM   3189 C CD    . PRO A  1 393 ? 37.729  -14.698 22.032  1.00 23.72  ? 838  PRO A CD    1 
ATOM   3190 N N     . GLU A  1 394 ? 34.565  -12.515 23.059  1.00 19.05  ? 839  GLU A N     1 
ATOM   3191 C CA    . GLU A  1 394 ? 33.620  -11.544 23.511  1.00 21.10  ? 839  GLU A CA    1 
ATOM   3192 C C     . GLU A  1 394 ? 33.050  -10.712 22.287  1.00 19.01  ? 839  GLU A C     1 
ATOM   3193 O O     . GLU A  1 394 ? 31.864  -10.329 22.273  1.00 17.67  ? 839  GLU A O     1 
ATOM   3194 C CB    . GLU A  1 394 ? 34.352  -10.609 24.488  1.00 25.66  ? 839  GLU A CB    1 
ATOM   3195 C CG    . GLU A  1 394 ? 33.538  -9.538  25.143  1.00 37.72  ? 839  GLU A CG    1 
ATOM   3196 C CD    . GLU A  1 394 ? 34.439  -8.392  25.725  1.00 50.36  ? 839  GLU A CD    1 
ATOM   3197 O OE1   . GLU A  1 394 ? 35.616  -8.214  25.255  1.00 55.04  ? 839  GLU A OE1   1 
ATOM   3198 O OE2   . GLU A  1 394 ? 33.962  -7.654  26.623  1.00 55.68  ? 839  GLU A OE2   1 
ATOM   3199 N N     . LYS A  1 395 ? 33.917  -10.446 21.328  1.00 17.09  ? 840  LYS A N     1 
ATOM   3200 C CA    A LYS A  1 395 ? 33.538  -9.631  20.173  0.50 19.77  ? 840  LYS A CA    1 
ATOM   3201 C CA    B LYS A  1 395 ? 33.588  -9.629  20.131  0.50 20.13  ? 840  LYS A CA    1 
ATOM   3202 C C     . LYS A  1 395 ? 32.783  -10.435 19.121  1.00 19.56  ? 840  LYS A C     1 
ATOM   3203 O O     . LYS A  1 395 ? 31.851  -9.900  18.467  1.00 19.61  ? 840  LYS A O     1 
ATOM   3204 C CB    A LYS A  1 395 ? 34.755  -8.974  19.593  0.50 18.55  ? 840  LYS A CB    1 
ATOM   3205 C CB    B LYS A  1 395 ? 34.855  -9.137  19.449  0.50 19.37  ? 840  LYS A CB    1 
ATOM   3206 C CG    A LYS A  1 395 ? 35.454  -8.094  20.619  0.50 19.54  ? 840  LYS A CG    1 
ATOM   3207 C CG    B LYS A  1 395 ? 35.779  -8.277  20.316  0.50 21.11  ? 840  LYS A CG    1 
ATOM   3208 C CD    A LYS A  1 395 ? 36.403  -7.117  19.983  0.50 20.27  ? 840  LYS A CD    1 
ATOM   3209 C CD    B LYS A  1 395 ? 35.116  -6.993  20.770  0.50 22.51  ? 840  LYS A CD    1 
ATOM   3210 C CE    A LYS A  1 395 ? 37.018  -6.161  21.024  0.50 21.94  ? 840  LYS A CE    1 
ATOM   3211 C CE    B LYS A  1 395 ? 35.936  -6.314  21.881  0.50 25.12  ? 840  LYS A CE    1 
ATOM   3212 N NZ    A LYS A  1 395 ? 36.061  -5.167  21.617  0.50 21.49  ? 840  LYS A NZ    1 
ATOM   3213 N NZ    B LYS A  1 395 ? 37.312  -5.979  21.422  0.50 27.12  ? 840  LYS A NZ    1 
ATOM   3214 N N     . MET A  1 396 ? 33.128  -11.715 18.967  1.00 17.87  ? 841  MET A N     1 
ATOM   3215 C CA    . MET A  1 396 ? 32.287  -12.638 18.142  1.00 17.85  ? 841  MET A CA    1 
ATOM   3216 C C     . MET A  1 396 ? 30.873  -12.802 18.733  1.00 18.27  ? 841  MET A C     1 
ATOM   3217 O O     . MET A  1 396 ? 29.855  -12.744 18.010  1.00 15.28  ? 841  MET A O     1 
ATOM   3218 C CB    . MET A  1 396 ? 32.974  -14.009 17.949  1.00 17.86  ? 841  MET A CB    1 
ATOM   3219 C CG    . MET A  1 396 ? 34.196  -13.929 17.088  1.00 19.26  ? 841  MET A CG    1 
ATOM   3220 S SD    . MET A  1 396 ? 34.916  -15.526 16.633  1.00 19.78  ? 841  MET A SD    1 
ATOM   3221 C CE    . MET A  1 396 ? 35.193  -16.242 18.279  1.00 21.74  ? 841  MET A CE    1 
ATOM   3222 N N     . ARG A  1 397 ? 30.774  -13.008 20.063  1.00 17.79  ? 842  ARG A N     1 
ATOM   3223 C CA    A ARG A  1 397 ? 29.487  -13.142 20.707  0.70 19.91  ? 842  ARG A CA    1 
ATOM   3224 C CA    B ARG A  1 397 ? 29.470  -13.127 20.730  0.30 17.21  ? 842  ARG A CA    1 
ATOM   3225 C C     . ARG A  1 397 ? 28.661  -11.843 20.601  1.00 17.72  ? 842  ARG A C     1 
ATOM   3226 O O     . ARG A  1 397 ? 27.449  -11.885 20.465  1.00 16.68  ? 842  ARG A O     1 
ATOM   3227 C CB    A ARG A  1 397 ? 29.676  -13.549 22.189  0.70 24.81  ? 842  ARG A CB    1 
ATOM   3228 C CB    B ARG A  1 397 ? 29.624  -13.500 22.232  0.30 17.01  ? 842  ARG A CB    1 
ATOM   3229 C CG    A ARG A  1 397 ? 28.472  -14.208 22.801  0.70 28.97  ? 842  ARG A CG    1 
ATOM   3230 C CG    B ARG A  1 397 ? 29.687  -14.991 22.493  0.30 16.22  ? 842  ARG A CG    1 
ATOM   3231 C CD    A ARG A  1 397 ? 28.598  -14.287 24.332  0.70 33.18  ? 842  ARG A CD    1 
ATOM   3232 C CD    B ARG A  1 397 ? 29.485  -15.332 23.957  0.30 15.57  ? 842  ARG A CD    1 
ATOM   3233 N NE    A ARG A  1 397 ? 29.962  -14.538 24.719  0.70 35.29  ? 842  ARG A NE    1 
ATOM   3234 N NE    B ARG A  1 397 ? 30.547  -14.773 24.779  0.30 15.84  ? 842  ARG A NE    1 
ATOM   3235 C CZ    A ARG A  1 397 ? 30.747  -13.689 25.387  0.70 37.94  ? 842  ARG A CZ    1 
ATOM   3236 C CZ    B ARG A  1 397 ? 31.758  -15.306 24.905  0.30 14.41  ? 842  ARG A CZ    1 
ATOM   3237 N NH1   A ARG A  1 397 ? 30.295  -12.494 25.790  0.70 41.27  ? 842  ARG A NH1   1 
ATOM   3238 N NH1   B ARG A  1 397 ? 32.077  -16.407 24.260  0.30 13.97  ? 842  ARG A NH1   1 
ATOM   3239 N NH2   A ARG A  1 397 ? 32.002  -14.041 25.652  0.70 34.90  ? 842  ARG A NH2   1 
ATOM   3240 N NH2   B ARG A  1 397 ? 32.641  -14.719 25.656  0.30 15.01  ? 842  ARG A NH2   1 
ATOM   3241 N N     . ARG A  1 398 ? 29.331  -10.693 20.679  1.00 16.56  ? 843  ARG A N     1 
ATOM   3242 C CA    . ARG A  1 398 ? 28.641  -9.392  20.577  1.00 16.70  ? 843  ARG A CA    1 
ATOM   3243 C C     . ARG A  1 398 ? 27.966  -9.308  19.187  1.00 14.54  ? 843  ARG A C     1 
ATOM   3244 O O     . ARG A  1 398 ? 26.782  -8.963  19.092  1.00 13.50  ? 843  ARG A O     1 
ATOM   3245 C CB    . ARG A  1 398 ? 29.661  -8.263  20.754  1.00 18.11  ? 843  ARG A CB    1 
ATOM   3246 C CG    . ARG A  1 398 ? 29.096  -6.855  20.788  1.00 19.17  ? 843  ARG A CG    1 
ATOM   3247 C CD    . ARG A  1 398 ? 28.749  -6.325  19.393  1.00 17.37  ? 843  ARG A CD    1 
ATOM   3248 N NE    . ARG A  1 398 ? 28.219  -4.973  19.510  1.00 16.84  ? 843  ARG A NE    1 
ATOM   3249 C CZ    . ARG A  1 398 ? 27.739  -4.262  18.491  1.00 17.05  ? 843  ARG A CZ    1 
ATOM   3250 N NH1   . ARG A  1 398 ? 27.741  -4.756  17.249  1.00 16.00  ? 843  ARG A NH1   1 
ATOM   3251 N NH2   . ARG A  1 398 ? 27.257  -3.039  18.717  1.00 17.07  ? 843  ARG A NH2   1 
ATOM   3252 N N     . GLU A  1 399 ? 28.700  -9.718  18.147  1.00 14.96  ? 844  GLU A N     1 
ATOM   3253 C CA    . GLU A  1 399 ? 28.148  -9.690  16.732  1.00 16.25  ? 844  GLU A CA    1 
ATOM   3254 C C     . GLU A  1 399 ? 27.023  -10.700 16.532  1.00 15.09  ? 844  GLU A C     1 
ATOM   3255 O O     . GLU A  1 399 ? 25.991  -10.365 15.966  1.00 12.68  ? 844  GLU A O     1 
ATOM   3256 C CB    . GLU A  1 399 ? 29.222  -9.873  15.679  1.00 15.70  ? 844  GLU A CB    1 
ATOM   3257 C CG    . GLU A  1 399 ? 30.349  -8.848  15.726  1.00 16.13  ? 844  GLU A CG    1 
ATOM   3258 C CD    . GLU A  1 399 ? 29.910  -7.413  15.453  1.00 17.37  ? 844  GLU A CD    1 
ATOM   3259 O OE1   . GLU A  1 399 ? 29.000  -6.951  16.133  1.00 18.04  ? 844  GLU A OE1   1 
ATOM   3260 O OE2   . GLU A  1 399 ? 30.533  -6.715  14.594  1.00 17.72  ? 844  GLU A OE2   1 
ATOM   3261 N N     . LEU A  1 400 ? 27.192  -11.918 17.068  1.00 15.02  ? 845  LEU A N     1 
ATOM   3262 C CA    . LEU A  1 400 ? 26.133  -12.884 17.071  1.00 13.99  ? 845  LEU A CA    1 
ATOM   3263 C C     . LEU A  1 400 ? 24.873  -12.395 17.753  1.00 14.01  ? 845  LEU A C     1 
ATOM   3264 O O     . LEU A  1 400 ? 23.768  -12.541 17.197  1.00 14.60  ? 845  LEU A O     1 
ATOM   3265 C CB    . LEU A  1 400 ? 26.595  -14.222 17.713  1.00 14.86  ? 845  LEU A CB    1 
ATOM   3266 C CG    . LEU A  1 400 ? 27.534  -15.104 16.930  1.00 15.96  ? 845  LEU A CG    1 
ATOM   3267 C CD1   . LEU A  1 400 ? 28.276  -16.007 17.887  1.00 17.40  ? 845  LEU A CD1   1 
ATOM   3268 C CD2   . LEU A  1 400 ? 26.781  -15.960 15.938  1.00 15.81  ? 845  LEU A CD2   1 
ATOM   3269 N N     . ASN A  1 401 ? 25.003  -11.807 18.949  1.00 13.34  ? 846  ASN A N     1 
ATOM   3270 C CA    . ASN A  1 401 ? 23.819  -11.360 19.697  1.00 14.08  ? 846  ASN A CA    1 
ATOM   3271 C C     . ASN A  1 401 ? 23.127  -10.160 19.008  1.00 13.48  ? 846  ASN A C     1 
ATOM   3272 O O     . ASN A  1 401 ? 21.935  -10.041 19.037  1.00 13.57  ? 846  ASN A O     1 
ATOM   3273 C CB    . ASN A  1 401 ? 24.200  -11.019 21.140  1.00 15.59  ? 846  ASN A CB    1 
ATOM   3274 C CG    . ASN A  1 401 ? 24.531  -12.258 21.964  1.00 15.13  ? 846  ASN A CG    1 
ATOM   3275 O OD1   . ASN A  1 401 ? 24.065  -13.328 21.699  1.00 16.41  ? 846  ASN A OD1   1 
ATOM   3276 N ND2   . ASN A  1 401 ? 25.279  -12.065 23.024  1.00 17.71  ? 846  ASN A ND2   1 
ATOM   3277 N N     . LYS A  1 402 ? 23.914  -9.283  18.399  1.00 13.28  ? 847  LYS A N     1 
ATOM   3278 C CA    . LYS A  1 402 ? 23.378  -8.127  17.667  1.00 13.93  ? 847  LYS A CA    1 
ATOM   3279 C C     . LYS A  1 402 ? 22.549  -8.618  16.497  1.00 13.39  ? 847  LYS A C     1 
ATOM   3280 O O     . LYS A  1 402 ? 21.413  -8.175  16.295  1.00 12.71  ? 847  LYS A O     1 
ATOM   3281 C CB    . LYS A  1 402 ? 24.531  -7.225  17.193  1.00 13.46  ? 847  LYS A CB    1 
ATOM   3282 C CG    . LYS A  1 402 ? 24.135  -6.054  16.292  1.00 13.53  ? 847  LYS A CG    1 
ATOM   3283 C CD    . LYS A  1 402 ? 23.228  -5.023  16.957  1.00 13.56  ? 847  LYS A CD    1 
ATOM   3284 C CE    . LYS A  1 402 ? 23.954  -4.234  18.022  1.00 14.47  ? 847  LYS A CE    1 
ATOM   3285 N NZ    . LYS A  1 402 ? 23.257  -2.973  18.417  1.00 15.93  ? 847  LYS A NZ    1 
ATOM   3286 N N     . ALA A  1 403 ? 23.124  -9.511  15.699  1.00 12.66  ? 848  ALA A N     1 
ATOM   3287 C CA    . ALA A  1 403 ? 22.415  -10.028 14.530  1.00 13.65  ? 848  ALA A CA    1 
ATOM   3288 C C     . ALA A  1 403 ? 21.175  -10.803 14.946  1.00 15.19  ? 848  ALA A C     1 
ATOM   3289 O O     . ALA A  1 403 ? 20.094  -10.664 14.353  1.00 12.43  ? 848  ALA A O     1 
ATOM   3290 C CB    . ALA A  1 403 ? 23.342  -10.919 13.703  1.00 13.49  ? 848  ALA A CB    1 
ATOM   3291 N N     . TYR A  1 404 ? 21.308  -11.580 16.021  1.00 13.71  ? 849  TYR A N     1 
ATOM   3292 C CA    . TYR A  1 404 ? 20.156  -12.305 16.573  1.00 15.43  ? 849  TYR A CA    1 
ATOM   3293 C C     . TYR A  1 404 ? 19.019  -11.377 17.006  1.00 14.68  ? 849  TYR A C     1 
ATOM   3294 O O     . TYR A  1 404 ? 17.863  -11.599 16.647  1.00 15.66  ? 849  TYR A O     1 
ATOM   3295 C CB    . TYR A  1 404 ? 20.649  -13.199 17.746  1.00 16.27  ? 849  TYR A CB    1 
ATOM   3296 C CG    . TYR A  1 404 ? 19.592  -14.000 18.462  1.00 16.55  ? 849  TYR A CG    1 
ATOM   3297 C CD1   . TYR A  1 404 ? 19.076  -15.160 17.909  1.00 17.36  ? 849  TYR A CD1   1 
ATOM   3298 C CD2   . TYR A  1 404 ? 19.159  -13.620 19.741  1.00 18.25  ? 849  TYR A CD2   1 
ATOM   3299 C CE1   . TYR A  1 404 ? 18.127  -15.921 18.578  1.00 17.24  ? 849  TYR A CE1   1 
ATOM   3300 C CE2   . TYR A  1 404 ? 18.213  -14.373 20.427  1.00 17.66  ? 849  TYR A CE2   1 
ATOM   3301 C CZ    . TYR A  1 404 ? 17.724  -15.520 19.843  1.00 18.70  ? 849  TYR A CZ    1 
ATOM   3302 O OH    . TYR A  1 404 ? 16.791  -16.231 20.470  1.00 21.51  ? 849  TYR A OH    1 
ATOM   3303 N N     . CYS A  1 405 ? 19.335  -10.323 17.751  1.00 14.03  ? 850  CYS A N     1 
ATOM   3304 C CA    . CYS A  1 405 ? 18.307  -9.368  18.136  1.00 15.16  ? 850  CYS A CA    1 
ATOM   3305 C C     . CYS A  1 405 ? 17.614  -8.763  16.828  1.00 14.87  ? 850  CYS A C     1 
ATOM   3306 O O     . CYS A  1 405 ? 16.415  -8.551  16.812  1.00 15.97  ? 850  CYS A O     1 
ATOM   3307 C CB    . CYS A  1 405 ? 18.895  -8.257  18.949  1.00 16.44  ? 850  CYS A CB    1 
ATOM   3308 S SG    . CYS A  1 405 ? 17.678  -6.941  19.320  1.00 22.01  ? 850  CYS A SG    1 
ATOM   3309 N N     . GLY A  1 406 ? 18.405  -8.504  15.775  1.00 15.45  ? 851  GLY A N     1 
ATOM   3310 C CA    . GLY A  1 406 ? 17.861  -7.984  14.480  1.00 15.02  ? 851  GLY A CA    1 
ATOM   3311 C C     . GLY A  1 406 ? 16.919  -8.946  13.760  1.00 14.78  ? 851  GLY A C     1 
ATOM   3312 O O     . GLY A  1 406 ? 15.949  -8.519  13.141  1.00 13.39  ? 851  GLY A O     1 
ATOM   3313 N N     . PHE A  1 407 ? 17.167  -10.271 13.909  1.00 12.40  ? 852  PHE A N     1 
ATOM   3314 C CA    . PHE A  1 407 ? 16.464  -11.278 13.162  1.00 12.90  ? 852  PHE A CA    1 
ATOM   3315 C C     . PHE A  1 407 ? 15.287  -11.870 13.946  1.00 13.89  ? 852  PHE A C     1 
ATOM   3316 O O     . PHE A  1 407 ? 14.332  -12.317 13.357  1.00 14.10  ? 852  PHE A O     1 
ATOM   3317 C CB    . PHE A  1 407 ? 17.421  -12.425 12.782  1.00 13.14  ? 852  PHE A CB    1 
ATOM   3318 C CG    . PHE A  1 407 ? 18.592  -12.014 11.935  1.00 12.50  ? 852  PHE A CG    1 
ATOM   3319 C CD1   . PHE A  1 407 ? 18.639  -10.772 11.305  1.00 13.00  ? 852  PHE A CD1   1 
ATOM   3320 C CD2   . PHE A  1 407 ? 19.650  -12.920 11.705  1.00 13.06  ? 852  PHE A CD2   1 
ATOM   3321 C CE1   . PHE A  1 407 ? 19.722  -10.439 10.494  1.00 13.83  ? 852  PHE A CE1   1 
ATOM   3322 C CE2   . PHE A  1 407 ? 20.749  -12.565 10.941  1.00 12.59  ? 852  PHE A CE2   1 
ATOM   3323 C CZ    . PHE A  1 407 ? 20.788  -11.313 10.327  1.00 12.43  ? 852  PHE A CZ    1 
ATOM   3324 N N     . LEU A  1 408 ? 15.366  -11.876 15.284  1.00 14.44  ? 853  LEU A N     1 
ATOM   3325 C CA    . LEU A  1 408 ? 14.378  -12.568 16.106  1.00 16.35  ? 853  LEU A CA    1 
ATOM   3326 C C     . LEU A  1 408 ? 13.057  -11.794 16.199  1.00 15.91  ? 853  LEU A C     1 
ATOM   3327 O O     . LEU A  1 408 ? 13.047  -10.555 16.398  1.00 14.39  ? 853  LEU A O     1 
ATOM   3328 C CB    . LEU A  1 408 ? 14.930  -12.787 17.536  1.00 18.87  ? 853  LEU A CB    1 
ATOM   3329 C CG    . LEU A  1 408 ? 13.996  -13.623 18.426  1.00 20.45  ? 853  LEU A CG    1 
ATOM   3330 C CD1   . LEU A  1 408 ? 14.113  -15.113 18.061  1.00 22.82  ? 853  LEU A CD1   1 
ATOM   3331 C CD2   . LEU A  1 408 ? 14.289  -13.387 19.873  1.00 23.63  ? 853  LEU A CD2   1 
ATOM   3332 N N     . ARG A  1 409 ? 11.932  -12.512 16.066  1.00 15.47  ? 854  ARG A N     1 
ATOM   3333 C CA    . ARG A  1 409 ? 10.625  -11.893 16.277  1.00 17.67  ? 854  ARG A CA    1 
ATOM   3334 C C     . ARG A  1 409 ? 9.832   -12.658 17.355  1.00 20.59  ? 854  ARG A C     1 
ATOM   3335 O O     . ARG A  1 409 ? 9.149   -13.651 17.035  1.00 19.91  ? 854  ARG A O     1 
ATOM   3336 C CB    . ARG A  1 409 ? 9.818   -11.795 14.971  1.00 17.96  ? 854  ARG A CB    1 
ATOM   3337 C CG    . ARG A  1 409 ? 10.522  -10.951 13.857  1.00 17.42  ? 854  ARG A CG    1 
ATOM   3338 C CD    . ARG A  1 409 ? 10.465  -9.467  14.118  1.00 17.03  ? 854  ARG A CD    1 
ATOM   3339 N NE    . ARG A  1 409 ? 11.144  -8.722  13.092  1.00 16.48  ? 854  ARG A NE    1 
ATOM   3340 C CZ    . ARG A  1 409 ? 12.451  -8.453  13.097  1.00 16.62  ? 854  ARG A CZ    1 
ATOM   3341 N NH1   . ARG A  1 409 ? 13.249  -8.857  14.111  1.00 16.69  ? 854  ARG A NH1   1 
ATOM   3342 N NH2   . ARG A  1 409 ? 12.979  -7.767  12.106  1.00 17.69  ? 854  ARG A NH2   1 
ATOM   3343 N N     . PRO A  1 410 ? 9.917   -12.195 18.617  1.00 23.10  ? 855  PRO A N     1 
ATOM   3344 C CA    . PRO A  1 410 ? 9.315   -12.970 19.734  1.00 28.44  ? 855  PRO A CA    1 
ATOM   3345 C C     . PRO A  1 410 ? 7.835   -13.104 19.523  1.00 29.71  ? 855  PRO A C     1 
ATOM   3346 O O     . PRO A  1 410 ? 7.193   -12.137 19.092  1.00 30.11  ? 855  PRO A O     1 
ATOM   3347 C CB    . PRO A  1 410 ? 9.601   -12.094 20.941  1.00 29.53  ? 855  PRO A CB    1 
ATOM   3348 C CG    . PRO A  1 410 ? 10.921  -11.466 20.590  1.00 29.31  ? 855  PRO A CG    1 
ATOM   3349 C CD    . PRO A  1 410 ? 10.752  -11.096 19.124  1.00 25.29  ? 855  PRO A CD    1 
ATOM   3350 N N     . GLY A  1 411 ? 7.318   -14.301 19.682  1.00 33.29  ? 856  GLY A N     1 
ATOM   3351 C CA    . GLY A  1 411 ? 5.891   -14.533 19.444  1.00 38.25  ? 856  GLY A CA    1 
ATOM   3352 C C     . GLY A  1 411 ? 5.584   -15.177 18.103  1.00 40.49  ? 856  GLY A C     1 
ATOM   3353 O O     . GLY A  1 411 ? 4.567   -15.823 17.976  1.00 43.80  ? 856  GLY A O     1 
ATOM   3354 N N     . VAL A  1 412 ? 6.485   -15.051 17.107  1.00 34.68  ? 857  VAL A N     1 
ATOM   3355 C CA    . VAL A  1 412 ? 6.137   -15.411 15.729  1.00 30.70  ? 857  VAL A CA    1 
ATOM   3356 C C     . VAL A  1 412 ? 6.720   -16.757 15.348  1.00 32.20  ? 857  VAL A C     1 
ATOM   3357 O O     . VAL A  1 412 ? 7.864   -17.009 15.551  1.00 36.40  ? 857  VAL A O     1 
ATOM   3358 C CB    . VAL A  1 412 ? 6.591   -14.343 14.740  1.00 28.72  ? 857  VAL A CB    1 
ATOM   3359 C CG1   . VAL A  1 412 ? 6.178   -14.728 13.341  1.00 30.29  ? 857  VAL A CG1   1 
ATOM   3360 C CG2   . VAL A  1 412 ? 6.034   -12.989 15.140  1.00 28.79  ? 857  VAL A CG2   1 
ATOM   3361 N N     . SER A  1 413 ? 5.916   -17.635 14.791  1.00 30.81  ? 858  SER A N     1 
ATOM   3362 C CA    . SER A  1 413 ? 6.411   -18.939 14.447  1.00 32.87  ? 858  SER A CA    1 
ATOM   3363 C C     . SER A  1 413 ? 7.217   -18.924 13.130  1.00 28.82  ? 858  SER A C     1 
ATOM   3364 O O     . SER A  1 413 ? 6.999   -18.089 12.245  1.00 28.94  ? 858  SER A O     1 
ATOM   3365 C CB    . SER A  1 413 ? 5.252   -19.931 14.365  1.00 38.43  ? 858  SER A CB    1 
ATOM   3366 O OG    . SER A  1 413 ? 5.401   -20.741 13.235  1.00 43.41  ? 858  SER A OG    1 
ATOM   3367 N N     . SER A  1 414 ? 8.141   -19.862 12.993  1.00 27.02  ? 859  SER A N     1 
ATOM   3368 C CA    . SER A  1 414 ? 9.152   -19.776 11.957  1.00 27.23  ? 859  SER A CA    1 
ATOM   3369 C C     . SER A  1 414 ? 8.595   -19.819 10.567  1.00 28.09  ? 859  SER A C     1 
ATOM   3370 O O     . SER A  1 414 ? 9.186   -19.248 9.640   1.00 26.84  ? 859  SER A O     1 
ATOM   3371 C CB    . SER A  1 414 ? 10.189  -20.869 12.114  1.00 31.21  ? 859  SER A CB    1 
ATOM   3372 O OG    . SER A  1 414 ? 9.650   -22.108 11.753  1.00 36.76  ? 859  SER A OG    1 
ATOM   3373 N N     . GLU A  1 415 ? 7.440   -20.447 10.372  1.00 25.28  ? 860  GLU A N     1 
ATOM   3374 C CA    . GLU A  1 415 ? 6.876   -20.495 9.024   1.00 24.03  ? 860  GLU A CA    1 
ATOM   3375 C C     . GLU A  1 415 ? 6.246   -19.170 8.589   1.00 23.45  ? 860  GLU A C     1 
ATOM   3376 O O     . GLU A  1 415 ? 5.929   -18.993 7.395   1.00 24.17  ? 860  GLU A O     1 
ATOM   3377 C CB    . GLU A  1 415 ? 5.846   -21.608 8.900   1.00 31.10  ? 860  GLU A CB    1 
ATOM   3378 C CG    . GLU A  1 415 ? 4.596   -21.359 9.709   1.00 36.37  ? 860  GLU A CG    1 
ATOM   3379 C CD    . GLU A  1 415 ? 4.633   -22.017 11.084  1.00 48.29  ? 860  GLU A CD    1 
ATOM   3380 O OE1   . GLU A  1 415 ? 5.734   -22.532 11.499  1.00 52.35  ? 860  GLU A OE1   1 
ATOM   3381 O OE2   . GLU A  1 415 ? 3.562   -22.012 11.759  1.00 55.64  ? 860  GLU A OE2   1 
ATOM   3382 N N     . ASN A  1 416 ? 6.087   -18.221 9.516   1.00 20.52  ? 861  ASN A N     1 
ATOM   3383 C CA    . ASN A  1 416 ? 5.626   -16.879 9.155   1.00 20.40  ? 861  ASN A CA    1 
ATOM   3384 C C     . ASN A  1 416 ? 6.772   -15.855 9.118   1.00 21.77  ? 861  ASN A C     1 
ATOM   3385 O O     . ASN A  1 416 ? 6.522   -14.663 9.112   1.00 24.63  ? 861  ASN A O     1 
ATOM   3386 C CB    . ASN A  1 416 ? 4.559   -16.400 10.135  1.00 21.36  ? 861  ASN A CB    1 
ATOM   3387 C CG    . ASN A  1 416 ? 3.335   -17.339 10.176  1.00 25.47  ? 861  ASN A CG    1 
ATOM   3388 O OD1   . ASN A  1 416 ? 2.789   -17.681 9.143   1.00 29.70  ? 861  ASN A OD1   1 
ATOM   3389 N ND2   . ASN A  1 416 ? 3.004   -17.831 11.333  1.00 25.25  ? 861  ASN A ND2   1 
ATOM   3390 N N     . LEU A  1 417 ? 8.026   -16.335 9.126   1.00 20.72  ? 862  LEU A N     1 
ATOM   3391 C CA    . LEU A  1 417 ? 9.196   -15.448 9.005   1.00 20.07  ? 862  LEU A CA    1 
ATOM   3392 C C     . LEU A  1 417 ? 9.791   -15.506 7.581   1.00 17.48  ? 862  LEU A C     1 
ATOM   3393 O O     . LEU A  1 417 ? 10.186  -16.553 7.094   1.00 18.08  ? 862  LEU A O     1 
ATOM   3394 C CB    . LEU A  1 417 ? 10.258  -15.799 10.040  1.00 18.88  ? 862  LEU A CB    1 
ATOM   3395 C CG    . LEU A  1 417 ? 9.844   -15.645 11.506  1.00 21.19  ? 862  LEU A CG    1 
ATOM   3396 C CD1   . LEU A  1 417 ? 10.941  -16.127 12.420  1.00 22.34  ? 862  LEU A CD1   1 
ATOM   3397 C CD2   . LEU A  1 417 ? 9.443   -14.212 11.858  1.00 23.23  ? 862  LEU A CD2   1 
ATOM   3398 N N     . SER A  1 418 ? 9.867   -14.374 6.940   1.00 15.76  ? 863  SER A N     1 
ATOM   3399 C CA    . SER A  1 418 ? 10.552  -14.263 5.654   1.00 16.00  ? 863  SER A CA    1 
ATOM   3400 C C     . SER A  1 418 ? 12.075  -14.579 5.788   1.00 14.73  ? 863  SER A C     1 
ATOM   3401 O O     . SER A  1 418 ? 12.627  -14.494 6.861   1.00 13.06  ? 863  SER A O     1 
ATOM   3402 C CB    . SER A  1 418 ? 10.381  -12.856 5.107   1.00 15.92  ? 863  SER A CB    1 
ATOM   3403 O OG    . SER A  1 418 ? 11.063  -11.897 5.933   1.00 16.73  ? 863  SER A OG    1 
ATOM   3404 N N     . ALA A  1 419 ? 12.729  -14.868 4.674   1.00 13.43  ? 864  ALA A N     1 
ATOM   3405 C CA    . ALA A  1 419 ? 14.176  -14.967 4.663   1.00 12.55  ? 864  ALA A CA    1 
ATOM   3406 C C     . ALA A  1 419 ? 14.788  -13.571 5.036   1.00 12.84  ? 864  ALA A C     1 
ATOM   3407 O O     . ALA A  1 419 ? 14.160  -12.517 4.817   1.00 12.18  ? 864  ALA A O     1 
ATOM   3408 C CB    . ALA A  1 419 ? 14.631  -15.402 3.288   1.00 13.78  ? 864  ALA A CB    1 
ATOM   3409 N N     . VAL A  1 420 ? 16.020  -13.576 5.510   1.00 12.96  ? 865  VAL A N     1 
ATOM   3410 C CA    . VAL A  1 420 ? 16.799  -12.362 5.694   1.00 13.42  ? 865  VAL A CA    1 
ATOM   3411 C C     . VAL A  1 420 ? 17.581  -12.079 4.428   1.00 12.42  ? 865  VAL A C     1 
ATOM   3412 O O     . VAL A  1 420 ? 18.365  -12.918 3.991   1.00 11.95  ? 865  VAL A O     1 
ATOM   3413 C CB    . VAL A  1 420 ? 17.839  -12.549 6.809   1.00 15.82  ? 865  VAL A CB    1 
ATOM   3414 C CG1   . VAL A  1 420 ? 18.662  -11.257 7.014   1.00 16.88  ? 865  VAL A CG1   1 
ATOM   3415 C CG2   . VAL A  1 420 ? 17.155  -12.952 8.068   1.00 18.75  ? 865  VAL A CG2   1 
ATOM   3416 N N     . ALA A  1 421 ? 17.459  -10.856 3.921   1.00 11.32  ? 866  ALA A N     1 
ATOM   3417 C CA    . ALA A  1 421 ? 18.286  -10.340 2.822   1.00 10.89  ? 866  ALA A CA    1 
ATOM   3418 C C     . ALA A  1 421 ? 19.408  -9.471  3.343   1.00 10.50  ? 866  ALA A C     1 
ATOM   3419 O O     . ALA A  1 421 ? 19.178  -8.374  3.904   1.00 10.36  ? 866  ALA A O     1 
ATOM   3420 C CB    . ALA A  1 421 ? 17.436  -9.575  1.817   1.00 11.54  ? 866  ALA A CB    1 
ATOM   3421 N N     . THR A  1 422 ? 20.631  -9.993  3.234   1.00 10.45  ? 867  THR A N     1 
ATOM   3422 C CA    . THR A  1 422 ? 21.794  -9.379  3.847   1.00 11.15  ? 867  THR A CA    1 
ATOM   3423 C C     . THR A  1 422 ? 23.009  -9.505  2.962   1.00 10.39  ? 867  THR A C     1 
ATOM   3424 O O     . THR A  1 422 ? 22.893  -9.788  1.754   1.00 10.99  ? 867  THR A O     1 
ATOM   3425 C CB    . THR A  1 422 ? 22.057  -9.931  5.282   1.00 11.30  ? 867  THR A CB    1 
ATOM   3426 O OG1   . THR A  1 422 ? 23.049  -9.130  5.959   1.00 11.46  ? 867  THR A OG1   1 
ATOM   3427 C CG2   . THR A  1 422 ? 22.498  -11.412 5.278   1.00 12.92  ? 867  THR A CG2   1 
ATOM   3428 N N     . GLY A  1 423 ? 24.145  -9.073  3.488   1.00 10.74  ? 868  GLY A N     1 
ATOM   3429 C CA    . GLY A  1 423 ? 25.382  -9.153  2.759   1.00 10.50  ? 868  GLY A CA    1 
ATOM   3430 C C     . GLY A  1 423 ? 26.584  -8.861  3.678   1.00 11.30  ? 868  GLY A C     1 
ATOM   3431 O O     . GLY A  1 423 ? 26.612  -9.305  4.870   1.00 12.60  ? 868  GLY A O     1 
ATOM   3432 N N     . ASN A  1 424 ? 27.573  -8.150  3.125   1.00 12.12  ? 869  ASN A N     1 
ATOM   3433 C CA    . ASN A  1 424 ? 28.863  -7.890  3.782   1.00 11.48  ? 869  ASN A CA    1 
ATOM   3434 C C     . ASN A  1 424 ? 28.782  -6.864  4.950   1.00 11.03  ? 869  ASN A C     1 
ATOM   3435 O O     . ASN A  1 424 ? 29.606  -5.918  5.046   1.00 10.54  ? 869  ASN A O     1 
ATOM   3436 C CB    . ASN A  1 424 ? 29.906  -7.423  2.740   1.00 13.12  ? 869  ASN A CB    1 
ATOM   3437 C CG    . ASN A  1 424 ? 30.093  -8.411  1.601   1.00 14.03  ? 869  ASN A CG    1 
ATOM   3438 O OD1   . ASN A  1 424 ? 29.933  -9.639  1.770   1.00 14.38  ? 869  ASN A OD1   1 
ATOM   3439 N ND2   . ASN A  1 424 ? 30.430  -7.890  0.429   1.00 14.35  ? 869  ASN A ND2   1 
ATOM   3440 N N     . TRP A  1 425 ? 27.851  -7.118  5.880   1.00 11.19  ? 870  TRP A N     1 
ATOM   3441 C CA    . TRP A  1 425 ? 27.622  -6.299  7.084   1.00 10.74  ? 870  TRP A CA    1 
ATOM   3442 C C     . TRP A  1 425 ? 28.886  -6.076  7.903   1.00 11.76  ? 870  TRP A C     1 
ATOM   3443 O O     . TRP A  1 425 ? 29.600  -7.056  8.228   1.00 12.81  ? 870  TRP A O     1 
ATOM   3444 C CB    . TRP A  1 425 ? 26.599  -7.016  7.957   1.00 11.29  ? 870  TRP A CB    1 
ATOM   3445 C CG    . TRP A  1 425 ? 26.300  -6.411  9.308   1.00 11.51  ? 870  TRP A CG    1 
ATOM   3446 C CD1   . TRP A  1 425 ? 25.999  -5.106  9.599   1.00 12.25  ? 870  TRP A CD1   1 
ATOM   3447 C CD2   . TRP A  1 425 ? 26.229  -7.125  10.540  1.00 12.12  ? 870  TRP A CD2   1 
ATOM   3448 N NE1   . TRP A  1 425 ? 25.703  -4.969  10.953  1.00 12.71  ? 870  TRP A NE1   1 
ATOM   3449 C CE2   . TRP A  1 425 ? 25.879  -6.198  11.554  1.00 12.61  ? 870  TRP A CE2   1 
ATOM   3450 C CE3   . TRP A  1 425 ? 26.511  -8.447  10.907  1.00 13.33  ? 870  TRP A CE3   1 
ATOM   3451 C CZ2   . TRP A  1 425 ? 25.833  -6.557  12.904  1.00 13.61  ? 870  TRP A CZ2   1 
ATOM   3452 C CZ3   . TRP A  1 425 ? 26.382  -8.804  12.250  1.00 13.62  ? 870  TRP A CZ3   1 
ATOM   3453 C CH2   . TRP A  1 425 ? 26.053  -7.866  13.221  1.00 11.94  ? 870  TRP A CH2   1 
ATOM   3454 N N     . GLY A  1 426 ? 29.231  -4.813  8.148   1.00 11.67  ? 871  GLY A N     1 
ATOM   3455 C CA    . GLY A  1 426 ? 30.438  -4.488  8.944   1.00 12.39  ? 871  GLY A CA    1 
ATOM   3456 C C     . GLY A  1 426 ? 31.776  -4.647  8.236   1.00 13.24  ? 871  GLY A C     1 
ATOM   3457 O O     . GLY A  1 426 ? 32.825  -4.388  8.832   1.00 13.75  ? 871  GLY A O     1 
ATOM   3458 N N     . CYS A  1 427 ? 31.753  -4.939  6.933   1.00 12.17  ? 872  CYS A N     1 
ATOM   3459 C CA    . CYS A  1 427 ? 32.975  -5.308  6.211   1.00 13.31  ? 872  CYS A CA    1 
ATOM   3460 C C     . CYS A  1 427 ? 33.418  -4.297  5.142   1.00 13.63  ? 872  CYS A C     1 
ATOM   3461 O O     . CYS A  1 427 ? 34.248  -4.628  4.304   1.00 14.42  ? 872  CYS A O     1 
ATOM   3462 C CB    . CYS A  1 427 ? 32.827  -6.703  5.591   1.00 14.46  ? 872  CYS A CB    1 
ATOM   3463 S SG    . CYS A  1 427 ? 32.484  -7.995  6.830   1.00 17.11  ? 872  CYS A SG    1 
ATOM   3464 N N     . GLY A  1 428 ? 32.886  -3.070  5.189   1.00 12.56  ? 873  GLY A N     1 
ATOM   3465 C CA    . GLY A  1 428 ? 33.384  -1.996  4.319   1.00 13.74  ? 873  GLY A CA    1 
ATOM   3466 C C     . GLY A  1 428 ? 34.006  -0.911  5.151   1.00 14.45  ? 873  GLY A C     1 
ATOM   3467 O O     . GLY A  1 428 ? 35.119  -1.073  5.664   1.00 13.05  ? 873  GLY A O     1 
ATOM   3468 N N     . ALA A  1 429 ? 33.212  0.102   5.481   1.00 13.23  ? 874  ALA A N     1 
ATOM   3469 C CA    . ALA A  1 429 ? 33.667  1.141   6.361   1.00 13.58  ? 874  ALA A CA    1 
ATOM   3470 C C     . ALA A  1 429 ? 34.111  0.645   7.731   1.00 14.46  ? 874  ALA A C     1 
ATOM   3471 O O     . ALA A  1 429 ? 35.017  1.261   8.355   1.00 15.44  ? 874  ALA A O     1 
ATOM   3472 C CB    . ALA A  1 429 ? 32.593  2.207   6.530   1.00 13.87  ? 874  ALA A CB    1 
ATOM   3473 N N     . PHE A  1 430 ? 33.515  -0.439  8.220   1.00 14.01  ? 875  PHE A N     1 
ATOM   3474 C CA    . PHE A  1 430 ? 33.794  -0.911  9.592   1.00 14.75  ? 875  PHE A CA    1 
ATOM   3475 C C     . PHE A  1 430 ? 34.888  -1.969  9.696   1.00 15.18  ? 875  PHE A C     1 
ATOM   3476 O O     . PHE A  1 430 ? 35.196  -2.405  10.786  1.00 15.90  ? 875  PHE A O     1 
ATOM   3477 C CB    . PHE A  1 430 ? 32.528  -1.357  10.290  1.00 14.52  ? 875  PHE A CB    1 
ATOM   3478 C CG    . PHE A  1 430 ? 31.791  -0.240  10.991  1.00 14.36  ? 875  PHE A CG    1 
ATOM   3479 C CD1   . PHE A  1 430 ? 32.109  1.085   10.772  1.00 14.46  ? 875  PHE A CD1   1 
ATOM   3480 C CD2   . PHE A  1 430 ? 30.699  -0.530  11.749  1.00 15.13  ? 875  PHE A CD2   1 
ATOM   3481 C CE1   . PHE A  1 430 ? 31.425  2.105   11.444  1.00 14.66  ? 875  PHE A CE1   1 
ATOM   3482 C CE2   . PHE A  1 430 ? 29.987  0.466   12.371  1.00 16.28  ? 875  PHE A CE2   1 
ATOM   3483 C CZ    . PHE A  1 430 ? 30.375  1.801   12.204  1.00 15.16  ? 875  PHE A CZ    1 
ATOM   3484 N N     . GLY A  1 431 ? 35.496  -2.335  8.563   1.00 16.75  ? 876  GLY A N     1 
ATOM   3485 C CA    . GLY A  1 431 ? 36.743  -3.084  8.554   1.00 17.79  ? 876  GLY A CA    1 
ATOM   3486 C C     . GLY A  1 431 ? 36.693  -4.575  8.919   1.00 18.35  ? 876  GLY A C     1 
ATOM   3487 O O     . GLY A  1 431 ? 37.708  -5.173  9.110   1.00 17.90  ? 876  GLY A O     1 
ATOM   3488 N N     . GLY A  1 432 ? 35.524  -5.176  8.966   1.00 15.32  ? 877  GLY A N     1 
ATOM   3489 C CA    . GLY A  1 432 ? 35.415  -6.596  9.306   1.00 14.87  ? 877  GLY A CA    1 
ATOM   3490 C C     . GLY A  1 432 ? 35.791  -7.549  8.180   1.00 15.31  ? 877  GLY A C     1 
ATOM   3491 O O     . GLY A  1 432 ? 35.870  -7.140  6.955   1.00 14.86  ? 877  GLY A O     1 
ATOM   3492 N N     . ASP A  1 433 ? 35.935  -8.835  8.541   1.00 15.02  ? 878  ASP A N     1 
ATOM   3493 C CA    . ASP A  1 433 ? 36.238  -9.889  7.568   1.00 15.54  ? 878  ASP A CA    1 
ATOM   3494 C C     . ASP A  1 433 ? 34.934  -10.522 7.096   1.00 14.97  ? 878  ASP A C     1 
ATOM   3495 O O     . ASP A  1 433 ? 34.199  -11.071 7.905   1.00 13.89  ? 878  ASP A O     1 
ATOM   3496 C CB    . ASP A  1 433 ? 37.090  -10.984 8.244   1.00 18.61  ? 878  ASP A CB    1 
ATOM   3497 C CG    . ASP A  1 433 ? 37.481  -12.126 7.276   1.00 23.21  ? 878  ASP A CG    1 
ATOM   3498 O OD1   . ASP A  1 433 ? 38.428  -11.961 6.536   1.00 29.16  ? 878  ASP A OD1   1 
ATOM   3499 O OD2   . ASP A  1 433 ? 36.817  -13.147 7.243   1.00 23.86  ? 878  ASP A OD2   1 
ATOM   3500 N N     . ALA A  1 434 ? 34.670  -10.517 5.790   1.00 12.83  ? 879  ALA A N     1 
ATOM   3501 C CA    . ALA A  1 434 ? 33.362  -10.976 5.301   1.00 13.66  ? 879  ALA A CA    1 
ATOM   3502 C C     . ALA A  1 434 ? 33.133  -12.465 5.503   1.00 13.01  ? 879  ALA A C     1 
ATOM   3503 O O     . ALA A  1 434 ? 32.019  -12.895 5.676   1.00 13.09  ? 879  ALA A O     1 
ATOM   3504 C CB    . ALA A  1 434 ? 33.167  -10.579 3.835   1.00 14.32  ? 879  ALA A CB    1 
ATOM   3505 N N     . ARG A  1 435 ? 34.190  -13.274 5.493   1.00 13.82  ? 880  ARG A N     1 
ATOM   3506 C CA    . ARG A  1 435 ? 34.015  -14.753 5.665   1.00 13.81  ? 880  ARG A CA    1 
ATOM   3507 C C     . ARG A  1 435 ? 33.588  -15.085 7.111   1.00 13.59  ? 880  ARG A C     1 
ATOM   3508 O O     . ARG A  1 435 ? 32.692  -15.917 7.341   1.00 12.70  ? 880  ARG A O     1 
ATOM   3509 C CB    . ARG A  1 435 ? 35.296  -15.500 5.228   1.00 14.36  ? 880  ARG A CB    1 
ATOM   3510 C CG    . ARG A  1 435 ? 35.378  -15.614 3.686   1.00 15.08  ? 880  ARG A CG    1 
ATOM   3511 C CD    . ARG A  1 435 ? 36.780  -15.812 3.141   1.00 17.42  ? 880  ARG A CD    1 
ATOM   3512 N NE    . ARG A  1 435 ? 36.767  -15.864 1.665   1.00 16.68  ? 880  ARG A NE    1 
ATOM   3513 C CZ    . ARG A  1 435 ? 36.865  -14.799 0.843   1.00 17.81  ? 880  ARG A CZ    1 
ATOM   3514 N NH1   . ARG A  1 435 ? 36.998  -13.601 1.318   1.00 17.08  ? 880  ARG A NH1   1 
ATOM   3515 N NH2   . ARG A  1 435 ? 36.812  -14.959 -0.478  1.00 18.26  ? 880  ARG A NH2   1 
ATOM   3516 N N     . LEU A  1 436 ? 34.157  -14.368 8.069   1.00 14.02  ? 881  LEU A N     1 
ATOM   3517 C CA    . LEU A  1 436 ? 33.734  -14.503 9.462   1.00 14.30  ? 881  LEU A CA    1 
ATOM   3518 C C     . LEU A  1 436 ? 32.333  -13.941 9.652   1.00 13.80  ? 881  LEU A C     1 
ATOM   3519 O O     . LEU A  1 436 ? 31.482  -14.599 10.223  1.00 13.12  ? 881  LEU A O     1 
ATOM   3520 C CB    . LEU A  1 436 ? 34.694  -13.807 10.408  1.00 13.82  ? 881  LEU A CB    1 
ATOM   3521 C CG    . LEU A  1 436 ? 34.220  -13.680 11.867  1.00 14.50  ? 881  LEU A CG    1 
ATOM   3522 C CD1   . LEU A  1 436 ? 34.116  -15.043 12.514  1.00 14.37  ? 881  LEU A CD1   1 
ATOM   3523 C CD2   . LEU A  1 436 ? 35.129  -12.750 12.696  1.00 15.66  ? 881  LEU A CD2   1 
ATOM   3524 N N     . LYS A  1 437 ? 32.079  -12.733 9.158   1.00 13.65  ? 882  LYS A N     1 
ATOM   3525 C CA    . LYS A  1 437 ? 30.749  -12.142 9.395   1.00 14.55  ? 882  LYS A CA    1 
ATOM   3526 C C     . LYS A  1 437 ? 29.658  -12.900 8.719   1.00 13.65  ? 882  LYS A C     1 
ATOM   3527 O O     . LYS A  1 437 ? 28.546  -12.930 9.235   1.00 13.03  ? 882  LYS A O     1 
ATOM   3528 C CB    . LYS A  1 437 ? 30.668  -10.706 8.929   1.00 15.32  ? 882  LYS A CB    1 
ATOM   3529 C CG    . LYS A  1 437 ? 31.062  -9.753  9.940   1.00 20.80  ? 882  LYS A CG    1 
ATOM   3530 C CD    . LYS A  1 437 ? 30.008  -9.540  10.993  1.00 18.22  ? 882  LYS A CD    1 
ATOM   3531 C CE    . LYS A  1 437 ? 30.157  -8.129  11.540  1.00 18.00  ? 882  LYS A CE    1 
ATOM   3532 N NZ    . LYS A  1 437 ? 31.502  -7.768  12.012  1.00 18.31  ? 882  LYS A NZ    1 
ATOM   3533 N N     . ALA A  1 438 ? 29.919  -13.452 7.532   1.00 12.58  ? 883  ALA A N     1 
ATOM   3534 C CA    . ALA A  1 438 ? 28.910  -14.281 6.906   1.00 14.45  ? 883  ALA A CA    1 
ATOM   3535 C C     . ALA A  1 438 ? 28.523  -15.490 7.799   1.00 14.36  ? 883  ALA A C     1 
ATOM   3536 O O     . ALA A  1 438 ? 27.349  -15.824 7.939   1.00 12.20  ? 883  ALA A O     1 
ATOM   3537 C CB    . ALA A  1 438 ? 29.355  -14.754 5.526   1.00 15.90  ? 883  ALA A CB    1 
ATOM   3538 N N     . LEU A  1 439 ? 29.518  -16.186 8.335   1.00 14.70  ? 884  LEU A N     1 
ATOM   3539 C CA    . LEU A  1 439 ? 29.240  -17.317 9.235   1.00 16.36  ? 884  LEU A CA    1 
ATOM   3540 C C     . LEU A  1 439 ? 28.478  -16.881 10.470  1.00 14.64  ? 884  LEU A C     1 
ATOM   3541 O O     . LEU A  1 439 ? 27.524  -17.539 10.892  1.00 13.71  ? 884  LEU A O     1 
ATOM   3542 C CB    . LEU A  1 439 ? 30.544  -17.991 9.704   1.00 19.01  ? 884  LEU A CB    1 
ATOM   3543 C CG    . LEU A  1 439 ? 30.753  -19.405 9.254   1.00 24.00  ? 884  LEU A CG    1 
ATOM   3544 C CD1   . LEU A  1 439 ? 31.999  -20.015 9.927   1.00 24.69  ? 884  LEU A CD1   1 
ATOM   3545 C CD2   . LEU A  1 439 ? 29.533  -20.288 9.440   1.00 22.72  ? 884  LEU A CD2   1 
ATOM   3546 N N     . ILE A  1 440 ? 28.904  -15.775 11.061  1.00 13.87  ? 885  ILE A N     1 
ATOM   3547 C CA    . ILE A  1 440 ? 28.156  -15.156 12.179  1.00 14.51  ? 885  ILE A CA    1 
ATOM   3548 C C     . ILE A  1 440 ? 26.707  -14.907 11.853  1.00 12.92  ? 885  ILE A C     1 
ATOM   3549 O O     . ILE A  1 440 ? 25.804  -15.315 12.621  1.00 12.60  ? 885  ILE A O     1 
ATOM   3550 C CB    . ILE A  1 440 ? 28.845  -13.909 12.695  1.00 15.67  ? 885  ILE A CB    1 
ATOM   3551 C CG1   . ILE A  1 440 ? 30.104  -14.318 13.470  1.00 18.39  ? 885  ILE A CG1   1 
ATOM   3552 C CG2   . ILE A  1 440 ? 27.900  -13.089 13.590  1.00 15.77  ? 885  ILE A CG2   1 
ATOM   3553 C CD1   . ILE A  1 440 ? 30.942  -13.137 13.905  1.00 18.91  ? 885  ILE A CD1   1 
ATOM   3554 N N     . GLN A  1 441 ? 26.428  -14.363 10.690  1.00 13.28  ? 886  GLN A N     1 
ATOM   3555 C CA    . GLN A  1 441 ? 25.016  -14.120 10.324  1.00 13.19  ? 886  GLN A CA    1 
ATOM   3556 C C     . GLN A  1 441 ? 24.254  -15.421 10.069  1.00 13.33  ? 886  GLN A C     1 
ATOM   3557 O O     . GLN A  1 441 ? 23.106  -15.522 10.390  1.00 12.82  ? 886  GLN A O     1 
ATOM   3558 C CB    . GLN A  1 441 ? 24.927  -13.240 9.119   1.00 13.97  ? 886  GLN A CB    1 
ATOM   3559 C CG    . GLN A  1 441 ? 25.371  -11.807 9.432   1.00 14.24  ? 886  GLN A CG    1 
ATOM   3560 C CD    . GLN A  1 441 ? 25.123  -10.921 8.246   1.00 15.33  ? 886  GLN A CD    1 
ATOM   3561 O OE1   . GLN A  1 441 ? 24.027  -10.347 8.081   1.00 14.93  ? 886  GLN A OE1   1 
ATOM   3562 N NE2   . GLN A  1 441 ? 26.119  -10.796 7.417   1.00 14.13  ? 886  GLN A NE2   1 
ATOM   3563 N N     . ILE A  1 442 ? 24.903  -16.373 9.453   1.00 13.07  ? 887  ILE A N     1 
ATOM   3564 C CA    . ILE A  1 442 ? 24.313  -17.712 9.256   1.00 14.18  ? 887  ILE A CA    1 
ATOM   3565 C C     . ILE A  1 442 ? 23.953  -18.382 10.609  1.00 14.32  ? 887  ILE A C     1 
ATOM   3566 O O     . ILE A  1 442 ? 22.876  -18.939 10.738  1.00 15.99  ? 887  ILE A O     1 
ATOM   3567 C CB    . ILE A  1 442 ? 25.256  -18.572 8.403   1.00 14.86  ? 887  ILE A CB    1 
ATOM   3568 C CG1   . ILE A  1 442 ? 25.181  -18.101 6.942   1.00 14.59  ? 887  ILE A CG1   1 
ATOM   3569 C CG2   . ILE A  1 442 ? 24.978  -20.076 8.571   1.00 14.38  ? 887  ILE A CG2   1 
ATOM   3570 C CD1   . ILE A  1 442 ? 26.308  -18.643 6.048   1.00 14.97  ? 887  ILE A CD1   1 
ATOM   3571 N N     . LEU A  1 443 ? 24.833  -18.265 11.616  1.00 13.95  ? 888  LEU A N     1 
ATOM   3572 C CA    . LEU A  1 443 ? 24.529  -18.812 12.942  1.00 15.03  ? 888  LEU A CA    1 
ATOM   3573 C C     . LEU A  1 443 ? 23.365  -18.074 13.637  1.00 13.21  ? 888  LEU A C     1 
ATOM   3574 O O     . LEU A  1 443 ? 22.463  -18.705 14.204  1.00 13.46  ? 888  LEU A O     1 
ATOM   3575 C CB    . LEU A  1 443 ? 25.766  -18.773 13.833  1.00 15.40  ? 888  LEU A CB    1 
ATOM   3576 C CG    . LEU A  1 443 ? 26.969  -19.611 13.335  1.00 18.20  ? 888  LEU A CG    1 
ATOM   3577 C CD1   . LEU A  1 443 ? 28.025  -19.651 14.440  1.00 19.83  ? 888  LEU A CD1   1 
ATOM   3578 C CD2   . LEU A  1 443 ? 26.585  -20.987 12.986  1.00 18.93  ? 888  LEU A CD2   1 
ATOM   3579 N N     . ALA A  1 444 ? 23.342  -16.760 13.532  1.00 12.33  ? 889  ALA A N     1 
ATOM   3580 C CA    . ALA A  1 444 ? 22.284  -15.993 14.143  1.00 12.89  ? 889  ALA A CA    1 
ATOM   3581 C C     . ALA A  1 444 ? 20.943  -16.246 13.501  1.00 13.49  ? 889  ALA A C     1 
ATOM   3582 O O     . ALA A  1 444 ? 19.906  -16.344 14.190  1.00 14.67  ? 889  ALA A O     1 
ATOM   3583 C CB    . ALA A  1 444 ? 22.620  -14.497 14.128  1.00 14.76  ? 889  ALA A CB    1 
ATOM   3584 N N     . ALA A  1 445 ? 20.927  -16.370 12.187  1.00 12.73  ? 890  ALA A N     1 
ATOM   3585 C CA    . ALA A  1 445 ? 19.705  -16.659 11.488  1.00 13.82  ? 890  ALA A CA    1 
ATOM   3586 C C     . ALA A  1 445 ? 19.178  -18.061 11.836  1.00 14.53  ? 890  ALA A C     1 
ATOM   3587 O O     . ALA A  1 445 ? 17.952  -18.283 11.950  1.00 13.72  ? 890  ALA A O     1 
ATOM   3588 C CB    . ALA A  1 445 ? 19.934  -16.540 9.995   1.00 14.33  ? 890  ALA A CB    1 
ATOM   3589 N N     . ALA A  1 446 ? 20.099  -19.008 11.971  1.00 14.07  ? 891  ALA A N     1 
ATOM   3590 C CA    . ALA A  1 446 ? 19.740  -20.364 12.332  1.00 14.73  ? 891  ALA A CA    1 
ATOM   3591 C C     . ALA A  1 446 ? 19.075  -20.361 13.733  1.00 15.85  ? 891  ALA A C     1 
ATOM   3592 O O     . ALA A  1 446 ? 18.023  -20.976 13.921  1.00 17.98  ? 891  ALA A O     1 
ATOM   3593 C CB    . ALA A  1 446 ? 20.989  -21.256 12.327  1.00 14.54  ? 891  ALA A CB    1 
ATOM   3594 N N     . ALA A  1 447 ? 19.660  -19.619 14.681  1.00 15.65  ? 892  ALA A N     1 
ATOM   3595 C CA    . ALA A  1 447 ? 19.096  -19.494 16.041  1.00 15.33  ? 892  ALA A CA    1 
ATOM   3596 C C     . ALA A  1 447 ? 17.739  -18.811 16.029  1.00 17.85  ? 892  ALA A C     1 
ATOM   3597 O O     . ALA A  1 447 ? 16.845  -19.191 16.780  1.00 18.18  ? 892  ALA A O     1 
ATOM   3598 C CB    . ALA A  1 447 ? 20.053  -18.762 16.957  1.00 16.39  ? 892  ALA A CB    1 
ATOM   3599 N N     . ALA A  1 448 ? 17.522  -17.882 15.109  1.00 15.30  ? 893  ALA A N     1 
ATOM   3600 C CA    . ALA A  1 448 ? 16.189  -17.268 14.953  1.00 16.11  ? 893  ALA A CA    1 
ATOM   3601 C C     . ALA A  1 448 ? 15.256  -18.026 14.006  1.00 16.99  ? 893  ALA A C     1 
ATOM   3602 O O     . ALA A  1 448 ? 14.158  -17.582 13.767  1.00 16.15  ? 893  ALA A O     1 
ATOM   3603 C CB    . ALA A  1 448 ? 16.342  -15.807 14.488  1.00 17.30  ? 893  ALA A CB    1 
ATOM   3604 N N     . GLU A  1 449 ? 15.714  -19.142 13.425  1.00 16.97  ? 894  GLU A N     1 
ATOM   3605 C CA    . GLU A  1 449 ? 14.896  -19.982 12.511  1.00 18.85  ? 894  GLU A CA    1 
ATOM   3606 C C     . GLU A  1 449 ? 14.440  -19.278 11.220  1.00 19.23  ? 894  GLU A C     1 
ATOM   3607 O O     . GLU A  1 449 ? 13.288  -19.431 10.782  1.00 19.36  ? 894  GLU A O     1 
ATOM   3608 C CB    . GLU A  1 449 ? 13.713  -20.629 13.297  1.00 22.58  ? 894  GLU A CB    1 
ATOM   3609 C CG    . GLU A  1 449 ? 14.267  -21.524 14.399  1.00 24.49  ? 894  GLU A CG    1 
ATOM   3610 C CD    . GLU A  1 449 ? 13.213  -22.335 15.181  1.00 32.05  ? 894  GLU A CD    1 
ATOM   3611 O OE1   . GLU A  1 449 ? 12.025  -22.316 14.843  1.00 32.93  ? 894  GLU A OE1   1 
ATOM   3612 O OE2   . GLU A  1 449 ? 13.603  -22.992 16.155  1.00 41.11  ? 894  GLU A OE2   1 
ATOM   3613 N N     . ARG A  1 450 ? 15.364  -18.508 10.630  1.00 14.88  ? 895  ARG A N     1 
ATOM   3614 C CA    . ARG A  1 450 ? 15.175  -17.869 9.311   1.00 15.58  ? 895  ARG A CA    1 
ATOM   3615 C C     . ARG A  1 450 ? 16.257  -18.360 8.295   1.00 14.98  ? 895  ARG A C     1 
ATOM   3616 O O     . ARG A  1 450 ? 17.412  -18.649 8.679   1.00 14.35  ? 895  ARG A O     1 
ATOM   3617 C CB    . ARG A  1 450 ? 15.266  -16.313 9.431   1.00 16.22  ? 895  ARG A CB    1 
ATOM   3618 C CG    . ARG A  1 450 ? 14.396  -15.723 10.548  1.00 19.22  ? 895  ARG A CG    1 
ATOM   3619 C CD    . ARG A  1 450 ? 14.496  -14.196 10.626  1.00 21.91  ? 895  ARG A CD    1 
ATOM   3620 N NE    . ARG A  1 450 ? 13.632  -13.612 9.653   1.00 20.19  ? 895  ARG A NE    1 
ATOM   3621 C CZ    . ARG A  1 450 ? 12.738  -12.668 9.855   1.00 17.63  ? 895  ARG A CZ    1 
ATOM   3622 N NH1   . ARG A  1 450 ? 12.633  -12.018 10.974  1.00 16.21  ? 895  ARG A NH1   1 
ATOM   3623 N NH2   . ARG A  1 450 ? 12.026  -12.287 8.836   1.00 18.23  ? 895  ARG A NH2   1 
ATOM   3624 N N     . ASP A  1 451 ? 15.864  -18.466 7.034   1.00 12.05  ? 896  ASP A N     1 
ATOM   3625 C CA    . ASP A  1 451 ? 16.793  -18.693 5.945   1.00 12.62  ? 896  ASP A CA    1 
ATOM   3626 C C     . ASP A  1 451 ? 17.498  -17.402 5.570   1.00 13.17  ? 896  ASP A C     1 
ATOM   3627 O O     . ASP A  1 451 ? 17.046  -16.293 5.958   1.00 13.58  ? 896  ASP A O     1 
ATOM   3628 C CB    . ASP A  1 451 ? 16.056  -19.218 4.750   1.00 13.47  ? 896  ASP A CB    1 
ATOM   3629 C CG    . ASP A  1 451 ? 15.362  -20.603 5.029   1.00 15.81  ? 896  ASP A CG    1 
ATOM   3630 O OD1   . ASP A  1 451 ? 15.981  -21.466 5.704   1.00 15.90  ? 896  ASP A OD1   1 
ATOM   3631 O OD2   . ASP A  1 451 ? 14.209  -20.788 4.548   1.00 19.89  ? 896  ASP A OD2   1 
ATOM   3632 N N     . VAL A  1 452 ? 18.579  -17.520 4.799   1.00 13.01  ? 897  VAL A N     1 
ATOM   3633 C CA    . VAL A  1 452 ? 19.454  -16.408 4.483   1.00 12.19  ? 897  VAL A CA    1 
ATOM   3634 C C     . VAL A  1 452 ? 19.638  -16.241 2.989   1.00 12.43  ? 897  VAL A C     1 
ATOM   3635 O O     . VAL A  1 452 ? 19.913  -17.229 2.241   1.00 11.30  ? 897  VAL A O     1 
ATOM   3636 C CB    . VAL A  1 452 ? 20.863  -16.617 5.122   1.00 14.24  ? 897  VAL A CB    1 
ATOM   3637 C CG1   . VAL A  1 452 ? 21.824  -15.472 4.739   1.00 14.98  ? 897  VAL A CG1   1 
ATOM   3638 C CG2   . VAL A  1 452 ? 20.757  -16.705 6.611   1.00 14.41  ? 897  VAL A CG2   1 
ATOM   3639 N N     . VAL A  1 453 ? 19.479  -15.005 2.512   1.00 11.14  ? 898  VAL A N     1 
ATOM   3640 C CA    . VAL A  1 453 ? 19.776  -14.669 1.118   1.00 12.23  ? 898  VAL A CA    1 
ATOM   3641 C C     . VAL A  1 453 ? 20.926  -13.618 1.187   1.00 12.25  ? 898  VAL A C     1 
ATOM   3642 O O     . VAL A  1 453 ? 20.744  -12.533 1.738   1.00 12.60  ? 898  VAL A O     1 
ATOM   3643 C CB    . VAL A  1 453 ? 18.532  -14.075 0.404   1.00 13.14  ? 898  VAL A CB    1 
ATOM   3644 C CG1   . VAL A  1 453 ? 18.864  -13.596 -1.011  1.00 13.33  ? 898  VAL A CG1   1 
ATOM   3645 C CG2   . VAL A  1 453 ? 17.382  -15.097 0.375   1.00 13.18  ? 898  VAL A CG2   1 
ATOM   3646 N N     . TYR A  1 454 ? 22.106  -13.983 0.710   1.00 11.23  ? 899  TYR A N     1 
ATOM   3647 C CA    . TYR A  1 454 ? 23.323  -13.217 0.933   1.00 11.24  ? 899  TYR A CA    1 
ATOM   3648 C C     . TYR A  1 454 ? 23.831  -12.650 -0.400  1.00 12.12  ? 899  TYR A C     1 
ATOM   3649 O O     . TYR A  1 454 ? 24.086  -13.431 -1.353  1.00 12.81  ? 899  TYR A O     1 
ATOM   3650 C CB    . TYR A  1 454 ? 24.394  -14.141 1.548   1.00 11.63  ? 899  TYR A CB    1 
ATOM   3651 C CG    . TYR A  1 454 ? 25.581  -13.380 2.071   1.00 12.05  ? 899  TYR A CG    1 
ATOM   3652 C CD1   . TYR A  1 454 ? 26.495  -12.837 1.206   1.00 13.14  ? 899  TYR A CD1   1 
ATOM   3653 C CD2   . TYR A  1 454 ? 25.807  -13.241 3.439   1.00 13.07  ? 899  TYR A CD2   1 
ATOM   3654 C CE1   . TYR A  1 454 ? 27.585  -12.119 1.665   1.00 15.33  ? 899  TYR A CE1   1 
ATOM   3655 C CE2   . TYR A  1 454 ? 26.906  -12.510 3.925   1.00 13.21  ? 899  TYR A CE2   1 
ATOM   3656 C CZ    . TYR A  1 454 ? 27.791  -11.972 3.048   1.00 14.33  ? 899  TYR A CZ    1 
ATOM   3657 O OH    . TYR A  1 454 ? 28.879  -11.274 3.485   1.00 16.70  ? 899  TYR A OH    1 
ATOM   3658 N N     . PHE A  1 455 ? 23.932  -11.315 -0.472  1.00 12.26  ? 900  PHE A N     1 
ATOM   3659 C CA    . PHE A  1 455 ? 24.464  -10.590 -1.625  1.00 12.75  ? 900  PHE A CA    1 
ATOM   3660 C C     . PHE A  1 455 ? 25.887  -10.184 -1.393  1.00 12.99  ? 900  PHE A C     1 
ATOM   3661 O O     . PHE A  1 455 ? 26.174  -9.512  -0.415  1.00 14.79  ? 900  PHE A O     1 
ATOM   3662 C CB    . PHE A  1 455 ? 23.616  -9.353  -1.872  1.00 12.49  ? 900  PHE A CB    1 
ATOM   3663 C CG    . PHE A  1 455 ? 22.225  -9.665  -2.222  1.00 12.40  ? 900  PHE A CG    1 
ATOM   3664 C CD1   . PHE A  1 455 ? 21.876  -9.982  -3.548  1.00 13.13  ? 900  PHE A CD1   1 
ATOM   3665 C CD2   . PHE A  1 455 ? 21.244  -9.704  -1.254  1.00 12.32  ? 900  PHE A CD2   1 
ATOM   3666 C CE1   . PHE A  1 455 ? 20.576  -10.360 -3.876  1.00 13.43  ? 900  PHE A CE1   1 
ATOM   3667 C CE2   . PHE A  1 455 ? 19.952  -10.095 -1.568  1.00 13.05  ? 900  PHE A CE2   1 
ATOM   3668 C CZ    . PHE A  1 455 ? 19.602  -10.412 -2.911  1.00 12.81  ? 900  PHE A CZ    1 
ATOM   3669 N N     . THR A  1 456 ? 26.819  -10.701 -2.215  1.00 12.30  ? 901  THR A N     1 
ATOM   3670 C CA    . THR A  1 456 ? 28.241  -10.414 -2.023  1.00 13.08  ? 901  THR A CA    1 
ATOM   3671 C C     . THR A  1 456 ? 28.712  -9.137  -2.770  1.00 14.61  ? 901  THR A C     1 
ATOM   3672 O O     . THR A  1 456 ? 29.867  -8.744  -2.629  1.00 14.56  ? 901  THR A O     1 
ATOM   3673 C CB    . THR A  1 456 ? 29.169  -11.562 -2.439  1.00 13.08  ? 901  THR A CB    1 
ATOM   3674 O OG1   . THR A  1 456 ? 29.198  -11.696 -3.868  1.00 12.95  ? 901  THR A OG1   1 
ATOM   3675 C CG2   . THR A  1 456 ? 28.767  -12.880 -1.799  1.00 13.98  ? 901  THR A CG2   1 
ATOM   3676 N N     . PHE A  1 457 ? 27.790  -8.453  -3.479  1.00 14.03  ? 902  PHE A N     1 
ATOM   3677 C CA    . PHE A  1 457 ? 28.077  -7.154  -4.083  1.00 14.99  ? 902  PHE A CA    1 
ATOM   3678 C C     . PHE A  1 457 ? 29.306  -7.198  -5.062  1.00 16.15  ? 902  PHE A C     1 
ATOM   3679 O O     . PHE A  1 457 ? 30.265  -6.425  -4.930  1.00 16.31  ? 902  PHE A O     1 
ATOM   3680 C CB    . PHE A  1 457 ? 28.289  -6.063  -2.964  1.00 15.68  ? 902  PHE A CB    1 
ATOM   3681 C CG    . PHE A  1 457 ? 27.951  -4.631  -3.406  1.00 14.90  ? 902  PHE A CG    1 
ATOM   3682 C CD1   . PHE A  1 457 ? 26.656  -4.251  -3.685  1.00 16.13  ? 902  PHE A CD1   1 
ATOM   3683 C CD2   . PHE A  1 457 ? 28.939  -3.679  -3.504  1.00 16.13  ? 902  PHE A CD2   1 
ATOM   3684 C CE1   . PHE A  1 457 ? 26.348  -2.908  -4.024  1.00 16.18  ? 902  PHE A CE1   1 
ATOM   3685 C CE2   . PHE A  1 457 ? 28.634  -2.353  -3.836  1.00 17.77  ? 902  PHE A CE2   1 
ATOM   3686 C CZ    . PHE A  1 457 ? 27.344  -1.984  -4.118  1.00 17.12  ? 902  PHE A CZ    1 
ATOM   3687 N N     . GLY A  1 458 ? 29.270  -8.134  -5.994  1.00 17.76  ? 903  GLY A N     1 
ATOM   3688 C CA    . GLY A  1 458 ? 30.254  -8.221  -7.047  1.00 20.89  ? 903  GLY A CA    1 
ATOM   3689 C C     . GLY A  1 458 ? 31.377  -9.215  -6.796  1.00 23.92  ? 903  GLY A C     1 
ATOM   3690 O O     . GLY A  1 458 ? 32.196  -9.443  -7.697  1.00 22.27  ? 903  GLY A O     1 
ATOM   3691 N N     . ASP A  1 459 ? 31.451  -9.825  -5.587  1.00 20.16  ? 904  ASP A N     1 
ATOM   3692 C CA    . ASP A  1 459 ? 32.598  -10.660 -5.244  1.00 18.34  ? 904  ASP A CA    1 
ATOM   3693 C C     . ASP A  1 459 ? 32.269  -12.166 -5.490  1.00 17.08  ? 904  ASP A C     1 
ATOM   3694 O O     . ASP A  1 459 ? 31.619  -12.822 -4.670  1.00 14.82  ? 904  ASP A O     1 
ATOM   3695 C CB    . ASP A  1 459 ? 32.992  -10.364 -3.787  1.00 17.76  ? 904  ASP A CB    1 
ATOM   3696 C CG    . ASP A  1 459 ? 34.331  -11.030 -3.338  1.00 19.24  ? 904  ASP A CG    1 
ATOM   3697 O OD1   . ASP A  1 459 ? 34.803  -12.014 -3.946  1.00 18.67  ? 904  ASP A OD1   1 
ATOM   3698 O OD2   . ASP A  1 459 ? 34.862  -10.590 -2.285  1.00 20.29  ? 904  ASP A OD2   1 
ATOM   3699 N N     . SER A  1 460 ? 32.650  -12.693 -6.656  1.00 16.70  ? 905  SER A N     1 
ATOM   3700 C CA    . SER A  1 460 ? 32.268  -14.067 -7.056  1.00 16.74  ? 905  SER A CA    1 
ATOM   3701 C C     . SER A  1 460 ? 33.016  -15.146 -6.251  1.00 16.07  ? 905  SER A C     1 
ATOM   3702 O O     . SER A  1 460 ? 32.453  -16.217 -5.942  1.00 15.08  ? 905  SER A O     1 
ATOM   3703 C CB    . SER A  1 460 ? 32.503  -14.292 -8.586  1.00 18.07  ? 905  SER A CB    1 
ATOM   3704 O OG    . SER A  1 460 ? 33.847  -14.031 -8.933  1.00 19.58  ? 905  SER A OG    1 
ATOM   3705 N N     . GLU A  1 461 ? 34.231  -14.850 -5.870  1.00 16.82  ? 906  GLU A N     1 
ATOM   3706 C CA    . GLU A  1 461 ? 35.009  -15.780 -5.077  1.00 20.64  ? 906  GLU A CA    1 
ATOM   3707 C C     . GLU A  1 461 ? 34.424  -15.911 -3.653  1.00 19.16  ? 906  GLU A C     1 
ATOM   3708 O O     . GLU A  1 461 ? 34.349  -17.007 -3.136  1.00 16.99  ? 906  GLU A O     1 
ATOM   3709 C CB    . GLU A  1 461 ? 36.492  -15.398 -5.007  1.00 23.20  ? 906  GLU A CB    1 
ATOM   3710 C CG    . GLU A  1 461 ? 37.324  -16.446 -4.297  1.00 33.35  ? 906  GLU A CG    1 
ATOM   3711 C CD    . GLU A  1 461 ? 38.828  -16.194 -4.378  1.00 47.63  ? 906  GLU A CD    1 
ATOM   3712 O OE1   . GLU A  1 461 ? 39.258  -15.178 -4.996  1.00 56.83  ? 906  GLU A OE1   1 
ATOM   3713 O OE2   . GLU A  1 461 ? 39.584  -17.017 -3.819  1.00 56.85  ? 906  GLU A OE2   1 
ATOM   3714 N N     . LEU A  1 462 ? 34.006  -14.795 -3.052  1.00 17.79  ? 907  LEU A N     1 
ATOM   3715 C CA    . LEU A  1 462 ? 33.368  -14.849 -1.729  1.00 16.27  ? 907  LEU A CA    1 
ATOM   3716 C C     . LEU A  1 462 ? 32.100  -15.637 -1.801  1.00 15.26  ? 907  LEU A C     1 
ATOM   3717 O O     . LEU A  1 462 ? 31.838  -16.453 -0.935  1.00 14.90  ? 907  LEU A O     1 
ATOM   3718 C CB    . LEU A  1 462 ? 33.077  -13.430 -1.228  1.00 16.10  ? 907  LEU A CB    1 
ATOM   3719 C CG    . LEU A  1 462 ? 32.376  -13.262 0.130   1.00 14.36  ? 907  LEU A CG    1 
ATOM   3720 C CD1   . LEU A  1 462 ? 33.200  -13.856 1.239   1.00 15.22  ? 907  LEU A CD1   1 
ATOM   3721 C CD2   . LEU A  1 462 ? 32.086  -11.790 0.367   1.00 15.36  ? 907  LEU A CD2   1 
ATOM   3722 N N     . MET A  1 463 ? 31.321  -15.437 -2.865  1.00 14.62  ? 908  MET A N     1 
ATOM   3723 C CA    . MET A  1 463 ? 30.109  -16.255 -3.084  1.00 14.75  ? 908  MET A CA    1 
ATOM   3724 C C     . MET A  1 463 ? 30.384  -17.769 -3.070  1.00 15.26  ? 908  MET A C     1 
ATOM   3725 O O     . MET A  1 463 ? 29.719  -18.553 -2.331  1.00 14.48  ? 908  MET A O     1 
ATOM   3726 C CB    . MET A  1 463 ? 29.453  -15.879 -4.400  1.00 14.60  ? 908  MET A CB    1 
ATOM   3727 C CG    . MET A  1 463 ? 28.275  -16.779 -4.813  1.00 14.87  ? 908  MET A CG    1 
ATOM   3728 S SD    . MET A  1 463 ? 27.739  -16.697 -6.553  1.00 15.84  ? 908  MET A SD    1 
ATOM   3729 C CE    . MET A  1 463 ? 29.146  -17.459 -7.431  1.00 17.66  ? 908  MET A CE    1 
ATOM   3730 N N     . ARG A  1 464 ? 31.368  -18.187 -3.860  1.00 14.05  ? 909  ARG A N     1 
ATOM   3731 C CA    C ARG A  1 464 ? 31.767  -19.589 -3.883  0.44 15.67  ? 909  ARG A CA    1 
ATOM   3732 C CA    D ARG A  1 464 ? 31.803  -19.590 -3.879  0.56 14.65  ? 909  ARG A CA    1 
ATOM   3733 C C     . ARG A  1 464 ? 32.248  -20.075 -2.509  1.00 14.76  ? 909  ARG A C     1 
ATOM   3734 O O     . ARG A  1 464 ? 31.879  -21.188 -2.073  1.00 13.98  ? 909  ARG A O     1 
ATOM   3735 C CB    C ARG A  1 464 ? 32.811  -19.843 -5.009  0.44 17.31  ? 909  ARG A CB    1 
ATOM   3736 C CB    D ARG A  1 464 ? 32.944  -19.789 -4.909  0.56 14.70  ? 909  ARG A CB    1 
ATOM   3737 C CG    C ARG A  1 464 ? 32.179  -19.702 -6.401  0.44 19.32  ? 909  ARG A CG    1 
ATOM   3738 C CG    D ARG A  1 464 ? 33.467  -21.212 -5.018  0.56 14.87  ? 909  ARG A CG    1 
ATOM   3739 C CD    C ARG A  1 464 ? 33.110  -20.043 -7.585  0.44 21.31  ? 909  ARG A CD    1 
ATOM   3740 C CD    D ARG A  1 464 ? 32.370  -22.259 -5.254  0.56 15.25  ? 909  ARG A CD    1 
ATOM   3741 N NE    C ARG A  1 464 ? 33.662  -18.832 -8.167  0.44 23.30  ? 909  ARG A NE    1 
ATOM   3742 N NE    D ARG A  1 464 ? 31.850  -22.200 -6.614  0.56 15.89  ? 909  ARG A NE    1 
ATOM   3743 C CZ    C ARG A  1 464 ? 34.867  -18.392 -7.886  0.44 22.63  ? 909  ARG A CZ    1 
ATOM   3744 C CZ    D ARG A  1 464 ? 31.098  -23.123 -7.186  0.56 16.12  ? 909  ARG A CZ    1 
ATOM   3745 N NH1   C ARG A  1 464 ? 35.621  -19.095 -7.065  0.44 24.53  ? 909  ARG A NH1   1 
ATOM   3746 N NH1   D ARG A  1 464 ? 30.737  -24.189 -6.540  0.56 17.28  ? 909  ARG A NH1   1 
ATOM   3747 N NH2   C ARG A  1 464 ? 35.327  -17.276 -8.434  0.44 22.15  ? 909  ARG A NH2   1 
ATOM   3748 N NH2   D ARG A  1 464 ? 30.671  -22.939 -8.421  0.56 16.85  ? 909  ARG A NH2   1 
ATOM   3749 N N     . ASP A  1 465 ? 33.015  -19.226 -1.790  1.00 14.17  ? 910  ASP A N     1 
ATOM   3750 C CA    . ASP A  1 465 ? 33.582  -19.641 -0.477  1.00 14.05  ? 910  ASP A CA    1 
ATOM   3751 C C     . ASP A  1 465 ? 32.481  -19.785 0.577   1.00 14.24  ? 910  ASP A C     1 
ATOM   3752 O O     . ASP A  1 465 ? 32.499  -20.732 1.397   1.00 14.89  ? 910  ASP A O     1 
ATOM   3753 C CB    . ASP A  1 465 ? 34.615  -18.641 0.012   1.00 15.78  ? 910  ASP A CB    1 
ATOM   3754 C CG    . ASP A  1 465 ? 35.969  -18.764 -0.719  1.00 17.95  ? 910  ASP A CG    1 
ATOM   3755 O OD1   . ASP A  1 465 ? 36.115  -19.668 -1.526  1.00 21.15  ? 910  ASP A OD1   1 
ATOM   3756 O OD2   . ASP A  1 465 ? 36.844  -17.925 -0.491  1.00 19.60  ? 910  ASP A OD2   1 
ATOM   3757 N N     . ILE A  1 466 ? 31.503  -18.867 0.585   1.00 13.92  ? 911  ILE A N     1 
ATOM   3758 C CA    . ILE A  1 466 ? 30.388  -18.972 1.574   1.00 13.54  ? 911  ILE A CA    1 
ATOM   3759 C C     . ILE A  1 466 ? 29.530  -20.174 1.298   1.00 13.64  ? 911  ILE A C     1 
ATOM   3760 O O     . ILE A  1 466 ? 29.191  -20.914 2.217   1.00 13.59  ? 911  ILE A O     1 
ATOM   3761 C CB    . ILE A  1 466 ? 29.521  -17.703 1.632   1.00 13.02  ? 911  ILE A CB    1 
ATOM   3762 C CG1   . ILE A  1 466 ? 30.366  -16.482 2.130   1.00 11.62  ? 911  ILE A CG1   1 
ATOM   3763 C CG2   . ILE A  1 466 ? 28.331  -17.948 2.534   1.00 13.44  ? 911  ILE A CG2   1 
ATOM   3764 C CD1   . ILE A  1 466 ? 29.665  -15.163 1.918   1.00 12.82  ? 911  ILE A CD1   1 
ATOM   3765 N N     . TYR A  1 467 ? 29.161  -20.368 0.032   1.00 14.56  ? 912  TYR A N     1 
ATOM   3766 C CA    . TYR A  1 467 ? 28.449  -21.545 -0.380  1.00 15.31  ? 912  TYR A CA    1 
ATOM   3767 C C     . TYR A  1 467 ? 29.161  -22.849 0.056   1.00 16.41  ? 912  TYR A C     1 
ATOM   3768 O O     . TYR A  1 467 ? 28.508  -23.770 0.565   1.00 15.68  ? 912  TYR A O     1 
ATOM   3769 C CB    . TYR A  1 467 ? 28.248  -21.574 -1.889  1.00 15.55  ? 912  TYR A CB    1 
ATOM   3770 C CG    . TYR A  1 467 ? 27.759  -22.898 -2.371  1.00 16.37  ? 912  TYR A CG    1 
ATOM   3771 C CD1   . TYR A  1 467 ? 26.439  -23.294 -2.178  1.00 16.76  ? 912  TYR A CD1   1 
ATOM   3772 C CD2   . TYR A  1 467 ? 28.621  -23.772 -3.021  1.00 18.91  ? 912  TYR A CD2   1 
ATOM   3773 C CE1   . TYR A  1 467 ? 26.008  -24.548 -2.557  1.00 20.18  ? 912  TYR A CE1   1 
ATOM   3774 C CE2   . TYR A  1 467 ? 28.183  -25.012 -3.453  1.00 21.48  ? 912  TYR A CE2   1 
ATOM   3775 C CZ    . TYR A  1 467 ? 26.888  -25.374 -3.253  1.00 22.83  ? 912  TYR A CZ    1 
ATOM   3776 O OH    . TYR A  1 467 ? 26.494  -26.588 -3.662  1.00 27.89  ? 912  TYR A OH    1 
ATOM   3777 N N     . SER A  1 468 ? 30.457  -22.949 -0.235  1.00 15.72  ? 913  SER A N     1 
ATOM   3778 C CA    . SER A  1 468 ? 31.216  -24.192 0.054   1.00 16.48  ? 913  SER A CA    1 
ATOM   3779 C C     . SER A  1 468 ? 31.257  -24.521 1.523   1.00 15.56  ? 913  SER A C     1 
ATOM   3780 O O     . SER A  1 468 ? 31.083  -25.681 1.892   1.00 14.96  ? 913  SER A O     1 
ATOM   3781 C CB    . SER A  1 468 ? 32.640  -24.109 -0.492  1.00 18.34  ? 913  SER A CB    1 
ATOM   3782 O OG    . SER A  1 468 ? 32.599  -24.006 -1.911  1.00 20.76  ? 913  SER A OG    1 
ATOM   3783 N N     . MET A  1 469 ? 31.442  -23.514 2.367   1.00 14.47  ? 914  MET A N     1 
ATOM   3784 C CA    . MET A  1 469 ? 31.443  -23.707 3.811   1.00 14.90  ? 914  MET A CA    1 
ATOM   3785 C C     . MET A  1 469 ? 30.061  -24.107 4.310   1.00 15.45  ? 914  MET A C     1 
ATOM   3786 O O     . MET A  1 469 ? 29.898  -25.048 5.112   1.00 14.12  ? 914  MET A O     1 
ATOM   3787 C CB    . MET A  1 469 ? 31.927  -22.457 4.491   1.00 15.19  ? 914  MET A CB    1 
ATOM   3788 C CG    . MET A  1 469 ? 32.052  -22.522 6.011   1.00 18.38  ? 914  MET A CG    1 
ATOM   3789 S SD    . MET A  1 469 ? 32.987  -23.984 6.648   1.00 18.66  ? 914  MET A SD    1 
ATOM   3790 C CE    . MET A  1 469 ? 34.614  -23.538 6.175   1.00 18.60  ? 914  MET A CE    1 
ATOM   3791 N N     . HIS A  1 470 ? 29.051  -23.414 3.843   1.00 14.71  ? 915  HIS A N     1 
ATOM   3792 C CA    . HIS A  1 470 ? 27.712  -23.705 4.293   1.00 15.83  ? 915  HIS A CA    1 
ATOM   3793 C C     . HIS A  1 470 ? 27.290  -25.151 3.965   1.00 16.19  ? 915  HIS A C     1 
ATOM   3794 O O     . HIS A  1 470 ? 26.726  -25.851 4.806   1.00 15.56  ? 915  HIS A O     1 
ATOM   3795 C CB    . HIS A  1 470 ? 26.744  -22.685 3.707   1.00 16.07  ? 915  HIS A CB    1 
ATOM   3796 C CG    . HIS A  1 470 ? 25.333  -22.851 4.166   1.00 16.08  ? 915  HIS A CG    1 
ATOM   3797 N ND1   . HIS A  1 470 ? 24.447  -23.697 3.540   1.00 17.81  ? 915  HIS A ND1   1 
ATOM   3798 C CD2   . HIS A  1 470 ? 24.645  -22.268 5.175   1.00 16.97  ? 915  HIS A CD2   1 
ATOM   3799 C CE1   . HIS A  1 470 ? 23.281  -23.665 4.169   1.00 16.25  ? 915  HIS A CE1   1 
ATOM   3800 N NE2   . HIS A  1 470 ? 23.366  -22.786 5.146   1.00 17.19  ? 915  HIS A NE2   1 
ATOM   3801 N N     . ILE A  1 471 ? 27.564  -25.598 2.751   1.00 17.25  ? 916  ILE A N     1 
ATOM   3802 C CA    . ILE A  1 471 ? 27.136  -26.918 2.375   1.00 18.55  ? 916  ILE A CA    1 
ATOM   3803 C C     . ILE A  1 471 ? 27.997  -28.021 3.065   1.00 19.36  ? 916  ILE A C     1 
ATOM   3804 O O     . ILE A  1 471 ? 27.470  -29.100 3.443   1.00 17.64  ? 916  ILE A O     1 
ATOM   3805 C CB    . ILE A  1 471 ? 27.059  -27.076 0.872   1.00 23.28  ? 916  ILE A CB    1 
ATOM   3806 C CG1   . ILE A  1 471 ? 26.145  -28.269 0.546   1.00 30.10  ? 916  ILE A CG1   1 
ATOM   3807 C CG2   . ILE A  1 471 ? 28.419  -27.183 0.251   1.00 21.53  ? 916  ILE A CG2   1 
ATOM   3808 C CD1   . ILE A  1 471 ? 25.924  -28.444 -0.917  1.00 34.93  ? 916  ILE A CD1   1 
ATOM   3809 N N     . PHE A  1 472 ? 29.270  -27.718 3.313   1.00 19.95  ? 917  PHE A N     1 
ATOM   3810 C CA    . PHE A  1 472 ? 30.161  -28.614 4.122   1.00 19.30  ? 917  PHE A CA    1 
ATOM   3811 C C     . PHE A  1 472 ? 29.592  -28.821 5.546   1.00 20.36  ? 917  PHE A C     1 
ATOM   3812 O O     . PHE A  1 472 ? 29.427  -29.960 6.010   1.00 17.35  ? 917  PHE A O     1 
ATOM   3813 C CB    . PHE A  1 472 ? 31.555  -28.002 4.206   1.00 18.93  ? 917  PHE A CB    1 
ATOM   3814 C CG    . PHE A  1 472 ? 32.541  -28.768 5.115   1.00 19.22  ? 917  PHE A CG    1 
ATOM   3815 C CD1   . PHE A  1 472 ? 33.148  -29.946 4.675   1.00 21.15  ? 917  PHE A CD1   1 
ATOM   3816 C CD2   . PHE A  1 472 ? 32.914  -28.257 6.331   1.00 19.88  ? 917  PHE A CD2   1 
ATOM   3817 C CE1   . PHE A  1 472 ? 34.072  -30.615 5.469   1.00 21.56  ? 917  PHE A CE1   1 
ATOM   3818 C CE2   . PHE A  1 472 ? 33.852  -28.912 7.136   1.00 22.96  ? 917  PHE A CE2   1 
ATOM   3819 C CZ    . PHE A  1 472 ? 34.431  -30.088 6.691   1.00 20.59  ? 917  PHE A CZ    1 
ATOM   3820 N N     . LEU A  1 473 ? 29.293  -27.715 6.230   1.00 18.36  ? 918  LEU A N     1 
ATOM   3821 C CA    . LEU A  1 473 ? 28.743  -27.784 7.582   1.00 18.96  ? 918  LEU A CA    1 
ATOM   3822 C C     . LEU A  1 473 ? 27.373  -28.474 7.634   1.00 20.11  ? 918  LEU A C     1 
ATOM   3823 O O     . LEU A  1 473 ? 27.111  -29.295 8.549   1.00 19.56  ? 918  LEU A O     1 
ATOM   3824 C CB    . LEU A  1 473 ? 28.641  -26.373 8.216   1.00 17.77  ? 918  LEU A CB    1 
ATOM   3825 C CG    . LEU A  1 473 ? 29.991  -25.622 8.340   1.00 17.90  ? 918  LEU A CG    1 
ATOM   3826 C CD1   . LEU A  1 473 ? 29.784  -24.166 8.728   1.00 17.79  ? 918  LEU A CD1   1 
ATOM   3827 C CD2   . LEU A  1 473 ? 30.958  -26.291 9.327   1.00 19.29  ? 918  LEU A CD2   1 
ATOM   3828 N N     . THR A  1 474 ? 26.509  -28.175 6.662   1.00 18.39  ? 919  THR A N     1 
ATOM   3829 C CA    A THR A  1 474 ? 25.135  -28.688 6.641   0.70 19.74  ? 919  THR A CA    1 
ATOM   3830 C CA    B THR A  1 474 ? 25.151  -28.699 6.706   0.30 18.56  ? 919  THR A CA    1 
ATOM   3831 C C     . THR A  1 474 ? 25.117  -30.190 6.375   1.00 21.00  ? 919  THR A C     1 
ATOM   3832 O O     . THR A  1 474 ? 24.362  -30.933 6.994   1.00 21.70  ? 919  THR A O     1 
ATOM   3833 C CB    A THR A  1 474 ? 24.308  -28.023 5.529   0.70 21.63  ? 919  THR A CB    1 
ATOM   3834 C CB    B THR A  1 474 ? 24.199  -27.927 5.783   0.30 17.82  ? 919  THR A CB    1 
ATOM   3835 O OG1   A THR A  1 474 ? 24.057  -26.655 5.864   0.70 22.44  ? 919  THR A OG1   1 
ATOM   3836 O OG1   B THR A  1 474 ? 24.667  -27.999 4.429   0.30 15.88  ? 919  THR A OG1   1 
ATOM   3837 C CG2   A THR A  1 474 ? 22.995  -28.744 5.346   0.70 23.69  ? 919  THR A CG2   1 
ATOM   3838 C CG2   B THR A  1 474 ? 24.112  -26.470 6.226   0.30 17.57  ? 919  THR A CG2   1 
ATOM   3839 N N     . GLU A  1 475 ? 25.941  -30.623 5.416   1.00 21.01  ? 920  GLU A N     1 
ATOM   3840 C CA    . GLU A  1 475 ? 26.036  -32.055 5.074   1.00 25.62  ? 920  GLU A CA    1 
ATOM   3841 C C     . GLU A  1 475 ? 26.639  -32.875 6.218   1.00 26.88  ? 920  GLU A C     1 
ATOM   3842 O O     . GLU A  1 475 ? 26.257  -34.005 6.407   1.00 30.69  ? 920  GLU A O     1 
ATOM   3843 C CB    . GLU A  1 475 ? 26.801  -32.272 3.718   1.00 27.65  ? 920  GLU A CB    1 
ATOM   3844 C CG    . GLU A  1 475 ? 25.881  -31.954 2.532   1.00 33.94  ? 920  GLU A CG    1 
ATOM   3845 C CD    . GLU A  1 475 ? 26.471  -32.182 1.129   1.00 40.30  ? 920  GLU A CD    1 
ATOM   3846 O OE1   . GLU A  1 475 ? 27.684  -32.526 1.004   1.00 40.76  ? 920  GLU A OE1   1 
ATOM   3847 O OE2   . GLU A  1 475 ? 25.693  -31.965 0.139   1.00 46.79  ? 920  GLU A OE2   1 
ATOM   3848 N N     . ARG A  1 476 ? 27.514  -32.281 7.038   1.00 25.07  ? 921  ARG A N     1 
ATOM   3849 C CA    . ARG A  1 476 ? 27.964  -32.978 8.241   1.00 25.83  ? 921  ARG A CA    1 
ATOM   3850 C C     . ARG A  1 476 ? 27.060  -32.796 9.481   1.00 25.69  ? 921  ARG A C     1 
ATOM   3851 O O     . ARG A  1 476 ? 27.372  -33.275 10.589  1.00 26.23  ? 921  ARG A O     1 
ATOM   3852 C CB    . ARG A  1 476 ? 29.396  -32.626 8.512   1.00 25.68  ? 921  ARG A CB    1 
ATOM   3853 C CG    . ARG A  1 476 ? 30.284  -33.185 7.434   1.00 29.32  ? 921  ARG A CG    1 
ATOM   3854 C CD    . ARG A  1 476 ? 31.673  -32.680 7.569   1.00 32.40  ? 921  ARG A CD    1 
ATOM   3855 N NE    . ARG A  1 476 ? 32.644  -33.415 6.736   1.00 35.06  ? 921  ARG A NE    1 
ATOM   3856 C CZ    . ARG A  1 476 ? 33.410  -34.433 7.162   1.00 37.40  ? 921  ARG A CZ    1 
ATOM   3857 N NH1   . ARG A  1 476 ? 33.314  -34.901 8.407   1.00 40.00  ? 921  ARG A NH1   1 
ATOM   3858 N NH2   . ARG A  1 476 ? 34.292  -34.971 6.344   1.00 37.27  ? 921  ARG A NH2   1 
ATOM   3859 N N     . LYS A  1 477 ? 25.942  -32.125 9.312   1.00 23.02  ? 922  LYS A N     1 
ATOM   3860 C CA    . LYS A  1 477 ? 24.962  -31.977 10.410  1.00 26.30  ? 922  LYS A CA    1 
ATOM   3861 C C     . LYS A  1 477 ? 25.529  -31.293 11.632  1.00 24.01  ? 922  LYS A C     1 
ATOM   3862 O O     . LYS A  1 477 ? 25.090  -31.530 12.718  1.00 21.24  ? 922  LYS A O     1 
ATOM   3863 C CB    . LYS A  1 477 ? 24.351  -33.351 10.778  1.00 28.20  ? 922  LYS A CB    1 
ATOM   3864 C CG    . LYS A  1 477 ? 23.773  -34.021 9.554   1.00 31.77  ? 922  LYS A CG    1 
ATOM   3865 C CD    . LYS A  1 477 ? 22.998  -35.281 9.872   1.00 43.06  ? 922  LYS A CD    1 
ATOM   3866 C CE    . LYS A  1 477 ? 22.090  -35.639 8.686   1.00 53.05  ? 922  LYS A CE    1 
ATOM   3867 N NZ    . LYS A  1 477 ? 21.686  -37.081 8.653   1.00 58.81  ? 922  LYS A NZ    1 
ATOM   3868 N N     . LEU A  1 478 ? 26.442  -30.352 11.432  1.00 22.25  ? 923  LEU A N     1 
ATOM   3869 C CA    . LEU A  1 478 ? 26.912  -29.564 12.556  1.00 20.51  ? 923  LEU A CA    1 
ATOM   3870 C C     . LEU A  1 478 ? 25.846  -28.551 13.034  1.00 21.07  ? 923  LEU A C     1 
ATOM   3871 O O     . LEU A  1 478 ? 25.157  -27.907 12.224  1.00 21.31  ? 923  LEU A O     1 
ATOM   3872 C CB    . LEU A  1 478 ? 28.217  -28.857 12.206  1.00 22.05  ? 923  LEU A CB    1 
ATOM   3873 C CG    . LEU A  1 478 ? 29.486  -29.706 12.246  1.00 27.29  ? 923  LEU A CG    1 
ATOM   3874 C CD1   . LEU A  1 478 ? 29.526  -30.712 11.148  1.00 32.58  ? 923  LEU A CD1   1 
ATOM   3875 C CD2   . LEU A  1 478 ? 30.710  -28.834 12.139  1.00 29.31  ? 923  LEU A CD2   1 
ATOM   3876 N N     . THR A  1 479 ? 25.729  -28.412 14.349  1.00 18.85  ? 924  THR A N     1 
ATOM   3877 C CA    . THR A  1 479 ? 24.808  -27.492 14.961  1.00 17.22  ? 924  THR A CA    1 
ATOM   3878 C C     . THR A  1 479 ? 25.447  -26.108 15.121  1.00 18.30  ? 924  THR A C     1 
ATOM   3879 O O     . THR A  1 479 ? 26.659  -25.954 14.983  1.00 17.48  ? 924  THR A O     1 
ATOM   3880 C CB    . THR A  1 479 ? 24.404  -27.998 16.362  1.00 20.10  ? 924  THR A CB    1 
ATOM   3881 O OG1   . THR A  1 479 ? 25.550  -27.992 17.237  1.00 19.20  ? 924  THR A OG1   1 
ATOM   3882 C CG2   . THR A  1 479 ? 23.764  -29.437 16.266  1.00 20.91  ? 924  THR A CG2   1 
ATOM   3883 N N     . VAL A  1 480 ? 24.631  -25.123 15.490  1.00 16.82  ? 925  VAL A N     1 
ATOM   3884 C CA    . VAL A  1 480 ? 25.116  -23.779 15.777  1.00 17.31  ? 925  VAL A CA    1 
ATOM   3885 C C     . VAL A  1 480 ? 26.231  -23.852 16.836  1.00 18.06  ? 925  VAL A C     1 
ATOM   3886 O O     . VAL A  1 480 ? 27.315  -23.215 16.716  1.00 15.42  ? 925  VAL A O     1 
ATOM   3887 C CB    . VAL A  1 480 ? 23.931  -22.903 16.281  1.00 18.86  ? 925  VAL A CB    1 
ATOM   3888 C CG1   . VAL A  1 480 ? 24.418  -21.642 16.956  1.00 17.91  ? 925  VAL A CG1   1 
ATOM   3889 C CG2   . VAL A  1 480 ? 22.991  -22.597 15.149  1.00 20.38  ? 925  VAL A CG2   1 
ATOM   3890 N N     . GLY A  1 481 ? 26.003  -24.681 17.867  1.00 18.07  ? 926  GLY A N     1 
ATOM   3891 C CA    . GLY A  1 481 ? 27.001  -24.852 18.908  1.00 17.32  ? 926  GLY A CA    1 
ATOM   3892 C C     . GLY A  1 481 ? 28.305  -25.447 18.422  1.00 17.10  ? 926  GLY A C     1 
ATOM   3893 O O     . GLY A  1 481 ? 29.392  -25.025 18.860  1.00 18.08  ? 926  GLY A O     1 
ATOM   3894 N N     . ASP A  1 482 ? 28.220  -26.473 17.605  1.00 15.84  ? 927  ASP A N     1 
ATOM   3895 C CA    . ASP A  1 482 ? 29.429  -27.094 17.005  1.00 17.21  ? 927  ASP A CA    1 
ATOM   3896 C C     . ASP A  1 482 ? 30.247  -26.036 16.249  1.00 18.11  ? 927  ASP A C     1 
ATOM   3897 O O     . ASP A  1 482 ? 31.487  -26.018 16.307  1.00 15.55  ? 927  ASP A O     1 
ATOM   3898 C CB    . ASP A  1 482 ? 29.061  -28.241 16.012  1.00 18.03  ? 927  ASP A CB    1 
ATOM   3899 C CG    . ASP A  1 482 ? 28.410  -29.494 16.700  1.00 21.32  ? 927  ASP A CG    1 
ATOM   3900 O OD1   . ASP A  1 482 ? 28.660  -29.745 17.882  1.00 23.24  ? 927  ASP A OD1   1 
ATOM   3901 O OD2   . ASP A  1 482 ? 27.646  -30.215 16.022  1.00 19.82  ? 927  ASP A OD2   1 
ATOM   3902 N N     . VAL A  1 483 ? 29.559  -25.178 15.478  1.00 17.07  ? 928  VAL A N     1 
ATOM   3903 C CA    . VAL A  1 483 ? 30.253  -24.172 14.707  1.00 16.21  ? 928  VAL A CA    1 
ATOM   3904 C C     . VAL A  1 483 ? 30.871  -23.112 15.601  1.00 16.71  ? 928  VAL A C     1 
ATOM   3905 O O     . VAL A  1 483 ? 32.055  -22.758 15.444  1.00 14.65  ? 928  VAL A O     1 
ATOM   3906 C CB    . VAL A  1 483 ? 29.313  -23.557 13.613  1.00 16.09  ? 928  VAL A CB    1 
ATOM   3907 C CG1   . VAL A  1 483 ? 30.070  -22.559 12.802  1.00 17.61  ? 928  VAL A CG1   1 
ATOM   3908 C CG2   . VAL A  1 483 ? 28.800  -24.657 12.704  1.00 16.36  ? 928  VAL A CG2   1 
ATOM   3909 N N     . TYR A  1 484 ? 30.116  -22.646 16.602  1.00 15.71  ? 929  TYR A N     1 
ATOM   3910 C CA    . TYR A  1 484 ? 30.619  -21.634 17.497  1.00 17.54  ? 929  TYR A CA    1 
ATOM   3911 C C     . TYR A  1 484 ? 31.849  -22.122 18.232  1.00 18.32  ? 929  TYR A C     1 
ATOM   3912 O O     . TYR A  1 484 ? 32.796  -21.361 18.440  1.00 15.95  ? 929  TYR A O     1 
ATOM   3913 C CB    . TYR A  1 484 ? 29.524  -21.195 18.494  1.00 20.09  ? 929  TYR A CB    1 
ATOM   3914 C CG    . TYR A  1 484 ? 29.992  -20.204 19.501  1.00 23.60  ? 929  TYR A CG    1 
ATOM   3915 C CD1   . TYR A  1 484 ? 30.312  -18.899 19.144  1.00 26.64  ? 929  TYR A CD1   1 
ATOM   3916 C CD2   . TYR A  1 484 ? 30.160  -20.578 20.833  1.00 27.20  ? 929  TYR A CD2   1 
ATOM   3917 C CE1   . TYR A  1 484 ? 30.809  -17.992 20.110  1.00 29.60  ? 929  TYR A CE1   1 
ATOM   3918 C CE2   . TYR A  1 484 ? 30.608  -19.680 21.790  1.00 29.96  ? 929  TYR A CE2   1 
ATOM   3919 C CZ    . TYR A  1 484 ? 30.931  -18.396 21.423  1.00 30.96  ? 929  TYR A CZ    1 
ATOM   3920 O OH    . TYR A  1 484 ? 31.381  -17.532 22.419  1.00 45.65  ? 929  TYR A OH    1 
ATOM   3921 N N     . LYS A  1 485 ? 31.862  -23.408 18.627  1.00 17.73  ? 930  LYS A N     1 
ATOM   3922 C CA    . LYS A  1 485 ? 33.081  -23.953 19.277  1.00 18.97  ? 930  LYS A CA    1 
ATOM   3923 C C     . LYS A  1 485 ? 34.284  -23.988 18.346  1.00 17.89  ? 930  LYS A C     1 
ATOM   3924 O O     . LYS A  1 485 ? 35.455  -23.868 18.796  1.00 18.94  ? 930  LYS A O     1 
ATOM   3925 C CB    . LYS A  1 485 ? 32.795  -25.353 19.782  1.00 22.67  ? 930  LYS A CB    1 
ATOM   3926 C CG    . LYS A  1 485 ? 31.974  -25.377 21.043  1.00 24.05  ? 930  LYS A CG    1 
ATOM   3927 C CD    . LYS A  1 485 ? 31.909  -26.777 21.615  1.00 29.07  ? 930  LYS A CD    1 
ATOM   3928 C CE    . LYS A  1 485 ? 30.579  -27.370 21.435  1.00 33.62  ? 930  LYS A CE    1 
ATOM   3929 N NZ    . LYS A  1 485 ? 30.315  -28.381 22.519  1.00 36.76  ? 930  LYS A NZ    1 
ATOM   3930 N N     . LEU A  1 486 ? 34.041  -24.230 17.055  1.00 16.57  ? 931  LEU A N     1 
ATOM   3931 C CA    . LEU A  1 486 ? 35.128  -24.131 16.078  1.00 17.03  ? 931  LEU A CA    1 
ATOM   3932 C C     . LEU A  1 486 ? 35.696  -22.718 15.986  1.00 16.61  ? 931  LEU A C     1 
ATOM   3933 O O     . LEU A  1 486 ? 36.904  -22.563 15.856  1.00 17.52  ? 931  LEU A O     1 
ATOM   3934 C CB    . LEU A  1 486 ? 34.710  -24.627 14.730  1.00 18.06  ? 931  LEU A CB    1 
ATOM   3935 C CG    . LEU A  1 486 ? 34.525  -26.105 14.650  1.00 20.28  ? 931  LEU A CG    1 
ATOM   3936 C CD1   . LEU A  1 486 ? 33.781  -26.472 13.403  1.00 21.35  ? 931  LEU A CD1   1 
ATOM   3937 C CD2   . LEU A  1 486 ? 35.882  -26.783 14.678  1.00 21.21  ? 931  LEU A CD2   1 
ATOM   3938 N N     . LEU A  1 487 ? 34.853  -21.687 16.112  1.00 15.61  ? 932  LEU A N     1 
ATOM   3939 C CA    . LEU A  1 487 ? 35.328  -20.303 16.106  1.00 15.93  ? 932  LEU A CA    1 
ATOM   3940 C C     . LEU A  1 487 ? 36.204  -20.042 17.312  1.00 17.09  ? 932  LEU A C     1 
ATOM   3941 O O     . LEU A  1 487 ? 37.221  -19.340 17.192  1.00 16.39  ? 932  LEU A O     1 
ATOM   3942 C CB    . LEU A  1 487 ? 34.165  -19.284 16.100  1.00 16.55  ? 932  LEU A CB    1 
ATOM   3943 C CG    . LEU A  1 487 ? 33.189  -19.328 14.908  1.00 18.06  ? 932  LEU A CG    1 
ATOM   3944 C CD1   . LEU A  1 487 ? 32.094  -18.260 15.017  1.00 19.88  ? 932  LEU A CD1   1 
ATOM   3945 C CD2   . LEU A  1 487 ? 33.978  -19.086 13.671  1.00 20.56  ? 932  LEU A CD2   1 
ATOM   3946 N N     . LEU A  1 488 ? 35.797  -20.571 18.479  1.00 16.01  ? 933  LEU A N     1 
ATOM   3947 C CA    . LEU A  1 488 ? 36.610  -20.439 19.729  1.00 17.82  ? 933  LEU A CA    1 
ATOM   3948 C C     . LEU A  1 488 ? 37.978  -21.115 19.611  1.00 17.85  ? 933  LEU A C     1 
ATOM   3949 O O     . LEU A  1 488 ? 38.980  -20.558 20.015  1.00 17.37  ? 933  LEU A O     1 
ATOM   3950 C CB    . LEU A  1 488 ? 35.857  -20.991 20.927  1.00 18.64  ? 933  LEU A CB    1 
ATOM   3951 C CG    . LEU A  1 488 ? 34.583  -20.295 21.312  1.00 20.87  ? 933  LEU A CG    1 
ATOM   3952 C CD1   . LEU A  1 488 ? 33.953  -20.967 22.541  1.00 23.55  ? 933  LEU A CD1   1 
ATOM   3953 C CD2   . LEU A  1 488 ? 34.830  -18.828 21.570  1.00 23.11  ? 933  LEU A CD2   1 
ATOM   3954 N N     . ARG A  1 489 ? 38.013  -22.271 18.967  1.00 19.43  ? 934  ARG A N     1 
ATOM   3955 C CA    . ARG A  1 489 ? 39.268  -22.951 18.682  1.00 19.84  ? 934  ARG A CA    1 
ATOM   3956 C C     . ARG A  1 489 ? 40.156  -22.180 17.738  1.00 20.21  ? 934  ARG A C     1 
ATOM   3957 O O     . ARG A  1 489 ? 41.368  -22.079 17.974  1.00 19.90  ? 934  ARG A O     1 
ATOM   3958 C CB    . ARG A  1 489 ? 38.999  -24.355 18.145  1.00 20.65  ? 934  ARG A CB    1 
ATOM   3959 C CG    . ARG A  1 489 ? 38.475  -25.287 19.217  1.00 24.90  ? 934  ARG A CG    1 
ATOM   3960 C CD    . ARG A  1 489 ? 38.070  -26.644 18.608  1.00 27.94  ? 934  ARG A CD    1 
ATOM   3961 N NE    . ARG A  1 489 ? 39.180  -27.276 17.865  1.00 29.33  ? 934  ARG A NE    1 
ATOM   3962 C CZ    . ARG A  1 489 ? 39.053  -28.412 17.161  1.00 33.29  ? 934  ARG A CZ    1 
ATOM   3963 N NH1   . ARG A  1 489 ? 37.857  -29.031 17.080  1.00 32.20  ? 934  ARG A NH1   1 
ATOM   3964 N NH2   . ARG A  1 489 ? 40.098  -28.912 16.506  1.00 32.48  ? 934  ARG A NH2   1 
ATOM   3965 N N     . TYR A  1 490 ? 39.589  -21.599 16.680  1.00 16.62  ? 935  TYR A N     1 
ATOM   3966 C CA    . TYR A  1 490 ? 40.393  -20.713 15.775  1.00 16.32  ? 935  TYR A CA    1 
ATOM   3967 C C     . TYR A  1 490 ? 41.056  -19.565 16.554  1.00 18.60  ? 935  TYR A C     1 
ATOM   3968 O O     . TYR A  1 490 ? 42.283  -19.301 16.383  1.00 19.86  ? 935  TYR A O     1 
ATOM   3969 C CB    . TYR A  1 490 ? 39.528  -20.128 14.628  1.00 16.12  ? 935  TYR A CB    1 
ATOM   3970 C CG    . TYR A  1 490 ? 40.318  -19.326 13.634  1.00 15.85  ? 935  TYR A CG    1 
ATOM   3971 C CD1   . TYR A  1 490 ? 41.285  -19.940 12.817  1.00 16.29  ? 935  TYR A CD1   1 
ATOM   3972 C CD2   . TYR A  1 490 ? 40.209  -17.949 13.593  1.00 16.95  ? 935  TYR A CD2   1 
ATOM   3973 C CE1   . TYR A  1 490 ? 42.057  -19.198 11.937  1.00 17.91  ? 935  TYR A CE1   1 
ATOM   3974 C CE2   . TYR A  1 490 ? 40.958  -17.198 12.705  1.00 18.19  ? 935  TYR A CE2   1 
ATOM   3975 C CZ    . TYR A  1 490 ? 41.885  -17.821 11.872  1.00 17.25  ? 935  TYR A CZ    1 
ATOM   3976 O OH    . TYR A  1 490 ? 42.608  -17.078 10.942  1.00 16.85  ? 935  TYR A OH    1 
ATOM   3977 N N     . TYR A  1 491 ? 40.301  -18.921 17.437  1.00 17.67  ? 936  TYR A N     1 
ATOM   3978 C CA    . TYR A  1 491 ? 40.865  -17.854 18.265  1.00 19.41  ? 936  TYR A CA    1 
ATOM   3979 C C     . TYR A  1 491 ? 42.042  -18.403 19.125  1.00 20.74  ? 936  TYR A C     1 
ATOM   3980 O O     . TYR A  1 491 ? 43.142  -17.922 19.049  1.00 20.55  ? 936  TYR A O     1 
ATOM   3981 C CB    . TYR A  1 491 ? 39.804  -17.268 19.197  1.00 19.50  ? 936  TYR A CB    1 
ATOM   3982 C CG    . TYR A  1 491 ? 40.382  -16.341 20.215  1.00 20.83  ? 936  TYR A CG    1 
ATOM   3983 C CD1   . TYR A  1 491 ? 40.949  -15.105 19.833  1.00 20.70  ? 936  TYR A CD1   1 
ATOM   3984 C CD2   . TYR A  1 491 ? 40.414  -16.690 21.562  1.00 21.51  ? 936  TYR A CD2   1 
ATOM   3985 C CE1   . TYR A  1 491 ? 41.561  -14.274 20.780  1.00 24.02  ? 936  TYR A CE1   1 
ATOM   3986 C CE2   . TYR A  1 491 ? 40.981  -15.848 22.506  1.00 23.19  ? 936  TYR A CE2   1 
ATOM   3987 C CZ    . TYR A  1 491 ? 41.557  -14.658 22.106  1.00 25.11  ? 936  TYR A CZ    1 
ATOM   3988 O OH    . TYR A  1 491 ? 42.075  -13.808 23.047  1.00 30.19  ? 936  TYR A OH    1 
ATOM   3989 N N     . ASN A  1 492 ? 41.796  -19.461 19.857  1.00 20.77  ? 937  ASN A N     1 
ATOM   3990 C CA    . ASN A  1 492 ? 42.848  -20.072 20.708  1.00 23.72  ? 937  ASN A CA    1 
ATOM   3991 C C     . ASN A  1 492 ? 44.087  -20.498 20.005  1.00 24.06  ? 937  ASN A C     1 
ATOM   3992 O O     . ASN A  1 492 ? 45.198  -20.207 20.454  1.00 24.17  ? 937  ASN A O     1 
ATOM   3993 C CB    . ASN A  1 492 ? 42.306  -21.271 21.387  1.00 29.22  ? 937  ASN A CB    1 
ATOM   3994 C CG    . ASN A  1 492 ? 41.811  -20.966 22.705  1.00 38.73  ? 937  ASN A CG    1 
ATOM   3995 O OD1   . ASN A  1 492 ? 40.600  -20.838 22.898  1.00 47.41  ? 937  ASN A OD1   1 
ATOM   3996 N ND2   . ASN A  1 492 ? 42.746  -20.802 23.679  1.00 40.70  ? 937  ASN A ND2   1 
ATOM   3997 N N     . GLU A  1 493 ? 43.905  -21.183 18.894  1.00 23.81  ? 938  GLU A N     1 
ATOM   3998 C CA    . GLU A  1 493 ? 44.992  -21.816 18.188  1.00 27.75  ? 938  GLU A CA    1 
ATOM   3999 C C     . GLU A  1 493 ? 45.741  -20.886 17.256  1.00 30.23  ? 938  GLU A C     1 
ATOM   4000 O O     . GLU A  1 493 ? 46.938  -21.112 17.011  1.00 26.50  ? 938  GLU A O     1 
ATOM   4001 C CB    . GLU A  1 493 ? 44.486  -23.003 17.390  1.00 27.88  ? 938  GLU A CB    1 
ATOM   4002 C CG    . GLU A  1 493 ? 43.894  -24.098 18.237  1.00 32.77  ? 938  GLU A CG    1 
ATOM   4003 C CD    . GLU A  1 493 ? 43.570  -25.355 17.431  1.00 42.34  ? 938  GLU A CD    1 
ATOM   4004 O OE1   . GLU A  1 493 ? 44.341  -25.646 16.469  1.00 43.90  ? 938  GLU A OE1   1 
ATOM   4005 O OE2   . GLU A  1 493 ? 42.550  -26.067 17.767  1.00 44.95  ? 938  GLU A OE2   1 
ATOM   4006 N N     . GLU A  1 494 ? 45.060  -19.865 16.703  1.00 24.60  ? 939  GLU A N     1 
ATOM   4007 C CA    . GLU A  1 494 ? 45.653  -19.077 15.624  1.00 25.04  ? 939  GLU A CA    1 
ATOM   4008 C C     . GLU A  1 494 ? 45.713  -17.568 15.898  1.00 25.04  ? 939  GLU A C     1 
ATOM   4009 O O     . GLU A  1 494 ? 46.486  -16.898 15.273  1.00 28.90  ? 939  GLU A O     1 
ATOM   4010 C CB    . GLU A  1 494 ? 44.917  -19.341 14.271  1.00 25.09  ? 939  GLU A CB    1 
ATOM   4011 C CG    . GLU A  1 494 ? 45.018  -20.774 13.729  1.00 27.66  ? 939  GLU A CG    1 
ATOM   4012 C CD    . GLU A  1 494 ? 46.467  -21.180 13.413  1.00 30.90  ? 939  GLU A CD    1 
ATOM   4013 O OE1   . GLU A  1 494 ? 47.325  -20.273 13.203  1.00 34.32  ? 939  GLU A OE1   1 
ATOM   4014 O OE2   . GLU A  1 494 ? 46.747  -22.375 13.409  1.00 34.60  ? 939  GLU A OE2   1 
ATOM   4015 N N     . CYS A  1 495 ? 44.904  -17.047 16.821  1.00 26.63  ? 940  CYS A N     1 
ATOM   4016 C CA    . CYS A  1 495 ? 44.849  -15.598 17.090  1.00 27.31  ? 940  CYS A CA    1 
ATOM   4017 C C     . CYS A  1 495 ? 45.398  -15.146 18.483  1.00 31.32  ? 940  CYS A C     1 
ATOM   4018 O O     . CYS A  1 495 ? 46.133  -14.180 18.549  1.00 36.10  ? 940  CYS A O     1 
ATOM   4019 C CB    . CYS A  1 495 ? 43.381  -15.095 16.922  1.00 26.63  ? 940  CYS A CB    1 
ATOM   4020 S SG    . CYS A  1 495 ? 42.662  -15.570 15.323  1.00 24.60  ? 940  CYS A SG    1 
ATOM   4021 N N     . ARG A  1 496 ? 44.988  -15.803 19.568  1.00 33.63  ? 941  ARG A N     1 
ATOM   4022 C CA    . ARG A  1 496 ? 45.281  -15.327 20.951  1.00 37.24  ? 941  ARG A CA    1 
ATOM   4023 C C     . ARG A  1 496 ? 46.752  -15.144 21.203  1.00 40.93  ? 941  ARG A C     1 
ATOM   4024 O O     . ARG A  1 496 ? 47.158  -14.161 21.808  1.00 44.45  ? 941  ARG A O     1 
ATOM   4025 C CB    . ARG A  1 496 ? 44.729  -16.255 22.066  1.00 37.87  ? 941  ARG A CB    1 
ATOM   4026 C CG    . ARG A  1 496 ? 44.912  -15.638 23.477  1.00 41.47  ? 941  ARG A CG    1 
ATOM   4027 C CD    . ARG A  1 496 ? 43.991  -16.212 24.564  1.00 41.42  ? 941  ARG A CD    1 
ATOM   4028 N NE    . ARG A  1 496 ? 44.199  -17.636 24.667  1.00 41.02  ? 941  ARG A NE    1 
ATOM   4029 C CZ    . ARG A  1 496 ? 45.114  -18.213 25.429  1.00 35.12  ? 941  ARG A CZ    1 
ATOM   4030 N NH1   . ARG A  1 496 ? 45.868  -17.498 26.256  1.00 34.95  ? 941  ARG A NH1   1 
ATOM   4031 N NH2   . ARG A  1 496 ? 45.240  -19.517 25.399  1.00 36.17  ? 941  ARG A NH2   1 
ATOM   4032 N N     . ASN A  1 497 ? 47.534  -16.108 20.773  1.00 45.11  ? 942  ASN A N     1 
ATOM   4033 C CA    . ASN A  1 497 ? 48.957  -16.123 21.048  1.00 51.05  ? 942  ASN A CA    1 
ATOM   4034 C C     . ASN A  1 497 ? 49.734  -15.707 19.847  1.00 50.03  ? 942  ASN A C     1 
ATOM   4035 O O     . ASN A  1 497 ? 50.934  -15.874 19.802  1.00 51.61  ? 942  ASN A O     1 
ATOM   4036 C CB    . ASN A  1 497 ? 49.383  -17.515 21.518  1.00 45.04  ? 942  ASN A CB    1 
ATOM   4037 C CG    . ASN A  1 497 ? 49.090  -17.725 22.968  1.00 47.57  ? 942  ASN A CG    1 
ATOM   4038 O OD1   . ASN A  1 497 ? 48.500  -18.745 23.383  1.00 50.78  ? 942  ASN A OD1   1 
ATOM   4039 N ND2   . ASN A  1 497 ? 49.446  -16.742 23.760  1.00 49.56  ? 942  ASN A ND2   1 
ATOM   4040 N N     . CYS A  1 498 ? 49.041  -15.148 18.862  1.00 49.64  ? 943  CYS A N     1 
ATOM   4041 C CA    . CYS A  1 498 ? 49.688  -14.623 17.675  1.00 49.37  ? 943  CYS A CA    1 
ATOM   4042 C C     . CYS A  1 498 ? 50.400  -13.281 18.014  1.00 57.41  ? 943  CYS A C     1 
ATOM   4043 O O     . CYS A  1 498 ? 49.901  -12.485 18.828  1.00 52.33  ? 943  CYS A O     1 
ATOM   4044 C CB    . CYS A  1 498 ? 48.646  -14.393 16.594  1.00 46.20  ? 943  CYS A CB    1 
ATOM   4045 S SG    . CYS A  1 498 ? 49.342  -14.083 14.983  1.00 43.41  ? 943  CYS A SG    1 
ATOM   4046 N N     . SER A  1 499 ? 51.569  -13.042 17.426  1.00 68.31  ? 944  SER A N     1 
ATOM   4047 C CA    . SER A  1 499 ? 52.254  -11.730 17.624  1.00 73.94  ? 944  SER A CA    1 
ATOM   4048 C C     . SER A  1 499 ? 52.749  -11.156 16.297  1.00 68.38  ? 944  SER A C     1 
ATOM   4049 O O     . SER A  1 499 ? 53.823  -10.576 16.203  1.00 77.58  ? 944  SER A O     1 
ATOM   4050 C CB    . SER A  1 499 ? 53.373  -11.823 18.685  1.00 70.40  ? 944  SER A CB    1 
ATOM   4051 O OG    . SER A  1 499 ? 53.881  -13.138 18.784  1.00 71.71  ? 944  SER A OG    1 
ATOM   4052 N N     . THR A  1 500 ? 51.921  -11.326 15.282  1.00 70.65  ? 945  THR A N     1 
ATOM   4053 C CA    . THR A  1 500 ? 51.997  -10.557 14.064  1.00 69.23  ? 945  THR A CA    1 
ATOM   4054 C C     . THR A  1 500 ? 50.558  -10.128 13.687  1.00 72.54  ? 945  THR A C     1 
ATOM   4055 O O     . THR A  1 500 ? 49.599  -10.790 14.096  1.00 59.74  ? 945  THR A O     1 
ATOM   4056 C CB    . THR A  1 500 ? 52.546  -11.412 12.945  1.00 61.91  ? 945  THR A CB    1 
ATOM   4057 O OG1   . THR A  1 500 ? 51.732  -12.570 12.822  1.00 56.40  ? 945  THR A OG1   1 
ATOM   4058 C CG2   . THR A  1 500 ? 53.969  -11.832 13.244  1.00 59.50  ? 945  THR A CG2   1 
ATOM   4059 N N     . PRO A  1 501 ? 50.415  -9.024  12.905  1.00 70.84  ? 946  PRO A N     1 
ATOM   4060 C CA    . PRO A  1 501 ? 49.118  -8.511  12.409  1.00 65.23  ? 946  PRO A CA    1 
ATOM   4061 C C     . PRO A  1 501 ? 48.099  -9.595  11.981  1.00 56.38  ? 946  PRO A C     1 
ATOM   4062 O O     . PRO A  1 501 ? 46.932  -9.557  12.413  1.00 51.27  ? 946  PRO A O     1 
ATOM   4063 C CB    . PRO A  1 501 ? 49.522  -7.657  11.179  1.00 66.25  ? 946  PRO A CB    1 
ATOM   4064 C CG    . PRO A  1 501 ? 51.035  -7.579  11.193  1.00 65.20  ? 946  PRO A CG    1 
ATOM   4065 C CD    . PRO A  1 501 ? 51.521  -8.144  12.491  1.00 66.69  ? 946  PRO A CD    1 
ATOM   4066 N N     . GLY A  1 502 ? 48.527  -10.507 11.106  1.00 48.83  ? 947  GLY A N     1 
ATOM   4067 C CA    . GLY A  1 502 ? 47.655  -11.558 10.571  1.00 45.99  ? 947  GLY A CA    1 
ATOM   4068 C C     . GLY A  1 502 ? 48.024  -12.919 11.143  1.00 48.73  ? 947  GLY A C     1 
ATOM   4069 O O     . GLY A  1 502 ? 49.183  -13.135 11.521  1.00 44.52  ? 947  GLY A O     1 
ATOM   4070 N N     . PRO A  1 503 ? 47.030  -13.842 11.252  1.00 44.18  ? 948  PRO A N     1 
ATOM   4071 C CA    . PRO A  1 503 ? 47.281  -15.201 11.749  1.00 42.21  ? 948  PRO A CA    1 
ATOM   4072 C C     . PRO A  1 503 ? 47.967  -16.052 10.679  1.00 39.70  ? 948  PRO A C     1 
ATOM   4073 O O     . PRO A  1 503 ? 47.979  -15.673 9.521   1.00 38.12  ? 948  PRO A O     1 
ATOM   4074 C CB    . PRO A  1 503 ? 45.859  -15.725 12.032  1.00 39.50  ? 948  PRO A CB    1 
ATOM   4075 C CG    . PRO A  1 503 ? 45.043  -15.080 10.987  1.00 39.05  ? 948  PRO A CG    1 
ATOM   4076 C CD    . PRO A  1 503 ? 45.626  -13.681 10.830  1.00 43.69  ? 948  PRO A CD    1 
ATOM   4077 N N     . ASP A  1 504 ? 48.489  -17.220 11.046  1.00 38.50  ? 949  ASP A N     1 
ATOM   4078 C CA    . ASP A  1 504 ? 49.232  -18.061 10.059  1.00 36.16  ? 949  ASP A CA    1 
ATOM   4079 C C     . ASP A  1 504 ? 48.319  -18.728 8.994   1.00 35.09  ? 949  ASP A C     1 
ATOM   4080 O O     . ASP A  1 504 ? 48.720  -18.948 7.827   1.00 29.33  ? 949  ASP A O     1 
ATOM   4081 C CB    . ASP A  1 504 ? 50.083  -19.115 10.799  1.00 41.83  ? 949  ASP A CB    1 
ATOM   4082 C CG    . ASP A  1 504 ? 51.205  -18.466 11.685  1.00 45.06  ? 949  ASP A CG    1 
ATOM   4083 O OD1   . ASP A  1 504 ? 51.699  -17.369 11.328  1.00 47.34  ? 949  ASP A OD1   1 
ATOM   4084 O OD2   . ASP A  1 504 ? 51.543  -19.021 12.761  1.00 49.29  ? 949  ASP A OD2   1 
ATOM   4085 N N     . ILE A  1 505 ? 47.096  -19.046 9.365   1.00 29.39  ? 950  ILE A N     1 
ATOM   4086 C CA    . ILE A  1 505 ? 46.144  -19.536 8.371   1.00 30.01  ? 950  ILE A CA    1 
ATOM   4087 C C     . ILE A  1 505 ? 44.757  -18.959 8.600   1.00 27.14  ? 950  ILE A C     1 
ATOM   4088 O O     . ILE A  1 505 ? 44.440  -18.521 9.697   1.00 23.90  ? 950  ILE A O     1 
ATOM   4089 C CB    . ILE A  1 505 ? 46.045  -21.067 8.323   1.00 30.52  ? 950  ILE A CB    1 
ATOM   4090 C CG1   . ILE A  1 505 ? 45.345  -21.604 9.511   1.00 31.64  ? 950  ILE A CG1   1 
ATOM   4091 C CG2   . ILE A  1 505 ? 47.431  -21.734 8.278   1.00 36.64  ? 950  ILE A CG2   1 
ATOM   4092 C CD1   . ILE A  1 505 ? 44.682  -22.906 9.176   1.00 30.77  ? 950  ILE A CD1   1 
ATOM   4093 N N     . LYS A  1 506 ? 43.935  -19.022 7.555   1.00 28.24  ? 951  LYS A N     1 
ATOM   4094 C CA    . LYS A  1 506 ? 42.672  -18.304 7.515   1.00 28.08  ? 951  LYS A CA    1 
ATOM   4095 C C     . LYS A  1 506 ? 41.588  -19.138 8.197   1.00 23.67  ? 951  LYS A C     1 
ATOM   4096 O O     . LYS A  1 506 ? 41.754  -20.339 8.369   1.00 20.63  ? 951  LYS A O     1 
ATOM   4097 C CB    . LYS A  1 506 ? 42.280  -18.060 6.063   1.00 32.21  ? 951  LYS A CB    1 
ATOM   4098 C CG    . LYS A  1 506 ? 43.369  -17.415 5.198   1.00 42.27  ? 951  LYS A CG    1 
ATOM   4099 C CD    . LYS A  1 506 ? 44.027  -16.243 5.881   1.00 45.47  ? 951  LYS A CD    1 
ATOM   4100 C CE    . LYS A  1 506 ? 43.026  -15.133 6.091   1.00 51.14  ? 951  LYS A CE    1 
ATOM   4101 N NZ    . LYS A  1 506 ? 43.634  -13.988 6.816   1.00 56.80  ? 951  LYS A NZ    1 
ATOM   4102 N N     . LEU A  1 507 ? 40.477  -18.496 8.561   1.00 18.58  ? 952  LEU A N     1 
ATOM   4103 C CA    . LEU A  1 507 ? 39.365  -19.170 9.213   1.00 17.52  ? 952  LEU A CA    1 
ATOM   4104 C C     . LEU A  1 507 ? 38.826  -20.415 8.470   1.00 16.28  ? 952  LEU A C     1 
ATOM   4105 O O     . LEU A  1 507 ? 38.642  -21.469 9.095   1.00 17.89  ? 952  LEU A O     1 
ATOM   4106 C CB    . LEU A  1 507 ? 38.229  -18.178 9.466   1.00 18.18  ? 952  LEU A CB    1 
ATOM   4107 C CG    . LEU A  1 507 ? 37.000  -18.746 10.267  1.00 18.99  ? 952  LEU A CG    1 
ATOM   4108 C CD1   . LEU A  1 507 ? 37.353  -19.258 11.631  1.00 20.26  ? 952  LEU A CD1   1 
ATOM   4109 C CD2   . LEU A  1 507 ? 35.885  -17.669 10.371  1.00 20.45  ? 952  LEU A CD2   1 
ATOM   4110 N N     . TYR A  1 508 ? 38.490  -20.296 7.178   1.00 14.70  ? 953  TYR A N     1 
ATOM   4111 C CA    . TYR A  1 508 ? 37.780  -21.368 6.521   1.00 15.78  ? 953  TYR A CA    1 
ATOM   4112 C C     . TYR A  1 508 ? 38.688  -22.615 6.361   1.00 18.41  ? 953  TYR A C     1 
ATOM   4113 O O     . TYR A  1 508 ? 38.232  -23.718 6.586   1.00 18.74  ? 953  TYR A O     1 
ATOM   4114 C CB    . TYR A  1 508 ? 37.161  -20.935 5.172   1.00 16.54  ? 953  TYR A CB    1 
ATOM   4115 C CG    . TYR A  1 508 ? 35.813  -20.130 5.275   1.00 15.41  ? 953  TYR A CG    1 
ATOM   4116 C CD1   . TYR A  1 508 ? 35.408  -19.552 6.464   1.00 15.26  ? 953  TYR A CD1   1 
ATOM   4117 C CD2   . TYR A  1 508 ? 35.018  -19.880 4.126   1.00 15.98  ? 953  TYR A CD2   1 
ATOM   4118 C CE1   . TYR A  1 508 ? 34.209  -18.833 6.558   1.00 13.99  ? 953  TYR A CE1   1 
ATOM   4119 C CE2   . TYR A  1 508 ? 33.842  -19.115 4.211   1.00 15.01  ? 953  TYR A CE2   1 
ATOM   4120 C CZ    . TYR A  1 508 ? 33.462  -18.584 5.409   1.00 15.23  ? 953  TYR A CZ    1 
ATOM   4121 O OH    . TYR A  1 508 ? 32.300  -17.816 5.504   1.00 14.79  ? 953  TYR A OH    1 
ATOM   4122 N N     . PRO A  1 509 ? 39.951  -22.431 5.909   1.00 20.65  ? 954  PRO A N     1 
ATOM   4123 C CA    . PRO A  1 509 ? 40.904  -23.566 5.882   1.00 21.16  ? 954  PRO A CA    1 
ATOM   4124 C C     . PRO A  1 509 ? 41.069  -24.249 7.231   1.00 19.56  ? 954  PRO A C     1 
ATOM   4125 O O     . PRO A  1 509 ? 41.078  -25.521 7.318   1.00 18.81  ? 954  PRO A O     1 
ATOM   4126 C CB    . PRO A  1 509 ? 42.217  -22.906 5.434   1.00 22.35  ? 954  PRO A CB    1 
ATOM   4127 C CG    . PRO A  1 509 ? 41.793  -21.735 4.606   1.00 22.75  ? 954  PRO A CG    1 
ATOM   4128 C CD    . PRO A  1 509 ? 40.488  -21.252 5.182   1.00 22.10  ? 954  PRO A CD    1 
ATOM   4129 N N     . PHE A  1 510 ? 41.109  -23.451 8.296   1.00 18.27  ? 955  PHE A N     1 
ATOM   4130 C CA    . PHE A  1 510 ? 41.147  -23.995 9.648   1.00 18.89  ? 955  PHE A CA    1 
ATOM   4131 C C     . PHE A  1 510 ? 39.975  -24.891 9.948   1.00 20.00  ? 955  PHE A C     1 
ATOM   4132 O O     . PHE A  1 510 ? 40.141  -26.011 10.473  1.00 17.57  ? 955  PHE A O     1 
ATOM   4133 C CB    . PHE A  1 510 ? 41.186  -22.888 10.691  1.00 18.60  ? 955  PHE A CB    1 
ATOM   4134 C CG    . PHE A  1 510 ? 41.162  -23.399 12.124  1.00 20.83  ? 955  PHE A CG    1 
ATOM   4135 C CD1   . PHE A  1 510 ? 42.365  -23.779 12.778  1.00 23.45  ? 955  PHE A CD1   1 
ATOM   4136 C CD2   . PHE A  1 510 ? 39.957  -23.522 12.828  1.00 21.23  ? 955  PHE A CD2   1 
ATOM   4137 C CE1   . PHE A  1 510 ? 42.338  -24.258 14.104  1.00 24.12  ? 955  PHE A CE1   1 
ATOM   4138 C CE2   . PHE A  1 510 ? 39.934  -24.033 14.148  1.00 20.32  ? 955  PHE A CE2   1 
ATOM   4139 C CZ    . PHE A  1 510 ? 41.104  -24.405 14.774  1.00 22.82  ? 955  PHE A CZ    1 
ATOM   4140 N N     . ILE A  1 511 ? 38.770  -24.385 9.666   1.00 17.31  ? 956  ILE A N     1 
ATOM   4141 C CA    . ILE A  1 511 ? 37.564  -25.124 9.906   1.00 16.61  ? 956  ILE A CA    1 
ATOM   4142 C C     . ILE A  1 511 ? 37.523  -26.444 9.111   1.00 17.28  ? 956  ILE A C     1 
ATOM   4143 O O     . ILE A  1 511 ? 37.166  -27.505 9.660   1.00 18.36  ? 956  ILE A O     1 
ATOM   4144 C CB    . ILE A  1 511 ? 36.314  -24.273 9.597   1.00 17.36  ? 956  ILE A CB    1 
ATOM   4145 C CG1   . ILE A  1 511 ? 36.187  -23.130 10.608  1.00 18.69  ? 956  ILE A CG1   1 
ATOM   4146 C CG2   . ILE A  1 511 ? 35.081  -25.148 9.615   1.00 18.53  ? 956  ILE A CG2   1 
ATOM   4147 C CD1   . ILE A  1 511 ? 34.982  -22.212 10.382  1.00 19.91  ? 956  ILE A CD1   1 
ATOM   4148 N N     . TYR A  1 512 ? 37.869  -26.403 7.833   1.00 16.44  ? 957  TYR A N     1 
ATOM   4149 C CA    . TYR A  1 512 ? 37.781  -27.614 7.032   1.00 17.51  ? 957  TYR A CA    1 
ATOM   4150 C C     . TYR A  1 512 ? 38.709  -28.659 7.647   1.00 19.72  ? 957  TYR A C     1 
ATOM   4151 O O     . TYR A  1 512 ? 38.333  -29.848 7.783   1.00 20.99  ? 957  TYR A O     1 
ATOM   4152 C CB    . TYR A  1 512 ? 38.187  -27.365 5.556   1.00 18.36  ? 957  TYR A CB    1 
ATOM   4153 C CG    . TYR A  1 512 ? 37.186  -26.598 4.699   1.00 19.34  ? 957  TYR A CG    1 
ATOM   4154 C CD1   . TYR A  1 512 ? 35.897  -27.064 4.515   1.00 20.39  ? 957  TYR A CD1   1 
ATOM   4155 C CD2   . TYR A  1 512 ? 37.569  -25.433 4.004   1.00 19.81  ? 957  TYR A CD2   1 
ATOM   4156 C CE1   . TYR A  1 512 ? 34.992  -26.379 3.720   1.00 19.92  ? 957  TYR A CE1   1 
ATOM   4157 C CE2   . TYR A  1 512 ? 36.660  -24.716 3.228   1.00 19.34  ? 957  TYR A CE2   1 
ATOM   4158 C CZ    . TYR A  1 512 ? 35.375  -25.206 3.087   1.00 21.03  ? 957  TYR A CZ    1 
ATOM   4159 O OH    . TYR A  1 512 ? 34.451  -24.524 2.314   1.00 22.82  ? 957  TYR A OH    1 
ATOM   4160 N N     . HIS A  1 513 ? 39.914  -28.230 8.001   1.00 20.97  ? 958  HIS A N     1 
ATOM   4161 C CA    . HIS A  1 513 ? 40.939  -29.165 8.540   1.00 23.95  ? 958  HIS A CA    1 
ATOM   4162 C C     . HIS A  1 513 ? 40.504  -29.754 9.870   1.00 23.97  ? 958  HIS A C     1 
ATOM   4163 O O     . HIS A  1 513 ? 40.627  -30.973 10.083  1.00 24.20  ? 958  HIS A O     1 
ATOM   4164 C CB    . HIS A  1 513 ? 42.286  -28.465 8.664   1.00 26.26  ? 958  HIS A CB    1 
ATOM   4165 C CG    . HIS A  1 513 ? 43.335  -29.286 9.358   1.00 34.35  ? 958  HIS A CG    1 
ATOM   4166 N ND1   . HIS A  1 513 ? 44.023  -30.306 8.728   1.00 37.49  ? 958  HIS A ND1   1 
ATOM   4167 C CD2   . HIS A  1 513 ? 43.797  -29.249 10.627  1.00 34.59  ? 958  HIS A CD2   1 
ATOM   4168 C CE1   . HIS A  1 513 ? 44.869  -30.852 9.577   1.00 37.11  ? 958  HIS A CE1   1 
ATOM   4169 N NE2   . HIS A  1 513 ? 44.760  -30.223 10.732  1.00 39.89  ? 958  HIS A NE2   1 
ATOM   4170 N N     . ALA A  1 514 ? 39.970  -28.909 10.751  1.00 21.21  ? 959  ALA A N     1 
ATOM   4171 C CA    . ALA A  1 514 ? 39.578  -29.309 12.089  1.00 23.45  ? 959  ALA A CA    1 
ATOM   4172 C C     . ALA A  1 514 ? 38.490  -30.351 12.081  1.00 24.89  ? 959  ALA A C     1 
ATOM   4173 O O     . ALA A  1 514 ? 38.465  -31.251 12.925  1.00 28.25  ? 959  ALA A O     1 
ATOM   4174 C CB    . ALA A  1 514 ? 39.121  -28.103 12.888  1.00 24.01  ? 959  ALA A CB    1 
ATOM   4175 N N     . VAL A  1 515 ? 37.557  -30.202 11.165  1.00 23.58  ? 960  VAL A N     1 
ATOM   4176 C CA    . VAL A  1 515 ? 36.446  -31.102 11.043  1.00 23.96  ? 960  VAL A CA    1 
ATOM   4177 C C     . VAL A  1 515 ? 36.895  -32.364 10.321  1.00 27.50  ? 960  VAL A C     1 
ATOM   4178 O O     . VAL A  1 515 ? 36.572  -33.453 10.753  1.00 28.96  ? 960  VAL A O     1 
ATOM   4179 C CB    . VAL A  1 515 ? 35.235  -30.470 10.322  1.00 23.84  ? 960  VAL A CB    1 
ATOM   4180 C CG1   . VAL A  1 515 ? 34.191  -31.508 10.017  1.00 23.29  ? 960  VAL A CG1   1 
ATOM   4181 C CG2   . VAL A  1 515 ? 34.639  -29.321 11.163  1.00 25.31  ? 960  VAL A CG2   1 
ATOM   4182 N N     . GLU A  1 516 ? 37.607  -32.214 9.214   1.00 26.99  ? 961  GLU A N     1 
ATOM   4183 C CA    . GLU A  1 516 ? 38.006  -33.365 8.410   1.00 30.48  ? 961  GLU A CA    1 
ATOM   4184 C C     . GLU A  1 516 ? 39.024  -34.249 9.183   1.00 35.46  ? 961  GLU A C     1 
ATOM   4185 O O     . GLU A  1 516 ? 39.087  -35.450 8.946   1.00 37.27  ? 961  GLU A O     1 
ATOM   4186 C CB    . GLU A  1 516 ? 38.579  -32.925 7.044   1.00 30.13  ? 961  GLU A CB    1 
ATOM   4187 C CG    . GLU A  1 516 ? 37.502  -32.617 5.997   1.00 30.68  ? 961  GLU A CG    1 
ATOM   4188 C CD    . GLU A  1 516 ? 38.034  -32.122 4.641   1.00 36.10  ? 961  GLU A CD    1 
ATOM   4189 O OE1   . GLU A  1 516 ? 39.202  -31.661 4.536   1.00 38.09  ? 961  GLU A OE1   1 
ATOM   4190 O OE2   . GLU A  1 516 ? 37.240  -32.153 3.661   1.00 38.39  ? 961  GLU A OE2   1 
ATOM   4191 N N     . SER A  1 517 ? 39.793  -33.635 10.091  1.00 32.85  ? 962  SER A N     1 
ATOM   4192 C CA    . SER A  1 517 ? 40.843  -34.324 10.906  1.00 40.16  ? 962  SER A CA    1 
ATOM   4193 C C     . SER A  1 517 ? 40.294  -35.156 12.038  1.00 43.44  ? 962  SER A C     1 
ATOM   4194 O O     . SER A  1 517 ? 40.979  -36.021 12.555  1.00 47.28  ? 962  SER A O     1 
ATOM   4195 C CB    . SER A  1 517 ? 41.758  -33.297 11.594  1.00 38.44  ? 962  SER A CB    1 
ATOM   4196 O OG    . SER A  1 517 ? 42.674  -32.772 10.699  1.00 44.44  ? 962  SER A OG    1 
ATOM   4197 N N     . CYS A  1 518 ? 39.120  -34.813 12.515  1.00 47.17  ? 963  CYS A N     1 
ATOM   4198 C CA    . CYS A  1 518 ? 38.634  -35.398 13.719  1.00 50.33  ? 963  CYS A CA    1 
ATOM   4199 C C     . CYS A  1 518 ? 38.133  -36.814 13.458  1.00 49.82  ? 963  CYS A C     1 
ATOM   4200 O O     . CYS A  1 518 ? 37.175  -37.008 12.712  1.00 58.99  ? 963  CYS A O     1 
ATOM   4201 C CB    . CYS A  1 518 ? 37.545  -34.547 14.314  1.00 48.95  ? 963  CYS A CB    1 
ATOM   4202 S SG    . CYS A  1 518 ? 37.040  -35.204 15.905  1.00 68.47  ? 963  CYS A SG    1 
HETATM 4203 N N1    . AR6 B  2 .   ? 23.427  -4.462  -1.133  1.00 10.87  ? 1964 AR6 A N1    1 
HETATM 4204 C C2    . AR6 B  2 .   ? 24.270  -5.432  -0.733  1.00 11.94  ? 1964 AR6 A C2    1 
HETATM 4205 N N3    . AR6 B  2 .   ? 25.552  -5.211  -0.346  1.00 11.67  ? 1964 AR6 A N3    1 
HETATM 4206 C C4    . AR6 B  2 .   ? 26.022  -3.959  -0.361  1.00 11.92  ? 1964 AR6 A C4    1 
HETATM 4207 C C5    . AR6 B  2 .   ? 25.165  -2.871  -0.769  1.00 11.76  ? 1964 AR6 A C5    1 
HETATM 4208 C C6    . AR6 B  2 .   ? 23.830  -3.211  -1.216  1.00 12.68  ? 1964 AR6 A C6    1 
HETATM 4209 N N6    . AR6 B  2 .   ? 22.971  -2.237  -1.641  1.00 14.57  ? 1964 AR6 A N6    1 
HETATM 4210 N N7    . AR6 B  2 .   ? 25.882  -1.706  -0.660  1.00 11.22  ? 1964 AR6 A N7    1 
HETATM 4211 C C8    . AR6 B  2 .   ? 27.120  -2.060  -0.250  1.00 11.51  ? 1964 AR6 A C8    1 
HETATM 4212 N N9    . AR6 B  2 .   ? 27.200  -3.406  -0.073  1.00 12.42  ? 1964 AR6 A N9    1 
HETATM 4213 P PA    . AR6 B  2 .   ? 29.258  -0.437  4.418   1.00 11.72  ? 1964 AR6 A PA    1 
HETATM 4214 P PB    . AR6 B  2 .   ? 29.731  -1.179  7.302   1.00 11.67  ? 1964 AR6 A PB    1 
HETATM 4215 C "C1'" . AR6 B  2 .   ? 28.336  -4.176  0.429   1.00 12.97  ? 1964 AR6 A "C1'" 1 
HETATM 4216 O O1A   . AR6 B  2 .   ? 28.165  0.556   4.098   1.00 11.78  ? 1964 AR6 A O1A   1 
HETATM 4217 O O1B   . AR6 B  2 .   ? 31.100  -1.680  6.994   1.00 11.75  ? 1964 AR6 A O1B   1 
HETATM 4218 C C1D   . AR6 B  2 .   ? 28.185  4.057   7.249   1.00 13.54  ? 1964 AR6 A C1D   1 
HETATM 4219 C "C2'" . AR6 B  2 .   ? 29.662  -3.636  -0.090  1.00 12.82  ? 1964 AR6 A "C2'" 1 
HETATM 4220 O "O2'" . AR6 B  2 .   ? 30.564  -4.745  -0.291  1.00 13.05  ? 1964 AR6 A "O2'" 1 
HETATM 4221 O O2A   . AR6 B  2 .   ? 30.676  -0.084  4.242   1.00 11.37  ? 1964 AR6 A O2A   1 
HETATM 4222 O O2B   . AR6 B  2 .   ? 28.815  -1.927  8.251   1.00 12.44  ? 1964 AR6 A O2B   1 
HETATM 4223 C C2D   . AR6 B  2 .   ? 27.165  3.725   8.292   1.00 13.57  ? 1964 AR6 A C2D   1 
HETATM 4224 O O2D   . AR6 B  2 .   ? 26.402  4.870   8.604   1.00 13.19  ? 1964 AR6 A O2D   1 
HETATM 4225 C "C3'" . AR6 B  2 .   ? 30.143  -2.839  1.115   1.00 13.29  ? 1964 AR6 A "C3'" 1 
HETATM 4226 O "O3'" . AR6 B  2 .   ? 31.554  -2.675  1.163   1.00 13.86  ? 1964 AR6 A "O3'" 1 
HETATM 4227 O O3A   . AR6 B  2 .   ? 28.907  -0.972  5.882   1.00 10.96  ? 1964 AR6 A O3A   1 
HETATM 4228 C C3D   . AR6 B  2 .   ? 28.013  3.157   9.415   1.00 12.82  ? 1964 AR6 A C3D   1 
HETATM 4229 O O3D   . AR6 B  2 .   ? 28.551  4.238   10.195  1.00 11.81  ? 1964 AR6 A O3D   1 
HETATM 4230 C "C4'" . AR6 B  2 .   ? 29.659  -3.656  2.287   1.00 12.48  ? 1964 AR6 A "C4'" 1 
HETATM 4231 O "O4'" . AR6 B  2 .   ? 28.375  -4.117  1.855   1.00 12.36  ? 1964 AR6 A "O4'" 1 
HETATM 4232 C C4D   . AR6 B  2 .   ? 29.138  2.453   8.651   1.00 12.77  ? 1964 AR6 A C4D   1 
HETATM 4233 O O4D   . AR6 B  2 .   ? 29.198  3.035   7.315   1.00 13.99  ? 1964 AR6 A O4D   1 
HETATM 4234 C "C5'" . AR6 B  2 .   ? 29.558  -2.934  3.659   1.00 12.35  ? 1964 AR6 A "C5'" 1 
HETATM 4235 O "O5'" . AR6 B  2 .   ? 28.868  -1.716  3.526   1.00 11.60  ? 1964 AR6 A "O5'" 1 
HETATM 4236 C C5D   . AR6 B  2 .   ? 28.872  0.973   8.584   1.00 13.35  ? 1964 AR6 A C5D   1 
HETATM 4237 O O5D   . AR6 B  2 .   ? 29.912  0.319   7.904   1.00 12.10  ? 1964 AR6 A O5D   1 
HETATM 4238 N N1    . AR6 C  2 .   ? 32.373  7.239   1.338   1.00 19.66  ? 1965 AR6 A N1    1 
HETATM 4239 C C2    . AR6 C  2 .   ? 31.140  7.556   1.838   1.00 21.26  ? 1965 AR6 A C2    1 
HETATM 4240 N N3    . AR6 C  2 .   ? 30.741  7.292   3.093   1.00 16.24  ? 1965 AR6 A N3    1 
HETATM 4241 C C4    . AR6 C  2 .   ? 31.610  6.680   3.945   1.00 17.32  ? 1965 AR6 A C4    1 
HETATM 4242 C C5    . AR6 C  2 .   ? 32.951  6.358   3.516   1.00 17.14  ? 1965 AR6 A C5    1 
HETATM 4243 C C6    . AR6 C  2 .   ? 33.311  6.662   2.116   1.00 20.61  ? 1965 AR6 A C6    1 
HETATM 4244 N N6    . AR6 C  2 .   ? 34.544  6.402   1.585   1.00 22.23  ? 1965 AR6 A N6    1 
HETATM 4245 N N7    . AR6 C  2 .   ? 33.565  5.774   4.584   1.00 17.20  ? 1965 AR6 A N7    1 
HETATM 4246 C C8    . AR6 C  2 .   ? 32.707  5.764   5.625   1.00 16.79  ? 1965 AR6 A C8    1 
HETATM 4247 N N9    . AR6 C  2 .   ? 31.502  6.289   5.223   1.00 16.69  ? 1965 AR6 A N9    1 
HETATM 4248 P PA    A AR6 C  2 .   ? 30.897  11.868  7.894   0.50 27.36  ? 1965 AR6 A PA    1 
HETATM 4249 P PA    B AR6 C  2 .   ? 30.506  11.820  8.484   0.50 24.89  ? 1965 AR6 A PA    1 
HETATM 4250 P PB    A AR6 C  2 .   ? 31.774  13.044  10.382  0.50 39.02  ? 1965 AR6 A PB    1 
HETATM 4251 P PB    B AR6 C  2 .   ? 31.632  12.331  10.763  0.50 46.28  ? 1965 AR6 A PB    1 
HETATM 4252 C "C1'" . AR6 C  2 .   ? 30.275  6.504   6.003   1.00 18.23  ? 1965 AR6 A "C1'" 1 
HETATM 4253 O O1A   A AR6 C  2 .   ? 32.046  11.771  6.943   0.50 25.67  ? 1965 AR6 A O1A   1 
HETATM 4254 O O1A   B AR6 C  2 .   ? 31.985  12.055  8.297   0.50 22.29  ? 1965 AR6 A O1A   1 
HETATM 4255 O O1B   A AR6 C  2 .   ? 32.798  12.478  11.397  0.50 35.06  ? 1965 AR6 A O1B   1 
HETATM 4256 O O1B   B AR6 C  2 .   ? 32.037  11.515  11.985  0.50 38.66  ? 1965 AR6 A O1B   1 
HETATM 4257 C "C2'" . AR6 C  2 .   ? 30.242  5.703   7.286   1.00 17.23  ? 1965 AR6 A "C2'" 1 
HETATM 4258 O "O2'" . AR6 C  2 .   ? 28.876  5.397   7.611   1.00 14.18  ? 1965 AR6 A "O2'" 1 
HETATM 4259 O O2A   A AR6 C  2 .   ? 29.883  12.976  7.715   0.50 24.62  ? 1965 AR6 A O2A   1 
HETATM 4260 O O2A   B AR6 C  2 .   ? 29.553  12.864  7.953   0.50 24.11  ? 1965 AR6 A O2A   1 
HETATM 4261 O O2B   A AR6 C  2 .   ? 32.146  14.222  9.518   0.50 30.52  ? 1965 AR6 A O2B   1 
HETATM 4262 O O2B   B AR6 C  2 .   ? 32.667  12.643  9.654   0.50 44.96  ? 1965 AR6 A O2B   1 
HETATM 4263 C "C3'" . AR6 C  2 .   ? 30.817  6.668   8.323   1.00 17.90  ? 1965 AR6 A "C3'" 1 
HETATM 4264 O "O3'" . AR6 C  2 .   ? 30.373  6.381   9.682   1.00 22.07  ? 1965 AR6 A "O3'" 1 
HETATM 4265 O O3A   A AR6 C  2 .   ? 31.365  11.785  9.430   0.50 28.35  ? 1965 AR6 A O3A   1 
HETATM 4266 O O3A   B AR6 C  2 .   ? 30.359  11.668  10.037  0.50 28.96  ? 1965 AR6 A O3A   1 
HETATM 4267 C "C4'" . AR6 C  2 .   ? 30.231  7.976   7.825   1.00 19.59  ? 1965 AR6 A "C4'" 1 
HETATM 4268 O "O4'" . AR6 C  2 .   ? 30.234  7.918   6.383   1.00 18.10  ? 1965 AR6 A "O4'" 1 
HETATM 4269 C "C5'" . AR6 C  2 .   ? 31.001  9.248   8.267   1.00 21.39  ? 1965 AR6 A "C5'" 1 
HETATM 4270 O "O5'" A AR6 C  2 .   ? 30.218  10.406  7.835   0.50 23.23  ? 1965 AR6 A "O5'" 1 
HETATM 4271 O "O5'" B AR6 C  2 .   ? 30.191  10.375  7.874   0.50 22.49  ? 1965 AR6 A "O5'" 1 
HETATM 4272 O O5D   A AR6 C  2 .   ? 30.396  13.288  11.172  0.50 33.70  ? 1965 AR6 A O5D   1 
HETATM 4273 O O5D   B AR6 C  2 .   ? 31.077  13.756  11.237  0.50 37.55  ? 1965 AR6 A O5D   1 
HETATM 4274 C C1    . BME D  3 .   ? -3.720  23.932  7.290   1.00 42.93  ? 1966 BME A C1    1 
HETATM 4275 C C2    . BME D  3 .   ? -2.222  23.650  7.452   1.00 31.68  ? 1966 BME A C2    1 
HETATM 4276 O O1    . BME D  3 .   ? -3.915  25.210  6.658   1.00 39.26  ? 1966 BME A O1    1 
HETATM 4277 S S2    . BME D  3 .   ? -1.959  22.115  6.448   1.00 55.28  ? 1966 BME A S2    1 
HETATM 4278 S S     . SO4 E  4 .   ? -8.249  6.314   17.768  1.00 79.51  ? 1967 SO4 A S     1 
HETATM 4279 O O1    . SO4 E  4 .   ? -8.363  7.782   17.906  1.00 79.87  ? 1967 SO4 A O1    1 
HETATM 4280 O O2    . SO4 E  4 .   ? -7.120  5.938   16.884  1.00 50.05  ? 1967 SO4 A O2    1 
HETATM 4281 O O3    . SO4 E  4 .   ? -9.523  5.788   17.185  1.00 72.92  ? 1967 SO4 A O3    1 
HETATM 4282 O O4    . SO4 E  4 .   ? -7.997  5.769   19.135  1.00 82.36  ? 1967 SO4 A O4    1 
HETATM 4283 S S     . SO4 F  4 .   ? 32.036  29.685  21.065  1.00 89.73  ? 1968 SO4 A S     1 
HETATM 4284 O O1    . SO4 F  4 .   ? 32.483  31.113  21.053  1.00 67.48  ? 1968 SO4 A O1    1 
HETATM 4285 O O2    . SO4 F  4 .   ? 32.264  29.107  19.724  1.00 93.54  ? 1968 SO4 A O2    1 
HETATM 4286 O O3    . SO4 F  4 .   ? 30.593  29.614  21.385  1.00 83.31  ? 1968 SO4 A O3    1 
HETATM 4287 O O4    . SO4 F  4 .   ? 32.795  28.881  22.065  1.00 86.45  ? 1968 SO4 A O4    1 
HETATM 4288 S S     . SO4 G  4 .   ? 33.727  10.272  4.607   1.00 99.13  ? 1969 SO4 A S     1 
HETATM 4289 O O1    . SO4 G  4 .   ? 33.844  11.705  4.991   1.00 97.25  ? 1969 SO4 A O1    1 
HETATM 4290 O O2    . SO4 G  4 .   ? 34.555  10.036  3.396   1.00 87.77  ? 1969 SO4 A O2    1 
HETATM 4291 O O3    . SO4 G  4 .   ? 32.304  9.932   4.344   1.00 89.14  ? 1969 SO4 A O3    1 
HETATM 4292 O O4    . SO4 G  4 .   ? 34.221  9.426   5.718   1.00 95.58  ? 1969 SO4 A O4    1 
HETATM 4293 S S     . SO4 H  4 .   ? 7.297   -19.314 -1.228  1.00 112.69 ? 1970 SO4 A S     1 
HETATM 4294 O O1    . SO4 H  4 .   ? 8.184   -19.454 -0.048  1.00 115.21 ? 1970 SO4 A O1    1 
HETATM 4295 O O2    . SO4 H  4 .   ? 7.419   -17.932 -1.798  1.00 90.48  ? 1970 SO4 A O2    1 
HETATM 4296 O O3    . SO4 H  4 .   ? 5.914   -19.586 -0.781  1.00 105.51 ? 1970 SO4 A O3    1 
HETATM 4297 O O4    . SO4 H  4 .   ? 7.663   -20.324 -2.249  1.00 108.08 ? 1970 SO4 A O4    1 
HETATM 4298 S S     . SO4 I  4 .   ? 32.346  -5.794  23.486  1.00 104.88 ? 1971 SO4 A S     1 
HETATM 4299 O O1    . SO4 I  4 .   ? 31.573  -5.605  24.738  1.00 104.52 ? 1971 SO4 A O1    1 
HETATM 4300 O O2    . SO4 I  4 .   ? 32.343  -4.522  22.706  1.00 83.66  ? 1971 SO4 A O2    1 
HETATM 4301 O O3    . SO4 I  4 .   ? 31.705  -6.878  22.722  1.00 111.63 ? 1971 SO4 A O3    1 
HETATM 4302 O O4    . SO4 I  4 .   ? 33.740  -6.221  23.778  1.00 94.71  ? 1971 SO4 A O4    1 
HETATM 4303 S S     . SO4 J  4 .   ? 19.502  25.360  20.359  1.00 30.76  ? 1972 SO4 A S     1 
HETATM 4304 O O1    . SO4 J  4 .   ? 19.231  26.837  20.543  1.00 39.38  ? 1972 SO4 A O1    1 
HETATM 4305 O O2    . SO4 J  4 .   ? 20.919  25.071  20.169  1.00 25.71  ? 1972 SO4 A O2    1 
HETATM 4306 O O3    . SO4 J  4 .   ? 18.710  25.002  19.162  1.00 43.78  ? 1972 SO4 A O3    1 
HETATM 4307 O O4    . SO4 J  4 .   ? 19.007  24.720  21.537  1.00 34.08  ? 1972 SO4 A O4    1 
HETATM 4308 S S     . SO4 K  4 .   ? 14.174  23.916  28.471  1.00 74.97  ? 1973 SO4 A S     1 
HETATM 4309 O O1    . SO4 K  4 .   ? 15.249  24.606  29.207  1.00 81.32  ? 1973 SO4 A O1    1 
HETATM 4310 O O2    . SO4 K  4 .   ? 14.724  23.577  27.110  1.00 64.47  ? 1973 SO4 A O2    1 
HETATM 4311 O O3    . SO4 K  4 .   ? 13.001  24.824  28.365  1.00 66.61  ? 1973 SO4 A O3    1 
HETATM 4312 O O4    . SO4 K  4 .   ? 13.747  22.701  29.249  1.00 73.01  ? 1973 SO4 A O4    1 
HETATM 4313 C C1    . GOL L  5 .   ? 12.616  -2.492  -1.224  1.00 26.75  ? 1974 GOL A C1    1 
HETATM 4314 O O1    . GOL L  5 .   ? 11.958  -3.813  -1.293  1.00 28.80  ? 1974 GOL A O1    1 
HETATM 4315 C C2    . GOL L  5 .   ? 11.875  -1.207  -1.787  1.00 29.77  ? 1974 GOL A C2    1 
HETATM 4316 O O2    . GOL L  5 .   ? 11.640  -0.061  -0.788  1.00 20.45  ? 1974 GOL A O2    1 
HETATM 4317 C C3    . GOL L  5 .   ? 10.644  -1.724  -2.416  1.00 29.17  ? 1974 GOL A C3    1 
HETATM 4318 O O3    . GOL L  5 .   ? 10.994  -2.431  -3.613  1.00 27.81  ? 1974 GOL A O3    1 
HETATM 4319 C C1    . GOL M  5 .   ? 27.347  -29.058 20.185  1.00 46.74  ? 1975 GOL A C1    1 
HETATM 4320 O O1    . GOL M  5 .   ? 28.597  -29.118 20.836  1.00 53.52  ? 1975 GOL A O1    1 
HETATM 4321 C C2    . GOL M  5 .   ? 26.417  -28.251 21.012  1.00 42.56  ? 1975 GOL A C2    1 
HETATM 4322 O O2    . GOL M  5 .   ? 26.754  -28.360 22.420  1.00 50.09  ? 1975 GOL A O2    1 
HETATM 4323 C C3    . GOL M  5 .   ? 25.046  -28.755 20.713  1.00 37.74  ? 1975 GOL A C3    1 
HETATM 4324 O O3    . GOL M  5 .   ? 25.069  -29.356 19.424  1.00 28.75  ? 1975 GOL A O3    1 
HETATM 4325 C C1    . GOL N  5 .   ? 33.118  -6.169  1.033   1.00 41.94  ? 1976 GOL A C1    1 
HETATM 4326 O O1    . GOL N  5 .   ? 33.306  -4.889  1.685   1.00 30.57  ? 1976 GOL A O1    1 
HETATM 4327 C C2    . GOL N  5 .   ? 34.413  -6.977  0.968   1.00 44.01  ? 1976 GOL A C2    1 
HETATM 4328 O O2    . GOL N  5 .   ? 34.931  -7.068  2.326   1.00 51.67  ? 1976 GOL A O2    1 
HETATM 4329 C C3    . GOL N  5 .   ? 34.172  -8.386  0.366   1.00 41.41  ? 1976 GOL A C3    1 
HETATM 4330 O O3    . GOL N  5 .   ? 33.764  -8.379  -1.042  1.00 33.67  ? 1976 GOL A O3    1 
HETATM 4331 C C1    . GOL O  5 .   ? 35.454  2.996   1.763   1.00 53.32  ? 1977 GOL A C1    1 
HETATM 4332 O O1    . GOL O  5 .   ? 35.373  2.560   3.149   1.00 49.48  ? 1977 GOL A O1    1 
HETATM 4333 C C2    . GOL O  5 .   ? 34.130  2.633   1.123   1.00 43.88  ? 1977 GOL A C2    1 
HETATM 4334 O O2    . GOL O  5 .   ? 33.747  1.509   1.874   1.00 41.48  ? 1977 GOL A O2    1 
HETATM 4335 C C3    . GOL O  5 .   ? 34.235  2.265   -0.359  1.00 45.69  ? 1977 GOL A C3    1 
HETATM 4336 O O3    . GOL O  5 .   ? 34.438  3.437   -1.158  1.00 44.95  ? 1977 GOL A O3    1 
HETATM 4337 C C1    . GOL P  5 .   ? 38.877  -3.295  17.657  1.00 43.93  ? 1978 GOL A C1    1 
HETATM 4338 O O1    . GOL P  5 .   ? 39.453  -2.624  16.551  1.00 41.94  ? 1978 GOL A O1    1 
HETATM 4339 C C2    . GOL P  5 .   ? 37.632  -2.625  18.149  1.00 46.62  ? 1978 GOL A C2    1 
HETATM 4340 O O2    . GOL P  5 .   ? 38.010  -1.583  19.029  1.00 57.94  ? 1978 GOL A O2    1 
HETATM 4341 C C3    . GOL P  5 .   ? 36.837  -3.628  18.931  1.00 44.78  ? 1978 GOL A C3    1 
HETATM 4342 O O3    . GOL P  5 .   ? 35.515  -3.162  19.051  1.00 43.82  ? 1978 GOL A O3    1 
HETATM 4343 C C1    . GOL Q  5 .   ? 3.337   8.767   -2.559  1.00 49.84  ? 1979 GOL A C1    1 
HETATM 4344 O O1    . GOL Q  5 .   ? 3.395   7.529   -3.286  1.00 47.76  ? 1979 GOL A O1    1 
HETATM 4345 C C2    . GOL Q  5 .   ? 3.902   9.903   -3.422  1.00 49.92  ? 1979 GOL A C2    1 
HETATM 4346 O O2    . GOL Q  5 .   ? 3.217   11.144  -3.157  1.00 44.80  ? 1979 GOL A O2    1 
HETATM 4347 C C3    . GOL Q  5 .   ? 3.722   9.573   -4.874  1.00 52.28  ? 1979 GOL A C3    1 
HETATM 4348 O O3    . GOL Q  5 .   ? 2.314   9.599   -5.054  1.00 56.79  ? 1979 GOL A O3    1 
HETATM 4349 C C1    . GOL R  5 .   ? 16.501  15.011  27.120  1.00 50.32  ? 1980 GOL A C1    1 
HETATM 4350 O O1    . GOL R  5 .   ? 15.466  15.903  26.677  1.00 46.63  ? 1980 GOL A O1    1 
HETATM 4351 C C2    . GOL R  5 .   ? 16.385  13.660  26.441  1.00 50.22  ? 1980 GOL A C2    1 
HETATM 4352 O O2    . GOL R  5 .   ? 15.465  12.901  27.217  1.00 49.69  ? 1980 GOL A O2    1 
HETATM 4353 C C3    . GOL R  5 .   ? 17.740  12.961  26.407  1.00 50.79  ? 1980 GOL A C3    1 
HETATM 4354 O O3    . GOL R  5 .   ? 17.671  11.648  26.980  1.00 47.19  ? 1980 GOL A O3    1 
HETATM 4355 C C1    . GOL S  5 .   ? 32.886  6.489   12.572  1.00 45.85  ? 1981 GOL A C1    1 
HETATM 4356 O O1    . GOL S  5 .   ? 32.533  5.785   11.350  1.00 45.45  ? 1981 GOL A O1    1 
HETATM 4357 C C2    . GOL S  5 .   ? 32.804  5.618   13.858  1.00 47.67  ? 1981 GOL A C2    1 
HETATM 4358 O O2    . GOL S  5 .   ? 33.214  4.294   13.595  1.00 45.34  ? 1981 GOL A O2    1 
HETATM 4359 C C3    . GOL S  5 .   ? 31.411  5.597   14.527  1.00 47.29  ? 1981 GOL A C3    1 
HETATM 4360 O O3    . GOL S  5 .   ? 31.146  4.325   15.249  1.00 43.08  ? 1981 GOL A O3    1 
HETATM 4361 C C1    . GOL T  5 .   ? 14.273  20.788  -9.544  1.00 44.43  ? 1982 GOL A C1    1 
HETATM 4362 O O1    . GOL T  5 .   ? 14.505  22.153  -9.293  1.00 38.46  ? 1982 GOL A O1    1 
HETATM 4363 C C2    . GOL T  5 .   ? 15.578  20.042  -9.383  1.00 41.50  ? 1982 GOL A C2    1 
HETATM 4364 O O2    . GOL T  5 .   ? 15.358  18.676  -9.812  1.00 44.94  ? 1982 GOL A O2    1 
HETATM 4365 C C3    . GOL T  5 .   ? 16.042  20.099  -7.929  1.00 33.94  ? 1982 GOL A C3    1 
HETATM 4366 O O3    . GOL T  5 .   ? 16.920  18.958  -7.690  1.00 30.97  ? 1982 GOL A O3    1 
HETATM 4367 C C1    . GOL U  5 .   ? -2.874  24.645  15.263  1.00 58.29  ? 1983 GOL A C1    1 
HETATM 4368 O O1    . GOL U  5 .   ? -2.350  24.815  16.578  1.00 58.57  ? 1983 GOL A O1    1 
HETATM 4369 C C2    . GOL U  5 .   ? -4.343  24.247  15.341  1.00 59.38  ? 1983 GOL A C2    1 
HETATM 4370 O O2    . GOL U  5 .   ? -5.117  25.400  15.663  1.00 65.73  ? 1983 GOL A O2    1 
HETATM 4371 C C3    . GOL U  5 .   ? -4.564  23.122  16.364  1.00 54.02  ? 1983 GOL A C3    1 
HETATM 4372 O O3    . GOL U  5 .   ? -4.205  21.853  15.772  1.00 43.33  ? 1983 GOL A O3    1 
HETATM 4373 C C1    . GOL V  5 .   ? 30.119  33.381  1.819   1.00 36.63  ? 1984 GOL A C1    1 
HETATM 4374 O O1    . GOL V  5 .   ? 31.232  33.170  2.675   1.00 40.43  ? 1984 GOL A O1    1 
HETATM 4375 C C2    . GOL V  5 .   ? 29.125  34.417  2.376   1.00 37.74  ? 1984 GOL A C2    1 
HETATM 4376 O O2    . GOL V  5 .   ? 28.908  34.210  3.795   1.00 40.76  ? 1984 GOL A O2    1 
HETATM 4377 C C3    . GOL V  5 .   ? 27.800  34.321  1.595   1.00 32.67  ? 1984 GOL A C3    1 
HETATM 4378 O O3    . GOL V  5 .   ? 26.925  33.312  2.125   1.00 25.07  ? 1984 GOL A O3    1 
HETATM 4379 C C1    . PPI W  6 .   ? 17.301  32.739  17.718  1.00 42.68  ? 1985 PPI A C1    1 
HETATM 4380 C C2    . PPI W  6 .   ? 17.203  34.255  17.784  1.00 45.98  ? 1985 PPI A C2    1 
HETATM 4381 C C3    . PPI W  6 .   ? 18.051  34.777  18.925  1.00 46.06  ? 1985 PPI A C3    1 
HETATM 4382 O O1    . PPI W  6 .   ? 16.347  32.088  18.164  1.00 58.91  ? 1985 PPI A O1    1 
HETATM 4383 O O2    . PPI W  6 .   ? 18.307  32.178  17.227  1.00 32.44  ? 1985 PPI A O2    1 
HETATM 4384 C C1    . PPI X  6 .   ? 4.306   -5.214  13.257  1.00 43.87  ? 1986 PPI A C1    1 
HETATM 4385 C C2    . PPI X  6 .   ? 3.664   -5.985  14.388  1.00 43.51  ? 1986 PPI A C2    1 
HETATM 4386 C C3    . PPI X  6 .   ? 2.721   -7.062  13.872  1.00 49.38  ? 1986 PPI A C3    1 
HETATM 4387 O O1    . PPI X  6 .   ? 4.729   -3.980  13.540  1.00 25.35  ? 1986 PPI A O1    1 
HETATM 4388 O O2    . PPI X  6 .   ? 4.371   -5.834  12.086  1.00 33.23  ? 1986 PPI A O2    1 
HETATM 4389 C C1    . PPI Y  6 .   ? 0.503   25.892  18.648  1.00 55.19  ? 1987 PPI A C1    1 
HETATM 4390 C C2    . PPI Y  6 .   ? 0.956   25.577  20.043  1.00 45.25  ? 1987 PPI A C2    1 
HETATM 4391 C C3    . PPI Y  6 .   ? -0.235  25.398  20.954  1.00 43.14  ? 1987 PPI A C3    1 
HETATM 4392 O O1    . PPI Y  6 .   ? 1.349   26.337  17.828  1.00 60.57  ? 1987 PPI A O1    1 
HETATM 4393 O O2    . PPI Y  6 .   ? -0.700  25.693  18.356  1.00 58.76  ? 1987 PPI A O2    1 
HETATM 4394 C C1    . PPI Z  6 .   ? 26.306  -5.224  -7.732  1.00 55.69  ? 1988 PPI A C1    1 
HETATM 4395 C C2    . PPI Z  6 .   ? 27.736  -5.005  -8.233  1.00 49.68  ? 1988 PPI A C2    1 
HETATM 4396 C C3    . PPI Z  6 .   ? 28.311  -3.655  -7.827  1.00 49.15  ? 1988 PPI A C3    1 
HETATM 4397 O O1    . PPI Z  6 .   ? 26.044  -6.291  -7.107  1.00 45.21  ? 1988 PPI A O1    1 
HETATM 4398 O O2    . PPI Z  6 .   ? 25.428  -4.350  -7.974  1.00 61.86  ? 1988 PPI A O2    1 
HETATM 4399 C C1    . PPI AA 6 .   ? 27.711  8.033   23.510  1.00 56.07  ? 1989 PPI A C1    1 
HETATM 4400 C C2    . PPI AA 6 .   ? 26.360  8.679   23.678  1.00 50.55  ? 1989 PPI A C2    1 
HETATM 4401 C C3    . PPI AA 6 .   ? 25.739  8.185   24.986  1.00 59.89  ? 1989 PPI A C3    1 
HETATM 4402 O O1    . PPI AA 6 .   ? 27.906  6.944   24.080  1.00 61.83  ? 1989 PPI A O1    1 
HETATM 4403 O O2    . PPI AA 6 .   ? 28.587  8.608   22.828  1.00 57.71  ? 1989 PPI A O2    1 
HETATM 4404 C C1    . PPI BA 6 .   ? 24.889  0.311   -7.364  1.00 46.54  ? 1990 PPI A C1    1 
HETATM 4405 C C2    . PPI BA 6 .   ? 24.032  -0.851  -6.890  1.00 48.57  ? 1990 PPI A C2    1 
HETATM 4406 C C3    . PPI BA 6 .   ? 23.362  -1.571  -8.066  1.00 50.38  ? 1990 PPI A C3    1 
HETATM 4407 O O1    . PPI BA 6 .   ? 24.414  1.159   -8.154  1.00 47.63  ? 1990 PPI A O1    1 
HETATM 4408 O O2    . PPI BA 6 .   ? 26.030  0.407   -6.926  1.00 36.69  ? 1990 PPI A O2    1 
HETATM 4409 O O     . HOH CA 7 .   ? 32.733  -1.714  -2.573  1.00 51.67  ? 2001 HOH A O     1 
HETATM 4410 O O     . HOH CA 7 .   ? 30.307  -15.949 -13.465 1.00 36.81  ? 2002 HOH A O     1 
HETATM 4411 O O     . HOH CA 7 .   ? 26.904  -17.759 -15.214 1.00 42.79  ? 2003 HOH A O     1 
HETATM 4412 O O     . HOH CA 7 .   ? 30.964  -20.272 -9.631  1.00 44.22  ? 2004 HOH A O     1 
HETATM 4413 O O     . HOH CA 7 .   ? 24.037  -18.604 -12.802 1.00 34.38  ? 2005 HOH A O     1 
HETATM 4414 O O     . HOH CA 7 .   ? 23.514  -22.458 -9.379  1.00 33.48  ? 2006 HOH A O     1 
HETATM 4415 O O     . HOH CA 7 .   ? 19.710  -19.245 -13.121 1.00 37.55  ? 2007 HOH A O     1 
HETATM 4416 O O     . HOH CA 7 .   ? 21.315  -17.071 -13.329 1.00 48.05  ? 2008 HOH A O     1 
HETATM 4417 O O     . HOH CA 7 .   ? 24.204  -24.417 -6.175  1.00 20.97  ? 2009 HOH A O     1 
HETATM 4418 O O     . HOH CA 7 .   ? 17.457  -26.170 -0.565  1.00 31.76  ? 2010 HOH A O     1 
HETATM 4419 O O     . HOH CA 7 .   ? 20.709  -24.001 1.281   1.00 14.67  ? 2011 HOH A O     1 
HETATM 4420 O O     . HOH CA 7 .   ? 17.565  -18.726 -7.854  1.00 22.23  ? 2012 HOH A O     1 
HETATM 4421 O O     . HOH CA 7 .   ? 10.998  -16.267 -3.051  1.00 25.20  ? 2013 HOH A O     1 
HETATM 4422 O O     . HOH CA 7 .   ? 16.390  -20.405 -9.795  1.00 40.86  ? 2014 HOH A O     1 
HETATM 4423 O O     . HOH CA 7 .   ? 11.268  -19.592 -11.777 1.00 29.57  ? 2015 HOH A O     1 
HETATM 4424 O O     . HOH CA 7 .   ? 9.837   -22.333 2.426   1.00 43.26  ? 2016 HOH A O     1 
HETATM 4425 O O     . HOH CA 7 .   ? 9.039   -26.859 -2.539  1.00 37.10  ? 2017 HOH A O     1 
HETATM 4426 O O     . HOH CA 7 .   ? 12.675  -18.612 3.830   1.00 19.90  ? 2018 HOH A O     1 
HETATM 4427 O O     . HOH CA 7 .   ? 11.605  -19.313 8.624   1.00 27.25  ? 2019 HOH A O     1 
HETATM 4428 O O     . HOH CA 7 .   ? 12.973  -17.661 6.734   1.00 15.68  ? 2020 HOH A O     1 
HETATM 4429 O O     . HOH CA 7 .   ? 6.209   -16.722 1.409   1.00 41.05  ? 2021 HOH A O     1 
HETATM 4430 O O     . HOH CA 7 .   ? 4.336   -12.333 -0.783  1.00 31.12  ? 2022 HOH A O     1 
HETATM 4431 O O     . HOH CA 7 .   ? 11.626  -15.401 -6.123  1.00 48.34  ? 2023 HOH A O     1 
HETATM 4432 O O     . HOH CA 7 .   ? 14.908  -11.677 -5.875  1.00 35.60  ? 2024 HOH A O     1 
HETATM 4433 O O     . HOH CA 7 .   ? 6.463   -11.653 -2.635  1.00 52.38  ? 2025 HOH A O     1 
HETATM 4434 O O     . HOH CA 7 .   ? 0.996   -10.487 5.422   1.00 39.93  ? 2026 HOH A O     1 
HETATM 4435 O O     . HOH CA 7 .   ? 4.605   -12.576 10.193  1.00 40.83  ? 2027 HOH A O     1 
HETATM 4436 O O     . HOH CA 7 .   ? -3.062  -8.993  7.978   1.00 35.40  ? 2028 HOH A O     1 
HETATM 4437 O O     . HOH CA 7 .   ? -5.815  -5.043  10.840  1.00 46.90  ? 2029 HOH A O     1 
HETATM 4438 O O     . HOH CA 7 .   ? -7.230  -7.972  16.411  1.00 38.79  ? 2030 HOH A O     1 
HETATM 4439 O O     . HOH CA 7 .   ? -2.118  -2.774  17.508  1.00 37.82  ? 2031 HOH A O     1 
HETATM 4440 O O     . HOH CA 7 .   ? -6.263  -2.596  11.702  1.00 25.53  ? 2032 HOH A O     1 
HETATM 4441 O O     . HOH CA 7 .   ? -1.313  -2.111  20.122  1.00 38.30  ? 2033 HOH A O     1 
HETATM 4442 O O     . HOH CA 7 .   ? -0.451  5.176   22.972  1.00 31.12  ? 2034 HOH A O     1 
HETATM 4443 O O     . HOH CA 7 .   ? -2.054  -1.298  26.955  1.00 48.83  ? 2035 HOH A O     1 
HETATM 4444 O O     . HOH CA 7 .   ? 5.848   -2.581  20.389  1.00 34.95  ? 2036 HOH A O     1 
HETATM 4445 O O     . HOH CA 7 .   ? 7.008   -4.012  24.885  1.00 41.42  ? 2037 HOH A O     1 
HETATM 4446 O O     . HOH CA 7 .   ? 2.889   7.853   23.354  1.00 44.25  ? 2038 HOH A O     1 
HETATM 4447 O O     . HOH CA 7 .   ? -1.042  6.668   20.725  1.00 15.87  ? 2039 HOH A O     1 
HETATM 4448 O O     . HOH CA 7 .   ? -3.654  7.336   20.179  1.00 19.64  ? 2040 HOH A O     1 
HETATM 4449 O O     . HOH CA 7 .   ? -4.806  6.263   17.561  1.00 21.18  ? 2041 HOH A O     1 
HETATM 4450 O O     . HOH CA 7 .   ? -1.098  13.233  15.473  1.00 14.19  ? 2042 HOH A O     1 
HETATM 4451 O O     . HOH CA 7 .   ? 3.361   12.070  13.973  1.00 27.70  ? 2043 HOH A O     1 
HETATM 4452 O O     . HOH CA 7 .   ? -7.169  7.967   9.437   1.00 15.95  ? 2044 HOH A O     1 
HETATM 4453 O O     . HOH CA 7 .   ? -9.098  13.112  15.107  1.00 20.44  ? 2045 HOH A O     1 
HETATM 4454 O O     . HOH CA 7 .   ? -15.688 6.149   13.524  1.00 40.63  ? 2046 HOH A O     1 
HETATM 4455 O O     . HOH CA 7 .   ? -6.970  6.797   5.815   1.00 15.23  ? 2047 HOH A O     1 
HETATM 4456 O O     . HOH CA 7 .   ? -11.556 7.790   6.082   1.00 31.01  ? 2048 HOH A O     1 
HETATM 4457 O O     . HOH CA 7 .   ? -8.734  8.995   6.108   1.00 25.91  ? 2049 HOH A O     1 
HETATM 4458 O O     . HOH CA 7 .   ? -4.361  4.960   3.771   1.00 21.31  ? 2050 HOH A O     1 
HETATM 4459 O O     . HOH CA 7 .   ? -14.064 6.139   6.988   1.00 38.34  ? 2051 HOH A O     1 
HETATM 4460 O O     . HOH CA 7 .   ? -9.301  0.321   3.135   1.00 26.16  ? 2052 HOH A O     1 
HETATM 4461 O O     . HOH CA 7 .   ? -10.619 2.905   0.304   1.00 36.81  ? 2053 HOH A O     1 
HETATM 4462 O O     . HOH CA 7 .   ? -3.531  4.017   1.573   1.00 27.14  ? 2054 HOH A O     1 
HETATM 4463 O O     . HOH CA 7 .   ? -14.707 6.828   2.890   1.00 29.73  ? 2055 HOH A O     1 
HETATM 4464 O O     . HOH CA 7 .   ? -12.269 6.309   -0.137  1.00 34.47  ? 2056 HOH A O     1 
HETATM 4465 O O     . HOH CA 7 .   ? -10.985 11.220  3.417   1.00 13.70  ? 2057 HOH A O     1 
HETATM 4466 O O     . HOH CA 7 .   ? -1.813  12.383  7.895   1.00 16.47  ? 2058 HOH A O     1 
HETATM 4467 O O     . HOH CA 7 .   ? -7.490  15.445  13.012  1.00 19.33  ? 2059 HOH A O     1 
HETATM 4468 O O     . HOH CA 7 .   ? -9.365  14.473  19.316  1.00 34.74  ? 2060 HOH A O     1 
HETATM 4469 O O     . HOH CA 7 .   ? -8.411  17.498  20.150  1.00 36.90  ? 2061 HOH A O     1 
HETATM 4470 O O     . HOH CA 7 .   ? -5.951  20.781  14.182  1.00 43.06  ? 2062 HOH A O     1 
HETATM 4471 O O     . HOH CA 7 .   ? -5.618  17.742  12.855  1.00 20.59  ? 2063 HOH A O     1 
HETATM 4472 O O     . HOH CA 7 .   ? -11.981 14.795  17.926  1.00 53.77  ? 2064 HOH A O     1 
HETATM 4473 O O     . HOH CA 7 .   ? -6.089  17.878  21.620  1.00 37.81  ? 2065 HOH A O     1 
HETATM 4474 O O     . HOH CA 7 .   ? 2.560   17.135  19.771  1.00 23.04  ? 2066 HOH A O     1 
HETATM 4475 O O     . HOH CA 7 .   ? -1.039  21.390  24.820  1.00 31.00  ? 2067 HOH A O     1 
HETATM 4476 O O     . HOH CA 7 .   ? 2.601   20.598  28.003  1.00 47.80  ? 2068 HOH A O     1 
HETATM 4477 O O     . HOH CA 7 .   ? 6.911   19.720  22.044  1.00 20.47  ? 2069 HOH A O     1 
HETATM 4478 O O     . HOH CA 7 .   ? 3.649   22.854  26.701  1.00 31.67  ? 2070 HOH A O     1 
HETATM 4479 O O     . HOH CA 7 .   ? 2.463   24.311  22.720  1.00 26.34  ? 2071 HOH A O     1 
HETATM 4480 O O     . HOH CA 7 .   ? 4.601   17.626  21.676  1.00 19.54  ? 2072 HOH A O     1 
HETATM 4481 O O     . HOH CA 7 .   ? 9.360   17.178  24.793  1.00 16.80  ? 2073 HOH A O     1 
HETATM 4482 O O     . HOH CA 7 .   ? 4.947   19.374  29.091  1.00 34.38  ? 2074 HOH A O     1 
HETATM 4483 O O     . HOH CA 7 .   ? 13.244  15.998  24.969  1.00 26.22  ? 2075 HOH A O     1 
HETATM 4484 O O     . HOH CA 7 .   ? 6.062   12.899  30.135  1.00 37.69  ? 2076 HOH A O     1 
HETATM 4485 O O     . HOH CA 7 .   ? 5.345   16.910  30.587  1.00 30.27  ? 2077 HOH A O     1 
HETATM 4486 O O     . HOH CA 7 .   ? 10.170  13.901  31.723  1.00 37.04  ? 2078 HOH A O     1 
HETATM 4487 O O     . HOH CA 7 .   ? 13.978  9.602   27.674  1.00 30.43  ? 2079 HOH A O     1 
HETATM 4488 O O     . HOH CA 7 .   ? 10.141  8.080   25.806  1.00 21.71  ? 2080 HOH A O     1 
HETATM 4489 O O     . HOH CA 7 .   ? 6.446   15.587  21.291  1.00 19.84  ? 2081 HOH A O     1 
HETATM 4490 O O     . HOH CA 7 .   ? 13.870  16.547  19.955  1.00 21.61  ? 2082 HOH A O     1 
HETATM 4491 O O     . HOH CA 7 .   ? 13.711  19.106  18.961  1.00 14.72  ? 2083 HOH A O     1 
HETATM 4492 O O     . HOH CA 7 .   ? 7.237   29.022  20.083  1.00 21.11  ? 2084 HOH A O     1 
HETATM 4493 O O     . HOH CA 7 .   ? 5.560   30.933  22.825  1.00 42.38  ? 2085 HOH A O     1 
HETATM 4494 O O     . HOH CA 7 .   ? 5.495   29.920  27.280  1.00 39.07  ? 2086 HOH A O     1 
HETATM 4495 O O     . HOH CA 7 .   ? 14.117  26.660  22.640  1.00 37.91  ? 2087 HOH A O     1 
HETATM 4496 O O     . HOH CA 7 .   ? 13.314  26.064  16.861  1.00 14.55  ? 2088 HOH A O     1 
HETATM 4497 O O     . HOH CA 7 .   ? 8.627   36.689  16.441  1.00 46.95  ? 2089 HOH A O     1 
HETATM 4498 O O     . HOH CA 7 .   ? 6.728   36.226  20.037  1.00 51.71  ? 2090 HOH A O     1 
HETATM 4499 O O     . HOH CA 7 .   ? 16.000  26.793  16.685  1.00 23.29  ? 2091 HOH A O     1 
HETATM 4500 O O     . HOH CA 7 .   ? 0.849   27.723  15.273  1.00 48.31  ? 2092 HOH A O     1 
HETATM 4501 O O     . HOH CA 7 .   ? 4.486   34.890  12.819  1.00 41.30  ? 2093 HOH A O     1 
HETATM 4502 O O     . HOH CA 7 .   ? 1.549   31.010  15.286  1.00 37.97  ? 2094 HOH A O     1 
HETATM 4503 O O     . HOH CA 7 .   ? 1.535   29.482  8.604   1.00 34.05  ? 2095 HOH A O     1 
HETATM 4504 O O     . HOH CA 7 .   ? 7.378   36.809  6.707   1.00 35.70  ? 2096 HOH A O     1 
HETATM 4505 O O     . HOH CA 7 .   ? 8.741   37.321  14.222  1.00 49.32  ? 2097 HOH A O     1 
HETATM 4506 O O     . HOH CA 7 .   ? 13.670  35.490  5.816   1.00 21.31  ? 2098 HOH A O     1 
HETATM 4507 O O     . HOH CA 7 .   ? 7.904   30.387  1.627   1.00 30.29  ? 2099 HOH A O     1 
HETATM 4508 O O     . HOH CA 7 .   ? 5.338   33.297  1.446   1.00 46.11  ? 2100 HOH A O     1 
HETATM 4509 O O     . HOH CA 7 .   ? 8.995   31.617  -0.724  1.00 41.49  ? 2101 HOH A O     1 
HETATM 4510 O O     . HOH CA 7 .   ? 13.870  36.217  1.363   1.00 44.52  ? 2102 HOH A O     1 
HETATM 4511 O O     . HOH CA 7 .   ? 13.495  38.142  -2.788  1.00 51.59  ? 2103 HOH A O     1 
HETATM 4512 O O     . HOH CA 7 .   ? 10.392  34.566  -8.728  1.00 41.45  ? 2104 HOH A O     1 
HETATM 4513 O O     . HOH CA 7 .   ? 9.891   31.767  -3.375  1.00 38.32  ? 2105 HOH A O     1 
HETATM 4514 O O     . HOH CA 7 .   ? 10.401  33.334  -6.378  1.00 39.12  ? 2106 HOH A O     1 
HETATM 4515 O O     . HOH CA 7 .   ? 18.694  32.245  -8.673  1.00 29.43  ? 2107 HOH A O     1 
HETATM 4516 O O     . HOH CA 7 .   ? 17.111  38.045  -8.151  1.00 42.53  ? 2108 HOH A O     1 
HETATM 4517 O O     . HOH CA 7 .   ? 25.073  33.413  -4.457  1.00 17.44  ? 2109 HOH A O     1 
HETATM 4518 O O     . HOH CA 7 .   ? 19.307  37.489  1.359   1.00 34.31  ? 2110 HOH A O     1 
HETATM 4519 O O     . HOH CA 7 .   ? 25.754  33.923  -1.464  1.00 15.83  ? 2111 HOH A O     1 
HETATM 4520 O O     . HOH CA 7 .   ? 22.602  38.674  3.554   1.00 38.70  ? 2112 HOH A O     1 
HETATM 4521 O O     . HOH CA 7 .   ? 26.341  35.407  4.816   1.00 25.62  ? 2113 HOH A O     1 
HETATM 4522 O O     . HOH CA 7 .   ? 15.217  35.525  3.622   1.00 23.81  ? 2114 HOH A O     1 
HETATM 4523 O O     . HOH CA 7 .   ? 28.043  29.858  4.132   1.00 17.02  ? 2115 HOH A O     1 
HETATM 4524 O O     . HOH CA 7 .   ? 27.018  30.954  8.294   1.00 37.48  ? 2116 HOH A O     1 
HETATM 4525 O O     . HOH CA 7 .   ? 27.636  33.949  7.384   1.00 50.10  ? 2117 HOH A O     1 
HETATM 4526 O O     . HOH CA 7 .   ? 19.838  35.987  8.931   1.00 22.52  ? 2118 HOH A O     1 
HETATM 4527 O O     . HOH CA 7 .   ? 22.558  35.694  7.514   1.00 36.19  ? 2119 HOH A O     1 
HETATM 4528 O O     . HOH CA 7 .   ? 20.490  35.707  11.806  1.00 35.07  ? 2120 HOH A O     1 
HETATM 4529 O O     . HOH CA 7 .   ? 16.711  36.826  14.195  1.00 31.15  ? 2121 HOH A O     1 
HETATM 4530 O O     . HOH CA 7 .   ? 11.866  38.148  8.737   1.00 46.20  ? 2122 HOH A O     1 
HETATM 4531 O O     . HOH CA 7 .   ? 19.436  27.701  17.275  1.00 22.38  ? 2123 HOH A O     1 
HETATM 4532 O O     . HOH CA 7 .   ? 17.210  24.823  15.346  1.00 21.32  ? 2124 HOH A O     1 
HETATM 4533 O O     . HOH CA 7 .   ? 20.375  30.350  18.063  1.00 23.84  ? 2125 HOH A O     1 
HETATM 4534 O O     . HOH CA 7 .   ? 27.844  31.453  15.256  1.00 32.91  ? 2126 HOH A O     1 
HETATM 4535 O O     . HOH CA 7 .   ? 20.668  23.577  20.245  1.00 30.57  ? 2127 HOH A O     1 
HETATM 4536 O O     . HOH CA 7 .   ? 29.777  24.394  8.890   1.00 42.46  ? 2128 HOH A O     1 
HETATM 4537 O O     . HOH CA 7 .   ? 25.514  22.748  15.089  1.00 25.34  ? 2129 HOH A O     1 
HETATM 4538 O O     . HOH CA 7 .   ? 26.321  23.885  8.277   1.00 24.09  ? 2130 HOH A O     1 
HETATM 4539 O O     . HOH CA 7 .   ? 30.587  30.024  4.639   1.00 31.31  ? 2131 HOH A O     1 
HETATM 4540 O O     . HOH CA 7 .   ? 31.773  28.968  6.241   1.00 43.75  ? 2132 HOH A O     1 
HETATM 4541 O O     . HOH CA 7 .   ? 33.377  25.213  2.540   1.00 39.25  ? 2133 HOH A O     1 
HETATM 4542 O O     . HOH CA 7 .   ? 29.482  29.921  -0.249  1.00 29.22  ? 2134 HOH A O     1 
HETATM 4543 O O     . HOH CA 7 .   ? 26.410  21.220  -4.001  1.00 24.89  ? 2135 HOH A O     1 
HETATM 4544 O O     . HOH CA 7 .   ? 29.825  22.958  -3.040  1.00 18.37  ? 2136 HOH A O     1 
HETATM 4545 O O     . HOH CA 7 .   ? 21.619  28.035  -11.581 1.00 20.24  ? 2137 HOH A O     1 
HETATM 4546 O O     . HOH CA 7 .   ? 24.597  26.310  -12.692 1.00 34.80  ? 2138 HOH A O     1 
HETATM 4547 O O     . HOH CA 7 .   ? 27.648  31.509  -6.931  1.00 16.55  ? 2139 HOH A O     1 
HETATM 4548 O O     . HOH CA 7 .   ? 21.646  19.849  -12.947 1.00 32.68  ? 2140 HOH A O     1 
HETATM 4549 O O     . HOH CA 7 .   ? 17.451  26.315  -18.036 1.00 29.45  ? 2141 HOH A O     1 
HETATM 4550 O O     . HOH CA 7 .   ? 20.708  27.162  -17.799 1.00 32.01  ? 2142 HOH A O     1 
HETATM 4551 O O     . HOH CA 7 .   ? 19.533  30.697  -11.271 1.00 34.89  ? 2143 HOH A O     1 
HETATM 4552 O O     . HOH CA 7 .   ? 19.024  33.603  -11.832 1.00 48.95  ? 2144 HOH A O     1 
HETATM 4553 O O     . HOH CA 7 .   ? 11.092  26.317  -14.525 1.00 40.59  ? 2145 HOH A O     1 
HETATM 4554 O O     . HOH CA 7 .   ? 6.470   31.171  -5.998  1.00 40.79  ? 2146 HOH A O     1 
HETATM 4555 O O     . HOH CA 7 .   ? 5.617   29.192  1.294   1.00 26.66  ? 2147 HOH A O     1 
HETATM 4556 O O     . HOH CA 7 .   ? 2.839   22.148  0.602   1.00 22.82  ? 2148 HOH A O     1 
HETATM 4557 O O     . HOH CA 7 .   ? 3.922   27.450  -3.366  1.00 41.33  ? 2149 HOH A O     1 
HETATM 4558 O O     . HOH CA 7 .   ? 1.070   26.218  5.730   1.00 18.59  ? 2150 HOH A O     1 
HETATM 4559 O O     . HOH CA 7 .   ? -0.607  26.897  -2.340  1.00 40.81  ? 2151 HOH A O     1 
HETATM 4560 O O     . HOH CA 7 .   ? -0.283  30.386  -1.869  1.00 44.12  ? 2152 HOH A O     1 
HETATM 4561 O O     . HOH CA 7 .   ? -5.767  25.873  12.052  1.00 43.52  ? 2153 HOH A O     1 
HETATM 4562 O O     . HOH CA 7 .   ? 1.926   13.302  16.011  1.00 15.46  ? 2154 HOH A O     1 
HETATM 4563 O O     . HOH CA 7 .   ? 1.823   10.303  22.383  1.00 25.07  ? 2155 HOH A O     1 
HETATM 4564 O O     . HOH CA 7 .   ? 30.485  -15.574 -16.490 1.00 43.04  ? 2156 HOH A O     1 
HETATM 4565 O O     . HOH CA 7 .   ? 22.935  -24.811 -0.134  1.00 28.95  ? 2157 HOH A O     1 
HETATM 4566 O O     . HOH CA 7 .   ? 20.476  -26.217 3.073   1.00 26.87  ? 2158 HOH A O     1 
HETATM 4567 O O     . HOH CA 7 .   ? 18.161  -16.419 -9.043  1.00 39.71  ? 2159 HOH A O     1 
HETATM 4568 O O     . HOH CA 7 .   ? 8.845   -16.309 -4.837  1.00 36.09  ? 2160 HOH A O     1 
HETATM 4569 O O     . HOH CA 7 .   ? 6.351   -27.741 -3.274  1.00 32.39  ? 2161 HOH A O     1 
HETATM 4570 O O     . HOH CA 7 .   ? 4.982   -18.383 2.747   1.00 42.44  ? 2162 HOH A O     1 
HETATM 4571 O O     . HOH CA 7 .   ? 17.241  -12.481 -7.079  1.00 39.48  ? 2163 HOH A O     1 
HETATM 4572 O O     . HOH CA 7 .   ? 19.262  -1.849  26.083  1.00 35.84  ? 2164 HOH A O     1 
HETATM 4573 O O     . HOH CA 7 .   ? 14.799  -3.963  28.067  1.00 39.61  ? 2165 HOH A O     1 
HETATM 4574 O O     . HOH CA 7 .   ? 0.578   -8.371  6.689   1.00 38.06  ? 2166 HOH A O     1 
HETATM 4575 O O     . HOH CA 7 .   ? 12.446  5.522   29.647  1.00 51.71  ? 2167 HOH A O     1 
HETATM 4576 O O     . HOH CA 7 .   ? 9.351   -0.441  27.005  1.00 36.49  ? 2168 HOH A O     1 
HETATM 4577 O O     . HOH CA 7 .   ? 7.277   -3.705  21.779  1.00 41.10  ? 2169 HOH A O     1 
HETATM 4578 O O     . HOH CA 7 .   ? 10.278  -6.576  20.811  1.00 38.96  ? 2170 HOH A O     1 
HETATM 4579 O O     . HOH CA 7 .   ? 9.794   -3.956  20.798  1.00 22.19  ? 2171 HOH A O     1 
HETATM 4580 O O     . HOH CA 7 .   ? 7.099   1.296   26.456  1.00 31.48  ? 2172 HOH A O     1 
HETATM 4581 O O     . HOH CA 7 .   ? -7.740  -1.095  11.097  1.00 46.67  ? 2173 HOH A O     1 
HETATM 4582 O O     . HOH CA 7 .   ? -5.101  6.882   22.578  1.00 32.90  ? 2174 HOH A O     1 
HETATM 4583 O O     . HOH CA 7 .   ? -3.455  9.365   23.023  1.00 53.04  ? 2175 HOH A O     1 
HETATM 4584 O O     . HOH CA 7 .   ? 0.173   9.469   4.804   1.00 11.05  ? 2176 HOH A O     1 
HETATM 4585 O O     . HOH CA 7 .   ? 6.710   11.011  3.466   1.00 13.14  ? 2177 HOH A O     1 
HETATM 4586 O O     . HOH CA 7 .   ? 1.485   6.587   -0.554  1.00 38.26  ? 2178 HOH A O     1 
HETATM 4587 O O     . HOH CA 7 .   ? 2.459   3.775   1.383   1.00 22.80  ? 2179 HOH A O     1 
HETATM 4588 O O     . HOH CA 7 .   ? -3.784  16.278  2.755   1.00 22.13  ? 2180 HOH A O     1 
HETATM 4589 O O     . HOH CA 7 .   ? -11.668 11.971  18.667  1.00 53.26  ? 2181 HOH A O     1 
HETATM 4590 O O     . HOH CA 7 .   ? -9.011  13.570  21.930  1.00 42.40  ? 2182 HOH A O     1 
HETATM 4591 O O     . HOH CA 7 .   ? 3.442   12.740  30.812  1.00 47.17  ? 2183 HOH A O     1 
HETATM 4592 O O     . HOH CA 7 .   ? 11.909  7.883   28.017  1.00 35.26  ? 2184 HOH A O     1 
HETATM 4593 O O     . HOH CA 7 .   ? 7.600   7.188   27.146  1.00 41.73  ? 2185 HOH A O     1 
HETATM 4594 O O     . HOH CA 7 .   ? 21.456  22.355  20.834  1.00 28.69  ? 2186 HOH A O     1 
HETATM 4595 O O     . HOH CA 7 .   ? 20.408  18.206  14.552  1.00 11.00  ? 2187 HOH A O     1 
HETATM 4596 O O     . HOH CA 7 .   ? 20.779  15.510  18.640  1.00 29.28  ? 2188 HOH A O     1 
HETATM 4597 O O     . HOH CA 7 .   ? 8.288   33.093  -5.014  1.00 41.70  ? 2189 HOH A O     1 
HETATM 4598 O O     . HOH CA 7 .   ? 22.388  21.002  13.814  1.00 21.40  ? 2190 HOH A O     1 
HETATM 4599 O O     . HOH CA 7 .   ? 17.090  39.587  1.707   1.00 49.00  ? 2191 HOH A O     1 
HETATM 4600 O O     . HOH CA 7 .   ? 25.278  35.743  7.473   1.00 49.94  ? 2192 HOH A O     1 
HETATM 4601 O O     . HOH CA 7 .   ? 27.962  23.985  19.668  1.00 50.77  ? 2193 HOH A O     1 
HETATM 4602 O O     . HOH CA 7 .   ? 18.881  37.895  12.845  1.00 34.58  ? 2194 HOH A O     1 
HETATM 4603 O O     . HOH CA 7 .   ? 17.019  36.840  17.219  1.00 44.89  ? 2195 HOH A O     1 
HETATM 4604 O O     . HOH CA 7 .   ? 27.451  15.622  27.374  1.00 51.66  ? 2196 HOH A O     1 
HETATM 4605 O O     . HOH CA 7 .   ? 21.251  12.333  25.466  1.00 32.04  ? 2197 HOH A O     1 
HETATM 4606 O O     . HOH CA 7 .   ? 30.563  31.487  16.361  1.00 44.80  ? 2198 HOH A O     1 
HETATM 4607 O O     . HOH CA 7 .   ? 26.258  10.900  25.605  1.00 52.12  ? 2199 HOH A O     1 
HETATM 4608 O O     . HOH CA 7 .   ? 16.171  9.571   26.268  1.00 29.32  ? 2200 HOH A O     1 
HETATM 4609 O O     . HOH CA 7 .   ? 24.644  11.957  14.409  1.00 32.02  ? 2201 HOH A O     1 
HETATM 4610 O O     . HOH CA 7 .   ? 25.317  12.460  11.849  1.00 37.68  ? 2202 HOH A O     1 
HETATM 4611 O O     . HOH CA 7 .   ? 24.447  15.842  10.356  1.00 25.72  ? 2203 HOH A O     1 
HETATM 4612 O O     . HOH CA 7 .   ? 23.154  18.068  9.629   1.00 21.83  ? 2204 HOH A O     1 
HETATM 4613 O O     . HOH CA 7 .   ? 2.160   28.754  5.740   1.00 26.31  ? 2205 HOH A O     1 
HETATM 4614 O O     . HOH CA 7 .   ? -0.373  26.476  8.154   1.00 40.06  ? 2206 HOH A O     1 
HETATM 4615 O O     . HOH CA 7 .   ? 26.305  20.889  13.070  1.00 36.59  ? 2207 HOH A O     1 
HETATM 4616 O O     . HOH CA 7 .   ? 28.879  17.150  5.075   1.00 28.36  ? 2208 HOH A O     1 
HETATM 4617 O O     . HOH CA 7 .   ? 30.822  18.949  1.173   1.00 19.96  ? 2209 HOH A O     1 
HETATM 4618 O O     . HOH CA 7 .   ? 34.952  21.284  1.105   1.00 31.04  ? 2210 HOH A O     1 
HETATM 4619 O O     . HOH CA 7 .   ? 7.815   -8.149  21.018  1.00 42.96  ? 2211 HOH A O     1 
HETATM 4620 O O     . HOH CA 7 .   ? 29.075  20.630  -3.695  1.00 24.73  ? 2212 HOH A O     1 
HETATM 4621 O O     . HOH CA 7 .   ? 28.833  14.372  0.397   1.00 19.32  ? 2213 HOH A O     1 
HETATM 4622 O O     . HOH CA 7 .   ? 34.559  15.711  -4.014  1.00 20.05  ? 2214 HOH A O     1 
HETATM 4623 O O     . HOH CA 7 .   ? 28.597  16.124  -8.786  1.00 38.05  ? 2215 HOH A O     1 
HETATM 4624 O O     . HOH CA 7 .   ? 30.227  10.319  -10.797 1.00 40.66  ? 2216 HOH A O     1 
HETATM 4625 O O     . HOH CA 7 .   ? 22.355  13.055  -11.115 1.00 18.08  ? 2217 HOH A O     1 
HETATM 4626 O O     . HOH CA 7 .   ? 24.587  16.610  -10.234 1.00 35.86  ? 2218 HOH A O     1 
HETATM 4627 O O     . HOH CA 7 .   ? 21.172  21.838  23.697  1.00 38.36  ? 2219 HOH A O     1 
HETATM 4628 O O     . HOH CA 7 .   ? 15.840  16.192  -7.939  1.00 17.90  ? 2220 HOH A O     1 
HETATM 4629 O O     . HOH CA 7 .   ? 21.245  15.000  -12.488 1.00 33.36  ? 2221 HOH A O     1 
HETATM 4630 O O     . HOH CA 7 .   ? 14.661  10.100  -2.543  1.00 10.91  ? 2222 HOH A O     1 
HETATM 4631 O O     . HOH CA 7 .   ? 26.511  11.753  16.727  1.00 54.32  ? 2223 HOH A O     1 
HETATM 4632 O O     . HOH CA 7 .   ? 12.443  14.046  -9.707  1.00 40.66  ? 2224 HOH A O     1 
HETATM 4633 O O     . HOH CA 7 .   ? 28.378  22.028  12.172  1.00 38.30  ? 2225 HOH A O     1 
HETATM 4634 O O     . HOH CA 7 .   ? 3.744   13.435  -6.365  1.00 29.92  ? 2226 HOH A O     1 
HETATM 4635 O O     . HOH CA 7 .   ? 7.504   5.735   -5.021  1.00 14.28  ? 2227 HOH A O     1 
HETATM 4636 O O     . HOH CA 7 .   ? 1.443   17.120  0.132   1.00 25.97  ? 2228 HOH A O     1 
HETATM 4637 O O     . HOH CA 7 .   ? -0.288  17.712  -1.843  1.00 29.80  ? 2229 HOH A O     1 
HETATM 4638 O O     . HOH CA 7 .   ? -2.783  15.758  -2.103  1.00 36.03  ? 2230 HOH A O     1 
HETATM 4639 O O     . HOH CA 7 .   ? -0.236  10.055  -3.105  1.00 42.40  ? 2231 HOH A O     1 
HETATM 4640 O O     . HOH CA 7 .   ? 3.823   2.982   3.878   1.00 10.59  ? 2232 HOH A O     1 
HETATM 4641 O O     . HOH CA 7 .   ? 8.560   -5.968  14.684  1.00 22.99  ? 2233 HOH A O     1 
HETATM 4642 O O     . HOH CA 7 .   ? 8.476   -2.001  12.167  1.00 18.05  ? 2234 HOH A O     1 
HETATM 4643 O O     . HOH CA 7 .   ? 7.342   -3.638  14.203  1.00 15.99  ? 2235 HOH A O     1 
HETATM 4644 O O     . HOH CA 7 .   ? 18.161  -20.302 20.098  1.00 44.62  ? 2236 HOH A O     1 
HETATM 4645 O O     . HOH CA 7 .   ? 9.738   -7.700  16.848  1.00 32.73  ? 2237 HOH A O     1 
HETATM 4646 O O     . HOH CA 7 .   ? 15.819  -24.846 11.378  1.00 40.35  ? 2238 HOH A O     1 
HETATM 4647 O O     . HOH CA 7 .   ? 16.249  -25.536 7.117   1.00 33.97  ? 2239 HOH A O     1 
HETATM 4648 O O     . HOH CA 7 .   ? 14.773  -10.876 26.166  1.00 39.31  ? 2240 HOH A O     1 
HETATM 4649 O O     . HOH CA 7 .   ? 17.320  -16.412 23.368  1.00 46.92  ? 2241 HOH A O     1 
HETATM 4650 O O     . HOH CA 7 .   ? 21.503  -14.044 28.018  1.00 37.77  ? 2242 HOH A O     1 
HETATM 4651 O O     . HOH CA 7 .   ? 18.844  -17.613 27.351  1.00 52.99  ? 2243 HOH A O     1 
HETATM 4652 O O     . HOH CA 7 .   ? 27.332  -17.553 24.736  1.00 37.92  ? 2244 HOH A O     1 
HETATM 4653 O O     . HOH CA 7 .   ? 25.315  -14.988 24.577  1.00 30.65  ? 2245 HOH A O     1 
HETATM 4654 O O     . HOH CA 7 .   ? 20.560  -21.062 24.988  1.00 34.14  ? 2246 HOH A O     1 
HETATM 4655 O O     . HOH CA 7 .   ? 28.789  -27.436 24.827  1.00 59.47  ? 2247 HOH A O     1 
HETATM 4656 O O     . HOH CA 7 .   ? 27.530  0.390   21.175  1.00 35.01  ? 2248 HOH A O     1 
HETATM 4657 O O     . HOH CA 7 .   ? 23.607  -28.373 24.495  1.00 45.19  ? 2249 HOH A O     1 
HETATM 4658 O O     . HOH CA 7 .   ? 19.887  -21.712 20.369  1.00 53.91  ? 2250 HOH A O     1 
HETATM 4659 O O     . HOH CA 7 .   ? 19.533  -25.978 21.967  1.00 37.26  ? 2251 HOH A O     1 
HETATM 4660 O O     . HOH CA 7 .   ? 17.603  -23.641 13.086  1.00 21.52  ? 2252 HOH A O     1 
HETATM 4661 O O     . HOH CA 7 .   ? 23.414  -27.966 10.265  1.00 26.02  ? 2253 HOH A O     1 
HETATM 4662 O O     . HOH CA 7 .   ? 17.042  -26.163 9.389   1.00 29.36  ? 2254 HOH A O     1 
HETATM 4663 O O     . HOH CA 7 .   ? 20.503  -28.044 7.779   1.00 30.41  ? 2255 HOH A O     1 
HETATM 4664 O O     . HOH CA 7 .   ? 21.549  -20.571 8.809   1.00 17.20  ? 2256 HOH A O     1 
HETATM 4665 O O     . HOH CA 7 .   ? 21.400  -26.101 5.615   1.00 36.62  ? 2257 HOH A O     1 
HETATM 4666 O O     . HOH CA 7 .   ? 21.959  -20.236 6.113   1.00 18.52  ? 2258 HOH A O     1 
HETATM 4667 O O     . HOH CA 7 .   ? 14.610  -23.447 6.516   1.00 27.40  ? 2259 HOH A O     1 
HETATM 4668 O O     . HOH CA 7 .   ? 14.552  -26.230 -0.036  1.00 40.83  ? 2260 HOH A O     1 
HETATM 4669 O O     . HOH CA 7 .   ? 19.617  -14.557 -7.327  1.00 27.11  ? 2261 HOH A O     1 
HETATM 4670 O O     . HOH CA 7 .   ? 25.298  -9.133  -4.819  1.00 15.28  ? 2262 HOH A O     1 
HETATM 4671 O O     . HOH CA 7 .   ? 21.522  -13.230 -8.811  1.00 40.31  ? 2263 HOH A O     1 
HETATM 4672 O O     . HOH CA 7 .   ? 27.674  -7.770  -9.282  1.00 45.14  ? 2264 HOH A O     1 
HETATM 4673 O O     . HOH CA 7 .   ? 22.440  -13.027 -11.638 1.00 35.52  ? 2265 HOH A O     1 
HETATM 4674 O O     . HOH CA 7 .   ? 24.503  -6.981  -10.071 1.00 34.84  ? 2266 HOH A O     1 
HETATM 4675 O O     . HOH CA 7 .   ? 28.717  4.619   -12.094 1.00 33.25  ? 2267 HOH A O     1 
HETATM 4676 O O     . HOH CA 7 .   ? 12.989  -5.135  -3.497  1.00 35.30  ? 2268 HOH A O     1 
HETATM 4677 O O     . HOH CA 7 .   ? 14.416  -1.280  -5.243  1.00 28.99  ? 2269 HOH A O     1 
HETATM 4678 O O     . HOH CA 7 .   ? 20.643  -1.552  0.713   1.00 15.64  ? 2270 HOH A O     1 
HETATM 4679 O O     . HOH CA 7 .   ? 19.413  -0.338  -6.171  1.00 32.47  ? 2271 HOH A O     1 
HETATM 4680 O O     . HOH CA 7 .   ? 12.005  -5.492  -6.255  1.00 39.33  ? 2272 HOH A O     1 
HETATM 4681 O O     . HOH CA 7 .   ? 19.575  -6.253  -9.540  1.00 36.46  ? 2273 HOH A O     1 
HETATM 4682 O O     . HOH CA 7 .   ? -2.471  -8.283  3.397   1.00 47.56  ? 2274 HOH A O     1 
HETATM 4683 O O     . HOH CA 7 .   ? 10.050  -5.451  0.371   1.00 20.60  ? 2275 HOH A O     1 
HETATM 4684 O O     . HOH CA 7 .   ? 6.769   -6.559  -0.841  1.00 28.05  ? 2276 HOH A O     1 
HETATM 4685 O O     . HOH CA 7 .   ? 6.561   -6.176  5.715   1.00 25.74  ? 2277 HOH A O     1 
HETATM 4686 O O     . HOH CA 7 .   ? 8.364   -10.786 10.693  1.00 39.85  ? 2278 HOH A O     1 
HETATM 4687 O O     . HOH CA 7 .   ? 7.423   -9.480  12.601  1.00 38.53  ? 2279 HOH A O     1 
HETATM 4688 O O     . HOH CA 7 .   ? 10.878  -6.300  2.988   1.00 14.86  ? 2280 HOH A O     1 
HETATM 4689 O O     . HOH CA 7 .   ? 9.963   -9.292  6.158   1.00 19.49  ? 2281 HOH A O     1 
HETATM 4690 O O     . HOH CA 7 .   ? 30.496  0.543   18.202  1.00 31.40  ? 2282 HOH A O     1 
HETATM 4691 O O     . HOH CA 7 .   ? 19.201  -1.931  3.086   1.00 17.50  ? 2283 HOH A O     1 
HETATM 4692 O O     . HOH CA 7 .   ? 26.399  1.605   5.832   1.00 11.98  ? 2284 HOH A O     1 
HETATM 4693 O O     . HOH CA 7 .   ? 27.139  -1.821  10.583  1.00 10.63  ? 2285 HOH A O     1 
HETATM 4694 O O     . HOH CA 7 .   ? 29.052  6.389   16.168  1.00 30.92  ? 2286 HOH A O     1 
HETATM 4695 O O     . HOH CA 7 .   ? 28.452  2.411   15.168  1.00 13.47  ? 2287 HOH A O     1 
HETATM 4696 O O     . HOH CA 7 .   ? 28.461  8.043   11.306  1.00 36.36  ? 2288 HOH A O     1 
HETATM 4697 O O     . HOH CA 7 .   ? 20.172  5.931   17.165  1.00 12.86  ? 2289 HOH A O     1 
HETATM 4698 O O     . HOH CA 7 .   ? 30.432  7.043   18.402  1.00 48.49  ? 2290 HOH A O     1 
HETATM 4699 O O     . HOH CA 7 .   ? 25.807  2.535   22.386  1.00 36.45  ? 2291 HOH A O     1 
HETATM 4700 O O     . HOH CA 7 .   ? 24.550  -9.383  26.108  1.00 51.36  ? 2292 HOH A O     1 
HETATM 4701 O O     . HOH CA 7 .   ? 30.036  0.184   20.520  1.00 47.62  ? 2293 HOH A O     1 
HETATM 4702 O O     . HOH CA 7 .   ? 27.966  10.896  11.163  1.00 45.45  ? 2294 HOH A O     1 
HETATM 4703 O O     . HOH CA 7 .   ? 30.280  11.846  0.423   1.00 33.22  ? 2295 HOH A O     1 
HETATM 4704 O O     . HOH CA 7 .   ? 22.029  0.815   0.094   1.00 14.16  ? 2296 HOH A O     1 
HETATM 4705 O O     . HOH CA 7 .   ? 40.364  -14.937 2.318   1.00 41.68  ? 2297 HOH A O     1 
HETATM 4706 O O     . HOH CA 7 .   ? 38.246  -21.474 1.687   1.00 47.29  ? 2298 HOH A O     1 
HETATM 4707 O O     . HOH CA 7 .   ? 14.703  1.081   -1.342  1.00 18.43  ? 2299 HOH A O     1 
HETATM 4708 O O     . HOH CA 7 .   ? 10.870  6.489   2.473   1.00 10.58  ? 2300 HOH A O     1 
HETATM 4709 O O     . HOH CA 7 .   ? 31.314  -27.515 -2.820  1.00 45.96  ? 2301 HOH A O     1 
HETATM 4710 O O     . HOH CA 7 .   ? 22.193  -26.361 -1.809  1.00 33.60  ? 2302 HOH A O     1 
HETATM 4711 O O     . HOH CA 7 .   ? 33.414  -30.517 14.961  1.00 46.28  ? 2303 HOH A O     1 
HETATM 4712 O O     . HOH CA 7 .   ? 17.753  6.862   28.118  1.00 38.76  ? 2304 HOH A O     1 
HETATM 4713 O O     . HOH CA 7 .   ? 22.507  6.155   25.864  1.00 35.43  ? 2305 HOH A O     1 
HETATM 4714 O O     . HOH CA 7 .   ? 21.783  3.398   24.481  1.00 31.07  ? 2306 HOH A O     1 
HETATM 4715 O O     . HOH CA 7 .   ? 25.588  -0.744  19.607  1.00 17.68  ? 2307 HOH A O     1 
HETATM 4716 O O     . HOH CA 7 .   ? 26.930  0.763   23.983  1.00 42.00  ? 2308 HOH A O     1 
HETATM 4717 O O     . HOH CA 7 .   ? 20.443  -0.110  27.209  1.00 32.86  ? 2309 HOH A O     1 
HETATM 4718 O O     . HOH CA 7 .   ? 45.359  -13.212 26.075  1.00 44.54  ? 2310 HOH A O     1 
HETATM 4719 O O     . HOH CA 7 .   ? 25.610  -7.720  21.158  1.00 18.24  ? 2311 HOH A O     1 
HETATM 4720 O O     . HOH CA 7 .   ? 10.570  0.034   5.681   1.00 10.53  ? 2312 HOH A O     1 
HETATM 4721 O O     . HOH CA 7 .   ? 6.964   -5.550  10.442  1.00 21.31  ? 2313 HOH A O     1 
HETATM 4722 O O     . HOH CA 7 .   ? 8.876   0.029   -0.116  1.00 15.55  ? 2314 HOH A O     1 
HETATM 4723 O O     . HOH CA 7 .   ? 16.413  0.079   -6.643  1.00 35.93  ? 2315 HOH A O     1 
HETATM 4724 O O     . HOH CA 7 .   ? 10.131  3.369   -11.462 1.00 27.54  ? 2316 HOH A O     1 
HETATM 4725 O O     . HOH CA 7 .   ? 18.578  2.369   -7.804  1.00 22.35  ? 2317 HOH A O     1 
HETATM 4726 O O     . HOH CA 7 .   ? 21.723  0.861   -8.163  1.00 35.78  ? 2318 HOH A O     1 
HETATM 4727 O O     . HOH CA 7 .   ? 19.605  3.501   -11.703 1.00 34.60  ? 2319 HOH A O     1 
HETATM 4728 O O     . HOH CA 7 .   ? 24.215  0.622   -1.701  1.00 15.05  ? 2320 HOH A O     1 
HETATM 4729 O O     . HOH CA 7 .   ? 27.265  6.710   -10.987 1.00 24.19  ? 2321 HOH A O     1 
HETATM 4730 O O     . HOH CA 7 .   ? 22.952  8.126   -13.021 1.00 47.83  ? 2322 HOH A O     1 
HETATM 4731 O O     . HOH CA 7 .   ? 25.749  1.453   -10.877 1.00 31.98  ? 2323 HOH A O     1 
HETATM 4732 O O     . HOH CA 7 .   ? 32.625  3.473   -5.787  1.00 32.73  ? 2324 HOH A O     1 
HETATM 4733 O O     . HOH CA 7 .   ? 31.504  0.263   1.860   1.00 11.59  ? 2325 HOH A O     1 
HETATM 4734 O O     . HOH CA 7 .   ? 32.345  9.368   -0.913  1.00 41.27  ? 2326 HOH A O     1 
HETATM 4735 O O     . HOH CA 7 .   ? 35.279  7.163   -1.137  1.00 41.18  ? 2327 HOH A O     1 
HETATM 4736 O O     . HOH CA 7 .   ? 30.903  3.409   -10.076 1.00 38.17  ? 2328 HOH A O     1 
HETATM 4737 O O     . HOH CA 7 .   ? 12.938  11.022  -12.950 1.00 22.63  ? 2329 HOH A O     1 
HETATM 4738 O O     . HOH CA 7 .   ? 11.395  8.002   -13.339 1.00 41.52  ? 2330 HOH A O     1 
HETATM 4739 O O     . HOH CA 7 .   ? 10.080  -0.876  -5.619  1.00 27.84  ? 2331 HOH A O     1 
HETATM 4740 O O     . HOH CA 7 .   ? 0.415   -0.426  -3.911  1.00 42.92  ? 2332 HOH A O     1 
HETATM 4741 O O     . HOH CA 7 .   ? 4.758   -6.132  -2.580  1.00 23.46  ? 2333 HOH A O     1 
HETATM 4742 O O     . HOH CA 7 .   ? -1.068  -7.107  1.257   1.00 42.45  ? 2334 HOH A O     1 
HETATM 4743 O O     . HOH CA 7 .   ? -1.521  -2.448  -1.955  1.00 36.40  ? 2335 HOH A O     1 
HETATM 4744 O O     . HOH CA 7 .   ? -4.081  -2.921  1.812   1.00 44.70  ? 2336 HOH A O     1 
HETATM 4745 O O     . HOH CA 7 .   ? -3.598  0.432   -0.295  1.00 40.96  ? 2337 HOH A O     1 
HETATM 4746 O O     . HOH CA 7 .   ? 2.707   -6.549  7.475   1.00 30.25  ? 2338 HOH A O     1 
HETATM 4747 O O     . HOH CA 7 .   ? -1.665  -7.453  6.130   1.00 22.48  ? 2339 HOH A O     1 
HETATM 4748 O O     . HOH CA 7 .   ? -6.045  -0.824  6.235   1.00 39.36  ? 2340 HOH A O     1 
HETATM 4749 O O     . HOH CA 7 .   ? 8.551   -7.487  4.179   1.00 22.50  ? 2341 HOH A O     1 
HETATM 4750 O O     . HOH CA 7 .   ? 7.058   -7.364  8.176   1.00 35.41  ? 2342 HOH A O     1 
HETATM 4751 O O     . HOH CA 7 .   ? 10.317  -10.208 10.089  1.00 17.33  ? 2343 HOH A O     1 
HETATM 4752 O O     . HOH CA 7 .   ? 8.542   -7.017  12.310  1.00 20.05  ? 2344 HOH A O     1 
HETATM 4753 O O     . HOH CA 7 .   ? 28.607  -0.096  16.438  1.00 14.70  ? 2345 HOH A O     1 
HETATM 4754 O O     . HOH CA 7 .   ? 32.724  -5.171  11.484  1.00 13.12  ? 2346 HOH A O     1 
HETATM 4755 O O     . HOH CA 7 .   ? 32.918  -0.195  17.330  1.00 28.96  ? 2347 HOH A O     1 
HETATM 4756 O O     . HOH CA 7 .   ? 35.913  3.620   8.130   1.00 31.01  ? 2348 HOH A O     1 
HETATM 4757 O O     . HOH CA 7 .   ? 45.814  -5.285  11.881  1.00 41.80  ? 2349 HOH A O     1 
HETATM 4758 O O     . HOH CA 7 .   ? 45.709  -7.682  13.532  1.00 29.11  ? 2350 HOH A O     1 
HETATM 4759 O O     . HOH CA 7 .   ? 40.880  -15.472 8.849   1.00 27.36  ? 2351 HOH A O     1 
HETATM 4760 O O     . HOH CA 7 .   ? 42.962  -2.627  18.798  1.00 44.97  ? 2352 HOH A O     1 
HETATM 4761 O O     . HOH CA 7 .   ? 33.488  -10.443 15.531  1.00 18.27  ? 2353 HOH A O     1 
HETATM 4762 O O     . HOH CA 7 .   ? 33.062  -9.835  12.787  1.00 22.60  ? 2354 HOH A O     1 
HETATM 4763 O O     . HOH CA 7 .   ? 39.164  -7.405  8.592   1.00 26.31  ? 2355 HOH A O     1 
HETATM 4764 O O     . HOH CA 7 .   ? 36.677  -12.855 25.083  1.00 25.50  ? 2356 HOH A O     1 
HETATM 4765 O O     . HOH CA 7 .   ? 30.059  -10.085 24.279  1.00 34.22  ? 2357 HOH A O     1 
HETATM 4766 O O     . HOH CA 7 .   ? 25.832  -8.666  23.620  1.00 25.43  ? 2358 HOH A O     1 
HETATM 4767 O O     . HOH CA 7 .   ? 12.361  -15.326 15.369  1.00 36.39  ? 2359 HOH A O     1 
HETATM 4768 O O     . HOH CA 7 .   ? 7.910   -9.854  17.243  1.00 36.33  ? 2360 HOH A O     1 
HETATM 4769 O O     . HOH CA 7 .   ? 3.264   -17.137 14.107  1.00 31.45  ? 2361 HOH A O     1 
HETATM 4770 O O     . HOH CA 7 .   ? 8.558   -11.896 8.219   1.00 30.64  ? 2362 HOH A O     1 
HETATM 4771 O O     . HOH CA 7 .   ? 0.604   -19.288 8.128   1.00 43.42  ? 2363 HOH A O     1 
HETATM 4772 O O     . HOH CA 7 .   ? 28.751  -10.828 6.425   1.00 47.42  ? 2364 HOH A O     1 
HETATM 4773 O O     . HOH CA 7 .   ? 27.248  -7.309  0.374   1.00 9.29   ? 2365 HOH A O     1 
HETATM 4774 O O     . HOH CA 7 .   ? 37.270  -5.174  5.544   1.00 33.38  ? 2366 HOH A O     1 
HETATM 4775 O O     . HOH CA 7 .   ? 37.051  -2.707  4.591   1.00 31.68  ? 2367 HOH A O     1 
HETATM 4776 O O     . HOH CA 7 .   ? 40.709  -4.122  10.125  1.00 51.00  ? 2368 HOH A O     1 
HETATM 4777 O O     . HOH CA 7 .   ? 36.423  -9.215  4.050   1.00 33.07  ? 2369 HOH A O     1 
HETATM 4778 O O     . HOH CA 7 .   ? 36.963  -12.513 4.192   1.00 24.10  ? 2370 HOH A O     1 
HETATM 4779 O O     . HOH CA 7 .   ? 38.716  -15.192 6.963   1.00 30.29  ? 2371 HOH A O     1 
HETATM 4780 O O     . HOH CA 7 .   ? 40.161  -14.083 5.114   1.00 52.48  ? 2372 HOH A O     1 
HETATM 4781 O O     . HOH CA 7 .   ? 39.247  -8.921  6.218   1.00 41.81  ? 2373 HOH A O     1 
HETATM 4782 O O     . HOH CA 7 .   ? 38.312  -19.035 2.015   1.00 39.23  ? 2374 HOH A O     1 
HETATM 4783 O O     . HOH CA 7 .   ? 36.493  -11.324 -0.608  1.00 37.07  ? 2375 HOH A O     1 
HETATM 4784 O O     . HOH CA 7 .   ? 37.220  -12.824 -2.313  1.00 32.66  ? 2376 HOH A O     1 
HETATM 4785 O O     . HOH CA 7 .   ? 12.329  -17.709 15.934  1.00 41.51  ? 2377 HOH A O     1 
HETATM 4786 O O     . HOH CA 7 .   ? 32.264  -7.001  -2.843  1.00 26.51  ? 2378 HOH A O     1 
HETATM 4787 O O     . HOH CA 7 .   ? 34.577  -11.233 -8.302  1.00 35.45  ? 2379 HOH A O     1 
HETATM 4788 O O     . HOH CA 7 .   ? 36.027  -12.385 -6.626  1.00 31.26  ? 2380 HOH A O     1 
HETATM 4789 O O     . HOH CA 7 .   ? 39.350  -17.590 -1.576  1.00 46.03  ? 2381 HOH A O     1 
HETATM 4790 O O     . HOH CA 7 .   ? 28.688  -26.062 -7.609  1.00 50.44  ? 2382 HOH A O     1 
HETATM 4791 O O     . HOH CA 7 .   ? 31.895  -25.426 -4.099  1.00 37.04  ? 2383 HOH A O     1 
HETATM 4792 O O     . HOH CA 7 .   ? 35.038  -22.223 1.463   1.00 25.50  ? 2384 HOH A O     1 
HETATM 4793 O O     . HOH CA 7 .   ? 35.893  -22.155 -1.560  1.00 41.67  ? 2385 HOH A O     1 
HETATM 4794 O O     . HOH CA 7 .   ? 25.348  -23.674 0.823   1.00 33.92  ? 2386 HOH A O     1 
HETATM 4795 O O     . HOH CA 7 .   ? 24.043  -27.539 -3.430  1.00 40.47  ? 2387 HOH A O     1 
HETATM 4796 O O     . HOH CA 7 .   ? 28.306  -28.800 -3.635  1.00 43.81  ? 2388 HOH A O     1 
HETATM 4797 O O     . HOH CA 7 .   ? 26.128  -25.960 -7.176  1.00 39.68  ? 2389 HOH A O     1 
HETATM 4798 O O     . HOH CA 7 .   ? 32.203  -27.730 0.427   1.00 23.21  ? 2390 HOH A O     1 
HETATM 4799 O O     . HOH CA 7 .   ? 35.585  -24.142 -2.578  1.00 42.98  ? 2391 HOH A O     1 
HETATM 4800 O O     . HOH CA 7 .   ? 22.512  -29.908 8.619   1.00 22.68  ? 2392 HOH A O     1 
HETATM 4801 O O     . HOH CA 7 .   ? 32.253  -33.494 4.470   1.00 45.96  ? 2393 HOH A O     1 
HETATM 4802 O O     . HOH CA 7 .   ? 32.796  -28.176 17.181  1.00 26.43  ? 2394 HOH A O     1 
HETATM 4803 O O     . HOH CA 7 .   ? 31.341  -29.790 19.065  1.00 39.26  ? 2395 HOH A O     1 
HETATM 4804 O O     . HOH CA 7 .   ? 26.331  -32.456 16.856  1.00 36.54  ? 2396 HOH A O     1 
HETATM 4805 O O     . HOH CA 7 .   ? 35.197  -28.116 18.458  1.00 39.90  ? 2397 HOH A O     1 
HETATM 4806 O O     . HOH CA 7 .   ? 36.582  -31.100 15.178  1.00 44.38  ? 2398 HOH A O     1 
HETATM 4807 O O     . HOH CA 7 .   ? 43.215  -11.845 22.479  1.00 40.20  ? 2399 HOH A O     1 
HETATM 4808 O O     . HOH CA 7 .   ? 47.028  -18.533 19.278  1.00 37.63  ? 2400 HOH A O     1 
HETATM 4809 O O     . HOH CA 7 .   ? 47.217  -20.924 22.353  1.00 39.35  ? 2401 HOH A O     1 
HETATM 4810 O O     . HOH CA 7 .   ? 48.561  -21.629 20.343  1.00 44.90  ? 2402 HOH A O     1 
HETATM 4811 O O     . HOH CA 7 .   ? 41.151  -18.518 24.867  1.00 42.58  ? 2403 HOH A O     1 
HETATM 4812 O O     . HOH CA 7 .   ? 45.526  -24.645 13.899  1.00 40.94  ? 2404 HOH A O     1 
HETATM 4813 O O     . HOH CA 7 .   ? 48.441  -17.725 14.046  1.00 38.19  ? 2405 HOH A O     1 
HETATM 4814 O O     . HOH CA 7 .   ? 50.118  -21.187 14.050  1.00 46.55  ? 2406 HOH A O     1 
HETATM 4815 O O     . HOH CA 7 .   ? 49.381  -23.730 13.952  1.00 54.24  ? 2407 HOH A O     1 
HETATM 4816 O O     . HOH CA 7 .   ? 45.578  -11.875 23.373  1.00 44.29  ? 2408 HOH A O     1 
HETATM 4817 O O     . HOH CA 7 .   ? 47.018  -14.959 27.058  1.00 39.81  ? 2409 HOH A O     1 
HETATM 4818 O O     . HOH CA 7 .   ? 50.233  -18.307 15.817  1.00 44.39  ? 2410 HOH A O     1 
HETATM 4819 O O     . HOH CA 7 .   ? 38.657  -17.721 5.586   1.00 16.88  ? 2411 HOH A O     1 
HETATM 4820 O O     . HOH CA 7 .   ? 41.871  -27.018 5.126   1.00 24.36  ? 2412 HOH A O     1 
HETATM 4821 O O     . HOH CA 7 .   ? 42.395  -26.907 11.863  1.00 30.85  ? 2413 HOH A O     1 
HETATM 4822 O O     . HOH CA 7 .   ? 35.412  -26.787 -0.043  1.00 41.35  ? 2414 HOH A O     1 
HETATM 4823 O O     . HOH CA 7 .   ? 41.605  -31.597 5.761   1.00 41.55  ? 2415 HOH A O     1 
HETATM 4824 O O     . HOH CA 7 .   ? 32.496  -4.204  -1.916  1.00 21.66  ? 2416 HOH A O     1 
HETATM 4825 O O     . HOH CA 7 .   ? 28.481  30.982  22.040  1.00 53.20  ? 2417 HOH A O     1 
HETATM 4826 O O     . HOH CA 7 .   ? 24.114  -31.676 19.487  1.00 45.28  ? 2418 HOH A O     1 
HETATM 4827 O O     . HOH CA 7 .   ? 34.379  -1.215  19.478  1.00 43.73  ? 2419 HOH A O     1 
HETATM 4828 O O     . HOH CA 7 .   ? 19.660  10.897  29.025  1.00 56.36  ? 2420 HOH A O     1 
HETATM 4829 O O     . HOH CA 7 .   ? 33.857  5.082   8.714   1.00 33.06  ? 2421 HOH A O     1 
HETATM 4830 O O     . HOH CA 7 .   ? 30.758  33.090  6.053   1.00 40.93  ? 2422 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   446 ?   ?   ?   A . n 
A 1 2   SER 2   447 ?   ?   ?   A . n 
A 1 3   SER 3   448 ?   ?   ?   A . n 
A 1 4   PRO 4   449 ?   ?   ?   A . n 
A 1 5   ASP 5   450 450 ASP ASP A . n 
A 1 6   LYS 6   451 451 LYS LYS A . n 
A 1 7   LYS 7   452 452 LYS LYS A . n 
A 1 8   TRP 8   453 453 TRP TRP A . n 
A 1 9   LEU 9   454 454 LEU LEU A . n 
A 1 10  GLY 10  455 455 GLY GLY A . n 
A 1 11  THR 11  456 456 THR THR A . n 
A 1 12  PRO 12  457 457 PRO PRO A . n 
A 1 13  ILE 13  458 458 ILE ILE A . n 
A 1 14  GLU 14  459 459 GLU GLU A . n 
A 1 15  GLU 15  460 460 GLU GLU A . n 
A 1 16  MET 16  461 461 MET MET A . n 
A 1 17  ARG 17  462 462 ARG ARG A . n 
A 1 18  ARG 18  463 463 ARG ARG A . n 
A 1 19  MET 19  464 464 MET MET A . n 
A 1 20  PRO 20  465 465 PRO PRO A . n 
A 1 21  ARG 21  466 466 ARG ARG A . n 
A 1 22  CYS 22  467 467 CYS CYS A . n 
A 1 23  GLY 23  468 468 GLY GLY A . n 
A 1 24  ILE 24  469 469 ILE ILE A . n 
A 1 25  ARG 25  470 470 ARG ARG A . n 
A 1 26  LEU 26  471 471 LEU LEU A . n 
A 1 27  PRO 27  472 472 PRO PRO A . n 
A 1 28  LEU 28  473 473 LEU LEU A . n 
A 1 29  LEU 29  474 474 LEU LEU A . n 
A 1 30  ARG 30  475 475 ARG ARG A . n 
A 1 31  PRO 31  476 476 PRO PRO A . n 
A 1 32  SER 32  477 477 SER SER A . n 
A 1 33  ALA 33  478 478 ALA ALA A . n 
A 1 34  ASN 34  479 479 ASN ASN A . n 
A 1 35  HIS 35  480 480 HIS HIS A . n 
A 1 36  THR 36  481 481 THR THR A . n 
A 1 37  VAL 37  482 482 VAL VAL A . n 
A 1 38  THR 38  483 483 THR THR A . n 
A 1 39  ILE 39  484 484 ILE ILE A . n 
A 1 40  ARG 40  485 485 ARG ARG A . n 
A 1 41  VAL 41  486 486 VAL VAL A . n 
A 1 42  ASP 42  487 487 ASP ASP A . n 
A 1 43  LEU 43  488 488 LEU LEU A . n 
A 1 44  LEU 44  489 489 LEU LEU A . n 
A 1 45  ARG 45  490 490 ARG ARG A . n 
A 1 46  ALA 46  491 491 ALA ALA A . n 
A 1 47  GLY 47  492 492 GLY GLY A . n 
A 1 48  GLU 48  493 493 GLU GLU A . n 
A 1 49  VAL 49  494 494 VAL VAL A . n 
A 1 50  PRO 50  495 495 PRO PRO A . n 
A 1 51  LYS 51  496 496 LYS LYS A . n 
A 1 52  PRO 52  497 497 PRO PRO A . n 
A 1 53  PHE 53  498 498 PHE PHE A . n 
A 1 54  PRO 54  499 499 PRO PRO A . n 
A 1 55  THR 55  500 500 THR THR A . n 
A 1 56  HIS 56  501 501 HIS HIS A . n 
A 1 57  TYR 57  502 502 TYR TYR A . n 
A 1 58  LYS 58  503 503 LYS LYS A . n 
A 1 59  ASP 59  504 504 ASP ASP A . n 
A 1 60  LEU 60  505 505 LEU LEU A . n 
A 1 61  TRP 61  506 506 TRP TRP A . n 
A 1 62  ASP 62  507 507 ASP ASP A . n 
A 1 63  ASN 63  508 508 ASN ASN A . n 
A 1 64  LYS 64  509 509 LYS LYS A . n 
A 1 65  HIS 65  510 510 HIS HIS A . n 
A 1 66  VAL 66  511 511 VAL VAL A . n 
A 1 67  LYS 67  512 512 LYS LYS A . n 
A 1 68  MET 68  513 513 MET MET A . n 
A 1 69  PRO 69  514 514 PRO PRO A . n 
A 1 70  CYS 70  515 515 CYS CYS A . n 
A 1 71  SER 71  516 516 SER SER A . n 
A 1 72  GLU 72  517 517 GLU GLU A . n 
A 1 73  GLN 73  518 518 GLN GLN A . n 
A 1 74  ASN 74  519 519 ASN ASN A . n 
A 1 75  LEU 75  520 520 LEU LEU A . n 
A 1 76  TYR 76  521 521 TYR TYR A . n 
A 1 77  PRO 77  522 522 PRO PRO A . n 
A 1 78  VAL 78  523 523 VAL VAL A . n 
A 1 79  GLU 79  524 ?   ?   ?   A . n 
A 1 80  ASP 80  525 ?   ?   ?   A . n 
A 1 81  GLU 81  526 ?   ?   ?   A . n 
A 1 82  ASN 82  527 ?   ?   ?   A . n 
A 1 83  GLY 83  528 ?   ?   ?   A . n 
A 1 84  GLU 84  529 ?   ?   ?   A . n 
A 1 85  ARG 85  530 ?   ?   ?   A . n 
A 1 86  THR 86  531 ?   ?   ?   A . n 
A 1 87  ALA 87  532 532 ALA ALA A . n 
A 1 88  GLY 88  533 533 GLY GLY A . n 
A 1 89  SER 89  534 534 SER SER A . n 
A 1 90  ARG 90  535 535 ARG ARG A . n 
A 1 91  TRP 91  536 536 TRP TRP A . n 
A 1 92  GLU 92  537 537 GLU GLU A . n 
A 1 93  LEU 93  538 538 LEU LEU A . n 
A 1 94  ILE 94  539 539 ILE ILE A . n 
A 1 95  GLN 95  540 540 GLN GLN A . n 
A 1 96  THR 96  541 541 THR THR A . n 
A 1 97  ALA 97  542 542 ALA ALA A . n 
A 1 98  LEU 98  543 543 LEU LEU A . n 
A 1 99  LEU 99  544 544 LEU LEU A . n 
A 1 100 ASN 100 545 545 ASN ASN A . n 
A 1 101 LYS 101 546 546 LYS LYS A . n 
A 1 102 PHE 102 547 547 PHE PHE A . n 
A 1 103 THR 103 548 548 THR THR A . n 
A 1 104 ARG 104 549 549 ARG ARG A . n 
A 1 105 PRO 105 550 550 PRO PRO A . n 
A 1 106 GLN 106 551 551 GLN GLN A . n 
A 1 107 ASN 107 552 552 ASN ASN A . n 
A 1 108 LEU 108 553 553 LEU LEU A . n 
A 1 109 LYS 109 554 554 LYS LYS A . n 
A 1 110 ASP 110 555 555 ASP ASP A . n 
A 1 111 ALA 111 556 556 ALA ALA A . n 
A 1 112 ILE 112 557 557 ILE ILE A . n 
A 1 113 LEU 113 558 558 LEU LEU A . n 
A 1 114 LYS 114 559 559 LYS LYS A . n 
A 1 115 TYR 115 560 560 TYR TYR A . n 
A 1 116 ASN 116 561 561 ASN ASN A . n 
A 1 117 VAL 117 562 562 VAL VAL A . n 
A 1 118 ALA 118 563 563 ALA ALA A . n 
A 1 119 TYR 119 564 564 TYR TYR A . n 
A 1 120 SER 120 565 565 SER SER A . n 
A 1 121 LYS 121 566 566 LYS LYS A . n 
A 1 122 LYS 122 567 567 LYS LYS A . n 
A 1 123 TRP 123 568 568 TRP TRP A . n 
A 1 124 ASP 124 569 569 ASP ASP A . n 
A 1 125 PHE 125 570 570 PHE PHE A . n 
A 1 126 THR 126 571 571 THR THR A . n 
A 1 127 ALA 127 572 572 ALA ALA A . n 
A 1 128 LEU 128 573 573 LEU LEU A . n 
A 1 129 ILE 129 574 574 ILE ILE A . n 
A 1 130 ASP 130 575 575 ASP ASP A . n 
A 1 131 PHE 131 576 576 PHE PHE A . n 
A 1 132 TRP 132 577 577 TRP TRP A . n 
A 1 133 ASP 133 578 578 ASP ASP A . n 
A 1 134 LYS 134 579 579 LYS LYS A . n 
A 1 135 VAL 135 580 580 VAL VAL A . n 
A 1 136 LEU 136 581 581 LEU LEU A . n 
A 1 137 GLU 137 582 582 GLU GLU A . n 
A 1 138 GLU 138 583 583 GLU GLU A . n 
A 1 139 ALA 139 584 584 ALA ALA A . n 
A 1 140 GLU 140 585 585 GLU GLU A . n 
A 1 141 ALA 141 586 586 ALA ALA A . n 
A 1 142 GLN 142 587 587 GLN GLN A . n 
A 1 143 HIS 143 588 588 HIS HIS A . n 
A 1 144 LEU 144 589 589 LEU LEU A . n 
A 1 145 TYR 145 590 590 TYR TYR A . n 
A 1 146 GLN 146 591 591 GLN GLN A . n 
A 1 147 SER 147 592 592 SER SER A . n 
A 1 148 ILE 148 593 593 ILE ILE A . n 
A 1 149 LEU 149 594 594 LEU LEU A . n 
A 1 150 PRO 150 595 595 PRO PRO A . n 
A 1 151 ASP 151 596 596 ASP ASP A . n 
A 1 152 MET 152 597 597 MET MET A . n 
A 1 153 VAL 153 598 598 VAL VAL A . n 
A 1 154 LYS 154 599 599 LYS LYS A . n 
A 1 155 ILE 155 600 600 ILE ILE A . n 
A 1 156 ALA 156 601 601 ALA ALA A . n 
A 1 157 LEU 157 602 602 LEU LEU A . n 
A 1 158 CYS 158 603 603 CYS CYS A . n 
A 1 159 LEU 159 604 604 LEU LEU A . n 
A 1 160 PRO 160 605 605 PRO PRO A . n 
A 1 161 ASN 161 606 606 ASN ASN A . n 
A 1 162 ILE 162 607 607 ILE ILE A . n 
A 1 163 CYS 163 608 608 CYS CYS A . n 
A 1 164 THR 164 609 609 THR THR A . n 
A 1 165 GLN 165 610 610 GLN GLN A . n 
A 1 166 PRO 166 611 611 PRO PRO A . n 
A 1 167 ILE 167 612 612 ILE ILE A . n 
A 1 168 PRO 168 613 613 PRO PRO A . n 
A 1 169 LEU 169 614 614 LEU LEU A . n 
A 1 170 LEU 170 615 615 LEU LEU A . n 
A 1 171 ALA 171 616 616 ALA ALA A . n 
A 1 172 ALA 172 617 617 ALA ALA A . n 
A 1 173 ALA 173 618 618 ALA ALA A . n 
A 1 174 MET 174 619 619 MET MET A . n 
A 1 175 ASN 175 620 620 ASN ASN A . n 
A 1 176 HIS 176 621 621 HIS HIS A . n 
A 1 177 SER 177 622 622 SER SER A . n 
A 1 178 ILE 178 623 623 ILE ILE A . n 
A 1 179 THR 179 624 624 THR THR A . n 
A 1 180 MET 180 625 625 MET MET A . n 
A 1 181 SER 181 626 626 SER SER A . n 
A 1 182 GLN 182 627 627 GLN GLN A . n 
A 1 183 GLU 183 628 628 GLU GLU A . n 
A 1 184 GLN 184 629 629 GLN GLN A . n 
A 1 185 ILE 185 630 630 ILE ILE A . n 
A 1 186 ALA 186 631 631 ALA ALA A . n 
A 1 187 SER 187 632 632 SER SER A . n 
A 1 188 LEU 188 633 633 LEU LEU A . n 
A 1 189 LEU 189 634 634 LEU LEU A . n 
A 1 190 ALA 190 635 635 ALA ALA A . n 
A 1 191 ASN 191 636 636 ASN ASN A . n 
A 1 192 ALA 192 637 637 ALA ALA A . n 
A 1 193 PHE 193 638 638 PHE PHE A . n 
A 1 194 PHE 194 639 639 PHE PHE A . n 
A 1 195 CYS 195 640 640 CYS CYS A . n 
A 1 196 THR 196 641 641 THR THR A . n 
A 1 197 PHE 197 642 642 PHE PHE A . n 
A 1 198 PRO 198 643 643 PRO PRO A . n 
A 1 199 ARG 199 644 644 ARG ARG A . n 
A 1 200 ARG 200 645 645 ARG ARG A . n 
A 1 201 ASN 201 646 646 ASN ASN A . n 
A 1 202 ALA 202 647 647 ALA ALA A . n 
A 1 203 LYS 203 648 648 LYS LYS A . n 
A 1 204 MET 204 649 649 MET MET A . n 
A 1 205 LYS 205 650 650 LYS LYS A . n 
A 1 206 SER 206 651 651 SER SER A . n 
A 1 207 GLU 207 652 652 GLU GLU A . n 
A 1 208 TYR 208 653 653 TYR TYR A . n 
A 1 209 SER 209 654 654 SER SER A . n 
A 1 210 SER 210 655 655 SER SER A . n 
A 1 211 TYR 211 656 656 TYR TYR A . n 
A 1 212 PRO 212 657 657 PRO PRO A . n 
A 1 213 ASP 213 658 658 ASP ASP A . n 
A 1 214 ILE 214 659 659 ILE ILE A . n 
A 1 215 ASN 215 660 660 ASN ASN A . n 
A 1 216 PHE 216 661 661 PHE PHE A . n 
A 1 217 ASN 217 662 662 ASN ASN A . n 
A 1 218 ARG 218 663 663 ARG ARG A . n 
A 1 219 LEU 219 664 664 LEU LEU A . n 
A 1 220 PHE 220 665 665 PHE PHE A . n 
A 1 221 GLU 221 666 666 GLU GLU A . n 
A 1 222 GLY 222 667 667 GLY GLY A . n 
A 1 223 ARG 223 668 668 ARG ARG A . n 
A 1 224 SER 224 669 669 SER SER A . n 
A 1 225 SER 225 670 670 SER SER A . n 
A 1 226 ARG 226 671 671 ARG ARG A . n 
A 1 227 LYS 227 672 672 LYS LYS A . n 
A 1 228 PRO 228 673 673 PRO PRO A . n 
A 1 229 GLU 229 674 674 GLU GLU A . n 
A 1 230 LYS 230 675 675 LYS LYS A . n 
A 1 231 LEU 231 676 676 LEU LEU A . n 
A 1 232 LYS 232 677 677 LYS LYS A . n 
A 1 233 THR 233 678 678 THR THR A . n 
A 1 234 LEU 234 679 679 LEU LEU A . n 
A 1 235 PHE 235 680 680 PHE PHE A . n 
A 1 236 CYS 236 681 681 CYS CYS A . n 
A 1 237 TYR 237 682 682 TYR TYR A . n 
A 1 238 PHE 238 683 683 PHE PHE A . n 
A 1 239 ARG 239 684 684 ARG ARG A . n 
A 1 240 ARG 240 685 685 ARG ARG A . n 
A 1 241 VAL 241 686 686 VAL VAL A . n 
A 1 242 THR 242 687 687 THR THR A . n 
A 1 243 ALA 243 688 688 ALA ALA A . n 
A 1 244 ALA 244 689 689 ALA ALA A . n 
A 1 245 ALA 245 690 690 ALA ALA A . n 
A 1 246 PRO 246 691 691 PRO PRO A . n 
A 1 247 THR 247 692 692 THR THR A . n 
A 1 248 GLY 248 693 693 GLY GLY A . n 
A 1 249 LEU 249 694 694 LEU LEU A . n 
A 1 250 VAL 250 695 695 VAL VAL A . n 
A 1 251 THR 251 696 696 THR THR A . n 
A 1 252 PHE 252 697 697 PHE PHE A . n 
A 1 253 THR 253 698 698 THR THR A . n 
A 1 254 ARG 254 699 699 ARG ARG A . n 
A 1 255 GLN 255 700 700 GLN GLN A . n 
A 1 256 SER 256 701 701 SER SER A . n 
A 1 257 LEU 257 702 702 LEU LEU A . n 
A 1 258 GLU 258 703 703 GLU GLU A . n 
A 1 259 ASP 259 704 704 ASP ASP A . n 
A 1 260 PHE 260 705 705 PHE PHE A . n 
A 1 261 PRO 261 706 706 PRO PRO A . n 
A 1 262 GLU 262 707 707 GLU GLU A . n 
A 1 263 TRP 263 708 708 TRP TRP A . n 
A 1 264 GLU 264 709 709 GLU GLU A . n 
A 1 265 ARG 265 710 710 ARG ARG A . n 
A 1 266 CYS 266 711 711 CYS CYS A . n 
A 1 267 GLU 267 712 712 GLU GLU A . n 
A 1 268 LYS 268 713 713 LYS LYS A . n 
A 1 269 PRO 269 714 714 PRO PRO A . n 
A 1 270 LEU 270 715 715 LEU LEU A . n 
A 1 271 THR 271 716 716 THR THR A . n 
A 1 272 ARG 272 717 717 ARG ARG A . n 
A 1 273 LEU 273 718 718 LEU LEU A . n 
A 1 274 HIS 274 719 719 HIS HIS A . n 
A 1 275 VAL 275 720 720 VAL VAL A . n 
A 1 276 THR 276 721 721 THR THR A . n 
A 1 277 TYR 277 722 722 TYR TYR A . n 
A 1 278 GLU 278 723 723 GLU GLU A . n 
A 1 279 GLY 279 724 724 GLY GLY A . n 
A 1 280 THR 280 725 725 THR THR A . n 
A 1 281 ILE 281 726 726 ILE ILE A . n 
A 1 282 GLU 282 727 727 GLU GLU A . n 
A 1 283 GLU 283 728 728 GLU GLU A . n 
A 1 284 ASN 284 729 729 ASN ASN A . n 
A 1 285 GLY 285 730 730 GLY GLY A . n 
A 1 286 GLN 286 731 731 GLN GLN A . n 
A 1 287 GLY 287 732 732 GLY GLY A . n 
A 1 288 MET 288 733 733 MET MET A . n 
A 1 289 LEU 289 734 734 LEU LEU A . n 
A 1 290 GLN 290 735 735 GLN GLN A . n 
A 1 291 VAL 291 736 736 VAL VAL A . n 
A 1 292 ASP 292 737 737 ASP ASP A . n 
A 1 293 PHE 293 738 738 PHE PHE A . n 
A 1 294 ALA 294 739 739 ALA ALA A . n 
A 1 295 ASN 295 740 740 ASN ASN A . n 
A 1 296 ARG 296 741 741 ARG ARG A . n 
A 1 297 PHE 297 742 742 PHE PHE A . n 
A 1 298 VAL 298 743 743 VAL VAL A . n 
A 1 299 GLY 299 744 744 GLY GLY A . n 
A 1 300 GLY 300 745 745 GLY GLY A . n 
A 1 301 GLY 301 746 746 GLY GLY A . n 
A 1 302 VAL 302 747 747 VAL VAL A . n 
A 1 303 THR 303 748 748 THR THR A . n 
A 1 304 SER 304 749 749 SER SER A . n 
A 1 305 ALA 305 750 750 ALA ALA A . n 
A 1 306 GLY 306 751 751 GLY GLY A . n 
A 1 307 LEU 307 752 752 LEU LEU A . n 
A 1 308 VAL 308 753 753 VAL VAL A . n 
A 1 309 GLN 309 754 754 GLN GLN A . n 
A 1 310 GLU 310 755 755 GLU GLU A . n 
A 1 311 ASN 311 756 756 ASN ASN A . n 
A 1 312 ILE 312 757 757 ILE ILE A . n 
A 1 313 ARG 313 758 758 ARG ARG A . n 
A 1 314 PHE 314 759 759 PHE PHE A . n 
A 1 315 LEU 315 760 760 LEU LEU A . n 
A 1 316 ILE 316 761 761 ILE ILE A . n 
A 1 317 ASN 317 762 762 ASN ASN A . n 
A 1 318 PRO 318 763 763 PRO PRO A . n 
A 1 319 GLU 319 764 764 GLU GLU A . n 
A 1 320 LEU 320 765 765 LEU LEU A . n 
A 1 321 ILE 321 766 766 ILE ILE A . n 
A 1 322 ILE 322 767 767 ILE ILE A . n 
A 1 323 SER 323 768 768 SER SER A . n 
A 1 324 ARG 324 769 769 ARG ARG A . n 
A 1 325 LEU 325 770 770 LEU LEU A . n 
A 1 326 PHE 326 771 771 PHE PHE A . n 
A 1 327 THR 327 772 772 THR THR A . n 
A 1 328 GLU 328 773 773 GLU GLU A . n 
A 1 329 VAL 329 774 774 VAL VAL A . n 
A 1 330 LEU 330 775 775 LEU LEU A . n 
A 1 331 ASP 331 776 776 ASP ASP A . n 
A 1 332 HIS 332 777 777 HIS HIS A . n 
A 1 333 ASN 333 778 778 ASN ASN A . n 
A 1 334 GLU 334 779 779 GLU GLU A . n 
A 1 335 CYS 335 780 780 CYS CYS A . n 
A 1 336 LEU 336 781 781 LEU LEU A . n 
A 1 337 ILE 337 782 782 ILE ILE A . n 
A 1 338 ILE 338 783 783 ILE ILE A . n 
A 1 339 THR 339 784 784 THR THR A . n 
A 1 340 GLY 340 785 785 GLY GLY A . n 
A 1 341 THR 341 786 786 THR THR A . n 
A 1 342 GLU 342 787 787 GLU GLU A . n 
A 1 343 GLN 343 788 788 GLN GLN A . n 
A 1 344 TYR 344 789 789 TYR TYR A . n 
A 1 345 SER 345 790 790 SER SER A . n 
A 1 346 GLU 346 791 791 GLU GLU A . n 
A 1 347 TYR 347 792 792 TYR TYR A . n 
A 1 348 THR 348 793 793 THR THR A . n 
A 1 349 GLY 349 794 794 GLY GLY A . n 
A 1 350 TYR 350 795 795 TYR TYR A . n 
A 1 351 ALA 351 796 796 ALA ALA A . n 
A 1 352 GLU 352 797 797 GLU GLU A . n 
A 1 353 THR 353 798 798 THR THR A . n 
A 1 354 TYR 354 799 799 TYR TYR A . n 
A 1 355 ARG 355 800 800 ARG ARG A . n 
A 1 356 TRP 356 801 801 TRP TRP A . n 
A 1 357 SER 357 802 802 SER SER A . n 
A 1 358 ARG 358 803 803 ARG ARG A . n 
A 1 359 SER 359 804 804 SER SER A . n 
A 1 360 HIS 360 805 805 HIS HIS A . n 
A 1 361 GLU 361 806 806 GLU GLU A . n 
A 1 362 ASP 362 807 807 ASP ASP A . n 
A 1 363 GLY 363 808 808 GLY GLY A . n 
A 1 364 SER 364 809 809 SER SER A . n 
A 1 365 GLU 365 810 810 GLU GLU A . n 
A 1 366 ARG 366 811 811 ARG ARG A . n 
A 1 367 ASP 367 812 812 ASP ASP A . n 
A 1 368 ASP 368 813 813 ASP ASP A . n 
A 1 369 TRP 369 814 814 TRP TRP A . n 
A 1 370 GLN 370 815 815 GLN GLN A . n 
A 1 371 ARG 371 816 816 ARG ARG A . n 
A 1 372 ARG 372 817 817 ARG ARG A . n 
A 1 373 CYS 373 818 818 CYS CYS A . n 
A 1 374 THR 374 819 819 THR THR A . n 
A 1 375 GLU 375 820 820 GLU GLU A . n 
A 1 376 ILE 376 821 821 ILE ILE A . n 
A 1 377 VAL 377 822 822 VAL VAL A . n 
A 1 378 ALA 378 823 823 ALA ALA A . n 
A 1 379 ILE 379 824 824 ILE ILE A . n 
A 1 380 ASP 380 825 825 ASP ASP A . n 
A 1 381 ALA 381 826 826 ALA ALA A . n 
A 1 382 LEU 382 827 827 LEU LEU A . n 
A 1 383 HIS 383 828 828 HIS HIS A . n 
A 1 384 PHE 384 829 829 PHE PHE A . n 
A 1 385 ARG 385 830 830 ARG ARG A . n 
A 1 386 ARG 386 831 831 ARG ARG A . n 
A 1 387 TYR 387 832 832 TYR TYR A . n 
A 1 388 LEU 388 833 833 LEU LEU A . n 
A 1 389 ASP 389 834 834 ASP ASP A . n 
A 1 390 GLN 390 835 835 GLN GLN A . n 
A 1 391 PHE 391 836 836 PHE PHE A . n 
A 1 392 VAL 392 837 837 VAL VAL A . n 
A 1 393 PRO 393 838 838 PRO PRO A . n 
A 1 394 GLU 394 839 839 GLU GLU A . n 
A 1 395 LYS 395 840 840 LYS LYS A . n 
A 1 396 MET 396 841 841 MET MET A . n 
A 1 397 ARG 397 842 842 ARG ARG A . n 
A 1 398 ARG 398 843 843 ARG ARG A . n 
A 1 399 GLU 399 844 844 GLU GLU A . n 
A 1 400 LEU 400 845 845 LEU LEU A . n 
A 1 401 ASN 401 846 846 ASN ASN A . n 
A 1 402 LYS 402 847 847 LYS LYS A . n 
A 1 403 ALA 403 848 848 ALA ALA A . n 
A 1 404 TYR 404 849 849 TYR TYR A . n 
A 1 405 CYS 405 850 850 CYS CYS A . n 
A 1 406 GLY 406 851 851 GLY GLY A . n 
A 1 407 PHE 407 852 852 PHE PHE A . n 
A 1 408 LEU 408 853 853 LEU LEU A . n 
A 1 409 ARG 409 854 854 ARG ARG A . n 
A 1 410 PRO 410 855 855 PRO PRO A . n 
A 1 411 GLY 411 856 856 GLY GLY A . n 
A 1 412 VAL 412 857 857 VAL VAL A . n 
A 1 413 SER 413 858 858 SER SER A . n 
A 1 414 SER 414 859 859 SER SER A . n 
A 1 415 GLU 415 860 860 GLU GLU A . n 
A 1 416 ASN 416 861 861 ASN ASN A . n 
A 1 417 LEU 417 862 862 LEU LEU A . n 
A 1 418 SER 418 863 863 SER SER A . n 
A 1 419 ALA 419 864 864 ALA ALA A . n 
A 1 420 VAL 420 865 865 VAL VAL A . n 
A 1 421 ALA 421 866 866 ALA ALA A . n 
A 1 422 THR 422 867 867 THR THR A . n 
A 1 423 GLY 423 868 868 GLY GLY A . n 
A 1 424 ASN 424 869 869 ASN ASN A . n 
A 1 425 TRP 425 870 870 TRP TRP A . n 
A 1 426 GLY 426 871 871 GLY GLY A . n 
A 1 427 CYS 427 872 872 CYS CYS A . n 
A 1 428 GLY 428 873 873 GLY GLY A . n 
A 1 429 ALA 429 874 874 ALA ALA A . n 
A 1 430 PHE 430 875 875 PHE PHE A . n 
A 1 431 GLY 431 876 876 GLY GLY A . n 
A 1 432 GLY 432 877 877 GLY GLY A . n 
A 1 433 ASP 433 878 878 ASP ASP A . n 
A 1 434 ALA 434 879 879 ALA ALA A . n 
A 1 435 ARG 435 880 880 ARG ARG A . n 
A 1 436 LEU 436 881 881 LEU LEU A . n 
A 1 437 LYS 437 882 882 LYS LYS A . n 
A 1 438 ALA 438 883 883 ALA ALA A . n 
A 1 439 LEU 439 884 884 LEU LEU A . n 
A 1 440 ILE 440 885 885 ILE ILE A . n 
A 1 441 GLN 441 886 886 GLN GLN A . n 
A 1 442 ILE 442 887 887 ILE ILE A . n 
A 1 443 LEU 443 888 888 LEU LEU A . n 
A 1 444 ALA 444 889 889 ALA ALA A . n 
A 1 445 ALA 445 890 890 ALA ALA A . n 
A 1 446 ALA 446 891 891 ALA ALA A . n 
A 1 447 ALA 447 892 892 ALA ALA A . n 
A 1 448 ALA 448 893 893 ALA ALA A . n 
A 1 449 GLU 449 894 894 GLU GLU A . n 
A 1 450 ARG 450 895 895 ARG ARG A . n 
A 1 451 ASP 451 896 896 ASP ASP A . n 
A 1 452 VAL 452 897 897 VAL VAL A . n 
A 1 453 VAL 453 898 898 VAL VAL A . n 
A 1 454 TYR 454 899 899 TYR TYR A . n 
A 1 455 PHE 455 900 900 PHE PHE A . n 
A 1 456 THR 456 901 901 THR THR A . n 
A 1 457 PHE 457 902 902 PHE PHE A . n 
A 1 458 GLY 458 903 903 GLY GLY A . n 
A 1 459 ASP 459 904 904 ASP ASP A . n 
A 1 460 SER 460 905 905 SER SER A . n 
A 1 461 GLU 461 906 906 GLU GLU A . n 
A 1 462 LEU 462 907 907 LEU LEU A . n 
A 1 463 MET 463 908 908 MET MET A . n 
A 1 464 ARG 464 909 909 ARG ARG A . n 
A 1 465 ASP 465 910 910 ASP ASP A . n 
A 1 466 ILE 466 911 911 ILE ILE A . n 
A 1 467 TYR 467 912 912 TYR TYR A . n 
A 1 468 SER 468 913 913 SER SER A . n 
A 1 469 MET 469 914 914 MET MET A . n 
A 1 470 HIS 470 915 915 HIS HIS A . n 
A 1 471 ILE 471 916 916 ILE ILE A . n 
A 1 472 PHE 472 917 917 PHE PHE A . n 
A 1 473 LEU 473 918 918 LEU LEU A . n 
A 1 474 THR 474 919 919 THR THR A . n 
A 1 475 GLU 475 920 920 GLU GLU A . n 
A 1 476 ARG 476 921 921 ARG ARG A . n 
A 1 477 LYS 477 922 922 LYS LYS A . n 
A 1 478 LEU 478 923 923 LEU LEU A . n 
A 1 479 THR 479 924 924 THR THR A . n 
A 1 480 VAL 480 925 925 VAL VAL A . n 
A 1 481 GLY 481 926 926 GLY GLY A . n 
A 1 482 ASP 482 927 927 ASP ASP A . n 
A 1 483 VAL 483 928 928 VAL VAL A . n 
A 1 484 TYR 484 929 929 TYR TYR A . n 
A 1 485 LYS 485 930 930 LYS LYS A . n 
A 1 486 LEU 486 931 931 LEU LEU A . n 
A 1 487 LEU 487 932 932 LEU LEU A . n 
A 1 488 LEU 488 933 933 LEU LEU A . n 
A 1 489 ARG 489 934 934 ARG ARG A . n 
A 1 490 TYR 490 935 935 TYR TYR A . n 
A 1 491 TYR 491 936 936 TYR TYR A . n 
A 1 492 ASN 492 937 937 ASN ASN A . n 
A 1 493 GLU 493 938 938 GLU GLU A . n 
A 1 494 GLU 494 939 939 GLU GLU A . n 
A 1 495 CYS 495 940 940 CYS CYS A . n 
A 1 496 ARG 496 941 941 ARG ARG A . n 
A 1 497 ASN 497 942 942 ASN ASN A . n 
A 1 498 CYS 498 943 943 CYS CYS A . n 
A 1 499 SER 499 944 944 SER SER A . n 
A 1 500 THR 500 945 945 THR THR A . n 
A 1 501 PRO 501 946 946 PRO PRO A . n 
A 1 502 GLY 502 947 947 GLY GLY A . n 
A 1 503 PRO 503 948 948 PRO PRO A . n 
A 1 504 ASP 504 949 949 ASP ASP A . n 
A 1 505 ILE 505 950 950 ILE ILE A . n 
A 1 506 LYS 506 951 951 LYS LYS A . n 
A 1 507 LEU 507 952 952 LEU LEU A . n 
A 1 508 TYR 508 953 953 TYR TYR A . n 
A 1 509 PRO 509 954 954 PRO PRO A . n 
A 1 510 PHE 510 955 955 PHE PHE A . n 
A 1 511 ILE 511 956 956 ILE ILE A . n 
A 1 512 TYR 512 957 957 TYR TYR A . n 
A 1 513 HIS 513 958 958 HIS HIS A . n 
A 1 514 ALA 514 959 959 ALA ALA A . n 
A 1 515 VAL 515 960 960 VAL VAL A . n 
A 1 516 GLU 516 961 961 GLU GLU A . n 
A 1 517 SER 517 962 962 SER SER A . n 
A 1 518 CYS 518 963 963 CYS CYS A . n 
A 1 519 ALA 519 964 ?   ?   ?   A . n 
A 1 520 GLU 520 965 ?   ?   ?   A . n 
A 1 521 THR 521 966 ?   ?   ?   A . n 
A 1 522 ALA 522 967 ?   ?   ?   A . n 
A 1 523 ASP 523 968 ?   ?   ?   A . n 
A 1 524 HIS 524 969 ?   ?   ?   A . n 
A 1 525 SER 525 970 ?   ?   ?   A . n 
A 1 526 GLY 526 971 ?   ?   ?   A . n 
A 1 527 GLN 527 972 ?   ?   ?   A . n 
A 1 528 ARG 528 973 ?   ?   ?   A . n 
A 1 529 THR 529 974 ?   ?   ?   A . n 
A 1 530 GLY 530 975 ?   ?   ?   A . n 
A 1 531 THR 531 976 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B  2 AR6 1   1964 1964 AR6 AR6 A . 
C  2 AR6 1   1965 1965 AR6 AR6 A . 
D  3 BME 1   1966 1966 BME BME A . 
E  4 SO4 1   1967 1967 SO4 SO4 A . 
F  4 SO4 1   1968 1968 SO4 SO4 A . 
G  4 SO4 1   1969 1969 SO4 SO4 A . 
H  4 SO4 1   1970 1970 SO4 SO4 A . 
I  4 SO4 1   1971 1971 SO4 SO4 A . 
J  4 SO4 1   1972 1972 SO4 SO4 A . 
K  4 SO4 1   1973 1973 SO4 SO4 A . 
L  5 GOL 1   1974 1974 GOL GOL A . 
M  5 GOL 1   1975 1975 GOL GOL A . 
N  5 GOL 1   1976 1976 GOL GOL A . 
O  5 GOL 1   1977 1977 GOL GOL A . 
P  5 GOL 1   1978 1978 GOL GOL A . 
Q  5 GOL 1   1979 1979 GOL GOL A . 
R  5 GOL 1   1980 1980 GOL GOL A . 
S  5 GOL 1   1981 1981 GOL GOL A . 
T  5 GOL 1   1982 1982 GOL GOL A . 
U  5 GOL 1   1983 1983 GOL GOL A . 
V  5 GOL 1   1984 1984 GOL GOL A . 
W  6 PPI 1   1985 1985 PPI PPI A . 
X  6 PPI 1   1986 1986 PPI PPI A . 
Y  6 PPI 1   1987 1987 PPI PPI A . 
Z  6 PPI 1   1988 1988 PPI PPI A . 
AA 6 PPI 1   1989 1989 PPI PPI A . 
BA 6 PPI 1   1990 1990 PPI PPI A . 
CA 7 HOH 1   2001 2001 HOH HOH A . 
CA 7 HOH 2   2002 2002 HOH HOH A . 
CA 7 HOH 3   2003 2003 HOH HOH A . 
CA 7 HOH 4   2004 2004 HOH HOH A . 
CA 7 HOH 5   2005 2005 HOH HOH A . 
CA 7 HOH 6   2006 2006 HOH HOH A . 
CA 7 HOH 7   2007 2007 HOH HOH A . 
CA 7 HOH 8   2008 2008 HOH HOH A . 
CA 7 HOH 9   2009 2009 HOH HOH A . 
CA 7 HOH 10  2010 2010 HOH HOH A . 
CA 7 HOH 11  2011 2011 HOH HOH A . 
CA 7 HOH 12  2012 2012 HOH HOH A . 
CA 7 HOH 13  2013 2013 HOH HOH A . 
CA 7 HOH 14  2014 2014 HOH HOH A . 
CA 7 HOH 15  2015 2015 HOH HOH A . 
CA 7 HOH 16  2016 2016 HOH HOH A . 
CA 7 HOH 17  2017 2017 HOH HOH A . 
CA 7 HOH 18  2018 2018 HOH HOH A . 
CA 7 HOH 19  2019 2019 HOH HOH A . 
CA 7 HOH 20  2020 2020 HOH HOH A . 
CA 7 HOH 21  2021 2021 HOH HOH A . 
CA 7 HOH 22  2022 2022 HOH HOH A . 
CA 7 HOH 23  2023 2023 HOH HOH A . 
CA 7 HOH 24  2024 2024 HOH HOH A . 
CA 7 HOH 25  2025 2025 HOH HOH A . 
CA 7 HOH 26  2026 2026 HOH HOH A . 
CA 7 HOH 27  2027 2027 HOH HOH A . 
CA 7 HOH 28  2028 2028 HOH HOH A . 
CA 7 HOH 29  2029 2029 HOH HOH A . 
CA 7 HOH 30  2030 2030 HOH HOH A . 
CA 7 HOH 31  2031 2031 HOH HOH A . 
CA 7 HOH 32  2032 2032 HOH HOH A . 
CA 7 HOH 33  2033 2033 HOH HOH A . 
CA 7 HOH 34  2034 2034 HOH HOH A . 
CA 7 HOH 35  2035 2035 HOH HOH A . 
CA 7 HOH 36  2036 2036 HOH HOH A . 
CA 7 HOH 37  2037 2037 HOH HOH A . 
CA 7 HOH 38  2038 2038 HOH HOH A . 
CA 7 HOH 39  2039 2039 HOH HOH A . 
CA 7 HOH 40  2040 2040 HOH HOH A . 
CA 7 HOH 41  2041 2041 HOH HOH A . 
CA 7 HOH 42  2042 2042 HOH HOH A . 
CA 7 HOH 43  2043 2043 HOH HOH A . 
CA 7 HOH 44  2044 2044 HOH HOH A . 
CA 7 HOH 45  2045 2045 HOH HOH A . 
CA 7 HOH 46  2046 2046 HOH HOH A . 
CA 7 HOH 47  2047 2047 HOH HOH A . 
CA 7 HOH 48  2048 2048 HOH HOH A . 
CA 7 HOH 49  2049 2049 HOH HOH A . 
CA 7 HOH 50  2050 2050 HOH HOH A . 
CA 7 HOH 51  2051 2051 HOH HOH A . 
CA 7 HOH 52  2052 2052 HOH HOH A . 
CA 7 HOH 53  2053 2053 HOH HOH A . 
CA 7 HOH 54  2054 2054 HOH HOH A . 
CA 7 HOH 55  2055 2055 HOH HOH A . 
CA 7 HOH 56  2056 2056 HOH HOH A . 
CA 7 HOH 57  2057 2057 HOH HOH A . 
CA 7 HOH 58  2058 2058 HOH HOH A . 
CA 7 HOH 59  2059 2059 HOH HOH A . 
CA 7 HOH 60  2060 2060 HOH HOH A . 
CA 7 HOH 61  2061 2061 HOH HOH A . 
CA 7 HOH 62  2062 2062 HOH HOH A . 
CA 7 HOH 63  2063 2063 HOH HOH A . 
CA 7 HOH 64  2064 2064 HOH HOH A . 
CA 7 HOH 65  2065 2065 HOH HOH A . 
CA 7 HOH 66  2066 2066 HOH HOH A . 
CA 7 HOH 67  2067 2067 HOH HOH A . 
CA 7 HOH 68  2068 2068 HOH HOH A . 
CA 7 HOH 69  2069 2069 HOH HOH A . 
CA 7 HOH 70  2070 2070 HOH HOH A . 
CA 7 HOH 71  2071 2071 HOH HOH A . 
CA 7 HOH 72  2072 2072 HOH HOH A . 
CA 7 HOH 73  2073 2073 HOH HOH A . 
CA 7 HOH 74  2074 2074 HOH HOH A . 
CA 7 HOH 75  2075 2075 HOH HOH A . 
CA 7 HOH 76  2076 2076 HOH HOH A . 
CA 7 HOH 77  2077 2077 HOH HOH A . 
CA 7 HOH 78  2078 2078 HOH HOH A . 
CA 7 HOH 79  2079 2079 HOH HOH A . 
CA 7 HOH 80  2080 2080 HOH HOH A . 
CA 7 HOH 81  2081 2081 HOH HOH A . 
CA 7 HOH 82  2082 2082 HOH HOH A . 
CA 7 HOH 83  2083 2083 HOH HOH A . 
CA 7 HOH 84  2084 2084 HOH HOH A . 
CA 7 HOH 85  2085 2085 HOH HOH A . 
CA 7 HOH 86  2086 2086 HOH HOH A . 
CA 7 HOH 87  2087 2087 HOH HOH A . 
CA 7 HOH 88  2088 2088 HOH HOH A . 
CA 7 HOH 89  2089 2089 HOH HOH A . 
CA 7 HOH 90  2090 2090 HOH HOH A . 
CA 7 HOH 91  2091 2091 HOH HOH A . 
CA 7 HOH 92  2092 2092 HOH HOH A . 
CA 7 HOH 93  2093 2093 HOH HOH A . 
CA 7 HOH 94  2094 2094 HOH HOH A . 
CA 7 HOH 95  2095 2095 HOH HOH A . 
CA 7 HOH 96  2096 2096 HOH HOH A . 
CA 7 HOH 97  2097 2097 HOH HOH A . 
CA 7 HOH 98  2098 2098 HOH HOH A . 
CA 7 HOH 99  2099 2099 HOH HOH A . 
CA 7 HOH 100 2100 2100 HOH HOH A . 
CA 7 HOH 101 2101 2101 HOH HOH A . 
CA 7 HOH 102 2102 2102 HOH HOH A . 
CA 7 HOH 103 2103 2103 HOH HOH A . 
CA 7 HOH 104 2104 2104 HOH HOH A . 
CA 7 HOH 105 2105 2105 HOH HOH A . 
CA 7 HOH 106 2106 2106 HOH HOH A . 
CA 7 HOH 107 2107 2107 HOH HOH A . 
CA 7 HOH 108 2108 2108 HOH HOH A . 
CA 7 HOH 109 2109 2109 HOH HOH A . 
CA 7 HOH 110 2110 2110 HOH HOH A . 
CA 7 HOH 111 2111 2111 HOH HOH A . 
CA 7 HOH 112 2112 2112 HOH HOH A . 
CA 7 HOH 113 2113 2113 HOH HOH A . 
CA 7 HOH 114 2114 2114 HOH HOH A . 
CA 7 HOH 115 2115 2115 HOH HOH A . 
CA 7 HOH 116 2116 2116 HOH HOH A . 
CA 7 HOH 117 2117 2117 HOH HOH A . 
CA 7 HOH 118 2118 2118 HOH HOH A . 
CA 7 HOH 119 2119 2119 HOH HOH A . 
CA 7 HOH 120 2120 2120 HOH HOH A . 
CA 7 HOH 121 2121 2121 HOH HOH A . 
CA 7 HOH 122 2122 2122 HOH HOH A . 
CA 7 HOH 123 2123 2123 HOH HOH A . 
CA 7 HOH 124 2124 2124 HOH HOH A . 
CA 7 HOH 125 2125 2125 HOH HOH A . 
CA 7 HOH 126 2126 2126 HOH HOH A . 
CA 7 HOH 127 2127 2127 HOH HOH A . 
CA 7 HOH 128 2128 2128 HOH HOH A . 
CA 7 HOH 129 2129 2129 HOH HOH A . 
CA 7 HOH 130 2130 2130 HOH HOH A . 
CA 7 HOH 131 2131 2131 HOH HOH A . 
CA 7 HOH 132 2132 2132 HOH HOH A . 
CA 7 HOH 133 2133 2133 HOH HOH A . 
CA 7 HOH 134 2134 2134 HOH HOH A . 
CA 7 HOH 135 2135 2135 HOH HOH A . 
CA 7 HOH 136 2136 2136 HOH HOH A . 
CA 7 HOH 137 2137 2137 HOH HOH A . 
CA 7 HOH 138 2138 2138 HOH HOH A . 
CA 7 HOH 139 2139 2139 HOH HOH A . 
CA 7 HOH 140 2140 2140 HOH HOH A . 
CA 7 HOH 141 2141 2141 HOH HOH A . 
CA 7 HOH 142 2142 2142 HOH HOH A . 
CA 7 HOH 143 2143 2143 HOH HOH A . 
CA 7 HOH 144 2144 2144 HOH HOH A . 
CA 7 HOH 145 2145 2145 HOH HOH A . 
CA 7 HOH 146 2146 2146 HOH HOH A . 
CA 7 HOH 147 2147 2147 HOH HOH A . 
CA 7 HOH 148 2148 2148 HOH HOH A . 
CA 7 HOH 149 2149 2149 HOH HOH A . 
CA 7 HOH 150 2150 2150 HOH HOH A . 
CA 7 HOH 151 2151 2151 HOH HOH A . 
CA 7 HOH 152 2152 2152 HOH HOH A . 
CA 7 HOH 153 2153 2153 HOH HOH A . 
CA 7 HOH 154 2154 2154 HOH HOH A . 
CA 7 HOH 155 2155 2155 HOH HOH A . 
CA 7 HOH 156 2156 2156 HOH HOH A . 
CA 7 HOH 157 2157 2157 HOH HOH A . 
CA 7 HOH 158 2158 2158 HOH HOH A . 
CA 7 HOH 159 2159 2159 HOH HOH A . 
CA 7 HOH 160 2160 2160 HOH HOH A . 
CA 7 HOH 161 2161 2161 HOH HOH A . 
CA 7 HOH 162 2162 2162 HOH HOH A . 
CA 7 HOH 163 2163 2163 HOH HOH A . 
CA 7 HOH 164 2164 2164 HOH HOH A . 
CA 7 HOH 165 2165 2165 HOH HOH A . 
CA 7 HOH 166 2166 2166 HOH HOH A . 
CA 7 HOH 167 2167 2167 HOH HOH A . 
CA 7 HOH 168 2168 2168 HOH HOH A . 
CA 7 HOH 169 2169 2169 HOH HOH A . 
CA 7 HOH 170 2170 2170 HOH HOH A . 
CA 7 HOH 171 2171 2171 HOH HOH A . 
CA 7 HOH 172 2172 2172 HOH HOH A . 
CA 7 HOH 173 2173 2173 HOH HOH A . 
CA 7 HOH 174 2174 2174 HOH HOH A . 
CA 7 HOH 175 2175 2175 HOH HOH A . 
CA 7 HOH 176 2176 2176 HOH HOH A . 
CA 7 HOH 177 2177 2177 HOH HOH A . 
CA 7 HOH 178 2178 2178 HOH HOH A . 
CA 7 HOH 179 2179 2179 HOH HOH A . 
CA 7 HOH 180 2180 2180 HOH HOH A . 
CA 7 HOH 181 2181 2181 HOH HOH A . 
CA 7 HOH 182 2182 2182 HOH HOH A . 
CA 7 HOH 183 2183 2183 HOH HOH A . 
CA 7 HOH 184 2184 2184 HOH HOH A . 
CA 7 HOH 185 2185 2185 HOH HOH A . 
CA 7 HOH 186 2186 2186 HOH HOH A . 
CA 7 HOH 187 2187 2187 HOH HOH A . 
CA 7 HOH 188 2188 2188 HOH HOH A . 
CA 7 HOH 189 2189 2189 HOH HOH A . 
CA 7 HOH 190 2190 2190 HOH HOH A . 
CA 7 HOH 191 2191 2191 HOH HOH A . 
CA 7 HOH 192 2192 2192 HOH HOH A . 
CA 7 HOH 193 2193 2193 HOH HOH A . 
CA 7 HOH 194 2194 2194 HOH HOH A . 
CA 7 HOH 195 2195 2195 HOH HOH A . 
CA 7 HOH 196 2196 2196 HOH HOH A . 
CA 7 HOH 197 2197 2197 HOH HOH A . 
CA 7 HOH 198 2198 2198 HOH HOH A . 
CA 7 HOH 199 2199 2199 HOH HOH A . 
CA 7 HOH 200 2200 2200 HOH HOH A . 
CA 7 HOH 201 2201 2201 HOH HOH A . 
CA 7 HOH 202 2202 2202 HOH HOH A . 
CA 7 HOH 203 2203 2203 HOH HOH A . 
CA 7 HOH 204 2204 2204 HOH HOH A . 
CA 7 HOH 205 2205 2205 HOH HOH A . 
CA 7 HOH 206 2206 2206 HOH HOH A . 
CA 7 HOH 207 2207 2207 HOH HOH A . 
CA 7 HOH 208 2208 2208 HOH HOH A . 
CA 7 HOH 209 2209 2209 HOH HOH A . 
CA 7 HOH 210 2210 2210 HOH HOH A . 
CA 7 HOH 211 2211 2211 HOH HOH A . 
CA 7 HOH 212 2212 2212 HOH HOH A . 
CA 7 HOH 213 2213 2213 HOH HOH A . 
CA 7 HOH 214 2214 2214 HOH HOH A . 
CA 7 HOH 215 2215 2215 HOH HOH A . 
CA 7 HOH 216 2216 2216 HOH HOH A . 
CA 7 HOH 217 2217 2217 HOH HOH A . 
CA 7 HOH 218 2218 2218 HOH HOH A . 
CA 7 HOH 219 2219 2219 HOH HOH A . 
CA 7 HOH 220 2220 2220 HOH HOH A . 
CA 7 HOH 221 2221 2221 HOH HOH A . 
CA 7 HOH 222 2222 2222 HOH HOH A . 
CA 7 HOH 223 2223 2223 HOH HOH A . 
CA 7 HOH 224 2224 2224 HOH HOH A . 
CA 7 HOH 225 2225 2225 HOH HOH A . 
CA 7 HOH 226 2226 2226 HOH HOH A . 
CA 7 HOH 227 2227 2227 HOH HOH A . 
CA 7 HOH 228 2228 2228 HOH HOH A . 
CA 7 HOH 229 2229 2229 HOH HOH A . 
CA 7 HOH 230 2230 2230 HOH HOH A . 
CA 7 HOH 231 2231 2231 HOH HOH A . 
CA 7 HOH 232 2232 2232 HOH HOH A . 
CA 7 HOH 233 2233 2233 HOH HOH A . 
CA 7 HOH 234 2234 2234 HOH HOH A . 
CA 7 HOH 235 2235 2235 HOH HOH A . 
CA 7 HOH 236 2236 2236 HOH HOH A . 
CA 7 HOH 237 2237 2237 HOH HOH A . 
CA 7 HOH 238 2238 2238 HOH HOH A . 
CA 7 HOH 239 2239 2239 HOH HOH A . 
CA 7 HOH 240 2240 2240 HOH HOH A . 
CA 7 HOH 241 2241 2241 HOH HOH A . 
CA 7 HOH 242 2242 2242 HOH HOH A . 
CA 7 HOH 243 2243 2243 HOH HOH A . 
CA 7 HOH 244 2244 2244 HOH HOH A . 
CA 7 HOH 245 2245 2245 HOH HOH A . 
CA 7 HOH 246 2246 2246 HOH HOH A . 
CA 7 HOH 247 2247 2247 HOH HOH A . 
CA 7 HOH 248 2248 2248 HOH HOH A . 
CA 7 HOH 249 2249 2249 HOH HOH A . 
CA 7 HOH 250 2250 2250 HOH HOH A . 
CA 7 HOH 251 2251 2251 HOH HOH A . 
CA 7 HOH 252 2252 2252 HOH HOH A . 
CA 7 HOH 253 2253 2253 HOH HOH A . 
CA 7 HOH 254 2254 2254 HOH HOH A . 
CA 7 HOH 255 2255 2255 HOH HOH A . 
CA 7 HOH 256 2256 2256 HOH HOH A . 
CA 7 HOH 257 2257 2257 HOH HOH A . 
CA 7 HOH 258 2258 2258 HOH HOH A . 
CA 7 HOH 259 2259 2259 HOH HOH A . 
CA 7 HOH 260 2260 2260 HOH HOH A . 
CA 7 HOH 261 2261 2261 HOH HOH A . 
CA 7 HOH 262 2262 2262 HOH HOH A . 
CA 7 HOH 263 2263 2263 HOH HOH A . 
CA 7 HOH 264 2264 2264 HOH HOH A . 
CA 7 HOH 265 2265 2265 HOH HOH A . 
CA 7 HOH 266 2266 2266 HOH HOH A . 
CA 7 HOH 267 2267 2267 HOH HOH A . 
CA 7 HOH 268 2268 2268 HOH HOH A . 
CA 7 HOH 269 2269 2269 HOH HOH A . 
CA 7 HOH 270 2270 2270 HOH HOH A . 
CA 7 HOH 271 2271 2271 HOH HOH A . 
CA 7 HOH 272 2272 2272 HOH HOH A . 
CA 7 HOH 273 2273 2273 HOH HOH A . 
CA 7 HOH 274 2274 2274 HOH HOH A . 
CA 7 HOH 275 2275 2275 HOH HOH A . 
CA 7 HOH 276 2276 2276 HOH HOH A . 
CA 7 HOH 277 2277 2277 HOH HOH A . 
CA 7 HOH 278 2278 2278 HOH HOH A . 
CA 7 HOH 279 2279 2279 HOH HOH A . 
CA 7 HOH 280 2280 2280 HOH HOH A . 
CA 7 HOH 281 2281 2281 HOH HOH A . 
CA 7 HOH 282 2282 2282 HOH HOH A . 
CA 7 HOH 283 2283 2283 HOH HOH A . 
CA 7 HOH 284 2284 2284 HOH HOH A . 
CA 7 HOH 285 2285 2285 HOH HOH A . 
CA 7 HOH 286 2286 2286 HOH HOH A . 
CA 7 HOH 287 2287 2287 HOH HOH A . 
CA 7 HOH 288 2288 2288 HOH HOH A . 
CA 7 HOH 289 2289 2289 HOH HOH A . 
CA 7 HOH 290 2290 2290 HOH HOH A . 
CA 7 HOH 291 2291 2291 HOH HOH A . 
CA 7 HOH 292 2292 2292 HOH HOH A . 
CA 7 HOH 293 2293 2293 HOH HOH A . 
CA 7 HOH 294 2294 2294 HOH HOH A . 
CA 7 HOH 295 2295 2295 HOH HOH A . 
CA 7 HOH 296 2296 2296 HOH HOH A . 
CA 7 HOH 297 2297 2297 HOH HOH A . 
CA 7 HOH 298 2298 2298 HOH HOH A . 
CA 7 HOH 299 2299 2299 HOH HOH A . 
CA 7 HOH 300 2300 2300 HOH HOH A . 
CA 7 HOH 301 2301 2301 HOH HOH A . 
CA 7 HOH 302 2302 2302 HOH HOH A . 
CA 7 HOH 303 2303 2303 HOH HOH A . 
CA 7 HOH 304 2304 2304 HOH HOH A . 
CA 7 HOH 305 2305 2305 HOH HOH A . 
CA 7 HOH 306 2306 2306 HOH HOH A . 
CA 7 HOH 307 2307 2307 HOH HOH A . 
CA 7 HOH 308 2308 2308 HOH HOH A . 
CA 7 HOH 309 2309 2309 HOH HOH A . 
CA 7 HOH 310 2310 2310 HOH HOH A . 
CA 7 HOH 311 2311 2311 HOH HOH A . 
CA 7 HOH 312 2312 2312 HOH HOH A . 
CA 7 HOH 313 2313 2313 HOH HOH A . 
CA 7 HOH 314 2314 2314 HOH HOH A . 
CA 7 HOH 315 2315 2315 HOH HOH A . 
CA 7 HOH 316 2316 2316 HOH HOH A . 
CA 7 HOH 317 2317 2317 HOH HOH A . 
CA 7 HOH 318 2318 2318 HOH HOH A . 
CA 7 HOH 319 2319 2319 HOH HOH A . 
CA 7 HOH 320 2320 2320 HOH HOH A . 
CA 7 HOH 321 2321 2321 HOH HOH A . 
CA 7 HOH 322 2322 2322 HOH HOH A . 
CA 7 HOH 323 2323 2323 HOH HOH A . 
CA 7 HOH 324 2324 2324 HOH HOH A . 
CA 7 HOH 325 2325 2325 HOH HOH A . 
CA 7 HOH 326 2326 2326 HOH HOH A . 
CA 7 HOH 327 2327 2327 HOH HOH A . 
CA 7 HOH 328 2328 2328 HOH HOH A . 
CA 7 HOH 329 2329 2329 HOH HOH A . 
CA 7 HOH 330 2330 2330 HOH HOH A . 
CA 7 HOH 331 2331 2331 HOH HOH A . 
CA 7 HOH 332 2332 2332 HOH HOH A . 
CA 7 HOH 333 2333 2333 HOH HOH A . 
CA 7 HOH 334 2334 2334 HOH HOH A . 
CA 7 HOH 335 2335 2335 HOH HOH A . 
CA 7 HOH 336 2336 2336 HOH HOH A . 
CA 7 HOH 337 2337 2337 HOH HOH A . 
CA 7 HOH 338 2338 2338 HOH HOH A . 
CA 7 HOH 339 2339 2339 HOH HOH A . 
CA 7 HOH 340 2340 2340 HOH HOH A . 
CA 7 HOH 341 2341 2341 HOH HOH A . 
CA 7 HOH 342 2342 2342 HOH HOH A . 
CA 7 HOH 343 2343 2343 HOH HOH A . 
CA 7 HOH 344 2344 2344 HOH HOH A . 
CA 7 HOH 345 2345 2345 HOH HOH A . 
CA 7 HOH 346 2346 2346 HOH HOH A . 
CA 7 HOH 347 2347 2347 HOH HOH A . 
CA 7 HOH 348 2348 2348 HOH HOH A . 
CA 7 HOH 349 2349 2349 HOH HOH A . 
CA 7 HOH 350 2350 2350 HOH HOH A . 
CA 7 HOH 351 2351 2351 HOH HOH A . 
CA 7 HOH 352 2352 2352 HOH HOH A . 
CA 7 HOH 353 2353 2353 HOH HOH A . 
CA 7 HOH 354 2354 2354 HOH HOH A . 
CA 7 HOH 355 2355 2355 HOH HOH A . 
CA 7 HOH 356 2356 2356 HOH HOH A . 
CA 7 HOH 357 2357 2357 HOH HOH A . 
CA 7 HOH 358 2358 2358 HOH HOH A . 
CA 7 HOH 359 2359 2359 HOH HOH A . 
CA 7 HOH 360 2360 2360 HOH HOH A . 
CA 7 HOH 361 2361 2361 HOH HOH A . 
CA 7 HOH 362 2362 2362 HOH HOH A . 
CA 7 HOH 363 2363 2363 HOH HOH A . 
CA 7 HOH 364 2364 2364 HOH HOH A . 
CA 7 HOH 365 2365 2365 HOH HOH A . 
CA 7 HOH 366 2366 2366 HOH HOH A . 
CA 7 HOH 367 2367 2367 HOH HOH A . 
CA 7 HOH 368 2368 2368 HOH HOH A . 
CA 7 HOH 369 2369 2369 HOH HOH A . 
CA 7 HOH 370 2370 2370 HOH HOH A . 
CA 7 HOH 371 2371 2371 HOH HOH A . 
CA 7 HOH 372 2372 2372 HOH HOH A . 
CA 7 HOH 373 2373 2373 HOH HOH A . 
CA 7 HOH 374 2374 2374 HOH HOH A . 
CA 7 HOH 375 2375 2375 HOH HOH A . 
CA 7 HOH 376 2376 2376 HOH HOH A . 
CA 7 HOH 377 2377 2377 HOH HOH A . 
CA 7 HOH 378 2378 2378 HOH HOH A . 
CA 7 HOH 379 2379 2379 HOH HOH A . 
CA 7 HOH 380 2380 2380 HOH HOH A . 
CA 7 HOH 381 2381 2381 HOH HOH A . 
CA 7 HOH 382 2382 2382 HOH HOH A . 
CA 7 HOH 383 2383 2383 HOH HOH A . 
CA 7 HOH 384 2384 2384 HOH HOH A . 
CA 7 HOH 385 2385 2385 HOH HOH A . 
CA 7 HOH 386 2386 2386 HOH HOH A . 
CA 7 HOH 387 2387 2387 HOH HOH A . 
CA 7 HOH 388 2388 2388 HOH HOH A . 
CA 7 HOH 389 2389 2389 HOH HOH A . 
CA 7 HOH 390 2390 2390 HOH HOH A . 
CA 7 HOH 391 2391 2391 HOH HOH A . 
CA 7 HOH 392 2392 2392 HOH HOH A . 
CA 7 HOH 393 2393 2393 HOH HOH A . 
CA 7 HOH 394 2394 2394 HOH HOH A . 
CA 7 HOH 395 2395 2395 HOH HOH A . 
CA 7 HOH 396 2396 2396 HOH HOH A . 
CA 7 HOH 397 2397 2397 HOH HOH A . 
CA 7 HOH 398 2398 2398 HOH HOH A . 
CA 7 HOH 399 2399 2399 HOH HOH A . 
CA 7 HOH 400 2400 2400 HOH HOH A . 
CA 7 HOH 401 2401 2401 HOH HOH A . 
CA 7 HOH 402 2402 2402 HOH HOH A . 
CA 7 HOH 403 2403 2403 HOH HOH A . 
CA 7 HOH 404 2404 2404 HOH HOH A . 
CA 7 HOH 405 2405 2405 HOH HOH A . 
CA 7 HOH 406 2406 2406 HOH HOH A . 
CA 7 HOH 407 2407 2407 HOH HOH A . 
CA 7 HOH 408 2408 2408 HOH HOH A . 
CA 7 HOH 409 2409 2409 HOH HOH A . 
CA 7 HOH 410 2410 2410 HOH HOH A . 
CA 7 HOH 411 2411 2411 HOH HOH A . 
CA 7 HOH 412 2412 2412 HOH HOH A . 
CA 7 HOH 413 2413 2413 HOH HOH A . 
CA 7 HOH 414 2414 2414 HOH HOH A . 
CA 7 HOH 415 2415 2415 HOH HOH A . 
CA 7 HOH 416 2416 2416 HOH HOH A . 
CA 7 HOH 417 2417 2417 HOH HOH A . 
CA 7 HOH 418 2418 2418 HOH HOH A . 
CA 7 HOH 419 2419 2419 HOH HOH A . 
CA 7 HOH 420 2420 2420 HOH HOH A . 
CA 7 HOH 421 2421 2421 HOH HOH A . 
CA 7 HOH 422 2422 2422 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-07-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC  refinement       5.8.0071 ? 1 
XDS     'data reduction' .        ? 2 
Aimless 'data scaling'   .        ? 3 
PHASER  phasing          .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O2  A SO4 1972 ? ? O  A HOH 2127 ? ? 1.52 
2 1 O   A HOH 2127 ? ? O  A HOH 2186 ? ? 1.57 
3 1 NH2 A ARG 462  ? ? O  A HOH 2019 ? ? 1.82 
4 1 OE2 A GLU 652  ? B O1 A GOL 1980 ? ? 1.97 
5 1 OD1 A ASN 508  ? ? O  A HOH 2078 ? ? 2.09 
6 1 O   A HOH 2278 ? ? O  A HOH 2343 ? ? 2.12 
7 1 S   A SO4 1972 ? ? O  A HOH 2127 ? ? 2.13 
8 1 O   A HOH 2032 ? ? O  A HOH 2173 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A GLU 652 ? A N  A TYR 653 ? ? CA  A TYR 653 ? ? 145.84 121.70 24.14 2.50 Y 
2 1 NE A ARG 684 ? ? CZ A ARG 684 ? ? NH1 A ARG 684 ? ? 123.67 120.30 3.37  0.50 N 
3 1 NE A ARG 684 ? ? CZ A ARG 684 ? ? NH2 A ARG 684 ? ? 117.23 120.30 -3.07 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 592 ? ? -122.34 -61.64  
2  1 SER A 592 ? ? -125.10 -56.59  
3  1 GLU A 652 ? A -33.53  -70.44  
4  1 THR A 716 ? ? -101.27 -167.08 
5  1 SER A 749 ? ? -136.45 -116.65 
6  1 LEU A 752 ? ? -160.05 40.85   
7  1 VAL A 753 ? ? -108.71 -154.75 
8  1 ASN A 762 ? ? -116.49 74.43   
9  1 TYR A 795 ? ? -170.88 142.94  
10 1 ALA A 796 ? ? 48.04   -119.09 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2161 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.94 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 450  ? N   ? A ASP 5 N   
2  1 Y 1 A ASP 450  ? CB  ? A ASP 5 CB  
3  1 Y 1 A ASP 450  ? CG  ? A ASP 5 CG  
4  1 Y 1 A ASP 450  ? OD1 ? A ASP 5 OD1 
5  1 Y 1 A ASP 450  ? OD2 ? A ASP 5 OD2 
6  1 N 1 A AR6 1965 ? C1D ? C AR6 1 C1D 
7  1 N 1 A AR6 1965 ? O1D ? C AR6 1 O1D 
8  1 N 1 A AR6 1965 ? C2D ? C AR6 1 C2D 
9  1 N 1 A AR6 1965 ? O2D ? C AR6 1 O2D 
10 1 N 1 A AR6 1965 ? C3D ? C AR6 1 C3D 
11 1 N 1 A AR6 1965 ? O3D ? C AR6 1 O3D 
12 1 N 1 A AR6 1965 ? C4D ? C AR6 1 C4D 
13 1 N 1 A AR6 1965 ? O4D ? C AR6 1 O4D 
14 1 N 1 A AR6 1965 ? C5D ? C AR6 1 C5D 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 446 ? A GLY 1   
2  1 Y 1 A SER 447 ? A SER 2   
3  1 Y 1 A SER 448 ? A SER 3   
4  1 Y 1 A PRO 449 ? A PRO 4   
5  1 Y 1 A GLU 524 ? A GLU 79  
6  1 Y 1 A ASP 525 ? A ASP 80  
7  1 Y 1 A GLU 526 ? A GLU 81  
8  1 Y 1 A ASN 527 ? A ASN 82  
9  1 Y 1 A GLY 528 ? A GLY 83  
10 1 Y 1 A GLU 529 ? A GLU 84  
11 1 Y 1 A ARG 530 ? A ARG 85  
12 1 Y 1 A THR 531 ? A THR 86  
13 1 Y 1 A ALA 964 ? A ALA 519 
14 1 Y 1 A GLU 965 ? A GLU 520 
15 1 Y 1 A THR 966 ? A THR 521 
16 1 Y 1 A ALA 967 ? A ALA 522 
17 1 Y 1 A ASP 968 ? A ASP 523 
18 1 Y 1 A HIS 969 ? A HIS 524 
19 1 Y 1 A SER 970 ? A SER 525 
20 1 Y 1 A GLY 971 ? A GLY 526 
21 1 Y 1 A GLN 972 ? A GLN 527 
22 1 Y 1 A ARG 973 ? A ARG 528 
23 1 Y 1 A THR 974 ? A THR 529 
24 1 Y 1 A GLY 975 ? A GLY 530 
25 1 Y 1 A THR 976 ? A THR 531 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;[(2R,3S,4R,5R)-5-(6-AMINOPURIN-9-YL)-3,4-DIHYDROXY-OXOLAN-2-YL]METHYL [HYDROXY-[[(2R,3S,4R,5S)-3,4,5-TRIHYDROXYOXOLAN-2-YL]METHOXY]PHOSPHORYL] HYDROGEN PHOSPHATE
;
AR6 
3 BETA-MERCAPTOETHANOL BME 
4 'SULFATE ION' SO4 
5 GLYCEROL GOL 
6 'PROPANOIC ACID' PPI 
7 water HOH 
#