data_5A91
# 
_entry.id   5A91 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5A91         
PDBE  EBI-64365    
WWPDB D_1290064365 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 5A90 unspecified 
;100K NEUTRON LIGAND FREE: EXPLORING THE MECHANISM OF BETA-LACTAM RING PROTONATION IN THE CLASS A BETA- LACTAMASE ACYLATION MECHANISM USING NEUTRON AND X-RAY CRYSTALLOGRAPHY
;
PDB 5A92 unspecified 
;15K X-RAY STRUCTURE WITH CEFOTAXIME: EXPLORING THE MECHANISM OF BETA-LACTAM RING PROTONATION IN THE CLASS A BETA-LACTAMASE ACYLATION MECHANISM USING NEUTRON AND X-RAY CRYSTALLOGRAPHY
;
PDB 5A93 unspecified 
;293K JOINT X-RAY NEUTRON WITH CEFOTAXIME: EXPLORING THE MECHANISM OF BETA-LACTAM RING PROTONATION IN THE CLASS A BETA-LACTAMASE ACYLATION MECHANISM USING NEUTRON AND X-RAY CRYSTALLOGRAPHY
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5A91 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-07-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vandavasi, V.G.' 1 
'Weiss, K.L.'     2 
'Cooper, J.B.'    3 
'Erskine, P.T.'   4 
'Tomanicek, S.J.' 5 
'Ostermann, A.'   6 
'Schrader, T.E.'  7 
'Ginell, S.L.'    8 
'Coates, L.'      9 
# 
_citation.id                        primary 
_citation.title                     
;Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            59 
_citation.page_first                474 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26630115 
_citation.pdbx_database_id_DOI      10.1021/ACS.JMEDCHEM.5B01215 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Vandavasi, V.G.' 1 ? 
primary 'Weiss, K.L.'     2 ? 
primary 'Cooper, J.B.'    3 ? 
primary 'Erskine, P.T.'   4 ? 
primary 'Tomanicek, S.J.' 5 ? 
primary 'Ostermann, A.'   6 ? 
primary 'Schrader, T.E.'  7 ? 
primary 'Ginell, S.L.'    8 ? 
primary 'Coates, L.'      9 ? 
# 
_cell.entry_id           5A91 
_cell.length_a           72.398 
_cell.length_b           72.398 
_cell.length_c           97.198 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5A91 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ?             28117.752 1   3.5.2.6 YES ? ? 
2 non-polymer syn 'SULFATE ION' 96.063    5   ?       ?   ? ? 
3 water       nat water         18.015    442 ?       ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TOHO1 BETA LACTMAMASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ANSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYN
PIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAM
AQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQP
EQKAENRNDILAAAAKIVTHGF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ANSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYN
PIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAM
AQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQP
EQKAENRNDILAAAAKIVTHGF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASN n 
1 3   SER n 
1 4   VAL n 
1 5   GLN n 
1 6   GLN n 
1 7   GLN n 
1 8   LEU n 
1 9   GLU n 
1 10  ALA n 
1 11  LEU n 
1 12  GLU n 
1 13  LYS n 
1 14  SER n 
1 15  SER n 
1 16  GLY n 
1 17  GLY n 
1 18  ARG n 
1 19  LEU n 
1 20  GLY n 
1 21  VAL n 
1 22  ALA n 
1 23  LEU n 
1 24  ILE n 
1 25  ASN n 
1 26  THR n 
1 27  ALA n 
1 28  ASP n 
1 29  ASN n 
1 30  SER n 
1 31  GLN n 
1 32  ILE n 
1 33  LEU n 
1 34  TYR n 
1 35  ARG n 
1 36  ALA n 
1 37  ASP n 
1 38  GLU n 
1 39  ARG n 
1 40  PHE n 
1 41  ALA n 
1 42  MET n 
1 43  CYS n 
1 44  SER n 
1 45  THR n 
1 46  SER n 
1 47  LYS n 
1 48  VAL n 
1 49  MET n 
1 50  ALA n 
1 51  ALA n 
1 52  ALA n 
1 53  ALA n 
1 54  VAL n 
1 55  LEU n 
1 56  LYS n 
1 57  GLN n 
1 58  SER n 
1 59  GLU n 
1 60  SER n 
1 61  ASP n 
1 62  LYS n 
1 63  HIS n 
1 64  LEU n 
1 65  LEU n 
1 66  ASN n 
1 67  GLN n 
1 68  ARG n 
1 69  VAL n 
1 70  GLU n 
1 71  ILE n 
1 72  LYS n 
1 73  LYS n 
1 74  SER n 
1 75  ASP n 
1 76  LEU n 
1 77  VAL n 
1 78  ASN n 
1 79  TYR n 
1 80  ASN n 
1 81  PRO n 
1 82  ILE n 
1 83  ALA n 
1 84  GLU n 
1 85  LYS n 
1 86  HIS n 
1 87  VAL n 
1 88  ASN n 
1 89  GLY n 
1 90  THR n 
1 91  MET n 
1 92  THR n 
1 93  LEU n 
1 94  ALA n 
1 95  GLU n 
1 96  LEU n 
1 97  GLY n 
1 98  ALA n 
1 99  ALA n 
1 100 ALA n 
1 101 LEU n 
1 102 GLN n 
1 103 TYR n 
1 104 SER n 
1 105 ASP n 
1 106 ASN n 
1 107 THR n 
1 108 ALA n 
1 109 MET n 
1 110 ASN n 
1 111 LYS n 
1 112 LEU n 
1 113 ILE n 
1 114 ALA n 
1 115 HIS n 
1 116 LEU n 
1 117 GLY n 
1 118 GLY n 
1 119 PRO n 
1 120 ASP n 
1 121 LYS n 
1 122 VAL n 
1 123 THR n 
1 124 ALA n 
1 125 PHE n 
1 126 ALA n 
1 127 ARG n 
1 128 SER n 
1 129 LEU n 
1 130 GLY n 
1 131 ASP n 
1 132 GLU n 
1 133 THR n 
1 134 PHE n 
1 135 ARG n 
1 136 LEU n 
1 137 ASP n 
1 138 ARG n 
1 139 THR n 
1 140 ALA n 
1 141 PRO n 
1 142 THR n 
1 143 LEU n 
1 144 ASN n 
1 145 THR n 
1 146 ALA n 
1 147 ILE n 
1 148 PRO n 
1 149 GLY n 
1 150 ASP n 
1 151 PRO n 
1 152 ARG n 
1 153 ASP n 
1 154 THR n 
1 155 THR n 
1 156 THR n 
1 157 PRO n 
1 158 LEU n 
1 159 ALA n 
1 160 MET n 
1 161 ALA n 
1 162 GLN n 
1 163 THR n 
1 164 LEU n 
1 165 LYS n 
1 166 ASN n 
1 167 LEU n 
1 168 THR n 
1 169 LEU n 
1 170 GLY n 
1 171 LYS n 
1 172 ALA n 
1 173 LEU n 
1 174 ALA n 
1 175 GLU n 
1 176 THR n 
1 177 GLN n 
1 178 ARG n 
1 179 ALA n 
1 180 GLN n 
1 181 LEU n 
1 182 VAL n 
1 183 THR n 
1 184 TRP n 
1 185 LEU n 
1 186 LYS n 
1 187 GLY n 
1 188 ASN n 
1 189 THR n 
1 190 THR n 
1 191 GLY n 
1 192 SER n 
1 193 ALA n 
1 194 SER n 
1 195 ILE n 
1 196 ARG n 
1 197 ALA n 
1 198 GLY n 
1 199 LEU n 
1 200 PRO n 
1 201 LYS n 
1 202 SER n 
1 203 TRP n 
1 204 VAL n 
1 205 VAL n 
1 206 GLY n 
1 207 ASP n 
1 208 LYS n 
1 209 THR n 
1 210 GLY n 
1 211 SER n 
1 212 GLY n 
1 213 ASP n 
1 214 TYR n 
1 215 GLY n 
1 216 THR n 
1 217 THR n 
1 218 ASN n 
1 219 ASP n 
1 220 ILE n 
1 221 ALA n 
1 222 VAL n 
1 223 ILE n 
1 224 TRP n 
1 225 PRO n 
1 226 GLU n 
1 227 ASN n 
1 228 HIS n 
1 229 ALA n 
1 230 PRO n 
1 231 LEU n 
1 232 VAL n 
1 233 LEU n 
1 234 VAL n 
1 235 THR n 
1 236 TYR n 
1 237 PHE n 
1 238 THR n 
1 239 GLN n 
1 240 PRO n 
1 241 GLU n 
1 242 GLN n 
1 243 LYS n 
1 244 ALA n 
1 245 GLU n 
1 246 ASN n 
1 247 ARG n 
1 248 ASN n 
1 249 ASP n 
1 250 ILE n 
1 251 LEU n 
1 252 ALA n 
1 253 ALA n 
1 254 ALA n 
1 255 ALA n 
1 256 LYS n 
1 257 ILE n 
1 258 VAL n 
1 259 THR n 
1 260 HIS n 
1 261 GLY n 
1 262 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BLC97_ECOLX 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          E1ANH6 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5A91 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 262 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             E1ANH6 
_struct_ref_seq.db_align_beg                  30 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  291 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       26 
_struct_ref_seq.pdbx_auth_seq_align_end       290 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5A91 ALA A 140 ? UNP E1ANH6 GLU 169 'engineered mutation' 166 1 
1 5A91 ASN A 246 ? UNP E1ANH6 SER 275 conflict              274 2 
1 5A91 ASN A 248 ? UNP E1ANH6 ARG 277 conflict              276 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5A91 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_percent_sol   52.97 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
;300 ul of a 10 mg/ml protein concentration in a
solution containing 2.0 M ammonium sulfate and 0.1 M sodium citrate (pH 6.1) prepared in D 2 O.
;
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     15 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.67 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             0.67 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5A91 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             38.41 
_reflns.d_resolution_high            1.20 
_reflns.number_obs                   86849 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.40 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.8 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              0.029 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.Rmerge_I_obs                0.34 
_reflns_shell.d_res_high                  1.20 
_reflns_shell.d_res_low                   1.26 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_sigI_obs         2.5 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
_reflns_shell.pdbx_Rpim_I_all             0.137 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_diffrn_id              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_redundancy             5.7 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.percent_possible_obs        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5A91 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     86837 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.199 
_refine.ls_d_res_high                            1.200 
_refine.ls_percent_reflns_obs                    93.95 
_refine.ls_R_factor_obs                          0.1304 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1294 
_refine.ls_R_factor_R_free                       0.1505 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  4412 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.07 
_refine.pdbx_overall_phase_error                 12.57 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1960 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         25 
_refine_hist.number_atoms_solvent             442 
_refine_hist.number_atoms_total               2427 
_refine_hist.d_res_high                       1.200 
_refine_hist.d_res_low                        36.199 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 2103 'X-RAY DIFFRACTION' ? 
f_angle_d          1.492  ? ? 2880 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.906 ? ? 794  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.084  ? ? 338  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.009  ? ? 374  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.2000 1.2136  2810 0.1515 97.00 0.1879 . . 143 . . . . 
'X-RAY DIFFRACTION' . 1.2136 1.2279  2818 0.1452 97.00 0.1679 . . 173 . . . . 
'X-RAY DIFFRACTION' . 1.2279 1.2429  2763 0.1497 97.00 0.1823 . . 131 . . . . 
'X-RAY DIFFRACTION' . 1.2429 1.2586  2777 0.1439 96.00 0.1890 . . 144 . . . . 
'X-RAY DIFFRACTION' . 1.2586 1.2752  2817 0.1406 96.00 0.1859 . . 133 . . . . 
'X-RAY DIFFRACTION' . 1.2752 1.2927  2801 0.1337 96.00 0.1541 . . 152 . . . . 
'X-RAY DIFFRACTION' . 1.2927 1.3111  2763 0.1359 96.00 0.1518 . . 149 . . . . 
'X-RAY DIFFRACTION' . 1.3111 1.3307  2788 0.1332 96.00 0.1627 . . 158 . . . . 
'X-RAY DIFFRACTION' . 1.3307 1.3515  2750 0.1372 96.00 0.1693 . . 152 . . . . 
'X-RAY DIFFRACTION' . 1.3515 1.3737  2763 0.1328 96.00 0.1760 . . 164 . . . . 
'X-RAY DIFFRACTION' . 1.3737 1.3973  2779 0.1303 96.00 0.1560 . . 145 . . . . 
'X-RAY DIFFRACTION' . 1.3973 1.4228  2773 0.1250 95.00 0.1341 . . 157 . . . . 
'X-RAY DIFFRACTION' . 1.4228 1.4501  2769 0.1255 95.00 0.1495 . . 146 . . . . 
'X-RAY DIFFRACTION' . 1.4501 1.4797  2768 0.1215 95.00 0.1557 . . 137 . . . . 
'X-RAY DIFFRACTION' . 1.4797 1.5119  2772 0.1176 95.00 0.1650 . . 139 . . . . 
'X-RAY DIFFRACTION' . 1.5119 1.5471  2732 0.1152 95.00 0.1287 . . 147 . . . . 
'X-RAY DIFFRACTION' . 1.5471 1.5858  2743 0.1134 95.00 0.1452 . . 157 . . . . 
'X-RAY DIFFRACTION' . 1.5858 1.6286  2764 0.1166 94.00 0.1236 . . 135 . . . . 
'X-RAY DIFFRACTION' . 1.6286 1.6766  2716 0.1120 94.00 0.1482 . . 174 . . . . 
'X-RAY DIFFRACTION' . 1.6766 1.7307  2732 0.1170 94.00 0.1446 . . 136 . . . . 
'X-RAY DIFFRACTION' . 1.7307 1.7925  2694 0.1187 93.00 0.1524 . . 156 . . . . 
'X-RAY DIFFRACTION' . 1.7925 1.8643  2762 0.1164 93.00 0.1367 . . 138 . . . . 
'X-RAY DIFFRACTION' . 1.8643 1.9491  2703 0.1167 93.00 0.1271 . . 154 . . . . 
'X-RAY DIFFRACTION' . 1.9491 2.0519  2720 0.1171 93.00 0.1312 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.0519 2.1804  2734 0.1165 92.00 0.1304 . . 118 . . . . 
'X-RAY DIFFRACTION' . 2.1804 2.3487  2687 0.1188 91.00 0.1264 . . 147 . . . . 
'X-RAY DIFFRACTION' . 2.3487 2.5851  2724 0.1228 91.00 0.1254 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.5851 2.9590  2651 0.1396 90.00 0.1771 . . 160 . . . . 
'X-RAY DIFFRACTION' . 2.9590 3.7274  2676 0.1401 89.00 0.1550 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.7274 36.2155 2676 0.1561 85.00 0.1678 . . 144 . . . . 
# 
_struct.entry_id                  5A91 
_struct.title                     
;15K X-ray ligand free: Exploring the Mechanism of beta-Lactam Ring Protonation in the Class A beta-lactamase Acylation Mechanism Using Neutron and X-ray Crystallography
;
_struct.pdbx_descriptor           PROTEIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5A91 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, BETA LACTAMASE, NEUTRON CRYSTALLOGRAPHY' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 3   ? GLY A 16  ? SER A 28  GLY A 41  1 ? 14 
HELX_P HELX_P2  2  CYS A 43  ? THR A 45  ? CYS A 69  THR A 71  5 ? 3  
HELX_P HELX_P3  3  SER A 46  ? GLU A 59  ? SER A 72  GLU A 85  1 ? 14 
HELX_P HELX_P4  4  LYS A 72  ? LEU A 76  ? LYS A 98  LEU A 102 5 ? 5  
HELX_P HELX_P5  5  ILE A 82  ? VAL A 87  ? ILE A 108 VAL A 113 5 ? 6  
HELX_P HELX_P6  6  LEU A 93  ? TYR A 103 ? LEU A 119 TYR A 129 1 ? 11 
HELX_P HELX_P7  7  ASP A 105 ? GLY A 117 ? ASP A 131 GLY A 143 1 ? 13 
HELX_P HELX_P8  8  GLY A 118 ? LEU A 129 ? GLY A 144 LEU A 155 1 ? 12 
HELX_P HELX_P9  9  PRO A 141 ? THR A 145 ? PRO A 167 THR A 171 5 ? 5  
HELX_P HELX_P10 10 THR A 156 ? GLY A 170 ? THR A 182 GLY A 196 1 ? 15 
HELX_P HELX_P11 11 ALA A 174 ? GLY A 187 ? ALA A 200 GLY A 213 1 ? 14 
HELX_P HELX_P12 12 SER A 194 ? LEU A 199 ? SER A 220 LEU A 225 5 ? 6  
HELX_P HELX_P13 13 ARG A 247 ? HIS A 260 ? ARG A 275 HIS A 288 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           140 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            166 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    141 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     167 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.11 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLN A 31  ? TYR A 34  ? GLN A 56  TYR A 60  
AA 2 ARG A 18  ? ASN A 25  ? ARG A 43  ASN A 50  
AA 3 LEU A 231 ? THR A 238 ? LEU A 259 THR A 266 
AA 4 THR A 217 ? TRP A 224 ? THR A 244 TRP A 251 
AA 5 VAL A 204 ? SER A 211 ? VAL A 230 SER A 237 
AB 1 PHE A 40  ? ALA A 41  ? PHE A 66  ALA A 67  
AB 2 THR A 154 ? THR A 155 ? THR A 180 THR A 181 
AC 1 ARG A 68  ? GLU A 70  ? ARG A 94  GLU A 96  
AC 2 THR A 90  ? THR A 92  ? THR A 116 THR A 118 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N TYR A 34  ? N TYR A 60  O VAL A 21  ? O VAL A 46  
AA 2 3 N ILE A 24  ? N ILE A 49  O VAL A 232 ? O VAL A 260 
AA 3 4 O PHE A 237 ? O PHE A 265 N THR A 217 ? N THR A 244 
AA 4 5 N TRP A 224 ? N TRP A 251 O VAL A 204 ? O VAL A 230 
AB 1 2 N PHE A 40  ? N PHE A 66  O THR A 155 ? O THR A 181 
AC 1 2 N VAL A 69  ? N VAL A 95  O MET A 91  ? O MET A 117 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 A 1291' 
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 A 1292' 
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE SO4 A 1293' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 1294' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 1295' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  SER A 44  ? SER A 70   . ? 1_555 ? 
2  AC1 9  SER A 104 ? SER A 130  . ? 1_555 ? 
3  AC1 9  LYS A 208 ? LYS A 234  . ? 1_555 ? 
4  AC1 9  THR A 209 ? THR A 235  . ? 1_555 ? 
5  AC1 9  GLY A 210 ? GLY A 236  . ? 1_555 ? 
6  AC1 9  SER A 211 ? SER A 237  . ? 1_555 ? 
7  AC1 9  HOH G .   ? HOH A 2118 . ? 1_555 ? 
8  AC1 9  HOH G .   ? HOH A 2209 . ? 1_555 ? 
9  AC1 9  HOH G .   ? HOH A 2439 . ? 1_555 ? 
10 AC2 9  TRP A 203 ? TRP A 229  . ? 1_555 ? 
11 AC2 9  PRO A 225 ? PRO A 252  . ? 1_555 ? 
12 AC2 9  GLU A 226 ? GLU A 254  . ? 1_555 ? 
13 AC2 9  ASN A 227 ? ASN A 255  . ? 1_555 ? 
14 AC2 9  HIS A 228 ? HIS A 256  . ? 1_555 ? 
15 AC2 9  PHE A 262 ? PHE A 290  . ? 1_555 ? 
16 AC2 9  HOH G .   ? HOH A 2410 . ? 1_555 ? 
17 AC2 9  HOH G .   ? HOH A 2438 . ? 1_555 ? 
18 AC2 9  HOH G .   ? HOH A 2440 . ? 1_555 ? 
19 AC3 12 LYS A 56  ? LYS A 82   . ? 3_655 ? 
20 AC3 12 ALA A 172 ? ALA A 198  . ? 3_655 ? 
21 AC3 12 ASN A 246 ? ASN A 274  . ? 1_555 ? 
22 AC3 12 ASN A 248 ? ASN A 276  . ? 1_555 ? 
23 AC3 12 ASP A 249 ? ASP A 277  . ? 1_555 ? 
24 AC3 12 HOH G .   ? HOH A 2127 . ? 3_655 ? 
25 AC3 12 HOH G .   ? HOH A 2323 . ? 3_655 ? 
26 AC3 12 HOH G .   ? HOH A 2325 . ? 3_655 ? 
27 AC3 12 HOH G .   ? HOH A 2370 . ? 1_555 ? 
28 AC3 12 HOH G .   ? HOH A 2422 . ? 1_555 ? 
29 AC3 12 HOH G .   ? HOH A 2427 . ? 1_555 ? 
30 AC3 12 HOH G .   ? HOH A 2441 . ? 1_555 ? 
31 AC4 6  LYS A 62  ? LYS A 88   . ? 1_555 ? 
32 AC4 6  HIS A 63  ? HIS A 89   . ? 1_555 ? 
33 AC4 6  ASN A 66  ? ASN A 92   . ? 1_555 ? 
34 AC4 6  HOH G .   ? HOH A 2154 . ? 1_555 ? 
35 AC4 6  HOH G .   ? HOH A 2157 . ? 1_555 ? 
36 AC4 6  HOH G .   ? HOH A 2442 . ? 1_555 ? 
37 AC5 7  ALA A 27  ? ALA A 52   . ? 4_655 ? 
38 AC5 7  ARG A 152 ? ARG A 178  . ? 1_555 ? 
39 AC5 7  HOH G .   ? HOH A 2054 . ? 4_655 ? 
40 AC5 7  HOH G .   ? HOH A 2293 . ? 1_555 ? 
41 AC5 7  HOH G .   ? HOH A 2313 . ? 1_555 ? 
42 AC5 7  HOH G .   ? HOH A 2408 . ? 4_655 ? 
43 AC5 7  HOH G .   ? HOH A 2409 . ? 4_655 ? 
# 
_database_PDB_matrix.entry_id          5A91 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5A91 
_atom_sites.fract_transf_matrix[1][1]   0.013813 
_atom_sites.fract_transf_matrix[1][2]   0.007975 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015949 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010288 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . SER A 1 3   ? 9.469  -3.286  4.899   1.00   27.09 ? 28   SER A N    1 
ATOM   2    C CA   . SER A 1 3   ? 9.894  -3.120  6.267   1.00   25.71 ? 28   SER A CA   1 
ATOM   3    C C    . SER A 1 3   ? 11.197 -3.857  6.473   1.00   22.36 ? 28   SER A C    1 
ATOM   4    O O    . SER A 1 3   ? 12.019 -3.358  7.194   1.00   21.10 ? 28   SER A O    1 
ATOM   5    C CB   . SER A 1 3   ? 8.868  -3.578  7.297   1.00   28.42 ? 28   SER A CB   1 
ATOM   6    O OG   . SER A 1 3   ? 9.253  -3.109  8.583   1.00   28.17 ? 28   SER A OG   1 
ATOM   7    H HA   . SER A 1 3   ? 10.064 -2.178  6.424   1.00   30.85 ? 28   SER A HA   1 
ATOM   8    H HB2  . SER A 1 3   ? 7.999  -3.213  7.069   1.00   34.10 ? 28   SER A HB2  1 
ATOM   9    H HB3  . SER A 1 3   ? 8.834  -4.548  7.306   1.00   34.10 ? 28   SER A HB3  1 
ATOM   10   H HG   . SER A 1 3   ? 8.693  -3.356  9.158   1.00   33.80 ? 28   SER A HG   1 
ATOM   11   N N    . VAL A 1 4   ? 11.390 -5.031  5.865   1.00   20.42 ? 29   VAL A N    1 
ATOM   12   C CA   . VAL A 1 4   ? 12.670 -5.734  6.032   1.00   19.08 ? 29   VAL A CA   1 
ATOM   13   C C    . VAL A 1 4   ? 13.812 -4.833  5.559   1.00   18.28 ? 29   VAL A C    1 
ATOM   14   O O    . VAL A 1 4   ? 14.837 -4.737  6.221   1.00   17.88 ? 29   VAL A O    1 
ATOM   15   C CB   . VAL A 1 4   ? 12.684 -7.108  5.329   1.00   19.74 ? 29   VAL A CB   1 
ATOM   16   C CG1  . VAL A 1 4   ? 14.119 -7.667  5.232   1.00   20.22 ? 29   VAL A CG1  1 
ATOM   17   C CG2  . VAL A 1 4   ? 11.798 -8.077  6.092   1.00   20.80 ? 29   VAL A CG2  1 
ATOM   18   H H    . VAL A 1 4   ? 10.816 -5.432  5.366   1.00   24.51 ? 29   VAL A H    1 
ATOM   19   H HA   . VAL A 1 4   ? 12.806 -5.896  6.978   1.00   22.90 ? 29   VAL A HA   1 
ATOM   20   H HB   . VAL A 1 4   ? 12.331 -7.013  4.431   1.00   23.69 ? 29   VAL A HB   1 
ATOM   21   H HG11 . VAL A 1 4   ? 14.479 -7.767  6.127   1.00   24.26 ? 29   VAL A HG11 1 
ATOM   22   H HG12 . VAL A 1 4   ? 14.092 -8.528  4.787   1.00   24.26 ? 29   VAL A HG12 1 
ATOM   23   H HG13 . VAL A 1 4   ? 14.664 -7.047  4.722   1.00   24.26 ? 29   VAL A HG13 1 
ATOM   24   H HG21 . VAL A 1 4   ? 10.893 -7.729  6.111   1.00   24.96 ? 29   VAL A HG21 1 
ATOM   25   H HG22 . VAL A 1 4   ? 11.812 -8.937  5.644   1.00   24.96 ? 29   VAL A HG22 1 
ATOM   26   H HG23 . VAL A 1 4   ? 12.136 -8.169  6.996   1.00   24.96 ? 29   VAL A HG23 1 
ATOM   27   N N    . GLN A 1 5   ? 13.643 -4.168  4.425   1.00   19.49 ? 30   GLN A N    1 
ATOM   28   C CA   . GLN A 1 5   ? 14.664 -3.240  3.946   1.00   19.81 ? 30   GLN A CA   1 
ATOM   29   C C    . GLN A 1 5   ? 14.885 -2.115  4.943   1.00   19.64 ? 30   GLN A C    1 
ATOM   30   O O    . GLN A 1 5   ? 16.036 -1.764  5.243   1.00   19.84 ? 30   GLN A O    1 
ATOM   31   C CB   . GLN A 1 5   ? 14.285 -2.656  2.583   1.00   20.99 ? 30   GLN A CB   1 
ATOM   32   C CG   . GLN A 1 5   ? 14.420 -3.654  1.444   1.00   21.79 ? 30   GLN A CG   1 
ATOM   33   C CD   . GLN A 1 5   ? 15.864 -4.122  1.243   1.00   21.95 ? 30   GLN A CD   1 
ATOM   34   O OE1  . GLN A 1 5   ? 16.808 -3.337  1.324   1.00   21.74 ? 30   GLN A OE1  1 
ATOM   35   N NE2  . GLN A 1 5   ? 16.038 -5.418  1.002   1.00   22.12 ? 30   GLN A NE2  1 
ATOM   36   H H    . GLN A 1 5   ? 12.953 -4.234  3.916   1.00   23.39 ? 30   GLN A H    1 
ATOM   37   H HA   . GLN A 1 5   ? 15.502 -3.719  3.843   1.00   23.77 ? 30   GLN A HA   1 
ATOM   38   H HB2  . GLN A 1 5   ? 13.361 -2.361  2.614   1.00   25.19 ? 30   GLN A HB2  1 
ATOM   39   H HB3  . GLN A 1 5   ? 14.865 -1.903  2.391   1.00   25.19 ? 30   GLN A HB3  1 
ATOM   40   H HG2  . GLN A 1 5   ? 13.876 -4.433  1.639   1.00   26.15 ? 30   GLN A HG2  1 
ATOM   41   H HG3  . GLN A 1 5   ? 14.122 -3.237  0.620   1.00   26.15 ? 30   GLN A HG3  1 
ATOM   42   H HE21 . GLN A 1 5   ? 15.358 -5.943  0.966   1.00   26.54 ? 30   GLN A HE21 1 
ATOM   43   H HE22 . GLN A 1 5   ? 16.830 -5.731  0.882   1.00   26.54 ? 30   GLN A HE22 1 
ATOM   44   N N    . GLN A 1 6   ? 13.795 -1.549  5.456   1.00   20.28 ? 31   GLN A N    1 
ATOM   45   C CA   . GLN A 1 6   ? 13.932 -0.518  6.470   1.00   21.77 ? 31   GLN A CA   1 
ATOM   46   C C    . GLN A 1 6   ? 14.680 -1.025  7.693   1.00   20.42 ? 31   GLN A C    1 
ATOM   47   O O    . GLN A 1 6   ? 15.493 -0.311  8.278   1.00   19.90 ? 31   GLN A O    1 
ATOM   48   C CB   . GLN A 1 6   ? 12.555 -0.005  6.900   1.00   25.56 ? 31   GLN A CB   1 
ATOM   49   C CG   . GLN A 1 6   ? 12.243 1.377   6.424   1.00   29.97 ? 31   GLN A CG   1 
ATOM   50   C CD   . GLN A 1 6   ? 11.848 1.422   4.968   1.00   33.64 ? 31   GLN A CD   1 
ATOM   51   O OE1  . GLN A 1 6   ? 12.369 0.667   4.152   1.00   35.20 ? 31   GLN A OE1  1 
ATOM   52   N NE2  . GLN A 1 6   ? 10.907 2.308   4.635   1.00   35.34 ? 31   GLN A NE2  1 
ATOM   53   H H    . GLN A 1 6   ? 12.986 -1.740  5.238   1.00   24.34 ? 31   GLN A H    1 
ATOM   54   H HA   . GLN A 1 6   ? 14.430 0.227   6.099   1.00   26.12 ? 31   GLN A HA   1 
ATOM   55   H HB2  . GLN A 1 6   ? 11.876 -0.599  6.546   1.00   30.67 ? 31   GLN A HB2  1 
ATOM   56   H HB3  . GLN A 1 6   ? 12.513 0.000   7.869   1.00   30.67 ? 31   GLN A HB3  1 
ATOM   57   H HG2  . GLN A 1 6   ? 11.506 1.732   6.946   1.00   35.97 ? 31   GLN A HG2  1 
ATOM   58   H HG3  . GLN A 1 6   ? 13.029 1.935   6.539   1.00   35.97 ? 31   GLN A HG3  1 
ATOM   59   H HE21 . GLN A 1 6   ? 10.561 2.814   5.237   1.00   42.41 ? 31   GLN A HE21 1 
ATOM   60   H HE22 . GLN A 1 6   ? 10.647 2.372   3.817   1.00   42.41 ? 31   GLN A HE22 1 
ATOM   61   N N    . GLN A 1 7   ? 14.403 -2.258  8.093   1.00   18.72 ? 32   GLN A N    1 
ATOM   62   C CA   A GLN A 1 7   ? 15.037 -2.823  9.276   0.17   18.53 ? 32   GLN A CA   1 
ATOM   63   C CA   B GLN A 1 7   ? 15.045 -2.805  9.277   0.83   18.30 ? 32   GLN A CA   1 
ATOM   64   C C    . GLN A 1 7   ? 16.530 -3.030  9.049   1.00   17.93 ? 32   GLN A C    1 
ATOM   65   O O    . GLN A 1 7   ? 17.336 -2.806  9.938   1.00   17.56 ? 32   GLN A O    1 
ATOM   66   C CB   A GLN A 1 7   ? 14.370 -4.144  9.655   0.17   18.92 ? 32   GLN A CB   1 
ATOM   67   C CB   B GLN A 1 7   ? 14.386 -4.110  9.671   0.83   18.50 ? 32   GLN A CB   1 
ATOM   68   C CG   A GLN A 1 7   ? 12.989 -3.970  10.275  0.17   19.53 ? 32   GLN A CG   1 
ATOM   69   C CG   B GLN A 1 7   ? 12.959 -3.909  10.167  0.83   19.73 ? 32   GLN A CG   1 
ATOM   70   C CD   A GLN A 1 7   ? 12.259 -5.285  10.444  0.17   20.02 ? 32   GLN A CD   1 
ATOM   71   C CD   B GLN A 1 7   ? 12.267 -5.221  10.397  0.83   21.05 ? 32   GLN A CD   1 
ATOM   72   O OE1  A GLN A 1 7   ? 12.151 -6.073  9.505   0.17   20.29 ? 32   GLN A OE1  1 
ATOM   73   O OE1  B GLN A 1 7   ? 12.816 -6.118  11.036  0.83   21.91 ? 32   GLN A OE1  1 
ATOM   74   N NE2  A GLN A 1 7   ? 11.753 -5.531  11.648  0.17   20.20 ? 32   GLN A NE2  1 
ATOM   75   N NE2  B GLN A 1 7   ? 11.057 -5.353  9.870   0.83   21.92 ? 32   GLN A NE2  1 
ATOM   76   H H    A GLN A 1 7   ? 13.853 -2.788  7.698   0.17   22.47 ? 32   GLN A H    1 
ATOM   77   H H    B GLN A 1 7   ? 13.854 -2.792  7.702   0.83   22.47 ? 32   GLN A H    1 
ATOM   78   H HA   A GLN A 1 7   ? 14.928 -2.208  10.017  0.17   22.24 ? 32   GLN A HA   1 
ATOM   79   H HA   B GLN A 1 7   ? 14.943 -2.180  10.012  0.83   21.96 ? 32   GLN A HA   1 
ATOM   80   H HB2  A GLN A 1 7   ? 14.271 -4.686  8.856   0.17   22.71 ? 32   GLN A HB2  1 
ATOM   81   H HB2  B GLN A 1 7   ? 14.357 -4.697  8.899   0.83   22.20 ? 32   GLN A HB2  1 
ATOM   82   H HB3  A GLN A 1 7   ? 14.930 -4.604  10.299  0.17   22.71 ? 32   GLN A HB3  1 
ATOM   83   H HB3  B GLN A 1 7   ? 14.899 -4.522  10.384  0.83   22.20 ? 32   GLN A HB3  1 
ATOM   84   H HG2  A GLN A 1 7   ? 13.085 -3.564  11.151  0.17   23.43 ? 32   GLN A HG2  1 
ATOM   85   H HG2  B GLN A 1 7   ? 12.978 -3.424  11.007  0.83   23.67 ? 32   GLN A HG2  1 
ATOM   86   H HG3  A GLN A 1 7   ? 12.454 -3.400  9.702   0.17   23.43 ? 32   GLN A HG3  1 
ATOM   87   H HG3  B GLN A 1 7   ? 12.456 -3.412  9.503   0.83   23.67 ? 32   GLN A HG3  1 
ATOM   88   H HE21 A GLN A 1 7   ? 11.850 -4.957  12.281  0.17   24.23 ? 32   GLN A HE21 1 
ATOM   89   H HE21 B GLN A 1 7   ? 10.709 -4.705  9.424   0.83   26.30 ? 32   GLN A HE21 1 
ATOM   90   H HE22 A GLN A 1 7   ? 11.329 -6.265  11.794  0.17   24.23 ? 32   GLN A HE22 1 
ATOM   91   H HE22 B GLN A 1 7   ? 10.620 -6.086  9.975   0.83   26.30 ? 32   GLN A HE22 1 
ATOM   92   N N    . LEU A 1 8   ? 16.896 -3.462  7.856   1.00   16.03 ? 33   LEU A N    1 
ATOM   93   C CA   . LEU A 1 8   ? 18.316 -3.663  7.583   1.00   15.15 ? 33   LEU A CA   1 
ATOM   94   C C    . LEU A 1 8   ? 19.046 -2.318  7.507   1.00   16.62 ? 33   LEU A C    1 
ATOM   95   O O    . LEU A 1 8   ? 20.177 -2.180  7.982   1.00   15.44 ? 33   LEU A O    1 
ATOM   96   C CB   . LEU A 1 8   ? 18.495 -4.443  6.293   1.00   13.90 ? 33   LEU A CB   1 
ATOM   97   C CG   . LEU A 1 8   ? 18.069 -5.915  6.373   1.00   13.13 ? 33   LEU A CG   1 
ATOM   98   C CD1  . LEU A 1 8   ? 18.208 -6.536  4.998   1.00   14.19 ? 33   LEU A CD1  1 
ATOM   99   C CD2  . LEU A 1 8   ? 18.887 -6.686  7.401   1.00   13.11 ? 33   LEU A CD2  1 
ATOM   100  H H    . LEU A 1 8   ? 16.366 -3.643  7.204   1.00   19.24 ? 33   LEU A H    1 
ATOM   101  H HA   . LEU A 1 8   ? 18.709 -4.178  8.304   1.00   18.19 ? 33   LEU A HA   1 
ATOM   102  H HB2  . LEU A 1 8   ? 17.965 -4.021  5.599   1.00   16.68 ? 33   LEU A HB2  1 
ATOM   103  H HB3  . LEU A 1 8   ? 19.433 -4.422  6.046   1.00   16.68 ? 33   LEU A HB3  1 
ATOM   104  H HG   . LEU A 1 8   ? 17.136 -5.962  6.632   1.00   15.76 ? 33   LEU A HG   1 
ATOM   105  H HD11 . LEU A 1 8   ? 19.133 -6.471  4.714   1.00   17.03 ? 33   LEU A HD11 1 
ATOM   106  H HD12 . LEU A 1 8   ? 17.939 -7.467  5.044   1.00   17.03 ? 33   LEU A HD12 1 
ATOM   107  H HD13 . LEU A 1 8   ? 17.637 -6.057  4.377   1.00   17.03 ? 33   LEU A HD13 1 
ATOM   108  H HD21 . LEU A 1 8   ? 18.761 -6.281  8.273   1.00   15.73 ? 33   LEU A HD21 1 
ATOM   109  H HD22 . LEU A 1 8   ? 18.585 -7.608  7.417   1.00   15.73 ? 33   LEU A HD22 1 
ATOM   110  H HD23 . LEU A 1 8   ? 19.824 -6.649  7.151   1.00   15.73 ? 33   LEU A HD23 1 
ATOM   111  N N    . GLU A 1 9   ? 18.395 -1.317  6.918   1.00   17.57 ? 34   GLU A N    1 
ATOM   112  C CA   . GLU A 1 9   ? 18.994 0.015   6.824   1.00   20.06 ? 34   GLU A CA   1 
ATOM   113  C C    . GLU A 1 9   ? 19.256 0.545   8.206   1.00   20.31 ? 34   GLU A C    1 
ATOM   114  O O    . GLU A 1 9   ? 20.314 1.136   8.473   1.00   19.72 ? 34   GLU A O    1 
ATOM   115  C CB   . GLU A 1 9   ? 18.058 0.983   6.106   1.00   22.76 ? 34   GLU A CB   1 
ATOM   116  C CG   . GLU A 1 9   ? 18.007 0.811   4.612   1.00   27.47 ? 34   GLU A CG   1 
ATOM   117  C CD   . GLU A 1 9   ? 17.009 1.740   3.964   1.00   31.32 ? 34   GLU A CD   1 
ATOM   118  O OE1  . GLU A 1 9   ? 17.146 2.961   4.169   1.00   31.93 ? 34   GLU A OE1  1 
ATOM   119  O OE2  . GLU A 1 9   ? 16.080 1.252   3.275   1.00   33.51 ? 34   GLU A OE2  1 
ATOM   120  H H    . GLU A 1 9   ? 17.613 -1.381  6.567   1.00   21.09 ? 34   GLU A H    1 
ATOM   121  H HA   . GLU A 1 9   ? 19.833 -0.031  6.338   1.00   24.07 ? 34   GLU A HA   1 
ATOM   122  H HB2  . GLU A 1 9   ? 17.159 0.855   6.448   1.00   27.31 ? 34   GLU A HB2  1 
ATOM   123  H HB3  . GLU A 1 9   ? 18.350 1.890   6.289   1.00   27.31 ? 34   GLU A HB3  1 
ATOM   124  H HG2  . GLU A 1 9   ? 18.883 1.003   4.240   1.00   32.97 ? 34   GLU A HG2  1 
ATOM   125  H HG3  . GLU A 1 9   ? 17.750 -0.101  4.405   1.00   32.97 ? 34   GLU A HG3  1 
ATOM   126  N N    . ALA A 1 10  ? 18.287 0.356   9.088   1.00   19.76 ? 35   ALA A N    1 
ATOM   127  C CA   . ALA A 1 10  ? 18.399 0.855   10.444  1.00   21.14 ? 35   ALA A CA   1 
ATOM   128  C C    . ALA A 1 10  ? 19.527 0.140   11.153  1.00   20.09 ? 35   ALA A C    1 
ATOM   129  O O    . ALA A 1 10  ? 20.342 0.775   11.814  1.00   19.80 ? 35   ALA A O    1 
ATOM   130  C CB   . ALA A 1 10  ? 17.085 0.674   11.185  1.00   22.67 ? 35   ALA A CB   1 
ATOM   131  H H    . ALA A 1 10  ? 17.552 -0.059  8.924   1.00   23.71 ? 35   ALA A H    1 
ATOM   132  H HA   . ALA A 1 10  ? 18.607 1.802   10.420  1.00   25.37 ? 35   ALA A HA   1 
ATOM   133  H HB1  . ALA A 1 10  ? 16.864 -0.270  11.208  1.00   27.21 ? 35   ALA A HB1  1 
ATOM   134  H HB2  . ALA A 1 10  ? 17.182 1.014   12.088  1.00   27.21 ? 35   ALA A HB2  1 
ATOM   135  H HB3  . ALA A 1 10  ? 16.390 1.165   10.719  1.00   27.21 ? 35   ALA A HB3  1 
ATOM   136  N N    . LEU A 1 11  ? 19.600 -1.186  10.987  1.00   17.49 ? 36   LEU A N    1 
ATOM   137  C CA   . LEU A 1 11  ? 20.663 -1.975  11.606  1.00   15.43 ? 36   LEU A CA   1 
ATOM   138  C C    . LEU A 1 11  ? 22.037 -1.456  11.190  1.00   15.91 ? 36   LEU A C    1 
ATOM   139  O O    . LEU A 1 11  ? 22.940 -1.282  12.016  1.00   16.61 ? 36   LEU A O    1 
ATOM   140  C CB   . LEU A 1 11  ? 20.522 -3.457  11.248  1.00   14.00 ? 36   LEU A CB   1 
ATOM   141  C CG   . LEU A 1 11  ? 21.640 -4.384  11.736  1.00   13.49 ? 36   LEU A CG   1 
ATOM   142  C CD1  . LEU A 1 11  ? 21.730 -4.366  13.241  1.00   15.25 ? 36   LEU A CD1  1 
ATOM   143  C CD2  . LEU A 1 11  ? 21.389 -5.793  11.207  1.00   12.30 ? 36   LEU A CD2  1 
ATOM   144  H H    . LEU A 1 11  ? 19.045 -1.649  10.521  1.00   20.98 ? 36   LEU A H    1 
ATOM   145  H HA   . LEU A 1 11  ? 20.593 -1.894  12.570  1.00   18.51 ? 36   LEU A HA   1 
ATOM   146  H HB2  . LEU A 1 11  ? 19.691 -3.784  11.627  1.00   16.80 ? 36   LEU A HB2  1 
ATOM   147  H HB3  . LEU A 1 11  ? 20.486 -3.534  10.281  1.00   16.80 ? 36   LEU A HB3  1 
ATOM   148  H HG   . LEU A 1 11  ? 22.487 -4.074  11.380  1.00   16.19 ? 36   LEU A HG   1 
ATOM   149  H HD11 . LEU A 1 11  ? 20.885 -4.666  13.611  1.00   18.30 ? 36   LEU A HD11 1 
ATOM   150  H HD12 . LEU A 1 11  ? 22.443 -4.960  13.522  1.00   18.30 ? 36   LEU A HD12 1 
ATOM   151  H HD13 . LEU A 1 11  ? 21.917 -3.461  13.535  1.00   18.30 ? 36   LEU A HD13 1 
ATOM   152  H HD21 . LEU A 1 11  ? 21.381 -5.768  10.237  1.00   14.76 ? 36   LEU A HD21 1 
ATOM   153  H HD22 . LEU A 1 11  ? 22.098 -6.377  11.517  1.00   14.76 ? 36   LEU A HD22 1 
ATOM   154  H HD23 . LEU A 1 11  ? 20.532 -6.106  11.537  1.00   14.76 ? 36   LEU A HD23 1 
ATOM   155  N N    . GLU A 1 12  ? 22.204 -1.231  9.902   1.00   14.34 ? 37   GLU A N    1 
ATOM   156  C CA   . GLU A 1 12  ? 23.475 -0.710  9.424   1.00   14.77 ? 37   GLU A CA   1 
ATOM   157  C C    . GLU A 1 12  ? 23.757 0.670   10.005  1.00   15.67 ? 37   GLU A C    1 
ATOM   158  O O    . GLU A 1 12  ? 24.883 0.960   10.358  1.00   14.84 ? 37   GLU A O    1 
ATOM   159  C CB   . GLU A 1 12  ? 23.463 -0.596  7.918   1.00   13.91 ? 37   GLU A CB   1 
ATOM   160  C CG   . GLU A 1 12  ? 24.781 -0.143  7.367   1.00   13.25 ? 37   GLU A CG   1 
ATOM   161  C CD   . GLU A 1 12  ? 24.799 -0.052  5.882   1.00   12.89 ? 37   GLU A CD   1 
ATOM   162  O OE1  . GLU A 1 12  ? 24.016 0.744   5.298   1.00   12.72 ? 37   GLU A OE1  1 
ATOM   163  O OE2  . GLU A 1 12  ? 25.587 -0.799  5.261   1.00   12.06 ? 37   GLU A OE2  1 
ATOM   164  H H    . GLU A 1 12  ? 21.613 -1.367  9.292   1.00   17.21 ? 37   GLU A H    1 
ATOM   165  H HA   . GLU A 1 12  ? 24.192 -1.309  9.684   1.00   17.72 ? 37   GLU A HA   1 
ATOM   166  H HB2  . GLU A 1 12  ? 23.260 -1.464  7.536   1.00   16.70 ? 37   GLU A HB2  1 
ATOM   167  H HB3  . GLU A 1 12  ? 22.788 0.050   7.655   1.00   16.70 ? 37   GLU A HB3  1 
ATOM   168  H HG2  . GLU A 1 12  ? 24.983 0.737   7.722   1.00   15.90 ? 37   GLU A HG2  1 
ATOM   169  H HG3  . GLU A 1 12  ? 25.467 -0.773  7.636   1.00   15.90 ? 37   GLU A HG3  1 
ATOM   170  N N    . LYS A 1 13  ? 22.726 1.515   10.112  1.00   15.77 ? 38   LYS A N    1 
ATOM   171  C CA   . LYS A 1 13  ? 22.864 2.919   10.497  1.00   16.32 ? 38   LYS A CA   1 
ATOM   172  C C    . LYS A 1 13  ? 23.537 3.008   11.838  1.00   14.44 ? 38   LYS A C    1 
ATOM   173  O O    . LYS A 1 13  ? 24.338 3.880   12.030  1.00   14.32 ? 38   LYS A O    1 
ATOM   174  C CB   . LYS A 1 13  ? 21.499 3.593   10.593  1.00   20.08 ? 38   LYS A CB   1 
ATOM   175  C CG   . LYS A 1 13  ? 21.525 5.107   10.820  1.00   22.88 ? 38   LYS A CG   1 
ATOM   176  C CD   . LYS A 1 13  ? 21.693 5.846   9.499   1.00   25.41 ? 38   LYS A CD   1 
ATOM   177  C CE   . LYS A 1 13  ? 21.151 7.288   9.504   1.00   25.32 ? 38   LYS A CE   1 
ATOM   178  N NZ   . LYS A 1 13  ? 21.873 8.177   8.504   1.00   22.72 ? 38   LYS A NZ   1 
ATOM   179  H H    . LYS A 1 13  ? 21.910 1.287   9.960   1.00   18.93 ? 38   LYS A H    1 
ATOM   180  H HA   . LYS A 1 13  ? 23.403 3.390   9.842   1.00   19.58 ? 38   LYS A HA   1 
ATOM   181  H HB2  . LYS A 1 13  ? 21.018 3.432   9.765   1.00   24.10 ? 38   LYS A HB2  1 
ATOM   182  H HB3  . LYS A 1 13  ? 21.012 3.197   11.332  1.00   24.10 ? 38   LYS A HB3  1 
ATOM   183  H HG2  . LYS A 1 13  ? 20.689 5.387   11.224  1.00   27.45 ? 38   LYS A HG2  1 
ATOM   184  H HG3  . LYS A 1 13  ? 22.272 5.334   11.396  1.00   27.45 ? 38   LYS A HG3  1 
ATOM   185  H HD2  . LYS A 1 13  ? 22.638 5.887   9.285   1.00   30.49 ? 38   LYS A HD2  1 
ATOM   186  H HD3  . LYS A 1 13  ? 21.222 5.356   8.807   1.00   30.49 ? 38   LYS A HD3  1 
ATOM   187  H HE2  . LYS A 1 13  ? 20.210 7.274   9.271   1.00   30.38 ? 38   LYS A HE2  1 
ATOM   188  H HE3  . LYS A 1 13  ? 21.271 7.669   10.388  1.00   30.38 ? 38   LYS A HE3  1 
ATOM   189  H HZ1  . LYS A 1 13  ? 21.775 7.852   7.682   1.00   27.27 ? 38   LYS A HZ1  1 
ATOM   190  H HZ2  . LYS A 1 13  ? 21.538 9.001   8.532   1.00   27.27 ? 38   LYS A HZ2  1 
ATOM   191  H HZ3  . LYS A 1 13  ? 22.741 8.211   8.699   1.00   27.27 ? 38   LYS A HZ3  1 
ATOM   192  N N    . SER A 1 14  ? 23.180 2.094   12.745  1.00   15.42 ? 39   SER A N    1 
ATOM   193  C CA   . SER A 1 14  ? 23.666 2.046   14.110  1.00   18.10 ? 39   SER A CA   1 
ATOM   194  C C    . SER A 1 14  ? 24.987 1.310   14.304  1.00   14.15 ? 39   SER A C    1 
ATOM   195  O O    . SER A 1 14  ? 25.698 1.482   15.310  1.00   13.49 ? 39   SER A O    1 
ATOM   196  C CB   . SER A 1 14  ? 22.604 1.325   14.966  1.00   20.45 ? 39   SER A CB   1 
ATOM   197  O OG   . SER A 1 14  ? 22.136 0.157   14.330  1.00   20.55 ? 39   SER A OG   1 
ATOM   198  H H    . SER A 1 14  ? 22.626 1.459   12.571  1.00   18.50 ? 39   SER A H    1 
ATOM   199  H HA   . SER A 1 14  ? 23.768 2.950   14.446  1.00   21.72 ? 39   SER A HA   1 
ATOM   200  H HB2  . SER A 1 14  ? 22.999 1.082   15.818  1.00   24.54 ? 39   SER A HB2  1 
ATOM   201  H HB3  . SER A 1 14  ? 21.855 1.926   15.109  1.00   24.54 ? 39   SER A HB3  1 
ATOM   202  H HG   . SER A 1 14  ? 21.789 0.352   13.590  1.00   24.66 ? 39   SER A HG   1 
ATOM   203  N N    . SER A 1 15  ? 25.304 0.494   13.320  1.00   14.15 ? 40   SER A N    1 
ATOM   204  C CA   . SER A 1 15  ? 26.348 -0.500  13.474  1.00   12.45 ? 40   SER A CA   1 
ATOM   205  C C    . SER A 1 15  ? 27.758 0.055   13.471  1.00   10.68 ? 40   SER A C    1 
ATOM   206  O O    . SER A 1 15  ? 28.656 -0.588  13.995  1.00   12.66 ? 40   SER A O    1 
ATOM   207  C CB   . SER A 1 15  ? 26.288 -1.515  12.337  1.00   14.09 ? 40   SER A CB   1 
ATOM   208  O OG   . SER A 1 15  ? 26.670 -0.933  11.105  1.00   13.93 ? 40   SER A OG   1 
ATOM   209  H H    . SER A 1 15  ? 24.928 0.493   12.547  1.00   16.98 ? 40   SER A H    1 
ATOM   210  H HA   . SER A 1 15  ? 26.213 -0.974  14.310  1.00   14.94 ? 40   SER A HA   1 
ATOM   211  H HB2  . SER A 1 15  ? 26.890 -2.248  12.539  1.00   16.91 ? 40   SER A HB2  1 
ATOM   212  H HB3  . SER A 1 15  ? 25.380 -1.846  12.260  1.00   16.91 ? 40   SER A HB3  1 
ATOM   213  H HG   . SER A 1 15  ? 26.156 -0.296  10.917  1.00   16.72 ? 40   SER A HG   1 
ATOM   214  N N    . GLY A 1 16  ? 27.964 1.214   12.852  1.00   9.48  ? 41   GLY A N    1 
ATOM   215  C CA   . GLY A 1 16  ? 29.317 1.719   12.615  1.00   10.18 ? 41   GLY A CA   1 
ATOM   216  C C    . GLY A 1 16  ? 30.076 1.047   11.478  1.00   9.44  ? 41   GLY A C    1 
ATOM   217  O O    . GLY A 1 16  ? 31.306 1.091   11.414  1.00   9.72  ? 41   GLY A O    1 
ATOM   218  H H    . GLY A 1 16  ? 27.340 1.728   12.558  1.00   11.38 ? 41   GLY A H    1 
ATOM   219  H HA2  . GLY A 1 16  ? 29.267 2.667   12.419  1.00   12.21 ? 41   GLY A HA2  1 
ATOM   220  H HA3  . GLY A 1 16  ? 29.838 1.609   13.426  1.00   12.21 ? 41   GLY A HA3  1 
ATOM   221  N N    . GLY A 1 17  ? 29.353 0.412   10.564  1.00   9.72  ? 42   GLY A N    1 
ATOM   222  C CA   . GLY A 1 17  ? 29.977 -0.255  9.443   1.00   9.57  ? 42   GLY A CA   1 
ATOM   223  C C    . GLY A 1 17  ? 29.050 -0.390  8.265   1.00   9.66  ? 42   GLY A C    1 
ATOM   224  O O    . GLY A 1 17  ? 28.014 0.265   8.170   1.00   11.61 ? 42   GLY A O    1 
ATOM   225  H H    . GLY A 1 17  ? 28.495 0.356   10.575  1.00   11.66 ? 42   GLY A H    1 
ATOM   226  H HA2  . GLY A 1 17  ? 30.758 0.247   9.163   1.00   11.49 ? 42   GLY A HA2  1 
ATOM   227  H HA3  . GLY A 1 17  ? 30.262 -1.142  9.713   1.00   11.49 ? 42   GLY A HA3  1 
ATOM   228  N N    . ARG A 1 18  ? 29.469 -1.267  7.356   1.00   7.51  ? 43   ARG A N    1 
ATOM   229  C CA   . ARG A 1 18  ? 28.819 -1.519  6.080   1.00   6.98  ? 43   ARG A CA   1 
ATOM   230  C C    . ARG A 1 18  ? 28.347 -2.972  6.085   1.00   7.17  ? 43   ARG A C    1 
ATOM   231  O O    . ARG A 1 18  ? 29.149 -3.888  6.276   1.00   6.63  ? 43   ARG A O    1 
ATOM   232  C CB   . ARG A 1 18  ? 29.813 -1.325  4.931   1.00   7.31  ? 43   ARG A CB   1 
ATOM   233  C CG   . ARG A 1 18  ? 29.198 -1.581  3.577   1.00   7.77  ? 43   ARG A CG   1 
ATOM   234  C CD   . ARG A 1 18  ? 30.038 -1.067  2.423   1.00   8.44  ? 43   ARG A CD   1 
ATOM   235  N NE   . ARG A 1 18  ? 31.357 -1.699  2.368   1.00   7.27  ? 43   ARG A NE   1 
ATOM   236  C CZ   . ARG A 1 18  ? 31.686 -2.696  1.549   1.00   7.27  ? 43   ARG A CZ   1 
ATOM   237  N NH1  . ARG A 1 18  ? 30.813 -3.177  0.698   1.00   8.59  ? 43   ARG A NH1  1 
ATOM   238  N NH2  . ARG A 1 18  ? 32.901 -3.188  1.572   1.00   7.99  ? 43   ARG A NH2  1 
ATOM   239  H H    . ARG A 1 18  ? 30.169 -1.753  7.469   1.00   9.01  ? 43   ARG A H    1 
ATOM   240  H HA   . ARG A 1 18  ? 28.059 -0.929  5.959   1.00   8.38  ? 43   ARG A HA   1 
ATOM   241  H HB2  . ARG A 1 18  ? 30.137 -0.411  4.945   1.00   8.77  ? 43   ARG A HB2  1 
ATOM   242  H HB3  . ARG A 1 18  ? 30.553 -1.942  5.045   1.00   8.77  ? 43   ARG A HB3  1 
ATOM   243  H HG2  . ARG A 1 18  ? 29.084 -2.537  3.460   1.00   9.33  ? 43   ARG A HG2  1 
ATOM   244  H HG3  . ARG A 1 18  ? 28.335 -1.139  3.537   1.00   9.33  ? 43   ARG A HG3  1 
ATOM   245  H HD2  . ARG A 1 18  ? 29.580 -1.255  1.589   1.00   10.13 ? 43   ARG A HD2  1 
ATOM   246  H HD3  . ARG A 1 18  ? 30.167 -0.111  2.525   1.00   10.13 ? 43   ARG A HD3  1 
ATOM   247  H HE   . ARG A 1 18  ? 31.963 -1.405  2.902   1.00   8.72  ? 43   ARG A HE   1 
ATOM   248  H HH11 . ARG A 1 18  ? 30.015 -2.857  0.674   1.00   10.30 ? 43   ARG A HH11 1 
ATOM   249  H HH12 . ARG A 1 18  ? 31.036 -3.819  0.171   1.00   10.30 ? 43   ARG A HH12 1 
ATOM   250  H HH21 . ARG A 1 18  ? 33.481 -2.877  2.125   1.00   9.59  ? 43   ARG A HH21 1 
ATOM   251  H HH22 . ARG A 1 18  ? 33.114 -3.831  1.042   1.00   9.59  ? 43   ARG A HH22 1 
ATOM   252  N N    . LEU A 1 19  ? 27.046 -3.158  5.909   1.00   7.19  ? 44   LEU A N    1 
ATOM   253  C CA   . LEU A 1 19  ? 26.386 -4.456  5.989   1.00   7.68  ? 44   LEU A CA   1 
ATOM   254  C C    . LEU A 1 19  ? 26.001 -4.920  4.599   1.00   7.42  ? 44   LEU A C    1 
ATOM   255  O O    . LEU A 1 19  ? 25.440 -4.149  3.806   1.00   8.64  ? 44   LEU A O    1 
ATOM   256  C CB   . LEU A 1 19  ? 25.124 -4.285  6.811   1.00   8.28  ? 44   LEU A CB   1 
ATOM   257  C CG   . LEU A 1 19  ? 24.213 -5.503  6.957   1.00   8.48  ? 44   LEU A CG   1 
ATOM   258  C CD1  . LEU A 1 19  ? 24.919 -6.615  7.698   1.00   8.71  ? 44   LEU A CD1  1 
ATOM   259  C CD2  . LEU A 1 19  ? 22.926 -5.106  7.680   1.00   9.21  ? 44   LEU A CD2  1 
ATOM   260  H H    . LEU A 1 19  ? 26.500 -2.517  5.734   1.00   8.63  ? 44   LEU A H    1 
ATOM   261  H HA   . LEU A 1 19  ? 26.965 -5.113  6.407   1.00   9.22  ? 44   LEU A HA   1 
ATOM   262  H HB2  . LEU A 1 19  ? 25.382 -4.014  7.705   1.00   9.94  ? 44   LEU A HB2  1 
ATOM   263  H HB3  . LEU A 1 19  ? 24.595 -3.581  6.405   1.00   9.94  ? 44   LEU A HB3  1 
ATOM   264  H HG   . LEU A 1 19  ? 23.975 -5.830  6.076   1.00   10.17 ? 44   LEU A HG   1 
ATOM   265  H HD11 . LEU A 1 19  ? 25.168 -6.298  8.580   1.00   10.45 ? 44   LEU A HD11 1 
ATOM   266  H HD12 . LEU A 1 19  ? 24.318 -7.373  7.776   1.00   10.45 ? 44   LEU A HD12 1 
ATOM   267  H HD13 . LEU A 1 19  ? 25.712 -6.871  7.201   1.00   10.45 ? 44   LEU A HD13 1 
ATOM   268  H HD21 . LEU A 1 19  ? 22.472 -4.423  7.164   1.00   11.05 ? 44   LEU A HD21 1 
ATOM   269  H HD22 . LEU A 1 19  ? 22.359 -5.889  7.766   1.00   11.05 ? 44   LEU A HD22 1 
ATOM   270  H HD23 . LEU A 1 19  ? 23.151 -4.763  8.559   1.00   11.05 ? 44   LEU A HD23 1 
ATOM   271  N N    . GLY A 1 20  ? 26.264 -6.204  4.323   1.00   6.28  ? 45   GLY A N    1 
ATOM   272  C CA   . GLY A 1 20  ? 25.879 -6.834  3.074   1.00   6.30  ? 45   GLY A CA   1 
ATOM   273  C C    . GLY A 1 20  ? 25.107 -8.105  3.350   1.00   5.90  ? 45   GLY A C    1 
ATOM   274  O O    . GLY A 1 20  ? 25.587 -8.962  4.085   1.00   6.23  ? 45   GLY A O    1 
ATOM   275  H H    . GLY A 1 20  ? 26.674 -6.734  4.862   1.00   7.54  ? 45   GLY A H    1 
ATOM   276  H HA2  . GLY A 1 20  ? 25.321 -6.232  2.558   1.00   7.56  ? 45   GLY A HA2  1 
ATOM   277  H HA3  . GLY A 1 20  ? 26.670 -7.052  2.556   1.00   7.56  ? 45   GLY A HA3  1 
ATOM   278  N N    . VAL A 1 21  ? 23.905 -8.202  2.801   1.00   6.16  ? 46   VAL A N    1 
ATOM   279  C CA   . VAL A 1 21  ? 23.059 -9.347  3.041   1.00   6.31  ? 46   VAL A CA   1 
ATOM   280  C C    . VAL A 1 21  ? 22.518 -9.856  1.726   1.00   6.35  ? 46   VAL A C    1 
ATOM   281  O O    . VAL A 1 21  ? 22.044 -9.077  0.893   1.00   6.68  ? 46   VAL A O    1 
ATOM   282  C CB   . VAL A 1 21  ? 21.883 -8.982  3.979   1.00   6.74  ? 46   VAL A CB   1 
ATOM   283  C CG1  . VAL A 1 21  ? 20.927 -10.166 4.120   1.00   7.28  ? 46   VAL A CG1  1 
ATOM   284  C CG2  . VAL A 1 21  ? 22.358 -8.496  5.348   1.00   7.26  ? 46   VAL A CG2  1 
ATOM   285  H H    . VAL A 1 21  ? 23.557 -7.610  2.283   1.00   7.39  ? 46   VAL A H    1 
ATOM   286  H HA   . VAL A 1 21  ? 23.578 -10.054 3.456   1.00   7.57  ? 46   VAL A HA   1 
ATOM   287  H HB   . VAL A 1 21  ? 21.384 -8.256  3.572   1.00   8.08  ? 46   VAL A HB   1 
ATOM   288  H HG11 . VAL A 1 21  ? 21.412 -10.919 4.492   1.00   8.73  ? 46   VAL A HG11 1 
ATOM   289  H HG12 . VAL A 1 21  ? 20.200 -9.915  4.710   1.00   8.73  ? 46   VAL A HG12 1 
ATOM   290  H HG13 . VAL A 1 21  ? 20.579 -10.396 3.244   1.00   8.73  ? 46   VAL A HG13 1 
ATOM   291  H HG21 . VAL A 1 21  ? 22.908 -7.706  5.229   1.00   8.72  ? 46   VAL A HG21 1 
ATOM   292  H HG22 . VAL A 1 21  ? 21.585 -8.282  5.893   1.00   8.72  ? 46   VAL A HG22 1 
ATOM   293  H HG23 . VAL A 1 21  ? 22.876 -9.199  5.770   1.00   8.72  ? 46   VAL A HG23 1 
ATOM   294  N N    . ALA A 1 22  ? 22.537 -11.187 1.562   1.00   5.55  ? 47   ALA A N    1 
ATOM   295  C CA   . ALA A 1 22  ? 21.765 -11.812 0.524   1.00   5.64  ? 47   ALA A CA   1 
ATOM   296  C C    . ALA A 1 22  ? 21.151 -13.067 1.093   1.00   5.41  ? 47   ALA A C    1 
ATOM   297  O O    . ALA A 1 22  ? 21.863 -13.982 1.525   1.00   5.43  ? 47   ALA A O    1 
ATOM   298  C CB   . ALA A 1 22  ? 22.614 -12.141 -0.674  1.00   6.18  ? 47   ALA A CB   1 
ATOM   299  H H    . ALA A 1 22  ? 22.991 -11.733 2.046   1.00   6.66  ? 47   ALA A H    1 
ATOM   300  H HA   . ALA A 1 22  ? 21.052 -11.217 0.244   1.00   6.76  ? 47   ALA A HA   1 
ATOM   301  H HB1  . ALA A 1 22  ? 23.320 -12.748 -0.403  1.00   7.42  ? 47   ALA A HB1  1 
ATOM   302  H HB2  . ALA A 1 22  ? 22.057 -12.560 -1.349  1.00   7.42  ? 47   ALA A HB2  1 
ATOM   303  H HB3  . ALA A 1 22  ? 22.997 -11.321 -1.023  1.00   7.42  ? 47   ALA A HB3  1 
ATOM   304  N N    . LEU A 1 23  ? 19.826 -13.105 1.067   1.00   5.94  ? 48   LEU A N    1 
ATOM   305  C CA   A LEU A 1 23  ? 19.055 -14.302 1.397   0.61   6.58  ? 48   LEU A CA   1 
ATOM   306  C CA   B LEU A 1 23  ? 19.018 -14.267 1.420   0.39   6.29  ? 48   LEU A CA   1 
ATOM   307  C C    . LEU A 1 23  ? 18.352 -14.767 0.146   1.00   6.30  ? 48   LEU A C    1 
ATOM   308  O O    . LEU A 1 23  ? 17.704 -13.974 -0.547  1.00   7.30  ? 48   LEU A O    1 
ATOM   309  C CB   A LEU A 1 23  ? 18.035 -14.033 2.500   0.61   7.73  ? 48   LEU A CB   1 
ATOM   310  C CB   B LEU A 1 23  ? 17.939 -13.852 2.426   0.39   6.97  ? 48   LEU A CB   1 
ATOM   311  C CG   A LEU A 1 23  ? 17.246 -15.299 2.881   0.61   8.56  ? 48   LEU A CG   1 
ATOM   312  C CG   B LEU A 1 23  ? 16.956 -14.950 2.855   0.39   7.90  ? 48   LEU A CG   1 
ATOM   313  C CD1  A LEU A 1 23  ? 17.029 -15.364 4.377   0.61   8.93  ? 48   LEU A CD1  1 
ATOM   314  C CD1  B LEU A 1 23  ? 17.647 -15.900 3.803   0.39   6.84  ? 48   LEU A CD1  1 
ATOM   315  C CD2  A LEU A 1 23  ? 15.905 -15.347 2.168   0.61   8.46  ? 48   LEU A CD2  1 
ATOM   316  C CD2  B LEU A 1 23  ? 15.700 -14.412 3.488   0.39   9.35  ? 48   LEU A CD2  1 
ATOM   317  H H    A LEU A 1 23  ? 19.334 -12.432 0.857   0.61   7.13  ? 48   LEU A H    1 
ATOM   318  H H    B LEU A 1 23  ? 19.346 -12.430 0.836   0.39   7.13  ? 48   LEU A H    1 
ATOM   319  H HA   A LEU A 1 23  ? 19.654 -15.004 1.694   0.61   7.89  ? 48   LEU A HA   1 
ATOM   320  H HA   B LEU A 1 23  ? 19.570 -14.968 1.800   0.39   7.55  ? 48   LEU A HA   1 
ATOM   321  H HB2  A LEU A 1 23  ? 18.498 -13.716 3.291   0.61   9.27  ? 48   LEU A HB2  1 
ATOM   322  H HB2  B LEU A 1 23  ? 18.379 -13.529 3.229   0.39   8.37  ? 48   LEU A HB2  1 
ATOM   323  H HB3  A LEU A 1 23  ? 17.403 -13.364 2.192   0.61   9.27  ? 48   LEU A HB3  1 
ATOM   324  H HB3  B LEU A 1 23  ? 17.417 -13.134 2.035   0.39   8.37  ? 48   LEU A HB3  1 
ATOM   325  H HG   A LEU A 1 23  ? 17.755 -16.081 2.617   0.61   10.27 ? 48   LEU A HG   1 
ATOM   326  H HG   B LEU A 1 23  ? 16.696 -15.456 2.069   0.39   9.48  ? 48   LEU A HG   1 
ATOM   327  H HD11 A LEU A 1 23  ? 16.529 -14.581 4.657   0.61   10.71 ? 48   LEU A HD11 1 
ATOM   328  H HD11 B LEU A 1 23  ? 17.946 -15.406 4.583   0.39   8.21  ? 48   LEU A HD11 1 
ATOM   329  H HD12 A LEU A 1 23  ? 16.531 -16.169 4.589   0.61   10.71 ? 48   LEU A HD12 1 
ATOM   330  H HD12 B LEU A 1 23  ? 17.020 -16.591 4.069   0.39   8.21  ? 48   LEU A HD12 1 
ATOM   331  H HD13 A LEU A 1 23  ? 17.892 -15.382 4.820   0.61   10.71 ? 48   LEU A HD13 1 
ATOM   332  H HD13 B LEU A 1 23  ? 18.407 -16.299 3.352   0.39   8.21  ? 48   LEU A HD13 1 
ATOM   333  H HD21 A LEU A 1 23  ? 16.058 -15.349 1.210   0.61   10.16 ? 48   LEU A HD21 1 
ATOM   334  H HD21 B LEU A 1 23  ? 15.246 -13.840 2.850   0.39   11.21 ? 48   LEU A HD21 1 
ATOM   335  H HD22 A LEU A 1 23  ? 15.437 -16.154 2.430   0.61   10.16 ? 48   LEU A HD22 1 
ATOM   336  H HD22 B LEU A 1 23  ? 15.128 -15.156 3.733   0.39   11.21 ? 48   LEU A HD22 1 
ATOM   337  H HD23 A LEU A 1 23  ? 15.387 -14.566 2.419   0.61   10.16 ? 48   LEU A HD23 1 
ATOM   338  H HD23 B LEU A 1 23  ? 15.939 -13.904 4.279   0.39   11.21 ? 48   LEU A HD23 1 
ATOM   339  N N    . ILE A 1 24  ? 18.498 -16.047 -0.135  1.00   5.90  ? 49   ILE A N    1 
ATOM   340  C CA   . ILE A 1 24  ? 17.762 -16.723 -1.173  1.00   6.11  ? 49   ILE A CA   1 
ATOM   341  C C    . ILE A 1 24  ? 16.791 -17.681 -0.495  1.00   6.23  ? 49   ILE A C    1 
ATOM   342  O O    . ILE A 1 24  ? 17.201 -18.555 0.258   1.00   5.99  ? 49   ILE A O    1 
ATOM   343  C CB   . ILE A 1 24  ? 18.678 -17.498 -2.121  1.00   6.88  ? 49   ILE A CB   1 
ATOM   344  C CG1  . ILE A 1 24  ? 19.690 -16.560 -2.814  1.00   7.55  ? 49   ILE A CG1  1 
ATOM   345  C CG2  . ILE A 1 24  ? 17.847 -18.240 -3.167  1.00   7.34  ? 49   ILE A CG2  1 
ATOM   346  C CD1  . ILE A 1 24  ? 20.763 -17.281 -3.596  1.00   8.43  ? 49   ILE A CD1  1 
ATOM   347  H H    . ILE A 1 24  ? 19.044 -16.563 0.283   1.00   7.08  ? 49   ILE A H    1 
ATOM   348  H HA   . ILE A 1 24  ? 17.254 -16.078 -1.689  1.00   7.33  ? 49   ILE A HA   1 
ATOM   349  H HB   . ILE A 1 24  ? 19.172 -18.152 -1.603  1.00   8.25  ? 49   ILE A HB   1 
ATOM   350  H HG12 . ILE A 1 24  ? 19.211 -15.986 -3.431  1.00   9.05  ? 49   ILE A HG12 1 
ATOM   351  H HG13 . ILE A 1 24  ? 20.129 -16.021 -2.138  1.00   9.05  ? 49   ILE A HG13 1 
ATOM   352  H HG21 . ILE A 1 24  ? 17.330 -17.594 -3.675  1.00   8.81  ? 49   ILE A HG21 1 
ATOM   353  H HG22 . ILE A 1 24  ? 18.444 -18.724 -3.758  1.00   8.81  ? 49   ILE A HG22 1 
ATOM   354  H HG23 . ILE A 1 24  ? 17.252 -18.859 -2.716  1.00   8.81  ? 49   ILE A HG23 1 
ATOM   355  H HD11 . ILE A 1 24  ? 20.344 -17.817 -4.287  1.00   10.11 ? 49   ILE A HD11 1 
ATOM   356  H HD12 . ILE A 1 24  ? 21.355 -16.626 -3.998  1.00   10.11 ? 49   ILE A HD12 1 
ATOM   357  H HD13 . ILE A 1 24  ? 21.263 -17.852 -2.992  1.00   10.11 ? 49   ILE A HD13 1 
ATOM   358  N N    . ASN A 1 25  ? 15.506 -17.502 -0.771  1.00   5.96  ? 50   ASN A N    1 
ATOM   359  C CA   . ASN A 1 25  ? 14.471 -18.390 -0.286  1.00   6.18  ? 50   ASN A CA   1 
ATOM   360  C C    . ASN A 1 25  ? 14.201 -19.406 -1.368  1.00   6.23  ? 50   ASN A C    1 
ATOM   361  O O    . ASN A 1 25  ? 13.634 -19.075 -2.416  1.00   7.19  ? 50   ASN A O    1 
ATOM   362  C CB   . ASN A 1 25  ? 13.226 -17.602 0.041   1.00   7.96  ? 50   ASN A CB   1 
ATOM   363  C CG   . ASN A 1 25  ? 12.077 -18.487 0.413   1.00   11.05 ? 50   ASN A CG   1 
ATOM   364  O OD1  . ASN A 1 25  ? 12.194 -19.694 0.509   1.00   9.37  ? 50   ASN A OD1  1 
ATOM   365  N ND2  . ASN A 1 25  ? 10.922 -17.877 0.589   1.00   14.98 ? 50   ASN A ND2  1 
ATOM   366  H H    . ASN A 1 25  ? 15.205 -16.855 -1.251  1.00   7.15  ? 50   ASN A H    1 
ATOM   367  H HA   . ASN A 1 25  ? 14.774 -18.849 0.513   1.00   7.41  ? 50   ASN A HA   1 
ATOM   368  H HB2  . ASN A 1 25  ? 13.409 -17.014 0.791   1.00   9.56  ? 50   ASN A HB2  1 
ATOM   369  H HB3  . ASN A 1 25  ? 12.966 -17.081 -0.735  1.00   9.56  ? 50   ASN A HB3  1 
ATOM   370  H HD21 . ASN A 1 25  ? 10.866 -17.025 0.488   1.00   17.98 ? 50   ASN A HD21 1 
ATOM   371  H HD22 . ASN A 1 25  ? 10.224 -18.332 0.804   1.00   17.98 ? 50   ASN A HD22 1 
ATOM   372  N N    . THR A 1 26  ? 14.636 -20.653 -1.154  1.00   6.40  ? 51   THR A N    1 
ATOM   373  C CA   . THR A 1 26  ? 14.529 -21.639 -2.225  1.00   7.52  ? 51   THR A CA   1 
ATOM   374  C C    . THR A 1 26  ? 13.094 -22.136 -2.440  1.00   9.16  ? 51   THR A C    1 
ATOM   375  O O    . THR A 1 26  ? 12.843 -22.892 -3.365  1.00   10.57 ? 51   THR A O    1 
ATOM   376  C CB   . THR A 1 26  ? 15.482 -22.831 -2.055  1.00   7.22  ? 51   THR A CB   1 
ATOM   377  O OG1  . THR A 1 26  ? 15.078 -23.676 -0.976  1.00   5.88  ? 51   THR A OG1  1 
ATOM   378  C CG2  . THR A 1 26  ? 16.915 -22.357 -1.849  1.00   7.41  ? 51   THR A CG2  1 
ATOM   379  H H    . THR A 1 26  ? 14.985 -20.943 -0.423  1.00   7.69  ? 51   THR A H    1 
ATOM   380  H HA   . THR A 1 26  ? 14.791 -21.197 -3.048  1.00   9.02  ? 51   THR A HA   1 
ATOM   381  H HB   . THR A 1 26  ? 15.465 -23.352 -2.872  1.00   8.66  ? 51   THR A HB   1 
ATOM   382  H HG1  . THR A 1 26  ? 15.072 -23.242 -0.257  1.00   7.05  ? 51   THR A HG1  1 
ATOM   383  H HG21 . THR A 1 26  ? 16.971 -21.804 -1.054  1.00   8.89  ? 51   THR A HG21 1 
ATOM   384  H HG22 . THR A 1 26  ? 17.504 -23.121 -1.743  1.00   8.89  ? 51   THR A HG22 1 
ATOM   385  H HG23 . THR A 1 26  ? 17.206 -21.838 -2.616  1.00   8.89  ? 51   THR A HG23 1 
ATOM   386  N N    . ALA A 1 27  ? 12.145 -21.686 -1.631  1.00   9.45  ? 52   ALA A N    1 
ATOM   387  C CA   . ALA A 1 27  ? 10.729 -22.030 -1.887  1.00   12.57 ? 52   ALA A CA   1 
ATOM   388  C C    . ALA A 1 27  ? 10.312 -21.475 -3.242  1.00   13.57 ? 52   ALA A C    1 
ATOM   389  O O    . ALA A 1 27  ? 9.607  -22.145 -4.022  1.00   15.53 ? 52   ALA A O    1 
ATOM   390  C CB   . ALA A 1 27  ? 9.838  -21.464 -0.803  1.00   14.37 ? 52   ALA A CB   1 
ATOM   391  H H    . ALA A 1 27  ? 12.277 -21.191 -0.940  1.00   11.34 ? 52   ALA A H    1 
ATOM   392  H HA   . ALA A 1 27  ? 10.625 -22.994 -1.901  1.00   15.08 ? 52   ALA A HA   1 
ATOM   393  H HB1  . ALA A 1 27  ? 9.934  -20.499 -0.789  1.00   17.25 ? 52   ALA A HB1  1 
ATOM   394  H HB2  . ALA A 1 27  ? 8.918  -21.704 -0.994  1.00   17.25 ? 52   ALA A HB2  1 
ATOM   395  H HB3  . ALA A 1 27  ? 10.107 -21.836 0.052   1.00   17.25 ? 52   ALA A HB3  1 
ATOM   396  N N    . ASP A 1 28  ? 10.746 -20.256 -3.536  1.00   13.30 ? 53   ASP A N    1 
ATOM   397  C CA   . ASP A 1 28  ? 10.240 -19.522 -4.702  1.00   14.91 ? 53   ASP A CA   1 
ATOM   398  C C    . ASP A 1 28  ? 11.332 -18.732 -5.407  1.00   16.11 ? 53   ASP A C    1 
ATOM   399  O O    . ASP A 1 28  ? 11.062 -17.972 -6.337  1.00   17.32 ? 53   ASP A O    1 
ATOM   400  C CB   . ASP A 1 28  ? 9.062  -18.623 -4.313  1.00   16.41 ? 53   ASP A CB   1 
ATOM   401  C CG   . ASP A 1 28  ? 9.436  -17.566 -3.311  1.00   16.85 ? 53   ASP A CG   1 
ATOM   402  O OD1  . ASP A 1 28  ? 10.594 -17.534 -2.871  1.00   14.77 ? 53   ASP A OD1  1 
ATOM   403  O OD2  . ASP A 1 28  ? 8.558  -16.757 -2.951  1.00   19.61 ? 53   ASP A OD2  1 
ATOM   404  H H    . ASP A 1 28  ? 11.334 -19.826 -3.079  1.00   15.95 ? 53   ASP A H    1 
ATOM   405  H HA   . ASP A 1 28  ? 9.903  -20.171 -5.340  1.00   17.89 ? 53   ASP A HA   1 
ATOM   406  H HB2  . ASP A 1 28  ? 8.730  -18.177 -5.108  1.00   19.69 ? 53   ASP A HB2  1 
ATOM   407  H HB3  . ASP A 1 28  ? 8.362  -19.170 -3.923  1.00   19.69 ? 53   ASP A HB3  1 
ATOM   408  N N    . ASN A 1 29  ? 12.570 -18.933 -4.972  1.00   15.72 ? 54   ASN A N    1 
ATOM   409  C CA   . ASN A 1 29  ? 13.709 -18.281 -5.584  1.00   17.69 ? 54   ASN A CA   1 
ATOM   410  C C    . ASN A 1 29  ? 13.722 -16.763 -5.323  1.00   15.75 ? 54   ASN A C    1 
ATOM   411  O O    . ASN A 1 29  ? 14.494 -16.026 -5.937  1.00   16.85 ? 54   ASN A O    1 
ATOM   412  C CB   . ASN A 1 29  ? 13.786 -18.623 -7.094  1.00   22.47 ? 54   ASN A CB   1 
ATOM   413  C CG   . ASN A 1 29  ? 13.352 -20.078 -7.409  1.00   26.28 ? 54   ASN A CG   1 
ATOM   414  O OD1  . ASN A 1 29  ? 12.602 -20.337 -8.360  1.00   28.59 ? 54   ASN A OD1  1 
ATOM   415  N ND2  . ASN A 1 29  ? 13.834 -21.018 -6.617  1.00   26.72 ? 54   ASN A ND2  1 
ATOM   416  H H    . ASN A 1 29  ? 12.775 -19.450 -4.316  1.00   18.87 ? 54   ASN A H    1 
ATOM   417  H HA   . ASN A 1 29  ? 14.511 -18.641 -5.174  1.00   21.22 ? 54   ASN A HA   1 
ATOM   418  H HB2  . ASN A 1 29  ? 13.200 -18.024 -7.582  1.00   26.96 ? 54   ASN A HB2  1 
ATOM   419  H HB3  . ASN A 1 29  ? 14.701 -18.511 -7.396  1.00   26.96 ? 54   ASN A HB3  1 
ATOM   420  H HD21 . ASN A 1 29  ? 14.358 -20.807 -5.968  1.00   32.06 ? 54   ASN A HD21 1 
ATOM   421  H HD22 . ASN A 1 29  ? 13.624 -21.841 -6.749  1.00   32.06 ? 54   ASN A HD22 1 
ATOM   422  N N    . SER A 1 30  ? 12.892 -16.297 -4.390  1.00   12.10 ? 55   SER A N    1 
ATOM   423  C CA   . SER A 1 30  ? 12.878 -14.907 -4.007  1.00   11.57 ? 55   SER A CA   1 
ATOM   424  C C    . SER A 1 30  ? 14.116 -14.594 -3.199  1.00   10.50 ? 55   SER A C    1 
ATOM   425  O O    . SER A 1 30  ? 14.776 -15.483 -2.644  1.00   11.35 ? 55   SER A O    1 
ATOM   426  C CB   . SER A 1 30  ? 11.608 -14.540 -3.235  1.00   12.80 ? 55   SER A CB   1 
ATOM   427  O OG   . SER A 1 30  ? 11.531 -15.209 -1.996  1.00   13.37 ? 55   SER A OG   1 
ATOM   428  H H    . SER A 1 30  ? 12.322 -16.780 -3.965  1.00   14.52 ? 55   SER A H    1 
ATOM   429  H HA   . SER A 1 30  ? 12.904 -14.362 -4.810  1.00   13.89 ? 55   SER A HA   1 
ATOM   430  H HB2  . SER A 1 30  ? 11.606 -13.584 -3.074  1.00   15.36 ? 55   SER A HB2  1 
ATOM   431  H HB3  . SER A 1 30  ? 10.836 -14.785 -3.770  1.00   15.36 ? 55   SER A HB3  1 
ATOM   432  H HG   . SER A 1 30  ? 11.529 -16.040 -2.118  1.00   16.04 ? 55   SER A HG   1 
ATOM   433  N N    . GLN A 1 31  ? 14.428 -13.303 -3.131  1.00   11.15 ? 56   GLN A N    1 
ATOM   434  C CA   . GLN A 1 31  ? 15.644 -12.829 -2.498  1.00   10.97 ? 56   GLN A CA   1 
ATOM   435  C C    . GLN A 1 31  ? 15.397 -11.616 -1.638  1.00   10.40 ? 56   GLN A C    1 
ATOM   436  O O    . GLN A 1 31  ? 14.538 -10.778 -1.954  1.00   12.47 ? 56   GLN A O    1 
ATOM   437  C CB   . GLN A 1 31  ? 16.663 -12.473 -3.581  1.00   12.86 ? 56   GLN A CB   1 
ATOM   438  C CG   . GLN A 1 31  ? 17.031 -13.660 -4.443  1.00   14.71 ? 56   GLN A CG   1 
ATOM   439  C CD   . GLN A 1 31  ? 17.941 -13.294 -5.597  1.00   17.94 ? 56   GLN A CD   1 
ATOM   440  O OE1  . GLN A 1 31  ? 18.137 -12.121 -5.909  1.00   18.59 ? 56   GLN A OE1  1 
ATOM   441  N NE2  . GLN A 1 31  ? 18.491 -14.302 -6.243  1.00   19.36 ? 56   GLN A NE2  1 
ATOM   442  H H    . GLN A 1 31  ? 13.938 -12.673 -3.452  1.00   13.38 ? 56   GLN A H    1 
ATOM   443  H HA   . GLN A 1 31  ? 16.016 -13.531 -1.942  1.00   13.17 ? 56   GLN A HA   1 
ATOM   444  H HB2  . GLN A 1 31  ? 16.287 -11.789 -4.157  1.00   15.43 ? 56   GLN A HB2  1 
ATOM   445  H HB3  . GLN A 1 31  ? 17.472 -12.146 -3.159  1.00   15.43 ? 56   GLN A HB3  1 
ATOM   446  H HG2  . GLN A 1 31  ? 17.490 -14.316 -3.896  1.00   17.65 ? 56   GLN A HG2  1 
ATOM   447  H HG3  . GLN A 1 31  ? 16.220 -14.045 -4.812  1.00   17.65 ? 56   GLN A HG3  1 
ATOM   448  H HE21 . GLN A 1 31  ? 18.323 -15.110 -6.001  1.00   23.23 ? 56   GLN A HE21 1 
ATOM   449  H HE22 . GLN A 1 31  ? 19.016 -14.152 -6.907  1.00   23.23 ? 56   GLN A HE22 1 
ATOM   450  N N    . ILE A 1 32  ? 16.187 -11.509 -0.583  1.00   9.78  ? 57   ILE A N    1 
ATOM   451  C CA   . ILE A 1 32  ? 16.259 -10.301 0.225   1.00   9.77  ? 57   ILE A CA   1 
ATOM   452  C C    . ILE A 1 32  ? 17.701 -9.842  0.141   1.00   9.44  ? 57   ILE A C    1 
ATOM   453  O O    . ILE A 1 32  ? 18.623 -10.562 0.562   1.00   8.74  ? 57   ILE A O    1 
ATOM   454  C CB   . ILE A 1 32  ? 15.873 -10.553 1.688   1.00   11.28 ? 57   ILE A CB   1 
ATOM   455  C CG1  . ILE A 1 32  ? 14.448 -11.130 1.751   1.00   13.77 ? 57   ILE A CG1  1 
ATOM   456  C CG2  . ILE A 1 32  ? 16.056 -9.249  2.501   1.00   12.81 ? 57   ILE A CG2  1 
ATOM   457  C CD1  . ILE A 1 32  ? 13.974 -11.468 3.168   1.00   15.70 ? 57   ILE A CD1  1 
ATOM   458  H H    . ILE A 1 32  ? 16.705 -12.138 -0.307  1.00   11.73 ? 57   ILE A H    1 
ATOM   459  H HA   . ILE A 1 32  ? 15.682 -9.614  -0.145  1.00   11.72 ? 57   ILE A HA   1 
ATOM   460  H HB   . ILE A 1 32  ? 16.481 -11.218 2.048   1.00   13.54 ? 57   ILE A HB   1 
ATOM   461  H HG12 . ILE A 1 32  ? 13.831 -10.479 1.381   1.00   16.52 ? 57   ILE A HG12 1 
ATOM   462  H HG13 . ILE A 1 32  ? 14.418 -11.946 1.227   1.00   16.52 ? 57   ILE A HG13 1 
ATOM   463  H HG21 . ILE A 1 32  ? 15.485 -8.561  2.127   1.00   15.37 ? 57   ILE A HG21 1 
ATOM   464  H HG22 . ILE A 1 32  ? 15.811 -9.417  3.425   1.00   15.37 ? 57   ILE A HG22 1 
ATOM   465  H HG23 . ILE A 1 32  ? 16.985 -8.974  2.450   1.00   15.37 ? 57   ILE A HG23 1 
ATOM   466  H HD11 . ILE A 1 32  ? 13.985 -10.660 3.705   1.00   18.84 ? 57   ILE A HD11 1 
ATOM   467  H HD12 . ILE A 1 32  ? 13.073 -11.823 3.122   1.00   18.84 ? 57   ILE A HD12 1 
ATOM   468  H HD13 . ILE A 1 32  ? 14.572 -12.128 3.551   1.00   18.84 ? 57   ILE A HD13 1 
ATOM   469  N N    . LEU A 1 33  ? 17.889 -8.655  -0.418  1.00   9.27  ? 59   LEU A N    1 
ATOM   470  C CA   . LEU A 1 33  ? 19.203 -8.128  -0.771  1.00   10.00 ? 59   LEU A CA   1 
ATOM   471  C C    . LEU A 1 33  ? 19.474 -6.788  -0.117  1.00   10.75 ? 59   LEU A C    1 
ATOM   472  O O    . LEU A 1 33  ? 18.605 -5.904  -0.098  1.00   11.79 ? 59   LEU A O    1 
ATOM   473  C CB   . LEU A 1 33  ? 19.289 -7.951  -2.279  1.00   10.44 ? 59   LEU A CB   1 
ATOM   474  C CG   . LEU A 1 33  ? 18.990 -9.203  -3.107  1.00   11.42 ? 59   LEU A CG   1 
ATOM   475  C CD1  . LEU A 1 33  ? 19.162 -8.871  -4.560  1.00   13.55 ? 59   LEU A CD1  1 
ATOM   476  C CD2  . LEU A 1 33  ? 19.879 -10.376 -2.747  1.00   11.04 ? 59   LEU A CD2  1 
ATOM   477  H H    . LEU A 1 33  ? 17.247 -8.116  -0.611  1.00   11.12 ? 59   LEU A H    1 
ATOM   478  H HA   . LEU A 1 33  ? 19.890 -8.753  -0.492  1.00   12.00 ? 59   LEU A HA   1 
ATOM   479  H HB2  . LEU A 1 33  ? 18.654 -7.268  -2.545  1.00   12.53 ? 59   LEU A HB2  1 
ATOM   480  H HB3  . LEU A 1 33  ? 20.187 -7.663  -2.503  1.00   12.53 ? 59   LEU A HB3  1 
ATOM   481  H HG   . LEU A 1 33  ? 18.068 -9.467  -2.964  1.00   13.71 ? 59   LEU A HG   1 
ATOM   482  H HD11 . LEU A 1 33  ? 20.075 -8.582  -4.712  1.00   16.27 ? 59   LEU A HD11 1 
ATOM   483  H HD12 . LEU A 1 33  ? 18.973 -9.663  -5.088  1.00   16.27 ? 59   LEU A HD12 1 
ATOM   484  H HD13 . LEU A 1 33  ? 18.546 -8.161  -4.797  1.00   16.27 ? 59   LEU A HD13 1 
ATOM   485  H HD21 . LEU A 1 33  ? 19.746 -10.597 -1.812  1.00   13.25 ? 59   LEU A HD21 1 
ATOM   486  H HD22 . LEU A 1 33  ? 19.642 -11.134 -3.303  1.00   13.25 ? 59   LEU A HD22 1 
ATOM   487  H HD23 . LEU A 1 33  ? 20.805 -10.129 -2.901  1.00   13.25 ? 59   LEU A HD23 1 
ATOM   488  N N    . TYR A 1 34  ? 20.676 -6.614  0.410   1.00   9.62  ? 60   TYR A N    1 
ATOM   489  C CA   . TYR A 1 34  ? 21.086 -5.338  0.983   1.00   9.66  ? 60   TYR A CA   1 
ATOM   490  C C    . TYR A 1 34  ? 22.558 -5.191  0.679   1.00   9.87  ? 60   TYR A C    1 
ATOM   491  O O    . TYR A 1 34  ? 23.369 -5.992  1.149   1.00   8.93  ? 60   TYR A O    1 
ATOM   492  C CB   . TYR A 1 34  ? 20.778 -5.294  2.477   1.00   10.49 ? 60   TYR A CB   1 
ATOM   493  C CG   . TYR A 1 34  ? 20.995 -3.924  3.040   1.00   10.93 ? 60   TYR A CG   1 
ATOM   494  C CD1  . TYR A 1 34  ? 20.001 -2.974  2.973   1.00   12.13 ? 60   TYR A CD1  1 
ATOM   495  C CD2  . TYR A 1 34  ? 22.226 -3.564  3.578   1.00   11.46 ? 60   TYR A CD2  1 
ATOM   496  C CE1  . TYR A 1 34  ? 20.205 -1.693  3.439   1.00   12.46 ? 60   TYR A CE1  1 
ATOM   497  C CE2  . TYR A 1 34  ? 22.448 -2.286  4.060   1.00   11.82 ? 60   TYR A CE2  1 
ATOM   498  C CZ   . TYR A 1 34  ? 21.426 -1.350  3.991   1.00   12.58 ? 60   TYR A CZ   1 
ATOM   499  O OH   . TYR A 1 34  ? 21.601 -0.053  4.450   1.00   13.50 ? 60   TYR A OH   1 
ATOM   500  H H    . TYR A 1 34  ? 21.281 -7.224  0.450   1.00   11.54 ? 60   TYR A H    1 
ATOM   501  H HA   . TYR A 1 34  ? 20.606 -4.616  0.547   1.00   11.59 ? 60   TYR A HA   1 
ATOM   502  H HB2  . TYR A 1 34  ? 19.850 -5.538  2.620   1.00   12.59 ? 60   TYR A HB2  1 
ATOM   503  H HB3  . TYR A 1 34  ? 21.364 -5.911  2.943   1.00   12.59 ? 60   TYR A HB3  1 
ATOM   504  H HD1  . TYR A 1 34  ? 19.180 -3.199  2.599   1.00   14.56 ? 60   TYR A HD1  1 
ATOM   505  H HD2  . TYR A 1 34  ? 22.910 -4.193  3.619   1.00   13.75 ? 60   TYR A HD2  1 
ATOM   506  H HE1  . TYR A 1 34  ? 19.520 -1.066  3.395   1.00   14.96 ? 60   TYR A HE1  1 
ATOM   507  H HE2  . TYR A 1 34  ? 23.272 -2.057  4.425   1.00   14.18 ? 60   TYR A HE2  1 
ATOM   508  H HH   . TYR A 1 34  ? 22.376 0.039   4.762   1.00   16.20 ? 60   TYR A HH   1 
ATOM   509  N N    . ARG A 1 35  ? 22.904 -4.219  -0.152  1.00   9.54  ? 61   ARG A N    1 
ATOM   510  C CA   . ARG A 1 35  ? 24.280 -4.057  -0.645  1.00   9.33  ? 61   ARG A CA   1 
ATOM   511  C C    . ARG A 1 35  ? 24.805 -5.375  -1.222  1.00   8.87  ? 61   ARG A C    1 
ATOM   512  O O    . ARG A 1 35  ? 25.983 -5.698  -1.119  1.00   8.78  ? 61   ARG A O    1 
ATOM   513  C CB   . ARG A 1 35  ? 25.239 -3.515  0.433   1.00   10.11 ? 61   ARG A CB   1 
ATOM   514  C CG   . ARG A 1 35  ? 24.792 -2.169  1.027   1.00   10.87 ? 61   ARG A CG   1 
ATOM   515  C CD   . ARG A 1 35  ? 25.941 -1.540  1.820   1.00   10.92 ? 61   ARG A CD   1 
ATOM   516  N NE   . ARG A 1 35  ? 25.476 -0.350  2.539   1.00   11.37 ? 61   ARG A NE   1 
ATOM   517  C CZ   . ARG A 1 35  ? 25.250 0.832   1.970   1.00   12.59 ? 61   ARG A CZ   1 
ATOM   518  N NH1  . ARG A 1 35  ? 25.511 0.996   0.686   1.00   12.82 ? 61   ARG A NH1  1 
ATOM   519  N NH2  . ARG A 1 35  ? 24.740 1.830   2.691   1.00   13.32 ? 61   ARG A NH2  1 
ATOM   520  H H    . ARG A 1 35  ? 22.358 -3.627  -0.454  1.00   11.45 ? 61   ARG A H    1 
ATOM   521  H HA   . ARG A 1 35  ? 24.268 -3.411  -1.368  1.00   11.19 ? 61   ARG A HA   1 
ATOM   522  H HB2  . ARG A 1 35  ? 25.292 -4.158  1.157   1.00   12.13 ? 61   ARG A HB2  1 
ATOM   523  H HB3  . ARG A 1 35  ? 26.116 -3.390  0.038   1.00   12.13 ? 61   ARG A HB3  1 
ATOM   524  H HG2  . ARG A 1 35  ? 24.544 -1.564  0.310   1.00   13.04 ? 61   ARG A HG2  1 
ATOM   525  H HG3  . ARG A 1 35  ? 24.044 -2.311  1.627   1.00   13.04 ? 61   ARG A HG3  1 
ATOM   526  H HD2  . ARG A 1 35  ? 26.274 -2.180  2.468   1.00   13.11 ? 61   ARG A HD2  1 
ATOM   527  H HD3  . ARG A 1 35  ? 26.647 -1.275  1.210   1.00   13.11 ? 61   ARG A HD3  1 
ATOM   528  H HE   . ARG A 1 35  ? 25.339 -0.420  3.385   1.00   13.64 ? 61   ARG A HE   1 
ATOM   529  H HH11 . ARG A 1 35  ? 25.815 0.339   0.221   1.00   15.38 ? 61   ARG A HH11 1 
ATOM   530  H HH12 . ARG A 1 35  ? 25.376 1.759   0.314   1.00   15.38 ? 61   ARG A HH12 1 
ATOM   531  H HH21 . ARG A 1 35  ? 24.589 1.719   3.530   1.00   15.98 ? 61   ARG A HH21 1 
ATOM   532  H HH22 . ARG A 1 35  ? 24.627 2.603   2.333   1.00   15.98 ? 61   ARG A HH22 1 
ATOM   533  N N    . ALA A 1 36  ? 23.916 -6.139  -1.853  1.00   8.92  ? 62   ALA A N    1 
ATOM   534  C CA   . ALA A 1 36  ? 24.256 -7.509  -2.219  1.00   8.87  ? 62   ALA A CA   1 
ATOM   535  C C    . ALA A 1 36  ? 25.157 -7.602  -3.448  1.00   8.66  ? 62   ALA A C    1 
ATOM   536  O O    . ALA A 1 36  ? 25.717 -8.663  -3.727  1.00   8.58  ? 62   ALA A O    1 
ATOM   537  C CB   . ALA A 1 36  ? 22.980 -8.323  -2.406  1.00   9.40  ? 62   ALA A CB   1 
ATOM   538  H H    . ALA A 1 36  ? 23.123 -5.893  -2.078  1.00   10.71 ? 62   ALA A H    1 
ATOM   539  H HA   . ALA A 1 36  ? 24.742 -7.906  -1.479  1.00   10.64 ? 62   ALA A HA   1 
ATOM   540  H HB1  . ALA A 1 36  ? 22.449 -7.920  -3.111  1.00   11.28 ? 62   ALA A HB1  1 
ATOM   541  H HB2  . ALA A 1 36  ? 23.218 -9.232  -2.649  1.00   11.28 ? 62   ALA A HB2  1 
ATOM   542  H HB3  . ALA A 1 36  ? 22.481 -8.322  -1.574  1.00   11.28 ? 62   ALA A HB3  1 
ATOM   543  N N    . ASP A 1 37  ? 25.302 -6.496  -4.176  1.00   9.36  ? 63   ASP A N    1 
ATOM   544  C CA   . ASP A 1 37  ? 26.237 -6.448  -5.306  1.00   10.70 ? 63   ASP A CA   1 
ATOM   545  C C    . ASP A 1 37  ? 27.512 -5.672  -4.970  1.00   10.72 ? 63   ASP A C    1 
ATOM   546  O O    . ASP A 1 37  ? 28.302 -5.376  -5.871  1.00   11.96 ? 63   ASP A O    1 
ATOM   547  C CB   . ASP A 1 37  ? 25.590 -5.833  -6.549  1.00   13.61 ? 63   ASP A CB   1 
ATOM   548  C CG   . ASP A 1 37  ? 24.515 -6.720  -7.147  1.00   16.40 ? 63   ASP A CG   1 
ATOM   549  O OD1  . ASP A 1 37  ? 24.722 -7.948  -7.289  1.00   16.05 ? 63   ASP A OD1  1 
ATOM   550  O OD2  . ASP A 1 37  ? 23.448 -6.175  -7.450  1.00   19.85 ? 63   ASP A OD2  1 
ATOM   551  H H    . ASP A 1 37  ? 24.875 -5.762  -4.040  1.00   11.24 ? 63   ASP A H    1 
ATOM   552  H HA   . ASP A 1 37  ? 26.497 -7.355  -5.530  1.00   12.84 ? 63   ASP A HA   1 
ATOM   553  H HB2  . ASP A 1 37  ? 25.182 -4.987  -6.308  1.00   16.33 ? 63   ASP A HB2  1 
ATOM   554  H HB3  . ASP A 1 37  ? 26.272 -5.693  -7.224  1.00   16.33 ? 63   ASP A HB3  1 
ATOM   555  N N    . GLU A 1 38  ? 27.721 -5.343  -3.700  1.00   10.09 ? 64   GLU A N    1 
ATOM   556  C CA   . GLU A 1 38  ? 28.965 -4.682  -3.283  1.00   9.48  ? 64   GLU A CA   1 
ATOM   557  C C    . GLU A 1 38  ? 29.991 -5.720  -2.854  1.00   8.45  ? 64   GLU A C    1 
ATOM   558  O O    . GLU A 1 38  ? 29.656 -6.725  -2.251  1.00   8.35  ? 64   GLU A O    1 
ATOM   559  C CB   . GLU A 1 38  ? 28.719 -3.757  -2.117  1.00   10.27 ? 64   GLU A CB   1 
ATOM   560  C CG   . GLU A 1 38  ? 27.738 -2.629  -2.452  1.00   11.26 ? 64   GLU A CG   1 
ATOM   561  C CD   . GLU A 1 38  ? 27.639 -1.569  -1.355  1.00   12.38 ? 64   GLU A CD   1 
ATOM   562  O OE1  . GLU A 1 38  ? 28.546 -1.523  -0.504  1.00   12.48 ? 64   GLU A OE1  1 
ATOM   563  O OE2  . GLU A 1 38  ? 26.649 -0.776  -1.373  1.00   12.09 ? 64   GLU A OE2  1 
ATOM   564  H H    . GLU A 1 38  ? 27.166 -5.488  -3.060  1.00   12.10 ? 64   GLU A H    1 
ATOM   565  H HA   . GLU A 1 38  ? 29.328 -4.168  -4.020  1.00   11.37 ? 64   GLU A HA   1 
ATOM   566  H HB2  . GLU A 1 38  ? 28.349 -4.268  -1.381  1.00   12.32 ? 64   GLU A HB2  1 
ATOM   567  H HB3  . GLU A 1 38  ? 29.560 -3.354  -1.851  1.00   12.32 ? 64   GLU A HB3  1 
ATOM   568  H HG2  . GLU A 1 38  ? 28.030 -2.190  -3.266  1.00   13.51 ? 64   GLU A HG2  1 
ATOM   569  H HG3  . GLU A 1 38  ? 26.854 -3.009  -2.581  1.00   13.51 ? 64   GLU A HG3  1 
ATOM   570  N N    . ARG A 1 39  ? 31.255 -5.440  -3.137  1.00   8.65  ? 65   ARG A N    1 
ATOM   571  C CA   . ARG A 1 39  ? 32.331 -6.338  -2.742  1.00   8.68  ? 65   ARG A CA   1 
ATOM   572  C C    . ARG A 1 39  ? 32.676 -6.173  -1.278  1.00   7.44  ? 65   ARG A C    1 
ATOM   573  O O    . ARG A 1 39  ? 32.705 -5.057  -0.736  1.00   7.99  ? 65   ARG A O    1 
ATOM   574  C CB   . ARG A 1 39  ? 33.592 -6.133  -3.588  1.00   10.55 ? 65   ARG A CB   1 
ATOM   575  C CG   . ARG A 1 39  ? 33.550 -6.792  -4.962  1.00   12.61 ? 65   ARG A CG   1 
ATOM   576  C CD   . ARG A 1 39  ? 34.847 -6.700  -5.745  1.00   13.63 ? 65   ARG A CD   1 
ATOM   577  N NE   . ARG A 1 39  ? 34.678 -7.359  -7.022  1.00   14.84 ? 65   ARG A NE   1 
ATOM   578  C CZ   . ARG A 1 39  ? 34.782 -8.670  -7.230  1.00   13.61 ? 65   ARG A CZ   1 
ATOM   579  N NH1  . ARG A 1 39  ? 35.112 -9.519  -6.258  1.00   9.81  ? 65   ARG A NH1  1 
ATOM   580  N NH2  . ARG A 1 39  ? 34.561 -9.131  -8.453  1.00   15.94 ? 65   ARG A NH2  1 
ATOM   581  H H    . ARG A 1 39  ? 31.517 -4.736  -3.557  1.00   10.38 ? 65   ARG A H    1 
ATOM   582  H HA   . ARG A 1 39  ? 32.035 -7.252  -2.874  1.00   10.42 ? 65   ARG A HA   1 
ATOM   583  H HB2  . ARG A 1 39  ? 33.723 -5.182  -3.722  1.00   12.66 ? 65   ARG A HB2  1 
ATOM   584  H HB3  . ARG A 1 39  ? 34.350 -6.503  -3.108  1.00   12.66 ? 65   ARG A HB3  1 
ATOM   585  H HG2  . ARG A 1 39  ? 33.342 -7.733  -4.849  1.00   15.13 ? 65   ARG A HG2  1 
ATOM   586  H HG3  . ARG A 1 39  ? 32.857 -6.365  -5.490  1.00   15.13 ? 65   ARG A HG3  1 
ATOM   587  H HD2  . ARG A 1 39  ? 35.069 -5.769  -5.903  1.00   16.35 ? 65   ARG A HD2  1 
ATOM   588  H HD3  . ARG A 1 39  ? 35.557 -7.144  -5.257  1.00   16.35 ? 65   ARG A HD3  1 
ATOM   589  H HE   . ARG A 1 39  ? 34.494 -6.865  -7.702  1.00   17.81 ? 65   ARG A HE   1 
ATOM   590  H HH11 . ARG A 1 39  ? 35.249 -9.228  -5.460  1.00   11.77 ? 65   ARG A HH11 1 
ATOM   591  H HH12 . ARG A 1 39  ? 35.179 -10.360 -6.426  1.00   11.77 ? 65   ARG A HH12 1 
ATOM   592  H HH21 . ARG A 1 39  ? 34.358 -8.587  -9.088  1.00   19.13 ? 65   ARG A HH21 1 
ATOM   593  H HH22 . ARG A 1 39  ? 34.641 -9.971  -8.617  1.00   19.13 ? 65   ARG A HH22 1 
ATOM   594  N N    . PHE A 1 40  ? 32.973 -7.299  -0.668  1.00   6.32  ? 66   PHE A N    1 
ATOM   595  C CA   . PHE A 1 40  ? 33.499 -7.383  0.684   1.00   5.75  ? 66   PHE A CA   1 
ATOM   596  C C    . PHE A 1 40  ? 34.602 -8.422  0.680   1.00   5.36  ? 66   PHE A C    1 
ATOM   597  O O    . PHE A 1 40  ? 34.544 -9.436  -0.036  1.00   4.96  ? 66   PHE A O    1 
ATOM   598  C CB   . PHE A 1 40  ? 32.463 -7.898  1.707   1.00   6.03  ? 66   PHE A CB   1 
ATOM   599  C CG   . PHE A 1 40  ? 31.257 -7.019  1.911   1.00   6.31  ? 66   PHE A CG   1 
ATOM   600  C CD1  . PHE A 1 40  ? 30.252 -6.946  0.959   1.00   6.82  ? 66   PHE A CD1  1 
ATOM   601  C CD2  . PHE A 1 40  ? 31.087 -6.322  3.085   1.00   6.48  ? 66   PHE A CD2  1 
ATOM   602  C CE1  . PHE A 1 40  ? 29.124 -6.157  1.153   1.00   6.84  ? 66   PHE A CE1  1 
ATOM   603  C CE2  . PHE A 1 40  ? 29.972 -5.533  3.292   1.00   6.57  ? 66   PHE A CE2  1 
ATOM   604  C CZ   . PHE A 1 40  ? 28.987 -5.451  2.333   1.00   6.95  ? 66   PHE A CZ   1 
ATOM   605  H H    . PHE A 1 40  ? 32.875 -8.071  -1.034  1.00   7.58  ? 66   PHE A H    1 
ATOM   606  H HA   . PHE A 1 40  ? 33.853 -6.527  0.973   1.00   6.90  ? 66   PHE A HA   1 
ATOM   607  H HB2  . PHE A 1 40  ? 32.144 -8.765  1.410   1.00   7.23  ? 66   PHE A HB2  1 
ATOM   608  H HB3  . PHE A 1 40  ? 32.903 -7.992  2.567   1.00   7.23  ? 66   PHE A HB3  1 
ATOM   609  H HD1  . PHE A 1 40  ? 30.344 -7.420  0.164   1.00   8.18  ? 66   PHE A HD1  1 
ATOM   610  H HD2  . PHE A 1 40  ? 31.744 -6.365  3.742   1.00   7.78  ? 66   PHE A HD2  1 
ATOM   611  H HE1  . PHE A 1 40  ? 28.466 -6.109  0.498   1.00   8.21  ? 66   PHE A HE1  1 
ATOM   612  H HE2  . PHE A 1 40  ? 29.883 -5.059  4.087   1.00   7.88  ? 66   PHE A HE2  1 
ATOM   613  H HZ   . PHE A 1 40  ? 28.238 -4.919  2.475   1.00   8.34  ? 66   PHE A HZ   1 
ATOM   614  N N    . ALA A 1 41  ? 35.600 -8.198  1.529   1.00   4.82  ? 67   ALA A N    1 
ATOM   615  C CA   . ALA A 1 41  ? 36.594 -9.230  1.799   1.00   4.92  ? 67   ALA A CA   1 
ATOM   616  C C    . ALA A 1 41  ? 35.899 -10.447 2.423   1.00   5.20  ? 67   ALA A C    1 
ATOM   617  O O    . ALA A 1 41  ? 35.199 -10.335 3.423   1.00   5.57  ? 67   ALA A O    1 
ATOM   618  C CB   . ALA A 1 41  ? 37.628 -8.690  2.741   1.00   5.12  ? 67   ALA A CB   1 
ATOM   619  H H    . ALA A 1 41  ? 35.723 -7.464  1.959   1.00   5.78  ? 67   ALA A H    1 
ATOM   620  H HA   . ALA A 1 41  ? 37.027 -9.500  0.974   1.00   5.91  ? 67   ALA A HA   1 
ATOM   621  H HB1  . ALA A 1 41  ? 37.195 -8.428  3.569   1.00   6.14  ? 67   ALA A HB1  1 
ATOM   622  H HB2  . ALA A 1 41  ? 38.286 -9.381  2.917   1.00   6.14  ? 67   ALA A HB2  1 
ATOM   623  H HB3  . ALA A 1 41  ? 38.056 -7.922  2.333   1.00   6.14  ? 67   ALA A HB3  1 
ATOM   624  N N    . MET A 1 42  ? 36.128 -11.610 1.837   1.00   4.39  ? 68   MET A N    1 
ATOM   625  C CA   . MET A 1 42  ? 35.506 -12.859 2.292   1.00   4.15  ? 68   MET A CA   1 
ATOM   626  C C    . MET A 1 42  ? 36.045 -13.343 3.619   1.00   3.80  ? 68   MET A C    1 
ATOM   627  O O    . MET A 1 42  ? 35.341 -14.060 4.358   1.00   4.18  ? 68   MET A O    1 
ATOM   628  C CB   . MET A 1 42  ? 35.767 -13.953 1.262   1.00   4.40  ? 68   MET A CB   1 
ATOM   629  C CG   . MET A 1 42  ? 34.980 -13.769 -0.009  1.00   4.35  ? 68   MET A CG   1 
ATOM   630  S SD   . MET A 1 42  ? 35.297 -15.068 -1.209  1.00   4.86  ? 68   MET A SD   1 
ATOM   631  C CE   . MET A 1 42  ? 36.929 -14.603 -1.814  1.00   5.50  ? 68   MET A CE   1 
ATOM   632  H H    . MET A 1 42  ? 36.648 -11.711 1.159   1.00   5.26  ? 68   MET A H    1 
ATOM   633  H HA   . MET A 1 42  ? 34.547 -12.730 2.364   1.00   4.98  ? 68   MET A HA   1 
ATOM   634  H HB2  . MET A 1 42  ? 36.709 -13.951 1.032   1.00   5.28  ? 68   MET A HB2  1 
ATOM   635  H HB3  . MET A 1 42  ? 35.521 -14.810 1.644   1.00   5.28  ? 68   MET A HB3  1 
ATOM   636  H HG2  . MET A 1 42  ? 34.033 -13.778 0.201   1.00   5.22  ? 68   MET A HG2  1 
ATOM   637  H HG3  . MET A 1 42  ? 35.223 -12.921 -0.412  1.00   5.22  ? 68   MET A HG3  1 
ATOM   638  H HE1  . MET A 1 42  ? 37.552 -14.602 -1.071  1.00   6.60  ? 68   MET A HE1  1 
ATOM   639  H HE2  . MET A 1 42  ? 37.212 -15.247 -2.483  1.00   6.60  ? 68   MET A HE2  1 
ATOM   640  H HE3  . MET A 1 42  ? 36.879 -13.718 -2.207  1.00   6.60  ? 68   MET A HE3  1 
ATOM   641  N N    . CYS A 1 43  ? 37.299 -13.039 3.880   1.00   4.26  ? 69   CYS A N    1 
ATOM   642  C CA   . CYS A 1 43  ? 38.010 -13.630 4.995   1.00   4.48  ? 69   CYS A CA   1 
ATOM   643  C C    . CYS A 1 43  ? 37.841 -15.143 4.925   1.00   4.22  ? 69   CYS A C    1 
ATOM   644  O O    . CYS A 1 43  ? 37.803 -15.689 3.829   1.00   4.71  ? 69   CYS A O    1 
ATOM   645  C CB   . CYS A 1 43  ? 37.572 -13.007 6.322   1.00   4.98  ? 69   CYS A CB   1 
ATOM   646  S SG   . CYS A 1 43  ? 37.917 -11.225 6.375   1.00   5.41  ? 69   CYS A SG   1 
ATOM   647  H H    . CYS A 1 43  ? 37.769 -12.486 3.420   1.00   5.11  ? 69   CYS A H    1 
ATOM   648  H HA   . CYS A 1 43  ? 38.955 -13.441 4.888   1.00   5.38  ? 69   CYS A HA   1 
ATOM   649  H HB2  . CYS A 1 43  ? 36.617 -13.134 6.435   1.00   5.97  ? 69   CYS A HB2  1 
ATOM   650  H HB3  . CYS A 1 43  ? 38.054 -13.431 7.049   1.00   5.97  ? 69   CYS A HB3  1 
ATOM   651  H HG   . CYS A 1 43  ? 37.555 -10.789 7.433   1.00   6.49  ? 69   CYS A HG   1 
ATOM   652  N N    . SER A 1 44  ? 37.695 -15.828 6.050   1.00   4.34  ? 70   SER A N    1 
ATOM   653  C CA   . SER A 1 44  ? 37.633 -17.280 6.017   1.00   4.65  ? 70   SER A CA   1 
ATOM   654  C C    . SER A 1 44  ? 36.385 -17.879 5.387   1.00   4.60  ? 70   SER A C    1 
ATOM   655  O O    . SER A 1 44  ? 36.350 -19.088 5.195   1.00   4.24  ? 70   SER A O    1 
ATOM   656  C CB   . SER A 1 44  ? 37.803 -17.883 7.419   1.00   6.54  ? 70   SER A CB   1 
ATOM   657  O OG   . SER A 1 44  ? 39.116 -17.686 7.902   1.00   8.92  ? 70   SER A OG   1 
ATOM   658  H H    . SER A 1 44  ? 37.631 -15.482 6.835   1.00   5.20  ? 70   SER A H    1 
ATOM   659  H HA   . SER A 1 44  ? 38.385 -17.591 5.489   1.00   5.59  ? 70   SER A HA   1 
ATOM   660  H HB2  . SER A 1 44  ? 37.177 -17.454 8.024   1.00   7.85  ? 70   SER A HB2  1 
ATOM   661  H HB3  . SER A 1 44  ? 37.622 -18.835 7.377   1.00   7.85  ? 70   SER A HB3  1 
ATOM   662  H HG   . SER A 1 44  ? 39.286 -16.865 7.945   1.00   10.70 ? 70   SER A HG   1 
ATOM   663  N N    . THR A 1 45  ? 35.403 -17.077 4.980   1.00   3.72  ? 71   THR A N    1 
ATOM   664  C CA   . THR A 1 45  ? 34.308 -17.660 4.227   1.00   4.29  ? 71   THR A CA   1 
ATOM   665  C C    . THR A 1 45  ? 34.819 -18.261 2.912   1.00   3.66  ? 71   THR A C    1 
ATOM   666  O O    . THR A 1 45  ? 34.178 -19.146 2.349   1.00   4.04  ? 71   THR A O    1 
ATOM   667  C CB   . THR A 1 45  ? 33.113 -16.736 4.038   1.00   4.40  ? 71   THR A CB   1 
ATOM   668  O OG1  . THR A 1 45  ? 33.414 -15.643 3.153   1.00   4.17  ? 71   THR A OG1  1 
ATOM   669  C CG2  . THR A 1 45  ? 32.604 -16.240 5.361   1.00   4.70  ? 71   THR A CG2  1 
ATOM   670  H H    . THR A 1 45  ? 35.350 -16.230 5.120   1.00   4.46  ? 71   THR A H    1 
ATOM   671  H HA   . THR A 1 45  ? 33.979 -18.409 4.748   1.00   5.15  ? 71   THR A HA   1 
ATOM   672  H HB   . THR A 1 45  ? 32.397 -17.254 3.637   1.00   5.28  ? 71   THR A HB   1 
ATOM   673  H HG1  . THR A 1 45  ? 34.047 -15.187 3.464   1.00   5.01  ? 71   THR A HG1  1 
ATOM   674  H HG21 . THR A 1 45  ? 33.303 -15.750 5.822   1.00   5.64  ? 71   THR A HG21 1 
ATOM   675  H HG22 . THR A 1 45  ? 31.844 -15.653 5.225   1.00   5.64  ? 71   THR A HG22 1 
ATOM   676  H HG23 . THR A 1 45  ? 32.329 -16.989 5.912   1.00   5.64  ? 71   THR A HG23 1 
ATOM   677  N N    . SER A 1 46  ? 35.975 -17.789 2.427   1.00   3.73  ? 72   SER A N    1 
ATOM   678  C CA   . SER A 1 46  ? 36.602 -18.327 1.228   1.00   4.09  ? 72   SER A CA   1 
ATOM   679  C C    . SER A 1 46  ? 37.038 -19.781 1.375   1.00   3.72  ? 72   SER A C    1 
ATOM   680  O O    . SER A 1 46  ? 37.265 -20.459 0.388   1.00   4.15  ? 72   SER A O    1 
ATOM   681  C CB   . SER A 1 46  ? 37.799 -17.486 0.847   1.00   5.06  ? 72   SER A CB   1 
ATOM   682  O OG   . SER A 1 46  ? 38.799 -17.554 1.833   1.00   5.81  ? 72   SER A OG   1 
ATOM   683  H H    . SER A 1 46  ? 36.417 -17.145 2.787   1.00   4.47  ? 72   SER A H    1 
ATOM   684  H HA   . SER A 1 46  ? 35.965 -18.283 0.498   1.00   4.91  ? 72   SER A HA   1 
ATOM   685  H HB2  . SER A 1 46  ? 38.161 -17.814 0.008   1.00   6.07  ? 72   SER A HB2  1 
ATOM   686  H HB3  . SER A 1 46  ? 37.517 -16.563 0.747   1.00   6.07  ? 72   SER A HB3  1 
ATOM   687  H HG   . SER A 1 46  ? 38.499 -17.272 2.566   1.00   6.97  ? 72   SER A HG   1 
ATOM   688  N N    . LYS A 1 47  ? 37.158 -20.267 2.605   1.00   4.11  ? 73   LYS A N    1 
ATOM   689  C CA   . LYS A 1 47  ? 37.589 -21.640 2.833   1.00   4.12  ? 73   LYS A CA   1 
ATOM   690  C C    . LYS A 1 47  ? 36.602 -22.632 2.227   1.00   3.98  ? 73   LYS A C    1 
ATOM   691  O O    . LYS A 1 47  ? 36.987 -23.719 1.803   1.00   4.98  ? 73   LYS A O    1 
ATOM   692  C CB   . LYS A 1 47  ? 37.830 -21.893 4.315   1.00   4.52  ? 73   LYS A CB   1 
ATOM   693  C CG   . LYS A 1 47  ? 39.016 -21.116 4.837   1.00   5.17  ? 73   LYS A CG   1 
ATOM   694  C CD   . LYS A 1 47  ? 39.296 -21.281 6.331   1.00   7.76  ? 73   LYS A CD   1 
ATOM   695  C CE   . LYS A 1 47  ? 40.564 -20.504 6.703   1.00   9.64  ? 73   LYS A CE   1 
ATOM   696  N NZ   . LYS A 1 47  ? 40.590 -19.936 8.060   1.00   8.68  ? 73   LYS A NZ   1 
ATOM   697  H H    . LYS A 1 47  ? 36.996 -19.823 3.324   1.00   4.94  ? 73   LYS A H    1 
ATOM   698  H HA   . LYS A 1 47  ? 38.437 -21.769 2.380   1.00   4.94  ? 73   LYS A HA   1 
ATOM   699  H HB2  . LYS A 1 47  ? 37.046 -21.621 4.816   1.00   5.42  ? 73   LYS A HB2  1 
ATOM   700  H HB3  . LYS A 1 47  ? 38.004 -22.838 4.453   1.00   5.42  ? 73   LYS A HB3  1 
ATOM   701  H HG2  . LYS A 1 47  ? 39.809 -21.405 4.358   1.00   6.21  ? 73   LYS A HG2  1 
ATOM   702  H HG3  . LYS A 1 47  ? 38.863 -20.172 4.672   1.00   6.21  ? 73   LYS A HG3  1 
ATOM   703  H HD2  . LYS A 1 47  ? 38.553 -20.926 6.843   1.00   9.31  ? 73   LYS A HD2  1 
ATOM   704  H HD3  . LYS A 1 47  ? 39.436 -22.219 6.535   1.00   9.31  ? 73   LYS A HD3  1 
ATOM   705  H HE2  . LYS A 1 47  ? 41.324 -21.102 6.624   1.00   11.57 ? 73   LYS A HE2  1 
ATOM   706  H HE3  . LYS A 1 47  ? 40.667 -19.769 6.079   1.00   11.57 ? 73   LYS A HE3  1 
ATOM   707  H HZ1  . LYS A 1 47  ? 40.515 -20.587 8.663   1.00   10.42 ? 73   LYS A HZ1  1 
ATOM   708  H HZ2  . LYS A 1 47  ? 41.356 -19.504 8.194   1.00   10.42 ? 73   LYS A HZ2  1 
ATOM   709  H HZ3  . LYS A 1 47  ? 39.914 -19.367 8.164   1.00   10.42 ? 73   LYS A HZ3  1 
ATOM   710  N N    . VAL A 1 48  ? 35.333 -22.258 2.162   1.00   4.16  ? 74   VAL A N    1 
ATOM   711  C CA   . VAL A 1 48  ? 34.349 -23.122 1.519   1.00   4.08  ? 74   VAL A CA   1 
ATOM   712  C C    . VAL A 1 48  ? 34.719 -23.415 0.071   1.00   3.91  ? 74   VAL A C    1 
ATOM   713  O O    . VAL A 1 48  ? 34.616 -24.544 -0.393  1.00   3.93  ? 74   VAL A O    1 
ATOM   714  C CB   . VAL A 1 48  ? 32.938 -22.503 1.587   1.00   4.90  ? 74   VAL A CB   1 
ATOM   715  C CG1  . VAL A 1 48  ? 31.953 -23.285 0.745   1.00   5.79  ? 74   VAL A CG1  1 
ATOM   716  C CG2  . VAL A 1 48  ? 32.472 -22.459 3.044   1.00   5.37  ? 74   VAL A CG2  1 
ATOM   717  H H    . VAL A 1 48  ? 35.016 -21.523 2.477   1.00   5.00  ? 74   VAL A H    1 
ATOM   718  H HA   . VAL A 1 48  ? 34.323 -23.968 1.993   1.00   4.89  ? 74   VAL A HA   1 
ATOM   719  H HB   . VAL A 1 48  ? 32.971 -21.593 1.251   1.00   5.88  ? 74   VAL A HB   1 
ATOM   720  H HG11 . VAL A 1 48  ? 31.911 -24.196 1.074   1.00   6.95  ? 74   VAL A HG11 1 
ATOM   721  H HG12 . VAL A 1 48  ? 31.080 -22.868 0.812   1.00   6.95  ? 74   VAL A HG12 1 
ATOM   722  H HG13 . VAL A 1 48  ? 32.253 -23.279 -0.178  1.00   6.95  ? 74   VAL A HG13 1 
ATOM   723  H HG21 . VAL A 1 48  ? 33.093 -21.918 3.557   1.00   6.44  ? 74   VAL A HG21 1 
ATOM   724  H HG22 . VAL A 1 48  ? 31.585 -22.069 3.079   1.00   6.44  ? 74   VAL A HG22 1 
ATOM   725  H HG23 . VAL A 1 48  ? 32.451 -23.363 3.395   1.00   6.44  ? 74   VAL A HG23 1 
ATOM   726  N N    . MET A 1 49  ? 35.157 -22.396 -0.657  1.00   4.18  ? 75   MET A N    1 
ATOM   727  C CA   . MET A 1 49  ? 35.471 -22.563 -2.072  1.00   4.37  ? 75   MET A CA   1 
ATOM   728  C C    . MET A 1 49  ? 36.681 -23.471 -2.261  1.00   4.43  ? 75   MET A C    1 
ATOM   729  O O    . MET A 1 49  ? 36.696 -24.273 -3.196  1.00   4.87  ? 75   MET A O    1 
ATOM   730  C CB   . MET A 1 49  ? 35.700 -21.208 -2.744  1.00   4.71  ? 75   MET A CB   1 
ATOM   731  C CG   . MET A 1 49  ? 35.486 -21.267 -4.244  1.00   5.64  ? 75   MET A CG   1 
ATOM   732  S SD   . MET A 1 49  ? 33.772 -21.525 -4.741  1.00   7.81  ? 75   MET A SD   1 
ATOM   733  C CE   . MET A 1 49  ? 33.043 -19.992 -4.193  1.00   9.82  ? 75   MET A CE   1 
ATOM   734  H H    . MET A 1 49  ? 35.281 -21.600 -0.358  1.00   5.02  ? 75   MET A H    1 
ATOM   735  H HA   . MET A 1 49  ? 34.709 -22.976 -2.506  1.00   5.25  ? 75   MET A HA   1 
ATOM   736  H HB2  . MET A 1 49  ? 35.077 -20.562 -2.376  1.00   5.65  ? 75   MET A HB2  1 
ATOM   737  H HB3  . MET A 1 49  ? 36.612 -20.923 -2.581  1.00   5.65  ? 75   MET A HB3  1 
ATOM   738  H HG2  . MET A 1 49  ? 35.783 -20.429 -4.633  1.00   6.77  ? 75   MET A HG2  1 
ATOM   739  H HG3  . MET A 1 49  ? 36.011 -21.999 -4.605  1.00   6.77  ? 75   MET A HG3  1 
ATOM   740  H HE1  . MET A 1 49  ? 33.478 -19.255 -4.649  1.00   11.78 ? 75   MET A HE1  1 
ATOM   741  H HE2  . MET A 1 49  ? 32.096 -20.000 -4.405  1.00   11.78 ? 75   MET A HE2  1 
ATOM   742  H HE3  . MET A 1 49  ? 33.167 -19.909 -3.235  1.00   11.78 ? 75   MET A HE3  1 
ATOM   743  N N    . ALA A 1 50  ? 37.685 -23.352 -1.401  1.00   4.44  ? 76   ALA A N    1 
ATOM   744  C CA   . ALA A 1 50  ? 38.879 -24.190 -1.516  1.00   4.55  ? 76   ALA A CA   1 
ATOM   745  C C    . ALA A 1 50  ? 38.529 -25.649 -1.211  1.00   4.62  ? 76   ALA A C    1 
ATOM   746  O O    . ALA A 1 50  ? 38.950 -26.563 -1.927  1.00   5.15  ? 76   ALA A O    1 
ATOM   747  C CB   . ALA A 1 50  ? 39.940 -23.703 -0.586  1.00   5.15  ? 76   ALA A CB   1 
ATOM   748  H H    . ALA A 1 50  ? 37.703 -22.797 -0.744  1.00   5.33  ? 76   ALA A H    1 
ATOM   749  H HA   . ALA A 1 50  ? 39.221 -24.141 -2.422  1.00   5.46  ? 76   ALA A HA   1 
ATOM   750  H HB1  . ALA A 1 50  ? 39.604 -23.743 0.324   1.00   6.18  ? 76   ALA A HB1  1 
ATOM   751  H HB2  . ALA A 1 50  ? 40.722 -24.270 -0.675  1.00   6.18  ? 76   ALA A HB2  1 
ATOM   752  H HB3  . ALA A 1 50  ? 40.165 -22.788 -0.816  1.00   6.18  ? 76   ALA A HB3  1 
ATOM   753  N N    . ALA A 1 51  ? 37.757 -25.885 -0.146  1.00   4.31  ? 77   ALA A N    1 
ATOM   754  C CA   . ALA A 1 51  ? 37.372 -27.246 0.187   1.00   4.22  ? 77   ALA A CA   1 
ATOM   755  C C    . ALA A 1 51  ? 36.510 -27.840 -0.928  1.00   4.33  ? 77   ALA A C    1 
ATOM   756  O O    . ALA A 1 51  ? 36.677 -28.997 -1.313  1.00   4.47  ? 77   ALA A O    1 
ATOM   757  C CB   . ALA A 1 51  ? 36.599 -27.261 1.497   1.00   5.28  ? 77   ALA A CB   1 
ATOM   758  H H    . ALA A 1 51  ? 37.453 -25.283 0.388   1.00   5.17  ? 77   ALA A H    1 
ATOM   759  H HA   . ALA A 1 51  ? 38.166 -27.793 0.290   1.00   5.07  ? 77   ALA A HA   1 
ATOM   760  H HB1  . ALA A 1 51  ? 35.804 -26.713 1.400   1.00   6.33  ? 77   ALA A HB1  1 
ATOM   761  H HB2  . ALA A 1 51  ? 36.349 -28.174 1.705   1.00   6.33  ? 77   ALA A HB2  1 
ATOM   762  H HB3  . ALA A 1 51  ? 37.164 -26.903 2.200   1.00   6.33  ? 77   ALA A HB3  1 
ATOM   763  N N    . ALA A 1 52  ? 35.587 -27.053 -1.460  1.00   4.16  ? 78   ALA A N    1 
ATOM   764  C CA   . ALA A 1 52  ? 34.707 -27.511 -2.530  1.00   4.39  ? 78   ALA A CA   1 
ATOM   765  C C    . ALA A 1 52  ? 35.482 -27.833 -3.806  1.00   4.18  ? 78   ALA A C    1 
ATOM   766  O O    . ALA A 1 52  ? 35.150 -28.775 -4.511  1.00   4.57  ? 78   ALA A O    1 
ATOM   767  C CB   . ALA A 1 52  ? 33.596 -26.520 -2.807  1.00   5.07  ? 78   ALA A CB   1 
ATOM   768  H H    . ALA A 1 52  ? 35.447 -26.240 -1.217  1.00   4.99  ? 78   ALA A H    1 
ATOM   769  H HA   . ALA A 1 52  ? 34.286 -28.335 -2.239  1.00   5.27  ? 78   ALA A HA   1 
ATOM   770  H HB1  . ALA A 1 52  ? 33.988 -25.673 -3.070  1.00   6.09  ? 78   ALA A HB1  1 
ATOM   771  H HB2  . ALA A 1 52  ? 33.038 -26.863 -3.522  1.00   6.09  ? 78   ALA A HB2  1 
ATOM   772  H HB3  . ALA A 1 52  ? 33.069 -26.404 -2.001  1.00   6.09  ? 78   ALA A HB3  1 
ATOM   773  N N    . ALA A 1 53  ? 36.528 -27.070 -4.087  1.00   4.13  ? 79   ALA A N    1 
ATOM   774  C CA   . ALA A 1 53  ? 37.357 -27.337 -5.263  1.00   3.99  ? 79   ALA A CA   1 
ATOM   775  C C    . ALA A 1 53  ? 38.033 -28.703 -5.161  1.00   3.92  ? 79   ALA A C    1 
ATOM   776  O O    . ALA A 1 53  ? 38.143 -29.420 -6.142  1.00   4.65  ? 79   ALA A O    1 
ATOM   777  C CB   . ALA A 1 53  ? 38.372 -26.222 -5.450  1.00   5.03  ? 79   ALA A CB   1 
ATOM   778  H H    . ALA A 1 53  ? 36.782 -26.395 -3.618  1.00   4.96  ? 79   ALA A H    1 
ATOM   779  H HA   . ALA A 1 53  ? 36.786 -27.350 -6.048  1.00   4.79  ? 79   ALA A HA   1 
ATOM   780  H HB1  . ALA A 1 53  ? 38.936 -26.174 -4.662  1.00   6.04  ? 79   ALA A HB1  1 
ATOM   781  H HB2  . ALA A 1 53  ? 38.912 -26.414 -6.232  1.00   6.04  ? 79   ALA A HB2  1 
ATOM   782  H HB3  . ALA A 1 53  ? 37.900 -25.383 -5.571  1.00   6.04  ? 79   ALA A HB3  1 
ATOM   783  N N    . VAL A 1 54  ? 38.491 -29.060 -3.967  1.00   4.71  ? 80   VAL A N    1 
ATOM   784  C CA   . VAL A 1 54  ? 39.066 -30.370 -3.737  1.00   4.75  ? 80   VAL A CA   1 
ATOM   785  C C    . VAL A 1 54  ? 37.990 -31.452 -3.831  1.00   4.69  ? 80   VAL A C    1 
ATOM   786  O O    . VAL A 1 54  ? 38.212 -32.504 -4.410  1.00   4.66  ? 80   VAL A O    1 
ATOM   787  C CB   . VAL A 1 54  ? 39.849 -30.402 -2.410  1.00   5.48  ? 80   VAL A CB   1 
ATOM   788  C CG1  . VAL A 1 54  ? 40.312 -31.806 -2.072  1.00   5.90  ? 80   VAL A CG1  1 
ATOM   789  C CG2  . VAL A 1 54  ? 41.037 -29.448 -2.486  1.00   5.25  ? 80   VAL A CG2  1 
ATOM   790  H H    . VAL A 1 54  ? 38.479 -28.555 -3.271  1.00   5.65  ? 80   VAL A H    1 
ATOM   791  H HA   . VAL A 1 54  ? 39.705 -30.545 -4.445  1.00   5.71  ? 80   VAL A HA   1 
ATOM   792  H HB   . VAL A 1 54  ? 39.268 -30.099 -1.694  1.00   6.58  ? 80   VAL A HB   1 
ATOM   793  H HG11 . VAL A 1 54  ? 40.890 -32.127 -2.782  1.00   7.09  ? 80   VAL A HG11 1 
ATOM   794  H HG12 . VAL A 1 54  ? 40.799 -31.784 -1.233  1.00   7.09  ? 80   VAL A HG12 1 
ATOM   795  H HG13 . VAL A 1 54  ? 39.536 -32.383 -1.989  1.00   7.09  ? 80   VAL A HG13 1 
ATOM   796  H HG21 . VAL A 1 54  ? 40.710 -28.549 -2.648  1.00   6.30  ? 80   VAL A HG21 1 
ATOM   797  H HG22 . VAL A 1 54  ? 41.520 -29.478 -1.645  1.00   6.30  ? 80   VAL A HG22 1 
ATOM   798  H HG23 . VAL A 1 54  ? 41.618 -29.725 -3.212  1.00   6.30  ? 80   VAL A HG23 1 
ATOM   799  N N    . LEU A 1 55  ? 36.806 -31.190 -3.272  1.00   4.44  ? 81   LEU A N    1 
ATOM   800  C CA   . LEU A 1 55  ? 35.698 -32.139 -3.463  1.00   4.90  ? 81   LEU A CA   1 
ATOM   801  C C    . LEU A 1 55  ? 35.431 -32.375 -4.949  1.00   4.77  ? 81   LEU A C    1 
ATOM   802  O O    . LEU A 1 55  ? 35.222 -33.507 -5.364  1.00   5.24  ? 81   LEU A O    1 
ATOM   803  C CB   . LEU A 1 55  ? 34.431 -31.687 -2.748  1.00   4.92  ? 81   LEU A CB   1 
ATOM   804  C CG   . LEU A 1 55  ? 34.467 -31.730 -1.231  1.00   4.78  ? 81   LEU A CG   1 
ATOM   805  C CD1  . LEU A 1 55  ? 33.234 -31.063 -0.655  1.00   4.84  ? 81   LEU A CD1  1 
ATOM   806  C CD2  . LEU A 1 55  ? 34.571 -33.166 -0.726  1.00   5.87  ? 81   LEU A CD2  1 
ATOM   807  H H    . LEU A 1 55  ? 36.620 -30.499 -2.795  1.00   5.33  ? 81   LEU A H    1 
ATOM   808  H HA   . LEU A 1 55  ? 35.957 -32.991 -3.078  1.00   5.87  ? 81   LEU A HA   1 
ATOM   809  H HB2  . LEU A 1 55  ? 34.246 -30.771 -3.006  1.00   5.90  ? 81   LEU A HB2  1 
ATOM   810  H HB3  . LEU A 1 55  ? 33.700 -32.256 -3.035  1.00   5.90  ? 81   LEU A HB3  1 
ATOM   811  H HG   . LEU A 1 55  ? 35.246 -31.244 -0.919  1.00   5.74  ? 81   LEU A HG   1 
ATOM   812  H HD11 . LEU A 1 55  ? 32.446 -31.532 -0.970  1.00   5.81  ? 81   LEU A HD11 1 
ATOM   813  H HD12 . LEU A 1 55  ? 33.278 -31.102 0.313   1.00   5.81  ? 81   LEU A HD12 1 
ATOM   814  H HD13 . LEU A 1 55  ? 33.209 -30.139 -0.949  1.00   5.81  ? 81   LEU A HD13 1 
ATOM   815  H HD21 . LEU A 1 55  ? 35.385 -33.564 -1.071  1.00   7.05  ? 81   LEU A HD21 1 
ATOM   816  H HD22 . LEU A 1 55  ? 34.591 -33.158 0.244   1.00   7.05  ? 81   LEU A HD22 1 
ATOM   817  H HD23 . LEU A 1 55  ? 33.800 -33.667 -1.037  1.00   7.05  ? 81   LEU A HD23 1 
ATOM   818  N N    . LYS A 1 56  ? 35.430 -31.323 -5.753  1.00   4.41  ? 82   LYS A N    1 
ATOM   819  C CA   . LYS A 1 56  ? 35.220 -31.502 -7.170  1.00   4.88  ? 82   LYS A CA   1 
ATOM   820  C C    . LYS A 1 56  ? 36.265 -32.432 -7.780  1.00   4.59  ? 82   LYS A C    1 
ATOM   821  O O    . LYS A 1 56  ? 35.941 -33.332 -8.544  1.00   5.73  ? 82   LYS A O    1 
ATOM   822  C CB   . LYS A 1 56  ? 35.209 -30.151 -7.879  1.00   4.90  ? 82   LYS A CB   1 
ATOM   823  C CG   . LYS A 1 56  ? 35.110 -30.233 -9.396  1.00   5.46  ? 82   LYS A CG   1 
ATOM   824  C CD   . LYS A 1 56  ? 33.920 -30.983 -9.961  1.00   6.67  ? 82   LYS A CD   1 
ATOM   825  C CE   . LYS A 1 56  ? 32.620 -30.304 -9.598  1.00   7.35  ? 82   LYS A CE   1 
ATOM   826  N NZ   . LYS A 1 56  ? 31.462 -31.079 -10.121 1.00   8.64  ? 82   LYS A NZ   1 
ATOM   827  H H    . LYS A 1 56  ? 35.548 -30.509 -5.504  1.00   5.29  ? 82   LYS A H    1 
ATOM   828  H HA   . LYS A 1 56  ? 34.351 -31.911 -7.304  1.00   5.86  ? 82   LYS A HA   1 
ATOM   829  H HB2  . LYS A 1 56  ? 34.448 -29.640 -7.562  1.00   5.88  ? 82   LYS A HB2  1 
ATOM   830  H HB3  . LYS A 1 56  ? 36.030 -29.681 -7.664  1.00   5.88  ? 82   LYS A HB3  1 
ATOM   831  H HG2  . LYS A 1 56  ? 35.071 -29.329 -9.746  1.00   6.55  ? 82   LYS A HG2  1 
ATOM   832  H HG3  . LYS A 1 56  ? 35.908 -30.672 -9.728  1.00   6.55  ? 82   LYS A HG3  1 
ATOM   833  H HD2  . LYS A 1 56  ? 33.989 -31.011 -10.928 1.00   8.00  ? 82   LYS A HD2  1 
ATOM   834  H HD3  . LYS A 1 56  ? 33.905 -31.882 -9.599  1.00   8.00  ? 82   LYS A HD3  1 
ATOM   835  H HE2  . LYS A 1 56  ? 32.542 -30.250 -8.632  1.00   8.82  ? 82   LYS A HE2  1 
ATOM   836  H HE3  . LYS A 1 56  ? 32.597 -29.417 -9.990  1.00   8.82  ? 82   LYS A HE3  1 
ATOM   837  H HZ1  . LYS A 1 56  ? 31.463 -31.898 -9.773  1.00   10.37 ? 82   LYS A HZ1  1 
ATOM   838  H HZ2  . LYS A 1 56  ? 30.701 -30.673 -9.902  1.00   10.37 ? 82   LYS A HZ2  1 
ATOM   839  H HZ3  . LYS A 1 56  ? 31.514 -31.141 -11.007 1.00   10.37 ? 82   LYS A HZ3  1 
ATOM   840  N N    . GLN A 1 57  ? 37.522 -32.203 -7.455  1.00   5.32  ? 83   GLN A N    1 
ATOM   841  C CA   . GLN A 1 57  ? 38.597 -33.058 -7.951  1.00   6.17  ? 83   GLN A CA   1 
ATOM   842  C C    . GLN A 1 57  ? 38.348 -34.505 -7.536  1.00   5.91  ? 83   GLN A C    1 
ATOM   843  O O    . GLN A 1 57  ? 38.588 -35.427 -8.319  1.00   6.60  ? 83   GLN A O    1 
ATOM   844  C CB   . GLN A 1 57  ? 39.939 -32.635 -7.402  1.00   6.03  ? 83   GLN A CB   1 
ATOM   845  C CG   . GLN A 1 57  ? 40.450 -31.325 -7.957  1.00   6.77  ? 83   GLN A CG   1 
ATOM   846  C CD   . GLN A 1 57  ? 41.841 -31.049 -7.459  1.00   8.64  ? 83   GLN A CD   1 
ATOM   847  O OE1  . GLN A 1 57  ? 42.143 -31.327 -6.311  1.00   9.86  ? 83   GLN A OE1  1 
ATOM   848  N NE2  . GLN A 1 57  ? 42.713 -30.545 -8.332  1.00   9.37  ? 83   GLN A NE2  1 
ATOM   849  H H    . GLN A 1 57  ? 37.786 -31.560 -6.949  1.00   6.39  ? 83   GLN A H    1 
ATOM   850  H HA   . GLN A 1 57  ? 38.629 -33.013 -8.920  1.00   7.40  ? 83   GLN A HA   1 
ATOM   851  H HB2  . GLN A 1 57  ? 39.865 -32.540 -6.439  1.00   7.24  ? 83   GLN A HB2  1 
ATOM   852  H HB3  . GLN A 1 57  ? 40.592 -33.321 -7.614  1.00   7.24  ? 83   GLN A HB3  1 
ATOM   853  H HG2  . GLN A 1 57  ? 40.474 -31.372 -8.926  1.00   8.12  ? 83   GLN A HG2  1 
ATOM   854  H HG3  . GLN A 1 57  ? 39.871 -30.603 -7.667  1.00   8.12  ? 83   GLN A HG3  1 
ATOM   855  H HE21 . GLN A 1 57  ? 42.470 -30.391 -9.142  1.00   11.24 ? 83   GLN A HE21 1 
ATOM   856  H HE22 . GLN A 1 57  ? 43.519 -30.373 -8.085  1.00   11.24 ? 83   GLN A HE22 1 
ATOM   857  N N    . SER A 1 58  ? 37.853 -34.701 -6.313  1.00   5.97  ? 84   SER A N    1 
ATOM   858  C CA   . SER A 1 58  ? 37.680 -36.045 -5.793  1.00   7.04  ? 84   SER A CA   1 
ATOM   859  C C    . SER A 1 58  ? 36.632 -36.840 -6.556  1.00   7.58  ? 84   SER A C    1 
ATOM   860  O O    . SER A 1 58  ? 36.629 -38.062 -6.499  1.00   8.16  ? 84   SER A O    1 
ATOM   861  C CB   . SER A 1 58  ? 37.365 -36.032 -4.301  1.00   6.98  ? 84   SER A CB   1 
ATOM   862  O OG   . SER A 1 58  ? 36.017 -35.696 -4.042  1.00   7.50  ? 84   SER A OG   1 
ATOM   863  H H    . SER A 1 58  ? 37.613 -34.076 -5.774  1.00   7.16  ? 84   SER A H    1 
ATOM   864  H HA   . SER A 1 58  ? 38.522 -36.515 -5.899  1.00   8.44  ? 84   SER A HA   1 
ATOM   865  H HB2  . SER A 1 58  ? 37.540 -36.914 -3.938  1.00   8.38  ? 84   SER A HB2  1 
ATOM   866  H HB3  . SER A 1 58  ? 37.937 -35.380 -3.868  1.00   8.38  ? 84   SER A HB3  1 
ATOM   867  H HG   . SER A 1 58  ? 35.848 -34.931 -4.347  1.00   9.00  ? 84   SER A HG   1 
ATOM   868  N N    . GLU A 1 59  ? 35.751 -36.162 -7.279  1.00   7.34  ? 85   GLU A N    1 
ATOM   869  C CA   . GLU A 1 59  ? 34.742 -36.847 -8.066  1.00   8.69  ? 85   GLU A CA   1 
ATOM   870  C C    . GLU A 1 59  ? 35.363 -37.741 -9.120  1.00   8.88  ? 85   GLU A C    1 
ATOM   871  O O    . GLU A 1 59  ? 34.767 -38.739 -9.498  1.00   10.55 ? 85   GLU A O    1 
ATOM   872  C CB   . GLU A 1 59  ? 33.824 -35.850 -8.763  1.00   9.71  ? 85   GLU A CB   1 
ATOM   873  C CG   . GLU A 1 59  ? 33.033 -34.977 -7.812  1.00   11.30 ? 85   GLU A CG   1 
ATOM   874  C CD   . GLU A 1 59  ? 32.139 -33.949 -8.500  1.00   13.69 ? 85   GLU A CD   1 
ATOM   875  O OE1  . GLU A 1 59  ? 31.934 -34.057 -9.709  1.00   16.41 ? 85   GLU A OE1  1 
ATOM   876  O OE2  . GLU A 1 59  ? 31.635 -33.048 -7.799  1.00   15.98 ? 85   GLU A OE2  1 
ATOM   877  H H    . GLU A 1 59  ? 35.718 -35.304 -7.330  1.00   8.80  ? 85   GLU A H    1 
ATOM   878  H HA   . GLU A 1 59  ? 34.201 -37.399 -7.480  1.00   10.43 ? 85   GLU A HA   1 
ATOM   879  H HB2  . GLU A 1 59  ? 34.362 -35.267 -9.322  1.00   11.65 ? 85   GLU A HB2  1 
ATOM   880  H HB3  . GLU A 1 59  ? 33.191 -36.339 -9.312  1.00   11.65 ? 85   GLU A HB3  1 
ATOM   881  H HG2  . GLU A 1 59  ? 32.464 -35.545 -7.269  1.00   13.57 ? 85   GLU A HG2  1 
ATOM   882  H HG3  . GLU A 1 59  ? 33.653 -34.495 -7.244  1.00   13.57 ? 85   GLU A HG3  1 
ATOM   883  N N    . SER A 1 60  ? 36.541 -37.382 -9.605  1.00   8.68  ? 86   SER A N    1 
ATOM   884  C CA   . SER A 1 60  ? 37.224 -38.135 -10.662 1.00   9.79  ? 86   SER A CA   1 
ATOM   885  C C    . SER A 1 60  ? 38.511 -38.809 -10.169 1.00   10.34 ? 86   SER A C    1 
ATOM   886  O O    . SER A 1 60  ? 39.283 -39.334 -10.956 1.00   11.89 ? 86   SER A O    1 
ATOM   887  C CB   . SER A 1 60  ? 37.515 -37.217 -11.844 1.00   10.50 ? 86   SER A CB   1 
ATOM   888  O OG   . SER A 1 60  ? 38.344 -36.158 -11.460 1.00   10.39 ? 86   SER A OG   1 
ATOM   889  H H    . SER A 1 60  ? 36.979 -36.692 -9.337  1.00   10.42 ? 86   SER A H    1 
ATOM   890  H HA   . SER A 1 60  ? 36.630 -38.834 -10.975 1.00   11.75 ? 86   SER A HA   1 
ATOM   891  H HB2  . SER A 1 60  ? 37.957 -37.729 -12.539 1.00   12.60 ? 86   SER A HB2  1 
ATOM   892  H HB3  . SER A 1 60  ? 36.678 -36.858 -12.178 1.00   12.60 ? 86   SER A HB3  1 
ATOM   893  H HG   . SER A 1 60  ? 37.972 -35.706 -10.857 1.00   12.47 ? 86   SER A HG   1 
ATOM   894  N N    . ASP A 1 61  ? 38.718 -38.845 -8.865  1.00   9.34  ? 87   ASP A N    1 
ATOM   895  C CA   . ASP A 1 61  ? 39.880 -39.508 -8.285  1.00   9.57  ? 87   ASP A CA   1 
ATOM   896  C C    . ASP A 1 61  ? 39.445 -40.083 -6.960  1.00   9.32  ? 87   ASP A C    1 
ATOM   897  O O    . ASP A 1 61  ? 39.418 -39.392 -5.938  1.00   8.17  ? 87   ASP A O    1 
ATOM   898  C CB   . ASP A 1 61  ? 41.017 -38.507 -8.104  1.00   9.97  ? 87   ASP A CB   1 
ATOM   899  C CG   . ASP A 1 61  ? 42.232 -39.093 -7.404  1.00   10.86 ? 87   ASP A CG   1 
ATOM   900  O OD1  . ASP A 1 61  ? 42.252 -40.301 -7.054  1.00   11.40 ? 87   ASP A OD1  1 
ATOM   901  O OD2  . ASP A 1 61  ? 43.193 -38.322 -7.187  1.00   11.88 ? 87   ASP A OD2  1 
ATOM   902  H H    . ASP A 1 61  ? 38.195 -38.489 -8.283  1.00   11.20 ? 87   ASP A H    1 
ATOM   903  H HA   . ASP A 1 61  ? 40.178 -40.228 -8.863  1.00   11.49 ? 87   ASP A HA   1 
ATOM   904  H HB2  . ASP A 1 61  ? 41.299 -38.191 -8.976  1.00   11.96 ? 87   ASP A HB2  1 
ATOM   905  H HB3  . ASP A 1 61  ? 40.697 -37.762 -7.571  1.00   11.96 ? 87   ASP A HB3  1 
ATOM   906  N N    . LYS A 1 62  ? 39.087 -41.359 -6.983  1.00   10.68 ? 88   LYS A N    1 
ATOM   907  C CA   . LYS A 1 62  ? 38.510 -42.016 -5.815  1.00   11.63 ? 88   LYS A CA   1 
ATOM   908  C C    . LYS A 1 62  ? 39.491 -42.150 -4.642  1.00   10.72 ? 88   LYS A C    1 
ATOM   909  O O    . LYS A 1 62  ? 39.085 -42.523 -3.547  1.00   11.86 ? 88   LYS A O    1 
ATOM   910  C CB   . LYS A 1 62  ? 37.913 -43.384 -6.192  1.00   15.19 ? 88   LYS A CB   1 
ATOM   911  C CG   . LYS A 1 62  ? 38.935 -44.426 -6.554  1.00   18.07 ? 88   LYS A CG   1 
ATOM   912  C CD   . LYS A 1 62  ? 38.241 -45.727 -6.985  1.00   21.20 ? 88   LYS A CD   1 
ATOM   913  C CE   . LYS A 1 62  ? 39.229 -46.861 -7.231  1.00   23.94 ? 88   LYS A CE   1 
ATOM   914  N NZ   . LYS A 1 62  ? 38.553 -48.180 -7.504  1.00   26.03 ? 88   LYS A NZ   1 
ATOM   915  H H    . LYS A 1 62  ? 39.167 -41.872 -7.668  1.00   12.82 ? 88   LYS A H    1 
ATOM   916  H HA   . LYS A 1 62  ? 37.775 -41.467 -5.501  1.00   13.95 ? 88   LYS A HA   1 
ATOM   917  H HB2  . LYS A 1 62  ? 37.403 -43.720 -5.438  1.00   18.23 ? 88   LYS A HB2  1 
ATOM   918  H HB3  . LYS A 1 62  ? 37.327 -43.268 -6.957  1.00   18.23 ? 88   LYS A HB3  1 
ATOM   919  H HG2  . LYS A 1 62  ? 39.477 -44.107 -7.292  1.00   21.68 ? 88   LYS A HG2  1 
ATOM   920  H HG3  . LYS A 1 62  ? 39.492 -44.616 -5.782  1.00   21.68 ? 88   LYS A HG3  1 
ATOM   921  H HD2  . LYS A 1 62  ? 37.629 -46.007 -6.286  1.00   25.44 ? 88   LYS A HD2  1 
ATOM   922  H HD3  . LYS A 1 62  ? 37.754 -45.569 -7.809  1.00   25.44 ? 88   LYS A HD3  1 
ATOM   923  H HE2  . LYS A 1 62  ? 39.777 -46.641 -8.000  1.00   28.73 ? 88   LYS A HE2  1 
ATOM   924  H HE3  . LYS A 1 62  ? 39.788 -46.968 -6.445  1.00   28.73 ? 88   LYS A HE3  1 
ATOM   925  H HZ1  . LYS A 1 62  ? 38.038 -48.114 -8.227  1.00   31.24 ? 88   LYS A HZ1  1 
ATOM   926  H HZ2  . LYS A 1 62  ? 39.164 -48.812 -7.642  1.00   31.24 ? 88   LYS A HZ2  1 
ATOM   927  H HZ3  . LYS A 1 62  ? 38.047 -48.413 -6.809  1.00   31.24 ? 88   LYS A HZ3  1 
ATOM   928  N N    . HIS A 1 63  ? 40.768 -41.858 -4.864  1.00   10.21 ? 89   HIS A N    1 
ATOM   929  C CA   . HIS A 1 63  ? 41.779 -41.937 -3.812  1.00   10.97 ? 89   HIS A CA   1 
ATOM   930  C C    . HIS A 1 63  ? 42.142 -40.585 -3.219  1.00   9.43  ? 89   HIS A C    1 
ATOM   931  O O    . HIS A 1 63  ? 42.903 -40.512 -2.251  1.00   10.56 ? 89   HIS A O    1 
ATOM   932  C CB   . HIS A 1 63  ? 43.031 -42.597 -4.373  1.00   13.96 ? 89   HIS A CB   1 
ATOM   933  C CG   . HIS A 1 63  ? 42.793 -43.998 -4.815  1.00   17.88 ? 89   HIS A CG   1 
ATOM   934  N ND1  . HIS A 1 63  ? 43.011 -44.430 -6.104  1.00   19.71 ? 89   HIS A ND1  1 
ATOM   935  C CD2  . HIS A 1 63  ? 42.305 -45.057 -4.139  1.00   18.92 ? 89   HIS A CD2  1 
ATOM   936  C CE1  . HIS A 1 63  ? 42.701 -45.712 -6.191  1.00   20.11 ? 89   HIS A CE1  1 
ATOM   937  N NE2  . HIS A 1 63  ? 42.264 -46.115 -5.013  1.00   19.85 ? 89   HIS A NE2  1 
ATOM   938  H H    . HIS A 1 63  ? 41.079 -41.609 -5.626  1.00   12.25 ? 89   HIS A H    1 
ATOM   939  H HA   . HIS A 1 63  ? 41.442 -42.496 -3.094  1.00   13.16 ? 89   HIS A HA   1 
ATOM   940  H HB2  . HIS A 1 63  ? 43.339 -42.089 -5.140  1.00   16.75 ? 89   HIS A HB2  1 
ATOM   941  H HB3  . HIS A 1 63  ? 43.716 -42.611 -3.687  1.00   16.75 ? 89   HIS A HB3  1 
ATOM   942  H HD2  . HIS A 1 63  ? 42.058 -45.073 -3.243  1.00   22.70 ? 89   HIS A HD2  1 
ATOM   943  H HE1  . HIS A 1 63  ? 42.766 -46.237 -6.956  1.00   24.13 ? 89   HIS A HE1  1 
ATOM   944  H HE2  . HIS A 1 63  ? 41.998 -46.911 -4.824  1.00   23.82 ? 89   HIS A HE2  1 
ATOM   945  N N    . LEU A 1 64  ? 41.583 -39.522 -3.771  1.00   8.32  ? 90   LEU A N    1 
ATOM   946  C CA   . LEU A 1 64  ? 42.047 -38.201 -3.401  1.00   7.08  ? 90   LEU A CA   1 
ATOM   947  C C    . LEU A 1 64  ? 41.751 -37.851 -1.951  1.00   6.90  ? 90   LEU A C    1 
ATOM   948  O O    . LEU A 1 64  ? 42.610 -37.323 -1.240  1.00   7.42  ? 90   LEU A O    1 
ATOM   949  C CB   . LEU A 1 64  ? 41.437 -37.160 -4.309  1.00   7.12  ? 90   LEU A CB   1 
ATOM   950  C CG   . LEU A 1 64  ? 41.968 -35.739 -4.088  1.00   7.13  ? 90   LEU A CG   1 
ATOM   951  C CD1  . LEU A 1 64  ? 43.471 -35.671 -4.390  1.00   7.86  ? 90   LEU A CD1  1 
ATOM   952  C CD2  . LEU A 1 64  ? 41.224 -34.760 -4.941  1.00   7.41  ? 90   LEU A CD2  1 
ATOM   953  H H    . LEU A 1 64  ? 40.947 -39.537 -4.350  1.00   9.99  ? 90   LEU A H    1 
ATOM   954  H HA   . LEU A 1 64  ? 43.009 -38.167 -3.520  1.00   8.50  ? 90   LEU A HA   1 
ATOM   955  H HB2  . LEU A 1 64  ? 41.622 -37.404 -5.229  1.00   8.54  ? 90   LEU A HB2  1 
ATOM   956  H HB3  . LEU A 1 64  ? 40.478 -37.143 -4.161  1.00   8.54  ? 90   LEU A HB3  1 
ATOM   957  H HG   . LEU A 1 64  ? 41.835 -35.492 -3.159  1.00   8.56  ? 90   LEU A HG   1 
ATOM   958  H HD11 . LEU A 1 64  ? 43.618 -35.926 -5.314  1.00   9.43  ? 90   LEU A HD11 1 
ATOM   959  H HD12 . LEU A 1 64  ? 43.781 -34.764 -4.243  1.00   9.43  ? 90   LEU A HD12 1 
ATOM   960  H HD13 . LEU A 1 64  ? 43.939 -36.281 -3.799  1.00   9.43  ? 90   LEU A HD13 1 
ATOM   961  H HD21 . LEU A 1 64  ? 40.283 -34.788 -4.707  1.00   8.89  ? 90   LEU A HD21 1 
ATOM   962  H HD22 . LEU A 1 64  ? 41.578 -33.871 -4.783  1.00   8.89  ? 90   LEU A HD22 1 
ATOM   963  H HD23 . LEU A 1 64  ? 41.340 -35.002 -5.873  1.00   8.89  ? 90   LEU A HD23 1 
ATOM   964  N N    . LEU A 1 65  ? 40.536 -38.089 -1.484  1.00   6.86  ? 91   LEU A N    1 
ATOM   965  C CA   . LEU A 1 65  ? 40.194 -37.608 -0.150  1.00   7.44  ? 91   LEU A CA   1 
ATOM   966  C C    . LEU A 1 65  ? 41.020 -38.288 0.935   1.00   6.67  ? 91   LEU A C    1 
ATOM   967  O O    . LEU A 1 65  ? 41.225 -37.708 2.004   1.00   7.10  ? 91   LEU A O    1 
ATOM   968  C CB   . LEU A 1 65  ? 38.685 -37.736 0.118   1.00   8.35  ? 91   LEU A CB   1 
ATOM   969  C CG   . LEU A 1 65  ? 37.842 -36.751 -0.695  1.00   9.80  ? 91   LEU A CG   1 
ATOM   970  C CD1  . LEU A 1 65  ? 36.358 -36.980 -0.430  1.00   12.85 ? 91   LEU A CD1  1 
ATOM   971  C CD2  . LEU A 1 65  ? 38.210 -35.304 -0.424  1.00   11.51 ? 91   LEU A CD2  1 
ATOM   972  H H    . LEU A 1 65  ? 39.911 -38.510 -1.898  1.00   8.23  ? 91   LEU A H    1 
ATOM   973  H HA   . LEU A 1 65  ? 40.407 -36.663 -0.112  1.00   8.93  ? 91   LEU A HA   1 
ATOM   974  H HB2  . LEU A 1 65  ? 38.399 -38.634 -0.112  1.00   10.02 ? 91   LEU A HB2  1 
ATOM   975  H HB3  . LEU A 1 65  ? 38.517 -37.567 1.058   1.00   10.02 ? 91   LEU A HB3  1 
ATOM   976  H HG   . LEU A 1 65  ? 37.999 -36.919 -1.637  1.00   11.76 ? 91   LEU A HG   1 
ATOM   977  H HD11 . LEU A 1 65  ? 36.182 -36.848 0.515   1.00   15.42 ? 91   LEU A HD11 1 
ATOM   978  H HD12 . LEU A 1 65  ? 35.843 -36.347 -0.954  1.00   15.42 ? 91   LEU A HD12 1 
ATOM   979  H HD13 . LEU A 1 65  ? 36.128 -37.887 -0.687  1.00   15.42 ? 91   LEU A HD13 1 
ATOM   980  H HD21 . LEU A 1 65  ? 39.142 -35.167 -0.656  1.00   13.81 ? 91   LEU A HD21 1 
ATOM   981  H HD22 . LEU A 1 65  ? 37.646 -34.729 -0.964  1.00   13.81 ? 91   LEU A HD22 1 
ATOM   982  H HD23 . LEU A 1 65  ? 38.072 -35.114 0.517   1.00   13.81 ? 91   LEU A HD23 1 
ATOM   983  N N    . ASN A 1 66  ? 41.487 -39.515 0.675   1.00   6.28  ? 92   ASN A N    1 
ATOM   984  C CA   A ASN A 1 66  ? 42.336 -40.268 1.589   0.25   7.34  ? 92   ASN A CA   1 
ATOM   985  C CA   B ASN A 1 66  ? 42.333 -40.202 1.648   0.75   7.48  ? 92   ASN A CA   1 
ATOM   986  C C    . ASN A 1 66  ? 43.824 -39.999 1.401   1.00   7.32  ? 92   ASN A C    1 
ATOM   987  O O    . ASN A 1 66  ? 44.639 -40.576 2.092   1.00   8.20  ? 92   ASN A O    1 
ATOM   988  C CB   A ASN A 1 66  ? 42.095 -41.761 1.391   0.25   8.89  ? 92   ASN A CB   1 
ATOM   989  C CB   B ASN A 1 66  ? 41.973 -41.683 1.734   0.75   9.50  ? 92   ASN A CB   1 
ATOM   990  C CG   A ASN A 1 66  ? 40.807 -42.227 2.014   0.25   10.76 ? 92   ASN A CG   1 
ATOM   991  C CG   B ASN A 1 66  ? 40.669 -41.909 2.481   0.75   11.43 ? 92   ASN A CG   1 
ATOM   992  O OD1  A ASN A 1 66  ? 39.907 -41.436 2.283   0.25   11.95 ? 92   ASN A OD1  1 
ATOM   993  O OD1  B ASN A 1 66  ? 40.321 -41.164 3.400   0.75   12.67 ? 92   ASN A OD1  1 
ATOM   994  N ND2  A ASN A 1 66  ? 40.716 -43.522 2.259   0.25   11.20 ? 92   ASN A ND2  1 
ATOM   995  N ND2  B ASN A 1 66  ? 39.925 -42.907 2.070   0.75   11.79 ? 92   ASN A ND2  1 
ATOM   996  H H    A ASN A 1 66  ? 41.316 -39.942 -0.052  0.25   7.53  ? 92   ASN A H    1 
ATOM   997  H H    B ASN A 1 66  ? 41.331 -39.961 -0.043  0.75   7.53  ? 92   ASN A H    1 
ATOM   998  H HA   A ASN A 1 66  ? 42.100 -40.041 2.502   0.25   8.81  ? 92   ASN A HA   1 
ATOM   999  H HA   B ASN A 1 66  ? 42.144 -39.821 2.520   0.75   8.98  ? 92   ASN A HA   1 
ATOM   1000 H HB2  A ASN A 1 66  ? 42.056 -41.952 0.441   0.25   10.67 ? 92   ASN A HB2  1 
ATOM   1001 H HB2  B ASN A 1 66  ? 41.874 -42.039 0.837   0.75   11.41 ? 92   ASN A HB2  1 
ATOM   1002 H HB3  A ASN A 1 66  ? 42.823 -42.256 1.799   0.25   10.67 ? 92   ASN A HB3  1 
ATOM   1003 H HB3  B ASN A 1 66  ? 42.677 -42.155 2.205   0.75   11.41 ? 92   ASN A HB3  1 
ATOM   1004 H HD21 A ASN A 1 66  ? 41.371 -44.044 2.064   0.25   13.44 ? 92   ASN A HD21 1 
ATOM   1005 H HD21 B ASN A 1 66  ? 40.184 -43.393 1.410   0.75   14.15 ? 92   ASN A HD21 1 
ATOM   1006 H HD22 A ASN A 1 66  ? 40.001 -43.843 2.615   0.25   13.44 ? 92   ASN A HD22 1 
ATOM   1007 H HD22 B ASN A 1 66  ? 39.178 -43.075 2.460   0.75   14.15 ? 92   ASN A HD22 1 
ATOM   1008 N N    . GLN A 1 67  ? 44.174 -39.159 0.435   1.00   7.13  ? 93   GLN A N    1 
ATOM   1009 C CA   . GLN A 1 67  ? 45.570 -38.843 0.196   1.00   7.62  ? 93   GLN A CA   1 
ATOM   1010 C C    . GLN A 1 67  ? 46.202 -38.175 1.418   1.00   7.89  ? 93   GLN A C    1 
ATOM   1011 O O    . GLN A 1 67  ? 45.645 -37.209 1.961   1.00   7.95  ? 93   GLN A O    1 
ATOM   1012 C CB   . GLN A 1 67  ? 45.701 -37.927 -1.023  1.00   7.92  ? 93   GLN A CB   1 
ATOM   1013 C CG   . GLN A 1 67  ? 47.144 -37.581 -1.373  1.00   9.14  ? 93   GLN A CG   1 
ATOM   1014 C CD   . GLN A 1 67  ? 47.259 -36.784 -2.646  1.00   10.63 ? 93   GLN A CD   1 
ATOM   1015 O OE1  . GLN A 1 67  ? 46.525 -37.006 -3.611  1.00   11.81 ? 93   GLN A OE1  1 
ATOM   1016 N NE2  . GLN A 1 67  ? 48.178 -35.853 -2.658  1.00   12.08 ? 93   GLN A NE2  1 
ATOM   1017 H H    . GLN A 1 67  ? 43.623 -38.762 -0.092  1.00   8.56  ? 93   GLN A H    1 
ATOM   1018 H HA   . GLN A 1 67  ? 46.056 -39.662 0.014   1.00   9.14  ? 93   GLN A HA   1 
ATOM   1019 H HB2  . GLN A 1 67  ? 45.307 -38.370 -1.791  1.00   9.50  ? 93   GLN A HB2  1 
ATOM   1020 H HB3  . GLN A 1 67  ? 45.231 -37.098 -0.844  1.00   9.50  ? 93   GLN A HB3  1 
ATOM   1021 H HG2  . GLN A 1 67  ? 47.526 -37.054 -0.654  1.00   10.97 ? 93   GLN A HG2  1 
ATOM   1022 H HG3  . GLN A 1 67  ? 47.647 -38.402 -1.487  1.00   10.97 ? 93   GLN A HG3  1 
ATOM   1023 H HE21 . GLN A 1 67  ? 48.671 -35.727 -1.965  1.00   14.50 ? 93   GLN A HE21 1 
ATOM   1024 H HE22 . GLN A 1 67  ? 48.289 -35.366 -3.359  1.00   14.50 ? 93   GLN A HE22 1 
ATOM   1025 N N    . ARG A 1 68  ? 47.362 -38.671 1.841   1.00   8.71  ? 94   ARG A N    1 
ATOM   1026 C CA   . ARG A 1 68  ? 48.110 -38.109 2.962   1.00   9.69  ? 94   ARG A CA   1 
ATOM   1027 C C    . ARG A 1 68  ? 48.819 -36.829 2.593   1.00   9.12  ? 94   ARG A C    1 
ATOM   1028 O O    . ARG A 1 68  ? 49.441 -36.718 1.528   1.00   10.86 ? 94   ARG A O    1 
ATOM   1029 C CB   . ARG A 1 68  ? 49.186 -39.098 3.404   1.00   13.49 ? 94   ARG A CB   1 
ATOM   1030 C CG   . ARG A 1 68  ? 48.682 -40.457 3.825   1.00   18.03 ? 94   ARG A CG   1 
ATOM   1031 C CD   . ARG A 1 68  ? 48.285 -40.492 5.249   1.00   23.47 ? 94   ARG A CD   1 
ATOM   1032 N NE   . ARG A 1 68  ? 47.464 -41.660 5.716   1.00   26.57 ? 94   ARG A NE   1 
ATOM   1033 C CZ   . ARG A 1 68  ? 47.512 -42.217 6.939   1.00   28.54 ? 94   ARG A CZ   1 
ATOM   1034 N NH1  . ARG A 1 68  ? 48.369 -41.785 7.853   1.00   30.11 ? 94   ARG A NH1  1 
ATOM   1035 N NH2  . ARG A 1 68  ? 46.733 -43.240 7.261   1.00   27.68 ? 94   ARG A NH2  1 
ATOM   1036 H H    . ARG A 1 68  ? 47.746 -39.352 1.483   1.00   10.45 ? 94   ARG A H    1 
ATOM   1037 H HA   . ARG A 1 68  ? 47.513 -37.937 3.707   1.00   11.63 ? 94   ARG A HA   1 
ATOM   1038 H HB2  . ARG A 1 68  ? 49.801 -39.232 2.666   1.00   16.19 ? 94   ARG A HB2  1 
ATOM   1039 H HB3  . ARG A 1 68  ? 49.662 -38.718 4.158   1.00   16.19 ? 94   ARG A HB3  1 
ATOM   1040 H HG2  . ARG A 1 68  ? 47.906 -40.687 3.290   1.00   21.64 ? 94   ARG A HG2  1 
ATOM   1041 H HG3  . ARG A 1 68  ? 49.385 -41.111 3.691   1.00   21.64 ? 94   ARG A HG3  1 
ATOM   1042 H HD2  . ARG A 1 68  ? 49.093 -40.482 5.785   1.00   28.17 ? 94   ARG A HD2  1 
ATOM   1043 H HD3  . ARG A 1 68  ? 47.770 -39.692 5.436   1.00   28.17 ? 94   ARG A HD3  1 
ATOM   1044 H HE   . ARG A 1 68  ? 46.915 -42.004 5.150   1.00   31.88 ? 94   ARG A HE   1 
ATOM   1045 H HH11 . ARG A 1 68  ? 48.887 -41.122 7.677   1.00   36.14 ? 94   ARG A HH11 1 
ATOM   1046 H HH12 . ARG A 1 68  ? 48.394 -42.157 8.628   1.00   36.14 ? 94   ARG A HH12 1 
ATOM   1047 H HH21 . ARG A 1 68  ? 46.174 -43.551 6.686   1.00   33.22 ? 94   ARG A HH21 1 
ATOM   1048 H HH22 . ARG A 1 68  ? 46.789 -43.594 8.043   1.00   33.22 ? 94   ARG A HH22 1 
ATOM   1049 N N    . VAL A 1 69  ? 48.759 -35.875 3.519   1.00   8.47  ? 95   VAL A N    1 
ATOM   1050 C CA   . VAL A 1 69  ? 49.460 -34.621 3.417   1.00   8.63  ? 95   VAL A CA   1 
ATOM   1051 C C    . VAL A 1 69  ? 50.297 -34.451 4.674   1.00   7.96  ? 95   VAL A C    1 
ATOM   1052 O O    . VAL A 1 69  ? 49.795 -34.527 5.790   1.00   8.52  ? 95   VAL A O    1 
ATOM   1053 C CB   . VAL A 1 69  ? 48.473 -33.465 3.260   1.00   9.06  ? 95   VAL A CB   1 
ATOM   1054 C CG1  . VAL A 1 69  ? 49.217 -32.150 3.208   1.00   9.67  ? 95   VAL A CG1  1 
ATOM   1055 C CG2  . VAL A 1 69  ? 47.575 -33.655 2.010   1.00   10.46 ? 95   VAL A CG2  1 
ATOM   1056 H H    . VAL A 1 69  ? 48.296 -35.945 4.241   1.00   10.16 ? 95   VAL A H    1 
ATOM   1057 H HA   . VAL A 1 69  ? 50.050 -34.636 2.648   1.00   10.35 ? 95   VAL A HA   1 
ATOM   1058 H HB   . VAL A 1 69  ? 47.894 -33.444 4.037   1.00   10.87 ? 95   VAL A HB   1 
ATOM   1059 H HG11 . VAL A 1 69  ? 49.824 -32.161 2.452   1.00   11.60 ? 95   VAL A HG11 1 
ATOM   1060 H HG12 . VAL A 1 69  ? 48.576 -31.429 3.108   1.00   11.60 ? 95   VAL A HG12 1 
ATOM   1061 H HG13 . VAL A 1 69  ? 49.716 -32.038 4.033   1.00   11.60 ? 95   VAL A HG13 1 
ATOM   1062 H HG21 . VAL A 1 69  ? 47.075 -34.481 2.104   1.00   12.55 ? 95   VAL A HG21 1 
ATOM   1063 H HG22 . VAL A 1 69  ? 46.964 -32.904 1.944   1.00   12.55 ? 95   VAL A HG22 1 
ATOM   1064 H HG23 . VAL A 1 69  ? 48.137 -33.696 1.221   1.00   12.55 ? 95   VAL A HG23 1 
ATOM   1065 N N    . GLU A 1 70  ? 51.593 -34.269 4.473   1.00   8.57  ? 96   GLU A N    1 
ATOM   1066 C CA   A GLU A 1 70  ? 52.510 -34.086 5.581   0.49   8.62  ? 96   GLU A CA   1 
ATOM   1067 C CA   B GLU A 1 70  ? 52.515 -34.081 5.586   0.51   8.41  ? 96   GLU A CA   1 
ATOM   1068 C C    . GLU A 1 70  ? 52.349 -32.704 6.203   1.00   8.85  ? 96   GLU A C    1 
ATOM   1069 O O    . GLU A 1 70  ? 52.297 -31.702 5.488   1.00   9.98  ? 96   GLU A O    1 
ATOM   1070 C CB   A GLU A 1 70  ? 53.937 -34.312 5.086   0.49   8.93  ? 96   GLU A CB   1 
ATOM   1071 C CB   B GLU A 1 70  ? 53.956 -34.235 5.112   0.51   8.35  ? 96   GLU A CB   1 
ATOM   1072 C CG   A GLU A 1 70  ? 54.169 -35.773 4.697   0.49   9.53  ? 96   GLU A CG   1 
ATOM   1073 C CG   B GLU A 1 70  ? 54.320 -35.631 4.606   0.51   8.30  ? 96   GLU A CG   1 
ATOM   1074 C CD   A GLU A 1 70  ? 55.520 -36.070 4.054   0.49   10.55 ? 96   GLU A CD   1 
ATOM   1075 C CD   B GLU A 1 70  ? 54.508 -36.677 5.711   0.51   8.73  ? 96   GLU A CD   1 
ATOM   1076 O OE1  A GLU A 1 70  ? 56.446 -35.231 4.082   0.49   11.33 ? 96   GLU A OE1  1 
ATOM   1077 O OE1  B GLU A 1 70  ? 54.793 -36.323 6.885   0.51   10.65 ? 96   GLU A OE1  1 
ATOM   1078 O OE2  A GLU A 1 70  ? 55.661 -37.179 3.514   0.49   11.63 ? 96   GLU A OE2  1 
ATOM   1079 O OE2  B GLU A 1 70  ? 54.372 -37.877 5.402   0.51   8.80  ? 96   GLU A OE2  1 
ATOM   1080 H H    A GLU A 1 70  ? 51.968 -34.248 3.699   0.49   10.28 ? 96   GLU A H    1 
ATOM   1081 H H    B GLU A 1 70  ? 51.968 -34.250 3.699   0.51   10.28 ? 96   GLU A H    1 
ATOM   1082 H HA   A GLU A 1 70  ? 52.319 -34.748 6.264   0.49   10.35 ? 96   GLU A HA   1 
ATOM   1083 H HA   B GLU A 1 70  ? 52.340 -34.748 6.268   0.51   10.10 ? 96   GLU A HA   1 
ATOM   1084 H HB2  A GLU A 1 70  ? 54.096 -33.760 4.304   0.49   10.71 ? 96   GLU A HB2  1 
ATOM   1085 H HB2  B GLU A 1 70  ? 54.111 -33.611 4.386   0.51   10.02 ? 96   GLU A HB2  1 
ATOM   1086 H HB3  A GLU A 1 70  ? 54.562 -34.082 5.792   0.49   10.71 ? 96   GLU A HB3  1 
ATOM   1087 H HB3  B GLU A 1 70  ? 54.548 -34.028 5.852   0.51   10.02 ? 96   GLU A HB3  1 
ATOM   1088 H HG2  A GLU A 1 70  ? 54.100 -36.319 5.496   0.49   11.44 ? 96   GLU A HG2  1 
ATOM   1089 H HG2  B GLU A 1 70  ? 53.612 -35.943 4.022   0.51   9.96  ? 96   GLU A HG2  1 
ATOM   1090 H HG3  A GLU A 1 70  ? 53.482 -36.036 4.065   0.49   11.44 ? 96   GLU A HG3  1 
ATOM   1091 H HG3  B GLU A 1 70  ? 55.152 -35.574 4.110   0.51   9.96  ? 96   GLU A HG3  1 
ATOM   1092 N N    . ILE A 1 71  ? 52.244 -32.656 7.537   1.00   8.91  ? 97   ILE A N    1 
ATOM   1093 C CA   . ILE A 1 71  ? 52.142 -31.407 8.294   1.00   9.33  ? 97   ILE A CA   1 
ATOM   1094 C C    . ILE A 1 71  ? 53.468 -31.203 9.016   1.00   11.05 ? 97   ILE A C    1 
ATOM   1095 O O    . ILE A 1 71  ? 53.915 -32.052 9.798   1.00   11.75 ? 97   ILE A O    1 
ATOM   1096 C CB   . ILE A 1 71  ? 51.024 -31.444 9.329   1.00   9.80  ? 97   ILE A CB   1 
ATOM   1097 C CG1  . ILE A 1 71  ? 49.717 -31.920 8.713   1.00   9.42  ? 97   ILE A CG1  1 
ATOM   1098 C CG2  . ILE A 1 71  ? 50.866 -30.101 9.996   1.00   10.63 ? 97   ILE A CG2  1 
ATOM   1099 C CD1  . ILE A 1 71  ? 49.221 -31.113 7.522   1.00   10.46 ? 97   ILE A CD1  1 
ATOM   1100 H H    . ILE A 1 71  ? 52.229 -33.356 8.037   1.00   10.69 ? 97   ILE A H    1 
ATOM   1101 H HA   . ILE A 1 71  ? 51.992 -30.662 7.691   1.00   11.20 ? 97   ILE A HA   1 
ATOM   1102 H HB   . ILE A 1 71  ? 51.277 -32.084 10.012  1.00   11.76 ? 97   ILE A HB   1 
ATOM   1103 H HG12 . ILE A 1 71  ? 49.833 -32.836 8.416   1.00   11.30 ? 97   ILE A HG12 1 
ATOM   1104 H HG13 . ILE A 1 71  ? 49.027 -31.886 9.394   1.00   11.30 ? 97   ILE A HG13 1 
ATOM   1105 H HG21 . ILE A 1 71  ? 50.651 -29.438 9.322   1.00   12.76 ? 97   ILE A HG21 1 
ATOM   1106 H HG22 . ILE A 1 71  ? 50.149 -30.156 10.648  1.00   12.76 ? 97   ILE A HG22 1 
ATOM   1107 H HG23 . ILE A 1 71  ? 51.697 -29.869 10.438  1.00   12.76 ? 97   ILE A HG23 1 
ATOM   1108 H HD11 . ILE A 1 71  ? 49.888 -31.147 6.819   1.00   12.56 ? 97   ILE A HD11 1 
ATOM   1109 H HD12 . ILE A 1 71  ? 48.387 -31.496 7.207   1.00   12.56 ? 97   ILE A HD12 1 
ATOM   1110 H HD13 . ILE A 1 71  ? 49.079 -30.195 7.800   1.00   12.56 ? 97   ILE A HD13 1 
ATOM   1111 N N    . LYS A 1 72  ? 54.102 -30.080 8.719   1.00   13.05 ? 98   LYS A N    1 
ATOM   1112 C CA   . LYS A 1 72  ? 55.368 -29.720 9.346   1.00   15.37 ? 98   LYS A CA   1 
ATOM   1113 C C    . LYS A 1 72  ? 55.197 -28.467 10.196  1.00   14.57 ? 98   LYS A C    1 
ATOM   1114 O O    . LYS A 1 72  ? 54.275 -27.678 10.004  1.00   13.67 ? 98   LYS A O    1 
ATOM   1115 C CB   . LYS A 1 72  ? 56.423 -29.502 8.274   1.00   18.85 ? 98   LYS A CB   1 
ATOM   1116 C CG   . LYS A 1 72  ? 56.719 -30.767 7.518   1.00   22.51 ? 98   LYS A CG   1 
ATOM   1117 C CD   . LYS A 1 72  ? 57.416 -30.513 6.199   1.00   25.21 ? 98   LYS A CD   1 
ATOM   1118 C CE   . LYS A 1 72  ? 57.432 -31.778 5.346   1.00   27.77 ? 98   LYS A CE   1 
ATOM   1119 N NZ   . LYS A 1 72  ? 57.858 -33.002 6.073   1.00   28.89 ? 98   LYS A NZ   1 
ATOM   1120 H H    . LYS A 1 72  ? 53.819 -29.501 8.150   1.00   15.66 ? 98   LYS A H    1 
ATOM   1121 H HA   . LYS A 1 72  ? 55.661 -30.443 9.922   1.00   18.44 ? 98   LYS A HA   1 
ATOM   1122 H HB2  . LYS A 1 72  ? 56.104 -28.839 7.642   1.00   22.62 ? 98   LYS A HB2  1 
ATOM   1123 H HB3  . LYS A 1 72  ? 57.244 -29.199 8.691   1.00   22.62 ? 98   LYS A HB3  1 
ATOM   1124 H HG2  . LYS A 1 72  ? 57.295 -31.330 8.058   1.00   27.02 ? 98   LYS A HG2  1 
ATOM   1125 H HG3  . LYS A 1 72  ? 55.885 -31.227 7.332   1.00   27.02 ? 98   LYS A HG3  1 
ATOM   1126 H HD2  . LYS A 1 72  ? 56.942 -29.820 5.712   1.00   30.25 ? 98   LYS A HD2  1 
ATOM   1127 H HD3  . LYS A 1 72  ? 58.333 -30.243 6.365   1.00   30.25 ? 98   LYS A HD3  1 
ATOM   1128 H HE2  . LYS A 1 72  ? 56.538 -31.934 5.005   1.00   33.33 ? 98   LYS A HE2  1 
ATOM   1129 H HE3  . LYS A 1 72  ? 58.046 -31.647 4.606   1.00   33.33 ? 98   LYS A HE3  1 
ATOM   1130 H HZ1  . LYS A 1 72  ? 57.305 -33.159 6.753   1.00   34.67 ? 98   LYS A HZ1  1 
ATOM   1131 H HZ2  . LYS A 1 72  ? 57.846 -33.702 5.523   1.00   34.67 ? 98   LYS A HZ2  1 
ATOM   1132 H HZ3  . LYS A 1 72  ? 58.683 -32.896 6.389   1.00   34.67 ? 98   LYS A HZ3  1 
ATOM   1133 N N    . LYS A 1 73  ? 56.085 -28.296 11.164  1.00   15.63 ? 99   LYS A N    1 
ATOM   1134 C CA   . LYS A 1 73  ? 56.059 -27.131 12.025  1.00   16.69 ? 99   LYS A CA   1 
ATOM   1135 C C    . LYS A 1 73  ? 56.055 -25.848 11.202  1.00   16.18 ? 99   LYS A C    1 
ATOM   1136 O O    . LYS A 1 73  ? 55.340 -24.909 11.516  1.00   16.17 ? 99   LYS A O    1 
ATOM   1137 C CB   . LYS A 1 73  ? 57.259 -27.146 12.975  1.00   18.85 ? 99   LYS A CB   1 
ATOM   1138 C CG   . LYS A 1 73  ? 57.210 -26.056 14.009  1.00   21.44 ? 99   LYS A CG   1 
ATOM   1139 C CD   . LYS A 1 73  ? 58.411 -26.121 14.924  1.00   24.02 ? 99   LYS A CD   1 
ATOM   1140 C CE   . LYS A 1 73  ? 58.446 -24.938 15.847  1.00   26.58 ? 99   LYS A CE   1 
ATOM   1141 N NZ   . LYS A 1 73  ? 59.616 -25.037 16.758  1.00   27.62 ? 99   LYS A NZ   1 
ATOM   1142 H H    . LYS A 1 73  ? 56.719 -28.849 11.343  1.00   18.75 ? 99   LYS A H    1 
ATOM   1143 H HA   . LYS A 1 73  ? 55.250 -27.149 12.560  1.00   20.03 ? 99   LYS A HA   1 
ATOM   1144 H HB2  . LYS A 1 73  ? 57.282 -27.997 13.439  1.00   22.63 ? 99   LYS A HB2  1 
ATOM   1145 H HB3  . LYS A 1 73  ? 58.071 -27.030 12.457  1.00   22.63 ? 99   LYS A HB3  1 
ATOM   1146 H HG2  . LYS A 1 73  ? 57.210 -25.193 13.567  1.00   25.72 ? 99   LYS A HG2  1 
ATOM   1147 H HG3  . LYS A 1 73  ? 56.410 -26.159 14.548  1.00   25.72 ? 99   LYS A HG3  1 
ATOM   1148 H HD2  . LYS A 1 73  ? 58.363 -26.927 15.461  1.00   28.82 ? 99   LYS A HD2  1 
ATOM   1149 H HD3  . LYS A 1 73  ? 59.222 -26.118 14.392  1.00   28.82 ? 99   LYS A HD3  1 
ATOM   1150 H HE2  . LYS A 1 73  ? 58.528 -24.123 15.328  1.00   31.90 ? 99   LYS A HE2  1 
ATOM   1151 H HE3  . LYS A 1 73  ? 57.638 -24.920 16.384  1.00   31.90 ? 99   LYS A HE3  1 
ATOM   1152 H HZ1  . LYS A 1 73  ? 60.369 -25.057 16.284  1.00   33.14 ? 99   LYS A HZ1  1 
ATOM   1153 H HZ2  . LYS A 1 73  ? 59.636 -24.336 17.305  1.00   33.14 ? 99   LYS A HZ2  1 
ATOM   1154 H HZ3  . LYS A 1 73  ? 59.561 -25.781 17.243  1.00   33.14 ? 99   LYS A HZ3  1 
ATOM   1155 N N    . SER A 1 74  ? 56.810 -25.827 10.113  1.00   16.51 ? 100  SER A N    1 
ATOM   1156 C CA   . SER A 1 74  ? 56.866 -24.642 9.266   1.00   17.96 ? 100  SER A CA   1 
ATOM   1157 C C    . SER A 1 74  ? 55.562 -24.341 8.532   1.00   16.04 ? 100  SER A C    1 
ATOM   1158 O O    . SER A 1 74  ? 55.403 -23.257 7.988   1.00   16.84 ? 100  SER A O    1 
ATOM   1159 C CB   . SER A 1 74  ? 57.986 -24.784 8.241   1.00   21.07 ? 100  SER A CB   1 
ATOM   1160 O OG   . SER A 1 74  ? 57.726 -25.840 7.338   1.00   23.01 ? 100  SER A OG   1 
ATOM   1161 H H    . SER A 1 74  ? 57.298 -26.482 9.842   1.00   19.81 ? 100  SER A H    1 
ATOM   1162 H HA   . SER A 1 74  ? 57.072 -23.875 9.823   1.00   21.55 ? 100  SER A HA   1 
ATOM   1163 H HB2  . SER A 1 74  ? 58.062 -23.956 7.743   1.00   25.29 ? 100  SER A HB2  1 
ATOM   1164 H HB3  . SER A 1 74  ? 58.817 -24.967 8.707   1.00   25.29 ? 100  SER A HB3  1 
ATOM   1165 H HG   . SER A 1 74  ? 58.352 -25.903 6.782   1.00   27.62 ? 100  SER A HG   1 
ATOM   1166 N N    . ASP A 1 75  ? 54.627 -25.287 8.506   1.00   13.54 ? 101  ASP A N    1 
ATOM   1167 C CA   . ASP A 1 75  ? 53.310 -25.049 7.909   1.00   13.23 ? 101  ASP A CA   1 
ATOM   1168 C C    . ASP A 1 75  ? 52.368 -24.297 8.831   1.00   13.80 ? 101  ASP A C    1 
ATOM   1169 O O    . ASP A 1 75  ? 51.308 -23.814 8.388   1.00   15.33 ? 101  ASP A O    1 
ATOM   1170 C CB   . ASP A 1 75  ? 52.631 -26.373 7.567   1.00   13.12 ? 101  ASP A CB   1 
ATOM   1171 C CG   . ASP A 1 75  ? 53.338 -27.143 6.487   1.00   13.97 ? 101  ASP A CG   1 
ATOM   1172 O OD1  . ASP A 1 75  ? 53.858 -26.529 5.542   1.00   16.11 ? 101  ASP A OD1  1 
ATOM   1173 O OD2  . ASP A 1 75  ? 53.325 -28.386 6.560   1.00   14.11 ? 101  ASP A OD2  1 
ATOM   1174 H H    . ASP A 1 75  ? 54.728 -26.079 8.827   1.00   16.25 ? 101  ASP A H    1 
ATOM   1175 H HA   . ASP A 1 75  ? 53.414 -24.537 7.092   1.00   15.87 ? 101  ASP A HA   1 
ATOM   1176 H HB2  . ASP A 1 75  ? 52.607 -26.928 8.362   1.00   15.74 ? 101  ASP A HB2  1 
ATOM   1177 H HB3  . ASP A 1 75  ? 51.728 -26.193 7.262   1.00   15.74 ? 101  ASP A HB3  1 
ATOM   1178 N N    . LEU A 1 76  ? 52.693 -24.242 10.117  1.00   13.23 ? 102  LEU A N    1 
ATOM   1179 C CA   . LEU A 1 76  ? 51.803 -23.555 11.035  1.00   12.77 ? 102  LEU A CA   1 
ATOM   1180 C C    . LEU A 1 76  ? 51.897 -22.068 10.793  1.00   11.94 ? 102  LEU A C    1 
ATOM   1181 O O    . LEU A 1 76  ? 52.982 -21.520 10.615  1.00   13.07 ? 102  LEU A O    1 
ATOM   1182 C CB   . LEU A 1 76  ? 52.129 -23.892 12.482  1.00   12.93 ? 102  LEU A CB   1 
ATOM   1183 C CG   . LEU A 1 76  ? 52.057 -25.388 12.806  1.00   13.41 ? 102  LEU A CG   1 
ATOM   1184 C CD1  . LEU A 1 76  ? 52.322 -25.576 14.287  1.00   15.33 ? 102  LEU A CD1  1 
ATOM   1185 C CD2  . LEU A 1 76  ? 50.718 -26.030 12.439  1.00   13.07 ? 102  LEU A CD2  1 
ATOM   1186 H H    . LEU A 1 76  ? 53.399 -24.582 10.472  1.00   15.88 ? 102  LEU A H    1 
ATOM   1187 H HA   . LEU A 1 76  ? 50.890 -23.832 10.859  1.00   15.32 ? 102  LEU A HA   1 
ATOM   1188 H HB2  . LEU A 1 76  ? 53.030 -23.590 12.677  1.00   15.51 ? 102  LEU A HB2  1 
ATOM   1189 H HB3  . LEU A 1 76  ? 51.498 -23.434 13.058  1.00   15.51 ? 102  LEU A HB3  1 
ATOM   1190 H HG   . LEU A 1 76  ? 52.755 -25.850 12.316  1.00   16.09 ? 102  LEU A HG   1 
ATOM   1191 H HD11 . LEU A 1 76  ? 51.649 -25.093 14.791  1.00   18.40 ? 102  LEU A HD11 1 
ATOM   1192 H HD12 . LEU A 1 76  ? 52.278 -26.522 14.497  1.00   18.40 ? 102  LEU A HD12 1 
ATOM   1193 H HD13 . LEU A 1 76  ? 53.204 -25.231 14.495  1.00   18.40 ? 102  LEU A HD13 1 
ATOM   1194 H HD21 . LEU A 1 76  ? 50.570 -25.929 11.485  1.00   15.68 ? 102  LEU A HD21 1 
ATOM   1195 H HD22 . LEU A 1 76  ? 50.745 -26.972 12.671  1.00   15.68 ? 102  LEU A HD22 1 
ATOM   1196 H HD23 . LEU A 1 76  ? 50.010 -25.588 12.932  1.00   15.68 ? 102  LEU A HD23 1 
ATOM   1197 N N    . VAL A 1 77  ? 50.744 -21.422 10.787  1.00   12.34 ? 103  VAL A N    1 
ATOM   1198 C CA   . VAL A 1 77  ? 50.653 -19.982 10.626  1.00   13.47 ? 103  VAL A CA   1 
ATOM   1199 C C    . VAL A 1 77  ? 50.015 -19.449 11.896  1.00   17.62 ? 103  VAL A C    1 
ATOM   1200 O O    . VAL A 1 77  ? 50.427 -19.856 12.986  1.00   20.02 ? 103  VAL A O    1 
ATOM   1201 C CB   . VAL A 1 77  ? 50.000 -19.600 9.281   1.00   12.42 ? 103  VAL A CB   1 
ATOM   1202 C CG1  . VAL A 1 77  ? 50.981 -19.942 8.152   1.00   13.99 ? 103  VAL A CG1  1 
ATOM   1203 C CG2  . VAL A 1 77  ? 48.661 -20.299 9.075   1.00   12.39 ? 103  VAL A CG2  1 
ATOM   1204 H H    . VAL A 1 77  ? 49.980 -21.806 10.878  1.00   14.80 ? 103  VAL A H    1 
ATOM   1205 H HA   . VAL A 1 77  ? 51.556 -19.630 10.601  1.00   16.17 ? 103  VAL A HA   1 
ATOM   1206 H HB   . VAL A 1 77  ? 49.845 -18.643 9.265   1.00   14.90 ? 103  VAL A HB   1 
ATOM   1207 H HG11 . VAL A 1 77  ? 51.170 -20.893 8.176   1.00   16.79 ? 103  VAL A HG11 1 
ATOM   1208 H HG12 . VAL A 1 77  ? 50.578 -19.705 7.302   1.00   16.79 ? 103  VAL A HG12 1 
ATOM   1209 H HG13 . VAL A 1 77  ? 51.800 -19.439 8.283   1.00   16.79 ? 103  VAL A HG13 1 
ATOM   1210 H HG21 . VAL A 1 77  ? 48.059 -20.043 9.792   1.00   14.87 ? 103  VAL A HG21 1 
ATOM   1211 H HG22 . VAL A 1 77  ? 48.292 -20.027 8.220   1.00   14.87 ? 103  VAL A HG22 1 
ATOM   1212 H HG23 . VAL A 1 77  ? 48.801 -21.258 9.087   1.00   14.87 ? 103  VAL A HG23 1 
ATOM   1213 N N    . ASN A 1 78  ? 49.089 -18.519 11.795  1.00   19.54 ? 104  ASN A N    1 
ATOM   1214 C CA   . ASN A 1 78  ? 48.595 -17.816 12.987  1.00   21.41 ? 104  ASN A CA   1 
ATOM   1215 C C    . ASN A 1 78  ? 47.425 -18.447 13.758  1.00   21.86 ? 104  ASN A C    1 
ATOM   1216 O O    . ASN A 1 78  ? 47.130 -17.992 14.875  1.00   24.42 ? 104  ASN A O    1 
ATOM   1217 C CB   . ASN A 1 78  ? 48.151 -16.425 12.577  1.00   22.77 ? 104  ASN A CB   1 
ATOM   1218 C CG   . ASN A 1 78  ? 46.952 -16.472 11.689  1.00   24.35 ? 104  ASN A CG   1 
ATOM   1219 O OD1  . ASN A 1 78  ? 46.865 -17.343 10.816  1.00   23.09 ? 104  ASN A OD1  1 
ATOM   1220 N ND2  . ASN A 1 78  ? 45.995 -15.574 11.922  1.00   26.74 ? 104  ASN A ND2  1 
ATOM   1221 H H    . ASN A 1 78  ? 48.724 -18.269 11.057  1.00   23.45 ? 104  ASN A H    1 
ATOM   1222 H HA   . ASN A 1 78  ? 49.331 -17.716 13.610  1.00   25.69 ? 104  ASN A HA   1 
ATOM   1223 H HB2  . ASN A 1 78  ? 47.922 -15.915 13.370  1.00   27.32 ? 104  ASN A HB2  1 
ATOM   1224 H HB3  . ASN A 1 78  ? 48.870 -15.989 12.093  1.00   27.32 ? 104  ASN A HB3  1 
ATOM   1225 H HD21 . ASN A 1 78  ? 46.085 -15.004 12.559  1.00   32.09 ? 104  ASN A HD21 1 
ATOM   1226 H HD22 . ASN A 1 78  ? 45.286 -15.565 11.434  1.00   32.09 ? 104  ASN A HD22 1 
ATOM   1227 N N    . TYR A 1 79  ? 46.733 -19.434 13.183  1.00   17.40 ? 105  TYR A N    1 
ATOM   1228 C CA   . TYR A 1 79  ? 45.477 -19.981 13.774  1.00   16.16 ? 105  TYR A CA   1 
ATOM   1229 C C    . TYR A 1 79  ? 45.171 -21.364 13.148  1.00   14.27 ? 105  TYR A C    1 
ATOM   1230 O O    . TYR A 1 79  ? 44.500 -21.492 12.089  1.00   16.56 ? 105  TYR A O    1 
ATOM   1231 C CB   . TYR A 1 79  ? 44.256 -19.079 13.502  1.00   17.45 ? 105  TYR A CB   1 
ATOM   1232 C CG   . TYR A 1 79  ? 43.055 -19.563 14.266  1.00   19.68 ? 105  TYR A CG   1 
ATOM   1233 C CD1  . TYR A 1 79  ? 42.862 -19.194 15.592  1.00   21.50 ? 105  TYR A CD1  1 
ATOM   1234 C CD2  . TYR A 1 79  ? 42.141 -20.434 13.682  1.00   19.86 ? 105  TYR A CD2  1 
ATOM   1235 C CE1  . TYR A 1 79  ? 41.781 -19.664 16.308  1.00   23.41 ? 105  TYR A CE1  1 
ATOM   1236 C CE2  . TYR A 1 79  ? 41.054 -20.905 14.376  1.00   20.98 ? 105  TYR A CE2  1 
ATOM   1237 C CZ   . TYR A 1 79  ? 40.889 -20.513 15.700  1.00   23.14 ? 105  TYR A CZ   1 
ATOM   1238 O OH   . TYR A 1 79  ? 39.823 -20.954 16.411  1.00   25.13 ? 105  TYR A OH   1 
ATOM   1239 H H    . TYR A 1 79  ? 46.960 -19.813 12.446  1.00   20.88 ? 105  TYR A H    1 
ATOM   1240 H HA   . TYR A 1 79  ? 45.583 -20.087 14.732  1.00   19.39 ? 105  TYR A HA   1 
ATOM   1241 H HB2  . TYR A 1 79  ? 44.455 -18.173 13.786  1.00   20.94 ? 105  TYR A HB2  1 
ATOM   1242 H HB3  . TYR A 1 79  ? 44.045 -19.098 12.556  1.00   20.94 ? 105  TYR A HB3  1 
ATOM   1243 H HD1  . TYR A 1 79  ? 43.472 -18.623 16.002  1.00   25.79 ? 105  TYR A HD1  1 
ATOM   1244 H HD2  . TYR A 1 79  ? 42.264 -20.695 12.798  1.00   23.84 ? 105  TYR A HD2  1 
ATOM   1245 H HE1  . TYR A 1 79  ? 41.653 -19.404 17.192  1.00   28.09 ? 105  TYR A HE1  1 
ATOM   1246 H HE2  . TYR A 1 79  ? 40.445 -21.480 13.972  1.00   25.18 ? 105  TYR A HE2  1 
ATOM   1247 H HH   . TYR A 1 79  ? 39.353 -21.464 15.937  1.00   30.15 ? 105  TYR A HH   1 
ATOM   1248 N N    . ASN A 1 80  ? 45.652 -22.407 13.810  1.00   12.01 ? 106  ASN A N    1 
ATOM   1249 C CA   A ASN A 1 80  ? 45.617 -23.747 13.236  0.71   11.76 ? 106  ASN A CA   1 
ATOM   1250 C CA   B ASN A 1 80  ? 45.714 -23.752 13.257  0.29   11.86 ? 106  ASN A CA   1 
ATOM   1251 C C    . ASN A 1 80  ? 45.415 -24.774 14.345  1.00   10.43 ? 106  ASN A C    1 
ATOM   1252 O O    . ASN A 1 80  ? 46.271 -25.613 14.653  1.00   9.74  ? 106  ASN A O    1 
ATOM   1253 C CB   A ASN A 1 80  ? 46.874 -23.990 12.438  0.71   11.99 ? 106  ASN A CB   1 
ATOM   1254 C CB   B ASN A 1 80  ? 47.108 -24.066 12.646  0.29   13.11 ? 106  ASN A CB   1 
ATOM   1255 C CG   A ASN A 1 80  ? 48.040 -23.319 13.044  0.71   12.44 ? 106  ASN A CG   1 
ATOM   1256 C CG   B ASN A 1 80  ? 47.969 -22.840 12.430  0.29   14.12 ? 106  ASN A CG   1 
ATOM   1257 O OD1  A ASN A 1 80  ? 48.665 -22.485 12.411  0.71   14.19 ? 106  ASN A OD1  1 
ATOM   1258 O OD1  B ASN A 1 80  ? 47.970 -22.261 11.351  0.29   14.81 ? 106  ASN A OD1  1 
ATOM   1259 N ND2  A ASN A 1 80  ? 48.295 -23.600 14.311  0.71   11.56 ? 106  ASN A ND2  1 
ATOM   1260 N ND2  B ASN A 1 80  ? 48.766 -22.484 13.437  0.29   14.01 ? 106  ASN A ND2  1 
ATOM   1261 H H    A ASN A 1 80  ? 46.006 -22.366 14.593  0.71   14.41 ? 106  ASN A H    1 
ATOM   1262 H H    B ASN A 1 80  ? 45.961 -22.357 14.611  0.29   14.41 ? 106  ASN A H    1 
ATOM   1263 H HA   A ASN A 1 80  ? 44.862 -23.810 12.630  0.71   14.11 ? 106  ASN A HA   1 
ATOM   1264 H HA   B ASN A 1 80  ? 45.047 -23.844 12.559  0.29   14.23 ? 106  ASN A HA   1 
ATOM   1265 H HB2  A ASN A 1 80  ? 47.054 -24.942 12.407  0.71   14.39 ? 106  ASN A HB2  1 
ATOM   1266 H HB2  B ASN A 1 80  ? 47.585 -24.662 13.244  0.29   15.73 ? 106  ASN A HB2  1 
ATOM   1267 H HB3  A ASN A 1 80  ? 46.755 -23.641 11.541  0.71   14.39 ? 106  ASN A HB3  1 
ATOM   1268 H HB3  B ASN A 1 80  ? 46.982 -24.495 11.785  0.29   15.73 ? 106  ASN A HB3  1 
ATOM   1269 H HD21 A ASN A 1 80  ? 47.791 -24.150 14.740  0.71   13.87 ? 106  ASN A HD21 1 
ATOM   1270 H HD21 B ASN A 1 80  ? 48.773 -22.945 14.163  0.29   16.82 ? 106  ASN A HD21 1 
ATOM   1271 H HD22 A ASN A 1 80  ? 48.965 -23.232 14.707  0.71   13.87 ? 106  ASN A HD22 1 
ATOM   1272 H HD22 B ASN A 1 80  ? 49.274 -21.794 13.360  0.29   16.82 ? 106  ASN A HD22 1 
ATOM   1273 N N    . PRO A 1 81  ? 44.236 -24.715 14.959  1.00   10.15 ? 107  PRO A N    1 
ATOM   1274 C CA   . PRO A 1 81  ? 43.950 -25.576 16.111  1.00   10.46 ? 107  PRO A CA   1 
ATOM   1275 C C    . PRO A 1 81  ? 43.989 -27.063 15.818  1.00   9.81  ? 107  PRO A C    1 
ATOM   1276 O O    . PRO A 1 81  ? 44.251 -27.838 16.725  1.00   11.03 ? 107  PRO A O    1 
ATOM   1277 C CB   . PRO A 1 81  ? 42.537 -25.130 16.525  1.00   12.01 ? 107  PRO A CB   1 
ATOM   1278 C CG   . PRO A 1 81  ? 41.953 -24.588 15.290  1.00   12.70 ? 107  PRO A CG   1 
ATOM   1279 C CD   . PRO A 1 81  ? 43.079 -23.864 14.632  1.00   12.04 ? 107  PRO A CD   1 
ATOM   1280 H HA   . PRO A 1 81  ? 44.567 -25.380 16.833  1.00   12.56 ? 107  PRO A HA   1 
ATOM   1281 H HB2  . PRO A 1 81  ? 42.030 -25.894 16.841  1.00   14.41 ? 107  PRO A HB2  1 
ATOM   1282 H HB3  . PRO A 1 81  ? 42.595 -24.445 17.210  1.00   14.41 ? 107  PRO A HB3  1 
ATOM   1283 H HG2  . PRO A 1 81  ? 41.636 -25.314 14.731  1.00   15.24 ? 107  PRO A HG2  1 
ATOM   1284 H HG3  . PRO A 1 81  ? 41.231 -23.978 15.508  1.00   15.24 ? 107  PRO A HG3  1 
ATOM   1285 H HD2  . PRO A 1 81  ? 42.945 -23.825 13.672  1.00   14.45 ? 107  PRO A HD2  1 
ATOM   1286 H HD3  . PRO A 1 81  ? 43.187 -22.980 15.016  1.00   14.45 ? 107  PRO A HD3  1 
ATOM   1287 N N    . ILE A 1 82  ? 43.716 -27.472 14.592  1.00   9.27  ? 108  ILE A N    1 
ATOM   1288 C CA   . ILE A 1 82  ? 43.755 -28.883 14.259  1.00   8.94  ? 108  ILE A CA   1 
ATOM   1289 C C    . ILE A 1 82  ? 45.114 -29.288 13.701  1.00   8.54  ? 108  ILE A C    1 
ATOM   1290 O O    . ILE A 1 82  ? 45.695 -30.272 14.146  1.00   8.43  ? 108  ILE A O    1 
ATOM   1291 C CB   . ILE A 1 82  ? 42.634 -29.276 13.259  1.00   8.58  ? 108  ILE A CB   1 
ATOM   1292 C CG1  . ILE A 1 82  ? 41.259 -28.828 13.778  1.00   9.08  ? 108  ILE A CG1  1 
ATOM   1293 C CG2  . ILE A 1 82  ? 42.691 -30.777 12.979  1.00   9.55  ? 108  ILE A CG2  1 
ATOM   1294 C CD1  . ILE A 1 82  ? 40.945 -29.264 15.207  1.00   10.11 ? 108  ILE A CD1  1 
ATOM   1295 H H    . ILE A 1 82  ? 43.506 -26.956 13.937  1.00   11.13 ? 108  ILE A H    1 
ATOM   1296 H HA   . ILE A 1 82  ? 43.611 -29.393 15.072  1.00   10.73 ? 108  ILE A HA   1 
ATOM   1297 H HB   . ILE A 1 82  ? 42.803 -28.812 12.425  1.00   10.30 ? 108  ILE A HB   1 
ATOM   1298 H HG12 . ILE A 1 82  ? 41.219 -27.859 13.751  1.00   10.90 ? 108  ILE A HG12 1 
ATOM   1299 H HG13 . ILE A 1 82  ? 40.574 -29.199 13.200  1.00   10.90 ? 108  ILE A HG13 1 
ATOM   1300 H HG21 . ILE A 1 82  ? 42.566 -31.258 13.812  1.00   11.46 ? 108  ILE A HG21 1 
ATOM   1301 H HG22 . ILE A 1 82  ? 41.987 -31.008 12.354  1.00   11.46 ? 108  ILE A HG22 1 
ATOM   1302 H HG23 . ILE A 1 82  ? 43.557 -30.994 12.598  1.00   11.46 ? 108  ILE A HG23 1 
ATOM   1303 H HD11 . ILE A 1 82  ? 41.612 -28.890 15.805  1.00   12.14 ? 108  ILE A HD11 1 
ATOM   1304 H HD12 . ILE A 1 82  ? 40.064 -28.939 15.450  1.00   12.14 ? 108  ILE A HD12 1 
ATOM   1305 H HD13 . ILE A 1 82  ? 40.966 -30.233 15.253  1.00   12.14 ? 108  ILE A HD13 1 
ATOM   1306 N N    . ALA A 1 83  ? 45.639 -28.524 12.753  1.00   8.42  ? 109  ALA A N    1 
ATOM   1307 C CA   . ALA A 1 83  ? 46.904 -28.899 12.154  1.00   8.17  ? 109  ALA A CA   1 
ATOM   1308 C C    . ALA A 1 83  ? 48.042 -28.978 13.174  1.00   8.52  ? 109  ALA A C    1 
ATOM   1309 O O    . ALA A 1 83  ? 48.921 -29.810 13.044  1.00   9.37  ? 109  ALA A O    1 
ATOM   1310 C CB   . ALA A 1 83  ? 47.271 -27.943 11.077  1.00   9.24  ? 109  ALA A CB   1 
ATOM   1311 H H    . ALA A 1 83  ? 45.290 -27.800 12.446  1.00   10.10 ? 109  ALA A H    1 
ATOM   1312 H HA   . ALA A 1 83  ? 46.808 -29.776 11.751  1.00   9.81  ? 109  ALA A HA   1 
ATOM   1313 H HB1  . ALA A 1 83  ? 47.348 -27.054 11.457  1.00   11.09 ? 109  ALA A HB1  1 
ATOM   1314 H HB2  . ALA A 1 83  ? 48.118 -28.213 10.691  1.00   11.09 ? 109  ALA A HB2  1 
ATOM   1315 H HB3  . ALA A 1 83  ? 46.579 -27.953 10.397  1.00   11.09 ? 109  ALA A HB3  1 
ATOM   1316 N N    . GLU A 1 84  ? 48.011 -28.136 14.199  1.00   8.93  ? 110  GLU A N    1 
ATOM   1317 C CA   . GLU A 1 84  ? 49.086 -28.152 15.183  1.00   11.04 ? 110  GLU A CA   1 
ATOM   1318 C C    . GLU A 1 84  ? 49.131 -29.493 15.927  1.00   10.81 ? 110  GLU A C    1 
ATOM   1319 O O    . GLU A 1 84  ? 50.176 -29.866 16.441  1.00   12.52 ? 110  GLU A O    1 
ATOM   1320 C CB   . GLU A 1 84  ? 48.959 -26.993 16.144  1.00   14.41 ? 110  GLU A CB   1 
ATOM   1321 C CG   . GLU A 1 84  ? 47.879 -27.155 17.182  1.00   18.98 ? 110  GLU A CG   1 
ATOM   1322 C CD   . GLU A 1 84  ? 47.781 -25.988 18.162  1.00   24.12 ? 110  GLU A CD   1 
ATOM   1323 O OE1  . GLU A 1 84  ? 48.792 -25.277 18.391  1.00   26.63 ? 110  GLU A OE1  1 
ATOM   1324 O OE2  . GLU A 1 84  ? 46.682 -25.805 18.721  1.00   26.05 ? 110  GLU A OE2  1 
ATOM   1325 H H    . GLU A 1 84  ? 47.393 -27.557 14.347  1.00   10.72 ? 110  GLU A H    1 
ATOM   1326 H HA   . GLU A 1 84  ? 49.930 -28.050 14.715  1.00   13.25 ? 110  GLU A HA   1 
ATOM   1327 H HB2  . GLU A 1 84  ? 49.802 -26.884 16.611  1.00   17.30 ? 110  GLU A HB2  1 
ATOM   1328 H HB3  . GLU A 1 84  ? 48.760 -26.190 15.637  1.00   17.30 ? 110  GLU A HB3  1 
ATOM   1329 H HG2  . GLU A 1 84  ? 47.024 -27.237 16.732  1.00   22.77 ? 110  GLU A HG2  1 
ATOM   1330 H HG3  . GLU A 1 84  ? 48.058 -27.958 17.696  1.00   22.77 ? 110  GLU A HG3  1 
ATOM   1331 N N    . LYS A 1 85  ? 48.014 -30.207 15.983  1.00   10.10 ? 111  LYS A N    1 
ATOM   1332 C CA   . LYS A 1 85  ? 47.958 -31.503 16.641  1.00   10.98 ? 111  LYS A CA   1 
ATOM   1333 C C    . LYS A 1 85  ? 48.634 -32.575 15.828  1.00   11.77 ? 111  LYS A C    1 
ATOM   1334 O O    . LYS A 1 85  ? 48.870 -33.670 16.340  1.00   14.89 ? 111  LYS A O    1 
ATOM   1335 C CB   . LYS A 1 85  ? 46.512 -31.940 16.852  1.00   12.00 ? 111  LYS A CB   1 
ATOM   1336 C CG   . LYS A 1 85  ? 45.668 -30.983 17.623  1.00   13.12 ? 111  LYS A CG   1 
ATOM   1337 C CD   . LYS A 1 85  ? 44.266 -31.545 17.725  1.00   14.76 ? 111  LYS A CD   1 
ATOM   1338 C CE   . LYS A 1 85  ? 43.258 -30.630 18.361  1.00   16.93 ? 111  LYS A CE   1 
ATOM   1339 N NZ   . LYS A 1 85  ? 41.993 -31.419 18.467  1.00   18.93 ? 111  LYS A NZ   1 
ATOM   1340 H H    . LYS A 1 85  ? 47.265 -29.957 15.642  1.00   12.12 ? 111  LYS A H    1 
ATOM   1341 H HA   . LYS A 1 85  ? 48.395 -31.449 17.505  1.00   13.18 ? 111  LYS A HA   1 
ATOM   1342 H HB2  . LYS A 1 85  ? 46.097 -32.062 15.984  1.00   14.40 ? 111  LYS A HB2  1 
ATOM   1343 H HB3  . LYS A 1 85  ? 46.512 -32.783 17.333  1.00   14.40 ? 111  LYS A HB3  1 
ATOM   1344 H HG2  . LYS A 1 85  ? 46.027 -30.874 18.518  1.00   15.75 ? 111  LYS A HG2  1 
ATOM   1345 H HG3  . LYS A 1 85  ? 45.630 -30.131 17.161  1.00   15.75 ? 111  LYS A HG3  1 
ATOM   1346 H HD2  . LYS A 1 85  ? 43.950 -31.751 16.832  1.00   17.71 ? 111  LYS A HD2  1 
ATOM   1347 H HD3  . LYS A 1 85  ? 44.297 -32.358 18.254  1.00   17.71 ? 111  LYS A HD3  1 
ATOM   1348 H HE2  . LYS A 1 85  ? 43.550 -30.372 19.250  1.00   20.32 ? 111  LYS A HE2  1 
ATOM   1349 H HE3  . LYS A 1 85  ? 43.105 -29.854 17.800  1.00   20.32 ? 111  LYS A HE3  1 
ATOM   1350 H HZ1  . LYS A 1 85  ? 42.127 -32.142 18.968  1.00   22.71 ? 111  LYS A HZ1  1 
ATOM   1351 H HZ2  . LYS A 1 85  ? 41.356 -30.923 18.840  1.00   22.71 ? 111  LYS A HZ2  1 
ATOM   1352 H HZ3  . LYS A 1 85  ? 41.725 -31.674 17.657  1.00   22.71 ? 111  LYS A HZ3  1 
ATOM   1353 N N    . HIS A 1 86  ? 48.908 -32.287 14.554  1.00   10.59 ? 112  HIS A N    1 
ATOM   1354 C CA   . HIS A 1 86  ? 49.383 -33.299 13.625  1.00   10.45 ? 112  HIS A CA   1 
ATOM   1355 C C    . HIS A 1 86  ? 50.758 -33.028 13.075  1.00   10.85 ? 112  HIS A C    1 
ATOM   1356 O O    . HIS A 1 86  ? 51.206 -33.683 12.151  1.00   11.42 ? 112  HIS A O    1 
ATOM   1357 C CB   . HIS A 1 86  ? 48.366 -33.484 12.498  1.00   10.65 ? 112  HIS A CB   1 
ATOM   1358 C CG   . HIS A 1 86  ? 47.053 -33.985 12.995  1.00   11.90 ? 112  HIS A CG   1 
ATOM   1359 N ND1  . HIS A 1 86  ? 46.866 -35.309 13.340  1.00   14.02 ? 112  HIS A ND1  1 
ATOM   1360 C CD2  . HIS A 1 86  ? 45.926 -33.336 13.358  1.00   14.17 ? 112  HIS A CD2  1 
ATOM   1361 C CE1  . HIS A 1 86  ? 45.638 -35.465 13.801  1.00   15.59 ? 112  HIS A CE1  1 
ATOM   1362 N NE2  . HIS A 1 86  ? 45.058 -34.280 13.846  1.00   14.72 ? 112  HIS A NE2  1 
ATOM   1363 H H    . HIS A 1 86  ? 48.826 -31.505 14.206  1.00   12.71 ? 112  HIS A H    1 
ATOM   1364 H HA   . HIS A 1 86  ? 49.432 -34.142 14.103  1.00   12.54 ? 112  HIS A HA   1 
ATOM   1365 H HB2  . HIS A 1 86  ? 48.217 -32.630 12.062  1.00   12.78 ? 112  HIS A HB2  1 
ATOM   1366 H HB3  . HIS A 1 86  ? 48.713 -34.127 11.860  1.00   12.78 ? 112  HIS A HB3  1 
ATOM   1367 H HD2  . HIS A 1 86  ? 45.759 -32.425 13.267  1.00   17.01 ? 112  HIS A HD2  1 
ATOM   1368 H HE1  . HIS A 1 86  ? 45.260 -36.266 14.083  1.00   18.70 ? 112  HIS A HE1  1 
ATOM   1369 H HE2  . HIS A 1 86  ? 44.254 -34.128 14.110  1.00   17.67 ? 112  HIS A HE2  1 
ATOM   1370 N N    . VAL A 1 87  ? 51.457 -32.076 13.667  1.00   11.14 ? 113  VAL A N    1 
ATOM   1371 C CA   . VAL A 1 87  ? 52.812 -31.802 13.248  1.00   11.72 ? 113  VAL A CA   1 
ATOM   1372 C C    . VAL A 1 87  ? 53.673 -33.053 13.395  1.00   11.76 ? 113  VAL A C    1 
ATOM   1373 O O    . VAL A 1 87  ? 53.604 -33.782 14.399  1.00   11.96 ? 113  VAL A O    1 
ATOM   1374 C CB   . VAL A 1 87  ? 53.417 -30.634 14.047  1.00   12.11 ? 113  VAL A CB   1 
ATOM   1375 C CG1  . VAL A 1 87  ? 54.912 -30.517 13.791  1.00   14.04 ? 113  VAL A CG1  1 
ATOM   1376 C CG2  . VAL A 1 87  ? 52.718 -29.359 13.694  1.00   11.53 ? 113  VAL A CG2  1 
ATOM   1377 H H    . VAL A 1 87  ? 51.172 -31.580 14.309  1.00   13.36 ? 113  VAL A H    1 
ATOM   1378 H HA   . VAL A 1 87  ? 52.807 -31.552 12.311  1.00   14.07 ? 113  VAL A HA   1 
ATOM   1379 H HB   . VAL A 1 87  ? 53.286 -30.797 14.994  1.00   14.54 ? 113  VAL A HB   1 
ATOM   1380 H HG11 . VAL A 1 87  ? 55.059 -30.362 12.844  1.00   16.85 ? 113  VAL A HG11 1 
ATOM   1381 H HG12 . VAL A 1 87  ? 55.264 -29.775 14.307  1.00   16.85 ? 113  VAL A HG12 1 
ATOM   1382 H HG13 . VAL A 1 87  ? 55.344 -31.343 14.062  1.00   16.85 ? 113  VAL A HG13 1 
ATOM   1383 H HG21 . VAL A 1 87  ? 51.776 -29.446 13.910  1.00   13.83 ? 113  VAL A HG21 1 
ATOM   1384 H HG22 . VAL A 1 87  ? 53.109 -28.633 14.205  1.00   13.83 ? 113  VAL A HG22 1 
ATOM   1385 H HG23 . VAL A 1 87  ? 52.826 -29.193 12.745  1.00   13.83 ? 113  VAL A HG23 1 
ATOM   1386 N N    . ASN A 1 88  ? 54.460 -33.296 12.349  1.00   11.36 ? 114  ASN A N    1 
ATOM   1387 C CA   . ASN A 1 88  ? 55.296 -34.496 12.162  1.00   13.05 ? 114  ASN A CA   1 
ATOM   1388 C C    . ASN A 1 88  ? 54.564 -35.721 11.658  1.00   12.78 ? 114  ASN A C    1 
ATOM   1389 O O    . ASN A 1 88  ? 55.197 -36.742 11.351  1.00   14.16 ? 114  ASN A O    1 
ATOM   1390 C CB   . ASN A 1 88  ? 56.118 -34.862 13.397  1.00   15.75 ? 114  ASN A CB   1 
ATOM   1391 C CG   . ASN A 1 88  ? 56.996 -33.752 13.828  1.00   18.86 ? 114  ASN A CG   1 
ATOM   1392 O OD1  . ASN A 1 88  ? 57.619 -33.092 13.000  1.00   19.32 ? 114  ASN A OD1  1 
ATOM   1393 N ND2  . ASN A 1 88  ? 57.073 -33.531 15.134  1.00   20.64 ? 114  ASN A ND2  1 
ATOM   1394 H H    . ASN A 1 88  ? 54.533 -32.747 11.691  1.00   13.63 ? 114  ASN A H    1 
ATOM   1395 H HA   . ASN A 1 88  ? 55.942 -34.276 11.473  1.00   15.66 ? 114  ASN A HA   1 
ATOM   1396 H HB2  . ASN A 1 88  ? 55.517 -35.073 14.128  1.00   18.90 ? 114  ASN A HB2  1 
ATOM   1397 H HB3  . ASN A 1 88  ? 56.677 -35.628 13.192  1.00   18.90 ? 114  ASN A HB3  1 
ATOM   1398 H HD21 . ASN A 1 88  ? 56.625 -34.022 15.680  1.00   24.77 ? 114  ASN A HD21 1 
ATOM   1399 H HD22 . ASN A 1 88  ? 57.570 -32.897 15.434  1.00   24.77 ? 114  ASN A HD22 1 
ATOM   1400 N N    . GLY A 1 89  ? 53.239 -35.597 11.568  1.00   12.14 ? 115  GLY A N    1 
ATOM   1401 C CA   . GLY A 1 89  ? 52.377 -36.637 11.026  1.00   11.80 ? 115  GLY A CA   1 
ATOM   1402 C C    . GLY A 1 89  ? 51.726 -36.189 9.725   1.00   10.92 ? 115  GLY A C    1 
ATOM   1403 O O    . GLY A 1 89  ? 52.186 -35.255 9.057   1.00   11.34 ? 115  GLY A O    1 
ATOM   1404 H H    . GLY A 1 89  ? 52.809 -34.898 11.824  1.00   14.56 ? 115  GLY A H    1 
ATOM   1405 H HA2  . GLY A 1 89  ? 52.897 -37.437 10.855  1.00   14.16 ? 115  GLY A HA2  1 
ATOM   1406 H HA3  . GLY A 1 89  ? 51.680 -36.850 11.666  1.00   14.16 ? 115  GLY A HA3  1 
ATOM   1407 N N    . THR A 1 90  ? 50.664 -36.882 9.343   1.00   10.14 ? 116  THR A N    1 
ATOM   1408 C CA   . THR A 1 90  ? 49.914 -36.549 8.138   1.00   9.47  ? 116  THR A CA   1 
ATOM   1409 C C    . THR A 1 90  ? 48.465 -36.324 8.525   1.00   8.02  ? 116  THR A C    1 
ATOM   1410 O O    . THR A 1 90  ? 48.001 -36.787 9.574   1.00   9.70  ? 116  THR A O    1 
ATOM   1411 C CB   . THR A 1 90  ? 49.983 -37.663 7.065   1.00   10.53 ? 116  THR A CB   1 
ATOM   1412 O OG1  . THR A 1 90  ? 49.447 -38.885 7.590   1.00   11.25 ? 116  THR A OG1  1 
ATOM   1413 C CG2  . THR A 1 90  ? 51.413 -37.864 6.603   1.00   10.33 ? 116  THR A CG2  1 
ATOM   1414 H H    . THR A 1 90  ? 50.351 -37.559 9.770   1.00   12.17 ? 116  THR A H    1 
ATOM   1415 H HA   . THR A 1 90  ? 50.263 -35.729 7.754   1.00   11.37 ? 116  THR A HA   1 
ATOM   1416 H HB   . THR A 1 90  ? 49.456 -37.393 6.297   1.00   12.63 ? 116  THR A HB   1 
ATOM   1417 H HG1  . THR A 1 90  ? 49.889 -39.128 8.262   1.00   13.50 ? 116  THR A HG1  1 
ATOM   1418 H HG21 . THR A 1 90  ? 51.971 -38.119 7.354   1.00   12.40 ? 116  THR A HG21 1 
ATOM   1419 H HG22 . THR A 1 90  ? 51.450 -38.562 5.931   1.00   12.40 ? 116  THR A HG22 1 
ATOM   1420 H HG23 . THR A 1 90  ? 51.757 -37.041 6.221   1.00   12.40 ? 116  THR A HG23 1 
ATOM   1421 N N    . MET A 1 91  ? 47.783 -35.588 7.653   1.00   7.96  ? 117  MET A N    1 
ATOM   1422 C CA   . MET A 1 91  ? 46.343 -35.466 7.622   1.00   7.79  ? 117  MET A CA   1 
ATOM   1423 C C    . MET A 1 91  ? 45.907 -35.787 6.209   1.00   7.33  ? 117  MET A C    1 
ATOM   1424 O O    . MET A 1 91  ? 46.612 -35.453 5.249   1.00   7.92  ? 117  MET A O    1 
ATOM   1425 C CB   . MET A 1 91  ? 45.882 -34.045 7.970   1.00   7.90  ? 117  MET A CB   1 
ATOM   1426 C CG   . MET A 1 91  ? 46.230 -33.649 9.383   1.00   8.57  ? 117  MET A CG   1 
ATOM   1427 S SD   . MET A 1 91  ? 45.849 -31.941 9.774   1.00   8.01  ? 117  MET A SD   1 
ATOM   1428 C CE   . MET A 1 91  ? 44.074 -31.932 9.664   1.00   8.55  ? 117  MET A CE   1 
ATOM   1429 H H    . MET A 1 91  ? 48.165 -35.125 7.037   1.00   9.55  ? 117  MET A H    1 
ATOM   1430 H HA   . MET A 1 91  ? 45.942 -36.092 8.245   1.00   9.34  ? 117  MET A HA   1 
ATOM   1431 H HB2  . MET A 1 91  ? 46.310 -33.417 7.368   1.00   9.48  ? 117  MET A HB2  1 
ATOM   1432 H HB3  . MET A 1 91  ? 44.918 -33.993 7.873   1.00   9.48  ? 117  MET A HB3  1 
ATOM   1433 H HG2  . MET A 1 91  ? 45.732 -34.211 9.997   1.00   10.28 ? 117  MET A HG2  1 
ATOM   1434 H HG3  . MET A 1 91  ? 47.182 -33.778 9.518   1.00   10.28 ? 117  MET A HG3  1 
ATOM   1435 H HE1  . MET A 1 91  ? 43.715 -32.563 10.307  1.00   10.26 ? 117  MET A HE1  1 
ATOM   1436 H HE2  . MET A 1 91  ? 43.751 -31.039 9.861   1.00   10.26 ? 117  MET A HE2  1 
ATOM   1437 H HE3  . MET A 1 91  ? 43.812 -32.188 8.766   1.00   10.26 ? 117  MET A HE3  1 
ATOM   1438 N N    . THR A 1 92  ? 44.743 -36.398 6.048   1.00   6.70  ? 118  THR A N    1 
ATOM   1439 C CA   . THR A 1 92  ? 44.240 -36.635 4.703   1.00   6.00  ? 118  THR A CA   1 
ATOM   1440 C C    . THR A 1 92  ? 43.645 -35.332 4.155   1.00   5.72  ? 118  THR A C    1 
ATOM   1441 O O    . THR A 1 92  ? 43.301 -34.413 4.907   1.00   5.42  ? 118  THR A O    1 
ATOM   1442 C CB   . THR A 1 92  ? 43.201 -37.727 4.654   1.00   6.37  ? 118  THR A CB   1 
ATOM   1443 O OG1  . THR A 1 92  ? 42.066 -37.270 5.384   1.00   6.81  ? 118  THR A OG1  1 
ATOM   1444 C CG2  . THR A 1 92  ? 43.712 -39.043 5.227   1.00   7.42  ? 118  THR A CG2  1 
ATOM   1445 H H    . THR A 1 92  ? 44.235 -36.679 6.683   1.00   8.04  ? 118  THR A H    1 
ATOM   1446 H HA   . THR A 1 92  ? 44.978 -36.895 4.130   1.00   7.20  ? 118  THR A HA   1 
ATOM   1447 H HB   . THR A 1 92  ? 42.944 -37.879 3.731   1.00   7.65  ? 118  THR A HB   1 
ATOM   1448 H HG1  . THR A 1 92  ? 41.464 -37.856 5.377   1.00   8.18  ? 118  THR A HG1  1 
ATOM   1449 H HG21 . THR A 1 92  ? 43.969 -38.922 6.154   1.00   8.91  ? 118  THR A HG21 1 
ATOM   1450 H HG22 . THR A 1 92  ? 43.017 -39.718 5.177   1.00   8.91  ? 118  THR A HG22 1 
ATOM   1451 H HG23 . THR A 1 92  ? 44.482 -39.346 4.722   1.00   8.91  ? 118  THR A HG23 1 
ATOM   1452 N N    . LEU A 1 93  ? 43.468 -35.277 2.847   1.00   5.77  ? 119  LEU A N    1 
ATOM   1453 C CA   . LEU A 1 93  ? 42.779 -34.141 2.248   1.00   5.47  ? 119  LEU A CA   1 
ATOM   1454 C C    . LEU A 1 93  ? 41.370 -33.963 2.821   1.00   5.45  ? 119  LEU A C    1 
ATOM   1455 O O    . LEU A 1 93  ? 40.952 -32.842 3.059   1.00   5.65  ? 119  LEU A O    1 
ATOM   1456 C CB   . LEU A 1 93  ? 42.772 -34.223 0.722   1.00   5.47  ? 119  LEU A CB   1 
ATOM   1457 C CG   . LEU A 1 93  ? 44.113 -33.834 0.106   1.00   6.28  ? 119  LEU A CG   1 
ATOM   1458 C CD1  . LEU A 1 93  ? 44.141 -34.197 -1.371  1.00   6.70  ? 119  LEU A CD1  1 
ATOM   1459 C CD2  . LEU A 1 93  ? 44.431 -32.349 0.281   1.00   6.27  ? 119  LEU A CD2  1 
ATOM   1460 H H    . LEU A 1 93  ? 43.731 -35.875 2.288   1.00   6.92  ? 119  LEU A H    1 
ATOM   1461 H HA   . LEU A 1 93  ? 43.276 -33.341 2.481   1.00   6.57  ? 119  LEU A HA   1 
ATOM   1462 H HB2  . LEU A 1 93  ? 42.573 -35.135 0.456   1.00   6.57  ? 119  LEU A HB2  1 
ATOM   1463 H HB3  . LEU A 1 93  ? 42.096 -33.620 0.376   1.00   6.57  ? 119  LEU A HB3  1 
ATOM   1464 H HG   . LEU A 1 93  ? 44.814 -34.338 0.546   1.00   7.54  ? 119  LEU A HG   1 
ATOM   1465 H HD11 . LEU A 1 93  ? 43.429 -33.721 -1.827  1.00   8.04  ? 119  LEU A HD11 1 
ATOM   1466 H HD12 . LEU A 1 93  ? 45.000 -33.941 -1.742  1.00   8.04  ? 119  LEU A HD12 1 
ATOM   1467 H HD13 . LEU A 1 93  ? 44.013 -35.154 -1.464  1.00   8.04  ? 119  LEU A HD13 1 
ATOM   1468 H HD21 . LEU A 1 93  ? 44.463 -32.144 1.229   1.00   7.52  ? 119  LEU A HD21 1 
ATOM   1469 H HD22 . LEU A 1 93  ? 45.290 -32.160 -0.128  1.00   7.52  ? 119  LEU A HD22 1 
ATOM   1470 H HD23 . LEU A 1 93  ? 43.737 -31.825 -0.148  1.00   7.52  ? 119  LEU A HD23 1 
ATOM   1471 N N    . ALA A 1 94  ? 40.657 -35.063 3.072   1.00   5.58  ? 120  ALA A N    1 
ATOM   1472 C CA   . ALA A 1 94  ? 39.344 -34.959 3.716   1.00   6.12  ? 120  ALA A CA   1 
ATOM   1473 C C    . ALA A 1 94  ? 39.478 -34.318 5.096   1.00   5.30  ? 120  ALA A C    1 
ATOM   1474 O O    . ALA A 1 94  ? 38.682 -33.454 5.474   1.00   5.89  ? 120  ALA A O    1 
ATOM   1475 C CB   . ALA A 1 94  ? 38.690 -36.317 3.843   1.00   6.57  ? 120  ALA A CB   1 
ATOM   1476 H H    . ALA A 1 94  ? 40.904 -35.865 2.885   1.00   6.69  ? 120  ALA A H    1 
ATOM   1477 H HA   . ALA A 1 94  ? 38.768 -34.395 3.176   1.00   7.35  ? 120  ALA A HA   1 
ATOM   1478 H HB1  . ALA A 1 94  ? 39.258 -36.892 4.379   1.00   7.88  ? 120  ALA A HB1  1 
ATOM   1479 H HB2  . ALA A 1 94  ? 37.826 -36.212 4.271   1.00   7.88  ? 120  ALA A HB2  1 
ATOM   1480 H HB3  . ALA A 1 94  ? 38.576 -36.696 2.957   1.00   7.88  ? 120  ALA A HB3  1 
ATOM   1481 N N    . GLU A 1 95  ? 40.455 -34.767 5.878   1.00   5.37  ? 121  GLU A N    1 
ATOM   1482 C CA   . GLU A 1 95  ? 40.646 -34.200 7.200   1.00   5.38  ? 121  GLU A CA   1 
ATOM   1483 C C    . GLU A 1 95  ? 40.992 -32.711 7.138   1.00   5.18  ? 121  GLU A C    1 
ATOM   1484 O O    . GLU A 1 95  ? 40.636 -31.941 8.031   1.00   5.66  ? 121  GLU A O    1 
ATOM   1485 C CB   . GLU A 1 95  ? 41.708 -34.990 7.967   1.00   6.99  ? 121  GLU A CB   1 
ATOM   1486 C CG   . GLU A 1 95  ? 41.201 -36.341 8.403   1.00   8.50  ? 121  GLU A CG   1 
ATOM   1487 C CD   . GLU A 1 95  ? 42.275 -37.328 8.814   1.00   10.69 ? 121  GLU A CD   1 
ATOM   1488 O OE1  . GLU A 1 95  ? 43.466 -37.080 8.591   1.00   9.22  ? 121  GLU A OE1  1 
ATOM   1489 O OE2  . GLU A 1 95  ? 41.907 -38.374 9.361   1.00   14.49 ? 121  GLU A OE2  1 
ATOM   1490 H H    . GLU A 1 95  ? 41.010 -35.389 5.667   1.00   6.44  ? 121  GLU A H    1 
ATOM   1491 H HA   . GLU A 1 95  ? 39.814 -34.284 7.691   1.00   6.45  ? 121  GLU A HA   1 
ATOM   1492 H HB2  . GLU A 1 95  ? 42.479 -35.126 7.394   1.00   8.39  ? 121  GLU A HB2  1 
ATOM   1493 H HB3  . GLU A 1 95  ? 41.964 -34.492 8.759   1.00   8.39  ? 121  GLU A HB3  1 
ATOM   1494 H HG2  . GLU A 1 95  ? 40.611 -36.218 9.162   1.00   10.20 ? 121  GLU A HG2  1 
ATOM   1495 H HG3  . GLU A 1 95  ? 40.707 -36.736 7.668   1.00   10.20 ? 121  GLU A HG3  1 
ATOM   1496 N N    . LEU A 1 96  ? 41.748 -32.313 6.119   1.00   5.20  ? 122  LEU A N    1 
ATOM   1497 C CA   . LEU A 1 96  ? 42.090 -30.914 5.907   1.00   5.25  ? 122  LEU A CA   1 
ATOM   1498 C C    . LEU A 1 96  ? 40.834 -30.117 5.530   1.00   5.18  ? 122  LEU A C    1 
ATOM   1499 O O    . LEU A 1 96  ? 40.649 -29.009 6.024   1.00   5.22  ? 122  LEU A O    1 
ATOM   1500 C CB   . LEU A 1 96  ? 43.207 -30.788 4.868   1.00   5.33  ? 122  LEU A CB   1 
ATOM   1501 C CG   . LEU A 1 96  ? 44.529 -31.314 5.414   1.00   6.04  ? 122  LEU A CG   1 
ATOM   1502 C CD1  . LEU A 1 96  ? 45.469 -31.660 4.249   1.00   7.16  ? 122  LEU A CD1  1 
ATOM   1503 C CD2  . LEU A 1 96  ? 45.187 -30.336 6.359   1.00   6.96  ? 122  LEU A CD2  1 
ATOM   1504 H H    . LEU A 1 96  ? 42.080 -32.844 5.530   1.00   6.24  ? 122  LEU A H    1 
ATOM   1505 H HA   . LEU A 1 96  ? 42.426 -30.549 6.740   1.00   6.30  ? 122  LEU A HA   1 
ATOM   1506 H HB2  . LEU A 1 96  ? 42.975 -31.306 4.081   1.00   6.40  ? 122  LEU A HB2  1 
ATOM   1507 H HB3  . LEU A 1 96  ? 43.324 -29.854 4.633   1.00   6.40  ? 122  LEU A HB3  1 
ATOM   1508 H HG   . LEU A 1 96  ? 44.358 -32.131 5.907   1.00   7.24  ? 122  LEU A HG   1 
ATOM   1509 H HD11 . LEU A 1 96  ? 45.629 -30.861 3.724   1.00   8.59  ? 122  LEU A HD11 1 
ATOM   1510 H HD12 . LEU A 1 96  ? 46.306 -31.994 4.608   1.00   8.59  ? 122  LEU A HD12 1 
ATOM   1511 H HD13 . LEU A 1 96  ? 45.051 -32.340 3.698   1.00   8.59  ? 122  LEU A HD13 1 
ATOM   1512 H HD21 . LEU A 1 96  ? 44.591 -30.171 7.107   1.00   8.35  ? 122  LEU A HD21 1 
ATOM   1513 H HD22 . LEU A 1 96  ? 46.020 -30.716 6.677   1.00   8.35  ? 122  LEU A HD22 1 
ATOM   1514 H HD23 . LEU A 1 96  ? 45.360 -29.507 5.886   1.00   8.35  ? 122  LEU A HD23 1 
ATOM   1515 N N    . GLY A 1 97  ? 39.969 -30.669 4.684   1.00   5.35  ? 123  GLY A N    1 
ATOM   1516 C CA   . GLY A 1 97  ? 38.698 -30.021 4.408   1.00   5.27  ? 123  GLY A CA   1 
ATOM   1517 C C    . GLY A 1 97  ? 37.888 -29.818 5.680   1.00   4.85  ? 123  GLY A C    1 
ATOM   1518 O O    . GLY A 1 97  ? 37.376 -28.730 5.952   1.00   5.30  ? 123  GLY A O    1 
ATOM   1519 H H    . GLY A 1 97  ? 40.094 -31.408 4.262   1.00   6.42  ? 123  GLY A H    1 
ATOM   1520 H HA2  . GLY A 1 97  ? 38.855 -29.156 3.999   1.00   6.32  ? 123  GLY A HA2  1 
ATOM   1521 H HA3  . GLY A 1 97  ? 38.180 -30.566 3.795   1.00   6.32  ? 123  GLY A HA3  1 
ATOM   1522 N N    . ALA A 1 98  ? 37.778 -30.881 6.481   1.00   5.19  ? 124  ALA A N    1 
ATOM   1523 C CA   . ALA A 1 98  ? 37.033 -30.808 7.721   1.00   6.15  ? 124  ALA A CA   1 
ATOM   1524 C C    . ALA A 1 98  ? 37.610 -29.749 8.661   1.00   5.94  ? 124  ALA A C    1 
ATOM   1525 O O    . ALA A 1 98  ? 36.882 -28.973 9.264   1.00   6.03  ? 124  ALA A O    1 
ATOM   1526 C CB   . ALA A 1 98  ? 37.005 -32.149 8.411   1.00   6.31  ? 124  ALA A CB   1 
ATOM   1527 H H    . ALA A 1 98  ? 38.129 -31.650 6.322   1.00   6.23  ? 124  ALA A H    1 
ATOM   1528 H HA   . ALA A 1 98  ? 36.117 -30.558 7.520   1.00   7.38  ? 124  ALA A HA   1 
ATOM   1529 H HB1  . ALA A 1 98  ? 37.915 -32.423 8.605   1.00   7.58  ? 124  ALA A HB1  1 
ATOM   1530 H HB2  . ALA A 1 98  ? 36.501 -32.069 9.235   1.00   7.58  ? 124  ALA A HB2  1 
ATOM   1531 H HB3  . ALA A 1 98  ? 36.582 -32.796 7.825   1.00   7.58  ? 124  ALA A HB3  1 
ATOM   1532 N N    . ALA A 1 99  ? 38.919 -29.740 8.816   1.00   5.27  ? 125  ALA A N    1 
ATOM   1533 C CA   . ALA A 1 99  ? 39.557 -28.786 9.712   1.00   5.48  ? 125  ALA A CA   1 
ATOM   1534 C C    . ALA A 1 99  ? 39.372 -27.343 9.214   1.00   5.24  ? 125  ALA A C    1 
ATOM   1535 O O    . ALA A 1 99  ? 39.107 -26.432 10.011  1.00   5.01  ? 125  ALA A O    1 
ATOM   1536 C CB   . ALA A 1 99  ? 41.021 -29.125 9.853   1.00   5.89  ? 125  ALA A CB   1 
ATOM   1537 H H    . ALA A 1 99  ? 39.463 -30.273 8.417   1.00   6.32  ? 125  ALA A H    1 
ATOM   1538 H HA   . ALA A 1 99  ? 39.148 -28.855 10.589  1.00   6.58  ? 125  ALA A HA   1 
ATOM   1539 H HB1  . ALA A 1 99  ? 41.440 -29.082 8.979   1.00   7.07  ? 125  ALA A HB1  1 
ATOM   1540 H HB2  . ALA A 1 99  ? 41.436 -28.484 10.451  1.00   7.07  ? 125  ALA A HB2  1 
ATOM   1541 H HB3  . ALA A 1 99  ? 41.104 -30.020 10.217  1.00   7.07  ? 125  ALA A HB3  1 
ATOM   1542 N N    . ALA A 1 100 ? 39.587 -27.132 7.917   1.00   4.49  ? 126  ALA A N    1 
ATOM   1543 C CA   . ALA A 1 100 ? 39.428 -25.811 7.337   1.00   4.97  ? 126  ALA A CA   1 
ATOM   1544 C C    . ALA A 1 100 ? 38.009 -25.297 7.569   1.00   4.60  ? 126  ALA A C    1 
ATOM   1545 O O    . ALA A 1 100 ? 37.811 -24.125 7.876   1.00   5.55  ? 126  ALA A O    1 
ATOM   1546 C CB   . ALA A 1 100 ? 39.727 -25.842 5.842   1.00   5.34  ? 126  ALA A CB   1 
ATOM   1547 H H    . ALA A 1 100 ? 39.826 -27.738 7.356   1.00   5.38  ? 126  ALA A H    1 
ATOM   1548 H HA   . ALA A 1 100 ? 40.049 -25.198 7.760   1.00   5.96  ? 126  ALA A HA   1 
ATOM   1549 H HB1  . ALA A 1 100 ? 39.112 -26.456 5.410   1.00   6.40  ? 126  ALA A HB1  1 
ATOM   1550 H HB2  . ALA A 1 100 ? 39.614 -24.950 5.480   1.00   6.40  ? 126  ALA A HB2  1 
ATOM   1551 H HB3  . ALA A 1 100 ? 40.640 -26.140 5.709   1.00   6.40  ? 126  ALA A HB3  1 
ATOM   1552 N N    . LEU A 1 101 ? 37.003 -26.147 7.358   1.00   4.52  ? 127  LEU A N    1 
ATOM   1553 C CA   . LEU A 1 101 ? 35.624 -25.695 7.443   1.00   4.91  ? 127  LEU A CA   1 
ATOM   1554 C C    . LEU A 1 101 ? 35.099 -25.650 8.877   1.00   4.64  ? 127  LEU A C    1 
ATOM   1555 O O    . LEU A 1 101 ? 34.378 -24.729 9.250   1.00   5.84  ? 127  LEU A O    1 
ATOM   1556 C CB   . LEU A 1 101 ? 34.704 -26.527 6.574   1.00   4.92  ? 127  LEU A CB   1 
ATOM   1557 C CG   . LEU A 1 101 ? 35.022 -26.411 5.100   1.00   6.21  ? 127  LEU A CG   1 
ATOM   1558 C CD1  . LEU A 1 101 ? 33.905 -26.998 4.261   1.00   6.76  ? 127  LEU A CD1  1 
ATOM   1559 C CD2  . LEU A 1 101 ? 35.305 -25.021 4.596   1.00   7.55  ? 127  LEU A CD2  1 
ATOM   1560 H H    . LEU A 1 101 ? 37.095 -26.981 7.167   1.00   5.43  ? 127  LEU A H    1 
ATOM   1561 H HA   . LEU A 1 101 ? 35.588 -24.788 7.102   1.00   5.89  ? 127  LEU A HA   1 
ATOM   1562 H HB2  . LEU A 1 101 ? 34.790 -27.460 6.826   1.00   5.90  ? 127  LEU A HB2  1 
ATOM   1563 H HB3  . LEU A 1 101 ? 33.790 -26.230 6.707   1.00   5.90  ? 127  LEU A HB3  1 
ATOM   1564 H HG   . LEU A 1 101 ? 35.816 -26.941 4.925   1.00   7.45  ? 127  LEU A HG   1 
ATOM   1565 H HD11 . LEU A 1 101 ? 33.085 -26.515 4.447   1.00   8.11  ? 127  LEU A HD11 1 
ATOM   1566 H HD12 . LEU A 1 101 ? 34.136 -26.910 3.323   1.00   8.11  ? 127  LEU A HD12 1 
ATOM   1567 H HD13 . LEU A 1 101 ? 33.798 -27.934 4.490   1.00   8.11  ? 127  LEU A HD13 1 
ATOM   1568 H HD21 . LEU A 1 101 ? 36.071 -24.663 5.071   1.00   9.07  ? 127  LEU A HD21 1 
ATOM   1569 H HD22 . LEU A 1 101 ? 35.495 -25.063 3.646   1.00   9.07  ? 127  LEU A HD22 1 
ATOM   1570 H HD23 . LEU A 1 101 ? 34.527 -24.463 4.754   1.00   9.07  ? 127  LEU A HD23 1 
ATOM   1571 N N    . GLN A 1 102 ? 35.399 -26.667 9.683   1.00   5.16  ? 128  GLN A N    1 
ATOM   1572 C CA   . GLN A 1 102 ? 34.735 -26.787 10.983  1.00   5.35  ? 128  GLN A CA   1 
ATOM   1573 C C    . GLN A 1 102 ? 35.450 -26.064 12.111  1.00   5.29  ? 128  GLN A C    1 
ATOM   1574 O O    . GLN A 1 102 ? 34.838 -25.764 13.118  1.00   5.79  ? 128  GLN A O    1 
ATOM   1575 C CB   . GLN A 1 102 ? 34.531 -28.252 11.363  1.00   5.92  ? 128  GLN A CB   1 
ATOM   1576 C CG   . GLN A 1 102 ? 33.690 -28.970 10.323  1.00   6.97  ? 128  GLN A CG   1 
ATOM   1577 C CD   . GLN A 1 102 ? 33.295 -30.340 10.745  1.00   9.64  ? 128  GLN A CD   1 
ATOM   1578 O OE1  . GLN A 1 102 ? 34.059 -31.050 11.393  1.00   12.66 ? 128  GLN A OE1  1 
ATOM   1579 N NE2  . GLN A 1 102 ? 32.091 -30.745 10.371  1.00   9.97  ? 128  GLN A NE2  1 
ATOM   1580 H H    . GLN A 1 102 ? 35.968 -27.287 9.508   1.00   6.19  ? 128  GLN A H    1 
ATOM   1581 H HA   . GLN A 1 102 ? 33.854 -26.388 10.905  1.00   6.42  ? 128  GLN A HA   1 
ATOM   1582 H HB2  . GLN A 1 102 ? 35.393 -28.693 11.418  1.00   7.10  ? 128  GLN A HB2  1 
ATOM   1583 H HB3  . GLN A 1 102 ? 34.072 -28.302 12.216  1.00   7.10  ? 128  GLN A HB3  1 
ATOM   1584 H HG2  . GLN A 1 102 ? 32.880 -28.460 10.165  1.00   8.36  ? 128  GLN A HG2  1 
ATOM   1585 H HG3  . GLN A 1 102 ? 34.200 -29.045 9.502   1.00   8.36  ? 128  GLN A HG3  1 
ATOM   1586 H HE21 . GLN A 1 102 ? 31.586 -30.225 9.910   1.00   11.96 ? 128  GLN A HE21 1 
ATOM   1587 H HE22 . GLN A 1 102 ? 31.814 -31.530 10.590  1.00   11.96 ? 128  GLN A HE22 1 
ATOM   1588 N N    . TYR A 1 103 ? 36.743 -25.812 11.921  1.00   5.41  ? 129  TYR A N    1 
ATOM   1589 C CA   . TYR A 1 103 ? 37.574 -25.098 12.884  1.00   5.36  ? 129  TYR A CA   1 
ATOM   1590 C C    . TYR A 1 103 ? 38.238 -23.873 12.283  1.00   6.00  ? 129  TYR A C    1 
ATOM   1591 O O    . TYR A 1 103 ? 38.947 -23.165 12.982  1.00   7.80  ? 129  TYR A O    1 
ATOM   1592 C CB   . TYR A 1 103 ? 38.624 -26.046 13.469  1.00   5.84  ? 129  TYR A CB   1 
ATOM   1593 C CG   . TYR A 1 103 ? 37.970 -27.134 14.295  1.00   6.23  ? 129  TYR A CG   1 
ATOM   1594 C CD1  . TYR A 1 103 ? 37.675 -26.929 15.616  1.00   6.36  ? 129  TYR A CD1  1 
ATOM   1595 C CD2  . TYR A 1 103 ? 37.570 -28.338 13.721  1.00   6.85  ? 129  TYR A CD2  1 
ATOM   1596 C CE1  . TYR A 1 103 ? 37.026 -27.895 16.361  1.00   7.57  ? 129  TYR A CE1  1 
ATOM   1597 C CE2  . TYR A 1 103 ? 36.919 -29.311 14.455  1.00   7.27  ? 129  TYR A CE2  1 
ATOM   1598 C CZ   . TYR A 1 103 ? 36.653 -29.078 15.778  1.00   7.82  ? 129  TYR A CZ   1 
ATOM   1599 O OH   . TYR A 1 103 ? 35.996 -30.036 16.504  1.00   9.77  ? 129  TYR A OH   1 
ATOM   1600 H H    . TYR A 1 103 ? 37.174 -26.055 11.218  1.00   6.49  ? 129  TYR A H    1 
ATOM   1601 H HA   . TYR A 1 103 ? 37.011 -24.796 13.614  1.00   6.43  ? 129  TYR A HA   1 
ATOM   1602 H HB2  . TYR A 1 103 ? 39.118 -26.465 12.747  1.00   7.01  ? 129  TYR A HB2  1 
ATOM   1603 H HB3  . TYR A 1 103 ? 39.225 -25.546 14.043  1.00   7.01  ? 129  TYR A HB3  1 
ATOM   1604 H HD1  . TYR A 1 103 ? 37.916 -26.126 16.019  1.00   7.63  ? 129  TYR A HD1  1 
ATOM   1605 H HD2  . TYR A 1 103 ? 37.743 -28.491 12.820  1.00   8.22  ? 129  TYR A HD2  1 
ATOM   1606 H HE1  . TYR A 1 103 ? 36.840 -27.742 17.260  1.00   9.08  ? 129  TYR A HE1  1 
ATOM   1607 H HE2  . TYR A 1 103 ? 36.665 -30.112 14.057  1.00   8.72  ? 129  TYR A HE2  1 
ATOM   1608 H HH   . TYR A 1 103 ? 35.893 -29.776 17.296  1.00   11.72 ? 129  TYR A HH   1 
ATOM   1609 N N    . SER A 1 104 ? 38.015 -23.611 11.002  1.00   5.33  ? 130  SER A N    1 
ATOM   1610 C CA   . SER A 1 104 ? 38.641 -22.479 10.313  1.00   5.88  ? 130  SER A CA   1 
ATOM   1611 C C    . SER A 1 104 ? 40.166 -22.548 10.371  1.00   6.23  ? 130  SER A C    1 
ATOM   1612 O O    . SER A 1 104 ? 40.842 -21.525 10.441  1.00   6.81  ? 130  SER A O    1 
ATOM   1613 C CB   . SER A 1 104 ? 38.129 -21.141 10.831  1.00   5.99  ? 130  SER A CB   1 
ATOM   1614 O OG   . SER A 1 104 ? 38.156 -20.221 9.765   1.00   5.80  ? 130  SER A OG   1 
ATOM   1615 H H    . SER A 1 104 ? 37.499 -24.079 10.498  1.00   6.39  ? 130  SER A H    1 
ATOM   1616 H HA   . SER A 1 104 ? 38.394 -22.529 9.377   1.00   7.06  ? 130  SER A HA   1 
ATOM   1617 H HB2  . SER A 1 104 ? 37.218 -21.243 11.148  1.00   7.19  ? 130  SER A HB2  1 
ATOM   1618 H HB3  . SER A 1 104 ? 38.706 -20.827 11.545  1.00   7.19  ? 130  SER A HB3  1 
ATOM   1619 H HG   . SER A 1 104 ? 37.878 -19.473 10.025  1.00   6.96  ? 130  SER A HG   1 
ATOM   1620 N N    . ASP A 1 105 ? 40.712 -23.761 10.299  1.00   5.92  ? 131  ASP A N    1 
ATOM   1621 C CA   . ASP A 1 105 ? 42.141 -23.951 10.417  1.00   6.03  ? 131  ASP A CA   1 
ATOM   1622 C C    . ASP A 1 105 ? 42.874 -23.374 9.192   1.00   5.56  ? 131  ASP A C    1 
ATOM   1623 O O    . ASP A 1 105 ? 42.603 -23.746 8.030   1.00   5.95  ? 131  ASP A O    1 
ATOM   1624 C CB   . ASP A 1 105 ? 42.430 -25.438 10.606  1.00   6.22  ? 131  ASP A CB   1 
ATOM   1625 C CG   . ASP A 1 105 ? 43.872 -25.715 10.941  1.00   6.68  ? 131  ASP A CG   1 
ATOM   1626 O OD1  . ASP A 1 105 ? 44.750 -25.370 10.115  1.00   6.86  ? 131  ASP A OD1  1 
ATOM   1627 O OD2  . ASP A 1 105 ? 44.101 -26.281 12.030  1.00   7.76  ? 131  ASP A OD2  1 
ATOM   1628 H H    . ASP A 1 105 ? 40.269 -24.489 10.182  1.00   7.11  ? 131  ASP A H    1 
ATOM   1629 H HA   . ASP A 1 105 ? 42.458 -23.482 11.204  1.00   7.23  ? 131  ASP A HA   1 
ATOM   1630 H HB2  . ASP A 1 105 ? 41.883 -25.776 11.332  1.00   7.46  ? 131  ASP A HB2  1 
ATOM   1631 H HB3  . ASP A 1 105 ? 42.218 -25.907 9.784   1.00   7.46  ? 131  ASP A HB3  1 
ATOM   1632 N N    . ASN A 1 106 ? 43.781 -22.428 9.450   1.00   6.33  ? 132  ASN A N    1 
ATOM   1633 C CA   . ASN A 1 106 ? 44.480 -21.752 8.371   1.00   6.51  ? 132  ASN A CA   1 
ATOM   1634 C C    . ASN A 1 106 ? 45.516 -22.612 7.676   1.00   6.32  ? 132  ASN A C    1 
ATOM   1635 O O    . ASN A 1 106 ? 45.737 -22.473 6.484   1.00   6.28  ? 132  ASN A O    1 
ATOM   1636 C CB   . ASN A 1 106 ? 45.136 -20.480 8.874   1.00   6.86  ? 132  ASN A CB   1 
ATOM   1637 C CG   . ASN A 1 106 ? 44.156 -19.325 9.016   1.00   8.57  ? 132  ASN A CG   1 
ATOM   1638 O OD1  . ASN A 1 106 ? 43.130 -19.298 8.361   1.00   8.95  ? 132  ASN A OD1  1 
ATOM   1639 N ND2  . ASN A 1 106 ? 44.514 -18.336 9.821   1.00   11.05 ? 132  ASN A ND2  1 
ATOM   1640 H H    . ASN A 1 106 ? 44.003 -22.165 10.238  1.00   7.60  ? 132  ASN A H    1 
ATOM   1641 H HA   . ASN A 1 106 ? 43.826 -21.494 7.703   1.00   7.81  ? 132  ASN A HA   1 
ATOM   1642 H HB2  . ASN A 1 106 ? 45.527 -20.649 9.745   1.00   8.23  ? 132  ASN A HB2  1 
ATOM   1643 H HB3  . ASN A 1 106 ? 45.826 -20.212 8.247   1.00   8.23  ? 132  ASN A HB3  1 
ATOM   1644 H HD21 . ASN A 1 106 ? 45.269 -18.368 10.232  1.00   13.26 ? 132  ASN A HD21 1 
ATOM   1645 H HD22 . ASN A 1 106 ? 43.993 -17.661 9.933   1.00   13.26 ? 132  ASN A HD22 1 
ATOM   1646 N N    . THR A 1 107 ? 46.191 -23.465 8.419   1.00   6.22  ? 133  THR A N    1 
ATOM   1647 C CA   . THR A 1 107 ? 47.122 -24.402 7.806   1.00   6.50  ? 133  THR A CA   1 
ATOM   1648 C C    . THR A 1 107 ? 46.367 -25.336 6.866   1.00   6.19  ? 133  THR A C    1 
ATOM   1649 O O    . THR A 1 107 ? 46.816 -25.631 5.762   1.00   6.46  ? 133  THR A O    1 
ATOM   1650 C CB   . THR A 1 107 ? 47.906 -25.173 8.869   1.00   7.74  ? 133  THR A CB   1 
ATOM   1651 O OG1  . THR A 1 107 ? 48.749 -24.266 9.602   1.00   9.64  ? 133  THR A OG1  1 
ATOM   1652 C CG2  . THR A 1 107 ? 48.762 -26.250 8.229   1.00   7.87  ? 133  THR A CG2  1 
ATOM   1653 H H    . THR A 1 107 ? 46.133 -23.526 9.275   1.00   7.46  ? 133  THR A H    1 
ATOM   1654 H HA   . THR A 1 107 ? 47.760 -23.902 7.273   1.00   7.80  ? 133  THR A HA   1 
ATOM   1655 H HB   . THR A 1 107 ? 47.286 -25.599 9.480   1.00   9.29  ? 133  THR A HB   1 
ATOM   1656 H HG1  . THR A 1 107 ? 48.280 -23.679 9.978   1.00   11.57 ? 133  THR A HG1  1 
ATOM   1657 H HG21 . THR A 1 107 ? 49.392 -25.849 7.611   1.00   9.45  ? 133  THR A HG21 1 
ATOM   1658 H HG22 . THR A 1 107 ? 49.254 -26.731 8.913   1.00   9.45  ? 133  THR A HG22 1 
ATOM   1659 H HG23 . THR A 1 107 ? 48.200 -26.876 7.746   1.00   9.45  ? 133  THR A HG23 1 
ATOM   1660 N N    . ALA A 1 108 ? 45.209 -25.793 7.311   1.00   5.79  ? 134  ALA A N    1 
ATOM   1661 C CA   . ALA A 1 108 ? 44.389 -26.669 6.495   1.00   5.52  ? 134  ALA A CA   1 
ATOM   1662 C C    . ALA A 1 108 ? 43.990 -25.965 5.195   1.00   5.10  ? 134  ALA A C    1 
ATOM   1663 O O    . ALA A 1 108 ? 44.109 -26.538 4.115   1.00   5.57  ? 134  ALA A O    1 
ATOM   1664 C CB   . ALA A 1 108 ? 43.182 -27.142 7.252   1.00   5.65  ? 134  ALA A CB   1 
ATOM   1665 H H    . ALA A 1 108 ? 44.875 -25.611 8.082   1.00   6.95  ? 134  ALA A H    1 
ATOM   1666 H HA   . ALA A 1 108 ? 44.911 -27.451 6.258   1.00   6.62  ? 134  ALA A HA   1 
ATOM   1667 H HB1  . ALA A 1 108 ? 42.653 -26.373 7.515   1.00   6.79  ? 134  ALA A HB1  1 
ATOM   1668 H HB2  . ALA A 1 108 ? 42.658 -27.723 6.679   1.00   6.79  ? 134  ALA A HB2  1 
ATOM   1669 H HB3  . ALA A 1 108 ? 43.474 -27.629 8.039   1.00   6.79  ? 134  ALA A HB3  1 
ATOM   1670 N N    . MET A 1 109 ? 43.522 -24.730 5.300   1.00   5.14  ? 135  MET A N    1 
ATOM   1671 C CA   . MET A 1 109 ? 43.212 -23.939 4.107   1.00   4.87  ? 135  MET A CA   1 
ATOM   1672 C C    . MET A 1 109 ? 44.419 -23.870 3.178   1.00   5.30  ? 135  MET A C    1 
ATOM   1673 O O    . MET A 1 109 ? 44.290 -24.091 1.976   1.00   5.38  ? 135  MET A O    1 
ATOM   1674 C CB   . MET A 1 109 ? 42.779 -22.541 4.533   1.00   5.11  ? 135  MET A CB   1 
ATOM   1675 C CG   . MET A 1 109 ? 42.626 -21.521 3.426   1.00   5.08  ? 135  MET A CG   1 
ATOM   1676 S SD   . MET A 1 109 ? 41.447 -22.027 2.136   1.00   4.92  ? 135  MET A SD   1 
ATOM   1677 C CE   . MET A 1 109 ? 40.858 -20.409 1.603   1.00   5.21  ? 135  MET A CE   1 
ATOM   1678 H H    . MET A 1 109 ? 43.375 -24.324 6.044   1.00   6.17  ? 135  MET A H    1 
ATOM   1679 H HA   . MET A 1 109 ? 42.472 -24.353 3.635   1.00   5.85  ? 135  MET A HA   1 
ATOM   1680 H HB2  . MET A 1 109 ? 41.922 -22.612 4.981   1.00   6.14  ? 135  MET A HB2  1 
ATOM   1681 H HB3  . MET A 1 109 ? 43.439 -22.195 5.154   1.00   6.14  ? 135  MET A HB3  1 
ATOM   1682 H HG2  . MET A 1 109 ? 42.309 -20.689 3.809   1.00   6.09  ? 135  MET A HG2  1 
ATOM   1683 H HG3  . MET A 1 109 ? 43.488 -21.383 3.005   1.00   6.09  ? 135  MET A HG3  1 
ATOM   1684 H HE1  . MET A 1 109 ? 41.610 -19.892 1.274   1.00   6.26  ? 135  MET A HE1  1 
ATOM   1685 H HE2  . MET A 1 109 ? 40.204 -20.528 0.896   1.00   6.26  ? 135  MET A HE2  1 
ATOM   1686 H HE3  . MET A 1 109 ? 40.450 -19.957 2.358   1.00   6.26  ? 135  MET A HE3  1 
ATOM   1687 N N    . ASN A 1 110 ? 45.591 -23.583 3.737   1.00   5.11  ? 136  ASN A N    1 
ATOM   1688 C CA   . ASN A 1 110 ? 46.776 -23.452 2.901   1.00   5.25  ? 136  ASN A CA   1 
ATOM   1689 C C    . ASN A 1 110 ? 47.149 -24.763 2.231   1.00   5.43  ? 136  ASN A C    1 
ATOM   1690 O O    . ASN A 1 110 ? 47.591 -24.737 1.089   1.00   6.00  ? 136  ASN A O    1 
ATOM   1691 C CB   . ASN A 1 110 ? 47.927 -22.869 3.684   1.00   6.06  ? 136  ASN A CB   1 
ATOM   1692 C CG   . ASN A 1 110 ? 47.698 -21.410 4.036   1.00   6.18  ? 136  ASN A CG   1 
ATOM   1693 O OD1  . ASN A 1 110 ? 46.805 -20.764 3.484   1.00   6.49  ? 136  ASN A OD1  1 
ATOM   1694 N ND2  . ASN A 1 110 ? 48.469 -20.903 4.982   1.00   7.21  ? 136  ASN A ND2  1 
ATOM   1695 H H    . ASN A 1 110 ? 45.725 -23.461 4.578   1.00   6.14  ? 136  ASN A H    1 
ATOM   1696 H HA   . ASN A 1 110 ? 46.571 -22.822 2.192   1.00   6.30  ? 136  ASN A HA   1 
ATOM   1697 H HB2  . ASN A 1 110 ? 48.034 -23.366 4.510   1.00   7.27  ? 136  ASN A HB2  1 
ATOM   1698 H HB3  . ASN A 1 110 ? 48.736 -22.928 3.152   1.00   7.27  ? 136  ASN A HB3  1 
ATOM   1699 H HD21 . ASN A 1 110 ? 49.062 -21.396 5.363   1.00   8.65  ? 136  ASN A HD21 1 
ATOM   1700 H HD22 . ASN A 1 110 ? 48.378 -20.081 5.217   1.00   8.65  ? 136  ASN A HD22 1 
ATOM   1701 N N    . LYS A 1 111 ? 46.950 -25.886 2.899   1.00   5.78  ? 137  LYS A N    1 
ATOM   1702 C CA   . LYS A 1 111 ? 47.233 -27.156 2.251   1.00   6.36  ? 137  LYS A CA   1 
ATOM   1703 C C    . LYS A 1 111 ? 46.264 -27.431 1.125   1.00   6.06  ? 137  LYS A C    1 
ATOM   1704 O O    . LYS A 1 111 ? 46.651 -27.991 0.110   1.00   6.21  ? 137  LYS A O    1 
ATOM   1705 C CB   . LYS A 1 111 ? 47.193 -28.303 3.254   1.00   7.05  ? 137  LYS A CB   1 
ATOM   1706 C CG   . LYS A 1 111 ? 48.307 -28.324 4.279   1.00   9.32  ? 137  LYS A CG   1 
ATOM   1707 C CD   . LYS A 1 111 ? 49.686 -28.489 3.613   1.00   11.13 ? 137  LYS A CD   1 
ATOM   1708 C CE   . LYS A 1 111 ? 50.724 -28.693 4.663   1.00   13.50 ? 137  LYS A CE   1 
ATOM   1709 N NZ   . LYS A 1 111 ? 52.056 -28.854 4.051   1.00   14.35 ? 137  LYS A NZ   1 
ATOM   1710 H H    . LYS A 1 111 ? 46.661 -25.943 3.707   1.00   6.94  ? 137  LYS A H    1 
ATOM   1711 H HA   . LYS A 1 111 ? 48.126 -27.123 1.873   1.00   7.64  ? 137  LYS A HA   1 
ATOM   1712 H HB2  . LYS A 1 111 ? 46.354 -28.255 3.739   1.00   8.46  ? 137  LYS A HB2  1 
ATOM   1713 H HB3  . LYS A 1 111 ? 47.235 -29.139 2.764   1.00   8.46  ? 137  LYS A HB3  1 
ATOM   1714 H HG2  . LYS A 1 111 ? 48.305 -27.488 4.771   1.00   11.19 ? 137  LYS A HG2  1 
ATOM   1715 H HG3  . LYS A 1 111 ? 48.170 -29.070 4.884   1.00   11.19 ? 137  LYS A HG3  1 
ATOM   1716 H HD2  . LYS A 1 111 ? 49.676 -29.265 3.031   1.00   13.35 ? 137  LYS A HD2  1 
ATOM   1717 H HD3  . LYS A 1 111 ? 49.904 -27.688 3.112   1.00   13.35 ? 137  LYS A HD3  1 
ATOM   1718 H HE2  . LYS A 1 111 ? 50.746 -27.921 5.249   1.00   16.20 ? 137  LYS A HE2  1 
ATOM   1719 H HE3  . LYS A 1 111 ? 50.519 -29.496 5.167   1.00   16.20 ? 137  LYS A HE3  1 
ATOM   1720 H HZ1  . LYS A 1 111 ? 52.265 -28.126 3.583   1.00   17.22 ? 137  LYS A HZ1  1 
ATOM   1721 H HZ2  . LYS A 1 111 ? 52.669 -28.975 4.686   1.00   17.22 ? 137  LYS A HZ2  1 
ATOM   1722 H HZ3  . LYS A 1 111 ? 52.059 -29.559 3.508   1.00   17.22 ? 137  LYS A HZ3  1 
ATOM   1723 N N    . LEU A 1 112 ? 45.006 -27.052 1.290   1.00   5.91  ? 138  LEU A N    1 
ATOM   1724 C CA   . LEU A 1 112 ? 44.041 -27.233 0.219   1.00   5.78  ? 138  LEU A CA   1 
ATOM   1725 C C    . LEU A 1 112 ? 44.445 -26.375 -0.980  1.00   5.56  ? 138  LEU A C    1 
ATOM   1726 O O    . LEU A 1 112 ? 44.455 -26.850 -2.120  1.00   5.87  ? 138  LEU A O    1 
ATOM   1727 C CB   . LEU A 1 112 ? 42.636 -26.859 0.691   1.00   5.93  ? 138  LEU A CB   1 
ATOM   1728 C CG   . LEU A 1 112 ? 42.038 -27.710 1.813   1.00   6.28  ? 138  LEU A CG   1 
ATOM   1729 C CD1  . LEU A 1 112 ? 40.781 -27.073 2.343   1.00   6.66  ? 138  LEU A CD1  1 
ATOM   1730 C CD2  . LEU A 1 112 ? 41.769 -29.144 1.361   1.00   6.97  ? 138  LEU A CD2  1 
ATOM   1731 H H    . LEU A 1 112 ? 44.688 -26.691 2.003   1.00   7.09  ? 138  LEU A H    1 
ATOM   1732 H HA   . LEU A 1 112 ? 44.035 -28.163 -0.057  1.00   6.94  ? 138  LEU A HA   1 
ATOM   1733 H HB2  . LEU A 1 112 ? 42.657 -25.942 1.007   1.00   7.12  ? 138  LEU A HB2  1 
ATOM   1734 H HB3  . LEU A 1 112 ? 42.035 -26.922 -0.068  1.00   7.12  ? 138  LEU A HB3  1 
ATOM   1735 H HG   . LEU A 1 112 ? 42.676 -27.750 2.543   1.00   7.54  ? 138  LEU A HG   1 
ATOM   1736 H HD11 . LEU A 1 112 ? 40.137 -26.997 1.622   1.00   7.99  ? 138  LEU A HD11 1 
ATOM   1737 H HD12 . LEU A 1 112 ? 40.420 -27.629 3.052   1.00   7.99  ? 138  LEU A HD12 1 
ATOM   1738 H HD13 . LEU A 1 112 ? 40.995 -26.193 2.690   1.00   7.99  ? 138  LEU A HD13 1 
ATOM   1739 H HD21 . LEU A 1 112 ? 42.604 -29.549 1.080   1.00   8.37  ? 138  LEU A HD21 1 
ATOM   1740 H HD22 . LEU A 1 112 ? 41.392 -29.643 2.103   1.00   8.37  ? 138  LEU A HD22 1 
ATOM   1741 H HD23 . LEU A 1 112 ? 41.142 -29.129 0.620   1.00   8.37  ? 138  LEU A HD23 1 
ATOM   1742 N N    . ILE A 1 113 ? 44.777 -25.117 -0.726  1.00   5.69  ? 139  ILE A N    1 
ATOM   1743 C CA   . ILE A 1 113 ? 45.177 -24.204 -1.804  1.00   6.30  ? 139  ILE A CA   1 
ATOM   1744 C C    . ILE A 1 113 ? 46.418 -24.755 -2.522  1.00   6.86  ? 139  ILE A C    1 
ATOM   1745 O O    . ILE A 1 113 ? 46.499 -24.762 -3.748  1.00   6.94  ? 139  ILE A O    1 
ATOM   1746 C CB   . ILE A 1 113 ? 45.442 -22.784 -1.280  1.00   6.19  ? 139  ILE A CB   1 
ATOM   1747 C CG1  . ILE A 1 113 ? 44.172 -22.157 -0.689  1.00   6.29  ? 139  ILE A CG1  1 
ATOM   1748 C CG2  . ILE A 1 113 ? 45.993 -21.907 -2.414  1.00   7.15  ? 139  ILE A CG2  1 
ATOM   1749 C CD1  . ILE A 1 113 ? 44.461 -20.869 0.087   1.00   6.01  ? 139  ILE A CD1  1 
ATOM   1750 H H    . ILE A 1 113 ? 44.781 -24.761 0.058   1.00   6.83  ? 139  ILE A H    1 
ATOM   1751 H HA   . ILE A 1 113 ? 44.457 -24.152 -2.452  1.00   7.55  ? 139  ILE A HA   1 
ATOM   1752 H HB   . ILE A 1 113 ? 46.112 -22.835 -0.580  1.00   7.43  ? 139  ILE A HB   1 
ATOM   1753 H HG12 . ILE A 1 113 ? 43.559 -21.943 -1.410  1.00   7.54  ? 139  ILE A HG12 1 
ATOM   1754 H HG13 . ILE A 1 113 ? 43.761 -22.790 -0.080  1.00   7.54  ? 139  ILE A HG13 1 
ATOM   1755 H HG21 . ILE A 1 113 ? 45.340 -21.873 -3.131  1.00   8.58  ? 139  ILE A HG21 1 
ATOM   1756 H HG22 . ILE A 1 113 ? 46.156 -21.015 -2.072  1.00   8.58  ? 139  ILE A HG22 1 
ATOM   1757 H HG23 . ILE A 1 113 ? 46.821 -22.295 -2.738  1.00   8.58  ? 139  ILE A HG23 1 
ATOM   1758 H HD11 . ILE A 1 113 ? 44.867 -20.224 -0.513  1.00   7.21  ? 139  ILE A HD11 1 
ATOM   1759 H HD12 . ILE A 1 113 ? 43.628 -20.517 0.437   1.00   7.21  ? 139  ILE A HD12 1 
ATOM   1760 H HD13 . ILE A 1 113 ? 45.068 -21.070 0.816   1.00   7.21  ? 139  ILE A HD13 1 
ATOM   1761 N N    . ALA A 1 114 ? 47.410 -25.186 -1.750  1.00   6.56  ? 140  ALA A N    1 
ATOM   1762 C CA   . ALA A 1 114 ? 48.650 -25.703 -2.324  1.00   7.11  ? 140  ALA A CA   1 
ATOM   1763 C C    . ALA A 1 114 ? 48.365 -26.936 -3.153  1.00   7.68  ? 140  ALA A C    1 
ATOM   1764 O O    . ALA A 1 114 ? 48.891 -27.080 -4.255  1.00   7.92  ? 140  ALA A O    1 
ATOM   1765 C CB   . ALA A 1 114 ? 49.661 -26.014 -1.237  1.00   7.97  ? 140  ALA A CB   1 
ATOM   1766 H H    . ALA A 1 114 ? 47.391 -25.190 -0.890  1.00   7.87  ? 140  ALA A H    1 
ATOM   1767 H HA   . ALA A 1 114 ? 49.033 -25.030 -2.908  1.00   8.53  ? 140  ALA A HA   1 
ATOM   1768 H HB1  . ALA A 1 114 ? 49.287 -26.681 -0.640  1.00   9.57  ? 140  ALA A HB1  1 
ATOM   1769 H HB2  . ALA A 1 114 ? 50.471 -26.354 -1.649  1.00   9.57  ? 140  ALA A HB2  1 
ATOM   1770 H HB3  . ALA A 1 114 ? 49.856 -25.201 -0.746  1.00   9.57  ? 140  ALA A HB3  1 
ATOM   1771 N N    . HIS A 1 115 ? 47.522 -27.820 -2.635  1.00   7.12  ? 141  HIS A N    1 
ATOM   1772 C CA   . HIS A 1 115 ? 47.157 -29.005 -3.387  1.00   7.24  ? 141  HIS A CA   1 
ATOM   1773 C C    . HIS A 1 115 ? 46.562 -28.644 -4.748  1.00   7.09  ? 141  HIS A C    1 
ATOM   1774 O O    . HIS A 1 115 ? 46.886 -29.273 -5.775  1.00   7.59  ? 141  HIS A O    1 
ATOM   1775 C CB   . HIS A 1 115 ? 46.160 -29.869 -2.620  1.00   7.48  ? 141  HIS A CB   1 
ATOM   1776 C CG   . HIS A 1 115 ? 45.617 -30.934 -3.485  1.00   8.14  ? 141  HIS A CG   1 
ATOM   1777 N ND1  . HIS A 1 115 ? 46.356 -32.053 -3.813  1.00   10.40 ? 141  HIS A ND1  1 
ATOM   1778 C CD2  . HIS A 1 115 ? 44.496 -30.980 -4.243  1.00   10.21 ? 141  HIS A CD2  1 
ATOM   1779 C CE1  . HIS A 1 115 ? 45.672 -32.768 -4.685  1.00   12.19 ? 141  HIS A CE1  1 
ATOM   1780 N NE2  . HIS A 1 115 ? 44.562 -32.127 -4.980  1.00   12.70 ? 141  HIS A NE2  1 
ATOM   1781 H H    . HIS A 1 115 ? 47.154 -27.757 -1.861  1.00   8.55  ? 141  HIS A H    1 
ATOM   1782 H HA   . HIS A 1 115 ? 47.954 -29.536 -3.542  1.00   8.69  ? 141  HIS A HA   1 
ATOM   1783 H HB2  . HIS A 1 115 ? 46.607 -30.284 -1.866  1.00   8.97  ? 141  HIS A HB2  1 
ATOM   1784 H HB3  . HIS A 1 115 ? 45.423 -29.317 -2.314  1.00   8.97  ? 141  HIS A HB3  1 
ATOM   1785 H HD2  . HIS A 1 115 ? 43.816 -30.346 -4.266  1.00   12.25 ? 141  HIS A HD2  1 
ATOM   1786 H HE1  . HIS A 1 115 ? 45.937 -33.585 -5.042  1.00   14.63 ? 141  HIS A HE1  1 
ATOM   1787 H HE2  . HIS A 1 115 ? 43.945 -32.416 -5.505  1.00   15.24 ? 141  HIS A HE2  1 
ATOM   1788 N N    . LEU A 1 116 ? 45.678 -27.650 -4.763  1.00   7.21  ? 142  LEU A N    1 
ATOM   1789 C CA   . LEU A 1 116 ? 45.015 -27.220 -5.979  1.00   7.36  ? 142  LEU A CA   1 
ATOM   1790 C C    . LEU A 1 116 ? 45.937 -26.524 -6.964  1.00   8.28  ? 142  LEU A C    1 
ATOM   1791 O O    . LEU A 1 116 ? 45.624 -26.468 -8.158  1.00   9.93  ? 142  LEU A O    1 
ATOM   1792 C CB   . LEU A 1 116 ? 43.880 -26.264 -5.631  1.00   6.59  ? 142  LEU A CB   1 
ATOM   1793 C CG   . LEU A 1 116 ? 42.715 -26.915 -4.892  1.00   6.48  ? 142  LEU A CG   1 
ATOM   1794 C CD1  . LEU A 1 116 ? 41.845 -25.874 -4.228  1.00   6.79  ? 142  LEU A CD1  1 
ATOM   1795 C CD2  . LEU A 1 116 ? 41.896 -27.812 -5.830  1.00   7.17  ? 142  LEU A CD2  1 
ATOM   1796 H H    . LEU A 1 116 ? 45.445 -27.204 -4.066  1.00   8.66  ? 142  LEU A H    1 
ATOM   1797 H HA   . LEU A 1 116 ? 44.632 -27.994 -6.421  1.00   8.84  ? 142  LEU A HA   1 
ATOM   1798 H HB2  . LEU A 1 116 ? 44.230 -25.558 -5.065  1.00   7.91  ? 142  LEU A HB2  1 
ATOM   1799 H HB3  . LEU A 1 116 ? 43.532 -25.883 -6.452  1.00   7.91  ? 142  LEU A HB3  1 
ATOM   1800 H HG   . LEU A 1 116 ? 43.076 -27.481 -4.191  1.00   7.78  ? 142  LEU A HG   1 
ATOM   1801 H HD11 . LEU A 1 116 ? 41.493 -25.277 -4.907  1.00   8.15  ? 142  LEU A HD11 1 
ATOM   1802 H HD12 . LEU A 1 116 ? 41.116 -26.319 -3.768  1.00   8.15  ? 142  LEU A HD12 1 
ATOM   1803 H HD13 . LEU A 1 116 ? 42.380 -25.374 -3.593  1.00   8.15  ? 142  LEU A HD13 1 
ATOM   1804 H HD21 . LEU A 1 116 ? 42.472 -28.508 -6.183  1.00   8.61  ? 142  LEU A HD21 1 
ATOM   1805 H HD22 . LEU A 1 116 ? 41.167 -28.209 -5.329  1.00   8.61  ? 142  LEU A HD22 1 
ATOM   1806 H HD23 . LEU A 1 116 ? 41.545 -27.272 -6.555  1.00   8.61  ? 142  LEU A HD23 1 
ATOM   1807 N N    . GLY A 1 117 ? 47.039 -25.955 -6.479  1.00   7.21  ? 143  GLY A N    1 
ATOM   1808 C CA   . GLY A 1 117 ? 47.985 -25.247 -7.319  1.00   7.76  ? 143  GLY A CA   1 
ATOM   1809 C C    . GLY A 1 117 ? 47.978 -23.744 -7.150  1.00   7.44  ? 143  GLY A C    1 
ATOM   1810 O O    . GLY A 1 117 ? 48.563 -23.060 -7.985  1.00   9.27  ? 143  GLY A O    1 
ATOM   1811 H H    . GLY A 1 117 ? 47.259 -25.969 -5.648  1.00   8.65  ? 143  GLY A H    1 
ATOM   1812 H HA2  . GLY A 1 117 ? 48.880 -25.567 -7.124  1.00   9.31  ? 143  GLY A HA2  1 
ATOM   1813 H HA3  . GLY A 1 117 ? 47.791 -25.445 -8.248  1.00   9.31  ? 143  GLY A HA3  1 
ATOM   1814 N N    . GLY A 1 118 ? 47.383 -23.222 -6.083  1.00   7.15  ? 144  GLY A N    1 
ATOM   1815 C CA   . GLY A 1 118 ? 47.478 -21.824 -5.743  1.00   7.07  ? 144  GLY A CA   1 
ATOM   1816 C C    . GLY A 1 118 ? 46.128 -21.135 -5.732  1.00   6.29  ? 144  GLY A C    1 
ATOM   1817 O O    . GLY A 1 118 ? 45.130 -21.685 -6.198  1.00   5.98  ? 144  GLY A O    1 
ATOM   1818 H H    . GLY A 1 118 ? 46.907 -23.678 -5.530  1.00   8.58  ? 144  GLY A H    1 
ATOM   1819 H HA2  . GLY A 1 118 ? 47.876 -21.732 -4.864  1.00   8.48  ? 144  GLY A HA2  1 
ATOM   1820 H HA3  . GLY A 1 118 ? 48.047 -21.373 -6.387  1.00   8.48  ? 144  GLY A HA3  1 
ATOM   1821 N N    . PRO A 1 119 ? 46.083 -19.915 -5.194  1.00   6.10  ? 145  PRO A N    1 
ATOM   1822 C CA   . PRO A 1 119 ? 44.802 -19.221 -5.055  1.00   5.99  ? 145  PRO A CA   1 
ATOM   1823 C C    . PRO A 1 119 ? 44.048 -19.082 -6.360  1.00   5.80  ? 145  PRO A C    1 
ATOM   1824 O O    . PRO A 1 119 ? 42.821 -19.206 -6.375  1.00   6.34  ? 145  PRO A O    1 
ATOM   1825 C CB   . PRO A 1 119 ? 45.190 -17.868 -4.436  1.00   6.94  ? 145  PRO A CB   1 
ATOM   1826 C CG   . PRO A 1 119 ? 46.461 -18.148 -3.688  1.00   8.25  ? 145  PRO A CG   1 
ATOM   1827 C CD   . PRO A 1 119 ? 47.175 -19.201 -4.516  1.00   6.73  ? 145  PRO A CD   1 
ATOM   1828 H HA   . PRO A 1 119 ? 44.240 -19.699 -4.425  1.00   7.19  ? 145  PRO A HA   1 
ATOM   1829 H HB2  . PRO A 1 119 ? 45.339 -17.216 -5.138  1.00   8.33  ? 145  PRO A HB2  1 
ATOM   1830 H HB3  . PRO A 1 119 ? 44.492 -17.572 -3.831  1.00   8.33  ? 145  PRO A HB3  1 
ATOM   1831 H HG2  . PRO A 1 119 ? 46.992 -17.338 -3.630  1.00   9.90  ? 145  PRO A HG2  1 
ATOM   1832 H HG3  . PRO A 1 119 ? 46.254 -18.488 -2.804  1.00   9.90  ? 145  PRO A HG3  1 
ATOM   1833 H HD2  . PRO A 1 119 ? 47.758 -18.780 -5.167  1.00   8.08  ? 145  PRO A HD2  1 
ATOM   1834 H HD3  . PRO A 1 119 ? 47.666 -19.806 -3.940  1.00   8.08  ? 145  PRO A HD3  1 
ATOM   1835 N N    . ASP A 1 120 ? 44.755 -18.839 -7.451  1.00   5.56  ? 146  ASP A N    1 
ATOM   1836 C CA   . ASP A 1 120 ? 44.084 -18.675 -8.734  1.00   6.45  ? 146  ASP A CA   1 
ATOM   1837 C C    . ASP A 1 120 ? 43.309 -19.917 -9.168  1.00   6.40  ? 146  ASP A C    1 
ATOM   1838 O O    . ASP A 1 120 ? 42.362 -19.807 -9.943  1.00   6.00  ? 146  ASP A O    1 
ATOM   1839 C CB   . ASP A 1 120 ? 45.109 -18.343 -9.837  1.00   9.44  ? 146  ASP A CB   1 
ATOM   1840 C CG   . ASP A 1 120 ? 46.165 -19.452 -9.984  1.00   15.34 ? 146  ASP A CG   1 
ATOM   1841 O OD1  . ASP A 1 120 ? 46.752 -19.851 -8.953  1.00   18.24 ? 146  ASP A OD1  1 
ATOM   1842 O OD2  . ASP A 1 120 ? 46.406 -19.952 -11.100 1.00   20.18 ? 146  ASP A OD2  1 
ATOM   1843 H H    . ASP A 1 120 ? 45.611 -18.764 -7.479  1.00   6.68  ? 146  ASP A H    1 
ATOM   1844 H HA   . ASP A 1 120 ? 43.459 -17.936 -8.672  1.00   7.74  ? 146  ASP A HA   1 
ATOM   1845 H HB2  . ASP A 1 120 ? 44.647 -18.249 -10.684 1.00   11.32 ? 146  ASP A HB2  1 
ATOM   1846 H HB3  . ASP A 1 120 ? 45.565 -17.517 -9.611  1.00   11.32 ? 146  ASP A HB3  1 
ATOM   1847 N N    . LYS A 1 121 ? 43.693 -21.092 -8.682  1.00   6.47  ? 147  LYS A N    1 
ATOM   1848 C CA   . LYS A 1 121 ? 42.980 -22.326 -9.015  1.00   6.15  ? 147  LYS A CA   1 
ATOM   1849 C C    . LYS A 1 121 ? 41.633 -22.364 -8.289  1.00   5.72  ? 147  LYS A C    1 
ATOM   1850 O O    . LYS A 1 121 ? 40.671 -22.952 -8.792  1.00   5.81  ? 147  LYS A O    1 
ATOM   1851 C CB   . LYS A 1 121 ? 43.827 -23.545 -8.674  1.00   8.27  ? 147  LYS A CB   1 
ATOM   1852 C CG   . LYS A 1 121 ? 45.186 -23.544 -9.357  1.00   10.65 ? 147  LYS A CG   1 
ATOM   1853 C CD   . LYS A 1 121 ? 45.090 -23.549 -10.842 1.00   15.00 ? 147  LYS A CD   1 
ATOM   1854 C CE   . LYS A 1 121 ? 46.481 -23.670 -11.466 1.00   17.88 ? 147  LYS A CE   1 
ATOM   1855 N NZ   . LYS A 1 121 ? 47.435 -22.581 -10.993 1.00   20.85 ? 147  LYS A NZ   1 
ATOM   1856 H H    . LYS A 1 121 ? 44.364 -21.205 -8.156  1.00   7.76  ? 147  LYS A H    1 
ATOM   1857 H HA   . LYS A 1 121 ? 42.805 -22.341 -9.969  1.00   7.38  ? 147  LYS A HA   1 
ATOM   1858 H HB2  . LYS A 1 121 ? 43.975 -23.568 -7.716  1.00   9.92  ? 147  LYS A HB2  1 
ATOM   1859 H HB3  . LYS A 1 121 ? 43.354 -24.345 -8.955  1.00   9.92  ? 147  LYS A HB3  1 
ATOM   1860 H HG2  . LYS A 1 121 ? 45.672 -22.747 -9.091  1.00   12.78 ? 147  LYS A HG2  1 
ATOM   1861 H HG3  . LYS A 1 121 ? 45.676 -24.336 -9.086  1.00   12.78 ? 147  LYS A HG3  1 
ATOM   1862 H HD2  . LYS A 1 121 ? 44.557 -24.306 -11.129 1.00   18.00 ? 147  LYS A HD2  1 
ATOM   1863 H HD3  . LYS A 1 121 ? 44.689 -22.718 -11.143 1.00   18.00 ? 147  LYS A HD3  1 
ATOM   1864 H HE2  . LYS A 1 121 ? 46.862 -24.528 -11.224 1.00   21.46 ? 147  LYS A HE2  1 
ATOM   1865 H HE3  . LYS A 1 121 ? 46.402 -23.601 -12.430 1.00   21.46 ? 147  LYS A HE3  1 
ATOM   1866 H HZ1  . LYS A 1 121 ? 47.533 -22.625 -10.109 1.00   25.02 ? 147  LYS A HZ1  1 
ATOM   1867 H HZ2  . LYS A 1 121 ? 48.231 -22.686 -11.377 1.00   25.02 ? 147  LYS A HZ2  1 
ATOM   1868 H HZ3  . LYS A 1 121 ? 47.113 -21.780 -11.208 1.00   25.02 ? 147  LYS A HZ3  1 
ATOM   1869 N N    . VAL A 1 122 ? 41.558 -21.742 -7.115  1.00   5.14  ? 148  VAL A N    1 
ATOM   1870 C CA   . VAL A 1 122 ? 40.305 -21.631 -6.406  1.00   5.11  ? 148  VAL A CA   1 
ATOM   1871 C C    . VAL A 1 122 ? 39.390 -20.669 -7.174  1.00   5.17  ? 148  VAL A C    1 
ATOM   1872 O O    . VAL A 1 122 ? 38.202 -20.944 -7.359  1.00   5.57  ? 148  VAL A O    1 
ATOM   1873 C CB   . VAL A 1 122 ? 40.508 -21.187 -4.946  1.00   5.34  ? 148  VAL A CB   1 
ATOM   1874 C CG1  . VAL A 1 122 ? 39.181 -21.204 -4.184  1.00   5.59  ? 148  VAL A CG1  1 
ATOM   1875 C CG2  . VAL A 1 122 ? 41.498 -22.102 -4.209  1.00   5.98  ? 148  VAL A CG2  1 
ATOM   1876 H H    . VAL A 1 122 ? 42.225 -21.377 -6.712  1.00   6.17  ? 148  VAL A H    1 
ATOM   1877 H HA   . VAL A 1 122 ? 39.875 -22.500 -6.393  1.00   6.14  ? 148  VAL A HA   1 
ATOM   1878 H HB   . VAL A 1 122 ? 40.858 -20.283 -4.931  1.00   6.41  ? 148  VAL A HB   1 
ATOM   1879 H HG11 . VAL A 1 122 ? 38.822 -22.105 -4.195  1.00   6.71  ? 148  VAL A HG11 1 
ATOM   1880 H HG12 . VAL A 1 122 ? 39.338 -20.921 -3.270  1.00   6.71  ? 148  VAL A HG12 1 
ATOM   1881 H HG13 . VAL A 1 122 ? 38.561 -20.596 -4.617  1.00   6.71  ? 148  VAL A HG13 1 
ATOM   1882 H HG21 . VAL A 1 122 ? 42.354 -22.072 -4.665  1.00   7.17  ? 148  VAL A HG21 1 
ATOM   1883 H HG22 . VAL A 1 122 ? 41.598 -21.789 -3.296  1.00   7.17  ? 148  VAL A HG22 1 
ATOM   1884 H HG23 . VAL A 1 122 ? 41.153 -23.008 -4.212  1.00   7.17  ? 148  VAL A HG23 1 
ATOM   1885 N N    . THR A 1 123 ? 39.938 -19.547 -7.648  1.00   5.15  ? 149  THR A N    1 
ATOM   1886 C CA   . THR A 1 123 ? 39.170 -18.650 -8.505  1.00   5.36  ? 149  THR A CA   1 
ATOM   1887 C C    . THR A 1 123 ? 38.612 -19.381 -9.722  1.00   5.06  ? 149  THR A C    1 
ATOM   1888 O O    . THR A 1 123 ? 37.436 -19.239 -10.063 1.00   5.04  ? 149  THR A O    1 
ATOM   1889 C CB   . THR A 1 123 ? 40.019 -17.463 -8.931  1.00   5.50  ? 149  THR A CB   1 
ATOM   1890 O OG1  . THR A 1 123 ? 40.502 -16.849 -7.742  1.00   5.85  ? 149  THR A OG1  1 
ATOM   1891 C CG2  . THR A 1 123 ? 39.199 -16.495 -9.763  1.00   6.04  ? 149  THR A CG2  1 
ATOM   1892 H H    . THR A 1 123 ? 40.743 -19.288 -7.489  1.00   6.18  ? 149  THR A H    1 
ATOM   1893 H HA   . THR A 1 123 ? 38.417 -18.306 -7.998  1.00   6.43  ? 149  THR A HA   1 
ATOM   1894 H HB   . THR A 1 123 ? 40.767 -17.773 -9.465  1.00   6.60  ? 149  THR A HB   1 
ATOM   1895 H HG1  . THR A 1 123 ? 40.979 -16.185 -7.936  1.00   7.03  ? 149  THR A HG1  1 
ATOM   1896 H HG21 . THR A 1 123 ? 38.446 -16.169 -9.246  1.00   7.25  ? 149  THR A HG21 1 
ATOM   1897 H HG22 . THR A 1 123 ? 39.748 -15.742 -10.031 1.00   7.25  ? 149  THR A HG22 1 
ATOM   1898 H HG23 . THR A 1 123 ? 38.866 -16.941 -10.558 1.00   7.25  ? 149  THR A HG23 1 
ATOM   1899 N N    . ALA A 1 124 ? 39.447 -20.169 -10.377 1.00   5.10  ? 150  ALA A N    1 
ATOM   1900 C CA   . ALA A 1 124 ? 39.016 -20.883 -11.570 1.00   5.58  ? 150  ALA A CA   1 
ATOM   1901 C C    . ALA A 1 124 ? 37.892 -21.850 -11.240 1.00   5.21  ? 150  ALA A C    1 
ATOM   1902 O O    . ALA A 1 124 ? 36.945 -22.008 -12.018 1.00   5.35  ? 150  ALA A O    1 
ATOM   1903 C CB   . ALA A 1 124 ? 40.184 -21.609 -12.211 1.00   6.31  ? 150  ALA A CB   1 
ATOM   1904 H H    . ALA A 1 124 ? 40.266 -20.309 -10.155 1.00   6.12  ? 150  ALA A H    1 
ATOM   1905 H HA   . ALA A 1 124 ? 38.677 -20.241 -12.213 1.00   6.70  ? 150  ALA A HA   1 
ATOM   1906 H HB1  . ALA A 1 124 ? 40.548 -22.245 -11.575 1.00   7.57  ? 150  ALA A HB1  1 
ATOM   1907 H HB2  . ALA A 1 124 ? 39.870 -22.075 -13.002 1.00   7.57  ? 150  ALA A HB2  1 
ATOM   1908 H HB3  . ALA A 1 124 ? 40.862 -20.961 -12.457 1.00   7.57  ? 150  ALA A HB3  1 
ATOM   1909 N N    . PHE A 1 125 ? 37.978 -22.509 -10.089 1.00   4.92  ? 151  PHE A N    1 
ATOM   1910 C CA   . PHE A 1 125 ? 36.888 -23.372 -9.668  1.00   4.99  ? 151  PHE A CA   1 
ATOM   1911 C C    . PHE A 1 125 ? 35.596 -22.579 -9.485  1.00   4.59  ? 151  PHE A C    1 
ATOM   1912 O O    . PHE A 1 125 ? 34.532 -22.984 -9.960  1.00   4.94  ? 151  PHE A O    1 
ATOM   1913 C CB   . PHE A 1 125 ? 37.246 -24.147 -8.395  1.00   5.23  ? 151  PHE A CB   1 
ATOM   1914 C CG   . PHE A 1 125 ? 36.088 -24.931 -7.859  1.00   5.11  ? 151  PHE A CG   1 
ATOM   1915 C CD1  . PHE A 1 125 ? 35.575 -26.014 -8.570  1.00   5.05  ? 151  PHE A CD1  1 
ATOM   1916 C CD2  . PHE A 1 125 ? 35.476 -24.558 -6.694  1.00   5.89  ? 151  PHE A CD2  1 
ATOM   1917 C CE1  . PHE A 1 125 ? 34.482 -26.701 -8.102  1.00   6.04  ? 151  PHE A CE1  1 
ATOM   1918 C CE2  . PHE A 1 125 ? 34.387 -25.266 -6.211  1.00   6.27  ? 151  PHE A CE2  1 
ATOM   1919 C CZ   . PHE A 1 125 ? 33.892 -26.330 -6.924  1.00   5.96  ? 151  PHE A CZ   1 
ATOM   1920 H H    . PHE A 1 125 ? 38.644 -22.474 -9.546  1.00   5.91  ? 151  PHE A H    1 
ATOM   1921 H HA   . PHE A 1 125 ? 36.729 -24.025 -10.367 1.00   5.99  ? 151  PHE A HA   1 
ATOM   1922 H HB2  . PHE A 1 125 ? 37.965 -24.768 -8.594  1.00   6.28  ? 151  PHE A HB2  1 
ATOM   1923 H HB3  . PHE A 1 125 ? 37.528 -23.519 -7.711  1.00   6.28  ? 151  PHE A HB3  1 
ATOM   1924 H HD1  . PHE A 1 125 ? 35.968 -26.265 -9.374  1.00   6.06  ? 151  PHE A HD1  1 
ATOM   1925 H HD2  . PHE A 1 125 ? 35.805 -23.834 -6.211  1.00   7.07  ? 151  PHE A HD2  1 
ATOM   1926 H HE1  . PHE A 1 125 ? 34.154 -27.430 -8.577  1.00   7.24  ? 151  PHE A HE1  1 
ATOM   1927 H HE2  . PHE A 1 125 ? 33.982 -25.011 -5.414  1.00   7.52  ? 151  PHE A HE2  1 
ATOM   1928 H HZ   . PHE A 1 125 ? 33.162 -26.807 -6.600  1.00   7.16  ? 151  PHE A HZ   1 
ATOM   1929 N N    . ALA A 1 126 ? 35.662 -21.445 -8.807  1.00   4.73  ? 152  ALA A N    1 
ATOM   1930 C CA   . ALA A 1 126 ? 34.459 -20.636 -8.642  1.00   5.03  ? 152  ALA A CA   1 
ATOM   1931 C C    . ALA A 1 126 ? 33.876 -20.253 -10.004 1.00   4.56  ? 152  ALA A C    1 
ATOM   1932 O O    . ALA A 1 126 ? 32.659 -20.320 -10.213 1.00   4.94  ? 152  ALA A O    1 
ATOM   1933 C CB   . ALA A 1 126 ? 34.760 -19.405 -7.819  1.00   5.27  ? 152  ALA A CB   1 
ATOM   1934 H H    . ALA A 1 126 ? 36.370 -21.125 -8.438  1.00   5.67  ? 152  ALA A H    1 
ATOM   1935 H HA   . ALA A 1 126 ? 33.792 -21.157 -8.168  1.00   6.04  ? 152  ALA A HA   1 
ATOM   1936 H HB1  . ALA A 1 126 ? 35.438 -18.881 -8.273  1.00   6.32  ? 152  ALA A HB1  1 
ATOM   1937 H HB2  . ALA A 1 126 ? 33.947 -18.884 -7.723  1.00   6.32  ? 152  ALA A HB2  1 
ATOM   1938 H HB3  . ALA A 1 126 ? 35.082 -19.680 -6.947  1.00   6.32  ? 152  ALA A HB3  1 
ATOM   1939 N N    . ARG A 1 127 ? 34.734 -19.857 -10.940 1.00   5.22  ? 153  ARG A N    1 
ATOM   1940 C CA   A ARG A 1 127 ? 34.273 -19.482 -12.273 0.58   5.86  ? 153  ARG A CA   1 
ATOM   1941 C CA   B ARG A 1 127 ? 34.258 -19.471 -12.251 0.42   5.74  ? 153  ARG A CA   1 
ATOM   1942 C C    . ARG A 1 127 ? 33.591 -20.660 -12.951 1.00   5.89  ? 153  ARG A C    1 
ATOM   1943 O O    . ARG A 1 127 ? 32.611 -20.485 -13.686 1.00   6.11  ? 153  ARG A O    1 
ATOM   1944 C CB   A ARG A 1 127 ? 35.433 -19.012 -13.149 0.58   6.43  ? 153  ARG A CB   1 
ATOM   1945 C CB   B ARG A 1 127 ? 35.408 -18.868 -13.062 0.42   6.09  ? 153  ARG A CB   1 
ATOM   1946 C CG   A ARG A 1 127 ? 36.087 -17.749 -12.680 0.58   6.69  ? 153  ARG A CG   1 
ATOM   1947 C CG   B ARG A 1 127 ? 35.739 -17.462 -12.580 0.42   6.73  ? 153  ARG A CG   1 
ATOM   1948 C CD   A ARG A 1 127 ? 35.324 -16.474 -13.076 0.58   7.23  ? 153  ARG A CD   1 
ATOM   1949 C CD   B ARG A 1 127 ? 37.036 -16.907 -13.095 0.42   7.17  ? 153  ARG A CD   1 
ATOM   1950 N NE   A ARG A 1 127 ? 36.116 -15.375 -12.558 0.58   7.19  ? 153  ARG A NE   1 
ATOM   1951 N NE   B ARG A 1 127 ? 37.212 -15.532 -12.632 0.42   7.49  ? 153  ARG A NE   1 
ATOM   1952 C CZ   A ARG A 1 127 ? 36.066 -14.936 -11.310 0.58   6.86  ? 153  ARG A CZ   1 
ATOM   1953 C CZ   B ARG A 1 127 ? 38.277 -14.792 -12.887 0.42   8.26  ? 153  ARG A CZ   1 
ATOM   1954 N NH1  A ARG A 1 127 ? 35.162 -15.346 -10.462 0.58   4.33  ? 153  ARG A NH1  1 
ATOM   1955 N NH1  B ARG A 1 127 ? 39.237 -15.282 -13.600 0.42   7.38  ? 153  ARG A NH1  1 
ATOM   1956 N NH2  A ARG A 1 127 ? 36.901 -14.015 -10.915 0.58   7.08  ? 153  ARG A NH2  1 
ATOM   1957 N NH2  B ARG A 1 127 ? 38.359 -13.546 -12.461 0.42   9.87  ? 153  ARG A NH2  1 
ATOM   1958 H H    A ARG A 1 127 ? 35.585 -19.797 -10.830 0.58   6.26  ? 153  ARG A H    1 
ATOM   1959 H H    B ARG A 1 127 ? 35.586 -19.805 -10.838 0.42   6.26  ? 153  ARG A H    1 
ATOM   1960 H HA   A ARG A 1 127 ? 33.631 -18.758 -12.200 0.58   7.03  ? 153  ARG A HA   1 
ATOM   1961 H HA   B ARG A 1 127 ? 33.584 -18.782 -12.143 0.42   6.88  ? 153  ARG A HA   1 
ATOM   1962 H HB2  A ARG A 1 127 ? 36.111 -19.706 -13.167 0.58   7.72  ? 153  ARG A HB2  1 
ATOM   1963 H HB2  B ARG A 1 127 ? 36.199 -19.420 -12.958 0.42   7.30  ? 153  ARG A HB2  1 
ATOM   1964 H HB3  A ARG A 1 127 ? 35.101 -18.856 -14.047 0.58   7.72  ? 153  ARG A HB3  1 
ATOM   1965 H HB3  B ARG A 1 127 ? 35.152 -18.818 -13.996 0.42   7.30  ? 153  ARG A HB3  1 
ATOM   1966 H HG2  A ARG A 1 127 ? 36.149 -17.770 -11.712 0.58   8.03  ? 153  ARG A HG2  1 
ATOM   1967 H HG2  B ARG A 1 127 ? 35.031 -16.863 -12.866 0.42   8.07  ? 153  ARG A HG2  1 
ATOM   1968 H HG3  A ARG A 1 127 ? 36.976 -17.695 -13.066 0.58   8.03  ? 153  ARG A HG3  1 
ATOM   1969 H HG3  B ARG A 1 127 ? 35.787 -17.471 -11.612 0.42   8.07  ? 153  ARG A HG3  1 
ATOM   1970 H HD2  A ARG A 1 127 ? 35.263 -16.401 -14.042 0.58   8.67  ? 153  ARG A HD2  1 
ATOM   1971 H HD2  B ARG A 1 127 ? 37.773 -17.442 -12.760 0.42   8.60  ? 153  ARG A HD2  1 
ATOM   1972 H HD3  A ARG A 1 127 ? 34.446 -16.462 -12.663 0.58   8.67  ? 153  ARG A HD3  1 
ATOM   1973 H HD3  B ARG A 1 127 ? 37.028 -16.908 -14.065 0.42   8.60  ? 153  ARG A HD3  1 
ATOM   1974 H HE   A ARG A 1 127 ? 36.657 -14.981 -13.099 0.58   8.63  ? 153  ARG A HE   1 
ATOM   1975 H HE   B ARG A 1 127 ? 36.581 -15.181 -12.164 0.42   8.99  ? 153  ARG A HE   1 
ATOM   1976 H HH11 A ARG A 1 127 ? 34.615 -15.971 -10.686 0.58   5.19  ? 153  ARG A HH11 1 
ATOM   1977 H HH11 B ARG A 1 127 ? 39.188 -16.090 -13.891 0.42   8.86  ? 153  ARG A HH11 1 
ATOM   1978 H HH12 A ARG A 1 127 ? 35.141 -15.020 -9.667  0.58   5.19  ? 153  ARG A HH12 1 
ATOM   1979 H HH12 B ARG A 1 127 ? 39.932 -14.805 -13.772 0.42   8.86  ? 153  ARG A HH12 1 
ATOM   1980 H HH21 A ARG A 1 127 ? 37.482 -13.698 -11.463 0.58   8.50  ? 153  ARG A HH21 1 
ATOM   1981 H HH21 B ARG A 1 127 ? 37.724 -13.212 -11.987 0.42   11.84 ? 153  ARG A HH21 1 
ATOM   1982 H HH22 A ARG A 1 127 ? 36.829 -13.682 -10.125 0.58   8.50  ? 153  ARG A HH22 1 
ATOM   1983 H HH22 B ARG A 1 127 ? 39.059 -13.078 -12.633 0.42   11.84 ? 153  ARG A HH22 1 
ATOM   1984 N N    . SER A 1 128 ? 34.106 -21.870 -12.725 1.00   5.71  ? 154  SER A N    1 
ATOM   1985 C CA   . SER A 1 128 ? 33.534 -23.055 -13.354 1.00   6.28  ? 154  SER A CA   1 
ATOM   1986 C C    . SER A 1 128 ? 32.102 -23.302 -12.881 1.00   6.18  ? 154  SER A C    1 
ATOM   1987 O O    . SER A 1 128 ? 31.347 -23.997 -13.547 1.00   7.06  ? 154  SER A O    1 
ATOM   1988 C CB   . SER A 1 128 ? 34.396 -24.281 -13.084 1.00   6.46  ? 154  SER A CB   1 
ATOM   1989 O OG   . SER A 1 128 ? 34.162 -24.847 -11.808 1.00   6.59  ? 154  SER A OG   1 
ATOM   1990 H H    . SER A 1 128 ? 34.780 -22.028 -12.216 1.00   6.85  ? 154  SER A H    1 
ATOM   1991 H HA   . SER A 1 128 ? 33.509 -22.917 -14.314 1.00   7.54  ? 154  SER A HA   1 
ATOM   1992 H HB2  . SER A 1 128 ? 34.203 -24.950 -13.759 1.00   7.76  ? 154  SER A HB2  1 
ATOM   1993 H HB3  . SER A 1 128 ? 35.329 -24.021 -13.140 1.00   7.76  ? 154  SER A HB3  1 
ATOM   1994 H HG   . SER A 1 128 ? 34.330 -24.283 -11.208 1.00   7.91  ? 154  SER A HG   1 
ATOM   1995 N N    . LEU A 1 129 ? 31.746 -22.736 -11.740 1.00   5.92  ? 155  LEU A N    1 
ATOM   1996 C CA   . LEU A 1 129 ? 30.420 -22.831 -11.162 1.00   6.35  ? 155  LEU A CA   1 
ATOM   1997 C C    . LEU A 1 129 ? 29.536 -21.690 -11.593 1.00   7.13  ? 155  LEU A C    1 
ATOM   1998 O O    . LEU A 1 129 ? 28.411 -21.600 -11.130 1.00   8.01  ? 155  LEU A O    1 
ATOM   1999 C CB   . LEU A 1 129 ? 30.489 -22.832 -9.634  1.00   6.65  ? 155  LEU A CB   1 
ATOM   2000 C CG   . LEU A 1 129 ? 31.323 -23.952 -9.023  1.00   7.19  ? 155  LEU A CG   1 
ATOM   2001 C CD1  . LEU A 1 129 ? 31.139 -23.921 -7.486  1.00   6.89  ? 155  LEU A CD1  1 
ATOM   2002 C CD2  . LEU A 1 129 ? 30.997 -25.329 -9.615  1.00   7.57  ? 155  LEU A CD2  1 
ATOM   2003 H H    . LEU A 1 129 ? 32.286 -22.268 -11.261 1.00   7.10  ? 155  LEU A H    1 
ATOM   2004 H HA   . LEU A 1 129 ? 30.006 -23.661 -11.448 1.00   7.63  ? 155  LEU A HA   1 
ATOM   2005 H HB2  . LEU A 1 129 ? 30.873 -21.991 -9.343  1.00   7.98  ? 155  LEU A HB2  1 
ATOM   2006 H HB3  . LEU A 1 129 ? 29.588 -22.916 -9.285  1.00   7.98  ? 155  LEU A HB3  1 
ATOM   2007 H HG   . LEU A 1 129 ? 32.259 -23.772 -9.207  1.00   8.63  ? 155  LEU A HG   1 
ATOM   2008 H HD11 . LEU A 1 129 ? 30.201 -24.050 -7.278  1.00   8.27  ? 155  LEU A HD11 1 
ATOM   2009 H HD12 . LEU A 1 129 ? 31.668 -24.631 -7.090  1.00   8.27  ? 155  LEU A HD12 1 
ATOM   2010 H HD13 . LEU A 1 129 ? 31.437 -23.060 -7.150  1.00   8.27  ? 155  LEU A HD13 1 
ATOM   2011 H HD21 . LEU A 1 129 ? 31.171 -25.312 -10.569 1.00   9.09  ? 155  LEU A HD21 1 
ATOM   2012 H HD22 . LEU A 1 129 ? 31.557 -25.997 -9.188  1.00   9.09  ? 155  LEU A HD22 1 
ATOM   2013 H HD23 . LEU A 1 129 ? 30.062 -25.529 -9.452  1.00   9.09  ? 155  LEU A HD23 1 
ATOM   2014 N N    . GLY A 1 130 ? 30.044 -20.817 -12.455 1.00   6.85  ? 156  GLY A N    1 
ATOM   2015 C CA   . GLY A 1 130 ? 29.286 -19.658 -12.906 1.00   7.81  ? 156  GLY A CA   1 
ATOM   2016 C C    . GLY A 1 130 ? 29.432 -18.429 -12.044 1.00   7.49  ? 156  GLY A C    1 
ATOM   2017 O O    . GLY A 1 130 ? 28.718 -17.462 -12.235 1.00   8.93  ? 156  GLY A O    1 
ATOM   2018 H H    . GLY A 1 130 ? 30.831 -20.874 -12.796 1.00   8.22  ? 156  GLY A H    1 
ATOM   2019 H HA2  . GLY A 1 130 ? 29.569 -19.428 -13.805 1.00   9.37  ? 156  GLY A HA2  1 
ATOM   2020 H HA3  . GLY A 1 130 ? 28.345 -19.891 -12.938 1.00   9.37  ? 156  GLY A HA3  1 
ATOM   2021 N N    . ASP A 1 131 ? 30.343 -18.475 -11.078 1.00   6.75  ? 157  ASP A N    1 
ATOM   2022 C CA   . ASP A 1 131 ? 30.546 -17.343 -10.194 1.00   6.18  ? 157  ASP A CA   1 
ATOM   2023 C C    . ASP A 1 131 ? 31.573 -16.423 -10.817 1.00   7.76  ? 157  ASP A C    1 
ATOM   2024 O O    . ASP A 1 131 ? 32.748 -16.763 -10.928 1.00   8.24  ? 157  ASP A O    1 
ATOM   2025 C CB   . ASP A 1 131 ? 31.023 -17.835 -8.851  1.00   6.24  ? 157  ASP A CB   1 
ATOM   2026 C CG   . ASP A 1 131 ? 31.059 -16.754 -7.775  1.00   5.59  ? 157  ASP A CG   1 
ATOM   2027 O OD1  . ASP A 1 131 ? 31.442 -15.598 -8.087  1.00   5.89  ? 157  ASP A OD1  1 
ATOM   2028 O OD2  . ASP A 1 131 ? 30.735 -17.088 -6.606  1.00   6.11  ? 157  ASP A OD2  1 
ATOM   2029 H H    . ASP A 1 131 ? 30.852 -19.149 -10.917 1.00   8.10  ? 157  ASP A H    1 
ATOM   2030 H HA   . ASP A 1 131 ? 29.714 -16.857 -10.077 1.00   7.42  ? 157  ASP A HA   1 
ATOM   2031 H HB2  . ASP A 1 131 ? 30.427 -18.537 -8.547  1.00   7.49  ? 157  ASP A HB2  1 
ATOM   2032 H HB3  . ASP A 1 131 ? 31.922 -18.186 -8.949  1.00   7.49  ? 157  ASP A HB3  1 
ATOM   2033 N N    . GLU A 1 132 ? 31.093 -15.270 -11.269 1.00   9.17  ? 158  GLU A N    1 
ATOM   2034 C CA   . GLU A 1 132 ? 31.906 -14.301 -11.988 1.00   11.37 ? 158  GLU A CA   1 
ATOM   2035 C C    . GLU A 1 132 ? 32.566 -13.294 -11.067 1.00   10.62 ? 158  GLU A C    1 
ATOM   2036 O O    . GLU A 1 132 ? 33.250 -12.387 -11.522 1.00   12.59 ? 158  GLU A O    1 
ATOM   2037 C CB   . GLU A 1 132 ? 31.020 -13.512 -12.957 1.00   14.98 ? 158  GLU A CB   1 
ATOM   2038 C CG   . GLU A 1 132 ? 30.181 -14.275 -13.908 1.00   18.22 ? 158  GLU A CG   1 
ATOM   2039 C CD   . GLU A 1 132 ? 29.212 -13.323 -14.598 1.00   21.10 ? 158  GLU A CD   1 
ATOM   2040 O OE1  . GLU A 1 132 ? 29.677 -12.434 -15.351 1.00   22.41 ? 158  GLU A OE1  1 
ATOM   2041 O OE2  . GLU A 1 132 ? 27.993 -13.422 -14.339 1.00   23.01 ? 158  GLU A OE2  1 
ATOM   2042 H H    . GLU A 1 132 ? 30.276 -15.021 -11.167 1.00   11.00 ? 158  GLU A H    1 
ATOM   2043 H HA   . GLU A 1 132 ? 32.593 -14.760 -12.495 1.00   13.64 ? 158  GLU A HA   1 
ATOM   2044 H HB2  . GLU A 1 132 ? 30.420 -12.961 -12.430 1.00   17.98 ? 158  GLU A HB2  1 
ATOM   2045 H HB3  . GLU A 1 132 ? 31.595 -12.938 -13.486 1.00   17.98 ? 158  GLU A HB3  1 
ATOM   2046 H HG2  . GLU A 1 132 ? 30.744 -14.689 -14.581 1.00   21.87 ? 158  GLU A HG2  1 
ATOM   2047 H HG3  . GLU A 1 132 ? 29.670 -14.946 -13.428 1.00   21.87 ? 158  GLU A HG3  1 
ATOM   2048 N N    . THR A 1 133 ? 32.316 -13.416 -9.782  1.00   8.50  ? 159  THR A N    1 
ATOM   2049 C CA   . THR A 1 133 ? 32.641 -12.389 -8.843  1.00   7.97  ? 159  THR A CA   1 
ATOM   2050 C C    . THR A 1 133 ? 33.769 -12.794 -7.880  1.00   6.64  ? 159  THR A C    1 
ATOM   2051 O O    . THR A 1 133 ? 34.682 -12.017 -7.587  1.00   6.90  ? 159  THR A O    1 
ATOM   2052 C CB   . THR A 1 133 ? 31.322 -12.112 -8.076  1.00   9.61  ? 159  THR A CB   1 
ATOM   2053 O OG1  . THR A 1 133 ? 30.264 -11.847 -9.025  1.00   11.79 ? 159  THR A OG1  1 
ATOM   2054 C CG2  . THR A 1 133 ? 31.488 -10.947 -7.224  1.00   10.09 ? 159  THR A CG2  1 
ATOM   2055 H H    . THR A 1 133 ? 31.948 -14.107 -9.426  1.00   10.20 ? 159  THR A H    1 
ATOM   2056 H HA   . THR A 1 133 ? 32.905 -11.583 -9.314  1.00   9.57  ? 159  THR A HA   1 
ATOM   2057 H HB   . THR A 1 133 ? 31.091 -12.876 -7.525  1.00   11.53 ? 159  THR A HB   1 
ATOM   2058 H HG1  . THR A 1 133 ? 30.459 -11.177 -9.493  1.00   14.14 ? 159  THR A HG1  1 
ATOM   2059 H HG21 . THR A 1 133 ? 31.711 -10.172 -7.763  1.00   12.11 ? 159  THR A HG21 1 
ATOM   2060 H HG22 . THR A 1 133 ? 30.665 -10.769 -6.742  1.00   12.11 ? 159  THR A HG22 1 
ATOM   2061 H HG23 . THR A 1 133 ? 32.201 -11.102 -6.585  1.00   12.11 ? 159  THR A HG23 1 
ATOM   2062 N N    . PHE A 1 134 ? 33.669 -13.990 -7.337  1.00   5.68  ? 160  PHE A N    1 
ATOM   2063 C CA   . PHE A 1 134 ? 34.657 -14.519 -6.410  1.00   5.31  ? 160  PHE A CA   1 
ATOM   2064 C C    . PHE A 1 134 ? 36.067 -14.362 -6.949  1.00   4.74  ? 160  PHE A C    1 
ATOM   2065 O O    . PHE A 1 134 ? 36.332 -14.694 -8.096  1.00   5.80  ? 160  PHE A O    1 
ATOM   2066 C CB   . PHE A 1 134 ? 34.337 -15.992 -6.198  1.00   4.95  ? 160  PHE A CB   1 
ATOM   2067 C CG   . PHE A 1 134 ? 35.318 -16.721 -5.309  1.00   4.74  ? 160  PHE A CG   1 
ATOM   2068 C CD1  . PHE A 1 134 ? 36.545 -17.156 -5.792  1.00   5.07  ? 160  PHE A CD1  1 
ATOM   2069 C CD2  . PHE A 1 134 ? 35.007 -16.980 -3.976  1.00   5.19  ? 160  PHE A CD2  1 
ATOM   2070 C CE1  . PHE A 1 134 ? 37.443 -17.847 -4.956  1.00   5.02  ? 160  PHE A CE1  1 
ATOM   2071 C CE2  . PHE A 1 134 ? 35.896 -17.650 -3.160  1.00   4.85  ? 160  PHE A CE2  1 
ATOM   2072 C CZ   . PHE A 1 134 ? 37.117 -18.067 -3.647  1.00   4.89  ? 160  PHE A CZ   1 
ATOM   2073 H H    . PHE A 1 134 ? 33.020 -14.532 -7.492  1.00   6.82  ? 160  PHE A H    1 
ATOM   2074 H HA   . PHE A 1 134 ? 34.593 -14.057 -5.559  1.00   6.38  ? 160  PHE A HA   1 
ATOM   2075 H HB2  . PHE A 1 134 ? 33.461 -16.064 -5.789  1.00   5.94  ? 160  PHE A HB2  1 
ATOM   2076 H HB3  . PHE A 1 134 ? 34.334 -16.437 -7.060  1.00   5.94  ? 160  PHE A HB3  1 
ATOM   2077 H HD1  . PHE A 1 134 ? 36.772 -16.999 -6.680  1.00   6.08  ? 160  PHE A HD1  1 
ATOM   2078 H HD2  . PHE A 1 134 ? 34.191 -16.696 -3.631  1.00   6.22  ? 160  PHE A HD2  1 
ATOM   2079 H HE1  . PHE A 1 134 ? 38.266 -18.129 -5.285  1.00   6.02  ? 160  PHE A HE1  1 
ATOM   2080 H HE2  . PHE A 1 134 ? 35.676 -17.810 -2.270  1.00   5.82  ? 160  PHE A HE2  1 
ATOM   2081 H HZ   . PHE A 1 134 ? 37.707 -18.524 -3.092  1.00   5.87  ? 160  PHE A HZ   1 
ATOM   2082 N N    . ARG A 1 135 ? 36.989 -13.946 -6.096  1.00   5.11  ? 161  ARG A N    1 
ATOM   2083 C CA   . ARG A 1 135 ? 38.406 -14.061 -6.411  1.00   5.02  ? 161  ARG A CA   1 
ATOM   2084 C C    . ARG A 1 135 ? 39.182 -14.388 -5.162  1.00   5.19  ? 161  ARG A C    1 
ATOM   2085 O O    . ARG A 1 135 ? 38.986 -13.742 -4.122  1.00   5.49  ? 161  ARG A O    1 
ATOM   2086 C CB   . ARG A 1 135 ? 38.957 -12.796 -7.093  1.00   5.64  ? 161  ARG A CB   1 
ATOM   2087 C CG   . ARG A 1 135 ? 38.697 -11.494 -6.327  1.00   5.88  ? 161  ARG A CG   1 
ATOM   2088 C CD   . ARG A 1 135 ? 39.169 -10.291 -7.105  1.00   5.83  ? 161  ARG A CD   1 
ATOM   2089 N NE   . ARG A 1 135 ? 40.624 -10.219 -7.114  1.00   6.04  ? 161  ARG A NE   1 
ATOM   2090 C CZ   . ARG A 1 135 ? 41.310 -9.287  -7.754  1.00   6.41  ? 161  ARG A CZ   1 
ATOM   2091 N NH1  . ARG A 1 135 ? 40.682 -8.384  -8.499  1.00   6.76  ? 161  ARG A NH1  1 
ATOM   2092 N NH2  . ARG A 1 135 ? 42.634 -9.270  -7.664  1.00   7.36  ? 161  ARG A NH2  1 
ATOM   2093 H H    . ARG A 1 135 ? 36.823 -13.595 -5.329  1.00   6.13  ? 161  ARG A H    1 
ATOM   2094 H HA   . ARG A 1 135 ? 38.524 -14.799 -7.029  1.00   6.02  ? 161  ARG A HA   1 
ATOM   2095 H HB2  . ARG A 1 135 ? 39.917 -12.891 -7.193  1.00   6.77  ? 161  ARG A HB2  1 
ATOM   2096 H HB3  . ARG A 1 135 ? 38.545 -12.710 -7.966  1.00   6.77  ? 161  ARG A HB3  1 
ATOM   2097 H HG2  . ARG A 1 135 ? 37.745 -11.400 -6.170  1.00   7.05  ? 161  ARG A HG2  1 
ATOM   2098 H HG3  . ARG A 1 135 ? 39.176 -11.518 -5.484  1.00   7.05  ? 161  ARG A HG3  1 
ATOM   2099 H HD2  . ARG A 1 135 ? 38.860 -10.359 -8.022  1.00   7.00  ? 161  ARG A HD2  1 
ATOM   2100 H HD3  . ARG A 1 135 ? 38.825 -9.484  -6.691  1.00   7.00  ? 161  ARG A HD3  1 
ATOM   2101 H HE   . ARG A 1 135 ? 41.057 -10.754 -6.598  1.00   7.25  ? 161  ARG A HE   1 
ATOM   2102 H HH11 . ARG A 1 135 ? 39.824 -8.388  -8.547  1.00   8.11  ? 161  ARG A HH11 1 
ATOM   2103 H HH12 . ARG A 1 135 ? 41.134 -7.786  -8.922  1.00   8.11  ? 161  ARG A HH12 1 
ATOM   2104 H HH21 . ARG A 1 135 ? 43.040 -9.865  -7.194  1.00   8.83  ? 161  ARG A HH21 1 
ATOM   2105 H HH22 . ARG A 1 135 ? 43.087 -8.683  -8.099  1.00   8.83  ? 161  ARG A HH22 1 
ATOM   2106 N N    . LEU A 1 136 ? 40.063 -15.386 -5.262  1.00   5.29  ? 162  LEU A N    1 
ATOM   2107 C CA   . LEU A 1 136 ? 41.034 -15.680 -4.212  1.00   5.10  ? 162  LEU A CA   1 
ATOM   2108 C C    . LEU A 1 136 ? 42.403 -15.324 -4.740  1.00   5.84  ? 162  LEU A C    1 
ATOM   2109 O O    . LEU A 1 136 ? 42.805 -15.786 -5.814  1.00   7.29  ? 162  LEU A O    1 
ATOM   2110 C CB   . LEU A 1 136 ? 40.988 -17.142 -3.782  1.00   5.49  ? 162  LEU A CB   1 
ATOM   2111 C CG   . LEU A 1 136 ? 41.721 -17.396 -2.463  1.00   5.39  ? 162  LEU A CG   1 
ATOM   2112 C CD1  . LEU A 1 136 ? 41.011 -16.765 -1.290  1.00   7.03  ? 162  LEU A CD1  1 
ATOM   2113 C CD2  . LEU A 1 136 ? 41.901 -18.884 -2.250  1.00   5.75  ? 162  LEU A CD2  1 
ATOM   2114 H H    . LEU A 1 136 ? 40.118 -15.913 -5.939  1.00   6.35  ? 162  LEU A H    1 
ATOM   2115 H HA   . LEU A 1 136 ? 40.849 -15.127 -3.437  1.00   6.12  ? 162  LEU A HA   1 
ATOM   2116 H HB2  . LEU A 1 136 ? 40.062 -17.409 -3.667  1.00   6.58  ? 162  LEU A HB2  1 
ATOM   2117 H HB3  . LEU A 1 136 ? 41.407 -17.686 -4.467  1.00   6.58  ? 162  LEU A HB3  1 
ATOM   2118 H HG   . LEU A 1 136 ? 42.604 -16.998 -2.519  1.00   6.46  ? 162  LEU A HG   1 
ATOM   2119 H HD11 . LEU A 1 136 ? 40.119 -17.141 -1.222  1.00   8.44  ? 162  LEU A HD11 1 
ATOM   2120 H HD12 . LEU A 1 136 ? 41.511 -16.952 -0.480  1.00   8.44  ? 162  LEU A HD12 1 
ATOM   2121 H HD13 . LEU A 1 136 ? 40.957 -15.807 -1.432  1.00   8.44  ? 162  LEU A HD13 1 
ATOM   2122 H HD21 . LEU A 1 136 ? 42.421 -19.247 -2.984  1.00   6.90  ? 162  LEU A HD21 1 
ATOM   2123 H HD22 . LEU A 1 136 ? 42.367 -19.029 -1.411  1.00   6.90  ? 162  LEU A HD22 1 
ATOM   2124 H HD23 . LEU A 1 136 ? 41.029 -19.307 -2.221  1.00   6.90  ? 162  LEU A HD23 1 
ATOM   2125 N N    . ASP A 1 137 ? 43.097 -14.482 -3.988  1.00   5.22  ? 163  ASP A N    1 
ATOM   2126 C CA   . ASP A 1 137 ? 44.370 -13.927 -4.380  1.00   5.27  ? 163  ASP A CA   1 
ATOM   2127 C C    . ASP A 1 137 ? 45.504 -14.365 -3.477  1.00   5.15  ? 163  ASP A C    1 
ATOM   2128 O O    . ASP A 1 137 ? 46.643 -14.420 -3.938  1.00   6.85  ? 163  ASP A O    1 
ATOM   2129 C CB   . ASP A 1 137 ? 44.265 -12.394 -4.360  1.00   6.36  ? 163  ASP A CB   1 
ATOM   2130 C CG   . ASP A 1 137 ? 43.332 -11.890 -5.419  1.00   7.65  ? 163  ASP A CG   1 
ATOM   2131 O OD1  . ASP A 1 137 ? 43.800 -11.665 -6.559  1.00   10.55 ? 163  ASP A OD1  1 
ATOM   2132 O OD2  . ASP A 1 137 ? 42.129 -11.780 -5.145  1.00   6.04  ? 163  ASP A OD2  1 
ATOM   2133 H H    . ASP A 1 137 ? 42.834 -14.211 -3.216  1.00   6.27  ? 163  ASP A H    1 
ATOM   2134 H HA   . ASP A 1 137 ? 44.576 -14.207 -5.286  1.00   6.32  ? 163  ASP A HA   1 
ATOM   2135 H HB2  . ASP A 1 137 ? 43.928 -12.108 -3.497  1.00   7.63  ? 163  ASP A HB2  1 
ATOM   2136 H HB3  . ASP A 1 137 ? 45.142 -12.011 -4.522  1.00   7.63  ? 163  ASP A HB3  1 
ATOM   2137 N N    . ARG A 1 138 ? 45.221 -14.626 -2.202  1.00   5.40  ? 164  ARG A N    1 
ATOM   2138 C CA   . ARG A 1 138 ? 46.252 -14.897 -1.221  1.00   5.71  ? 164  ARG A CA   1 
ATOM   2139 C C    . ARG A 1 138 ? 45.891 -16.124 -0.389  1.00   5.85  ? 164  ARG A C    1 
ATOM   2140 O O    . ARG A 1 138 ? 44.744 -16.579 -0.351  1.00   6.49  ? 164  ARG A O    1 
ATOM   2141 C CB   . ARG A 1 138 ? 46.433 -13.665 -0.325  1.00   6.11  ? 164  ARG A CB   1 
ATOM   2142 C CG   . ARG A 1 138 ? 47.069 -12.508 -1.075  1.00   6.28  ? 164  ARG A CG   1 
ATOM   2143 C CD   . ARG A 1 138 ? 47.042 -11.222 -0.237  1.00   6.82  ? 164  ARG A CD   1 
ATOM   2144 N NE   . ARG A 1 138 ? 45.675 -10.789 -0.053  1.00   5.97  ? 164  ARG A NE   1 
ATOM   2145 C CZ   . ARG A 1 138 ? 45.282 -9.852  0.799   1.00   5.56  ? 164  ARG A CZ   1 
ATOM   2146 N NH1  . ARG A 1 138 ? 46.156 -9.125  1.496   1.00   6.31  ? 164  ARG A NH1  1 
ATOM   2147 N NH2  . ARG A 1 138 ? 43.985 -9.615  0.927   1.00   6.13  ? 164  ARG A NH2  1 
ATOM   2148 H H    . ARG A 1 138 ? 44.423 -14.651 -1.882  1.00   6.48  ? 164  ARG A H    1 
ATOM   2149 H HA   . ARG A 1 138 ? 47.091 -15.071 -1.676  1.00   6.85  ? 164  ARG A HA   1 
ATOM   2150 H HB2  . ARG A 1 138 ? 45.566 -13.376 0.000   1.00   7.33  ? 164  ARG A HB2  1 
ATOM   2151 H HB3  . ARG A 1 138 ? 47.010 -13.895 0.421   1.00   7.33  ? 164  ARG A HB3  1 
ATOM   2152 H HG2  . ARG A 1 138 ? 47.993 -12.724 -1.274  1.00   7.53  ? 164  ARG A HG2  1 
ATOM   2153 H HG3  . ARG A 1 138 ? 46.576 -12.348 -1.895  1.00   7.53  ? 164  ARG A HG3  1 
ATOM   2154 H HD2  . ARG A 1 138 ? 47.433 -11.393 0.635   1.00   8.19  ? 164  ARG A HD2  1 
ATOM   2155 H HD3  . ARG A 1 138 ? 47.530 -10.522 -0.698  1.00   8.19  ? 164  ARG A HD3  1 
ATOM   2156 H HE   . ARG A 1 138 ? 45.071 -11.168 -0.534  1.00   7.16  ? 164  ARG A HE   1 
ATOM   2157 H HH11 . ARG A 1 138 ? 46.998 -9.287  1.433   1.00   7.58  ? 164  ARG A HH11 1 
ATOM   2158 H HH12 . ARG A 1 138 ? 45.875 -8.511  2.029   1.00   7.58  ? 164  ARG A HH12 1 
ATOM   2159 H HH21 . ARG A 1 138 ? 43.418 -10.064 0.461   1.00   7.35  ? 164  ARG A HH21 1 
ATOM   2160 H HH22 . ARG A 1 138 ? 43.713 -8.982  1.441   1.00   7.35  ? 164  ARG A HH22 1 
ATOM   2161 N N    . THR A 1 139 ? 46.917 -16.643 0.252   1.00   5.89  ? 165  THR A N    1 
ATOM   2162 C CA   . THR A 1 139 ? 46.771 -17.682 1.256   1.00   6.84  ? 165  THR A CA   1 
ATOM   2163 C C    . THR A 1 139 ? 46.384 -17.074 2.605   1.00   6.73  ? 165  THR A C    1 
ATOM   2164 O O    . THR A 1 139 ? 46.249 -15.859 2.753   1.00   7.26  ? 165  THR A O    1 
ATOM   2165 C CB   . THR A 1 139 ? 48.070 -18.459 1.399   1.00   8.02  ? 165  THR A CB   1 
ATOM   2166 O OG1  . THR A 1 139 ? 49.075 -17.529 1.806   1.00   8.73  ? 165  THR A OG1  1 
ATOM   2167 C CG2  . THR A 1 139 ? 48.444 -19.118 0.068   1.00   8.89  ? 165  THR A CG2  1 
ATOM   2168 H H    . THR A 1 139 ? 47.733 -16.405 0.121   1.00   7.07  ? 165  THR A H    1 
ATOM   2169 H HA   . THR A 1 139 ? 46.073 -18.298 0.985   1.00   8.21  ? 165  THR A HA   1 
ATOM   2170 H HB   . THR A 1 139 ? 47.968 -19.149 2.073   1.00   9.63  ? 165  THR A HB   1 
ATOM   2171 H HG1  . THR A 1 139 ? 49.812 -17.923 1.896   1.00   10.48 ? 165  THR A HG1  1 
ATOM   2172 H HG21 . THR A 1 139 ? 48.559 -18.440 -0.617  1.00   10.66 ? 165  THR A HG21 1 
ATOM   2173 H HG22 . THR A 1 139 ? 49.273 -19.612 0.164   1.00   10.66 ? 165  THR A HG22 1 
ATOM   2174 H HG23 . THR A 1 139 ? 47.743 -19.729 -0.208  1.00   10.66 ? 165  THR A HG23 1 
ATOM   2175 N N    . ALA A 1 140 ? 46.189 -17.939 3.583   1.00   7.03  ? 166  ALA A N    1 
ATOM   2176 C CA   . ALA A 1 140 ? 45.951 -17.486 4.936   1.00   9.02  ? 166  ALA A CA   1 
ATOM   2177 C C    . ALA A 1 140 ? 47.298 -17.284 5.626   1.00   10.30 ? 166  ALA A C    1 
ATOM   2178 O O    . ALA A 1 140 ? 48.232 -18.056 5.403   1.00   9.94  ? 166  ALA A O    1 
ATOM   2179 C CB   . ALA A 1 140 ? 45.122 -18.522 5.683   1.00   11.69 ? 166  ALA A CB   1 
ATOM   2180 H H    . ALA A 1 140 ? 46.190 -18.794 3.489   1.00   8.44  ? 166  ALA A H    1 
ATOM   2181 H HA   . ALA A 1 140 ? 45.470 -16.644 4.925   1.00   10.82 ? 166  ALA A HA   1 
ATOM   2182 H HB1  . ALA A 1 140 ? 45.608 -19.361 5.700   1.00   14.03 ? 166  ALA A HB1  1 
ATOM   2183 H HB2  . ALA A 1 140 ? 44.968 -18.210 6.588   1.00   14.03 ? 166  ALA A HB2  1 
ATOM   2184 H HB3  . ALA A 1 140 ? 44.276 -18.639 5.224   1.00   14.03 ? 166  ALA A HB3  1 
ATOM   2185 N N    . PRO A 1 141 ? 47.389 -16.296 6.539   1.00   11.47 ? 167  PRO A N    1 
ATOM   2186 C CA   . PRO A 1 141 ? 46.303 -15.418 6.997   1.00   11.60 ? 167  PRO A CA   1 
ATOM   2187 C C    . PRO A 1 141 ? 46.193 -14.117 6.223   1.00   8.85  ? 167  PRO A C    1 
ATOM   2188 O O    . PRO A 1 141 ? 45.323 -13.315 6.570   1.00   9.05  ? 167  PRO A O    1 
ATOM   2189 C CB   . PRO A 1 141 ? 46.713 -15.109 8.431   1.00   14.08 ? 167  PRO A CB   1 
ATOM   2190 C CG   . PRO A 1 141 ? 48.170 -15.035 8.356   1.00   13.84 ? 167  PRO A CG   1 
ATOM   2191 C CD   . PRO A 1 141 ? 48.595 -16.111 7.360   1.00   12.94 ? 167  PRO A CD   1 
ATOM   2192 H HA   . PRO A 1 141 ? 45.453 -15.884 6.989   1.00   13.92 ? 167  PRO A HA   1 
ATOM   2193 H HB2  . PRO A 1 141 ? 46.335 -14.260 8.709   1.00   16.89 ? 167  PRO A HB2  1 
ATOM   2194 H HB3  . PRO A 1 141 ? 46.430 -15.827 9.019   1.00   16.89 ? 167  PRO A HB3  1 
ATOM   2195 H HG2  . PRO A 1 141 ? 48.434 -14.156 8.041   1.00   16.61 ? 167  PRO A HG2  1 
ATOM   2196 H HG3  . PRO A 1 141 ? 48.549 -15.212 9.231   1.00   16.61 ? 167  PRO A HG3  1 
ATOM   2197 H HD2  . PRO A 1 141 ? 49.332 -15.797 6.814   1.00   15.53 ? 167  PRO A HD2  1 
ATOM   2198 H HD3  . PRO A 1 141 ? 48.818 -16.934 7.824   1.00   15.53 ? 167  PRO A HD3  1 
ATOM   2199 N N    . THR A 1 142 ? 47.019 -13.872 5.210   1.00   7.88  ? 168  THR A N    1 
ATOM   2200 C CA   . THR A 1 142 ? 46.982 -12.548 4.593   1.00   7.82  ? 168  THR A CA   1 
ATOM   2201 C C    . THR A 1 142 ? 45.670 -12.293 3.863   1.00   7.06  ? 168  THR A C    1 
ATOM   2202 O O    . THR A 1 142 ? 45.313 -11.147 3.663   1.00   7.45  ? 168  THR A O    1 
ATOM   2203 C CB   . THR A 1 142 ? 48.180 -12.204 3.688   1.00   8.66  ? 168  THR A CB   1 
ATOM   2204 O OG1  . THR A 1 142 ? 48.251 -13.100 2.581   1.00   8.55  ? 168  THR A OG1  1 
ATOM   2205 C CG2  . THR A 1 142 ? 49.469 -12.194 4.479   1.00   10.41 ? 168  THR A CG2  1 
ATOM   2206 H H    . THR A 1 142 ? 47.584 -14.425 4.873   1.00   9.46  ? 168  THR A H    1 
ATOM   2207 H HA   . THR A 1 142 ? 47.009 -11.904 5.318   1.00   9.38  ? 168  THR A HA   1 
ATOM   2208 H HB   . THR A 1 142 ? 48.050 -11.307 3.343   1.00   10.40 ? 168  THR A HB   1 
ATOM   2209 H HG1  . THR A 1 142 ? 48.340 -13.889 2.856   1.00   10.26 ? 168  THR A HG1  1 
ATOM   2210 H HG21 . THR A 1 142 ? 49.623 -13.066 4.874   1.00   12.49 ? 168  THR A HG21 1 
ATOM   2211 H HG22 . THR A 1 142 ? 50.214 -11.976 3.897   1.00   12.49 ? 168  THR A HG22 1 
ATOM   2212 H HG23 . THR A 1 142 ? 49.419 -11.532 5.187   1.00   12.49 ? 168  THR A HG23 1 
ATOM   2213 N N    . LEU A 1 143 ? 44.893 -13.332 3.556   1.00   6.32  ? 169  LEU A N    1 
ATOM   2214 C CA   . LEU A 1 143 ? 43.586 -13.121 2.936   1.00   7.04  ? 169  LEU A CA   1 
ATOM   2215 C C    . LEU A 1 143 ? 42.597 -12.423 3.862   1.00   6.85  ? 169  LEU A C    1 
ATOM   2216 O O    . LEU A 1 143 ? 41.521 -12.051 3.427   1.00   8.13  ? 169  LEU A O    1 
ATOM   2217 C CB   . LEU A 1 143 ? 43.038 -14.430 2.360   1.00   7.05  ? 169  LEU A CB   1 
ATOM   2218 C CG   . LEU A 1 143 ? 42.762 -15.582 3.317   1.00   7.95  ? 169  LEU A CG   1 
ATOM   2219 C CD1  . LEU A 1 143 ? 41.488 -15.377 4.130   1.00   9.36  ? 169  LEU A CD1  1 
ATOM   2220 C CD2  . LEU A 1 143 ? 42.642 -16.893 2.551   1.00   7.64  ? 169  LEU A CD2  1 
ATOM   2221 H H    . LEU A 1 143 ? 45.095 -14.157 3.694   1.00   7.58  ? 169  LEU A H    1 
ATOM   2222 H HA   . LEU A 1 143 ? 43.718 -12.526 2.182   1.00   8.45  ? 169  LEU A HA   1 
ATOM   2223 H HB2  . LEU A 1 143 ? 42.201 -14.230 1.912   1.00   8.45  ? 169  LEU A HB2  1 
ATOM   2224 H HB3  . LEU A 1 143 ? 43.676 -14.756 1.705   1.00   8.45  ? 169  LEU A HB3  1 
ATOM   2225 H HG   . LEU A 1 143 ? 43.504 -15.663 3.937   1.00   9.53  ? 169  LEU A HG   1 
ATOM   2226 H HD11 . LEU A 1 143 ? 40.735 -15.303 3.522   1.00   11.23 ? 169  LEU A HD11 1 
ATOM   2227 H HD12 . LEU A 1 143 ? 41.364 -16.138 4.719   1.00   11.23 ? 169  LEU A HD12 1 
ATOM   2228 H HD13 . LEU A 1 143 ? 41.574 -14.564 4.652   1.00   11.23 ? 169  LEU A HD13 1 
ATOM   2229 H HD21 . LEU A 1 143 ? 43.474 -17.061 2.080   1.00   9.16  ? 169  LEU A HD21 1 
ATOM   2230 H HD22 . LEU A 1 143 ? 42.467 -17.611 3.179   1.00   9.16  ? 169  LEU A HD22 1 
ATOM   2231 H HD23 . LEU A 1 143 ? 41.911 -16.822 1.917   1.00   9.16  ? 169  LEU A HD23 1 
ATOM   2232 N N    . ASN A 1 144 ? 42.974 -12.208 5.123   1.00   6.28  ? 170  ASN A N    1 
ATOM   2233 C CA   . ASN A 1 144 ? 42.133 -11.532 6.113   1.00   6.98  ? 170  ASN A CA   1 
ATOM   2234 C C    . ASN A 1 144 ? 42.432 -10.047 6.305   1.00   6.23  ? 170  ASN A C    1 
ATOM   2235 O O    . ASN A 1 144 ? 41.866 -9.428  7.199   1.00   6.74  ? 170  ASN A O    1 
ATOM   2236 C CB   . ASN A 1 144 ? 42.274 -12.234 7.479   1.00   10.30 ? 170  ASN A CB   1 
ATOM   2237 C CG   . ASN A 1 144 ? 41.668 -13.614 7.482   1.00   14.03 ? 170  ASN A CG   1 
ATOM   2238 O OD1  . ASN A 1 144 ? 40.625 -13.841 6.876   1.00   13.74 ? 170  ASN A OD1  1 
ATOM   2239 N ND2  . ASN A 1 144 ? 42.284 -14.529 8.212   1.00   17.18 ? 170  ASN A ND2  1 
ATOM   2240 H H    . ASN A 1 144 ? 43.736 -12.452 5.437   1.00   7.54  ? 170  ASN A H    1 
ATOM   2241 H HA   . ASN A 1 144 ? 41.207 -11.611 5.836   1.00   8.38  ? 170  ASN A HA   1 
ATOM   2242 H HB2  . ASN A 1 144 ? 43.215 -12.318 7.696   1.00   12.36 ? 170  ASN A HB2  1 
ATOM   2243 H HB3  . ASN A 1 144 ? 41.822 -11.705 8.155   1.00   12.36 ? 170  ASN A HB3  1 
ATOM   2244 H HD21 . ASN A 1 144 ? 42.993 -14.321 8.653   1.00   20.61 ? 170  ASN A HD21 1 
ATOM   2245 H HD22 . ASN A 1 144 ? 41.976 -15.331 8.246   1.00   20.61 ? 170  ASN A HD22 1 
ATOM   2246 N N    . THR A 1 145 ? 43.314 -9.447  5.503   1.00   5.87  ? 171  THR A N    1 
ATOM   2247 C CA   . THR A 1 145 ? 43.620 -8.035  5.703   1.00   5.90  ? 171  THR A CA   1 
ATOM   2248 C C    . THR A 1 145 ? 42.390 -7.138  5.558   1.00   5.00  ? 171  THR A C    1 
ATOM   2249 O O    . THR A 1 145 ? 42.276 -6.122  6.245   1.00   5.39  ? 171  THR A O    1 
ATOM   2250 C CB   . THR A 1 145 ? 44.768 -7.551  4.814   1.00   6.52  ? 171  THR A CB   1 
ATOM   2251 O OG1  . THR A 1 145 ? 44.517 -7.875  3.447   1.00   6.14  ? 171  THR A OG1  1 
ATOM   2252 C CG2  . THR A 1 145 ? 46.076 -8.180  5.216   1.00   7.70  ? 171  THR A CG2  1 
ATOM   2253 H H    . THR A 1 145 ? 43.735 -9.824  4.855   1.00   7.05  ? 171  THR A H    1 
ATOM   2254 H HA   . THR A 1 145 ? 43.924 -7.935  6.619   1.00   7.09  ? 171  THR A HA   1 
ATOM   2255 H HB   . THR A 1 145 ? 44.855 -6.589  4.903   1.00   7.83  ? 171  THR A HB   1 
ATOM   2256 H HG1  . THR A 1 145 ? 43.806 -7.508  3.191   1.00   7.37  ? 171  THR A HG1  1 
ATOM   2257 H HG21 . THR A 1 145 ? 46.018 -9.145  5.137   1.00   9.23  ? 171  THR A HG21 1 
ATOM   2258 H HG22 . THR A 1 145 ? 46.788 -7.859  4.641   1.00   9.23  ? 171  THR A HG22 1 
ATOM   2259 H HG23 . THR A 1 145 ? 46.286 -7.951  6.135   1.00   9.23  ? 171  THR A HG23 1 
ATOM   2260 N N    . ALA A 1 146 ? 41.514 -7.484  4.633   1.00   4.91  ? 172  ALA A N    1 
ATOM   2261 C CA   . ALA A 1 146 ? 40.191 -6.873  4.494   1.00   4.31  ? 172  ALA A CA   1 
ATOM   2262 C C    . ALA A 1 146 ? 40.217 -5.345  4.417   1.00   4.44  ? 172  ALA A C    1 
ATOM   2263 O O    . ALA A 1 146 ? 39.372 -4.661  4.985   1.00   5.04  ? 172  ALA A O    1 
ATOM   2264 C CB   . ALA A 1 146 ? 39.254 -7.334  5.615   1.00   4.86  ? 172  ALA A CB   1 
ATOM   2265 H H    . ALA A 1 146 ? 41.663 -8.096  4.047   1.00   5.89  ? 172  ALA A H    1 
ATOM   2266 H HA   . ALA A 1 146 ? 39.806 -7.188  3.660   1.00   5.18  ? 172  ALA A HA   1 
ATOM   2267 H HB1  . ALA A 1 146 ? 39.633 -7.074  6.469   1.00   5.83  ? 172  ALA A HB1  1 
ATOM   2268 H HB2  . ALA A 1 146 ? 38.388 -6.913  5.496   1.00   5.83  ? 172  ALA A HB2  1 
ATOM   2269 H HB3  . ALA A 1 146 ? 39.162 -8.298  5.573   1.00   5.83  ? 172  ALA A HB3  1 
ATOM   2270 N N    . ILE A 1 147 ? 41.138 -4.829  3.623   1.00   4.83  ? 173  ILE A N    1 
ATOM   2271 C CA   . ILE A 1 147 ? 41.337 -3.402  3.531   1.00   5.57  ? 173  ILE A CA   1 
ATOM   2272 C C    . ILE A 1 147 ? 40.226 -2.797  2.678   1.00   5.21  ? 173  ILE A C    1 
ATOM   2273 O O    . ILE A 1 147 ? 39.930 -3.309  1.614   1.00   5.39  ? 173  ILE A O    1 
ATOM   2274 C CB   . ILE A 1 147 ? 42.710 -3.133  2.885   1.00   5.59  ? 173  ILE A CB   1 
ATOM   2275 C CG1  . ILE A 1 147 ? 43.842 -3.659  3.786   1.00   6.35  ? 173  ILE A CG1  1 
ATOM   2276 C CG2  . ILE A 1 147 ? 42.879 -1.642  2.605   1.00   5.99  ? 173  ILE A CG2  1 
ATOM   2277 C CD1  . ILE A 1 147 ? 45.117 -3.943  3.037   1.00   7.70  ? 173  ILE A CD1  1 
ATOM   2278 H H    . ILE A 1 147 ? 41.664 -5.290  3.124   1.00   5.80  ? 173  ILE A H    1 
ATOM   2279 H HA   . ILE A 1 147 ? 41.316 -3.002  4.415   1.00   6.68  ? 173  ILE A HA   1 
ATOM   2280 H HB   . ILE A 1 147 ? 42.747 -3.608  2.040   1.00   6.71  ? 173  ILE A HB   1 
ATOM   2281 H HG12 . ILE A 1 147 ? 44.037 -2.994  4.465   1.00   7.62  ? 173  ILE A HG12 1 
ATOM   2282 H HG13 . ILE A 1 147 ? 43.553 -4.484  4.205   1.00   7.62  ? 173  ILE A HG13 1 
ATOM   2283 H HG21 . ILE A 1 147 ? 42.818 -1.156  3.442   1.00   7.19  ? 173  ILE A HG21 1 
ATOM   2284 H HG22 . ILE A 1 147 ? 43.748 -1.495  2.199   1.00   7.19  ? 173  ILE A HG22 1 
ATOM   2285 H HG23 . ILE A 1 147 ? 42.178 -1.353  2.001   1.00   7.19  ? 173  ILE A HG23 1 
ATOM   2286 H HD11 . ILE A 1 147 ? 45.427 -3.123  2.620   1.00   9.23  ? 173  ILE A HD11 1 
ATOM   2287 H HD12 . ILE A 1 147 ? 45.784 -4.269  3.662   1.00   9.23  ? 173  ILE A HD12 1 
ATOM   2288 H HD13 . ILE A 1 147 ? 44.943 -4.614  2.359   1.00   9.23  ? 173  ILE A HD13 1 
ATOM   2289 N N    . PRO A 1 148 ? 39.584 -1.720  3.149   1.00   5.56  ? 174  PRO A N    1 
ATOM   2290 C CA   . PRO A 1 148 ? 38.473 -1.158  2.374   1.00   6.01  ? 174  PRO A CA   1 
ATOM   2291 C C    . PRO A 1 148 ? 38.889 -0.837  0.944   1.00   5.22  ? 174  PRO A C    1 
ATOM   2292 O O    . PRO A 1 148 ? 39.913 -0.195  0.709   1.00   5.21  ? 174  PRO A O    1 
ATOM   2293 C CB   . PRO A 1 148 ? 38.076 0.080   3.185   1.00   6.69  ? 174  PRO A CB   1 
ATOM   2294 C CG   . PRO A 1 148 ? 38.408 -0.296  4.573   1.00   7.23  ? 174  PRO A CG   1 
ATOM   2295 C CD   . PRO A 1 148 ? 39.703 -1.040  4.446   1.00   6.53  ? 174  PRO A CD   1 
ATOM   2296 H HA   . PRO A 1 148 ? 37.729 -1.780  2.358   1.00   7.22  ? 174  PRO A HA   1 
ATOM   2297 H HB2  . PRO A 1 148 ? 38.598 0.846   2.898   1.00   8.02  ? 174  PRO A HB2  1 
ATOM   2298 H HB3  . PRO A 1 148 ? 37.126 0.249   3.088   1.00   8.02  ? 174  PRO A HB3  1 
ATOM   2299 H HG2  . PRO A 1 148 ? 38.519 0.502   5.114   1.00   8.68  ? 174  PRO A HG2  1 
ATOM   2300 H HG3  . PRO A 1 148 ? 37.713 -0.868  4.935   1.00   8.68  ? 174  PRO A HG3  1 
ATOM   2301 H HD2  . PRO A 1 148 ? 40.449 -0.421  4.436   1.00   7.84  ? 174  PRO A HD2  1 
ATOM   2302 H HD3  . PRO A 1 148 ? 39.791 -1.690  5.161   1.00   7.84  ? 174  PRO A HD3  1 
ATOM   2303 N N    . GLY A 1 149 ? 38.094 -1.299  -0.018  1.00   5.67  ? 175  GLY A N    1 
ATOM   2304 C CA   . GLY A 1 149 ? 38.371 -1.012  -1.416  1.00   6.12  ? 175  GLY A CA   1 
ATOM   2305 C C    . GLY A 1 149 ? 39.372 -1.943  -2.068  1.00   5.06  ? 175  GLY A C    1 
ATOM   2306 O O    . GLY A 1 149 ? 39.568 -1.877  -3.277  1.00   5.87  ? 175  GLY A O    1 
ATOM   2307 H H    . GLY A 1 149 ? 37.392 -1.778  0.114   1.00   6.80  ? 175  GLY A H    1 
ATOM   2308 H HA2  . GLY A 1 149 ? 37.543 -1.064  -1.918  1.00   7.34  ? 175  GLY A HA2  1 
ATOM   2309 H HA3  . GLY A 1 149 ? 38.712 -0.107  -1.490  1.00   7.34  ? 175  GLY A HA3  1 
ATOM   2310 N N    . ASP A 1 150 ? 40.026 -2.813  -1.304  1.00   5.08  ? 176  ASP A N    1 
ATOM   2311 C CA   . ASP A 1 150 ? 40.985 -3.752  -1.877  1.00   4.72  ? 176  ASP A CA   1 
ATOM   2312 C C    . ASP A 1 150 ? 40.163 -4.867  -2.522  1.00   4.92  ? 176  ASP A C    1 
ATOM   2313 O O    . ASP A 1 150 ? 39.319 -5.475  -1.851  1.00   5.05  ? 176  ASP A O    1 
ATOM   2314 C CB   . ASP A 1 150 ? 41.881 -4.267  -0.745  1.00   5.02  ? 176  ASP A CB   1 
ATOM   2315 C CG   . ASP A 1 150 ? 43.036 -5.151  -1.175  1.00   5.27  ? 176  ASP A CG   1 
ATOM   2316 O OD1  . ASP A 1 150 ? 43.062 -5.683  -2.304  1.00   5.59  ? 176  ASP A OD1  1 
ATOM   2317 O OD2  . ASP A 1 150 ? 43.916 -5.328  -0.318  1.00   5.81  ? 176  ASP A OD2  1 
ATOM   2318 H H    . ASP A 1 150 ? 39.932 -2.881  -0.452  1.00   6.10  ? 176  ASP A H    1 
ATOM   2319 H HA   . ASP A 1 150 ? 41.529 -3.316  -2.551  1.00   5.67  ? 176  ASP A HA   1 
ATOM   2320 H HB2  . ASP A 1 150 ? 42.257 -3.504  -0.280  1.00   6.02  ? 176  ASP A HB2  1 
ATOM   2321 H HB3  . ASP A 1 150 ? 41.334 -4.782  -0.131  1.00   6.02  ? 176  ASP A HB3  1 
ATOM   2322 N N    . PRO A 1 151 ? 40.385 -5.169  -3.801  1.00   5.20  ? 177  PRO A N    1 
ATOM   2323 C CA   . PRO A 1 151 ? 39.596 -6.209  -4.459  1.00   5.20  ? 177  PRO A CA   1 
ATOM   2324 C C    . PRO A 1 151 ? 40.088 -7.620  -4.141  1.00   5.54  ? 177  PRO A C    1 
ATOM   2325 O O    . PRO A 1 151 ? 39.413 -8.589  -4.466  1.00   5.43  ? 177  PRO A O    1 
ATOM   2326 C CB   . PRO A 1 151 ? 39.809 -5.899  -5.933  1.00   6.35  ? 177  PRO A CB   1 
ATOM   2327 C CG   . PRO A 1 151 ? 41.234 -5.376  -5.953  1.00   6.30  ? 177  PRO A CG   1 
ATOM   2328 C CD   . PRO A 1 151 ? 41.315 -4.507  -4.727  1.00   5.67  ? 177  PRO A CD   1 
ATOM   2329 H HA   . PRO A 1 151 ? 38.656 -6.126  -4.235  1.00   6.24  ? 177  PRO A HA   1 
ATOM   2330 H HB2  . PRO A 1 151 ? 39.725 -6.708  -6.461  1.00   7.62  ? 177  PRO A HB2  1 
ATOM   2331 H HB3  . PRO A 1 151 ? 39.181 -5.220  -6.226  1.00   7.62  ? 177  PRO A HB3  1 
ATOM   2332 H HG2  . PRO A 1 151 ? 41.859 -6.115  -5.895  1.00   7.56  ? 177  PRO A HG2  1 
ATOM   2333 H HG3  . PRO A 1 151 ? 41.384 -4.855  -6.757  1.00   7.56  ? 177  PRO A HG3  1 
ATOM   2334 H HD2  . PRO A 1 151 ? 42.215 -4.511  -4.365  1.00   6.81  ? 177  PRO A HD2  1 
ATOM   2335 H HD3  . PRO A 1 151 ? 41.013 -3.607  -4.927  1.00   6.81  ? 177  PRO A HD3  1 
ATOM   2336 N N    . ARG A 1 152 ? 41.274 -7.750  -3.566  1.00   5.22  ? 178  ARG A N    1 
ATOM   2337 C CA   . ARG A 1 152 ? 41.808 -9.092  -3.339  1.00   5.66  ? 178  ARG A CA   1 
ATOM   2338 C C    . ARG A 1 152 ? 40.936 -9.885  -2.385  1.00   4.90  ? 178  ARG A C    1 
ATOM   2339 O O    . ARG A 1 152 ? 40.485 -9.364  -1.376  1.00   4.99  ? 178  ARG A O    1 
ATOM   2340 C CB   . ARG A 1 152 ? 43.224 -9.005  -2.783  1.00   6.32  ? 178  ARG A CB   1 
ATOM   2341 C CG   . ARG A 1 152 ? 44.229 -8.453  -3.805  1.00   6.06  ? 178  ARG A CG   1 
ATOM   2342 C CD   . ARG A 1 152 ? 45.621 -8.297  -3.236  1.00   6.55  ? 178  ARG A CD   1 
ATOM   2343 N NE   . ARG A 1 152 ? 45.627 -7.303  -2.174  1.00   6.75  ? 178  ARG A NE   1 
ATOM   2344 C CZ   . ARG A 1 152 ? 46.651 -7.081  -1.364  1.00   6.98  ? 178  ARG A CZ   1 
ATOM   2345 N NH1  . ARG A 1 152 ? 47.772 -7.778  -1.479  1.00   8.25  ? 178  ARG A NH1  1 
ATOM   2346 N NH2  . ARG A 1 152 ? 46.572 -6.162  -0.427  1.00   8.06  ? 178  ARG A NH2  1 
ATOM   2347 H H    . ARG A 1 152 ? 41.778 -7.104  -3.304  1.00   6.26  ? 178  ARG A H    1 
ATOM   2348 H HA   . ARG A 1 152 ? 41.843 -9.567  -4.184  1.00   6.79  ? 178  ARG A HA   1 
ATOM   2349 H HB2  . ARG A 1 152 ? 43.226 -8.415  -2.013  1.00   7.59  ? 178  ARG A HB2  1 
ATOM   2350 H HB3  . ARG A 1 152 ? 43.517 -9.892  -2.523  1.00   7.59  ? 178  ARG A HB3  1 
ATOM   2351 H HG2  . ARG A 1 152 ? 44.280 -9.063  -4.557  1.00   7.27  ? 178  ARG A HG2  1 
ATOM   2352 H HG3  . ARG A 1 152 ? 43.928 -7.581  -4.104  1.00   7.27  ? 178  ARG A HG3  1 
ATOM   2353 H HD2  . ARG A 1 152 ? 45.917 -9.143  -2.866  1.00   7.86  ? 178  ARG A HD2  1 
ATOM   2354 H HD3  . ARG A 1 152 ? 46.225 -8.003  -3.935  1.00   7.86  ? 178  ARG A HD3  1 
ATOM   2355 H HE   . ARG A 1 152 ? 44.918 -6.828  -2.065  1.00   8.10  ? 178  ARG A HE   1 
ATOM   2356 H HH11 . ARG A 1 152 ? 47.842 -8.383  -2.086  1.00   9.90  ? 178  ARG A HH11 1 
ATOM   2357 H HH12 . ARG A 1 152 ? 48.430 -7.625  -0.947  1.00   9.90  ? 178  ARG A HH12 1 
ATOM   2358 H HH21 . ARG A 1 152 ? 45.852 -5.699  -0.337  1.00   9.68  ? 178  ARG A HH21 1 
ATOM   2359 H HH22 . ARG A 1 152 ? 47.240 -6.022  0.096   1.00   9.68  ? 178  ARG A HH22 1 
ATOM   2360 N N    . ASP A 1 153 ? 40.697 -11.155 -2.708  1.00   4.67  ? 179  ASP A N    1 
ATOM   2361 C CA   . ASP A 1 153 ? 40.027 -12.056 -1.769  1.00   4.63  ? 179  ASP A CA   1 
ATOM   2362 C C    . ASP A 1 153 ? 38.635 -11.542 -1.415  1.00   4.45  ? 179  ASP A C    1 
ATOM   2363 O O    . ASP A 1 153 ? 38.192 -11.647 -0.279  1.00   4.97  ? 179  ASP A O    1 
ATOM   2364 C CB   . ASP A 1 153 ? 40.896 -12.278 -0.527  1.00   4.70  ? 179  ASP A CB   1 
ATOM   2365 C CG   . ASP A 1 153 ? 42.292 -12.669 -0.883  1.00   5.14  ? 179  ASP A CG   1 
ATOM   2366 O OD1  . ASP A 1 153 ? 42.463 -13.749 -1.485  1.00   5.71  ? 179  ASP A OD1  1 
ATOM   2367 O OD2  . ASP A 1 153 ? 43.218 -11.878 -0.595  1.00   6.54  ? 179  ASP A OD2  1 
ATOM   2368 H H    . ASP A 1 153 ? 40.911 -11.518 -3.458  1.00   5.61  ? 179  ASP A H    1 
ATOM   2369 H HA   . ASP A 1 153 ? 39.915 -12.917 -2.201  1.00   5.56  ? 179  ASP A HA   1 
ATOM   2370 H HB2  . ASP A 1 153 ? 40.933 -11.456 -0.013  1.00   5.64  ? 179  ASP A HB2  1 
ATOM   2371 H HB3  . ASP A 1 153 ? 40.510 -12.989 0.008   1.00   5.64  ? 179  ASP A HB3  1 
ATOM   2372 N N    . THR A 1 154 ? 37.907 -11.051 -2.404  1.00   4.54  ? 180  THR A N    1 
ATOM   2373 C CA   . THR A 1 154 ? 36.573 -10.510 -2.225  1.00   4.95  ? 180  THR A CA   1 
ATOM   2374 C C    . THR A 1 154 ? 35.537 -11.260 -3.048  1.00   4.66  ? 180  THR A C    1 
ATOM   2375 O O    . THR A 1 154 ? 35.839 -11.954 -4.023  1.00   5.04  ? 180  THR A O    1 
ATOM   2376 C CB   . THR A 1 154 ? 36.487 -9.008  -2.636  1.00   5.23  ? 180  THR A CB   1 
ATOM   2377 O OG1  . THR A 1 154 ? 36.784 -8.857  -4.027  1.00   5.82  ? 180  THR A OG1  1 
ATOM   2378 C CG2  . THR A 1 154 ? 37.357 -8.117  -1.801  1.00   5.34  ? 180  THR A CG2  1 
ATOM   2379 H H    . THR A 1 154 ? 38.176 -11.020 -3.220  1.00   5.45  ? 180  THR A H    1 
ATOM   2380 H HA   . THR A 1 154 ? 36.326 -10.582 -1.289  1.00   5.93  ? 180  THR A HA   1 
ATOM   2381 H HB   . THR A 1 154 ? 35.573 -8.715  -2.495  1.00   6.28  ? 180  THR A HB   1 
ATOM   2382 H HG1  . THR A 1 154 ? 37.560 -9.137  -4.188  1.00   6.99  ? 180  THR A HG1  1 
ATOM   2383 H HG21 . THR A 1 154 ? 38.285 -8.387  -1.886  1.00   6.41  ? 180  THR A HG21 1 
ATOM   2384 H HG22 . THR A 1 154 ? 37.269 -7.197  -2.095  1.00   6.41  ? 180  THR A HG22 1 
ATOM   2385 H HG23 . THR A 1 154 ? 37.095 -8.177  -0.869  1.00   6.41  ? 180  THR A HG23 1 
ATOM   2386 N N    . THR A 1 155 ? 34.281 -11.058 -2.671  1.00   5.06  ? 181  THR A N    1 
ATOM   2387 C CA   . THR A 1 155 ? 33.135 -11.391 -3.494  1.00   5.01  ? 181  THR A CA   1 
ATOM   2388 C C    . THR A 1 155 ? 31.982 -10.481 -3.063  1.00   5.47  ? 181  THR A C    1 
ATOM   2389 O O    . THR A 1 155 ? 32.166 -9.593  -2.222  1.00   6.32  ? 181  THR A O    1 
ATOM   2390 C CB   . THR A 1 155 ? 32.773 -12.888 -3.386  1.00   4.79  ? 181  THR A CB   1 
ATOM   2391 O OG1  . THR A 1 155 ? 31.927 -13.164 -4.507  1.00   5.15  ? 181  THR A OG1  1 
ATOM   2392 C CG2  . THR A 1 155 ? 32.127 -13.229 -2.061  1.00   4.76  ? 181  THR A CG2  1 
ATOM   2393 H H    . THR A 1 155 ? 34.063 -10.715 -1.913  1.00   6.07  ? 181  THR A H    1 
ATOM   2394 H HA   . THR A 1 155 ? 33.342 -11.198 -4.422  1.00   6.01  ? 181  THR A HA   1 
ATOM   2395 H HB   . THR A 1 155 ? 33.584 -13.414 -3.466  1.00   5.75  ? 181  THR A HB   1 
ATOM   2396 H HG1  . THR A 1 155 ? 31.696 -13.972 -4.500  1.00   6.18  ? 181  THR A HG1  1 
ATOM   2397 H HG21 . THR A 1 155 ? 31.309 -12.718 -1.950  1.00   5.71  ? 181  THR A HG21 1 
ATOM   2398 H HG22 . THR A 1 155 ? 31.914 -14.175 -2.030  1.00   5.71  ? 181  THR A HG22 1 
ATOM   2399 H HG23 . THR A 1 155 ? 32.732 -13.017 -1.333  1.00   5.71  ? 181  THR A HG23 1 
ATOM   2400 N N    . THR A 1 156 ? 30.805 -10.694 -3.643  1.00   5.44  ? 182  THR A N    1 
ATOM   2401 C CA   . THR A 1 156 ? 29.615 -9.964  -3.220  1.00   5.94  ? 182  THR A CA   1 
ATOM   2402 C C    . THR A 1 156 ? 28.681 -10.905 -2.458  1.00   5.48  ? 182  THR A C    1 
ATOM   2403 O O    . THR A 1 156 ? 28.729 -12.131 -2.630  1.00   5.71  ? 182  THR A O    1 
ATOM   2404 C CB   . THR A 1 156 ? 28.848 -9.374  -4.396  1.00   6.99  ? 182  THR A CB   1 
ATOM   2405 O OG1  . THR A 1 156 ? 28.305 -10.468 -5.135  1.00   7.59  ? 182  THR A OG1  1 
ATOM   2406 C CG2  . THR A 1 156 ? 29.719 -8.484  -5.247  1.00   7.87  ? 182  THR A CG2  1 
ATOM   2407 H H    . THR A 1 156 ? 30.670 -11.254 -4.282  1.00   6.53  ? 182  THR A H    1 
ATOM   2408 H HA   . THR A 1 156 ? 29.874 -9.241  -2.628  1.00   7.13  ? 182  THR A HA   1 
ATOM   2409 H HB   . THR A 1 156 ? 28.118 -8.834  -4.054  1.00   8.39  ? 182  THR A HB   1 
ATOM   2410 H HG1  . THR A 1 156 ? 27.872 -10.182 -5.796  1.00   9.11  ? 182  THR A HG1  1 
ATOM   2411 H HG21 . THR A 1 156 ? 30.466 -8.992  -5.602  1.00   9.45  ? 182  THR A HG21 1 
ATOM   2412 H HG22 . THR A 1 156 ? 29.204 -8.124  -5.986  1.00   9.45  ? 182  THR A HG22 1 
ATOM   2413 H HG23 . THR A 1 156 ? 30.063 -7.749  -4.715  1.00   9.45  ? 182  THR A HG23 1 
ATOM   2414 N N    . PRO A 1 157 ? 27.790 -10.350 -1.620  1.00   5.47  ? 183  PRO A N    1 
ATOM   2415 C CA   . PRO A 1 157 ? 26.862 -11.242 -0.900  1.00   5.09  ? 183  PRO A CA   1 
ATOM   2416 C C    . PRO A 1 157 ? 26.015 -12.076 -1.847  1.00   5.84  ? 183  PRO A C    1 
ATOM   2417 O O    . PRO A 1 157 ? 25.827 -13.273 -1.595  1.00   5.99  ? 183  PRO A O    1 
ATOM   2418 C CB   . PRO A 1 157 ? 26.041 -10.286 -0.060  1.00   5.84  ? 183  PRO A CB   1 
ATOM   2419 C CG   . PRO A 1 157 ? 27.019 -9.117  0.205   1.00   5.84  ? 183  PRO A CG   1 
ATOM   2420 C CD   . PRO A 1 157 ? 27.781 -8.973  -1.091  1.00   5.87  ? 183  PRO A CD   1 
ATOM   2421 H HA   . PRO A 1 157 ? 27.358 -11.834 -0.314  1.00   6.10  ? 183  PRO A HA   1 
ATOM   2422 H HB2  . PRO A 1 157 ? 25.266 -9.985  -0.560  1.00   7.00  ? 183  PRO A HB2  1 
ATOM   2423 H HB3  . PRO A 1 157 ? 25.777 -10.714 0.770   1.00   7.00  ? 183  PRO A HB3  1 
ATOM   2424 H HG2  . PRO A 1 157 ? 26.521 -8.309  0.404   1.00   7.01  ? 183  PRO A HG2  1 
ATOM   2425 H HG3  . PRO A 1 157 ? 27.616 -9.345  0.934   1.00   7.01  ? 183  PRO A HG3  1 
ATOM   2426 H HD2  . PRO A 1 157 ? 27.311 -8.379  -1.697  1.00   7.04  ? 183  PRO A HD2  1 
ATOM   2427 H HD3  . PRO A 1 157 ? 28.686 -8.669  -0.921  1.00   7.04  ? 183  PRO A HD3  1 
ATOM   2428 N N    . LEU A 1 158 ? 25.506 -11.479 -2.915  1.00   6.13  ? 184  LEU A N    1 
ATOM   2429 C CA   . LEU A 1 158 ? 24.668 -12.231 -3.846  1.00   6.98  ? 184  LEU A CA   1 
ATOM   2430 C C    . LEU A 1 158 ? 25.453 -13.325 -4.560  1.00   6.54  ? 184  LEU A C    1 
ATOM   2431 O O    . LEU A 1 158 ? 24.982 -14.450 -4.682  1.00   6.38  ? 184  LEU A O    1 
ATOM   2432 C CB   . LEU A 1 158 ? 23.986 -11.302 -4.850  1.00   9.09  ? 184  LEU A CB   1 
ATOM   2433 C CG   . LEU A 1 158 ? 23.121 -12.034 -5.882  1.00   10.82 ? 184  LEU A CG   1 
ATOM   2434 C CD1  . LEU A 1 158 ? 22.033 -12.835 -5.168  1.00   11.40 ? 184  LEU A CD1  1 
ATOM   2435 C CD2  . LEU A 1 158 ? 22.512 -11.022 -6.837  1.00   13.20 ? 184  LEU A CD2  1 
ATOM   2436 H H    . LEU A 1 158 ? 25.627 -10.654 -3.125  1.00   7.35  ? 184  LEU A H    1 
ATOM   2437 H HA   . LEU A 1 158 ? 23.967 -12.667 -3.337  1.00   8.37  ? 184  LEU A HA   1 
ATOM   2438 H HB2  . LEU A 1 158 ? 23.413 -10.686 -4.367  1.00   10.91 ? 184  LEU A HB2  1 
ATOM   2439 H HB3  . LEU A 1 158 ? 24.668 -10.808 -5.332  1.00   10.91 ? 184  LEU A HB3  1 
ATOM   2440 H HG   . LEU A 1 158 ? 23.672 -12.648 -6.392  1.00   12.99 ? 184  LEU A HG   1 
ATOM   2441 H HD11 . LEU A 1 158 ? 21.481 -12.226 -4.653  1.00   13.68 ? 184  LEU A HD11 1 
ATOM   2442 H HD12 . LEU A 1 158 ? 21.493 -13.294 -5.830  1.00   13.68 ? 184  LEU A HD12 1 
ATOM   2443 H HD13 . LEU A 1 158 ? 22.453 -13.481 -4.578  1.00   13.68 ? 184  LEU A HD13 1 
ATOM   2444 H HD21 . LEU A 1 158 ? 23.226 -10.543 -7.287  1.00   15.84 ? 184  LEU A HD21 1 
ATOM   2445 H HD22 . LEU A 1 158 ? 21.966 -11.490 -7.487  1.00   15.84 ? 184  LEU A HD22 1 
ATOM   2446 H HD23 . LEU A 1 158 ? 21.965 -10.401 -6.331  1.00   15.84 ? 184  LEU A HD23 1 
ATOM   2447 N N    . ALA A 1 159 ? 26.641 -13.007 -5.045  1.00   6.17  ? 185  ALA A N    1 
ATOM   2448 C CA   . ALA A 1 159 ? 27.411 -14.030 -5.724  1.00   5.92  ? 185  ALA A CA   1 
ATOM   2449 C C    . ALA A 1 159 ? 27.683 -15.201 -4.798  1.00   5.44  ? 185  ALA A C    1 
ATOM   2450 O O    . ALA A 1 159 ? 27.595 -16.365 -5.198  1.00   5.61  ? 185  ALA A O    1 
ATOM   2451 C CB   . ALA A 1 159 ? 28.711 -13.479 -6.259  1.00   6.24  ? 185  ALA A CB   1 
ATOM   2452 H H    . ALA A 1 159 ? 27.014 -12.233 -4.997  1.00   7.41  ? 185  ALA A H    1 
ATOM   2453 H HA   . ALA A 1 159 ? 26.897 -14.361 -6.478  1.00   7.10  ? 185  ALA A HA   1 
ATOM   2454 H HB1  . ALA A 1 159 ? 29.235 -13.135 -5.519  1.00   7.49  ? 185  ALA A HB1  1 
ATOM   2455 H HB2  . ALA A 1 159 ? 29.195 -14.191 -6.705  1.00   7.49  ? 185  ALA A HB2  1 
ATOM   2456 H HB3  . ALA A 1 159 ? 28.516 -12.766 -6.887  1.00   7.49  ? 185  ALA A HB3  1 
ATOM   2457 N N    . MET A 1 160 ? 28.039 -14.914 -3.561  1.00   4.97  ? 186  MET A N    1 
ATOM   2458 C CA   A MET A 1 160 ? 28.376 -15.973 -2.627  0.61   4.57  ? 186  MET A CA   1 
ATOM   2459 C CA   B MET A 1 160 ? 28.379 -15.981 -2.631  0.39   4.78  ? 186  MET A CA   1 
ATOM   2460 C C    . MET A 1 160 ? 27.133 -16.763 -2.229  1.00   4.56  ? 186  MET A C    1 
ATOM   2461 O O    . MET A 1 160 ? 27.204 -17.971 -2.034  1.00   4.49  ? 186  MET A O    1 
ATOM   2462 C CB   A MET A 1 160 ? 29.096 -15.411 -1.411  0.61   5.00  ? 186  MET A CB   1 
ATOM   2463 C CB   B MET A 1 160 ? 29.110 -15.440 -1.408  0.39   5.36  ? 186  MET A CB   1 
ATOM   2464 C CG   A MET A 1 160 ? 29.673 -16.490 -0.506  0.61   4.54  ? 186  MET A CG   1 
ATOM   2465 C CG   B MET A 1 160 ? 29.780 -16.529 -0.564  0.39   5.46  ? 186  MET A CG   1 
ATOM   2466 S SD   A MET A 1 160 ? 30.874 -17.578 -1.325  0.61   5.05  ? 186  MET A SD   1 
ATOM   2467 S SD   B MET A 1 160 ? 31.069 -17.459 -1.447  0.39   5.70  ? 186  MET A SD   1 
ATOM   2468 C CE   A MET A 1 160 ? 32.391 -17.084 -0.485  0.61   5.47  ? 186  MET A CE   1 
ATOM   2469 C CE   B MET A 1 160 ? 30.291 -19.053 -1.686  0.39   5.77  ? 186  MET A CE   1 
ATOM   2470 H H    A MET A 1 160 ? 28.093 -14.120 -3.236  0.61   5.96  ? 186  MET A H    1 
ATOM   2471 H H    B MET A 1 160 ? 28.092 -14.121 -3.233  0.39   5.96  ? 186  MET A H    1 
ATOM   2472 H HA   A MET A 1 160 ? 28.991 -16.580 -3.068  0.61   5.49  ? 186  MET A HA   1 
ATOM   2473 H HA   B MET A 1 160 ? 28.985 -16.590 -3.081  0.39   5.74  ? 186  MET A HA   1 
ATOM   2474 H HB2  A MET A 1 160 ? 29.827 -14.849 -1.711  0.61   6.00  ? 186  MET A HB2  1 
ATOM   2475 H HB2  B MET A 1 160 ? 29.801 -14.826 -1.702  0.39   6.43  ? 186  MET A HB2  1 
ATOM   2476 H HB3  A MET A 1 160 ? 28.468 -14.888 -0.889  0.61   6.00  ? 186  MET A HB3  1 
ATOM   2477 H HB3  B MET A 1 160 ? 28.474 -14.975 -0.843  0.39   6.43  ? 186  MET A HB3  1 
ATOM   2478 H HG2  A MET A 1 160 ? 30.122 -16.064 0.240   0.61   5.45  ? 186  MET A HG2  1 
ATOM   2479 H HG2  B MET A 1 160 ? 30.191 -16.115 0.211   0.39   6.55  ? 186  MET A HG2  1 
ATOM   2480 H HG3  A MET A 1 160 ? 28.947 -17.045 -0.180  0.61   5.45  ? 186  MET A HG3  1 
ATOM   2481 H HG3  B MET A 1 160 ? 29.103 -17.162 -0.276  0.39   6.55  ? 186  MET A HG3  1 
ATOM   2482 H HE1  A MET A 1 160 ? 32.294 -17.250 0.465   0.61   6.57  ? 186  MET A HE1  1 
ATOM   2483 H HE1  B MET A 1 160 ? 29.482 -18.934 -2.208  0.39   6.92  ? 186  MET A HE1  1 
ATOM   2484 H HE2  A MET A 1 160 ? 33.130 -17.603 -0.839  0.61   6.57  ? 186  MET A HE2  1 
ATOM   2485 H HE2  B MET A 1 160 ? 30.906 -19.637 -2.158  0.39   6.92  ? 186  MET A HE2  1 
ATOM   2486 H HE3  A MET A 1 160 ? 32.545 -16.139 -0.642  0.61   6.57  ? 186  MET A HE3  1 
ATOM   2487 H HE3  B MET A 1 160 ? 30.074 -19.431 -0.820  0.39   6.92  ? 186  MET A HE3  1 
ATOM   2488 N N    . ALA A 1 161 ? 25.991 -16.100 -2.116  1.00   4.56  ? 187  ALA A N    1 
ATOM   2489 C CA   . ALA A 1 161 ? 24.765 -16.812 -1.802  1.00   5.04  ? 187  ALA A CA   1 
ATOM   2490 C C    . ALA A 1 161 ? 24.400 -17.751 -2.941  1.00   4.69  ? 187  ALA A C    1 
ATOM   2491 O O    . ALA A 1 161 ? 24.029 -18.894 -2.712  1.00   5.43  ? 187  ALA A O    1 
ATOM   2492 C CB   . ALA A 1 161 ? 23.638 -15.847 -1.477  1.00   5.71  ? 187  ALA A CB   1 
ATOM   2493 H H    . ALA A 1 161 ? 25.900 -15.250 -2.214  1.00   5.47  ? 187  ALA A H    1 
ATOM   2494 H HA   . ALA A 1 161 ? 24.918 -17.357 -1.014  1.00   6.05  ? 187  ALA A HA   1 
ATOM   2495 H HB1  . ALA A 1 161 ? 23.481 -15.275 -2.244  1.00   6.86  ? 187  ALA A HB1  1 
ATOM   2496 H HB2  . ALA A 1 161 ? 22.837 -16.354 -1.273  1.00   6.86  ? 187  ALA A HB2  1 
ATOM   2497 H HB3  . ALA A 1 161 ? 23.894 -15.310 -0.710  1.00   6.86  ? 187  ALA A HB3  1 
ATOM   2498 N N    . GLN A 1 162 ? 24.475 -17.256 -4.165  1.00   5.63  ? 188  GLN A N    1 
ATOM   2499 C CA   . GLN A 1 162 ? 24.161 -18.091 -5.310  1.00   6.17  ? 188  GLN A CA   1 
ATOM   2500 C C    . GLN A 1 162 ? 25.085 -19.289 -5.371  1.00   5.89  ? 188  GLN A C    1 
ATOM   2501 O O    . GLN A 1 162 ? 24.658 -20.411 -5.591  1.00   5.79  ? 188  GLN A O    1 
ATOM   2502 C CB   . GLN A 1 162 ? 24.292 -17.268 -6.587  1.00   7.95  ? 188  GLN A CB   1 
ATOM   2503 C CG   . GLN A 1 162 ? 23.259 -16.197 -6.755  1.00   11.20 ? 188  GLN A CG   1 
ATOM   2504 C CD   . GLN A 1 162 ? 23.553 -15.227 -7.896  1.00   15.54 ? 188  GLN A CD   1 
ATOM   2505 O OE1  . GLN A 1 162 ? 24.715 -14.978 -8.281  1.00   18.34 ? 188  GLN A OE1  1 
ATOM   2506 N NE2  . GLN A 1 162 ? 22.494 -14.647 -8.425  1.00   16.78 ? 188  GLN A NE2  1 
ATOM   2507 H H    . GLN A 1 162 ? 24.703 -16.450 -4.359  1.00   6.75  ? 188  GLN A H    1 
ATOM   2508 H HA   . GLN A 1 162 ? 23.247 -18.409 -5.239  1.00   7.41  ? 188  GLN A HA   1 
ATOM   2509 H HB2  . GLN A 1 162 ? 25.162 -16.839 -6.590  1.00   9.54  ? 188  GLN A HB2  1 
ATOM   2510 H HB3  . GLN A 1 162 ? 24.222 -17.865 -7.348  1.00   9.54  ? 188  GLN A HB3  1 
ATOM   2511 H HG2  . GLN A 1 162 ? 22.403 -16.615 -6.935  1.00   13.44 ? 188  GLN A HG2  1 
ATOM   2512 H HG3  . GLN A 1 162 ? 23.207 -15.682 -5.935  1.00   13.44 ? 188  GLN A HG3  1 
ATOM   2513 H HE21 . GLN A 1 162 ? 21.709 -14.827 -8.122  1.00   20.13 ? 188  GLN A HE21 1 
ATOM   2514 H HE22 . GLN A 1 162 ? 22.587 -14.089 -9.072  1.00   20.13 ? 188  GLN A HE22 1 
ATOM   2515 N N    . THR A 1 163 ? 26.370 -19.053 -5.159  1.00   5.71  ? 189  THR A N    1 
ATOM   2516 C CA   . THR A 1 163 ? 27.323 -20.144 -5.255  1.00   5.64  ? 189  THR A CA   1 
ATOM   2517 C C    . THR A 1 163 ? 27.194 -21.109 -4.090  1.00   4.78  ? 189  THR A C    1 
ATOM   2518 O O    . THR A 1 163 ? 27.285 -22.321 -4.293  1.00   5.21  ? 189  THR A O    1 
ATOM   2519 C CB   . THR A 1 163 ? 28.735 -19.633 -5.424  1.00   6.53  ? 189  THR A CB   1 
ATOM   2520 O OG1  . THR A 1 163 ? 28.754 -18.871 -6.604  1.00   6.74  ? 189  THR A OG1  1 
ATOM   2521 C CG2  . THR A 1 163 ? 29.700 -20.765 -5.571  1.00   7.88  ? 189  THR A CG2  1 
ATOM   2522 H H    . THR A 1 163 ? 26.709 -18.288 -4.962  1.00   6.85  ? 189  THR A H    1 
ATOM   2523 H HA   . THR A 1 163 ? 27.112 -20.647 -6.057  1.00   6.77  ? 189  THR A HA   1 
ATOM   2524 H HB   . THR A 1 163 ? 28.992 -19.087 -4.665  1.00   7.84  ? 189  THR A HB   1 
ATOM   2525 H HG1  . THR A 1 163 ? 29.525 -18.566 -6.736  1.00   8.09  ? 189  THR A HG1  1 
ATOM   2526 H HG21 . THR A 1 163 ? 29.470 -21.297 -6.350  1.00   9.45  ? 189  THR A HG21 1 
ATOM   2527 H HG22 . THR A 1 163 ? 30.600 -20.421 -5.679  1.00   9.45  ? 189  THR A HG22 1 
ATOM   2528 H HG23 . THR A 1 163 ? 29.670 -21.330 -4.784  1.00   9.45  ? 189  THR A HG23 1 
ATOM   2529 N N    . LEU A 1 164 ? 26.922 -20.609 -2.892  1.00   4.60  ? 190  LEU A N    1 
ATOM   2530 C CA   . LEU A 1 164 ? 26.713 -21.503 -1.766  1.00   4.48  ? 190  LEU A CA   1 
ATOM   2531 C C    . LEU A 1 164 ? 25.489 -22.364 -2.012  1.00   4.48  ? 190  LEU A C    1 
ATOM   2532 O O    . LEU A 1 164 ? 25.470 -23.547 -1.674  1.00   4.59  ? 190  LEU A O    1 
ATOM   2533 C CB   . LEU A 1 164 ? 26.591 -20.728 -0.468  1.00   4.41  ? 190  LEU A CB   1 
ATOM   2534 C CG   . LEU A 1 164 ? 26.545 -21.598 0.781   1.00   4.74  ? 190  LEU A CG   1 
ATOM   2535 C CD1  . LEU A 1 164 ? 27.806 -22.440 0.980   1.00   5.04  ? 190  LEU A CD1  1 
ATOM   2536 C CD2  . LEU A 1 164 ? 26.290 -20.747 2.022   1.00   4.68  ? 190  LEU A CD2  1 
ATOM   2537 H H    . LEU A 1 164 ? 26.854 -19.772 -2.708  1.00   5.52  ? 190  LEU A H    1 
ATOM   2538 H HA   . LEU A 1 164 ? 27.480 -22.092 -1.688  1.00   5.38  ? 190  LEU A HA   1 
ATOM   2539 H HB2  . LEU A 1 164 ? 27.354 -20.136 -0.387  1.00   5.29  ? 190  LEU A HB2  1 
ATOM   2540 H HB3  . LEU A 1 164 ? 25.773 -20.207 -0.494  1.00   5.29  ? 190  LEU A HB3  1 
ATOM   2541 H HG   . LEU A 1 164 ? 25.799 -22.213 0.696   1.00   5.68  ? 190  LEU A HG   1 
ATOM   2542 H HD11 . LEU A 1 164 ? 28.570 -21.849 1.058   1.00   6.04  ? 190  LEU A HD11 1 
ATOM   2543 H HD12 . LEU A 1 164 ? 27.709 -22.967 1.789   1.00   6.04  ? 190  LEU A HD12 1 
ATOM   2544 H HD13 . LEU A 1 164 ? 27.917 -23.026 0.215   1.00   6.04  ? 190  LEU A HD13 1 
ATOM   2545 H HD21 . LEU A 1 164 ? 25.440 -20.290 1.922   1.00   5.62  ? 190  LEU A HD21 1 
ATOM   2546 H HD22 . LEU A 1 164 ? 26.266 -21.324 2.801   1.00   5.62  ? 190  LEU A HD22 1 
ATOM   2547 H HD23 . LEU A 1 164 ? 27.006 -20.099 2.112   1.00   5.62  ? 190  LEU A HD23 1 
ATOM   2548 N N    . LYS A 1 165 ? 24.430 -21.796 -2.559  1.00   4.36  ? 191  LYS A N    1 
ATOM   2549 C CA   A LYS A 1 165 ? 23.245 -22.565 -2.937  0.51   4.94  ? 191  LYS A CA   1 
ATOM   2550 C CA   B LYS A 1 165 ? 23.253 -22.574 -2.915  0.49   4.81  ? 191  LYS A CA   1 
ATOM   2551 C C    . LYS A 1 165 ? 23.617 -23.650 -3.935  1.00   4.56  ? 191  LYS A C    1 
ATOM   2552 O O    . LYS A 1 165 ? 23.269 -24.812 -3.773  1.00   5.13  ? 191  LYS A O    1 
ATOM   2553 C CB   A LYS A 1 165 ? 22.176 -21.641 -3.520  0.51   5.89  ? 191  LYS A CB   1 
ATOM   2554 C CB   B LYS A 1 165 ? 22.174 -21.645 -3.445  0.49   5.31  ? 191  LYS A CB   1 
ATOM   2555 C CG   A LYS A 1 165 ? 20.910 -22.381 -3.994  0.51   8.17  ? 191  LYS A CG   1 
ATOM   2556 C CG   B LYS A 1 165 ? 20.830 -22.340 -3.684  0.49   7.42  ? 191  LYS A CG   1 
ATOM   2557 C CD   A LYS A 1 165 ? 19.875 -21.462 -4.587  0.51   11.66 ? 191  LYS A CD   1 
ATOM   2558 C CD   B LYS A 1 165 ? 19.851 -21.439 -4.366  0.49   11.00 ? 191  LYS A CD   1 
ATOM   2559 C CE   A LYS A 1 165 ? 18.805 -22.261 -5.315  0.51   14.09 ? 191  LYS A CE   1 
ATOM   2560 C CE   B LYS A 1 165 ? 20.218 -21.263 -5.829  0.49   13.86 ? 191  LYS A CE   1 
ATOM   2561 N NZ   A LYS A 1 165 ? 18.673 -21.887 -6.748  0.51   15.79 ? 191  LYS A NZ   1 
ATOM   2562 N NZ   B LYS A 1 165 ? 19.514 -22.250 -6.668  0.49   14.44 ? 191  LYS A NZ   1 
ATOM   2563 H H    A LYS A 1 165 ? 24.367 -20.955 -2.726  0.51   5.23  ? 191  LYS A H    1 
ATOM   2564 H H    B LYS A 1 165 ? 24.365 -20.957 -2.736  0.49   5.23  ? 191  LYS A H    1 
ATOM   2565 H HA   A LYS A 1 165 ? 22.877 -22.993 -2.148  0.51   5.93  ? 191  LYS A HA   1 
ATOM   2566 H HA   B LYS A 1 165 ? 22.910 -23.014 -2.121  0.49   5.77  ? 191  LYS A HA   1 
ATOM   2567 H HB2  A LYS A 1 165 ? 21.910 -21.002 -2.841  0.51   7.07  ? 191  LYS A HB2  1 
ATOM   2568 H HB2  B LYS A 1 165 ? 22.031 -20.933 -2.802  0.49   6.37  ? 191  LYS A HB2  1 
ATOM   2569 H HB3  A LYS A 1 165 ? 22.549 -21.173 -4.284  0.51   7.07  ? 191  LYS A HB3  1 
ATOM   2570 H HB3  B LYS A 1 165 ? 22.470 -21.271 -4.290  0.49   6.37  ? 191  LYS A HB3  1 
ATOM   2571 H HG2  A LYS A 1 165 ? 21.159 -23.028 -4.672  0.51   9.81  ? 191  LYS A HG2  1 
ATOM   2572 H HG2  B LYS A 1 165 ? 20.968 -23.118 -4.247  0.49   8.90  ? 191  LYS A HG2  1 
ATOM   2573 H HG3  A LYS A 1 165 ? 20.509 -22.834 -3.236  0.51   9.81  ? 191  LYS A HG3  1 
ATOM   2574 H HG3  B LYS A 1 165 ? 20.452 -22.606 -2.831  0.49   8.90  ? 191  LYS A HG3  1 
ATOM   2575 H HD2  A LYS A 1 165 ? 19.449 -20.954 -3.878  0.51   13.99 ? 191  LYS A HD2  1 
ATOM   2576 H HD2  B LYS A 1 165 ? 18.964 -21.829 -4.317  0.49   13.20 ? 191  LYS A HD2  1 
ATOM   2577 H HD3  A LYS A 1 165 ? 20.299 -20.865 -5.223  0.51   13.99 ? 191  LYS A HD3  1 
ATOM   2578 H HD3  B LYS A 1 165 ? 19.862 -20.568 -3.940  0.49   13.20 ? 191  LYS A HD3  1 
ATOM   2579 H HE2  A LYS A 1 165 ? 19.032 -23.203 -5.271  0.51   16.91 ? 191  LYS A HE2  1 
ATOM   2580 H HE2  B LYS A 1 165 ? 19.960 -20.374 -6.121  0.49   16.63 ? 191  LYS A HE2  1 
ATOM   2581 H HE3  A LYS A 1 165 ? 17.949 -22.106 -4.885  0.51   16.91 ? 191  LYS A HE3  1 
ATOM   2582 H HE3  B LYS A 1 165 ? 21.173 -21.391 -5.940  0.49   16.63 ? 191  LYS A HE3  1 
ATOM   2583 H HZ1  A LYS A 1 165 ? 19.444 -22.027 -7.171  0.51   18.95 ? 191  LYS A HZ1  1 
ATOM   2584 H HZ1  B LYS A 1 165 ? 18.634 -22.150 -6.582  0.49   17.33 ? 191  LYS A HZ1  1 
ATOM   2585 H HZ2  A LYS A 1 165 ? 18.038 -22.377 -7.133  0.51   18.95 ? 191  LYS A HZ2  1 
ATOM   2586 H HZ2  B LYS A 1 165 ? 19.737 -22.137 -7.522  0.49   17.33 ? 191  LYS A HZ2  1 
ATOM   2587 H HZ3  A LYS A 1 165 ? 18.456 -21.026 -6.819  0.51   18.95 ? 191  LYS A HZ3  1 
ATOM   2588 H HZ3  B LYS A 1 165 ? 19.737 -23.075 -6.418  0.49   17.33 ? 191  LYS A HZ3  1 
ATOM   2589 N N    . ASN A 1 166 ? 24.326 -23.274 -4.995  1.00   4.75  ? 192  ASN A N    1 
ATOM   2590 C CA   A ASN A 1 166 ? 24.734 -24.266 -5.989  0.68   5.23  ? 192  ASN A CA   1 
ATOM   2591 C CA   B ASN A 1 166 ? 24.802 -24.191 -6.031  0.32   5.67  ? 192  ASN A CA   1 
ATOM   2592 C C    . ASN A 1 166 ? 25.579 -25.358 -5.393  1.00   4.82  ? 192  ASN A C    1 
ATOM   2593 O O    . ASN A 1 166 ? 25.388 -26.525 -5.731  1.00   5.43  ? 192  ASN A O    1 
ATOM   2594 C CB   A ASN A 1 166 ? 25.474 -23.594 -7.142  0.68   6.08  ? 192  ASN A CB   1 
ATOM   2595 C CB   B ASN A 1 166 ? 25.679 -23.365 -7.008  0.32   6.91  ? 192  ASN A CB   1 
ATOM   2596 C CG   A ASN A 1 166 ? 24.549 -22.874 -8.041  0.68   8.13  ? 192  ASN A CG   1 
ATOM   2597 C CG   B ASN A 1 166 ? 25.988 -24.081 -8.315  0.32   8.99  ? 192  ASN A CG   1 
ATOM   2598 O OD1  A ASN A 1 166 ? 23.414 -23.294 -8.229  0.68   11.14 ? 192  ASN A OD1  1 
ATOM   2599 O OD1  B ASN A 1 166 ? 25.562 -25.197 -8.531  0.32   9.63  ? 192  ASN A OD1  1 
ATOM   2600 N ND2  A ASN A 1 166 ? 25.013 -21.781 -8.613  0.68   8.54  ? 192  ASN A ND2  1 
ATOM   2601 N ND2  B ASN A 1 166 ? 26.757 -23.432 -9.187  0.32   10.43 ? 192  ASN A ND2  1 
ATOM   2602 H H    A ASN A 1 166 ? 24.580 -22.469 -5.161  0.68   5.70  ? 192  ASN A H    1 
ATOM   2603 H H    B ASN A 1 166 ? 24.554 -22.458 -5.142  0.32   5.70  ? 192  ASN A H    1 
ATOM   2604 H HA   A ASN A 1 166 ? 23.937 -24.680 -6.355  0.68   6.28  ? 192  ASN A HA   1 
ATOM   2605 H HA   B ASN A 1 166 ? 24.046 -24.552 -6.521  0.32   6.80  ? 192  ASN A HA   1 
ATOM   2606 H HB2  A ASN A 1 166 ? 26.109 -22.955 -6.785  0.68   7.30  ? 192  ASN A HB2  1 
ATOM   2607 H HB2  B ASN A 1 166 ? 25.214 -22.541 -7.224  0.32   8.30  ? 192  ASN A HB2  1 
ATOM   2608 H HB3  A ASN A 1 166 ? 25.936 -24.271 -7.662  0.68   7.30  ? 192  ASN A HB3  1 
ATOM   2609 H HB3  B ASN A 1 166 ? 26.523 -23.162 -6.575  0.32   8.30  ? 192  ASN A HB3  1 
ATOM   2610 H HD21 A ASN A 1 166 ? 25.818 -21.522 -8.456  0.68   10.24 ? 192  ASN A HD21 1 
ATOM   2611 H HD21 B ASN A 1 166 ? 27.052 -22.646 -8.998  0.32   12.52 ? 192  ASN A HD21 1 
ATOM   2612 H HD22 A ASN A 1 166 ? 24.511 -21.327 -9.144  0.68   10.24 ? 192  ASN A HD22 1 
ATOM   2613 H HD22 B ASN A 1 166 ? 26.958 -23.797 -9.939  0.32   12.52 ? 192  ASN A HD22 1 
ATOM   2614 N N    . LEU A 1 167 ? 26.469 -25.011 -4.479  1.00   4.28  ? 193  LEU A N    1 
ATOM   2615 C CA   . LEU A 1 167 ? 27.352 -25.978 -3.837  1.00   4.75  ? 193  LEU A CA   1 
ATOM   2616 C C    . LEU A 1 167 ? 26.633 -26.955 -2.937  1.00   4.96  ? 193  LEU A C    1 
ATOM   2617 O O    . LEU A 1 167 ? 26.965 -28.131 -2.916  1.00   5.70  ? 193  LEU A O    1 
ATOM   2618 C CB   . LEU A 1 167 ? 28.419 -25.261 -3.010  1.00   4.69  ? 193  LEU A CB   1 
ATOM   2619 C CG   . LEU A 1 167 ? 29.555 -24.634 -3.814  1.00   4.98  ? 193  LEU A CG   1 
ATOM   2620 C CD1  . LEU A 1 167 ? 30.363 -23.725 -2.909  1.00   5.77  ? 193  LEU A CD1  1 
ATOM   2621 C CD2  . LEU A 1 167 ? 30.445 -25.709 -4.398  1.00   5.41  ? 193  LEU A CD2  1 
ATOM   2622 H H    . LEU A 1 167 ? 26.585 -24.204 -4.205  1.00   5.14  ? 193  LEU A H    1 
ATOM   2623 H HA   . LEU A 1 167 ? 27.806 -26.489 -4.526  1.00   5.70  ? 193  LEU A HA   1 
ATOM   2624 H HB2  . LEU A 1 167 ? 27.991 -24.551 -2.506  1.00   5.63  ? 193  LEU A HB2  1 
ATOM   2625 H HB3  . LEU A 1 167 ? 28.814 -25.901 -2.397  1.00   5.63  ? 193  LEU A HB3  1 
ATOM   2626 H HG   . LEU A 1 167 ? 29.189 -24.105 -4.540  1.00   5.98  ? 193  LEU A HG   1 
ATOM   2627 H HD11 . LEU A 1 167 ? 30.727 -24.250 -2.178  1.00   6.93  ? 193  LEU A HD11 1 
ATOM   2628 H HD12 . LEU A 1 167 ? 31.084 -23.329 -3.422  1.00   6.93  ? 193  LEU A HD12 1 
ATOM   2629 H HD13 . LEU A 1 167 ? 29.783 -23.030 -2.561  1.00   6.93  ? 193  LEU A HD13 1 
ATOM   2630 H HD21 . LEU A 1 167 ? 29.915 -26.276 -4.981  1.00   6.50  ? 193  LEU A HD21 1 
ATOM   2631 H HD22 . LEU A 1 167 ? 31.158 -25.288 -4.904  1.00   6.50  ? 193  LEU A HD22 1 
ATOM   2632 H HD23 . LEU A 1 167 ? 30.819 -26.236 -3.674  1.00   6.50  ? 193  LEU A HD23 1 
ATOM   2633 N N    . THR A 1 168 ? 25.679 -26.464 -2.150  1.00   4.75  ? 194  THR A N    1 
ATOM   2634 C CA   . THR A 1 168 ? 25.106 -27.241 -1.058  1.00   4.89  ? 194  THR A CA   1 
ATOM   2635 C C    . THR A 1 168 ? 23.767 -27.883 -1.395  1.00   5.11  ? 194  THR A C    1 
ATOM   2636 O O    . THR A 1 168 ? 23.432 -28.911 -0.844  1.00   5.86  ? 194  THR A O    1 
ATOM   2637 C CB   . THR A 1 168 ? 24.907 -26.401 0.202   1.00   4.90  ? 194  THR A CB   1 
ATOM   2638 O OG1  . THR A 1 168 ? 24.022 -25.300 -0.074  1.00   5.56  ? 194  THR A OG1  1 
ATOM   2639 C CG2  . THR A 1 168 ? 26.245 -25.927 0.740   1.00   5.76  ? 194  THR A CG2  1 
ATOM   2640 H H    . THR A 1 168 ? 25.344 -25.676 -2.230  1.00   5.70  ? 194  THR A H    1 
ATOM   2641 H HA   . THR A 1 168 ? 25.723 -27.956 -0.836  1.00   5.87  ? 194  THR A HA   1 
ATOM   2642 H HB   . THR A 1 168 ? 24.500 -26.959 0.883   1.00   5.88  ? 194  THR A HB   1 
ATOM   2643 H HG1  . THR A 1 168 ? 24.348 -24.814 -0.677  1.00   6.67  ? 194  THR A HG1  1 
ATOM   2644 H HG21 . THR A 1 168 ? 26.697 -25.387 0.074   1.00   6.91  ? 194  THR A HG21 1 
ATOM   2645 H HG22 . THR A 1 168 ? 26.111 -25.395 1.540   1.00   6.91  ? 194  THR A HG22 1 
ATOM   2646 H HG23 . THR A 1 168 ? 26.803 -26.690 0.959   1.00   6.91  ? 194  THR A HG23 1 
ATOM   2647 N N    . LEU A 1 169 ? 23.009 -27.275 -2.295  1.00   4.89  ? 195  LEU A N    1 
ATOM   2648 C CA   . LEU A 1 169 ? 21.662 -27.697 -2.641  1.00   5.77  ? 195  LEU A CA   1 
ATOM   2649 C C    . LEU A 1 169 ? 21.489 -27.917 -4.118  1.00   7.47  ? 195  LEU A C    1 
ATOM   2650 O O    . LEU A 1 169 ? 20.473 -28.487 -4.538  1.00   10.80 ? 195  LEU A O    1 
ATOM   2651 C CB   . LEU A 1 169 ? 20.645 -26.646 -2.182  1.00   5.90  ? 195  LEU A CB   1 
ATOM   2652 C CG   . LEU A 1 169 ? 20.610 -26.409 -0.682  1.00   6.72  ? 195  LEU A CG   1 
ATOM   2653 C CD1  . LEU A 1 169 ? 19.837 -25.137 -0.438  1.00   6.90  ? 195  LEU A CD1  1 
ATOM   2654 C CD2  . LEU A 1 169 ? 19.999 -27.565 0.064   1.00   7.65  ? 195  LEU A CD2  1 
ATOM   2655 H H    . LEU A 1 169 ? 23.266 -26.585 -2.738  1.00   5.87  ? 195  LEU A H    1 
ATOM   2656 H HA   . LEU A 1 169 ? 21.463 -28.530 -2.185  1.00   6.92  ? 195  LEU A HA   1 
ATOM   2657 H HB2  . LEU A 1 169 ? 20.860 -25.801 -2.608  1.00   7.08  ? 195  LEU A HB2  1 
ATOM   2658 H HB3  . LEU A 1 169 ? 19.759 -26.933 -2.455  1.00   7.08  ? 195  LEU A HB3  1 
ATOM   2659 H HG   . LEU A 1 169 ? 21.515 -26.282 -0.357  1.00   8.06  ? 195  LEU A HG   1 
ATOM   2660 H HD11 . LEU A 1 169 ? 18.939 -25.242 -0.788  1.00   8.28  ? 195  LEU A HD11 1 
ATOM   2661 H HD12 . LEU A 1 169 ? 19.803 -24.967 0.516   1.00   8.28  ? 195  LEU A HD12 1 
ATOM   2662 H HD13 . LEU A 1 169 ? 20.286 -24.404 -0.889  1.00   8.28  ? 195  LEU A HD13 1 
ATOM   2663 H HD21 . LEU A 1 169 ? 20.524 -28.363 -0.106  1.00   9.17  ? 195  LEU A HD21 1 
ATOM   2664 H HD22 . LEU A 1 169 ? 20.001 -27.364 1.013   1.00   9.17  ? 195  LEU A HD22 1 
ATOM   2665 H HD23 . LEU A 1 169 ? 19.089 -27.694 -0.245  1.00   9.17  ? 195  LEU A HD23 1 
ATOM   2666 N N    . GLY A 1 170 ? 22.449 -27.495 -4.916  1.00   6.94  ? 196  GLY A N    1 
ATOM   2667 C CA   . GLY A 1 170 ? 22.287 -27.447 -6.341  1.00   6.68  ? 196  GLY A CA   1 
ATOM   2668 C C    . GLY A 1 170 ? 23.337 -28.193 -7.116  1.00   6.18  ? 196  GLY A C    1 
ATOM   2669 O O    . GLY A 1 170 ? 23.875 -29.213 -6.681  1.00   6.92  ? 196  GLY A O    1 
ATOM   2670 H H    . GLY A 1 170 ? 23.220 -27.227 -4.644  1.00   8.33  ? 196  GLY A H    1 
ATOM   2671 H HA2  . GLY A 1 170 ? 21.422 -27.819 -6.573  1.00   8.02  ? 196  GLY A HA2  1 
ATOM   2672 H HA3  . GLY A 1 170 ? 22.303 -26.521 -6.630  1.00   8.02  ? 196  GLY A HA3  1 
ATOM   2673 N N    . LYS A 1 171 ? 23.604 -27.650 -8.289  1.00   6.52  ? 197  LYS A N    1 
ATOM   2674 C CA   . LYS A 1 171 ? 24.254 -28.401 -9.331  1.00   6.92  ? 197  LYS A CA   1 
ATOM   2675 C C    . LYS A 1 171 ? 25.767 -28.490 -9.323  1.00   6.00  ? 197  LYS A C    1 
ATOM   2676 O O    . LYS A 1 171 ? 26.320 -29.103 -10.214 1.00   7.47  ? 197  LYS A O    1 
ATOM   2677 C CB   . LYS A 1 171 ? 23.817 -27.836 -10.666 1.00   10.28 ? 197  LYS A CB   1 
ATOM   2678 C CG   . LYS A 1 171 ? 24.151 -26.409 -10.867 1.00   13.72 ? 197  LYS A CG   1 
ATOM   2679 C CD   . LYS A 1 171 ? 23.358 -25.902 -12.067 1.00   18.78 ? 197  LYS A CD   1 
ATOM   2680 C CE   . LYS A 1 171 ? 23.359 -24.401 -12.179 1.00   23.51 ? 197  LYS A CE   1 
ATOM   2681 N NZ   . LYS A 1 171 ? 22.311 -23.969 -13.159 1.00   26.04 ? 197  LYS A NZ   1 
ATOM   2682 H H    . LYS A 1 171 ? 23.415 -26.839 -8.505  1.00   7.82  ? 197  LYS A H    1 
ATOM   2683 H HA   . LYS A 1 171 ? 23.922 -29.311 -9.287  1.00   8.30  ? 197  LYS A HA   1 
ATOM   2684 H HB2  . LYS A 1 171 ? 24.249 -28.342 -11.372 1.00   12.34 ? 197  LYS A HB2  1 
ATOM   2685 H HB3  . LYS A 1 171 ? 22.854 -27.927 -10.741 1.00   12.34 ? 197  LYS A HB3  1 
ATOM   2686 H HG2  . LYS A 1 171 ? 23.897 -25.896 -10.084 1.00   16.47 ? 197  LYS A HG2  1 
ATOM   2687 H HG3  . LYS A 1 171 ? 25.098 -26.313 -11.053 1.00   16.47 ? 197  LYS A HG3  1 
ATOM   2688 H HD2  . LYS A 1 171 ? 23.748 -26.263 -12.878 1.00   22.53 ? 197  LYS A HD2  1 
ATOM   2689 H HD3  . LYS A 1 171 ? 22.437 -26.195 -11.983 1.00   22.53 ? 197  LYS A HD3  1 
ATOM   2690 H HE2  . LYS A 1 171 ? 23.156 -24.009 -11.315 1.00   28.21 ? 197  LYS A HE2  1 
ATOM   2691 H HE3  . LYS A 1 171 ? 24.224 -24.098 -12.496 1.00   28.21 ? 197  LYS A HE3  1 
ATOM   2692 H HZ1  . LYS A 1 171 ? 21.509 -24.241 -12.886 1.00   31.25 ? 197  LYS A HZ1  1 
ATOM   2693 H HZ2  . LYS A 1 171 ? 22.307 -23.082 -13.229 1.00   31.25 ? 197  LYS A HZ2  1 
ATOM   2694 H HZ3  . LYS A 1 171 ? 22.479 -24.322 -13.959 1.00   31.25 ? 197  LYS A HZ3  1 
ATOM   2695 N N    . ALA A 1 172 ? 26.446 -27.850 -8.375  1.00   4.94  ? 198  ALA A N    1 
ATOM   2696 C CA   . ALA A 1 172 ? 27.879 -27.738 -8.464  1.00   5.53  ? 198  ALA A CA   1 
ATOM   2697 C C    . ALA A 1 172 ? 28.648 -29.040 -8.324  1.00   5.59  ? 198  ALA A C    1 
ATOM   2698 O O    . ALA A 1 172 ? 29.643 -29.237 -9.019  1.00   6.85  ? 198  ALA A O    1 
ATOM   2699 C CB   . ALA A 1 172 ? 28.370 -26.745 -7.441  1.00   5.98  ? 198  ALA A CB   1 
ATOM   2700 H H    . ALA A 1 172 ? 26.097 -27.479 -7.682  1.00   5.93  ? 198  ALA A H    1 
ATOM   2701 H HA   . ALA A 1 172 ? 28.096 -27.375 -9.338  1.00   6.63  ? 198  ALA A HA   1 
ATOM   2702 H HB1  . ALA A 1 172 ? 28.120 -27.055 -6.556  1.00   7.18  ? 198  ALA A HB1  1 
ATOM   2703 H HB2  . ALA A 1 172 ? 29.335 -26.675 -7.507  1.00   7.18  ? 198  ALA A HB2  1 
ATOM   2704 H HB3  . ALA A 1 172 ? 27.963 -25.883 -7.617  1.00   7.18  ? 198  ALA A HB3  1 
ATOM   2705 N N    . LEU A 1 173 ? 28.232 -29.872 -7.373  1.00   5.37  ? 199  LEU A N    1 
ATOM   2706 C CA   . LEU A 1 173 ? 28.992 -31.055 -6.968  1.00   5.98  ? 199  LEU A CA   1 
ATOM   2707 C C    . LEU A 1 173 ? 28.180 -32.322 -7.181  1.00   6.65  ? 199  LEU A C    1 
ATOM   2708 O O    . LEU A 1 173 ? 26.977 -32.307 -7.119  1.00   6.61  ? 199  LEU A O    1 
ATOM   2709 C CB   . LEU A 1 173 ? 29.351 -30.986 -5.483  1.00   5.50  ? 199  LEU A CB   1 
ATOM   2710 C CG   . LEU A 1 173 ? 30.289 -29.857 -5.077  1.00   6.05  ? 199  LEU A CG   1 
ATOM   2711 C CD1  . LEU A 1 173 ? 30.428 -29.803 -3.568  1.00   6.16  ? 199  LEU A CD1  1 
ATOM   2712 C CD2  . LEU A 1 173 ? 31.636 -29.996 -5.726  1.00   8.25  ? 199  LEU A CD2  1 
ATOM   2713 H H    . LEU A 1 173 ? 27.497 -29.771 -6.937  1.00   6.44  ? 199  LEU A H    1 
ATOM   2714 H HA   . LEU A 1 173 ? 29.810 -31.115 -7.486  1.00   7.18  ? 199  LEU A HA   1 
ATOM   2715 H HB2  . LEU A 1 173 ? 28.532 -30.878 -4.975  1.00   6.59  ? 199  LEU A HB2  1 
ATOM   2716 H HB3  . LEU A 1 173 ? 29.778 -31.821 -5.233  1.00   6.59  ? 199  LEU A HB3  1 
ATOM   2717 H HG   . LEU A 1 173 ? 29.907 -29.015 -5.368  1.00   7.26  ? 199  LEU A HG   1 
ATOM   2718 H HD11 . LEU A 1 173 ? 30.789 -30.647 -3.254  1.00   7.39  ? 199  LEU A HD11 1 
ATOM   2719 H HD12 . LEU A 1 173 ? 31.029 -29.078 -3.332  1.00   7.39  ? 199  LEU A HD12 1 
ATOM   2720 H HD13 . LEU A 1 173 ? 29.554 -29.650 -3.176  1.00   7.39  ? 199  LEU A HD13 1 
ATOM   2721 H HD21 . LEU A 1 173 ? 31.525 -29.976 -6.690  1.00   9.90  ? 199  LEU A HD21 1 
ATOM   2722 H HD22 . LEU A 1 173 ? 32.201 -29.260 -5.443  1.00   9.90  ? 199  LEU A HD22 1 
ATOM   2723 H HD23 . LEU A 1 173 ? 32.031 -30.840 -5.456  1.00   9.90  ? 199  LEU A HD23 1 
ATOM   2724 N N    . ALA A 1 174 ? 28.867 -33.431 -7.397  1.00   7.85  ? 200  ALA A N    1 
ATOM   2725 C CA   . ALA A 1 174 ? 28.239 -34.751 -7.407  1.00   9.07  ? 200  ALA A CA   1 
ATOM   2726 C C    . ALA A 1 174 ? 27.593 -35.011 -6.062  1.00   7.02  ? 200  ALA A C    1 
ATOM   2727 O O    . ALA A 1 174 ? 27.964 -34.399 -5.072  1.00   6.18  ? 200  ALA A O    1 
ATOM   2728 C CB   . ALA A 1 174 ? 29.292 -35.832 -7.692  1.00   11.79 ? 200  ALA A CB   1 
ATOM   2729 H H    . ALA A 1 174 ? 29.714 -33.451 -7.542  1.00   9.42  ? 200  ALA A H    1 
ATOM   2730 H HA   . ALA A 1 174 ? 27.557 -34.787 -8.095  1.00   10.88 ? 200  ALA A HA   1 
ATOM   2731 H HB1  . ALA A 1 174 ? 29.970 -35.802 -7.000  1.00   14.14 ? 200  ALA A HB1  1 
ATOM   2732 H HB2  . ALA A 1 174 ? 28.859 -36.700 -7.696  1.00   14.14 ? 200  ALA A HB2  1 
ATOM   2733 H HB3  . ALA A 1 174 ? 29.694 -35.659 -8.558  1.00   14.14 ? 200  ALA A HB3  1 
ATOM   2734 N N    . GLU A 1 175 ? 26.663 -35.949 -5.996  1.00   7.35  ? 201  GLU A N    1 
ATOM   2735 C CA   A GLU A 1 175 ? 25.883 -36.106 -4.782  0.59   6.39  ? 201  GLU A CA   1 
ATOM   2736 C CA   B GLU A 1 175 ? 25.890 -36.164 -4.778  0.41   6.28  ? 201  GLU A CA   1 
ATOM   2737 C C    . GLU A 1 175 ? 26.724 -36.444 -3.550  1.00   6.31  ? 201  GLU A C    1 
ATOM   2738 O O    . GLU A 1 175 ? 26.509 -35.871 -2.498  1.00   6.00  ? 201  GLU A O    1 
ATOM   2739 C CB   A GLU A 1 175 ? 24.768 -37.130 -4.963  0.59   6.69  ? 201  GLU A CB   1 
ATOM   2740 C CB   B GLU A 1 175 ? 24.940 -37.324 -4.978  0.41   5.98  ? 201  GLU A CB   1 
ATOM   2741 C CG   A GLU A 1 175 ? 23.959 -37.330 -3.680  0.59   5.89  ? 201  GLU A CG   1 
ATOM   2742 C CG   B GLU A 1 175 ? 23.940 -37.018 -6.021  0.41   5.85  ? 201  GLU A CG   1 
ATOM   2743 C CD   A GLU A 1 175 ? 23.421 -36.042 -3.050  0.59   6.84  ? 201  GLU A CD   1 
ATOM   2744 C CD   B GLU A 1 175 ? 23.021 -35.896 -5.666  0.41   4.67  ? 201  GLU A CD   1 
ATOM   2745 O OE1  A GLU A 1 175 ? 22.973 -35.118 -3.741  0.59   6.53  ? 201  GLU A OE1  1 
ATOM   2746 O OE1  B GLU A 1 175 ? 22.842 -35.644 -4.475  0.41   4.36  ? 201  GLU A OE1  1 
ATOM   2747 O OE2  A GLU A 1 175 ? 23.495 -35.880 -1.822  0.59   7.96  ? 201  GLU A OE2  1 
ATOM   2748 O OE2  B GLU A 1 175 ? 22.481 -35.250 -6.589  0.41   5.79  ? 201  GLU A OE2  1 
ATOM   2749 H H    A GLU A 1 175 ? 26.465 -36.498 -6.628  0.59   8.82  ? 201  GLU A H    1 
ATOM   2750 H H    B GLU A 1 175 ? 26.456 -36.477 -6.643  0.41   8.82  ? 201  GLU A H    1 
ATOM   2751 H HA   A GLU A 1 175 ? 25.452 -35.256 -4.598  0.59   7.66  ? 201  GLU A HA   1 
ATOM   2752 H HA   B GLU A 1 175 ? 25.359 -35.372 -4.601  0.41   7.53  ? 201  GLU A HA   1 
ATOM   2753 H HB2  A GLU A 1 175 ? 24.164 -36.824 -5.657  0.59   8.03  ? 201  GLU A HB2  1 
ATOM   2754 H HB2  B GLU A 1 175 ? 25.442 -38.106 -5.256  0.41   7.17  ? 201  GLU A HB2  1 
ATOM   2755 H HB3  A GLU A 1 175 ? 25.157 -37.983 -5.211  0.59   8.03  ? 201  GLU A HB3  1 
ATOM   2756 H HB3  B GLU A 1 175 ? 24.471 -37.501 -4.148  0.41   7.17  ? 201  GLU A HB3  1 
ATOM   2757 H HG2  A GLU A 1 175 ? 23.198 -37.898 -3.880  0.59   7.07  ? 201  GLU A HG2  1 
ATOM   2758 H HG2  B GLU A 1 175 ? 24.405 -36.774 -6.837  0.41   7.02  ? 201  GLU A HG2  1 
ATOM   2759 H HG3  A GLU A 1 175 ? 24.524 -37.764 -3.022  0.59   7.07  ? 201  GLU A HG3  1 
ATOM   2760 H HG3  B GLU A 1 175 ? 23.398 -37.808 -6.175  0.41   7.02  ? 201  GLU A HG3  1 
ATOM   2761 N N    . THR A 1 176 ? 27.661 -37.369 -3.650  1.00   7.37  ? 202  THR A N    1 
ATOM   2762 C CA   . THR A 1 176 ? 28.408 -37.740 -2.454  1.00   8.02  ? 202  THR A CA   1 
ATOM   2763 C C    . THR A 1 176 ? 29.214 -36.544 -1.938  1.00   6.99  ? 202  THR A C    1 
ATOM   2764 O O    . THR A 1 176 ? 29.290 -36.292 -0.728  1.00   7.59  ? 202  THR A O    1 
ATOM   2765 C CB   . THR A 1 176 ? 29.287 -38.940 -2.684  1.00   9.71  ? 202  THR A CB   1 
ATOM   2766 O OG1  . THR A 1 176 ? 28.451 -40.049 -3.014  1.00   10.40 ? 202  THR A OG1  1 
ATOM   2767 C CG2  . THR A 1 176 ? 30.094 -39.279 -1.427  1.00   11.93 ? 202  THR A CG2  1 
ATOM   2768 H H    . THR A 1 176 ? 27.881 -37.786 -4.369  1.00   8.84  ? 202  THR A H    1 
ATOM   2769 H HA   . THR A 1 176 ? 27.772 -37.979 -1.761  1.00   9.63  ? 202  THR A HA   1 
ATOM   2770 H HB   . THR A 1 176 ? 29.902 -38.763 -3.413  1.00   11.65 ? 202  THR A HB   1 
ATOM   2771 H HG1  . THR A 1 176 ? 28.011 -39.881 -3.709  1.00   12.49 ? 202  THR A HG1  1 
ATOM   2772 H HG21 . THR A 1 176 ? 29.494 -39.475 -0.690  1.00   14.32 ? 202  THR A HG21 1 
ATOM   2773 H HG22 . THR A 1 176 ? 30.654 -40.054 -1.592  1.00   14.32 ? 202  THR A HG22 1 
ATOM   2774 H HG23 . THR A 1 176 ? 30.658 -38.529 -1.182  1.00   14.32 ? 202  THR A HG23 1 
ATOM   2775 N N    . GLN A 1 177 ? 29.774 -35.788 -2.868  1.00   6.79  ? 203  GLN A N    1 
ATOM   2776 C CA   . GLN A 1 177 ? 30.571 -34.614 -2.527  1.00   7.33  ? 203  GLN A CA   1 
ATOM   2777 C C    . GLN A 1 177 ? 29.722 -33.479 -1.965  1.00   6.49  ? 203  GLN A C    1 
ATOM   2778 O O    . GLN A 1 177 ? 30.118 -32.827 -0.996  1.00   6.31  ? 203  GLN A O    1 
ATOM   2779 C CB   . GLN A 1 177 ? 31.356 -34.190 -3.764  1.00   8.13  ? 203  GLN A CB   1 
ATOM   2780 C CG   . GLN A 1 177 ? 32.635 -35.022 -3.971  1.00   10.38 ? 203  GLN A CG   1 
ATOM   2781 C CD   . GLN A 1 177 ? 32.386 -36.357 -4.570  1.00   13.52 ? 203  GLN A CD   1 
ATOM   2782 O OE1  . GLN A 1 177 ? 31.303 -36.640 -5.079  1.00   12.89 ? 203  GLN A OE1  1 
ATOM   2783 N NE2  . GLN A 1 177 ? 33.429 -37.190 -4.581  1.00   14.62 ? 203  GLN A NE2  1 
ATOM   2784 H H    . GLN A 1 177 ? 29.709 -35.932 -3.713  1.00   8.15  ? 203  GLN A H    1 
ATOM   2785 H HA   . GLN A 1 177 ? 31.213 -34.864 -1.845  1.00   8.79  ? 203  GLN A HA   1 
ATOM   2786 H HB2  . GLN A 1 177 ? 30.795 -34.301 -4.548  1.00   9.75  ? 203  GLN A HB2  1 
ATOM   2787 H HB3  . GLN A 1 177 ? 31.615 -33.260 -3.670  1.00   9.75  ? 203  GLN A HB3  1 
ATOM   2788 H HG2  . GLN A 1 177 ? 33.231 -34.538 -4.563  1.00   12.45 ? 203  GLN A HG2  1 
ATOM   2789 H HG3  . GLN A 1 177 ? 33.063 -35.158 -3.111  1.00   12.45 ? 203  GLN A HG3  1 
ATOM   2790 H HE21 . GLN A 1 177 ? 34.183 -36.938 -4.253  1.00   17.54 ? 203  GLN A HE21 1 
ATOM   2791 H HE22 . GLN A 1 177 ? 33.347 -37.978 -4.915  1.00   17.54 ? 203  GLN A HE22 1 
ATOM   2792 N N    . ARG A 1 178 ? 28.559 -33.246 -2.562  1.00   6.28  ? 204  ARG A N    1 
ATOM   2793 C CA   A ARG A 1 178 ? 27.597 -32.276 -2.035  0.47   5.42  ? 204  ARG A CA   1 
ATOM   2794 C CA   B ARG A 1 178 ? 27.626 -32.278 -2.016  0.53   5.58  ? 204  ARG A CA   1 
ATOM   2795 C C    . ARG A 1 178 ? 27.258 -32.630 -0.586  1.00   5.43  ? 204  ARG A C    1 
ATOM   2796 O O    . ARG A 1 178 ? 27.289 -31.780 0.298   1.00   5.41  ? 204  ARG A O    1 
ATOM   2797 C CB   A ARG A 1 178 ? 26.322 -32.239 -2.901  0.47   5.16  ? 204  ARG A CB   1 
ATOM   2798 C CB   B ARG A 1 178 ? 26.383 -32.225 -2.874  0.53   5.62  ? 204  ARG A CB   1 
ATOM   2799 C CG   A ARG A 1 178 ? 25.323 -31.142 -2.516  0.47   4.71  ? 204  ARG A CG   1 
ATOM   2800 C CG   B ARG A 1 178 ? 25.373 -31.226 -2.392  0.53   5.23  ? 204  ARG A CG   1 
ATOM   2801 C CD   A ARG A 1 178 ? 23.853 -31.451 -2.921  0.47   5.91  ? 204  ARG A CD   1 
ATOM   2802 C CD   B ARG A 1 178 ? 24.138 -31.284 -3.250  0.53   6.81  ? 204  ARG A CD   1 
ATOM   2803 N NE   A ARG A 1 178 ? 23.355 -32.622 -2.214  0.47   6.12  ? 204  ARG A NE   1 
ATOM   2804 N NE   B ARG A 1 178 ? 24.532 -31.550 -4.618  0.53   7.67  ? 204  ARG A NE   1 
ATOM   2805 C CZ   A ARG A 1 178 ? 22.844 -32.627 -0.984  0.47   7.55  ? 204  ARG A CZ   1 
ATOM   2806 C CZ   B ARG A 1 178 ? 23.846 -32.273 -5.492  0.53   8.43  ? 204  ARG A CZ   1 
ATOM   2807 N NH1  A ARG A 1 178 ? 22.665 -31.499 -0.297  0.47   8.35  ? 204  ARG A NH1  1 
ATOM   2808 N NH1  B ARG A 1 178 ? 22.653 -32.778 -5.198  0.53   9.81  ? 204  ARG A NH1  1 
ATOM   2809 N NH2  A ARG A 1 178 ? 22.490 -33.788 -0.458  0.47   9.77  ? 204  ARG A NH2  1 
ATOM   2810 N NH2  B ARG A 1 178 ? 24.351 -32.457 -6.683  0.53   8.67  ? 204  ARG A NH2  1 
ATOM   2811 H H    A ARG A 1 178 ? 28.299 -33.639 -3.281  0.47   7.54  ? 204  ARG A H    1 
ATOM   2812 H H    B ARG A 1 178 ? 28.290 -33.635 -3.281  0.53   7.54  ? 204  ARG A H    1 
ATOM   2813 H HA   A ARG A 1 178 ? 27.996 -31.392 -2.045  0.47   6.50  ? 204  ARG A HA   1 
ATOM   2814 H HA   B ARG A 1 178 ? 28.036 -31.399 -2.019  0.53   6.70  ? 204  ARG A HA   1 
ATOM   2815 H HB2  A ARG A 1 178 ? 26.579 -32.091 -3.824  0.47   6.20  ? 204  ARG A HB2  1 
ATOM   2816 H HB2  B ARG A 1 178 ? 26.636 -31.982 -3.779  0.53   6.75  ? 204  ARG A HB2  1 
ATOM   2817 H HB3  A ARG A 1 178 ? 25.867 -33.092 -2.821  0.47   6.20  ? 204  ARG A HB3  1 
ATOM   2818 H HB3  B ARG A 1 178 ? 25.963 -33.099 -2.872  0.53   6.75  ? 204  ARG A HB3  1 
ATOM   2819 H HG2  A ARG A 1 178 ? 25.345 -31.025 -1.553  0.47   5.65  ? 204  ARG A HG2  1 
ATOM   2820 H HG2  B ARG A 1 178 ? 25.123 -31.431 -1.478  0.53   6.28  ? 204  ARG A HG2  1 
ATOM   2821 H HG3  A ARG A 1 178 ? 25.583 -30.316 -2.953  0.47   5.65  ? 204  ARG A HG3  1 
ATOM   2822 H HG3  B ARG A 1 178 ? 25.747 -30.333 -2.451  0.53   6.28  ? 204  ARG A HG3  1 
ATOM   2823 H HD2  A ARG A 1 178 ? 23.291 -30.694 -2.694  0.47   7.09  ? 204  ARG A HD2  1 
ATOM   2824 H HD2  B ARG A 1 178 ? 23.561 -32.002 -2.946  0.53   8.17  ? 204  ARG A HD2  1 
ATOM   2825 H HD3  A ARG A 1 178 ? 23.812 -31.628 -3.874  0.47   7.09  ? 204  ARG A HD3  1 
ATOM   2826 H HD3  B ARG A 1 178 ? 23.675 -30.433 -3.218  0.53   8.17  ? 204  ARG A HD3  1 
ATOM   2827 H HE   A ARG A 1 178 ? 23.395 -33.376 -2.626  0.47   7.34  ? 204  ARG A HE   1 
ATOM   2828 H HE   B ARG A 1 178 ? 25.274 -31.210 -4.886  0.53   9.21  ? 204  ARG A HE   1 
ATOM   2829 H HH11 A ARG A 1 178 ? 22.908 -30.746 -0.635  0.47   10.02 ? 204  ARG A HH11 1 
ATOM   2830 H HH11 B ARG A 1 178 ? 22.320 -32.666 -4.413  0.53   10.41 ? 204  ARG A HH11 1 
ATOM   2831 H HH12 A ARG A 1 178 ? 22.322 -31.525 0.491   0.47   10.02 ? 204  ARG A HH12 1 
ATOM   2832 H HH12 B ARG A 1 178 ? 22.222 -33.234 -5.786  0.53   10.41 ? 204  ARG A HH12 1 
ATOM   2833 H HH21 A ARG A 1 178 ? 22.591 -34.513 -0.910  0.47   11.73 ? 204  ARG A HH21 1 
ATOM   2834 H HH21 B ARG A 1 178 ? 25.117 -32.118 -6.882  0.53   11.77 ? 204  ARG A HH21 1 
ATOM   2835 H HH22 A ARG A 1 178 ? 22.130 -33.814 0.322   0.47   11.73 ? 204  ARG A HH22 1 
ATOM   2836 H HH22 B ARG A 1 178 ? 23.911 -32.902 -7.273  0.53   11.77 ? 204  ARG A HH22 1 
ATOM   2837 N N    . ALA A 1 179 ? 26.942 -33.903 -0.355  1.00   5.94  ? 205  ALA A N    1 
ATOM   2838 C CA   . ALA A 1 179 ? 26.564 -34.327 0.970   1.00   6.10  ? 205  ALA A CA   1 
ATOM   2839 C C    . ALA A 1 179 ? 27.722 -34.134 1.938   1.00   6.32  ? 205  ALA A C    1 
ATOM   2840 O O    . ALA A 1 179 ? 27.505 -33.767 3.099   1.00   6.66  ? 205  ALA A O    1 
ATOM   2841 C CB   . ALA A 1 179 ? 26.119 -35.787 0.961   1.00   7.57  ? 205  ALA A CB   1 
ATOM   2842 H H    . ALA A 1 179 ? 26.941 -34.527 -0.946  1.00   7.13  ? 205  ALA A H    1 
ATOM   2843 H HA   . ALA A 1 179 ? 25.820 -33.786 1.277   1.00   7.32  ? 205  ALA A HA   1 
ATOM   2844 H HB1  . ALA A 1 179 ? 26.853 -36.338 0.648   1.00   9.08  ? 205  ALA A HB1  1 
ATOM   2845 H HB2  . ALA A 1 179 ? 25.871 -36.046 1.862   1.00   9.08  ? 205  ALA A HB2  1 
ATOM   2846 H HB3  . ALA A 1 179 ? 25.358 -35.881 0.368   1.00   9.08  ? 205  ALA A HB3  1 
ATOM   2847 N N    . GLN A 1 180 ? 28.946 -34.408 1.489   1.00   6.05  ? 206  GLN A N    1 
ATOM   2848 C CA   . GLN A 1 180 ? 30.106 -34.202 2.348   1.00   6.54  ? 206  GLN A CA   1 
ATOM   2849 C C    . GLN A 1 180 ? 30.267 -32.730 2.721   1.00   6.28  ? 206  GLN A C    1 
ATOM   2850 O O    . GLN A 1 180 ? 30.571 -32.405 3.869   1.00   6.39  ? 206  GLN A O    1 
ATOM   2851 C CB   . GLN A 1 180 ? 31.375 -34.711 1.687   1.00   6.94  ? 206  GLN A CB   1 
ATOM   2852 C CG   . GLN A 1 180 ? 32.635 -34.529 2.512   1.00   8.06  ? 206  GLN A CG   1 
ATOM   2853 C CD   . GLN A 1 180 ? 32.607 -35.331 3.777   1.00   9.18  ? 206  GLN A CD   1 
ATOM   2854 O OE1  . GLN A 1 180 ? 32.950 -36.500 3.779   1.00   11.97 ? 206  GLN A OE1  1 
ATOM   2855 N NE2  . GLN A 1 180 ? 32.191 -34.711 4.872   1.00   9.24  ? 206  GLN A NE2  1 
ATOM   2856 H H    . GLN A 1 180 ? 29.128 -34.709 0.704   1.00   7.26  ? 206  GLN A H    1 
ATOM   2857 H HA   . GLN A 1 180 ? 29.979 -34.703 3.169   1.00   7.85  ? 206  GLN A HA   1 
ATOM   2858 H HB2  . GLN A 1 180 ? 31.273 -35.659 1.512   1.00   8.33  ? 206  GLN A HB2  1 
ATOM   2859 H HB3  . GLN A 1 180 ? 31.500 -34.236 0.851   1.00   8.33  ? 206  GLN A HB3  1 
ATOM   2860 H HG2  . GLN A 1 180 ? 33.400 -34.817 1.990   1.00   9.67  ? 206  GLN A HG2  1 
ATOM   2861 H HG3  . GLN A 1 180 ? 32.727 -33.594 2.750   1.00   9.67  ? 206  GLN A HG3  1 
ATOM   2862 H HE21 . GLN A 1 180 ? 31.952 -33.885 4.834   1.00   11.09 ? 206  GLN A HE21 1 
ATOM   2863 H HE22 . GLN A 1 180 ? 32.159 -35.134 5.620   1.00   11.09 ? 206  GLN A HE22 1 
ATOM   2864 N N    . LEU A 1 181 ? 30.110 -31.845 1.743   1.00   5.43  ? 207  LEU A N    1 
ATOM   2865 C CA   . LEU A 1 181 ? 30.189 -30.431 2.045   1.00   5.43  ? 207  LEU A CA   1 
ATOM   2866 C C    . LEU A 1 181 ? 29.140 -30.013 3.081   1.00   5.04  ? 207  LEU A C    1 
ATOM   2867 O O    . LEU A 1 181 ? 29.427 -29.281 4.020   1.00   5.53  ? 207  LEU A O    1 
ATOM   2868 C CB   . LEU A 1 181 ? 30.064 -29.600 0.765   1.00   5.29  ? 207  LEU A CB   1 
ATOM   2869 C CG   . LEU A 1 181 ? 30.117 -28.089 0.995   1.00   5.16  ? 207  LEU A CG   1 
ATOM   2870 C CD1  . LEU A 1 181 ? 31.399 -27.620 1.642   1.00   6.18  ? 207  LEU A CD1  1 
ATOM   2871 C CD2  . LEU A 1 181 ? 29.869 -27.365 -0.310  1.00   5.02  ? 207  LEU A CD2  1 
ATOM   2872 H H    . LEU A 1 181 ? 29.961 -32.035 0.918   1.00   6.52  ? 207  LEU A H    1 
ATOM   2873 H HA   . LEU A 1 181 ? 31.062 -30.248 2.426   1.00   6.51  ? 207  LEU A HA   1 
ATOM   2874 H HB2  . LEU A 1 181 ? 30.793 -29.834 0.170   1.00   6.34  ? 207  LEU A HB2  1 
ATOM   2875 H HB3  . LEU A 1 181 ? 29.216 -29.806 0.341   1.00   6.34  ? 207  LEU A HB3  1 
ATOM   2876 H HG   . LEU A 1 181 ? 29.392 -27.852 1.594   1.00   6.19  ? 207  LEU A HG   1 
ATOM   2877 H HD11 . LEU A 1 181 ? 32.145 -27.856 1.070   1.00   7.41  ? 207  LEU A HD11 1 
ATOM   2878 H HD12 . LEU A 1 181 ? 31.360 -26.657 1.756   1.00   7.41  ? 207  LEU A HD12 1 
ATOM   2879 H HD13 . LEU A 1 181 ? 31.493 -28.052 2.505   1.00   7.41  ? 207  LEU A HD13 1 
ATOM   2880 H HD21 . LEU A 1 181 ? 28.994 -27.613 -0.647  1.00   6.02  ? 207  LEU A HD21 1 
ATOM   2881 H HD22 . LEU A 1 181 ? 29.905 -26.409 -0.152  1.00   6.02  ? 207  LEU A HD22 1 
ATOM   2882 H HD23 . LEU A 1 181 ? 30.554 -27.621 -0.948  1.00   6.02  ? 207  LEU A HD23 1 
ATOM   2883 N N    . VAL A 1 182 ? 27.918 -30.485 2.898   1.00   4.78  ? 208  VAL A N    1 
ATOM   2884 C CA   . VAL A 1 182 ? 26.846 -30.176 3.821   1.00   5.28  ? 208  VAL A CA   1 
ATOM   2885 C C    . VAL A 1 182 ? 27.159 -30.701 5.213   1.00   5.65  ? 208  VAL A C    1 
ATOM   2886 O O    . VAL A 1 182 ? 26.958 -29.992 6.210   1.00   5.97  ? 208  VAL A O    1 
ATOM   2887 C CB   . VAL A 1 182 ? 25.513 -30.677 3.282   1.00   6.37  ? 208  VAL A CB   1 
ATOM   2888 C CG1  . VAL A 1 182 ? 24.443 -30.691 4.325   1.00   7.20  ? 208  VAL A CG1  1 
ATOM   2889 C CG2  . VAL A 1 182 ? 25.079 -29.846 2.090   1.00   7.40  ? 208  VAL A CG2  1 
ATOM   2890 H H    . VAL A 1 182 ? 27.683 -30.990 2.242   1.00   5.73  ? 208  VAL A H    1 
ATOM   2891 H HA   . VAL A 1 182 ? 26.779 -29.210 3.891   1.00   6.34  ? 208  VAL A HA   1 
ATOM   2892 H HB   . VAL A 1 182 ? 25.630 -31.589 2.974   1.00   7.64  ? 208  VAL A HB   1 
ATOM   2893 H HG11 . VAL A 1 182 ? 24.316 -29.789 4.658   1.00   8.65  ? 208  VAL A HG11 1 
ATOM   2894 H HG12 . VAL A 1 182 ? 23.621 -31.017 3.928   1.00   8.65  ? 208  VAL A HG12 1 
ATOM   2895 H HG13 . VAL A 1 182 ? 24.717 -31.276 5.049   1.00   8.65  ? 208  VAL A HG13 1 
ATOM   2896 H HG21 . VAL A 1 182 ? 25.751 -29.916 1.395   1.00   8.88  ? 208  VAL A HG21 1 
ATOM   2897 H HG22 . VAL A 1 182 ? 24.229 -30.182 1.764   1.00   8.88  ? 208  VAL A HG22 1 
ATOM   2898 H HG23 . VAL A 1 182 ? 24.984 -28.921 2.368   1.00   8.88  ? 208  VAL A HG23 1 
ATOM   2899 N N    . THR A 1 183 ? 27.658 -31.929 5.301   1.00   6.60  ? 209  THR A N    1 
ATOM   2900 C CA   . THR A 1 183 ? 28.034 -32.487 6.583   1.00   7.57  ? 209  THR A CA   1 
ATOM   2901 C C    . THR A 1 183 ? 29.073 -31.591 7.258   1.00   7.24  ? 209  THR A C    1 
ATOM   2902 O O    . THR A 1 183 ? 29.001 -31.295 8.443   1.00   7.22  ? 209  THR A O    1 
ATOM   2903 C CB   . THR A 1 183 ? 28.557 -33.924 6.396   1.00   9.08  ? 209  THR A CB   1 
ATOM   2904 O OG1  . THR A 1 183 ? 27.502 -34.751 5.895   1.00   9.38  ? 209  THR A OG1  1 
ATOM   2905 C CG2  . THR A 1 183 ? 29.100 -34.483 7.693   1.00   10.32 ? 209  THR A CG2  1 
ATOM   2906 H H    . THR A 1 183 ? 27.786 -32.455 4.633   1.00   7.92  ? 209  THR A H    1 
ATOM   2907 H HA   . THR A 1 183 ? 27.251 -32.523 7.155   1.00   9.08  ? 209  THR A HA   1 
ATOM   2908 H HB   . THR A 1 183 ? 29.281 -33.913 5.751   1.00   10.89 ? 209  THR A HB   1 
ATOM   2909 H HG1  . THR A 1 183 ? 27.232 -34.455 5.157   1.00   11.25 ? 209  THR A HG1  1 
ATOM   2910 H HG21 . THR A 1 183 ? 28.401 -34.498 8.365   1.00   12.39 ? 209  THR A HG21 1 
ATOM   2911 H HG22 . THR A 1 183 ? 29.424 -35.387 7.554   1.00   12.39 ? 209  THR A HG22 1 
ATOM   2912 H HG23 . THR A 1 183 ? 29.832 -33.931 8.010   1.00   12.39 ? 209  THR A HG23 1 
ATOM   2913 N N    . TRP A 1 184 ? 30.077 -31.174 6.510   1.00   6.96  ? 210  TRP A N    1 
ATOM   2914 C CA   . TRP A 1 184 ? 31.091 -30.311 7.076   1.00   6.26  ? 210  TRP A CA   1 
ATOM   2915 C C    . TRP A 1 184 ? 30.501 -29.014 7.609   1.00   5.82  ? 210  TRP A C    1 
ATOM   2916 O O    . TRP A 1 184 ? 30.773 -28.612 8.740   1.00   7.21  ? 210  TRP A O    1 
ATOM   2917 C CB   . TRP A 1 184 ? 32.185 -30.031 6.039   1.00   6.69  ? 210  TRP A CB   1 
ATOM   2918 C CG   . TRP A 1 184 ? 33.171 -31.169 5.854   1.00   7.02  ? 210  TRP A CG   1 
ATOM   2919 C CD1  . TRP A 1 184 ? 33.445 -32.163 6.738   1.00   8.28  ? 210  TRP A CD1  1 
ATOM   2920 C CD2  . TRP A 1 184 ? 34.012 -31.397 4.723   1.00   7.37  ? 210  TRP A CD2  1 
ATOM   2921 N NE1  . TRP A 1 184 ? 34.413 -32.981 6.241   1.00   8.96  ? 210  TRP A NE1  1 
ATOM   2922 C CE2  . TRP A 1 184 ? 34.782 -32.540 4.997   1.00   8.52  ? 210  TRP A CE2  1 
ATOM   2923 C CE3  . TRP A 1 184 ? 34.182 -30.750 3.502   1.00   7.32  ? 210  TRP A CE3  1 
ATOM   2924 C CZ2  . TRP A 1 184 ? 35.714 -33.047 4.094   1.00   9.34  ? 210  TRP A CZ2  1 
ATOM   2925 C CZ3  . TRP A 1 184 ? 35.112 -31.234 2.609   1.00   8.12  ? 210  TRP A CZ3  1 
ATOM   2926 C CH2  . TRP A 1 184 ? 35.861 -32.386 2.901   1.00   8.91  ? 210  TRP A CH2  1 
ATOM   2927 H H    . TRP A 1 184 ? 30.195 -31.374 5.682   1.00   8.36  ? 210  TRP A H    1 
ATOM   2928 H HA   . TRP A 1 184 ? 31.506 -30.771 7.823   1.00   7.52  ? 210  TRP A HA   1 
ATOM   2929 H HB2  . TRP A 1 184 ? 31.765 -29.862 5.181   1.00   8.02  ? 210  TRP A HB2  1 
ATOM   2930 H HB3  . TRP A 1 184 ? 32.686 -29.248 6.318   1.00   8.02  ? 210  TRP A HB3  1 
ATOM   2931 H HD1  . TRP A 1 184 ? 33.052 -32.252 7.576   1.00   9.93  ? 210  TRP A HD1  1 
ATOM   2932 H HE1  . TRP A 1 184 ? 34.734 -33.672 6.639   1.00   10.75 ? 210  TRP A HE1  1 
ATOM   2933 H HE3  . TRP A 1 184 ? 33.696 -29.981 3.305   1.00   8.78  ? 210  TRP A HE3  1 
ATOM   2934 H HZ2  . TRP A 1 184 ? 36.207 -33.812 4.286   1.00   11.21 ? 210  TRP A HZ2  1 
ATOM   2935 H HZ3  . TRP A 1 184 ? 35.232 -30.804 1.793   1.00   9.75  ? 210  TRP A HZ3  1 
ATOM   2936 H HH2  . TRP A 1 184 ? 36.476 -32.700 2.278   1.00   10.69 ? 210  TRP A HH2  1 
ATOM   2937 N N    . LEU A 1 185 ? 29.685 -28.350 6.801   1.00   5.47  ? 211  LEU A N    1 
ATOM   2938 C CA   . LEU A 1 185 ? 29.124 -27.067 7.189   1.00   5.17  ? 211  LEU A CA   1 
ATOM   2939 C C    . LEU A 1 185 ? 28.220 -27.222 8.403   1.00   5.31  ? 211  LEU A C    1 
ATOM   2940 O O    . LEU A 1 185 ? 28.241 -26.378 9.297   1.00   5.42  ? 211  LEU A O    1 
ATOM   2941 C CB   . LEU A 1 185 ? 28.335 -26.469 6.033   1.00   5.13  ? 211  LEU A CB   1 
ATOM   2942 C CG   . LEU A 1 185 ? 29.157 -26.046 4.821   1.00   5.83  ? 211  LEU A CG   1 
ATOM   2943 C CD1  . LEU A 1 185 ? 28.212 -25.775 3.640   1.00   6.26  ? 211  LEU A CD1  1 
ATOM   2944 C CD2  . LEU A 1 185 ? 29.988 -24.816 5.098   1.00   7.17  ? 211  LEU A CD2  1 
ATOM   2945 H H    . LEU A 1 185 ? 29.440 -28.622 6.023   1.00   6.57  ? 211  LEU A H    1 
ATOM   2946 H HA   . LEU A 1 185 ? 29.843 -26.456 7.417   1.00   6.20  ? 211  LEU A HA   1 
ATOM   2947 H HB2  . LEU A 1 185 ? 27.690 -27.128 5.730   1.00   6.16  ? 211  LEU A HB2  1 
ATOM   2948 H HB3  . LEU A 1 185 ? 27.867 -25.683 6.355   1.00   6.16  ? 211  LEU A HB3  1 
ATOM   2949 H HG   . LEU A 1 185 ? 29.755 -26.768 4.572   1.00   6.99  ? 211  LEU A HG   1 
ATOM   2950 H HD11 . LEU A 1 185 ? 27.597 -25.067 3.885   1.00   7.52  ? 211  LEU A HD11 1 
ATOM   2951 H HD12 . LEU A 1 185 ? 28.738 -25.506 2.871   1.00   7.52  ? 211  LEU A HD12 1 
ATOM   2952 H HD13 . LEU A 1 185 ? 27.720 -26.587 3.438   1.00   7.52  ? 211  LEU A HD13 1 
ATOM   2953 H HD21 . LEU A 1 185 ? 30.597 -25.005 5.829   1.00   8.60  ? 211  LEU A HD21 1 
ATOM   2954 H HD22 . LEU A 1 185 ? 30.490 -24.589 4.299   1.00   8.60  ? 211  LEU A HD22 1 
ATOM   2955 H HD23 . LEU A 1 185 ? 29.399 -24.084 5.338   1.00   8.60  ? 211  LEU A HD23 1 
ATOM   2956 N N    . LYS A 1 186 ? 27.426 -28.290 8.452   1.00   5.79  ? 212  LYS A N    1 
ATOM   2957 C CA   . LYS A 1 186 ? 26.554 -28.515 9.603   1.00   6.30  ? 212  LYS A CA   1 
ATOM   2958 C C    . LYS A 1 186 ? 27.336 -28.696 10.895  1.00   7.16  ? 212  LYS A C    1 
ATOM   2959 O O    . LYS A 1 186 ? 26.871 -28.329 11.965  1.00   9.68  ? 212  LYS A O    1 
ATOM   2960 C CB   . LYS A 1 186 ? 25.649 -29.716 9.367   1.00   6.66  ? 212  LYS A CB   1 
ATOM   2961 C CG   . LYS A 1 186 ? 24.505 -29.411 8.414   1.00   7.80  ? 212  LYS A CG   1 
ATOM   2962 C CD   . LYS A 1 186 ? 23.684 -30.704 8.203   1.00   9.96  ? 212  LYS A CD   1 
ATOM   2963 C CE   . LYS A 1 186 ? 22.467 -30.562 7.319   1.00   11.52 ? 212  LYS A CE   1 
ATOM   2964 N NZ   . LYS A 1 186 ? 21.760 -31.868 7.265   1.00   12.61 ? 212  LYS A NZ   1 
ATOM   2965 H H    . LYS A 1 186 ? 27.373 -28.892 7.841   1.00   6.94  ? 212  LYS A H    1 
ATOM   2966 H HA   . LYS A 1 186 ? 25.985 -27.738 9.714   1.00   7.56  ? 212  LYS A HA   1 
ATOM   2967 H HB2  . LYS A 1 186 ? 26.174 -30.437 8.985   1.00   7.99  ? 212  LYS A HB2  1 
ATOM   2968 H HB3  . LYS A 1 186 ? 25.268 -29.996 10.214  1.00   7.99  ? 212  LYS A HB3  1 
ATOM   2969 H HG2  . LYS A 1 186 ? 23.928 -28.733 8.799   1.00   9.36  ? 212  LYS A HG2  1 
ATOM   2970 H HG3  . LYS A 1 186 ? 24.858 -29.121 7.559   1.00   9.36  ? 212  LYS A HG3  1 
ATOM   2971 H HD2  . LYS A 1 186 ? 24.261 -31.371 7.800   1.00   11.96 ? 212  LYS A HD2  1 
ATOM   2972 H HD3  . LYS A 1 186 ? 23.380 -31.019 9.069   1.00   11.96 ? 212  LYS A HD3  1 
ATOM   2973 H HE2  . LYS A 1 186 ? 21.867 -29.897 7.690   1.00   13.82 ? 212  LYS A HE2  1 
ATOM   2974 H HE3  . LYS A 1 186 ? 22.740 -30.317 6.421   1.00   13.82 ? 212  LYS A HE3  1 
ATOM   2975 H HZ1  . LYS A 1 186 ? 21.507 -32.111 8.083   1.00   15.13 ? 212  LYS A HZ1  1 
ATOM   2976 H HZ2  . LYS A 1 186 ? 21.039 -31.802 6.747   1.00   15.13 ? 212  LYS A HZ2  1 
ATOM   2977 H HZ3  . LYS A 1 186 ? 22.300 -32.492 6.931   1.00   15.13 ? 212  LYS A HZ3  1 
ATOM   2978 N N    . GLY A 1 187 ? 28.515 -29.292 10.789  1.00   6.92  ? 213  GLY A N    1 
ATOM   2979 C CA   . GLY A 1 187 ? 29.375 -29.548 11.931  1.00   7.12  ? 213  GLY A CA   1 
ATOM   2980 C C    . GLY A 1 187 ? 30.305 -28.402 12.264  1.00   6.61  ? 213  GLY A C    1 
ATOM   2981 O O    . GLY A 1 187 ? 31.192 -28.554 13.088  1.00   7.66  ? 213  GLY A O    1 
ATOM   2982 H H    . GLY A 1 187 ? 28.846 -29.565 10.044  1.00   8.30  ? 213  GLY A H    1 
ATOM   2983 H HA2  . GLY A 1 187 ? 28.825 -29.727 12.710  1.00   8.54  ? 213  GLY A HA2  1 
ATOM   2984 H HA3  . GLY A 1 187 ? 29.915 -30.334 11.754  1.00   8.54  ? 213  GLY A HA3  1 
ATOM   2985 N N    . ASN A 1 188 ? 30.112 -27.237 11.665  1.00   5.50  ? 214  ASN A N    1 
ATOM   2986 C CA   . ASN A 1 188 ? 30.947 -26.122 12.032  1.00   5.00  ? 214  ASN A CA   1 
ATOM   2987 C C    . ASN A 1 188 ? 30.873 -25.816 13.512  1.00   4.95  ? 214  ASN A C    1 
ATOM   2988 O O    . ASN A 1 188 ? 29.787 -25.801 14.099  1.00   5.66  ? 214  ASN A O    1 
ATOM   2989 C CB   . ASN A 1 188 ? 30.528 -24.873 11.254  1.00   5.30  ? 214  ASN A CB   1 
ATOM   2990 C CG   . ASN A 1 188 ? 31.413 -23.715 11.570  1.00   5.35  ? 214  ASN A CG   1 
ATOM   2991 O OD1  . ASN A 1 188 ? 32.606 -23.905 11.844  1.00   5.38  ? 214  ASN A OD1  1 
ATOM   2992 N ND2  . ASN A 1 188 ? 30.853 -22.514 11.612  1.00   5.49  ? 214  ASN A ND2  1 
ATOM   2993 H H    . ASN A 1 188 ? 29.522 -27.073 11.061  1.00   6.60  ? 214  ASN A H    1 
ATOM   2994 H HA   . ASN A 1 188 ? 31.869 -26.325 11.809  1.00   6.01  ? 214  ASN A HA   1 
ATOM   2995 H HB2  . ASN A 1 188 ? 30.590 -25.052 10.302  1.00   6.36  ? 214  ASN A HB2  1 
ATOM   2996 H HB3  . ASN A 1 188 ? 29.619 -24.636 11.493  1.00   6.36  ? 214  ASN A HB3  1 
ATOM   2997 H HD21 . ASN A 1 188 ? 30.011 -22.426 11.461  1.00   6.59  ? 214  ASN A HD21 1 
ATOM   2998 H HD22 . ASN A 1 188 ? 31.332 -21.822 11.792  1.00   6.59  ? 214  ASN A HD22 1 
ATOM   2999 N N    . THR A 1 189 ? 32.018 -25.502 14.101  1.00   5.16  ? 215  THR A N    1 
ATOM   3000 C CA   . THR A 1 189 ? 32.082 -25.185 15.525  1.00   5.62  ? 215  THR A CA   1 
ATOM   3001 C C    . THR A 1 189 ? 32.200 -23.693 15.815  1.00   5.22  ? 215  THR A C    1 
ATOM   3002 O O    . THR A 1 189 ? 32.081 -23.291 16.972  1.00   6.04  ? 215  THR A O    1 
ATOM   3003 C CB   . THR A 1 189 ? 33.260 -25.883 16.217  1.00   5.87  ? 215  THR A CB   1 
ATOM   3004 O OG1  . THR A 1 189 ? 34.486 -25.305 15.793  1.00   5.82  ? 215  THR A OG1  1 
ATOM   3005 C CG2  . THR A 1 189 ? 33.267 -27.379 15.962  1.00   5.90  ? 215  THR A CG2  1 
ATOM   3006 H H    . THR A 1 189 ? 32.777 -25.464 13.699  1.00   6.19  ? 215  THR A H    1 
ATOM   3007 H HA   . THR A 1 189 ? 31.267 -25.501 15.946  1.00   6.75  ? 215  THR A HA   1 
ATOM   3008 H HB   . THR A 1 189 ? 33.174 -25.752 17.174  1.00   7.05  ? 215  THR A HB   1 
ATOM   3009 H HG1  . THR A 1 189 ? 34.571 -25.389 14.962  1.00   6.99  ? 215  THR A HG1  1 
ATOM   3010 H HG21 . THR A 1 189 ? 33.336 -27.552 15.010  1.00   7.08  ? 215  THR A HG21 1 
ATOM   3011 H HG22 . THR A 1 189 ? 34.023 -27.788 16.412  1.00   7.08  ? 215  THR A HG22 1 
ATOM   3012 H HG23 . THR A 1 189 ? 32.448 -27.776 16.296  1.00   7.08  ? 215  THR A HG23 1 
ATOM   3013 N N    . THR A 1 190 ? 32.430 -22.866 14.806  1.00   5.57  ? 216  THR A N    1 
ATOM   3014 C CA   . THR A 1 190 ? 32.823 -21.484 15.034  1.00   5.34  ? 216  THR A CA   1 
ATOM   3015 C C    . THR A 1 190 ? 31.705 -20.463 14.905  1.00   5.59  ? 216  THR A C    1 
ATOM   3016 O O    . THR A 1 190 ? 31.959 -19.260 15.040  1.00   6.60  ? 216  THR A O    1 
ATOM   3017 C CB   . THR A 1 190 ? 33.909 -21.083 14.021  1.00   5.57  ? 216  THR A CB   1 
ATOM   3018 O OG1  . THR A 1 190 ? 33.315 -21.022 12.719  1.00   5.46  ? 216  THR A OG1  1 
ATOM   3019 C CG2  . THR A 1 190 ? 35.089 -22.020 14.012  1.00   6.47  ? 216  THR A CG2  1 
ATOM   3020 H H    . THR A 1 190 ? 32.365 -23.081 13.976  1.00   6.69  ? 216  THR A H    1 
ATOM   3021 H HA   . THR A 1 190 ? 33.198 -21.406 15.925  1.00   6.41  ? 216  THR A HA   1 
ATOM   3022 H HB   . THR A 1 190 ? 34.237 -20.201 14.254  1.00   6.68  ? 216  THR A HB   1 
ATOM   3023 H HG1  . THR A 1 190 ? 32.697 -20.453 12.712  1.00   6.55  ? 216  THR A HG1  1 
ATOM   3024 H HG21 . THR A 1 190 ? 34.799 -22.917 13.782  1.00   7.77  ? 216  THR A HG21 1 
ATOM   3025 H HG22 . THR A 1 190 ? 35.742 -21.724 13.359  1.00   7.77  ? 216  THR A HG22 1 
ATOM   3026 H HG23 . THR A 1 190 ? 35.505 -22.038 14.888  1.00   7.77  ? 216  THR A HG23 1 
ATOM   3027 N N    . GLY A 1 191 ? 30.494 -20.905 14.620  1.00   5.87  ? 217  GLY A N    1 
ATOM   3028 C CA   . GLY A 1 191 ? 29.437 -19.989 14.229  1.00   6.37  ? 217  GLY A CA   1 
ATOM   3029 C C    . GLY A 1 191 ? 28.319 -19.779 15.226  1.00   5.59  ? 217  GLY A C    1 
ATOM   3030 O O    . GLY A 1 191 ? 27.305 -19.186 14.862  1.00   5.35  ? 217  GLY A O    1 
ATOM   3031 H H    . GLY A 1 191 ? 30.256 -21.731 14.644  1.00   7.04  ? 217  GLY A H    1 
ATOM   3032 H HA2  . GLY A 1 191 ? 29.832 -19.122 14.046  1.00   7.65  ? 217  GLY A HA2  1 
ATOM   3033 H HA3  . GLY A 1 191 ? 29.038 -20.312 13.406  1.00   7.65  ? 217  GLY A HA3  1 
ATOM   3034 N N    . SER A 1 192 ? 28.473 -20.206 16.472  1.00   5.99  ? 218  SER A N    1 
ATOM   3035 C CA   . SER A 1 192 ? 27.384 -20.112 17.457  1.00   6.84  ? 218  SER A CA   1 
ATOM   3036 C C    . SER A 1 192 ? 26.805 -18.702 17.566  1.00   6.48  ? 218  SER A C    1 
ATOM   3037 O O    . SER A 1 192 ? 25.596 -18.516 17.632  1.00   7.15  ? 218  SER A O    1 
ATOM   3038 C CB   . SER A 1 192 ? 27.907 -20.555 18.834  1.00   8.66  ? 218  SER A CB   1 
ATOM   3039 O OG   . SER A 1 192 ? 26.906 -20.542 19.819  1.00   11.30 ? 218  SER A OG   1 
ATOM   3040 H H    . SER A 1 192 ? 29.196 -20.555 16.781  1.00   7.18  ? 218  SER A H    1 
ATOM   3041 H HA   . SER A 1 192 ? 26.668 -20.713 17.197  1.00   8.21  ? 218  SER A HA   1 
ATOM   3042 H HB2  . SER A 1 192 ? 28.255 -21.457 18.758  1.00   10.39 ? 218  SER A HB2  1 
ATOM   3043 H HB3  . SER A 1 192 ? 28.617 -19.952 19.104  1.00   10.39 ? 218  SER A HB3  1 
ATOM   3044 H HG   . SER A 1 192 ? 26.595 -19.766 19.902  1.00   13.56 ? 218  SER A HG   1 
ATOM   3045 N N    . ALA A 1 193 ? 27.669 -17.713 17.613  1.00   5.74  ? 219  ALA A N    1 
ATOM   3046 C CA   . ALA A 1 193 ? 27.245 -16.339 17.885  1.00   5.55  ? 219  ALA A CA   1 
ATOM   3047 C C    . ALA A 1 193 ? 26.919 -15.539 16.630  1.00   5.34  ? 219  ALA A C    1 
ATOM   3048 O O    . ALA A 1 193 ? 26.620 -14.348 16.735  1.00   6.15  ? 219  ALA A O    1 
ATOM   3049 C CB   . ALA A 1 193 ? 28.321 -15.644 18.665  1.00   6.57  ? 219  ALA A CB   1 
ATOM   3050 H H    . ALA A 1 193 ? 28.516 -17.801 17.490  1.00   6.88  ? 219  ALA A H    1 
ATOM   3051 H HA   . ALA A 1 193 ? 26.447 -16.362 18.436  1.00   6.66  ? 219  ALA A HA   1 
ATOM   3052 H HB1  . ALA A 1 193 ? 29.138 -15.642 18.142  1.00   7.89  ? 219  ALA A HB1  1 
ATOM   3053 H HB2  . ALA A 1 193 ? 28.041 -14.733 18.846  1.00   7.89  ? 219  ALA A HB2  1 
ATOM   3054 H HB3  . ALA A 1 193 ? 28.463 -16.119 19.499  1.00   7.89  ? 219  ALA A HB3  1 
ATOM   3055 N N    . SER A 1 194 ? 26.989 -16.165 15.461  1.00   5.15  ? 220  SER A N    1 
ATOM   3056 C CA   . SER A 1 194 ? 26.772 -15.450 14.221  1.00   5.27  ? 220  SER A CA   1 
ATOM   3057 C C    . SER A 1 194 ? 25.359 -15.707 13.676  1.00   4.88  ? 220  SER A C    1 
ATOM   3058 O O    . SER A 1 194 ? 24.395 -15.542 14.414  1.00   5.30  ? 220  SER A O    1 
ATOM   3059 C CB   . SER A 1 194 ? 27.899 -15.782 13.235  1.00   7.44  ? 220  SER A CB   1 
ATOM   3060 O OG   . SER A 1 194 ? 29.167 -15.463 13.794  1.00   11.04 ? 220  SER A OG   1 
ATOM   3061 H H    . SER A 1 194 ? 27.159 -17.002 15.363  1.00   6.18  ? 220  SER A H    1 
ATOM   3062 H HA   . SER A 1 194 ? 26.833 -14.500 14.409  1.00   6.33  ? 220  SER A HA   1 
ATOM   3063 H HB2  . SER A 1 194 ? 27.873 -16.730 13.033  1.00   8.93  ? 220  SER A HB2  1 
ATOM   3064 H HB3  . SER A 1 194 ? 27.772 -15.265 12.424  1.00   8.93  ? 220  SER A HB3  1 
ATOM   3065 H HG   . SER A 1 194 ? 29.203 -14.643 13.975  1.00   13.25 ? 220  SER A HG   1 
ATOM   3066 N N    . ILE A 1 195 ? 25.212 -16.114 12.418  1.00   4.58  ? 221  ILE A N    1 
ATOM   3067 C CA   . ILE A 1 195 ? 23.862 -16.330 11.873  1.00   4.62  ? 221  ILE A CA   1 
ATOM   3068 C C    . ILE A 1 195 ? 23.013 -17.237 12.779  1.00   5.27  ? 221  ILE A C    1 
ATOM   3069 O O    . ILE A 1 195 ? 21.844 -16.952 13.048  1.00   6.00  ? 221  ILE A O    1 
ATOM   3070 C CB   . ILE A 1 195 ? 23.925 -16.886 10.452  1.00   4.00  ? 221  ILE A CB   1 
ATOM   3071 C CG1  . ILE A 1 195 ? 24.333 -15.779 9.473   1.00   4.53  ? 221  ILE A CG1  1 
ATOM   3072 C CG2  . ILE A 1 195 ? 22.598 -17.519 10.050  1.00   4.92  ? 221  ILE A CG2  1 
ATOM   3073 C CD1  . ILE A 1 195 ? 24.700 -16.255 8.085   1.00   4.63  ? 221  ILE A CD1  1 
ATOM   3074 H H    . ILE A 1 195 ? 25.854 -16.269 11.868  1.00   5.49  ? 221  ILE A H    1 
ATOM   3075 H HA   . ILE A 1 195 ? 23.414 -15.471 11.826  1.00   5.54  ? 221  ILE A HA   1 
ATOM   3076 H HB   . ILE A 1 195 ? 24.607 -17.575 10.429  1.00   4.80  ? 221  ILE A HB   1 
ATOM   3077 H HG12 . ILE A 1 195 ? 23.593 -15.159 9.383   1.00   5.43  ? 221  ILE A HG12 1 
ATOM   3078 H HG13 . ILE A 1 195 ? 25.104 -15.315 9.836   1.00   5.43  ? 221  ILE A HG13 1 
ATOM   3079 H HG21 . ILE A 1 195 ? 21.902 -16.845 10.093  1.00   5.90  ? 221  ILE A HG21 1 
ATOM   3080 H HG22 . ILE A 1 195 ? 22.674 -17.860 9.145   1.00   5.90  ? 221  ILE A HG22 1 
ATOM   3081 H HG23 . ILE A 1 195 ? 22.397 -18.244 10.662  1.00   5.90  ? 221  ILE A HG23 1 
ATOM   3082 H HD11 . ILE A 1 195 ? 23.936 -16.708 7.696   1.00   5.56  ? 221  ILE A HD11 1 
ATOM   3083 H HD12 . ILE A 1 195 ? 24.942 -15.488 7.543   1.00   5.56  ? 221  ILE A HD12 1 
ATOM   3084 H HD13 . ILE A 1 195 ? 25.451 -16.865 8.149   1.00   5.56  ? 221  ILE A HD13 1 
ATOM   3085 N N    . ARG A 1 196 ? 23.606 -18.317 13.272  1.00   5.61  ? 222  ARG A N    1 
ATOM   3086 C CA   . ARG A 1 196 ? 22.891 -19.254 14.135  1.00   6.15  ? 222  ARG A CA   1 
ATOM   3087 C C    . ARG A 1 196 ? 22.193 -18.584 15.319  1.00   6.71  ? 222  ARG A C    1 
ATOM   3088 O O    . ARG A 1 196 ? 21.113 -19.024 15.707  1.00   7.57  ? 222  ARG A O    1 
ATOM   3089 C CB   . ARG A 1 196 ? 23.835 -20.325 14.661  1.00   6.94  ? 222  ARG A CB   1 
ATOM   3090 C CG   . ARG A 1 196 ? 24.271 -21.348 13.612  1.00   6.61  ? 222  ARG A CG   1 
ATOM   3091 C CD   . ARG A 1 196 ? 25.496 -22.113 14.066  1.00   7.65  ? 222  ARG A CD   1 
ATOM   3092 N NE   . ARG A 1 196 ? 26.092 -22.955 13.022  1.00   7.59  ? 222  ARG A NE   1 
ATOM   3093 C CZ   . ARG A 1 196 ? 25.846 -24.233 12.807  1.00   8.13  ? 222  ARG A CZ   1 
ATOM   3094 N NH1  . ARG A 1 196 ? 24.972 -24.884 13.546  1.00   9.96  ? 222  ARG A NH1  1 
ATOM   3095 N NH2  . ARG A 1 196 ? 26.502 -24.861 11.840  1.00   8.34  ? 222  ARG A NH2  1 
ATOM   3096 H H    . ARG A 1 196 ? 24.425 -18.533 13.122  1.00   6.73  ? 222  ARG A H    1 
ATOM   3097 H HA   . ARG A 1 196 ? 22.208 -19.698 13.608  1.00   7.38  ? 222  ARG A HA   1 
ATOM   3098 H HB2  . ARG A 1 196 ? 24.633 -19.895 15.004  1.00   8.33  ? 222  ARG A HB2  1 
ATOM   3099 H HB3  . ARG A 1 196 ? 23.390 -20.807 15.376  1.00   8.33  ? 222  ARG A HB3  1 
ATOM   3100 H HG2  . ARG A 1 196 ? 23.553 -21.983 13.465  1.00   7.93  ? 222  ARG A HG2  1 
ATOM   3101 H HG3  . ARG A 1 196 ? 24.487 -20.888 12.786  1.00   7.93  ? 222  ARG A HG3  1 
ATOM   3102 H HD2  . ARG A 1 196 ? 26.171 -21.478 14.356  1.00   9.18  ? 222  ARG A HD2  1 
ATOM   3103 H HD3  . ARG A 1 196 ? 25.249 -22.689 14.806  1.00   9.18  ? 222  ARG A HD3  1 
ATOM   3104 H HE   . ARG A 1 196 ? 26.659 -22.577 12.497  1.00   9.10  ? 222  ARG A HE   1 
ATOM   3105 H HH11 . ARG A 1 196 ? 24.556 -24.476 14.179  1.00   11.95 ? 222  ARG A HH11 1 
ATOM   3106 H HH12 . ARG A 1 196 ? 24.816 -25.716 13.395  1.00   11.95 ? 222  ARG A HH12 1 
ATOM   3107 H HH21 . ARG A 1 196 ? 27.068 -24.432 11.355  1.00   10.01 ? 222  ARG A HH21 1 
ATOM   3108 H HH22 . ARG A 1 196 ? 26.341 -25.691 11.679  1.00   10.01 ? 222  ARG A HH22 1 
ATOM   3109 N N    . ALA A 1 197 ? 22.805 -17.557 15.892  1.00   5.67  ? 223  ALA A N    1 
ATOM   3110 C CA   . ALA A 1 197 ? 22.247 -16.909 17.075  1.00   5.95  ? 223  ALA A CA   1 
ATOM   3111 C C    . ALA A 1 197 ? 21.004 -16.101 16.766  1.00   6.05  ? 223  ALA A C    1 
ATOM   3112 O O    . ALA A 1 197 ? 20.272 -15.737 17.691  1.00   7.26  ? 223  ALA A O    1 
ATOM   3113 C CB   . ALA A 1 197 ? 23.309 -16.055 17.741  1.00   6.14  ? 223  ALA A CB   1 
ATOM   3114 H H    . ALA A 1 197 ? 23.545 -17.214 15.618  1.00   6.80  ? 223  ALA A H    1 
ATOM   3115 H HA   . ALA A 1 197 ? 21.992 -17.598 17.708  1.00   7.13  ? 223  ALA A HA   1 
ATOM   3116 H HB1  . ALA A 1 197 ? 23.611 -15.381 17.113  1.00   7.37  ? 223  ALA A HB1  1 
ATOM   3117 H HB2  . ALA A 1 197 ? 22.927 -15.630 18.524  1.00   7.37  ? 223  ALA A HB2  1 
ATOM   3118 H HB3  . ALA A 1 197 ? 24.052 -16.622 18.001  1.00   7.37  ? 223  ALA A HB3  1 
ATOM   3119 N N    . GLY A 1 198 ? 20.756 -15.824 15.492  1.00   6.42  ? 224  GLY A N    1 
ATOM   3120 C CA   . GLY A 1 198 ? 19.571 -15.083 15.062  1.00   6.80  ? 224  GLY A CA   1 
ATOM   3121 C C    . GLY A 1 198 ? 18.413 -15.951 14.611  1.00   7.31  ? 224  GLY A C    1 
ATOM   3122 O O    . GLY A 1 198 ? 17.406 -15.423 14.174  1.00   8.95  ? 224  GLY A O    1 
ATOM   3123 H H    . GLY A 1 198 ? 21.268 -16.058 14.842  1.00   7.70  ? 224  GLY A H    1 
ATOM   3124 H HA2  . GLY A 1 198 ? 19.263 -14.528 15.795  1.00   8.15  ? 224  GLY A HA2  1 
ATOM   3125 H HA3  . GLY A 1 198 ? 19.814 -14.500 14.325  1.00   8.15  ? 224  GLY A HA3  1 
ATOM   3126 N N    . LEU A 1 199 ? 18.561 -17.264 14.738  1.00   7.38  ? 225  LEU A N    1 
ATOM   3127 C CA   . LEU A 1 199 ? 17.583 -18.204 14.201  1.00   8.07  ? 225  LEU A CA   1 
ATOM   3128 C C    . LEU A 1 199 ? 16.943 -19.000 15.308  1.00   8.88  ? 225  LEU A C    1 
ATOM   3129 O O    . LEU A 1 199 ? 17.518 -19.161 16.388  1.00   8.94  ? 225  LEU A O    1 
ATOM   3130 C CB   . LEU A 1 199 ? 18.274 -19.193 13.278  1.00   9.01  ? 225  LEU A CB   1 
ATOM   3131 C CG   . LEU A 1 199 ? 19.049 -18.604 12.106  1.00   10.63 ? 225  LEU A CG   1 
ATOM   3132 C CD1  . LEU A 1 199 ? 19.689 -19.711 11.310  1.00   11.38 ? 225  LEU A CD1  1 
ATOM   3133 C CD2  . LEU A 1 199 ? 18.163 -17.774 11.229  1.00   11.71 ? 225  LEU A CD2  1 
ATOM   3134 H H    . LEU A 1 199 ? 19.226 -17.640 15.134  1.00   8.85  ? 225  LEU A H    1 
ATOM   3135 H HA   . LEU A 1 199 ? 16.896 -17.730 13.707  1.00   9.68  ? 225  LEU A HA   1 
ATOM   3136 H HB2  . LEU A 1 199 ? 18.901 -19.712 13.804  1.00   10.81 ? 225  LEU A HB2  1 
ATOM   3137 H HB3  . LEU A 1 199 ? 17.600 -19.784 12.908  1.00   10.81 ? 225  LEU A HB3  1 
ATOM   3138 H HG   . LEU A 1 199 ? 19.754 -18.032 12.448  1.00   12.75 ? 225  LEU A HG   1 
ATOM   3139 H HD11 . LEU A 1 199 ? 18.996 -20.301 10.977  1.00   13.65 ? 225  LEU A HD11 1 
ATOM   3140 H HD12 . LEU A 1 199 ? 20.179 -19.323 10.568  1.00   13.65 ? 225  LEU A HD12 1 
ATOM   3141 H HD13 . LEU A 1 199 ? 20.296 -20.203 11.885  1.00   13.65 ? 225  LEU A HD13 1 
ATOM   3142 H HD21 . LEU A 1 199 ? 17.790 -17.048 11.754  1.00   14.05 ? 225  LEU A HD21 1 
ATOM   3143 H HD22 . LEU A 1 199 ? 18.689 -17.417 10.497  1.00   14.05 ? 225  LEU A HD22 1 
ATOM   3144 H HD23 . LEU A 1 199 ? 17.449 -18.332 10.883  1.00   14.05 ? 225  LEU A HD23 1 
ATOM   3145 N N    . PRO A 1 200 ? 15.755 -19.556 15.030  1.00   10.55 ? 226  PRO A N    1 
ATOM   3146 C CA   . PRO A 1 200 ? 15.175 -20.528 15.940  1.00   11.72 ? 226  PRO A CA   1 
ATOM   3147 C C    . PRO A 1 200 ? 16.190 -21.629 16.277  1.00   12.23 ? 226  PRO A C    1 
ATOM   3148 O O    . PRO A 1 200 ? 16.892 -22.104 15.384  1.00   12.29 ? 226  PRO A O    1 
ATOM   3149 C CB   . PRO A 1 200 ? 13.960 -21.039 15.157  1.00   12.73 ? 226  PRO A CB   1 
ATOM   3150 C CG   . PRO A 1 200 ? 13.557 -19.861 14.310  1.00   12.90 ? 226  PRO A CG   1 
ATOM   3151 C CD   . PRO A 1 200 ? 14.864 -19.277 13.889  1.00   11.60 ? 226  PRO A CD   1 
ATOM   3152 H HA   . PRO A 1 200 ? 14.878 -20.096 16.756  1.00   14.07 ? 226  PRO A HA   1 
ATOM   3153 H HB2  . PRO A 1 200 ? 14.216 -21.792 14.603  1.00   15.27 ? 226  PRO A HB2  1 
ATOM   3154 H HB3  . PRO A 1 200 ? 13.250 -21.284 15.771  1.00   15.27 ? 226  PRO A HB3  1 
ATOM   3155 H HG2  . PRO A 1 200 ? 13.047 -20.163 13.543  1.00   15.48 ? 226  PRO A HG2  1 
ATOM   3156 H HG3  . PRO A 1 200 ? 13.048 -19.229 14.842  1.00   15.48 ? 226  PRO A HG3  1 
ATOM   3157 H HD2  . PRO A 1 200 ? 15.190 -19.720 13.090  1.00   13.92 ? 226  PRO A HD2  1 
ATOM   3158 H HD3  . PRO A 1 200 ? 14.779 -18.320 13.755  1.00   13.92 ? 226  PRO A HD3  1 
ATOM   3159 N N    . LYS A 1 201 ? 16.292 -22.006 17.546  1.00   13.21 ? 227  LYS A N    1 
ATOM   3160 C CA   . LYS A 1 201 ? 17.391 -22.855 18.008  1.00   13.81 ? 227  LYS A CA   1 
ATOM   3161 C C    . LYS A 1 201 ? 17.389 -24.237 17.400  1.00   13.81 ? 227  LYS A C    1 
ATOM   3162 O O    . LYS A 1 201 ? 18.444 -24.877 17.300  1.00   14.16 ? 227  LYS A O    1 
ATOM   3163 C CB   . LYS A 1 201 ? 17.344 -23.022 19.531  1.00   14.87 ? 227  LYS A CB   1 
ATOM   3164 C CG   . LYS A 1 201 ? 17.729 -21.773 20.321  1.00   16.82 ? 227  LYS A CG   1 
ATOM   3165 C CD   . LYS A 1 201 ? 17.271 -21.892 21.791  1.00   18.53 ? 227  LYS A CD   1 
ATOM   3166 C CE   . LYS A 1 201 ? 17.615 -20.635 22.614  1.00   19.23 ? 227  LYS A CE   1 
ATOM   3167 N NZ   . LYS A 1 201 ? 16.972 -20.700 23.963  1.00   19.15 ? 227  LYS A NZ   1 
ATOM   3168 H H    . LYS A 1 201 ? 15.737 -21.784 18.165  1.00   15.86 ? 227  LYS A H    1 
ATOM   3169 H HA   . LYS A 1 201 ? 18.233 -22.430 17.780  1.00   16.57 ? 227  LYS A HA   1 
ATOM   3170 H HB2  . LYS A 1 201 ? 16.440 -23.265 19.788  1.00   17.84 ? 227  LYS A HB2  1 
ATOM   3171 H HB3  . LYS A 1 201 ? 17.956 -23.730 19.784  1.00   17.84 ? 227  LYS A HB3  1 
ATOM   3172 H HG2  . LYS A 1 201 ? 18.694 -21.669 20.309  1.00   20.18 ? 227  LYS A HG2  1 
ATOM   3173 H HG3  . LYS A 1 201 ? 17.300 -20.997 19.928  1.00   20.18 ? 227  LYS A HG3  1 
ATOM   3174 H HD2  . LYS A 1 201 ? 16.309 -22.014 21.815  1.00   22.23 ? 227  LYS A HD2  1 
ATOM   3175 H HD3  . LYS A 1 201 ? 17.714 -22.651 22.202  1.00   22.23 ? 227  LYS A HD3  1 
ATOM   3176 H HE2  . LYS A 1 201 ? 18.576 -20.579 22.734  1.00   23.07 ? 227  LYS A HE2  1 
ATOM   3177 H HE3  . LYS A 1 201 ? 17.285 -19.847 22.154  1.00   23.07 ? 227  LYS A HE3  1 
ATOM   3178 H HZ1  . LYS A 1 201 ? 17.262 -21.417 24.403  1.00   22.98 ? 227  LYS A HZ1  1 
ATOM   3179 H HZ2  . LYS A 1 201 ? 17.175 -19.971 24.432  1.00   22.98 ? 227  LYS A HZ2  1 
ATOM   3180 H HZ3  . LYS A 1 201 ? 16.088 -20.751 23.876  1.00   22.98 ? 227  LYS A HZ3  1 
ATOM   3181 N N    . SER A 1 202 ? 16.221 -24.720 16.997  1.00   11.86 ? 228  SER A N    1 
ATOM   3182 C CA   . SER A 1 202 ? 16.093 -26.072 16.491  1.00   13.30 ? 228  SER A CA   1 
ATOM   3183 C C    . SER A 1 202 ? 16.210 -26.148 14.970  1.00   11.86 ? 228  SER A C    1 
ATOM   3184 O O    . SER A 1 202 ? 16.163 -27.252 14.424  1.00   11.67 ? 228  SER A O    1 
ATOM   3185 C CB   . SER A 1 202 ? 14.755 -26.653 16.929  1.00   15.64 ? 228  SER A CB   1 
ATOM   3186 O OG   . SER A 1 202 ? 13.701 -25.852 16.424  1.00   18.20 ? 228  SER A OG   1 
ATOM   3187 H H    . SER A 1 202 ? 15.484 -24.277 17.006  1.00   14.23 ? 228  SER A H    1 
ATOM   3188 H HA   . SER A 1 202 ? 16.797 -26.620 16.873  1.00   15.96 ? 228  SER A HA   1 
ATOM   3189 H HB2  . SER A 1 202 ? 14.668 -27.553 16.580  1.00   18.76 ? 228  SER A HB2  1 
ATOM   3190 H HB3  . SER A 1 202 ? 14.713 -26.662 17.898  1.00   18.76 ? 228  SER A HB3  1 
ATOM   3191 H HG   . SER A 1 202 ? 13.731 -25.833 15.585  1.00   21.84 ? 228  SER A HG   1 
ATOM   3192 N N    . TRP A 1 203 ? 16.375 -25.014 14.279  1.00   10.70 ? 229  TRP A N    1 
ATOM   3193 C CA   . TRP A 1 203 ? 16.600 -25.074 12.835  1.00   9.90  ? 229  TRP A CA   1 
ATOM   3194 C C    . TRP A 1 203 ? 17.959 -25.683 12.595  1.00   8.72  ? 229  TRP A C    1 
ATOM   3195 O O    . TRP A 1 203 ? 18.930 -25.326 13.242  1.00   9.95  ? 229  TRP A O    1 
ATOM   3196 C CB   . TRP A 1 203 ? 16.541 -23.692 12.180  1.00   9.48  ? 229  TRP A CB   1 
ATOM   3197 C CG   . TRP A 1 203 ? 15.149 -23.158 11.938  1.00   9.85  ? 229  TRP A CG   1 
ATOM   3198 C CD1  . TRP A 1 203 ? 13.974 -23.714 12.317  1.00   10.41 ? 229  TRP A CD1  1 
ATOM   3199 C CD2  . TRP A 1 203 ? 14.812 -21.956 11.229  1.00   9.69  ? 229  TRP A CD2  1 
ATOM   3200 N NE1  . TRP A 1 203 ? 12.936 -22.944 11.878  1.00   11.76 ? 229  TRP A NE1  1 
ATOM   3201 C CE2  . TRP A 1 203 ? 13.422 -21.851 11.215  1.00   12.27 ? 229  TRP A CE2  1 
ATOM   3202 C CE3  . TRP A 1 203 ? 15.571 -20.951 10.617  1.00   9.59  ? 229  TRP A CE3  1 
ATOM   3203 C CZ2  . TRP A 1 203 ? 12.763 -20.792 10.604  1.00   12.61 ? 229  TRP A CZ2  1 
ATOM   3204 C CZ3  . TRP A 1 203 ? 14.923 -19.900 10.011  1.00   10.97 ? 229  TRP A CZ3  1 
ATOM   3205 C CH2  . TRP A 1 203 ? 13.531 -19.823 10.018  1.00   12.88 ? 229  TRP A CH2  1 
ATOM   3206 H H    . TRP A 1 203 ? 16.361 -24.221 14.613  1.00   12.84 ? 229  TRP A H    1 
ATOM   3207 H HA   . TRP A 1 203 ? 15.929 -25.640 12.423  1.00   11.88 ? 229  TRP A HA   1 
ATOM   3208 H HB2  . TRP A 1 203 ? 17.001 -23.060 12.754  1.00   11.38 ? 229  TRP A HB2  1 
ATOM   3209 H HB3  . TRP A 1 203 ? 16.990 -23.738 11.321  1.00   11.38 ? 229  TRP A HB3  1 
ATOM   3210 H HD1  . TRP A 1 203 ? 13.886 -24.516 12.780  1.00   12.49 ? 229  TRP A HD1  1 
ATOM   3211 H HE1  . TRP A 1 203 ? 12.104 -23.113 12.011  1.00   14.11 ? 229  TRP A HE1  1 
ATOM   3212 H HE3  . TRP A 1 203 ? 16.500 -21.001 10.608  1.00   11.51 ? 229  TRP A HE3  1 
ATOM   3213 H HZ2  . TRP A 1 203 ? 11.835 -20.733 10.612  1.00   15.14 ? 229  TRP A HZ2  1 
ATOM   3214 H HZ3  . TRP A 1 203 ? 15.419 -19.230 9.597   1.00   13.17 ? 229  TRP A HZ3  1 
ATOM   3215 H HH2  . TRP A 1 203 ? 13.114 -19.103 9.603   1.00   15.45 ? 229  TRP A HH2  1 
ATOM   3216 N N    . VAL A 1 204 ? 18.060 -26.533 11.591  1.00   8.62  ? 230  VAL A N    1 
ATOM   3217 C CA   . VAL A 1 204 ? 19.314 -27.127 11.225  1.00   8.21  ? 230  VAL A CA   1 
ATOM   3218 C C    . VAL A 1 204 ? 20.027 -26.125 10.321  1.00   7.00  ? 230  VAL A C    1 
ATOM   3219 O O    . VAL A 1 204 ? 19.424 -25.522 9.426   1.00   7.25  ? 230  VAL A O    1 
ATOM   3220 C CB   . VAL A 1 204 ? 19.084 -28.486 10.551  1.00   8.60  ? 230  VAL A CB   1 
ATOM   3221 C CG1  . VAL A 1 204 ? 20.356 -29.009 9.942   1.00   9.42  ? 230  VAL A CG1  1 
ATOM   3222 C CG2  . VAL A 1 204 ? 18.519 -29.482 11.552  1.00   8.63  ? 230  VAL A CG2  1 
ATOM   3223 H H    . VAL A 1 204 ? 17.399 -26.784 11.101  1.00   10.35 ? 230  VAL A H    1 
ATOM   3224 H HA   . VAL A 1 204 ? 19.853 -27.264 12.020  1.00   9.85  ? 230  VAL A HA   1 
ATOM   3225 H HB   . VAL A 1 204 ? 18.434 -28.378 9.839   1.00   10.32 ? 230  VAL A HB   1 
ATOM   3226 H HG11 . VAL A 1 204 ? 21.021 -29.113 10.641  1.00   11.30 ? 230  VAL A HG11 1 
ATOM   3227 H HG12 . VAL A 1 204 ? 20.177 -29.867 9.526   1.00   11.30 ? 230  VAL A HG12 1 
ATOM   3228 H HG13 . VAL A 1 204 ? 20.670 -28.377 9.277   1.00   11.30 ? 230  VAL A HG13 1 
ATOM   3229 H HG21 . VAL A 1 204 ? 17.675 -29.144 11.890  1.00   10.36 ? 230  VAL A HG21 1 
ATOM   3230 H HG22 . VAL A 1 204 ? 18.381 -30.332 11.106  1.00   10.36 ? 230  VAL A HG22 1 
ATOM   3231 H HG23 . VAL A 1 204 ? 19.150 -29.588 12.281  1.00   10.36 ? 230  VAL A HG23 1 
ATOM   3232 N N    . VAL A 1 205 ? 21.316 -25.959 10.577  1.00   6.31  ? 231  VAL A N    1 
ATOM   3233 C CA   A VAL A 1 205 ? 22.122 -24.935 9.917   0.84   6.33  ? 231  VAL A CA   1 
ATOM   3234 C CA   B VAL A 1 205 ? 22.098 -24.983 9.865   0.16   5.95  ? 231  VAL A CA   1 
ATOM   3235 C C    . VAL A 1 205 ? 23.508 -25.483 9.617   1.00   5.79  ? 231  VAL A C    1 
ATOM   3236 O O    . VAL A 1 205 ? 24.115 -26.159 10.466  1.00   6.89  ? 231  VAL A O    1 
ATOM   3237 C CB   A VAL A 1 205 ? 22.286 -23.657 10.792  0.84   7.76  ? 231  VAL A CB   1 
ATOM   3238 C CB   B VAL A 1 205 ? 22.116 -23.656 10.637  0.16   5.89  ? 231  VAL A CB   1 
ATOM   3239 C CG1  A VAL A 1 205 ? 23.151 -22.622 10.084  0.84   7.28  ? 231  VAL A CG1  1 
ATOM   3240 C CG1  B VAL A 1 205 ? 20.997 -22.783 10.176  0.16   6.31  ? 231  VAL A CG1  1 
ATOM   3241 C CG2  A VAL A 1 205 ? 20.948 -23.050 11.175  0.84   8.73  ? 231  VAL A CG2  1 
ATOM   3242 C CG2  B VAL A 1 205 ? 21.998 -23.905 12.130  0.16   5.43  ? 231  VAL A CG2  1 
ATOM   3243 H H    A VAL A 1 205 ? 21.759 -26.435 11.140  0.84   7.57  ? 231  VAL A H    1 
ATOM   3244 H H    B VAL A 1 205 ? 21.759 -26.405 11.164  0.16   7.57  ? 231  VAL A H    1 
ATOM   3245 H HA   A VAL A 1 205 ? 21.703 -24.683 9.079   0.84   7.59  ? 231  VAL A HA   1 
ATOM   3246 H HA   B VAL A 1 205 ? 21.685 -24.819 9.003   0.16   7.15  ? 231  VAL A HA   1 
ATOM   3247 H HB   A VAL A 1 205 ? 22.739 -23.904 11.613  0.84   9.31  ? 231  VAL A HB   1 
ATOM   3248 H HB   B VAL A 1 205 ? 22.953 -23.196 10.468  0.16   7.07  ? 231  VAL A HB   1 
ATOM   3249 H HG11 A VAL A 1 205 ? 22.730 -22.379 9.245   0.84   8.74  ? 231  VAL A HG11 1 
ATOM   3250 H HG11 B VAL A 1 205 ? 20.155 -23.239 10.336  0.16   7.57  ? 231  VAL A HG11 1 
ATOM   3251 H HG12 A VAL A 1 205 ? 23.235 -21.840 10.652  0.84   8.74  ? 231  VAL A HG12 1 
ATOM   3252 H HG12 B VAL A 1 205 ? 21.022 -21.950 10.672  0.16   7.57  ? 231  VAL A HG12 1 
ATOM   3253 H HG13 A VAL A 1 205 ? 24.027 -23.005 9.917   0.84   8.74  ? 231  VAL A HG13 1 
ATOM   3254 H HG13 B VAL A 1 205 ? 21.103 -22.607 9.228   0.16   7.57  ? 231  VAL A HG13 1 
ATOM   3255 H HG21 A VAL A 1 205 ? 20.438 -23.703 11.680  0.84   10.47 ? 231  VAL A HG21 1 
ATOM   3256 H HG21 B VAL A 1 205 ? 22.746 -24.452 12.418  0.16   6.51  ? 231  VAL A HG21 1 
ATOM   3257 H HG22 A VAL A 1 205 ? 21.104 -22.261 11.717  0.84   10.47 ? 231  VAL A HG22 1 
ATOM   3258 H HG22 B VAL A 1 205 ? 22.012 -23.054 12.594  0.16   6.51  ? 231  VAL A HG22 1 
ATOM   3259 H HG23 A VAL A 1 205 ? 20.469 -22.808 10.367  0.84   10.47 ? 231  VAL A HG23 1 
ATOM   3260 H HG23 B VAL A 1 205 ? 21.163 -24.366 12.307  0.16   6.51  ? 231  VAL A HG23 1 
ATOM   3261 N N    . GLY A 1 206 ? 24.002 -25.162 8.432   1.00   5.76  ? 232  GLY A N    1 
ATOM   3262 C CA   . GLY A 1 206 ? 25.412 -25.299 8.118   1.00   6.03  ? 232  GLY A CA   1 
ATOM   3263 C C    . GLY A 1 206 ? 25.964 -23.917 7.813   1.00   5.16  ? 232  GLY A C    1 
ATOM   3264 O O    . GLY A 1 206 ? 25.295 -23.120 7.170   1.00   6.23  ? 232  GLY A O    1 
ATOM   3265 H H    . GLY A 1 206 ? 23.531 -24.857 7.781   1.00   6.91  ? 232  GLY A H    1 
ATOM   3266 H HA2  . GLY A 1 206 ? 25.890 -25.677 8.873   1.00   7.24  ? 232  GLY A HA2  1 
ATOM   3267 H HA3  . GLY A 1 206 ? 25.531 -25.871 7.344   1.00   7.24  ? 232  GLY A HA3  1 
ATOM   3268 N N    . ASP A 1 207 ? 27.170 -23.613 8.286   1.00   4.62  ? 233  ASP A N    1 
ATOM   3269 C CA   . ASP A 1 207 ? 27.723 -22.312 7.992   1.00   4.08  ? 233  ASP A CA   1 
ATOM   3270 C C    . ASP A 1 207 ? 29.235 -22.319 7.987   1.00   3.89  ? 233  ASP A C    1 
ATOM   3271 O O    . ASP A 1 207 ? 29.872 -23.234 8.521   1.00   4.17  ? 233  ASP A O    1 
ATOM   3272 C CB   . ASP A 1 207 ? 27.231 -21.258 9.005   1.00   4.32  ? 233  ASP A CB   1 
ATOM   3273 C CG   . ASP A 1 207 ? 28.019 -21.270 10.293  1.00   4.37  ? 233  ASP A CG   1 
ATOM   3274 O OD1  . ASP A 1 207 ? 27.966 -22.280 11.026  1.00   5.24  ? 233  ASP A OD1  1 
ATOM   3275 O OD2  . ASP A 1 207 ? 28.741 -20.274 10.564  1.00   4.69  ? 233  ASP A OD2  1 
ATOM   3276 H H    . ASP A 1 207 ? 27.668 -24.128 8.762   1.00   5.54  ? 233  ASP A H    1 
ATOM   3277 H HA   . ASP A 1 207 ? 27.425 -22.038 7.111   1.00   4.89  ? 233  ASP A HA   1 
ATOM   3278 H HB2  . ASP A 1 207 ? 27.315 -20.377 8.610   1.00   5.18  ? 233  ASP A HB2  1 
ATOM   3279 H HB3  . ASP A 1 207 ? 26.302 -21.437 9.220   1.00   5.18  ? 233  ASP A HB3  1 
ATOM   3280 N N    . LYS A 1 208 ? 29.798 -21.256 7.429   1.00   3.61  ? 234  LYS A N    1 
ATOM   3281 C CA   . LYS A 1 208 ? 31.207 -20.938 7.539   1.00   3.73  ? 234  LYS A CA   1 
ATOM   3282 C C    . LYS A 1 208 ? 31.351 -19.469 7.871   1.00   3.51  ? 234  LYS A C    1 
ATOM   3283 O O    . LYS A 1 208 ? 30.910 -18.617 7.106   1.00   3.42  ? 234  LYS A O    1 
ATOM   3284 C CB   . LYS A 1 208 ? 31.973 -21.242 6.242   1.00   3.59  ? 234  LYS A CB   1 
ATOM   3285 C CG   . LYS A 1 208 ? 33.452 -20.901 6.334   1.00   3.58  ? 234  LYS A CG   1 
ATOM   3286 C CD   . LYS A 1 208 ? 34.230 -21.922 7.137   1.00   4.08  ? 234  LYS A CD   1 
ATOM   3287 C CE   . LYS A 1 208 ? 35.601 -21.453 7.569   1.00   4.24  ? 234  LYS A CE   1 
ATOM   3288 N NZ   . LYS A 1 208 ? 35.497 -20.539 8.718   1.00   4.39  ? 234  LYS A NZ   1 
ATOM   3289 H H    . LYS A 1 208 ? 29.360 -20.681 6.962   1.00   4.33  ? 234  LYS A H    1 
ATOM   3290 H HA   . LYS A 1 208 ? 31.600 -21.457 8.258   1.00   4.48  ? 234  LYS A HA   1 
ATOM   3291 H HB2  . LYS A 1 208 ? 31.896 -22.189 6.045   1.00   4.31  ? 234  LYS A HB2  1 
ATOM   3292 H HB3  . LYS A 1 208 ? 31.590 -20.721 5.520   1.00   4.31  ? 234  LYS A HB3  1 
ATOM   3293 H HG2  . LYS A 1 208 ? 33.827 -20.872 5.440   1.00   4.30  ? 234  LYS A HG2  1 
ATOM   3294 H HG3  . LYS A 1 208 ? 33.552 -20.038 6.765   1.00   4.30  ? 234  LYS A HG3  1 
ATOM   3295 H HD2  . LYS A 1 208 ? 33.726 -22.138 7.937   1.00   4.90  ? 234  LYS A HD2  1 
ATOM   3296 H HD3  . LYS A 1 208 ? 34.346 -22.719 6.597   1.00   4.90  ? 234  LYS A HD3  1 
ATOM   3297 H HE2  . LYS A 1 208 ? 36.136 -22.219 7.833   1.00   5.09  ? 234  LYS A HE2  1 
ATOM   3298 H HE3  . LYS A 1 208 ? 36.027 -20.980 6.837   1.00   5.09  ? 234  LYS A HE3  1 
ATOM   3299 H HZ1  . LYS A 1 208 ? 35.109 -20.955 9.403   1.00   5.26  ? 234  LYS A HZ1  1 
ATOM   3300 H HZ2  . LYS A 1 208 ? 36.308 -20.269 8.966   1.00   5.26  ? 234  LYS A HZ2  1 
ATOM   3301 H HZ3  . LYS A 1 208 ? 35.010 -19.828 8.497   1.00   5.26  ? 234  LYS A HZ3  1 
ATOM   3302 N N    . THR A 1 209 ? 32.032 -19.186 8.973   1.00   3.84  ? 235  THR A N    1 
ATOM   3303 C CA   . THR A 1 209 ? 32.339 -17.843 9.402   1.00   3.67  ? 235  THR A CA   1 
ATOM   3304 C C    . THR A 1 209 ? 33.599 -17.317 8.720   1.00   4.02  ? 235  THR A C    1 
ATOM   3305 O O    . THR A 1 209 ? 34.387 -18.059 8.145   1.00   4.25  ? 235  THR A O    1 
ATOM   3306 C CB   . THR A 1 209 ? 32.571 -17.829 10.909  1.00   4.55  ? 235  THR A CB   1 
ATOM   3307 O OG1  . THR A 1 209 ? 33.546 -18.822 11.233  1.00   5.64  ? 235  THR A OG1  1 
ATOM   3308 C CG2  . THR A 1 209 ? 31.295 -18.111 11.679  1.00   5.38  ? 235  THR A CG2  1 
ATOM   3309 H H    . THR A 1 209 ? 32.336 -19.787 9.508   1.00   4.61  ? 235  THR A H    1 
ATOM   3310 H HA   . THR A 1 209 ? 31.599 -17.253 9.192   1.00   4.40  ? 235  THR A HA   1 
ATOM   3311 H HB   . THR A 1 209 ? 32.901 -16.956 11.175  1.00   5.46  ? 235  THR A HB   1 
ATOM   3312 H HG1  . THR A 1 209 ? 34.267 -18.656 10.836  1.00   6.76  ? 235  THR A HG1  1 
ATOM   3313 H HG21 . THR A 1 209 ? 30.949 -18.984 11.437  1.00   6.46  ? 235  THR A HG21 1 
ATOM   3314 H HG22 . THR A 1 209 ? 31.473 -18.095 12.632  1.00   6.46  ? 235  THR A HG22 1 
ATOM   3315 H HG23 . THR A 1 209 ? 30.628 -17.438 11.472  1.00   6.46  ? 235  THR A HG23 1 
ATOM   3316 N N    . GLY A 1 210 ? 33.829 -16.024 8.845   1.00   4.20  ? 236  GLY A N    1 
ATOM   3317 C CA   . GLY A 1 210 ? 35.116 -15.458 8.534   1.00   5.29  ? 236  GLY A CA   1 
ATOM   3318 C C    . GLY A 1 210 ? 35.257 -14.112 9.179   1.00   5.90  ? 236  GLY A C    1 
ATOM   3319 O O    . GLY A 1 210 ? 34.380 -13.307 9.096   1.00   9.05  ? 236  GLY A O    1 
ATOM   3320 H H    . GLY A 1 210 ? 33.247 -15.450 9.111   1.00   5.03  ? 236  GLY A H    1 
ATOM   3321 H HA2  . GLY A 1 210 ? 35.821 -16.039 8.860   1.00   6.35  ? 236  GLY A HA2  1 
ATOM   3322 H HA3  . GLY A 1 210 ? 35.210 -15.357 7.574   1.00   6.35  ? 236  GLY A HA3  1 
ATOM   3323 N N    . SER A 1 211 ? 36.401 -13.847 9.747   1.00   7.04  ? 237  SER A N    1 
ATOM   3324 C CA   . SER A 1 211 ? 36.672 -12.566 10.348  1.00   8.46  ? 237  SER A CA   1 
ATOM   3325 C C    . SER A 1 211 ? 38.057 -12.096 9.998   1.00   7.90  ? 237  SER A C    1 
ATOM   3326 O O    . SER A 1 211 ? 38.961 -12.883 9.733   1.00   10.86 ? 237  SER A O    1 
ATOM   3327 C CB   . SER A 1 211 ? 36.506 -12.639 11.851  1.00   12.74 ? 237  SER A CB   1 
ATOM   3328 O OG   . SER A 1 211 ? 37.506 -13.428 12.383  1.00   18.28 ? 237  SER A OG   1 
ATOM   3329 H H    . SER A 1 211 ? 37.055 -14.403 9.801   1.00   8.45  ? 237  SER A H    1 
ATOM   3330 H HA   . SER A 1 211 ? 36.039 -11.916 10.007  1.00   10.15 ? 237  SER A HA   1 
ATOM   3331 H HB2  . SER A 1 211 ? 36.570 -11.747 12.225  1.00   15.29 ? 237  SER A HB2  1 
ATOM   3332 H HB3  . SER A 1 211 ? 35.644 -13.031 12.060  1.00   15.29 ? 237  SER A HB3  1 
ATOM   3333 H HG   . SER A 1 211 ? 37.422 -13.474 13.218  1.00   21.93 ? 237  SER A HG   1 
ATOM   3334 N N    . GLY A 1 212 ? 38.227 -10.804 9.996   1.00   6.27  ? 238  GLY A N    1 
ATOM   3335 C CA   . GLY A 1 212 ? 39.486 -10.234 9.623   1.00   6.58  ? 238  GLY A CA   1 
ATOM   3336 C C    . GLY A 1 212 ? 39.625 -8.853  10.188  1.00   5.71  ? 238  GLY A C    1 
ATOM   3337 O O    . GLY A 1 212 ? 38.882 -8.422  11.073  1.00   6.14  ? 238  GLY A O    1 
ATOM   3338 H H    . GLY A 1 212 ? 37.624 -10.229 10.209  1.00   7.53  ? 238  GLY A H    1 
ATOM   3339 H HA2  . GLY A 1 212 ? 40.210 -10.785 9.960   1.00   7.90  ? 238  GLY A HA2  1 
ATOM   3340 H HA3  . GLY A 1 212 ? 39.553 -10.186 8.656   1.00   7.90  ? 238  GLY A HA3  1 
ATOM   3341 N N    . ASP A 1 213 ? 40.616 -8.162  9.664   1.00   5.87  ? 240  ASP A N    1 
ATOM   3342 C CA   . ASP A 1 213 ? 40.868 -6.773  10.036  1.00   6.09  ? 240  ASP A CA   1 
ATOM   3343 C C    . ASP A 1 213 ? 39.723 -5.888  9.532   1.00   5.27  ? 240  ASP A C    1 
ATOM   3344 O O    . ASP A 1 213 ? 38.800 -6.354  8.847   1.00   5.32  ? 240  ASP A O    1 
ATOM   3345 C CB   . ASP A 1 213 ? 42.215 -6.307  9.470   1.00   8.13  ? 240  ASP A CB   1 
ATOM   3346 C CG   . ASP A 1 213 ? 43.405 -6.959  10.135  1.00   12.56 ? 240  ASP A CG   1 
ATOM   3347 O OD1  . ASP A 1 213 ? 43.261 -7.643  11.175  1.00   14.72 ? 240  ASP A OD1  1 
ATOM   3348 O OD2  . ASP A 1 213 ? 44.509 -6.780  9.599   1.00   15.19 ? 240  ASP A OD2  1 
ATOM   3349 H H    . ASP A 1 213 ? 41.168 -8.473  9.082   1.00   7.04  ? 240  ASP A H    1 
ATOM   3350 H HA   . ASP A 1 213 ? 40.904 -6.702  11.002  1.00   7.30  ? 240  ASP A HA   1 
ATOM   3351 H HB2  . ASP A 1 213 ? 42.248 -6.520  8.525   1.00   9.75  ? 240  ASP A HB2  1 
ATOM   3352 H HB3  . ASP A 1 213 ? 42.292 -5.348  9.595   1.00   9.75  ? 240  ASP A HB3  1 
ATOM   3353 N N    . TYR A 1 214 ? 39.767 -4.612  9.909   1.00   5.30  ? 241  TYR A N    1 
ATOM   3354 C CA   . TYR A 1 214 ? 38.677 -3.679  9.643   1.00   5.19  ? 241  TYR A CA   1 
ATOM   3355 C C    . TYR A 1 214 ? 37.383 -4.225  10.250  1.00   4.88  ? 241  TYR A C    1 
ATOM   3356 O O    . TYR A 1 214 ? 36.297 -3.949  9.776   1.00   4.93  ? 241  TYR A O    1 
ATOM   3357 C CB   . TYR A 1 214 ? 38.588 -3.309  8.147   1.00   5.51  ? 241  TYR A CB   1 
ATOM   3358 C CG   . TYR A 1 214 ? 39.793 -2.495  7.779   1.00   5.67  ? 241  TYR A CG   1 
ATOM   3359 C CD1  . TYR A 1 214 ? 40.972 -3.101  7.369   1.00   6.18  ? 241  TYR A CD1  1 
ATOM   3360 C CD2  . TYR A 1 214 ? 39.771 -1.121  7.888   1.00   6.71  ? 241  TYR A CD2  1 
ATOM   3361 C CE1  . TYR A 1 214 ? 42.103 -2.366  7.100   1.00   8.06  ? 241  TYR A CE1  1 
ATOM   3362 C CE2  . TYR A 1 214 ? 40.888 -0.375  7.601   1.00   7.81  ? 241  TYR A CE2  1 
ATOM   3363 C CZ   . TYR A 1 214 ? 42.045 -0.992  7.201   1.00   9.13  ? 241  TYR A CZ   1 
ATOM   3364 O OH   . TYR A 1 214 ? 43.185 -0.244  6.920   1.00   11.55 ? 241  TYR A OH   1 
ATOM   3365 H H    . TYR A 1 214 ? 40.430 -4.257  10.326  1.00   6.36  ? 241  TYR A H    1 
ATOM   3366 H HA   . TYR A 1 214 ? 38.876 -2.856  10.117  1.00   6.23  ? 241  TYR A HA   1 
ATOM   3367 H HB2  . TYR A 1 214 ? 38.579 -4.116  7.609   1.00   6.61  ? 241  TYR A HB2  1 
ATOM   3368 H HB3  . TYR A 1 214 ? 37.792 -2.778  7.986   1.00   6.61  ? 241  TYR A HB3  1 
ATOM   3369 H HD1  . TYR A 1 214 ? 41.009 -4.029  7.313   1.00   7.41  ? 241  TYR A HD1  1 
ATOM   3370 H HD2  . TYR A 1 214 ? 38.994 -0.694  8.168   1.00   8.05  ? 241  TYR A HD2  1 
ATOM   3371 H HE1  . TYR A 1 214 ? 42.884 -2.786  6.821   1.00   9.67  ? 241  TYR A HE1  1 
ATOM   3372 H HE2  . TYR A 1 214 ? 40.859 0.551   7.678   1.00   9.37  ? 241  TYR A HE2  1 
ATOM   3373 H HH   . TYR A 1 214 ? 43.812 -0.752  6.688   1.00   13.86 ? 241  TYR A HH   1 
ATOM   3374 N N    . GLY A 1 215 ? 37.526 -4.992  11.325  1.00   4.68  ? 242  GLY A N    1 
ATOM   3375 C CA   . GLY A 1 215 ? 36.372 -5.548  12.005  1.00   4.66  ? 242  GLY A CA   1 
ATOM   3376 C C    . GLY A 1 215 ? 35.472 -6.333  11.074  1.00   4.78  ? 242  GLY A C    1 
ATOM   3377 O O    . GLY A 1 215 ? 34.265 -6.390  11.278  1.00   5.10  ? 242  GLY A O    1 
ATOM   3378 H H    . GLY A 1 215 ? 38.281 -5.203  11.679  1.00   5.61  ? 242  GLY A H    1 
ATOM   3379 H HA2  . GLY A 1 215 ? 36.670 -6.139  12.714  1.00   5.59  ? 242  GLY A HA2  1 
ATOM   3380 H HA3  . GLY A 1 215 ? 35.854 -4.830  12.400  1.00   5.59  ? 242  GLY A HA3  1 
ATOM   3381 N N    . THR A 1 216 ? 36.065 -6.955  10.068  1.00   4.41  ? 243  THR A N    1 
ATOM   3382 C CA   . THR A 1 216 ? 35.307 -7.637  9.034   1.00   4.07  ? 243  THR A CA   1 
ATOM   3383 C C    . THR A 1 216 ? 34.794 -8.914  9.645   1.00   4.46  ? 243  THR A C    1 
ATOM   3384 O O    . THR A 1 216 ? 35.558 -9.710  10.198  1.00   5.14  ? 243  THR A O    1 
ATOM   3385 C CB   . THR A 1 216 ? 36.139 -7.861  7.788   1.00   4.51  ? 243  THR A CB   1 
ATOM   3386 O OG1  . THR A 1 216 ? 36.576 -6.594  7.289   1.00   4.95  ? 243  THR A OG1  1 
ATOM   3387 C CG2  . THR A 1 216 ? 35.345 -8.525  6.700   1.00   4.57  ? 243  THR A CG2  1 
ATOM   3388 H H    . THR A 1 216 ? 36.918 -6.997  9.960   1.00   5.29  ? 243  THR A H    1 
ATOM   3389 H HA   . THR A 1 216 ? 34.542 -7.092  8.790   1.00   4.89  ? 243  THR A HA   1 
ATOM   3390 H HB   . THR A 1 216 ? 36.908 -8.414  7.999   1.00   5.42  ? 243  THR A HB   1 
ATOM   3391 H HG1  . THR A 1 216 ? 37.039 -6.200  7.868   1.00   5.94  ? 243  THR A HG1  1 
ATOM   3392 H HG21 . THR A 1 216 ? 34.585 -7.972  6.459   1.00   5.48  ? 243  THR A HG21 1 
ATOM   3393 H HG22 . THR A 1 216 ? 35.901 -8.656  5.916   1.00   5.48  ? 243  THR A HG22 1 
ATOM   3394 H HG23 . THR A 1 216 ? 35.022 -9.388  7.005   1.00   5.48  ? 243  THR A HG23 1 
ATOM   3395 N N    . THR A 1 217 ? 33.478 -9.088  9.578   1.00   4.21  ? 244  THR A N    1 
ATOM   3396 C CA   . THR A 1 217 ? 32.798 -10.152 10.298  1.00   4.76  ? 244  THR A CA   1 
ATOM   3397 C C    . THR A 1 217 ? 31.726 -10.725 9.392   1.00   4.23  ? 244  THR A C    1 
ATOM   3398 O O    . THR A 1 217 ? 30.777 -10.023 9.041   1.00   4.76  ? 244  THR A O    1 
ATOM   3399 C CB   . THR A 1 217 ? 32.161 -9.614  11.573  1.00   5.23  ? 244  THR A CB   1 
ATOM   3400 O OG1  . THR A 1 217 ? 33.077 -8.753  12.281  1.00   6.11  ? 244  THR A OG1  1 
ATOM   3401 C CG2  . THR A 1 217 ? 31.807 -10.758 12.471  1.00   5.69  ? 244  THR A CG2  1 
ATOM   3402 H H    . THR A 1 217 ? 32.950 -8.592  9.114   1.00   5.05  ? 244  THR A H    1 
ATOM   3403 H HA   . THR A 1 217 ? 33.427 -10.854 10.529  1.00   5.71  ? 244  THR A HA   1 
ATOM   3404 H HB   . THR A 1 217 ? 31.352 -9.125  11.356  1.00   6.28  ? 244  THR A HB   1 
ATOM   3405 H HG1  . THR A 1 217 ? 33.293 -8.103  11.795  1.00   7.34  ? 244  THR A HG1  1 
ATOM   3406 H HG21 . THR A 1 217 ? 32.606 -11.260 12.699  1.00   6.83  ? 244  THR A HG21 1 
ATOM   3407 H HG22 . THR A 1 217 ? 31.401 -10.426 13.287  1.00   6.83  ? 244  THR A HG22 1 
ATOM   3408 H HG23 . THR A 1 217 ? 31.181 -11.348 12.024  1.00   6.83  ? 244  THR A HG23 1 
ATOM   3409 N N    . ASN A 1 218 ? 31.931 -11.985 8.997   1.00   3.94  ? 245  ASN A N    1 
ATOM   3410 C CA   . ASN A 1 218 ? 31.169 -12.602 7.943   1.00   3.81  ? 245  ASN A CA   1 
ATOM   3411 C C    . ASN A 1 218 ? 30.641 -13.968 8.354   1.00   3.48  ? 245  ASN A C    1 
ATOM   3412 O O    . ASN A 1 218 ? 31.234 -14.659 9.185   1.00   3.86  ? 245  ASN A O    1 
ATOM   3413 C CB   . ASN A 1 218 ? 32.053 -12.802 6.709   1.00   4.43  ? 245  ASN A CB   1 
ATOM   3414 C CG   . ASN A 1 218 ? 32.556 -11.530 6.106   1.00   4.17  ? 245  ASN A CG   1 
ATOM   3415 O OD1  . ASN A 1 218 ? 31.969 -10.451 6.241   1.00   4.86  ? 245  ASN A OD1  1 
ATOM   3416 N ND2  . ASN A 1 218 ? 33.661 -11.660 5.394   1.00   4.75  ? 245  ASN A ND2  1 
ATOM   3417 H H    . ASN A 1 218 ? 32.524 -12.505 9.341   1.00   4.73  ? 245  ASN A H    1 
ATOM   3418 H HA   . ASN A 1 218 ? 30.419 -12.035 7.703   1.00   4.58  ? 245  ASN A HA   1 
ATOM   3419 H HB2  . ASN A 1 218 ? 32.823 -13.335 6.962   1.00   5.32  ? 245  ASN A HB2  1 
ATOM   3420 H HB3  . ASN A 1 218 ? 31.540 -13.269 6.031   1.00   5.32  ? 245  ASN A HB3  1 
ATOM   3421 H HD21 . ASN A 1 218 ? 34.030 -12.432 5.309   1.00   5.70  ? 245  ASN A HD21 1 
ATOM   3422 H HD22 . ASN A 1 218 ? 34.012 -10.972 5.015   1.00   5.70  ? 245  ASN A HD22 1 
ATOM   3423 N N    . ASP A 1 219 ? 29.572 -14.396 7.701   1.00   3.19  ? 246  ASP A N    1 
ATOM   3424 C CA   . ASP A 1 219 ? 29.080 -15.762 7.868   1.00   3.60  ? 246  ASP A CA   1 
ATOM   3425 C C    . ASP A 1 219 ? 28.239 -16.072 6.635   1.00   3.30  ? 246  ASP A C    1 
ATOM   3426 O O    . ASP A 1 219 ? 27.531 -15.209 6.130   1.00   4.02  ? 246  ASP A O    1 
ATOM   3427 C CB   . ASP A 1 219 ? 28.241 -15.872 9.151   1.00   3.88  ? 246  ASP A CB   1 
ATOM   3428 C CG   . ASP A 1 219 ? 28.021 -17.280 9.650   1.00   4.47  ? 246  ASP A CG   1 
ATOM   3429 O OD1  . ASP A 1 219 ? 28.755 -18.203 9.249   1.00   4.45  ? 246  ASP A OD1  1 
ATOM   3430 O OD2  . ASP A 1 219 ? 27.137 -17.427 10.527  1.00   5.04  ? 246  ASP A OD2  1 
ATOM   3431 H H    . ASP A 1 219 ? 29.111 -13.919 7.154   1.00   3.83  ? 246  ASP A H    1 
ATOM   3432 H HA   . ASP A 1 219 ? 29.822 -16.385 7.915   1.00   4.32  ? 246  ASP A HA   1 
ATOM   3433 H HB2  . ASP A 1 219 ? 28.689 -15.379 9.856   1.00   4.65  ? 246  ASP A HB2  1 
ATOM   3434 H HB3  . ASP A 1 219 ? 27.369 -15.481 8.985   1.00   4.65  ? 246  ASP A HB3  1 
ATOM   3435 N N    . ILE A 1 220 ? 28.363 -17.310 6.160   1.00   3.37  ? 247  ILE A N    1 
ATOM   3436 C CA   . ILE A 1 220 ? 27.579 -17.806 5.039   1.00   3.41  ? 247  ILE A CA   1 
ATOM   3437 C C    . ILE A 1 220 ? 26.943 -19.093 5.495   1.00   3.57  ? 247  ILE A C    1 
ATOM   3438 O O    . ILE A 1 220 ? 27.618 -19.936 6.075   1.00   3.95  ? 247  ILE A O    1 
ATOM   3439 C CB   . ILE A 1 220 ? 28.396 -17.907 3.727   1.00   3.77  ? 247  ILE A CB   1 
ATOM   3440 C CG1  . ILE A 1 220 ? 29.423 -19.035 3.710   1.00   4.07  ? 247  ILE A CG1  1 
ATOM   3441 C CG2  . ILE A 1 220 ? 29.067 -16.565 3.458   1.00   3.87  ? 247  ILE A CG2  1 
ATOM   3442 C CD1  . ILE A 1 220 ? 30.155 -19.193 2.405   1.00   4.48  ? 247  ILE A CD1  1 
ATOM   3443 H H    . ILE A 1 220 ? 28.909 -17.892 6.481   1.00   4.04  ? 247  ILE A H    1 
ATOM   3444 H HA   . ILE A 1 220 ? 26.860 -17.177 4.874   1.00   4.10  ? 247  ILE A HA   1 
ATOM   3445 H HB   . ILE A 1 220 ? 27.769 -18.072 3.004   1.00   4.53  ? 247  ILE A HB   1 
ATOM   3446 H HG12 . ILE A 1 220 ? 30.084 -18.863 4.399   1.00   4.89  ? 247  ILE A HG12 1 
ATOM   3447 H HG13 . ILE A 1 220 ? 28.968 -19.871 3.896   1.00   4.89  ? 247  ILE A HG13 1 
ATOM   3448 H HG21 . ILE A 1 220 ? 29.655 -16.352 4.199   1.00   4.64  ? 247  ILE A HG21 1 
ATOM   3449 H HG22 . ILE A 1 220 ? 29.578 -16.627 2.636   1.00   4.64  ? 247  ILE A HG22 1 
ATOM   3450 H HG23 . ILE A 1 220 ? 28.383 -15.882 3.371   1.00   4.64  ? 247  ILE A HG23 1 
ATOM   3451 H HD11 . ILE A 1 220 ? 30.629 -18.370 2.208   1.00   5.38  ? 247  ILE A HD11 1 
ATOM   3452 H HD12 . ILE A 1 220 ? 30.784 -19.927 2.483   1.00   5.38  ? 247  ILE A HD12 1 
ATOM   3453 H HD13 . ILE A 1 220 ? 29.511 -19.380 1.704   1.00   5.38  ? 247  ILE A HD13 1 
ATOM   3454 N N    . ALA A 1 221 ? 25.645 -19.250 5.245   1.00   3.97  ? 248  ALA A N    1 
ATOM   3455 C CA   . ALA A 1 221 ? 24.879 -20.345 5.818   1.00   4.16  ? 248  ALA A CA   1 
ATOM   3456 C C    . ALA A 1 221 ? 23.857 -20.916 4.879   1.00   4.00  ? 248  ALA A C    1 
ATOM   3457 O O    . ALA A 1 221 ? 23.287 -20.205 4.047   1.00   4.03  ? 248  ALA A O    1 
ATOM   3458 C CB   . ALA A 1 221 ? 24.172 -19.876 7.114   1.00   4.64  ? 248  ALA A CB   1 
ATOM   3459 H H    . ALA A 1 221 ? 25.184 -18.728 4.741   1.00   4.76  ? 248  ALA A H    1 
ATOM   3460 H HA   . ALA A 1 221 ? 25.491 -21.059 6.057   1.00   4.99  ? 248  ALA A HA   1 
ATOM   3461 H HB1  . ALA A 1 221 ? 23.575 -19.142 6.900   1.00   5.57  ? 248  ALA A HB1  1 
ATOM   3462 H HB2  . ALA A 1 221 ? 23.666 -20.617 7.483   1.00   5.57  ? 248  ALA A HB2  1 
ATOM   3463 H HB3  . ALA A 1 221 ? 24.842 -19.583 7.751   1.00   5.57  ? 248  ALA A HB3  1 
ATOM   3464 N N    . VAL A 1 222 ? 23.598 -22.194 5.092   1.00   4.13  ? 249  VAL A N    1 
ATOM   3465 C CA   A VAL A 1 222 ? 22.427 -22.880 4.557   0.70   5.05  ? 249  VAL A CA   1 
ATOM   3466 C CA   B VAL A 1 222 ? 22.435 -22.864 4.548   0.30   4.97  ? 249  VAL A CA   1 
ATOM   3467 C C    . VAL A 1 222 ? 21.583 -23.284 5.748   1.00   5.26  ? 249  VAL A C    1 
ATOM   3468 O O    . VAL A 1 222 ? 22.095 -23.792 6.739   1.00   5.93  ? 249  VAL A O    1 
ATOM   3469 C CB   A VAL A 1 222 ? 22.790 -24.088 3.737   0.70   5.45  ? 249  VAL A CB   1 
ATOM   3470 C CB   B VAL A 1 222 ? 22.818 -24.000 3.561   0.30   5.32  ? 249  VAL A CB   1 
ATOM   3471 C CG1  A VAL A 1 222 ? 21.534 -24.700 3.100   0.70   4.14  ? 249  VAL A CG1  1 
ATOM   3472 C CG1  B VAL A 1 222 ? 23.338 -23.391 2.330   0.30   6.62  ? 249  VAL A CG1  1 
ATOM   3473 C CG2  A VAL A 1 222 ? 23.774 -23.700 2.696   0.70   6.25  ? 249  VAL A CG2  1 
ATOM   3474 C CG2  B VAL A 1 222 ? 23.887 -24.965 4.125   0.30   4.33  ? 249  VAL A CG2  1 
ATOM   3475 H H    A VAL A 1 222 ? 24.104 -22.708 5.561   0.70   4.96  ? 249  VAL A H    1 
ATOM   3476 H H    B VAL A 1 222 ? 24.099 -22.710 5.563   0.30   4.96  ? 249  VAL A H    1 
ATOM   3477 H HA   A VAL A 1 222 ? 21.914 -22.271 4.004   0.70   6.06  ? 249  VAL A HA   1 
ATOM   3478 H HA   B VAL A 1 222 ? 21.919 -22.214 4.046   0.30   5.96  ? 249  VAL A HA   1 
ATOM   3479 H HB   A VAL A 1 222 ? 23.198 -24.756 4.310   0.70   6.54  ? 249  VAL A HB   1 
ATOM   3480 H HB   B VAL A 1 222 ? 22.026 -24.515 3.337   0.30   6.38  ? 249  VAL A HB   1 
ATOM   3481 H HG11 A VAL A 1 222 ? 21.117 -24.037 2.526   0.70   4.97  ? 249  VAL A HG11 1 
ATOM   3482 H HG11 B VAL A 1 222 ? 24.119 -22.859 2.548   0.30   7.94  ? 249  VAL A HG11 1 
ATOM   3483 H HG12 A VAL A 1 222 ? 21.792 -25.475 2.577   0.70   4.97  ? 249  VAL A HG12 1 
ATOM   3484 H HG12 B VAL A 1 222 ? 23.580 -24.095 1.708   0.30   7.94  ? 249  VAL A HG12 1 
ATOM   3485 H HG13 A VAL A 1 222 ? 20.920 -24.963 3.803   0.70   4.97  ? 249  VAL A HG13 1 
ATOM   3486 H HG13 B VAL A 1 222 ? 22.651 -22.827 1.942   0.30   7.94  ? 249  VAL A HG13 1 
ATOM   3487 H HG21 A VAL A 1 222 ? 24.567 -23.347 3.128   0.70   7.50  ? 249  VAL A HG21 1 
ATOM   3488 H HG21 B VAL A 1 222 ? 23.544 -25.378 4.933   0.30   5.20  ? 249  VAL A HG21 1 
ATOM   3489 H HG22 A VAL A 1 222 ? 24.003 -24.483 2.171   0.70   7.50  ? 249  VAL A HG22 1 
ATOM   3490 H HG22 B VAL A 1 222 ? 24.078 -25.646 3.461   0.30   5.20  ? 249  VAL A HG22 1 
ATOM   3491 H HG23 A VAL A 1 222 ? 23.378 -23.023 2.125   0.70   7.50  ? 249  VAL A HG23 1 
ATOM   3492 H HG23 B VAL A 1 222 ? 24.691 -24.462 4.325   0.30   5.20  ? 249  VAL A HG23 1 
ATOM   3493 N N    . ILE A 1 223 ? 20.297 -23.006 5.658   1.00   5.84  ? 250  ILE A N    1 
ATOM   3494 C CA   . ILE A 1 223 ? 19.374 -23.115 6.761   1.00   5.84  ? 250  ILE A CA   1 
ATOM   3495 C C    . ILE A 1 223 ? 18.190 -23.963 6.342   1.00   5.93  ? 250  ILE A C    1 
ATOM   3496 O O    . ILE A 1 223 ? 17.584 -23.700 5.310   1.00   5.96  ? 250  ILE A O    1 
ATOM   3497 C CB   . ILE A 1 223 ? 18.876 -21.702 7.136   1.00   6.83  ? 250  ILE A CB   1 
ATOM   3498 C CG1  . ILE A 1 223 ? 20.029 -20.776 7.572   1.00   7.71  ? 250  ILE A CG1  1 
ATOM   3499 C CG2  . ILE A 1 223 ? 17.794 -21.759 8.212   1.00   7.34  ? 250  ILE A CG2  1 
ATOM   3500 C CD1  . ILE A 1 223 ? 19.670 -19.297 7.524   1.00   8.66  ? 250  ILE A CD1  1 
ATOM   3501 H H    . ILE A 1 223 ? 19.922 -22.739 4.931   1.00   7.01  ? 250  ILE A H    1 
ATOM   3502 H HA   . ILE A 1 223 ? 19.808 -23.520 7.529   1.00   7.00  ? 250  ILE A HA   1 
ATOM   3503 H HB   . ILE A 1 223 ? 18.477 -21.314 6.342   1.00   8.20  ? 250  ILE A HB   1 
ATOM   3504 H HG12 . ILE A 1 223 ? 20.278 -20.993 8.484   1.00   9.25  ? 250  ILE A HG12 1 
ATOM   3505 H HG13 . ILE A 1 223 ? 20.785 -20.918 6.981   1.00   9.25  ? 250  ILE A HG13 1 
ATOM   3506 H HG21 . ILE A 1 223 ? 18.159 -22.181 9.005   1.00   8.81  ? 250  ILE A HG21 1 
ATOM   3507 H HG22 . ILE A 1 223 ? 17.508 -20.855 8.420   1.00   8.81  ? 250  ILE A HG22 1 
ATOM   3508 H HG23 . ILE A 1 223 ? 17.043 -22.275 7.878   1.00   8.81  ? 250  ILE A HG23 1 
ATOM   3509 H HD11 . ILE A 1 223 ? 18.921 -19.135 8.119   1.00   10.40 ? 250  ILE A HD11 1 
ATOM   3510 H HD12 . ILE A 1 223 ? 20.438 -18.777 7.809   1.00   10.40 ? 250  ILE A HD12 1 
ATOM   3511 H HD13 . ILE A 1 223 ? 19.429 -19.060 6.615   1.00   10.40 ? 250  ILE A HD13 1 
ATOM   3512 N N    . TRP A 1 224 ? 17.874 -24.973 7.144   1.00   5.62  ? 251  TRP A N    1 
ATOM   3513 C CA   . TRP A 1 224 ? 16.767 -25.884 6.881   1.00   6.66  ? 251  TRP A CA   1 
ATOM   3514 C C    . TRP A 1 224 ? 15.703 -25.700 7.961   1.00   7.46  ? 251  TRP A C    1 
ATOM   3515 O O    . TRP A 1 224 ? 15.798 -26.266 9.036   1.00   8.70  ? 251  TRP A O    1 
ATOM   3516 C CB   . TRP A 1 224 ? 17.258 -27.325 6.924   1.00   7.02  ? 251  TRP A CB   1 
ATOM   3517 C CG   . TRP A 1 224 ? 18.145 -27.754 5.777   1.00   6.89  ? 251  TRP A CG   1 
ATOM   3518 C CD1  . TRP A 1 224 ? 17.751 -28.434 4.664   1.00   7.15  ? 251  TRP A CD1  1 
ATOM   3519 C CD2  . TRP A 1 224 ? 19.568 -27.621 5.678   1.00   6.11  ? 251  TRP A CD2  1 
ATOM   3520 N NE1  . TRP A 1 224 ? 18.821 -28.720 3.861   1.00   7.58  ? 251  TRP A NE1  1 
ATOM   3521 C CE2  . TRP A 1 224 ? 19.956 -28.233 4.465   1.00   7.03  ? 251  TRP A CE2  1 
ATOM   3522 C CE3  . TRP A 1 224 ? 20.541 -27.044 6.494   1.00   6.59  ? 251  TRP A CE3  1 
ATOM   3523 C CZ2  . TRP A 1 224 ? 21.284 -28.296 4.050   1.00   7.95  ? 251  TRP A CZ2  1 
ATOM   3524 C CZ3  . TRP A 1 224 ? 21.861 -27.105 6.074   1.00   6.74  ? 251  TRP A CZ3  1 
ATOM   3525 C CH2  . TRP A 1 224 ? 22.218 -27.726 4.864   1.00   7.69  ? 251  TRP A CH2  1 
ATOM   3526 H H    . TRP A 1 224 ? 18.299 -25.156 7.869   1.00   6.75  ? 251  TRP A H    1 
ATOM   3527 H HA   . TRP A 1 224 ? 16.379 -25.702 6.011   1.00   8.00  ? 251  TRP A HA   1 
ATOM   3528 H HB2  . TRP A 1 224 ? 17.761 -27.452 7.743   1.00   8.43  ? 251  TRP A HB2  1 
ATOM   3529 H HB3  . TRP A 1 224 ? 16.485 -27.911 6.927   1.00   8.43  ? 251  TRP A HB3  1 
ATOM   3530 H HD1  . TRP A 1 224 ? 16.872 -28.669 4.474   1.00   8.58  ? 251  TRP A HD1  1 
ATOM   3531 H HE1  . TRP A 1 224 ? 18.790 -29.137 3.109   1.00   9.09  ? 251  TRP A HE1  1 
ATOM   3532 H HE3  . TRP A 1 224 ? 20.315 -26.651 7.306   1.00   7.91  ? 251  TRP A HE3  1 
ATOM   3533 H HZ2  . TRP A 1 224 ? 21.520 -28.687 3.241   1.00   9.54  ? 251  TRP A HZ2  1 
ATOM   3534 H HZ3  . TRP A 1 224 ? 22.526 -26.726 6.603   1.00   8.09  ? 251  TRP A HZ3  1 
ATOM   3535 H HH2  . TRP A 1 224 ? 23.110 -27.730 4.602   1.00   9.23  ? 251  TRP A HH2  1 
ATOM   3536 N N    . PRO A 1 225 ? 14.678 -24.878 7.682   1.00   8.07  ? 252  PRO A N    1 
ATOM   3537 C CA   . PRO A 1 225 ? 13.545 -24.791 8.617   1.00   9.15  ? 252  PRO A CA   1 
ATOM   3538 C C    . PRO A 1 225 ? 12.809 -26.130 8.753   1.00   8.95  ? 252  PRO A C    1 
ATOM   3539 O O    . PRO A 1 225 ? 12.945 -27.041 7.946   1.00   9.24  ? 252  PRO A O    1 
ATOM   3540 C CB   . PRO A 1 225 ? 12.648 -23.743 7.957   1.00   9.75  ? 252  PRO A CB   1 
ATOM   3541 C CG   . PRO A 1 225 ? 13.619 -22.917 7.090   1.00   8.93  ? 252  PRO A CG   1 
ATOM   3542 C CD   . PRO A 1 225 ? 14.516 -23.968 6.542   1.00   7.62  ? 252  PRO A CD   1 
ATOM   3543 H HA   . PRO A 1 225 ? 13.834 -24.479 9.488   1.00   10.98 ? 252  PRO A HA   1 
ATOM   3544 H HB2  . PRO A 1 225 ? 11.979 -24.180 7.407   1.00   11.70 ? 252  PRO A HB2  1 
ATOM   3545 H HB3  . PRO A 1 225 ? 12.233 -23.189 8.635   1.00   11.70 ? 252  PRO A HB3  1 
ATOM   3546 H HG2  . PRO A 1 225 ? 13.134 -22.464 6.382   1.00   10.71 ? 252  PRO A HG2  1 
ATOM   3547 H HG3  . PRO A 1 225 ? 14.109 -22.288 7.642   1.00   10.71 ? 252  PRO A HG3  1 
ATOM   3548 H HD2  . PRO A 1 225 ? 14.091 -24.425 5.799   1.00   9.14  ? 252  PRO A HD2  1 
ATOM   3549 H HD3  . PRO A 1 225 ? 15.371 -23.586 6.287   1.00   9.14  ? 252  PRO A HD3  1 
ATOM   3550 N N    . GLU A 1 226 ? 12.001 -26.245 9.796   1.00   9.70  ? 254  GLU A N    1 
ATOM   3551 C CA   . GLU A 1 226 ? 11.304 -27.483 10.084  1.00   10.08 ? 254  GLU A CA   1 
ATOM   3552 C C    . GLU A 1 226 ? 10.180 -27.798 9.119   1.00   10.11 ? 254  GLU A C    1 
ATOM   3553 O O    . GLU A 1 226 ? 9.894  -28.983 8.914   1.00   11.68 ? 254  GLU A O    1 
ATOM   3554 C CB   . GLU A 1 226 ? 10.735 -27.444 11.502  1.00   10.96 ? 254  GLU A CB   1 
ATOM   3555 C CG   . GLU A 1 226 ? 9.825  -28.594 11.877  1.00   11.68 ? 254  GLU A CG   1 
ATOM   3556 C CD   . GLU A 1 226 ? 10.444 -29.960 11.755  1.00   12.50 ? 254  GLU A CD   1 
ATOM   3557 O OE1  . GLU A 1 226 ? 11.688 -30.101 11.910  1.00   14.33 ? 254  GLU A OE1  1 
ATOM   3558 O OE2  . GLU A 1 226 ? 9.684  -30.917 11.487  1.00   13.09 ? 254  GLU A OE2  1 
ATOM   3559 H H    . GLU A 1 226 ? 11.839 -25.613 10.356  1.00   11.64 ? 254  GLU A H    1 
ATOM   3560 H HA   . GLU A 1 226 ? 11.941 -28.214 10.042  1.00   12.10 ? 254  GLU A HA   1 
ATOM   3561 H HB2  . GLU A 1 226 ? 11.476 -27.444 12.129  1.00   13.16 ? 254  GLU A HB2  1 
ATOM   3562 H HB3  . GLU A 1 226 ? 10.225 -26.625 11.604  1.00   13.16 ? 254  GLU A HB3  1 
ATOM   3563 H HG2  . GLU A 1 226 ? 9.547  -28.480 12.799  1.00   14.02 ? 254  GLU A HG2  1 
ATOM   3564 H HG3  . GLU A 1 226 ? 9.047  -28.573 11.298  1.00   14.02 ? 254  GLU A HG3  1 
ATOM   3565 N N    . ASN A 1 227 ? 9.561  -26.752 8.570   1.00   9.00  ? 255  ASN A N    1 
ATOM   3566 C CA   . ASN A 1 227 ? 8.358  -26.850 7.749   1.00   9.08  ? 255  ASN A CA   1 
ATOM   3567 C C    . ASN A 1 227 ? 8.430  -26.024 6.475   1.00   9.42  ? 255  ASN A C    1 
ATOM   3568 O O    . ASN A 1 227 ? 7.406  -25.716 5.889   1.00   11.65 ? 255  ASN A O    1 
ATOM   3569 C CB   . ASN A 1 227 ? 7.141  -26.405 8.559   1.00   10.14 ? 255  ASN A CB   1 
ATOM   3570 C CG   . ASN A 1 227 ? 6.949  -27.236 9.780   1.00   10.31 ? 255  ASN A CG   1 
ATOM   3571 O OD1  . ASN A 1 227 ? 6.779  -28.444 9.687   1.00   11.21 ? 255  ASN A OD1  1 
ATOM   3572 N ND2  . ASN A 1 227 ? 6.993  -26.615 10.935  1.00   10.70 ? 255  ASN A ND2  1 
ATOM   3573 H H    . ASN A 1 227 ? 9.833  -25.942 8.666   1.00   10.79 ? 255  ASN A H    1 
ATOM   3574 H HA   . ASN A 1 227 ? 8.226  -27.777 7.496   1.00   10.89 ? 255  ASN A HA   1 
ATOM   3575 H HB2  . ASN A 1 227 ? 7.263  -25.484 8.837   1.00   12.17 ? 255  ASN A HB2  1 
ATOM   3576 H HB3  . ASN A 1 227 ? 6.346  -26.487 8.010   1.00   12.17 ? 255  ASN A HB3  1 
ATOM   3577 H HD21 . ASN A 1 227 ? 7.129  -25.766 10.962  1.00   12.84 ? 255  ASN A HD21 1 
ATOM   3578 H HD22 . ASN A 1 227 ? 6.887  -27.056 11.665  1.00   12.84 ? 255  ASN A HD22 1 
ATOM   3579 N N    . HIS A 1 228 ? 9.635  -25.696 6.023   1.00   7.89  ? 256  HIS A N    1 
ATOM   3580 C CA   . HIS A 1 228 ? 9.810  -24.828 4.851   1.00   7.82  ? 256  HIS A CA   1 
ATOM   3581 C C    . HIS A 1 228 ? 11.055 -25.242 4.118   1.00   6.31  ? 256  HIS A C    1 
ATOM   3582 O O    . HIS A 1 228 ? 11.926 -25.898 4.672   1.00   6.55  ? 256  HIS A O    1 
ATOM   3583 C CB   . HIS A 1 228 ? 9.906  -23.358 5.269   1.00   11.17 ? 256  HIS A CB   1 
ATOM   3584 C CG   . HIS A 1 228 ? 8.633  -22.818 5.843   1.00   17.84 ? 256  HIS A CG   1 
ATOM   3585 N ND1  . HIS A 1 228 ? 7.528  -22.486 5.087   1.00   22.10 ? 256  HIS A ND1  1 
ATOM   3586 C CD2  . HIS A 1 228 ? 8.281  -22.589 7.125   1.00   19.64 ? 256  HIS A CD2  1 
ATOM   3587 C CE1  . HIS A 1 228 ? 6.563  -22.051 5.882   1.00   23.02 ? 256  HIS A CE1  1 
ATOM   3588 N NE2  . HIS A 1 228 ? 7.000  -22.098 7.126   1.00   22.35 ? 256  HIS A NE2  1 
ATOM   3589 H H    . HIS A 1 228 ? 10.373 -25.962 6.376   1.00   9.47  ? 256  HIS A H    1 
ATOM   3590 H HA   . HIS A 1 228 ? 9.052  -24.931 4.255   1.00   9.38  ? 256  HIS A HA   1 
ATOM   3591 H HB2  . HIS A 1 228 ? 10.598 -23.267 5.942   1.00   13.40 ? 256  HIS A HB2  1 
ATOM   3592 H HB3  . HIS A 1 228 ? 10.132 -22.825 4.490   1.00   13.40 ? 256  HIS A HB3  1 
ATOM   3593 H HD2  . HIS A 1 228 ? 8.820  -22.717 7.872   1.00   23.57 ? 256  HIS A HD2  1 
ATOM   3594 H HE1  . HIS A 1 228 ? 5.722  -21.761 5.610   1.00   27.62 ? 256  HIS A HE1  1 
ATOM   3595 H HE2  . HIS A 1 228 ? 6.550  -21.873 7.824   1.00   26.81 ? 256  HIS A HE2  1 
ATOM   3596 N N    . ALA A 1 229 ? 11.103 -24.822 2.868   1.00   5.99  ? 257  ALA A N    1 
ATOM   3597 C CA   . ALA A 1 229 ? 12.245 -25.045 2.015   1.00   5.31  ? 257  ALA A CA   1 
ATOM   3598 C C    . ALA A 1 229 ? 13.473 -24.311 2.557   1.00   4.97  ? 257  ALA A C    1 
ATOM   3599 O O    . ALA A 1 229 ? 13.367 -23.313 3.274   1.00   5.16  ? 257  ALA A O    1 
ATOM   3600 C CB   . ALA A 1 229 ? 11.963 -24.606 0.592   1.00   6.06  ? 257  ALA A CB   1 
ATOM   3601 H H    . ALA A 1 229 ? 10.466 -24.392 2.483   1.00   7.19  ? 257  ALA A H    1 
ATOM   3602 H HA   . ALA A 1 229 ? 12.446 -25.994 2.001   1.00   6.37  ? 257  ALA A HA   1 
ATOM   3603 H HB1  . ALA A 1 229 ? 11.752 -23.659 0.590   1.00   7.27  ? 257  ALA A HB1  1 
ATOM   3604 H HB2  . ALA A 1 229 ? 12.750 -24.771 0.049   1.00   7.27  ? 257  ALA A HB2  1 
ATOM   3605 H HB3  . ALA A 1 229 ? 11.212 -25.114 0.248   1.00   7.27  ? 257  ALA A HB3  1 
ATOM   3606 N N    . PRO A 1 230 ? 14.670 -24.773 2.175   1.00   4.73  ? 258  PRO A N    1 
ATOM   3607 C CA   . PRO A 1 230 ? 15.865 -24.115 2.700   1.00   5.21  ? 258  PRO A CA   1 
ATOM   3608 C C    . PRO A 1 230 ? 16.033 -22.668 2.315   1.00   5.01  ? 258  PRO A C    1 
ATOM   3609 O O    . PRO A 1 230 ? 15.551 -22.206 1.278   1.00   5.05  ? 258  PRO A O    1 
ATOM   3610 C CB   . PRO A 1 230 ? 17.006 -24.928 2.075   1.00   5.26  ? 258  PRO A CB   1 
ATOM   3611 C CG   . PRO A 1 230 ? 16.434 -26.287 1.894   1.00   5.16  ? 258  PRO A CG   1 
ATOM   3612 C CD   . PRO A 1 230 ? 15.008 -26.031 1.475   1.00   5.02  ? 258  PRO A CD   1 
ATOM   3613 H HA   . PRO A 1 230 ? 15.901 -24.199 3.665   1.00   6.25  ? 258  PRO A HA   1 
ATOM   3614 H HB2  . PRO A 1 230 ? 17.255 -24.541 1.221   1.00   6.31  ? 258  PRO A HB2  1 
ATOM   3615 H HB3  . PRO A 1 230 ? 17.764 -24.949 2.679   1.00   6.31  ? 258  PRO A HB3  1 
ATOM   3616 H HG2  . PRO A 1 230 ? 16.919 -26.760 1.200   1.00   6.20  ? 258  PRO A HG2  1 
ATOM   3617 H HG3  . PRO A 1 230 ? 16.466 -26.773 2.733   1.00   6.20  ? 258  PRO A HG3  1 
ATOM   3618 H HD2  . PRO A 1 230 ? 14.954 -25.908 0.514   1.00   6.03  ? 258  PRO A HD2  1 
ATOM   3619 H HD3  . PRO A 1 230 ? 14.432 -26.751 1.775   1.00   6.03  ? 258  PRO A HD3  1 
ATOM   3620 N N    . LEU A 1 231 ? 16.770 -21.964 3.165   1.00   4.95  ? 259  LEU A N    1 
ATOM   3621 C CA   . LEU A 1 231 ? 17.209 -20.582 2.925   1.00   5.26  ? 259  LEU A CA   1 
ATOM   3622 C C    . LEU A 1 231 ? 18.713 -20.605 2.827   1.00   5.06  ? 259  LEU A C    1 
ATOM   3623 O O    . LEU A 1 231 ? 19.378 -21.343 3.561   1.00   6.37  ? 259  LEU A O    1 
ATOM   3624 C CB   . LEU A 1 231 ? 16.807 -19.683 4.094   1.00   6.28  ? 259  LEU A CB   1 
ATOM   3625 C CG   . LEU A 1 231 ? 15.357 -19.793 4.551   1.00   7.36  ? 259  LEU A CG   1 
ATOM   3626 C CD1  . LEU A 1 231 ? 15.125 -18.975 5.794   1.00   8.83  ? 259  LEU A CD1  1 
ATOM   3627 C CD2  . LEU A 1 231 ? 14.382 -19.417 3.442   1.00   7.70  ? 259  LEU A CD2  1 
ATOM   3628 H H    . LEU A 1 231 ? 17.043 -22.275 3.919   1.00   5.94  ? 259  LEU A H    1 
ATOM   3629 H HA   . LEU A 1 231 ? 16.831 -20.239 2.100   1.00   6.31  ? 259  LEU A HA   1 
ATOM   3630 H HB2  . LEU A 1 231 ? 17.368 -19.902 4.855   1.00   7.54  ? 259  LEU A HB2  1 
ATOM   3631 H HB3  . LEU A 1 231 ? 16.960 -18.760 3.836   1.00   7.54  ? 259  LEU A HB3  1 
ATOM   3632 H HG   . LEU A 1 231 ? 15.184 -20.719 4.782   1.00   8.83  ? 259  LEU A HG   1 
ATOM   3633 H HD11 . LEU A 1 231 ? 15.326 -18.045 5.602   1.00   10.60 ? 259  LEU A HD11 1 
ATOM   3634 H HD12 . LEU A 1 231 ? 14.196 -19.064 6.061   1.00   10.60 ? 259  LEU A HD12 1 
ATOM   3635 H HD13 . LEU A 1 231 ? 15.705 -19.301 6.500   1.00   10.60 ? 259  LEU A HD13 1 
ATOM   3636 H HD21 . LEU A 1 231 ? 14.514 -20.014 2.690   1.00   9.23  ? 259  LEU A HD21 1 
ATOM   3637 H HD22 . LEU A 1 231 ? 13.476 -19.501 3.777   1.00   9.23  ? 259  LEU A HD22 1 
ATOM   3638 H HD23 . LEU A 1 231 ? 14.551 -18.501 3.171   1.00   9.23  ? 259  LEU A HD23 1 
ATOM   3639 N N    . VAL A 1 232 ? 19.271 -19.783 1.954   1.00   4.62  ? 260  VAL A N    1 
ATOM   3640 C CA   . VAL A 1 232 ? 20.705 -19.592 1.871   1.00   4.51  ? 260  VAL A CA   1 
ATOM   3641 C C    . VAL A 1 232 ? 20.949 -18.138 2.227   1.00   4.71  ? 260  VAL A C    1 
ATOM   3642 O O    . VAL A 1 232 ? 20.311 -17.256 1.662   1.00   4.98  ? 260  VAL A O    1 
ATOM   3643 C CB   . VAL A 1 232 ? 21.238 -19.933 0.482   1.00   5.40  ? 260  VAL A CB   1 
ATOM   3644 C CG1  . VAL A 1 232 ? 22.739 -19.681 0.409   1.00   5.75  ? 260  VAL A CG1  1 
ATOM   3645 C CG2  . VAL A 1 232 ? 20.910 -21.397 0.127   1.00   6.21  ? 260  VAL A CG2  1 
ATOM   3646 H H    . VAL A 1 232 ? 18.828 -19.314 1.385   1.00   5.55  ? 260  VAL A H    1 
ATOM   3647 H HA   . VAL A 1 232 ? 21.150 -20.153 2.525   1.00   5.41  ? 260  VAL A HA   1 
ATOM   3648 H HB   . VAL A 1 232 ? 20.805 -19.362 -0.171  1.00   6.48  ? 260  VAL A HB   1 
ATOM   3649 H HG11 . VAL A 1 232 ? 23.185 -20.237 1.067   1.00   6.90  ? 260  VAL A HG11 1 
ATOM   3650 H HG12 . VAL A 1 232 ? 23.053 -19.905 -0.481  1.00   6.90  ? 260  VAL A HG12 1 
ATOM   3651 H HG13 . VAL A 1 232 ? 22.911 -18.745 0.594   1.00   6.90  ? 260  VAL A HG13 1 
ATOM   3652 H HG21 . VAL A 1 232 ? 19.948 -21.517 0.139   1.00   7.45  ? 260  VAL A HG21 1 
ATOM   3653 H HG22 . VAL A 1 232 ? 21.257 -21.592 -0.758  1.00   7.45  ? 260  VAL A HG22 1 
ATOM   3654 H HG23 . VAL A 1 232 ? 21.325 -21.981 0.781   1.00   7.45  ? 260  VAL A HG23 1 
ATOM   3655 N N    . LEU A 1 233 ? 21.859 -17.890 3.168   1.00   4.26  ? 261  LEU A N    1 
ATOM   3656 C CA   . LEU A 1 233 ? 22.038 -16.560 3.707   1.00   4.45  ? 261  LEU A CA   1 
ATOM   3657 C C    . LEU A 1 233 ? 23.500 -16.216 3.801   1.00   4.20  ? 261  LEU A C    1 
ATOM   3658 O O    . LEU A 1 233 ? 24.296 -16.937 4.413   1.00   4.69  ? 261  LEU A O    1 
ATOM   3659 C CB   . LEU A 1 233 ? 21.409 -16.480 5.101   1.00   5.00  ? 261  LEU A CB   1 
ATOM   3660 C CG   . LEU A 1 233 ? 21.598 -15.159 5.870   1.00   5.32  ? 261  LEU A CG   1 
ATOM   3661 C CD1  . LEU A 1 233 ? 21.062 -13.965 5.070   1.00   5.29  ? 261  LEU A CD1  1 
ATOM   3662 C CD2  . LEU A 1 233 ? 20.983 -15.237 7.241   1.00   6.41  ? 261  LEU A CD2  1 
ATOM   3663 H H    . LEU A 1 233 ? 22.382 -18.482 3.507   1.00   5.11  ? 261  LEU A H    1 
ATOM   3664 H HA   . LEU A 1 233 ? 21.603 -15.913 3.131   1.00   5.34  ? 261  LEU A HA   1 
ATOM   3665 H HB2  . LEU A 1 233 ? 20.454 -16.624 5.010   1.00   6.00  ? 261  LEU A HB2  1 
ATOM   3666 H HB3  . LEU A 1 233 ? 21.789 -17.186 5.646   1.00   6.00  ? 261  LEU A HB3  1 
ATOM   3667 H HG   . LEU A 1 233 ? 22.549 -15.016 5.992   1.00   6.38  ? 261  LEU A HG   1 
ATOM   3668 H HD11 . LEU A 1 233 ? 20.116 -14.096 4.903   1.00   6.34  ? 261  LEU A HD11 1 
ATOM   3669 H HD12 . LEU A 1 233 ? 21.198 -13.154 5.584   1.00   6.34  ? 261  LEU A HD12 1 
ATOM   3670 H HD13 . LEU A 1 233 ? 21.542 -13.908 4.229   1.00   6.34  ? 261  LEU A HD13 1 
ATOM   3671 H HD21 . LEU A 1 233 ? 21.408 -15.953 7.738   1.00   7.69  ? 261  LEU A HD21 1 
ATOM   3672 H HD22 . LEU A 1 233 ? 21.120 -14.391 7.697   1.00   7.69  ? 261  LEU A HD22 1 
ATOM   3673 H HD23 . LEU A 1 233 ? 20.033 -15.414 7.152   1.00   7.69  ? 261  LEU A HD23 1 
ATOM   3674 N N    . VAL A 1 234 ? 23.840 -15.069 3.225   1.00   4.43  ? 262  VAL A N    1 
ATOM   3675 C CA   . VAL A 1 234 ? 25.152 -14.475 3.405   1.00   4.42  ? 262  VAL A CA   1 
ATOM   3676 C C    . VAL A 1 234 ? 24.993 -13.165 4.161   1.00   4.30  ? 262  VAL A C    1 
ATOM   3677 O O    . VAL A 1 234 ? 24.203 -12.316 3.758   1.00   5.21  ? 262  VAL A O    1 
ATOM   3678 C CB   . VAL A 1 234 ? 25.837 -14.228 2.046   1.00   5.14  ? 262  VAL A CB   1 
ATOM   3679 C CG1  . VAL A 1 234 ? 27.136 -13.399 2.207   1.00   6.20  ? 262  VAL A CG1  1 
ATOM   3680 C CG2  . VAL A 1 234 ? 26.126 -15.553 1.348   1.00   5.27  ? 262  VAL A CG2  1 
ATOM   3681 H H    . VAL A 1 234 ? 23.318 -14.611 2.718   1.00   5.31  ? 262  VAL A H    1 
ATOM   3682 H HA   . VAL A 1 234 ? 25.710 -15.070 3.930   1.00   5.31  ? 262  VAL A HA   1 
ATOM   3683 H HB   . VAL A 1 234 ? 25.232 -13.723 1.480   1.00   6.16  ? 262  VAL A HB   1 
ATOM   3684 H HG11 . VAL A 1 234 ? 27.750 -13.882 2.782   1.00   7.44  ? 262  VAL A HG11 1 
ATOM   3685 H HG12 . VAL A 1 234 ? 27.536 -13.266 1.334   1.00   7.44  ? 262  VAL A HG12 1 
ATOM   3686 H HG13 . VAL A 1 234 ? 26.916 -12.542 2.605   1.00   7.44  ? 262  VAL A HG13 1 
ATOM   3687 H HG21 . VAL A 1 234 ? 25.290 -16.023 1.204   1.00   6.33  ? 262  VAL A HG21 1 
ATOM   3688 H HG22 . VAL A 1 234 ? 26.556 -15.374 0.497   1.00   6.33  ? 262  VAL A HG22 1 
ATOM   3689 H HG23 . VAL A 1 234 ? 26.712 -16.084 1.909   1.00   6.33  ? 262  VAL A HG23 1 
ATOM   3690 N N    . THR A 1 235 ? 25.740 -13.011 5.251   1.00   4.51  ? 263  THR A N    1 
ATOM   3691 C CA   . THR A 1 235 ? 25.800 -11.773 5.998   1.00   4.73  ? 263  THR A CA   1 
ATOM   3692 C C    . THR A 1 235 ? 27.266 -11.374 6.100   1.00   4.30  ? 263  THR A C    1 
ATOM   3693 O O    . THR A 1 235 ? 28.066 -12.069 6.733   1.00   4.71  ? 263  THR A O    1 
ATOM   3694 C CB   . THR A 1 235 ? 25.194 -11.907 7.395   1.00   5.09  ? 263  THR A CB   1 
ATOM   3695 O OG1  . THR A 1 235 ? 25.852 -12.951 8.123   1.00   4.87  ? 263  THR A OG1  1 
ATOM   3696 C CG2  . THR A 1 235 ? 23.726 -12.225 7.348   1.00   5.62  ? 263  THR A CG2  1 
ATOM   3697 H H    . THR A 1 235 ? 26.234 -13.633 5.582   1.00   5.42  ? 263  THR A H    1 
ATOM   3698 H HA   . THR A 1 235 ? 25.322 -11.079 5.518   1.00   5.67  ? 263  THR A HA   1 
ATOM   3699 H HB   . THR A 1 235 ? 25.306 -11.069 7.871   1.00   6.10  ? 263  THR A HB   1 
ATOM   3700 H HG1  . THR A 1 235 ? 26.671 -12.777 8.197   1.00   5.84  ? 263  THR A HG1  1 
ATOM   3701 H HG21 . THR A 1 235 ? 23.584 -13.062 6.880   1.00   6.74  ? 263  THR A HG21 1 
ATOM   3702 H HG22 . THR A 1 235 ? 23.375 -12.303 8.249   1.00   6.74  ? 263  THR A HG22 1 
ATOM   3703 H HG23 . THR A 1 235 ? 23.250 -11.519 6.883   1.00   6.74  ? 263  THR A HG23 1 
ATOM   3704 N N    . TYR A 1 236 ? 27.625 -10.282 5.444   1.00   4.43  ? 264  TYR A N    1 
ATOM   3705 C CA   . TYR A 1 236 ? 28.972 -9.726  5.457   1.00   4.59  ? 264  TYR A CA   1 
ATOM   3706 C C    . TYR A 1 236 ? 28.916 -8.367  6.155   1.00   4.75  ? 264  TYR A C    1 
ATOM   3707 O O    . TYR A 1 236 ? 27.918 -7.646  6.031   1.00   5.72  ? 264  TYR A O    1 
ATOM   3708 C CB   . TYR A 1 236 ? 29.478 -9.587  4.028   1.00   5.04  ? 264  TYR A CB   1 
ATOM   3709 C CG   . TYR A 1 236 ? 29.923 -10.850 3.334   1.00   4.34  ? 264  TYR A CG   1 
ATOM   3710 C CD1  . TYR A 1 236 ? 30.103 -12.043 4.017   1.00   4.77  ? 264  TYR A CD1  1 
ATOM   3711 C CD2  . TYR A 1 236 ? 30.281 -10.819 2.008   1.00   5.56  ? 264  TYR A CD2  1 
ATOM   3712 C CE1  . TYR A 1 236 ? 30.624 -13.161 3.367   1.00   4.50  ? 264  TYR A CE1  1 
ATOM   3713 C CE2  . TYR A 1 236 ? 30.830 -11.920 1.363   1.00   5.59  ? 264  TYR A CE2  1 
ATOM   3714 C CZ   . TYR A 1 236 ? 31.020 -13.072 2.057   1.00   4.84  ? 264  TYR A CZ   1 
ATOM   3715 O OH   . TYR A 1 236 ? 31.619 -14.142 1.432   1.00   5.06  ? 264  TYR A OH   1 
ATOM   3716 H H    . TYR A 1 236 ? 27.081 -9.824  4.962   1.00   5.31  ? 264  TYR A H    1 
ATOM   3717 H HA   . TYR A 1 236 ? 29.569 -10.311 5.949   1.00   5.50  ? 264  TYR A HA   1 
ATOM   3718 H HB2  . TYR A 1 236 ? 28.767 -9.202  3.492   1.00   6.04  ? 264  TYR A HB2  1 
ATOM   3719 H HB3  . TYR A 1 236 ? 30.236 -8.982  4.034   1.00   6.04  ? 264  TYR A HB3  1 
ATOM   3720 H HD1  . TYR A 1 236 ? 29.889 -12.093 4.921   1.00   5.73  ? 264  TYR A HD1  1 
ATOM   3721 H HD2  . TYR A 1 236 ? 30.211 -10.016 1.544   1.00   6.67  ? 264  TYR A HD2  1 
ATOM   3722 H HE1  . TYR A 1 236 ? 30.772 -13.947 3.843   1.00   5.40  ? 264  TYR A HE1  1 
ATOM   3723 H HE2  . TYR A 1 236 ? 31.092 -11.860 0.473   1.00   6.70  ? 264  TYR A HE2  1 
ATOM   3724 H HH   . TYR A 1 236 ? 31.682 -14.787 1.966   1.00   6.07  ? 264  TYR A HH   1 
ATOM   3725 N N    . PHE A 1 237 ? 29.997 -8.023  6.839   1.00   4.65  ? 265  PHE A N    1 
ATOM   3726 C CA   . PHE A 1 237 ? 30.043 -6.782  7.577   1.00   4.55  ? 265  PHE A CA   1 
ATOM   3727 C C    . PHE A 1 237 ? 31.466 -6.301  7.698   1.00   4.45  ? 265  PHE A C    1 
ATOM   3728 O O    . PHE A 1 237 ? 32.356 -7.085  7.967   1.00   4.51  ? 265  PHE A O    1 
ATOM   3729 C CB   . PHE A 1 237 ? 29.425 -6.972  8.953   1.00   5.73  ? 265  PHE A CB   1 
ATOM   3730 C CG   . PHE A 1 237 ? 29.372 -5.704  9.775   1.00   5.91  ? 265  PHE A CG   1 
ATOM   3731 C CD1  . PHE A 1 237 ? 28.485 -4.689  9.423   1.00   7.06  ? 265  PHE A CD1  1 
ATOM   3732 C CD2  . PHE A 1 237 ? 30.212 -5.496  10.866  1.00   6.00  ? 265  PHE A CD2  1 
ATOM   3733 C CE1  . PHE A 1 237 ? 28.432 -3.520  10.142  1.00   8.27  ? 265  PHE A CE1  1 
ATOM   3734 C CE2  . PHE A 1 237 ? 30.139 -4.319  11.605  1.00   6.59  ? 265  PHE A CE2  1 
ATOM   3735 C CZ   . PHE A 1 237 ? 29.257 -3.339  11.234  1.00   7.01  ? 265  PHE A CZ   1 
ATOM   3736 H H    . PHE A 1 237 ? 30.715 -8.493  6.890   1.00   5.58  ? 265  PHE A H    1 
ATOM   3737 H HA   . PHE A 1 237 ? 29.531 -6.107  7.103   1.00   5.46  ? 265  PHE A HA   1 
ATOM   3738 H HB2  . PHE A 1 237 ? 28.516 -7.294  8.847   1.00   6.87  ? 265  PHE A HB2  1 
ATOM   3739 H HB3  . PHE A 1 237 ? 29.950 -7.623  9.445   1.00   6.87  ? 265  PHE A HB3  1 
ATOM   3740 H HD1  . PHE A 1 237 ? 27.924 -4.804  8.690   1.00   8.48  ? 265  PHE A HD1  1 
ATOM   3741 H HD2  . PHE A 1 237 ? 30.809 -6.162  11.120  1.00   7.20  ? 265  PHE A HD2  1 
ATOM   3742 H HE1  . PHE A 1 237 ? 27.829 -2.854  9.901   1.00   9.92  ? 265  PHE A HE1  1 
ATOM   3743 H HE2  . PHE A 1 237 ? 30.701 -4.190  12.335  1.00   7.91  ? 265  PHE A HE2  1 
ATOM   3744 H HZ   . PHE A 1 237 ? 29.213 -2.547  11.720  1.00   8.41  ? 265  PHE A HZ   1 
ATOM   3745 N N    . THR A 1 238 ? 31.690 -5.009  7.479   1.00   4.34  ? 266  THR A N    1 
ATOM   3746 C CA   . THR A 1 238 ? 33.050 -4.482  7.581   1.00   4.58  ? 266  THR A CA   1 
ATOM   3747 C C    . THR A 1 238 ? 33.002 -3.024  8.019   1.00   4.99  ? 266  THR A C    1 
ATOM   3748 O O    . THR A 1 238 ? 31.980 -2.361  7.877   1.00   5.32  ? 266  THR A O    1 
ATOM   3749 C CB   . THR A 1 238 ? 33.829 -4.668  6.256   1.00   4.91  ? 266  THR A CB   1 
ATOM   3750 O OG1  . THR A 1 238 ? 35.205 -4.395  6.478   1.00   4.97  ? 266  THR A OG1  1 
ATOM   3751 C CG2  . THR A 1 238 ? 33.295 -3.796  5.153   1.00   5.26  ? 266  THR A CG2  1 
ATOM   3752 H H    . THR A 1 238 ? 31.090 -4.428  7.274   1.00   5.20  ? 266  THR A H    1 
ATOM   3753 H HA   . THR A 1 238 ? 33.522 -4.978  8.269   1.00   5.49  ? 266  THR A HA   1 
ATOM   3754 H HB   . THR A 1 238 ? 33.739 -5.590  5.971   1.00   5.89  ? 266  THR A HB   1 
ATOM   3755 H HG1  . THR A 1 238 ? 35.513 -4.921  7.057   1.00   5.97  ? 266  THR A HG1  1 
ATOM   3756 H HG21 . THR A 1 238 ? 33.362 -2.862  5.407   1.00   6.31  ? 266  THR A HG21 1 
ATOM   3757 H HG22 . THR A 1 238 ? 33.807 -3.939  4.341   1.00   6.31  ? 266  THR A HG22 1 
ATOM   3758 H HG23 . THR A 1 238 ? 32.365 -4.011  4.982   1.00   6.31  ? 266  THR A HG23 1 
ATOM   3759 N N    . GLN A 1 239 ? 34.110 -2.556  8.585   1.00   4.25  ? 267  GLN A N    1 
ATOM   3760 C CA   . GLN A 1 239 ? 34.138 -1.297  9.296   1.00   5.14  ? 267  GLN A CA   1 
ATOM   3761 C C    . GLN A 1 239 ? 35.275 -0.428  8.788   1.00   5.65  ? 267  GLN A C    1 
ATOM   3762 O O    . GLN A 1 239 ? 36.178 -0.897  8.109   1.00   5.78  ? 267  GLN A O    1 
ATOM   3763 C CB   . GLN A 1 239 ? 34.266 -1.585  10.773  1.00   5.69  ? 267  GLN A CB   1 
ATOM   3764 C CG   . GLN A 1 239 ? 33.034 -2.271  11.319  1.00   5.91  ? 267  GLN A CG   1 
ATOM   3765 C CD   . GLN A 1 239 ? 33.223 -2.746  12.734  1.00   6.13  ? 267  GLN A CD   1 
ATOM   3766 O OE1  . GLN A 1 239 ? 33.175 -1.957  13.673  1.00   6.93  ? 267  GLN A OE1  1 
ATOM   3767 N NE2  . GLN A 1 239 ? 33.427 -4.039  12.905  1.00   5.96  ? 267  GLN A NE2  1 
ATOM   3768 H H    . GLN A 1 239 ? 34.868 -2.962  8.568   1.00   5.10  ? 267  GLN A H    1 
ATOM   3769 H HA   . GLN A 1 239 ? 33.303 -0.825  9.148   1.00   6.16  ? 267  GLN A HA   1 
ATOM   3770 H HB2  . GLN A 1 239 ? 35.027 -2.168  10.920  1.00   6.83  ? 267  GLN A HB2  1 
ATOM   3771 H HB3  . GLN A 1 239 ? 34.386 -0.750  11.252  1.00   6.83  ? 267  GLN A HB3  1 
ATOM   3772 H HG2  . GLN A 1 239 ? 32.292 -1.646  11.308  1.00   7.09  ? 267  GLN A HG2  1 
ATOM   3773 H HG3  . GLN A 1 239 ? 32.829 -3.042  10.768  1.00   7.09  ? 267  GLN A HG3  1 
ATOM   3774 H HE21 . GLN A 1 239 ? 33.447 -4.564  12.225  1.00   7.15  ? 267  GLN A HE21 1 
ATOM   3775 H HE22 . GLN A 1 239 ? 33.540 -4.355  13.697  1.00   7.15  ? 267  GLN A HE22 1 
ATOM   3776 N N    . PRO A 1 240 ? 35.228 0.867   9.115   1.00   6.55  ? 268  PRO A N    1 
ATOM   3777 C CA   . PRO A 1 240 ? 36.192 1.765   8.461   1.00   8.19  ? 268  PRO A CA   1 
ATOM   3778 C C    . PRO A 1 240 ? 37.573 1.753   9.090   1.00   8.77  ? 268  PRO A C    1 
ATOM   3779 O O    . PRO A 1 240 ? 38.518 2.194   8.418   1.00   11.08 ? 268  PRO A O    1 
ATOM   3780 C CB   . PRO A 1 240 ? 35.544 3.143   8.605   1.00   9.34  ? 268  PRO A CB   1 
ATOM   3781 C CG   . PRO A 1 240 ? 34.610 3.014   9.714   1.00   9.16  ? 268  PRO A CG   1 
ATOM   3782 C CD   . PRO A 1 240 ? 34.095 1.606   9.675   1.00   7.09  ? 268  PRO A CD   1 
ATOM   3783 H HA   . PRO A 1 240 ? 36.269 1.545   7.519   1.00   9.82  ? 268  PRO A HA   1 
ATOM   3784 H HB2  . PRO A 1 240 ? 36.225 3.804   8.805   1.00   11.21 ? 268  PRO A HB2  1 
ATOM   3785 H HB3  . PRO A 1 240 ? 35.075 3.370   7.787   1.00   11.21 ? 268  PRO A HB3  1 
ATOM   3786 H HG2  . PRO A 1 240 ? 35.075 3.182   10.549  1.00   11.00 ? 268  PRO A HG2  1 
ATOM   3787 H HG3  . PRO A 1 240 ? 33.882 3.645   9.598   1.00   11.00 ? 268  PRO A HG3  1 
ATOM   3788 H HD2  . PRO A 1 240 ? 33.893 1.293   10.571  1.00   8.50  ? 268  PRO A HD2  1 
ATOM   3789 H HD3  . PRO A 1 240 ? 33.323 1.542   9.091   1.00   8.50  ? 268  PRO A HD3  1 
ATOM   3790 N N    . GLU A 1 241 ? 37.721 1.310   10.340  1.00   7.74  ? 269  GLU A N    1 
ATOM   3791 C CA   . GLU A 1 241 ? 38.975 1.411   11.050  1.00   9.01  ? 269  GLU A CA   1 
ATOM   3792 C C    . GLU A 1 241 ? 39.634 0.020   11.184  1.00   8.29  ? 269  GLU A C    1 
ATOM   3793 O O    . GLU A 1 241 ? 38.986 -0.989  11.465  1.00   8.22  ? 269  GLU A O    1 
ATOM   3794 C CB   . GLU A 1 241 ? 38.791 2.230   12.335  1.00   11.53 ? 269  GLU A CB   1 
ATOM   3795 C CG   . GLU A 1 241 ? 38.131 1.560   13.504  1.00   11.12 ? 269  GLU A CG   1 
ATOM   3796 C CD   . GLU A 1 241 ? 36.585 1.506   13.518  1.00   9.48  ? 269  GLU A CD   1 
ATOM   3797 O OE1  . GLU A 1 241 ? 35.932 1.322   12.474  1.00   8.72  ? 269  GLU A OE1  1 
ATOM   3798 O OE2  . GLU A 1 241 ? 36.033 1.624   14.636  1.00   9.96  ? 269  GLU A OE2  1 
ATOM   3799 H H    . GLU A 1 241 ? 37.093 0.942   10.797  1.00   9.28  ? 269  GLU A H    1 
ATOM   3800 H HA   . GLU A 1 241 ? 39.574 1.931   10.492  1.00   10.81 ? 269  GLU A HA   1 
ATOM   3801 H HB2  . GLU A 1 241 ? 39.667 2.520   12.633  1.00   13.83 ? 269  GLU A HB2  1 
ATOM   3802 H HB3  . GLU A 1 241 ? 38.257 3.011   12.118  1.00   13.83 ? 269  GLU A HB3  1 
ATOM   3803 H HG2  . GLU A 1 241 ? 38.447 0.644   13.542  1.00   13.35 ? 269  GLU A HG2  1 
ATOM   3804 H HG3  . GLU A 1 241 ? 38.406 2.025   14.310  1.00   13.35 ? 269  GLU A HG3  1 
ATOM   3805 N N    . GLN A 1 242 ? 40.935 -0.015  10.929  1.00   8.00  ? 270  GLN A N    1 
ATOM   3806 C CA   A GLN A 1 242 ? 41.666 -1.272  10.822  0.63   8.91  ? 270  GLN A CA   1 
ATOM   3807 C CA   B GLN A 1 242 ? 41.687 -1.255  10.830  0.37   8.62  ? 270  GLN A CA   1 
ATOM   3808 C C    . GLN A 1 242 ? 41.531 -2.194  12.025  1.00   8.45  ? 270  GLN A C    1 
ATOM   3809 O O    . GLN A 1 242 ? 41.442 -3.407  11.862  1.00   8.14  ? 270  GLN A O    1 
ATOM   3810 C CB   A GLN A 1 242 ? 43.152 -1.033  10.547  0.63   10.12 ? 270  GLN A CB   1 
ATOM   3811 C CB   B GLN A 1 242 ? 43.163 -0.925  10.630  0.37   9.40  ? 270  GLN A CB   1 
ATOM   3812 C CG   A GLN A 1 242 ? 43.900 -2.347  10.314  0.63   11.21 ? 270  GLN A CG   1 
ATOM   3813 C CG   B GLN A 1 242 ? 44.001 -2.125  10.262  0.37   10.23 ? 270  GLN A CG   1 
ATOM   3814 C CD   A GLN A 1 242 ? 45.352 -2.167  9.930   0.63   12.81 ? 270  GLN A CD   1 
ATOM   3815 C CD   B GLN A 1 242 ? 45.444 -1.775  9.977   0.37   11.15 ? 270  GLN A CD   1 
ATOM   3816 O OE1  A GLN A 1 242 ? 45.867 -2.840  9.031   0.63   14.72 ? 270  GLN A OE1  1 
ATOM   3817 O OE1  B GLN A 1 242 ? 46.355 -2.458  10.431  0.37   12.96 ? 270  GLN A OE1  1 
ATOM   3818 N NE2  A GLN A 1 242 ? 46.030 -1.274  10.627  0.63   12.20 ? 270  GLN A NE2  1 
ATOM   3819 N NE2  B GLN A 1 242 ? 45.661 -0.713  9.214   0.37   9.99  ? 270  GLN A NE2  1 
ATOM   3820 H H    A GLN A 1 242 ? 41.423 0.683   10.813  0.63   9.60  ? 270  GLN A H    1 
ATOM   3821 H H    B GLN A 1 242 ? 41.416 0.687   10.807  0.37   9.60  ? 270  GLN A H    1 
ATOM   3822 H HA   A GLN A 1 242 ? 41.312 -1.754  10.058  0.63   10.69 ? 270  GLN A HA   1 
ATOM   3823 H HA   B GLN A 1 242 ? 41.385 -1.735  10.042  0.37   10.34 ? 270  GLN A HA   1 
ATOM   3824 H HB2  A GLN A 1 242 ? 43.246 -0.486  9.751   0.63   12.14 ? 270  GLN A HB2  1 
ATOM   3825 H HB2  B GLN A 1 242 ? 43.245 -0.274  9.915   0.37   11.28 ? 270  GLN A HB2  1 
ATOM   3826 H HB3  A GLN A 1 242 ? 43.552 -0.588  11.310  0.63   12.14 ? 270  GLN A HB3  1 
ATOM   3827 H HB3  B GLN A 1 242 ? 43.517 -0.556  11.454  0.37   11.28 ? 270  GLN A HB3  1 
ATOM   3828 H HG2  A GLN A 1 242 ? 43.872 -2.871  11.131  0.63   13.45 ? 270  GLN A HG2  1 
ATOM   3829 H HG2  B GLN A 1 242 ? 43.987 -2.757  10.998  0.37   12.28 ? 270  GLN A HG2  1 
ATOM   3830 H HG3  A GLN A 1 242 ? 43.462 -2.833  9.598   0.63   13.45 ? 270  GLN A HG3  1 
ATOM   3831 H HG3  B GLN A 1 242 ? 43.630 -2.537  9.466   0.37   12.28 ? 270  GLN A HG3  1 
ATOM   3832 H HE21 A GLN A 1 242 ? 45.643 -0.835  11.257  0.63   14.64 ? 270  GLN A HE21 1 
ATOM   3833 H HE21 B GLN A 1 242 ? 44.997 -0.261  8.907   0.37   11.99 ? 270  GLN A HE21 1 
ATOM   3834 H HE22 A GLN A 1 242 ? 46.860 -1.131  10.451  0.63   14.64 ? 270  GLN A HE22 1 
ATOM   3835 H HE22 B GLN A 1 242 ? 46.466 -0.476  9.025   0.37   11.99 ? 270  GLN A HE22 1 
ATOM   3836 N N    . LYS A 1 243 ? 41.542 -1.630  13.226  1.00   9.38  ? 271  LYS A N    1 
ATOM   3837 C CA   . LYS A 1 243 ? 41.527 -2.425  14.451  1.00   10.53 ? 271  LYS A CA   1 
ATOM   3838 C C    . LYS A 1 243 ? 40.146 -2.458  15.106  1.00   9.03  ? 271  LYS A C    1 
ATOM   3839 O O    . LYS A 1 243 ? 40.017 -2.753  16.286  1.00   10.04 ? 271  LYS A O    1 
ATOM   3840 C CB   . LYS A 1 243 ? 42.646 -1.968  15.410  1.00   15.06 ? 271  LYS A CB   1 
ATOM   3841 C CG   . LYS A 1 243 ? 44.070 -2.225  14.818  1.00   18.67 ? 271  LYS A CG   1 
ATOM   3842 C CD   . LYS A 1 243 ? 45.222 -2.109  15.815  1.00   23.99 ? 271  LYS A CD   1 
ATOM   3843 C CE   . LYS A 1 243 ? 46.593 -2.327  15.156  1.00   27.53 ? 271  LYS A CE   1 
ATOM   3844 N NZ   . LYS A 1 243 ? 47.709 -1.914  16.064  1.00   29.56 ? 271  LYS A NZ   1 
ATOM   3845 H H    . LYS A 1 243 ? 41.559 -0.781  13.362  1.00   11.26 ? 271  LYS A H    1 
ATOM   3846 H HA   . LYS A 1 243 ? 41.734 -3.340  14.206  1.00   12.64 ? 271  LYS A HA   1 
ATOM   3847 H HB2  . LYS A 1 243 ? 42.554 -1.017  15.575  1.00   18.08 ? 271  LYS A HB2  1 
ATOM   3848 H HB3  . LYS A 1 243 ? 42.572 -2.461  16.243  1.00   18.08 ? 271  LYS A HB3  1 
ATOM   3849 H HG2  . LYS A 1 243 ? 44.093 -3.122  14.449  1.00   22.40 ? 271  LYS A HG2  1 
ATOM   3850 H HG3  . LYS A 1 243 ? 44.230 -1.580  14.111  1.00   22.40 ? 271  LYS A HG3  1 
ATOM   3851 H HD2  . LYS A 1 243 ? 45.214 -1.222  16.207  1.00   28.79 ? 271  LYS A HD2  1 
ATOM   3852 H HD3  . LYS A 1 243 ? 45.111 -2.780  16.507  1.00   28.79 ? 271  LYS A HD3  1 
ATOM   3853 H HE2  . LYS A 1 243 ? 46.702 -3.268  14.948  1.00   33.03 ? 271  LYS A HE2  1 
ATOM   3854 H HE3  . LYS A 1 243 ? 46.647 -1.795  14.347  1.00   33.03 ? 271  LYS A HE3  1 
ATOM   3855 H HZ1  . LYS A 1 243 ? 47.683 -2.392  16.815  1.00   35.48 ? 271  LYS A HZ1  1 
ATOM   3856 H HZ2  . LYS A 1 243 ? 48.492 -2.049  15.663  1.00   35.48 ? 271  LYS A HZ2  1 
ATOM   3857 H HZ3  . LYS A 1 243 ? 47.632 -1.051  16.267  1.00   35.48 ? 271  LYS A HZ3  1 
ATOM   3858 N N    . ALA A 1 244 ? 39.097 -2.245  14.310  1.00   8.08  ? 272  ALA A N    1 
ATOM   3859 C CA   . ALA A 1 244 ? 37.743 -2.379  14.807  1.00   7.94  ? 272  ALA A CA   1 
ATOM   3860 C C    . ALA A 1 244 ? 37.510 -3.773  15.358  1.00   7.80  ? 272  ALA A C    1 
ATOM   3861 O O    . ALA A 1 244 ? 38.005 -4.768  14.838  1.00   7.98  ? 272  ALA A O    1 
ATOM   3862 C CB   . ALA A 1 244 ? 36.749 -2.126  13.679  1.00   7.61  ? 272  ALA A CB   1 
ATOM   3863 H H    . ALA A 1 244 ? 39.150 -2.022  13.482  1.00   9.69  ? 272  ALA A H    1 
ATOM   3864 H HA   . ALA A 1 244 ? 37.586 -1.733  15.514  1.00   9.52  ? 272  ALA A HA   1 
ATOM   3865 H HB1  . ALA A 1 244 ? 36.901 -2.774  12.973  1.00   9.14  ? 272  ALA A HB1  1 
ATOM   3866 H HB2  . ALA A 1 244 ? 35.848 -2.220  14.026  1.00   9.14  ? 272  ALA A HB2  1 
ATOM   3867 H HB3  . ALA A 1 244 ? 36.881 -1.228  13.338  1.00   9.14  ? 272  ALA A HB3  1 
ATOM   3868 N N    . GLU A 1 245 ? 36.727 -3.882  16.411  1.00   7.96  ? 273  GLU A N    1 
ATOM   3869 C CA   . GLU A 1 245 ? 36.342 -5.211  16.888  1.00   7.86  ? 273  GLU A CA   1 
ATOM   3870 C C    . GLU A 1 245 ? 35.416 -5.884  15.891  1.00   7.82  ? 273  GLU A C    1 
ATOM   3871 O O    . GLU A 1 245 ? 34.674 -5.244  15.140  1.00   9.30  ? 273  GLU A O    1 
ATOM   3872 C CB   . GLU A 1 245 ? 35.639 -5.133  18.231  1.00   7.81  ? 273  GLU A CB   1 
ATOM   3873 C CG   . GLU A 1 245 ? 34.275 -4.478  18.182  1.00   7.83  ? 273  GLU A CG   1 
ATOM   3874 C CD   . GLU A 1 245 ? 33.498 -4.615  19.443  1.00   7.76  ? 273  GLU A CD   1 
ATOM   3875 O OE1  . GLU A 1 245 ? 33.695 -5.562  20.224  1.00   10.51 ? 273  GLU A OE1  1 
ATOM   3876 O OE2  . GLU A 1 245 ? 32.632 -3.739  19.631  1.00   7.96  ? 273  GLU A OE2  1 
ATOM   3877 H H    . GLU A 1 245 ? 36.407 -3.224  16.864  1.00   9.56  ? 273  GLU A H    1 
ATOM   3878 H HA   . GLU A 1 245 ? 37.136 -5.759  16.989  1.00   9.43  ? 273  GLU A HA   1 
ATOM   3879 H HB2  . GLU A 1 245 ? 35.522 -6.032  18.573  1.00   9.37  ? 273  GLU A HB2  1 
ATOM   3880 H HB3  . GLU A 1 245 ? 36.191 -4.619  18.841  1.00   9.37  ? 273  GLU A HB3  1 
ATOM   3881 H HG2  . GLU A 1 245 ? 34.389 -3.531  18.005  1.00   9.39  ? 273  GLU A HG2  1 
ATOM   3882 H HG3  . GLU A 1 245 ? 33.758 -4.886  17.469  1.00   9.39  ? 273  GLU A HG3  1 
ATOM   3883 N N    . ASN A 1 246 ? 35.471 -7.187  15.854  1.00   8.33  ? 274  ASN A N    1 
ATOM   3884 C CA   . ASN A 1 246 ? 34.516 -7.934  15.061  1.00   7.87  ? 274  ASN A CA   1 
ATOM   3885 C C    . ASN A 1 246 ? 33.135 -7.869  15.752  1.00   7.74  ? 274  ASN A C    1 
ATOM   3886 O O    . ASN A 1 246 ? 33.019 -7.584  16.960  1.00   8.31  ? 274  ASN A O    1 
ATOM   3887 C CB   . ASN A 1 246 ? 35.037 -9.339  14.792  1.00   9.48  ? 274  ASN A CB   1 
ATOM   3888 C CG   . ASN A 1 246 ? 36.393 -9.322  14.078  1.00   10.83 ? 274  ASN A CG   1 
ATOM   3889 O OD1  . ASN A 1 246 ? 37.441 -9.480  14.699  1.00   13.61 ? 274  ASN A OD1  1 
ATOM   3890 N ND2  . ASN A 1 246 ? 36.382 -9.055  12.799  1.00   9.18  ? 274  ASN A ND2  1 
ATOM   3891 H H    . ASN A 1 246 ? 36.047 -7.670  16.273  1.00   10.00 ? 274  ASN A H    1 
ATOM   3892 H HA   . ASN A 1 246 ? 34.427 -7.494  14.201  1.00   9.44  ? 274  ASN A HA   1 
ATOM   3893 H HB2  . ASN A 1 246 ? 35.146 -9.805  15.636  1.00   11.38 ? 274  ASN A HB2  1 
ATOM   3894 H HB3  . ASN A 1 246 ? 34.404 -9.810  14.229  1.00   11.38 ? 274  ASN A HB3  1 
ATOM   3895 H HD21 . ASN A 1 246 ? 35.637 -8.899  12.399  1.00   11.02 ? 274  ASN A HD21 1 
ATOM   3896 H HD22 . ASN A 1 246 ? 37.120 -9.035  12.358  1.00   11.02 ? 274  ASN A HD22 1 
ATOM   3897 N N    . ARG A 1 247 ? 32.091 -8.091  14.954  1.00   7.58  ? 275  ARG A N    1 
ATOM   3898 C CA   . ARG A 1 247 ? 30.708 -7.821  15.354  1.00   7.40  ? 275  ARG A CA   1 
ATOM   3899 C C    . ARG A 1 247 ? 29.769 -8.950  14.890  1.00   6.55  ? 275  ARG A C    1 
ATOM   3900 O O    . ARG A 1 247 ? 28.898 -8.763  14.028  1.00   7.36  ? 275  ARG A O    1 
ATOM   3901 C CB   . ARG A 1 247 ? 30.240 -6.485  14.776  1.00   8.15  ? 275  ARG A CB   1 
ATOM   3902 C CG   . ARG A 1 247 ? 30.997 -5.254  15.324  1.00   8.83  ? 275  ARG A CG   1 
ATOM   3903 C CD   . ARG A 1 247 ? 30.768 -5.040  16.814  1.00   9.14  ? 275  ARG A CD   1 
ATOM   3904 N NE   . ARG A 1 247 ? 29.339 -4.955  17.135  1.00   8.09  ? 275  ARG A NE   1 
ATOM   3905 C CZ   . ARG A 1 247 ? 28.609 -3.876  16.949  1.00   10.13 ? 275  ARG A CZ   1 
ATOM   3906 N NH1  . ARG A 1 247 ? 29.180 -2.763  16.488  1.00   12.17 ? 275  ARG A NH1  1 
ATOM   3907 N NH2  . ARG A 1 247 ? 27.323 -3.914  17.240  1.00   11.49 ? 275  ARG A NH2  1 
ATOM   3908 H H    . ARG A 1 247 ? 32.160 -8.405  14.156  1.00   9.09  ? 275  ARG A H    1 
ATOM   3909 H HA   . ARG A 1 247 ? 30.661 -7.766  16.322  1.00   8.89  ? 275  ARG A HA   1 
ATOM   3910 H HB2  . ARG A 1 247 ? 30.364 -6.503  13.814  1.00   9.78  ? 275  ARG A HB2  1 
ATOM   3911 H HB3  . ARG A 1 247 ? 29.300 -6.370  14.983  1.00   9.78  ? 275  ARG A HB3  1 
ATOM   3912 H HG2  . ARG A 1 247 ? 31.949 -5.379  15.182  1.00   10.59 ? 275  ARG A HG2  1 
ATOM   3913 H HG3  . ARG A 1 247 ? 30.693 -4.461  14.856  1.00   10.59 ? 275  ARG A HG3  1 
ATOM   3914 H HD2  . ARG A 1 247 ? 31.146 -5.785  17.307  1.00   10.97 ? 275  ARG A HD2  1 
ATOM   3915 H HD3  . ARG A 1 247 ? 31.190 -4.210  17.087  1.00   10.97 ? 275  ARG A HD3  1 
ATOM   3916 H HE   . ARG A 1 247 ? 28.937 -5.676  17.376  1.00   9.71  ? 275  ARG A HE   1 
ATOM   3917 H HH11 . ARG A 1 247 ? 30.018 -2.758  16.295  1.00   14.61 ? 275  ARG A HH11 1 
ATOM   3918 H HH12 . ARG A 1 247 ? 28.707 -2.054  16.371  1.00   14.61 ? 275  ARG A HH12 1 
ATOM   3919 H HH21 . ARG A 1 247 ? 26.973 -4.637  17.547  1.00   13.79 ? 275  ARG A HH21 1 
ATOM   3920 H HH22 . ARG A 1 247 ? 26.839 -3.210  17.140  1.00   13.79 ? 275  ARG A HH22 1 
ATOM   3921 N N    . ASN A 1 248 ? 29.927 -10.119 15.497  1.00   6.74  ? 276  ASN A N    1 
ATOM   3922 C CA   . ASN A 1 248 ? 29.043 -11.224 15.148  1.00   6.59  ? 276  ASN A CA   1 
ATOM   3923 C C    . ASN A 1 248 ? 27.615 -10.943 15.515  1.00   6.40  ? 276  ASN A C    1 
ATOM   3924 O O    . ASN A 1 248 ? 26.708 -11.464 14.877  1.00   6.89  ? 276  ASN A O    1 
ATOM   3925 C CB   . ASN A 1 248 ? 29.543 -12.513 15.723  1.00   8.48  ? 276  ASN A CB   1 
ATOM   3926 C CG   . ASN A 1 248 ? 30.748 -13.003 14.941  1.00   11.03 ? 276  ASN A CG   1 
ATOM   3927 O OD1  . ASN A 1 248 ? 30.605 -13.532 13.846  1.00   12.31 ? 276  ASN A OD1  1 
ATOM   3928 N ND2  . ASN A 1 248 ? 31.900 -12.673 15.393  1.00   12.79 ? 276  ASN A ND2  1 
ATOM   3929 H H    . ASN A 1 248 ? 30.518 -10.296 16.096  1.00   8.09  ? 276  ASN A H    1 
ATOM   3930 H HA   . ASN A 1 248 ? 29.066 -11.324 14.184  1.00   7.91  ? 276  ASN A HA   1 
ATOM   3931 H HB2  . ASN A 1 248 ? 29.810 -12.375 16.645  1.00   10.18 ? 276  ASN A HB2  1 
ATOM   3932 H HB3  . ASN A 1 248 ? 28.846 -13.185 15.668  1.00   10.18 ? 276  ASN A HB3  1 
ATOM   3933 H HD21 . ASN A 1 248 ? 31.961 -12.196 16.106  1.00   15.35 ? 276  ASN A HD21 1 
ATOM   3934 H HD22 . ASN A 1 248 ? 32.612 -12.928 14.983  1.00   15.35 ? 276  ASN A HD22 1 
ATOM   3935 N N    . ASP A 1 249 ? 27.414 -10.084 16.497  1.00   6.31  ? 277  ASP A N    1 
ATOM   3936 C CA   . ASP A 1 249 ? 26.082 -9.693  16.930  1.00   6.15  ? 277  ASP A CA   1 
ATOM   3937 C C    . ASP A 1 249 ? 25.303 -9.073  15.769  1.00   6.58  ? 277  ASP A C    1 
ATOM   3938 O O    . ASP A 1 249 ? 24.092 -9.251  15.669  1.00   7.04  ? 277  ASP A O    1 
ATOM   3939 C CB   . ASP A 1 249 ? 26.139 -8.739  18.133  1.00   7.70  ? 277  ASP A CB   1 
ATOM   3940 C CG   . ASP A 1 249 ? 26.864 -7.444  17.825  1.00   10.06 ? 277  ASP A CG   1 
ATOM   3941 O OD1  . ASP A 1 249 ? 27.954 -7.450  17.306  1.00   11.61 ? 277  ASP A OD1  1 
ATOM   3942 O OD2  . ASP A 1 249 ? 26.329 -6.374  18.085  1.00   13.58 ? 277  ASP A OD2  1 
ATOM   3943 H H    . ASP A 1 249 ? 28.046 -9.703  16.940  1.00   7.57  ? 277  ASP A H    1 
ATOM   3944 H HA   . ASP A 1 249 ? 25.604 -10.488 17.211  1.00   7.38  ? 277  ASP A HA   1 
ATOM   3945 H HB2  . ASP A 1 249 ? 25.234 -8.519  18.404  1.00   9.24  ? 277  ASP A HB2  1 
ATOM   3946 H HB3  . ASP A 1 249 ? 26.606 -9.178  18.861  1.00   9.24  ? 277  ASP A HB3  1 
ATOM   3947 N N    . ILE A 1 250 ? 25.987 -8.319  14.911  1.00   6.63  ? 278  ILE A N    1 
ATOM   3948 C CA   . ILE A 1 250 ? 25.307 -7.715  13.780  1.00   6.63  ? 278  ILE A CA   1 
ATOM   3949 C C    . ILE A 1 250 ? 24.815 -8.781  12.805  1.00   6.07  ? 278  ILE A C    1 
ATOM   3950 O O    . ILE A 1 250 ? 23.744 -8.652  12.200  1.00   6.66  ? 278  ILE A O    1 
ATOM   3951 C CB   . ILE A 1 250 ? 26.254 -6.716  13.069  1.00   7.56  ? 278  ILE A CB   1 
ATOM   3952 C CG1  . ILE A 1 250 ? 26.597 -5.556  14.014  1.00   9.34  ? 278  ILE A CG1  1 
ATOM   3953 C CG2  . ILE A 1 250 ? 25.665 -6.240  11.732  1.00   8.86  ? 278  ILE A CG2  1 
ATOM   3954 C CD1  . ILE A 1 250 ? 25.486 -4.722  14.356  1.00   10.83 ? 278  ILE A CD1  1 
ATOM   3955 H H    . ILE A 1 250 ? 26.828 -8.147  14.963  1.00   7.96  ? 278  ILE A H    1 
ATOM   3956 H HA   . ILE A 1 250 ? 24.536 -7.222  14.100  1.00   7.96  ? 278  ILE A HA   1 
ATOM   3957 H HB   . ILE A 1 250 ? 27.079 -7.185  12.872  1.00   9.07  ? 278  ILE A HB   1 
ATOM   3958 H HG12 . ILE A 1 250 ? 26.954 -5.923  14.838  1.00   11.21 ? 278  ILE A HG12 1 
ATOM   3959 H HG13 . ILE A 1 250 ? 27.266 -4.997  13.589  1.00   11.21 ? 278  ILE A HG13 1 
ATOM   3960 H HG21 . ILE A 1 250 ? 24.817 -5.800  11.900  1.00   10.63 ? 278  ILE A HG21 1 
ATOM   3961 H HG22 . ILE A 1 250 ? 26.284 -5.618  11.319  1.00   10.63 ? 278  ILE A HG22 1 
ATOM   3962 H HG23 . ILE A 1 250 ? 25.532 -7.008  11.155  1.00   10.63 ? 278  ILE A HG23 1 
ATOM   3963 H HD11 . ILE A 1 250 ? 24.811 -5.261  14.796  1.00   13.00 ? 278  ILE A HD11 1 
ATOM   3964 H HD12 . ILE A 1 250 ? 25.791 -4.020  14.953  1.00   13.00 ? 278  ILE A HD12 1 
ATOM   3965 H HD13 . ILE A 1 250 ? 25.123 -4.333  13.545  1.00   13.00 ? 278  ILE A HD13 1 
ATOM   3966 N N    . LEU A 1 251 ? 25.616 -9.826  12.613  1.00   6.03  ? 279  LEU A N    1 
ATOM   3967 C CA   . LEU A 1 251 ? 25.205 -10.912 11.723  1.00   5.39  ? 279  LEU A CA   1 
ATOM   3968 C C    . LEU A 1 251 ? 23.994 -11.653 12.288  1.00   5.79  ? 279  LEU A C    1 
ATOM   3969 O O    . LEU A 1 251 ? 23.056 -11.962 11.548  1.00   6.68  ? 279  LEU A O    1 
ATOM   3970 C CB   . LEU A 1 251 ? 26.361 -11.875 11.498  1.00   5.52  ? 279  LEU A CB   1 
ATOM   3971 C CG   . LEU A 1 251 ? 27.683 -11.260 11.074  1.00   5.09  ? 279  LEU A CG   1 
ATOM   3972 C CD1  . LEU A 1 251 ? 28.681 -12.351 10.730  1.00   5.12  ? 279  LEU A CD1  1 
ATOM   3973 C CD2  . LEU A 1 251 ? 27.541 -10.293 9.907   1.00   5.95  ? 279  LEU A CD2  1 
ATOM   3974 H H    . LEU A 1 251 ? 26.388 -9.931  12.978  1.00   7.24  ? 279  LEU A H    1 
ATOM   3975 H HA   . LEU A 1 251 ? 24.954 -10.539 10.864  1.00   6.47  ? 279  LEU A HA   1 
ATOM   3976 H HB2  . LEU A 1 251 ? 26.520 -12.356 12.325  1.00   6.63  ? 279  LEU A HB2  1 
ATOM   3977 H HB3  . LEU A 1 251 ? 26.101 -12.503 10.806  1.00   6.63  ? 279  LEU A HB3  1 
ATOM   3978 H HG   . LEU A 1 251 ? 28.044 -10.761 11.823  1.00   6.10  ? 279  LEU A HG   1 
ATOM   3979 H HD11 . LEU A 1 251 ? 28.326 -12.885 10.001  1.00   6.15  ? 279  LEU A HD11 1 
ATOM   3980 H HD12 . LEU A 1 251 ? 29.518 -11.940 10.462  1.00   6.15  ? 279  LEU A HD12 1 
ATOM   3981 H HD13 . LEU A 1 251 ? 28.821 -12.909 11.511  1.00   6.15  ? 279  LEU A HD13 1 
ATOM   3982 H HD21 . LEU A 1 251 ? 26.944 -9.573  10.165  1.00   7.14  ? 279  LEU A HD21 1 
ATOM   3983 H HD22 . LEU A 1 251 ? 28.415 -9.936  9.685   1.00   7.14  ? 279  LEU A HD22 1 
ATOM   3984 H HD23 . LEU A 1 251 ? 27.175 -10.770 9.146   1.00   7.14  ? 279  LEU A HD23 1 
ATOM   3985 N N    . ALA A 1 252 ? 23.996 -11.912 13.590  1.00   6.22  ? 280  ALA A N    1 
ATOM   3986 C CA   . ALA A 1 252 ? 22.839 -12.519 14.236  1.00   6.74  ? 280  ALA A CA   1 
ATOM   3987 C C    . ALA A 1 252 ? 21.597 -11.645 14.068  1.00   7.17  ? 280  ALA A C    1 
ATOM   3988 O O    . ALA A 1 252 ? 20.523 -12.136 13.734  1.00   7.51  ? 280  ALA A O    1 
ATOM   3989 C CB   . ALA A 1 252 ? 23.123 -12.752 15.673  1.00   7.58  ? 280  ALA A CB   1 
ATOM   3990 H H    . ALA A 1 252 ? 24.652 -11.747 14.121  1.00   7.46  ? 280  ALA A H    1 
ATOM   3991 H HA   . ALA A 1 252 ? 22.660 -13.378 13.822  1.00   8.09  ? 280  ALA A HA   1 
ATOM   3992 H HB1  . ALA A 1 252 ? 23.321 -11.903 16.097  1.00   9.09  ? 280  ALA A HB1  1 
ATOM   3993 H HB2  . ALA A 1 252 ? 22.344 -13.156 16.087  1.00   9.09  ? 280  ALA A HB2  1 
ATOM   3994 H HB3  . ALA A 1 252 ? 23.885 -13.347 15.751  1.00   9.09  ? 280  ALA A HB3  1 
ATOM   3995 N N    . ALA A 1 253 ? 21.750 -10.338 14.274  1.00   7.83  ? 281  ALA A N    1 
ATOM   3996 C CA   . ALA A 1 253 ? 20.643 -9.405  14.132  1.00   8.67  ? 281  ALA A CA   1 
ATOM   3997 C C    . ALA A 1 253 ? 20.106 -9.391  12.706  1.00   8.48  ? 281  ALA A C    1 
ATOM   3998 O O    . ALA A 1 253 ? 18.889 -9.367  12.483  1.00   8.83  ? 281  ALA A O    1 
ATOM   3999 C CB   . ALA A 1 253 ? 21.089 -8.006  14.559  1.00   9.06  ? 281  ALA A CB   1 
ATOM   4000 H H    . ALA A 1 253 ? 22.492 -9.967  14.498  1.00   9.39  ? 281  ALA A H    1 
ATOM   4001 H HA   . ALA A 1 253 ? 19.922 -9.680  14.720  1.00   10.40 ? 281  ALA A HA   1 
ATOM   4002 H HB1  . ALA A 1 253 ? 21.826 -7.725  13.994  1.00   10.87 ? 281  ALA A HB1  1 
ATOM   4003 H HB2  . ALA A 1 253 ? 20.343 -7.394  14.460  1.00   10.87 ? 281  ALA A HB2  1 
ATOM   4004 H HB3  . ALA A 1 253 ? 21.374 -8.035  15.485  1.00   10.87 ? 281  ALA A HB3  1 
ATOM   4005 N N    . ALA A 1 254 ? 21.007 -9.387  11.733  1.00   7.85  ? 282  ALA A N    1 
ATOM   4006 C CA   . ALA A 1 254 ? 20.585 -9.391  10.340  1.00   7.70  ? 282  ALA A CA   1 
ATOM   4007 C C    . ALA A 1 254 ? 19.834 -10.678 10.011  1.00   7.34  ? 282  ALA A C    1 
ATOM   4008 O O    . ALA A 1 254 ? 18.810 -10.646 9.324   1.00   7.77  ? 282  ALA A O    1 
ATOM   4009 C CB   . ALA A 1 254 ? 21.778 -9.232  9.423   1.00   7.68  ? 282  ALA A CB   1 
ATOM   4010 H H    . ALA A 1 254 ? 21.859 -9.383  11.851  1.00   9.42  ? 282  ALA A H    1 
ATOM   4011 H HA   . ALA A 1 254 ? 19.986 -8.644  10.188  1.00   9.24  ? 282  ALA A HA   1 
ATOM   4012 H HB1  . ALA A 1 254 ? 22.391 -9.968  9.573   1.00   9.22  ? 282  ALA A HB1  1 
ATOM   4013 H HB2  . ALA A 1 254 ? 21.471 -9.237  8.503   1.00   9.22  ? 282  ALA A HB2  1 
ATOM   4014 H HB3  . ALA A 1 254 ? 22.217 -8.390  9.621   1.00   9.22  ? 282  ALA A HB3  1 
ATOM   4015 N N    . ALA A 1 255 ? 20.353 -11.802 10.500  1.00   7.28  ? 283  ALA A N    1 
ATOM   4016 C CA   . ALA A 1 255 ? 19.712 -13.091 10.277  1.00   7.53  ? 283  ALA A CA   1 
ATOM   4017 C C    . ALA A 1 255 ? 18.303 -13.118 10.847  1.00   8.16  ? 283  ALA A C    1 
ATOM   4018 O O    . ALA A 1 255 ? 17.363 -13.618 10.208  1.00   8.75  ? 283  ALA A O    1 
ATOM   4019 C CB   . ALA A 1 255 ? 20.538 -14.193 10.897  1.00   7.83  ? 283  ALA A CB   1 
ATOM   4020 H H    . ALA A 1 255 ? 21.076 -11.843 10.963  1.00   8.74  ? 283  ALA A H    1 
ATOM   4021 H HA   . ALA A 1 255 ? 19.655 -13.257 9.323   1.00   9.04  ? 283  ALA A HA   1 
ATOM   4022 H HB1  . ALA A 1 255 ? 20.614 -14.031 11.850  1.00   9.39  ? 283  ALA A HB1  1 
ATOM   4023 H HB2  . ALA A 1 255 ? 20.098 -15.043 10.739  1.00   9.39  ? 283  ALA A HB2  1 
ATOM   4024 H HB3  . ALA A 1 255 ? 21.418 -14.195 10.489  1.00   9.39  ? 283  ALA A HB3  1 
ATOM   4025 N N    . LYS A 1 256 ? 18.134 -12.567 12.047  1.00   8.78  ? 284  LYS A N    1 
ATOM   4026 C CA   . LYS A 1 256 ? 16.815 -12.499 12.662  1.00   10.07 ? 284  LYS A CA   1 
ATOM   4027 C C    . LYS A 1 256 ? 15.847 -11.664 11.819  1.00   10.97 ? 284  LYS A C    1 
ATOM   4028 O O    . LYS A 1 256 ? 14.713 -12.066 11.580  1.00   12.00 ? 284  LYS A O    1 
ATOM   4029 C CB   . LYS A 1 256 ? 16.924 -11.953 14.072  1.00   12.04 ? 284  LYS A CB   1 
ATOM   4030 C CG   . LYS A 1 256 ? 15.613 -11.988 14.863  1.00   15.39 ? 284  LYS A CG   1 
ATOM   4031 C CD   . LYS A 1 256 ? 15.860 -11.544 16.307  1.00   19.59 ? 284  LYS A CD   1 
ATOM   4032 C CE   . LYS A 1 256 ? 14.679 -11.779 17.217  1.00   22.88 ? 284  LYS A CE   1 
ATOM   4033 N NZ   . LYS A 1 256 ? 15.090 -11.511 18.632  1.00   25.56 ? 284  LYS A NZ   1 
ATOM   4034 H H    . LYS A 1 256 ? 18.765 -12.228 12.523  1.00   10.53 ? 284  LYS A H    1 
ATOM   4035 H HA   . LYS A 1 256 ? 16.453 -13.398 12.721  1.00   12.08 ? 284  LYS A HA   1 
ATOM   4036 H HB2  . LYS A 1 256 ? 17.577 -12.480 14.560  1.00   14.45 ? 284  LYS A HB2  1 
ATOM   4037 H HB3  . LYS A 1 256 ? 17.217 -11.030 14.026  1.00   14.45 ? 284  LYS A HB3  1 
ATOM   4038 H HG2  . LYS A 1 256 ? 14.974 -11.380 14.459  1.00   18.47 ? 284  LYS A HG2  1 
ATOM   4039 H HG3  . LYS A 1 256 ? 15.263 -12.892 14.873  1.00   18.47 ? 284  LYS A HG3  1 
ATOM   4040 H HD2  . LYS A 1 256 ? 16.614 -12.041 16.663  1.00   23.50 ? 284  LYS A HD2  1 
ATOM   4041 H HD3  . LYS A 1 256 ? 16.058 -10.595 16.315  1.00   23.50 ? 284  LYS A HD3  1 
ATOM   4042 H HE2  . LYS A 1 256 ? 13.959 -11.174 16.981  1.00   27.45 ? 284  LYS A HE2  1 
ATOM   4043 H HE3  . LYS A 1 256 ? 14.390 -12.702 17.146  1.00   27.45 ? 284  LYS A HE3  1 
ATOM   4044 H HZ1  . LYS A 1 256 ? 15.364 -10.668 18.714  1.00   30.67 ? 284  LYS A HZ1  1 
ATOM   4045 H HZ2  . LYS A 1 256 ? 14.401 -11.646 19.179  1.00   30.67 ? 284  LYS A HZ2  1 
ATOM   4046 H HZ3  . LYS A 1 256 ? 15.755 -12.055 18.864  1.00   30.67 ? 284  LYS A HZ3  1 
ATOM   4047 N N    . ILE A 1 257 ? 16.315 -10.518 11.348  1.00   10.95 ? 285  ILE A N    1 
ATOM   4048 C CA   . ILE A 1 257 ? 15.495 -9.660  10.515  1.00   11.44 ? 285  ILE A CA   1 
ATOM   4049 C C    . ILE A 1 257 ? 14.999 -10.379 9.267   1.00   11.93 ? 285  ILE A C    1 
ATOM   4050 O O    . ILE A 1 257 ? 13.807 -10.336 8.941   1.00   13.76 ? 285  ILE A O    1 
ATOM   4051 C CB   . ILE A 1 257 ? 16.263 -8.386  10.129  1.00   12.91 ? 285  ILE A CB   1 
ATOM   4052 C CG1  . ILE A 1 257 ? 16.343 -7.461  11.347  1.00   12.54 ? 285  ILE A CG1  1 
ATOM   4053 C CG2  . ILE A 1 257 ? 15.594 -7.670  8.955   1.00   12.91 ? 285  ILE A CG2  1 
ATOM   4054 C CD1  . ILE A 1 257 ? 17.352 -6.327  11.244  1.00   13.45 ? 285  ILE A CD1  1 
ATOM   4055 H H    . ILE A 1 257 ? 17.105 -10.214 11.498  1.00   13.14 ? 285  ILE A H    1 
ATOM   4056 H HA   . ILE A 1 257 ? 14.716 -9.389  11.025  1.00   13.73 ? 285  ILE A HA   1 
ATOM   4057 H HB   . ILE A 1 257 ? 17.164 -8.634  9.869   1.00   15.49 ? 285  ILE A HB   1 
ATOM   4058 H HG12 . ILE A 1 257 ? 15.470 -7.061  11.486  1.00   15.05 ? 285  ILE A HG12 1 
ATOM   4059 H HG13 . ILE A 1 257 ? 16.582 -7.993  12.121  1.00   15.05 ? 285  ILE A HG13 1 
ATOM   4060 H HG21 . ILE A 1 257 ? 14.690 -7.426  9.209   1.00   15.49 ? 285  ILE A HG21 1 
ATOM   4061 H HG22 . ILE A 1 257 ? 16.104 -6.873  8.740   1.00   15.49 ? 285  ILE A HG22 1 
ATOM   4062 H HG23 . ILE A 1 257 ? 15.574 -8.267  8.191   1.00   15.49 ? 285  ILE A HG23 1 
ATOM   4063 H HD11 . ILE A 1 257 ? 17.122 -5.769  10.485  1.00   16.14 ? 285  ILE A HD11 1 
ATOM   4064 H HD12 . ILE A 1 257 ? 17.323 -5.805  12.060  1.00   16.14 ? 285  ILE A HD12 1 
ATOM   4065 H HD13 . ILE A 1 257 ? 18.237 -6.704  11.122  1.00   16.14 ? 285  ILE A HD13 1 
ATOM   4066 N N    . VAL A 1 258 ? 15.900 -11.015 8.537   1.00   10.76 ? 286  VAL A N    1 
ATOM   4067 C CA   . VAL A 1 258 ? 15.515 -11.535 7.233   1.00   11.22 ? 286  VAL A CA   1 
ATOM   4068 C C    . VAL A 1 258 ? 14.846 -12.899 7.264   1.00   12.33 ? 286  VAL A C    1 
ATOM   4069 O O    . VAL A 1 258 ? 14.278 -13.327 6.256   1.00   13.12 ? 286  VAL A O    1 
ATOM   4070 C CB   . VAL A 1 258 ? 16.703 -11.564 6.235   1.00   10.73 ? 286  VAL A CB   1 
ATOM   4071 C CG1  . VAL A 1 258 ? 17.271 -10.194 6.067   1.00   10.71 ? 286  VAL A CG1  1 
ATOM   4072 C CG2  . VAL A 1 258 ? 17.805 -12.557 6.663   1.00   10.11 ? 286  VAL A CG2  1 
ATOM   4073 H H    . VAL A 1 258 ? 16.718 -11.157 8.762   1.00   12.92 ? 286  VAL A H    1 
ATOM   4074 H HA   . VAL A 1 258 ? 14.862 -10.921 6.862   1.00   13.46 ? 286  VAL A HA   1 
ATOM   4075 H HB   . VAL A 1 258 ? 16.371 -11.850 5.370   1.00   12.87 ? 286  VAL A HB   1 
ATOM   4076 H HG11 . VAL A 1 258 ? 17.583 -9.874  6.928   1.00   12.85 ? 286  VAL A HG11 1 
ATOM   4077 H HG12 . VAL A 1 258 ? 18.011 -10.234 5.441   1.00   12.85 ? 286  VAL A HG12 1 
ATOM   4078 H HG13 . VAL A 1 258 ? 16.579 -9.605  5.726   1.00   12.85 ? 286  VAL A HG13 1 
ATOM   4079 H HG21 . VAL A 1 258 ? 17.425 -13.449 6.709   1.00   12.14 ? 286  VAL A HG21 1 
ATOM   4080 H HG22 . VAL A 1 258 ? 18.520 -12.536 6.008   1.00   12.14 ? 286  VAL A HG22 1 
ATOM   4081 H HG23 . VAL A 1 258 ? 18.144 -12.296 7.533   1.00   12.14 ? 286  VAL A HG23 1 
ATOM   4082 N N    . THR A 1 259 ? 14.923 -13.613 8.382   1.00   13.70 ? 287  THR A N    1 
ATOM   4083 C CA   . THR A 1 259 ? 14.299 -14.938 8.457   1.00   15.41 ? 287  THR A CA   1 
ATOM   4084 C C    . THR A 1 259 ? 13.000 -14.895 9.229   1.00   20.12 ? 287  THR A C    1 
ATOM   4085 O O    . THR A 1 259 ? 12.334 -15.904 9.362   1.00   19.82 ? 287  THR A O    1 
ATOM   4086 C CB   . THR A 1 259 ? 15.208 -16.001 9.081   1.00   14.53 ? 287  THR A CB   1 
ATOM   4087 O OG1  . THR A 1 259 ? 15.494 -15.645 10.438  1.00   14.83 ? 287  THR A OG1  1 
ATOM   4088 C CG2  . THR A 1 259 ? 16.481 -16.165 8.257   1.00   15.09 ? 287  THR A CG2  1 
ATOM   4089 H H    . THR A 1 259 ? 15.323 -13.362 9.101   1.00   16.44 ? 287  THR A H    1 
ATOM   4090 H HA   . THR A 1 259 ? 14.091 -15.228 7.556   1.00   18.49 ? 287  THR A HA   1 
ATOM   4091 H HB   . THR A 1 259 ? 14.742 -16.851 9.074   1.00   17.43 ? 287  THR A HB   1 
ATOM   4092 H HG1  . THR A 1 259 ? 15.881 -14.900 10.464  1.00   17.79 ? 287  THR A HG1  1 
ATOM   4093 H HG21 . THR A 1 259 ? 16.964 -15.324 8.223   1.00   18.11 ? 287  THR A HG21 1 
ATOM   4094 H HG22 . THR A 1 259 ? 17.051 -16.839 8.659   1.00   18.11 ? 287  THR A HG22 1 
ATOM   4095 H HG23 . THR A 1 259 ? 16.258 -16.437 7.353   1.00   18.11 ? 287  THR A HG23 1 
ATOM   4096 N N    . HIS A 1 260 ? 12.622 -13.714 9.696   1.00   24.77 ? 288  HIS A N    1 
ATOM   4097 C CA   . HIS A 1 260 ? 11.368 -13.541 10.426  1.00   31.62 ? 288  HIS A CA   1 
ATOM   4098 C C    . HIS A 1 260 ? 10.135 -13.814 9.554   1.00   35.86 ? 288  HIS A C    1 
ATOM   4099 O O    . HIS A 1 260 ? 10.206 -13.810 8.323   1.00   35.77 ? 288  HIS A O    1 
ATOM   4100 C CB   . HIS A 1 260 ? 11.300 -12.122 10.990  1.00   33.59 ? 288  HIS A CB   1 
ATOM   4101 C CG   . HIS A 1 260 ? 10.139 -11.883 11.904  1.00   35.76 ? 288  HIS A CG   1 
ATOM   4102 N ND1  . HIS A 1 260 ? 8.970  -11.290 11.480  1.00   36.73 ? 288  HIS A ND1  1 
ATOM   4103 C CD2  . HIS A 1 260 ? 9.972  -12.145 13.222  1.00   36.62 ? 288  HIS A CD2  1 
ATOM   4104 C CE1  . HIS A 1 260 ? 8.130  -11.200 12.496  1.00   37.07 ? 288  HIS A CE1  1 
ATOM   4105 N NE2  . HIS A 1 260 ? 8.713  -11.712 13.565  1.00   37.27 ? 288  HIS A NE2  1 
ATOM   4106 H H    . HIS A 1 260 ? 13.076 -12.989 9.605   1.00   29.72 ? 288  HIS A H    1 
ATOM   4107 H HA   . HIS A 1 260 ? 11.349 -14.161 11.172  1.00   37.94 ? 288  HIS A HA   1 
ATOM   4108 H HB2  . HIS A 1 260 ? 12.112 -11.946 11.491  1.00   40.31 ? 288  HIS A HB2  1 
ATOM   4109 H HB3  . HIS A 1 260 ? 11.229 -11.497 10.251  1.00   40.31 ? 288  HIS A HB3  1 
ATOM   4110 H HD2  . HIS A 1 260 ? 10.592 -12.544 13.788  1.00   43.95 ? 288  HIS A HD2  1 
ATOM   4111 H HE1  . HIS A 1 260 ? 7.273  -10.839 12.464  1.00   44.49 ? 288  HIS A HE1  1 
ATOM   4112 H HE2  . HIS A 1 260 ? 8.362  -11.767 14.348  1.00   44.72 ? 288  HIS A HE2  1 
ATOM   4113 N N    . GLY A 1 261 ? 8.997  -14.034 10.203  1.00   40.02 ? 289  GLY A N    1 
ATOM   4114 C CA   . GLY A 1 261 ? 7.758  -14.286 9.490   1.00   43.22 ? 289  GLY A CA   1 
ATOM   4115 C C    . GLY A 1 261 ? 7.952  -15.568 8.719   1.00   46.12 ? 289  GLY A C    1 
ATOM   4116 O O    . GLY A 1 261 ? 7.847  -15.619 7.490   1.00   46.92 ? 289  GLY A O    1 
ATOM   4117 H H    . GLY A 1 261 ? 8.919  -14.042 11.060  1.00   48.02 ? 289  GLY A H    1 
ATOM   4118 H HA2  . GLY A 1 261 ? 7.021  -14.389 10.112  1.00   51.87 ? 289  GLY A HA2  1 
ATOM   4119 H HA3  . GLY A 1 261 ? 7.566  -13.562 8.874   1.00   51.87 ? 289  GLY A HA3  1 
ATOM   4120 N N    . PHE A 1 262 ? 8.256  -16.622 9.455   1.00   47.66 ? 290  PHE A N    1 
ATOM   4121 C CA   . PHE A 1 262 ? 8.721  -17.830 8.822   1.00   48.76 ? 290  PHE A CA   1 
ATOM   4122 C C    . PHE A 1 262 ? 8.891  -18.944 9.842   1.00   48.37 ? 290  PHE A C    1 
ATOM   4123 O O    . PHE A 1 262 ? 9.915  -19.022 10.505  1.00   47.70 ? 290  PHE A O    1 
ATOM   4124 C CB   . PHE A 1 262 ? 10.060 -17.547 8.150   1.00   49.56 ? 290  PHE A CB   1 
ATOM   4125 C CG   . PHE A 1 262 ? 10.475 -18.595 7.203   1.00   50.52 ? 290  PHE A CG   1 
ATOM   4126 C CD1  . PHE A 1 262 ? 10.843 -19.836 7.660   1.00   50.96 ? 290  PHE A CD1  1 
ATOM   4127 C CD2  . PHE A 1 262 ? 10.468 -18.356 5.852   1.00   51.08 ? 290  PHE A CD2  1 
ATOM   4128 C CE1  . PHE A 1 262 ? 11.211 -20.807 6.793   1.00   51.19 ? 290  PHE A CE1  1 
ATOM   4129 C CE2  . PHE A 1 262 ? 10.837 -19.331 4.968   1.00   51.22 ? 290  PHE A CE2  1 
ATOM   4130 C CZ   . PHE A 1 262 ? 11.215 -20.557 5.441   1.00   51.28 ? 290  PHE A CZ   1 
ATOM   4131 H H    . PHE A 1 262 ? 8.201  -16.660 10.312  1.00   57.20 ? 290  PHE A H    1 
ATOM   4132 H HA   . PHE A 1 262 ? 8.085  -18.116 8.148   1.00   58.51 ? 290  PHE A HA   1 
ATOM   4133 H HB2  . PHE A 1 262 ? 9.995  -16.713 7.659   1.00   59.47 ? 290  PHE A HB2  1 
ATOM   4134 H HB3  . PHE A 1 262 ? 10.745 -17.475 8.833   1.00   59.47 ? 290  PHE A HB3  1 
ATOM   4135 H HD1  . PHE A 1 262 ? 10.846 -20.009 8.574   1.00   61.15 ? 290  PHE A HD1  1 
ATOM   4136 H HD2  . PHE A 1 262 ? 10.214 -17.519 5.534   1.00   61.29 ? 290  PHE A HD2  1 
ATOM   4137 H HE1  . PHE A 1 262 ? 11.467 -21.642 7.112   1.00   61.43 ? 290  PHE A HE1  1 
ATOM   4138 H HE2  . PHE A 1 262 ? 10.838 -19.160 4.054   1.00   61.46 ? 290  PHE A HE2  1 
ATOM   4139 H HZ   . PHE A 1 262 ? 11.467 -21.226 4.846   1.00   61.54 ? 290  PHE A HZ   1 
HETATM 4140 S S    . SO4 B 2 .   ? 36.957 -17.381 11.509  0.66   7.84  ? 1291 SO4 A S    1 
HETATM 4141 O O1   . SO4 B 2 .   ? 38.010 -17.266 10.513  0.66   30.42 ? 1291 SO4 A O1   1 
HETATM 4142 O O2   . SO4 B 2 .   ? 35.925 -18.128 10.847  0.66   15.11 ? 1291 SO4 A O2   1 
HETATM 4143 O O3   . SO4 B 2 .   ? 37.558 -18.103 12.630  0.66   23.36 ? 1291 SO4 A O3   1 
HETATM 4144 O O4   . SO4 B 2 .   ? 36.617 -16.034 11.949  0.66   31.44 ? 1291 SO4 A O4   1 
HETATM 4145 S S    . SO4 C 2 .   ? 9.324  -23.499 10.524  0.83   10.06 ? 1292 SO4 A S    1 
HETATM 4146 O O1   . SO4 C 2 .   ? 9.489  -24.061 9.177   0.83   11.65 ? 1292 SO4 A O1   1 
HETATM 4147 O O2   . SO4 C 2 .   ? 7.966  -23.866 11.005  0.83   10.27 ? 1292 SO4 A O2   1 
HETATM 4148 O O3   . SO4 C 2 .   ? 10.309 -24.162 11.311  0.83   12.53 ? 1292 SO4 A O3   1 
HETATM 4149 O O4   . SO4 C 2 .   ? 9.509  -22.046 10.556  0.83   11.21 ? 1292 SO4 A O4   1 
HETATM 4150 S S    . SO4 D 2 .   ? 30.529 -10.567 18.916  0.76   9.01  ? 1293 SO4 A S    1 
HETATM 4151 O O1   . SO4 D 2 .   ? 31.409 -10.692 17.759  0.76   8.81  ? 1293 SO4 A O1   1 
HETATM 4152 O O2   . SO4 D 2 .   ? 29.589 -9.471  18.745  0.76   9.23  ? 1293 SO4 A O2   1 
HETATM 4153 O O3   . SO4 D 2 .   ? 29.783 -11.816 19.320  0.76   8.17  ? 1293 SO4 A O3   1 
HETATM 4154 O O4   . SO4 D 2 .   ? 31.405 -10.181 20.024  0.76   10.04 ? 1293 SO4 A O4   1 
HETATM 4155 S S    . SO4 E 2 .   ? 41.644 -44.990 -0.699  0.68   22.63 ? 1294 SO4 A S    1 
HETATM 4156 O O1   . SO4 E 2 .   ? 42.870 -44.477 -1.301  0.68   25.08 ? 1294 SO4 A O1   1 
HETATM 4157 O O2   . SO4 E 2 .   ? 41.199 -46.186 -1.418  0.68   30.80 ? 1294 SO4 A O2   1 
HETATM 4158 O O3   . SO4 E 2 .   ? 41.963 -45.317 0.690   0.68   29.51 ? 1294 SO4 A O3   1 
HETATM 4159 O O4   . SO4 E 2 .   ? 40.583 -43.972 -0.712  0.68   22.16 ? 1294 SO4 A O4   1 
HETATM 4160 S S    . SO4 F 2 .   ? 50.168 -5.831  0.301   0.55   23.40 ? 1295 SO4 A S    1 
HETATM 4161 O O1   . SO4 F 2 .   ? 50.858 -5.256  -0.853  0.55   31.16 ? 1295 SO4 A O1   1 
HETATM 4162 O O2   . SO4 F 2 .   ? 48.822 -5.281  0.187   0.55   38.41 ? 1295 SO4 A O2   1 
HETATM 4163 O O3   . SO4 F 2 .   ? 50.149 -7.290  0.112   0.55   19.76 ? 1295 SO4 A O3   1 
HETATM 4164 O O4   . SO4 F 2 .   ? 50.915 -5.453  1.508   0.55   22.62 ? 1295 SO4 A O4   1 
HETATM 4165 O O    . HOH G 3 .   ? 9.050  -24.218 16.706  1.00   48.11 ? 2001 HOH A O    1 
HETATM 4166 O O    . HOH G 3 .   ? 11.525 -4.942  2.437   1.00   23.37 ? 2002 HOH A O    1 
HETATM 4167 O O    . HOH G 3 .   ? 8.838  -6.357  3.983   1.00   34.94 ? 2003 HOH A O    1 
HETATM 4168 O O    . HOH G 3 .   ? 11.121 -1.858  4.270   1.00   22.99 ? 2004 HOH A O    1 
HETATM 4169 O O    . HOH G 3 .   ? 10.100 -1.140  9.196   1.00   43.21 ? 2005 HOH A O    1 
HETATM 4170 O O    . HOH G 3 .   ? 8.231  -1.271  10.290  1.00   38.78 ? 2006 HOH A O    1 
HETATM 4171 O O    . HOH G 3 .   ? 17.143 -0.776  1.854   1.00   29.19 ? 2007 HOH A O    1 
HETATM 4172 O O    . HOH G 3 .   ? 15.718 -7.406  -1.883  1.00   14.79 ? 2008 HOH A O    1 
HETATM 4173 O O    . HOH G 3 .   ? 13.578 -6.961  0.506   1.00   27.76 ? 2009 HOH A O    1 
HETATM 4174 O O    . HOH G 3 .   ? 15.310 2.496   7.804   1.00   27.68 ? 2010 HOH A O    1 
HETATM 4175 O O    . HOH G 3 .   ? 10.974 -0.389  2.154   1.00   38.14 ? 2011 HOH A O    1 
HETATM 4176 O O    . HOH G 3 .   ? 13.280 1.200   1.973   1.00   40.05 ? 2012 HOH A O    1 
HETATM 4177 O O    . HOH G 3 .   ? 16.750 -2.720  12.664  1.00   27.74 ? 2013 HOH A O    1 
HETATM 4178 O O    . HOH G 3 .   ? 12.042 -8.781  10.364  1.00   24.33 ? 2014 HOH A O    1 
HETATM 4179 O O    . HOH G 3 .   ? 13.897 -5.499  13.315  1.00   29.54 ? 2015 HOH A O    1 
HETATM 4180 O O    . HOH G 3 .   ? 22.815 2.717   6.489   1.00   17.68 ? 2016 HOH A O    1 
HETATM 4181 O O    . HOH G 3 .   ? 20.962 3.163   7.543   1.00   24.15 ? 2017 HOH A O    1 
HETATM 4182 O O    . HOH G 3 .   ? 19.068 4.382   4.117   1.00   26.02 ? 2018 HOH A O    1 
HETATM 4183 O O    . HOH G 3 .   ? 19.358 3.064   13.017  1.00   24.65 ? 2019 HOH A O    1 
HETATM 4184 O O    . HOH G 3 .   ? 27.316 2.411   9.671   1.00   14.93 ? 2020 HOH A O    1 
HETATM 4185 O O    . HOH G 3 .   ? 26.866 3.550   11.238  1.00   15.92 ? 2021 HOH A O    1 
HETATM 4186 O O    . HOH G 3 .   ? 19.840 -0.549  -0.005  1.00   43.23 ? 2022 HOH A O    1 
HETATM 4187 O O    . HOH G 3 .   ? 16.743 -5.194  -3.434  1.00   34.05 ? 2023 HOH A O    1 
HETATM 4188 O O    . HOH G 3 .   ? 17.475 3.936   8.939   1.00   30.73 ? 2024 HOH A O    1 
HETATM 4189 O O    . HOH G 3 .   ? 15.771 -4.321  14.087  1.00   36.42 ? 2025 HOH A O    1 
HETATM 4190 O O    . HOH G 3 .   ? 14.222 -1.000  12.486  1.00   31.73 ? 2026 HOH A O    1 
HETATM 4191 O O    . HOH G 3 .   ? 12.722 -9.496  13.368  1.00   37.18 ? 2027 HOH A O    1 
HETATM 4192 O O    . HOH G 3 .   ? 14.658 -8.251  14.625  1.00   23.02 ? 2028 HOH A O    1 
HETATM 4193 O O    . HOH G 3 .   ? 14.800 3.798   11.627  1.00   39.86 ? 2029 HOH A O    1 
HETATM 4194 O O    . HOH G 3 .   ? 25.164 5.713   9.963   1.00   19.15 ? 2030 HOH A O    1 
HETATM 4195 O O    . HOH G 3 .   ? 23.711 7.940   10.377  1.00   17.46 ? 2031 HOH A O    1 
HETATM 4196 O O    . HOH G 3 .   ? 17.305 4.246   11.276  1.00   31.64 ? 2032 HOH A O    1 
HETATM 4197 O O    . HOH G 3 .   ? 24.167 2.304   17.334  1.00   23.61 ? 2033 HOH A O    1 
HETATM 4198 O O    . HOH G 3 .   ? 27.724 0.000   16.200  0.50   21.66 ? 2034 HOH A O    1 
HETATM 4199 O O    . HOH G 3 .   ? 19.632 -1.637  14.953  1.00   37.85 ? 2035 HOH A O    1 
HETATM 4200 O O    . HOH G 3 .   ? 19.965 0.000   16.200  0.50   37.08 ? 2036 HOH A O    1 
HETATM 4201 O O    . HOH G 3 .   ? 22.353 4.226   15.455  1.00   18.70 ? 2037 HOH A O    1 
HETATM 4202 O O    . HOH G 3 .   ? 30.687 -1.652  15.065  1.00   16.79 ? 2038 HOH A O    1 
HETATM 4203 O O    . HOH G 3 .   ? 30.072 3.188   8.726   1.00   14.64 ? 2039 HOH A O    1 
HETATM 4204 O O    . HOH G 3 .   ? 33.296 0.864   13.515  1.00   9.63  ? 2040 HOH A O    1 
HETATM 4205 O O    . HOH G 3 .   ? 35.398 -1.476  -3.335  1.00   28.75 ? 2041 HOH A O    1 
HETATM 4206 O O    . HOH G 3 .   ? 32.713 0.138   6.685   1.00   7.82  ? 2042 HOH A O    1 
HETATM 4207 O O    . HOH G 3 .   ? 35.103 -1.886  3.016   1.00   7.98  ? 2043 HOH A O    1 
HETATM 4208 O O    . HOH G 3 .   ? 35.882 -3.209  0.155   1.00   10.91 ? 2044 HOH A O    1 
HETATM 4209 O O    . HOH G 3 .   ? 34.707 -0.493  -0.064  1.00   28.64 ? 2045 HOH A O    1 
HETATM 4210 O O    . HOH G 3 .   ? 12.030 -15.084 2.867   1.00   34.46 ? 2046 HOH A O    1 
HETATM 4211 O O    . HOH G 3 .   ? 4.218  -23.852 -4.444  1.00   23.37 ? 2047 HOH A O    1 
HETATM 4212 O O    . HOH G 3 .   ? 6.452  -20.602 -5.458  1.00   39.74 ? 2048 HOH A O    1 
HETATM 4213 O O    . HOH G 3 .   ? 17.290 -7.813  -7.760  1.00   44.85 ? 2049 HOH A O    1 
HETATM 4214 O O    . HOH G 3 .   ? 22.053 -0.314  -1.497  1.00   39.12 ? 2050 HOH A O    1 
HETATM 4215 O O    . HOH G 3 .   ? 28.842 2.017   -3.035  1.00   26.91 ? 2051 HOH A O    1 
HETATM 4216 O O    . HOH G 3 .   ? 29.119 0.469   -5.404  1.00   36.11 ? 2052 HOH A O    1 
HETATM 4217 O O    . HOH G 3 .   ? 11.361 -21.400 2.596   1.00   12.11 ? 2053 HOH A O    1 
HETATM 4218 O O    . HOH G 3 .   ? 8.235  -19.131 0.959   1.00   26.07 ? 2054 HOH A O    1 
HETATM 4219 O O    . HOH G 3 .   ? 11.140 -16.734 3.634   1.00   36.95 ? 2055 HOH A O    1 
HETATM 4220 O O    . HOH G 3 .   ? 10.581 -14.953 0.436   1.00   40.03 ? 2056 HOH A O    1 
HETATM 4221 O O    . HOH G 3 .   ? 35.759 -5.069  -11.618 1.00   46.11 ? 2057 HOH A O    1 
HETATM 4222 O O    . HOH G 3 .   ? 12.304 -23.792 -5.988  1.00   20.10 ? 2058 HOH A O    1 
HETATM 4223 O O    . HOH G 3 .   ? 7.139  -23.434 -4.307  1.00   18.80 ? 2059 HOH A O    1 
HETATM 4224 O O    . HOH G 3 .   ? 8.534  -15.142 -0.508  1.00   42.42 ? 2060 HOH A O    1 
HETATM 4225 O O    . HOH G 3 .   ? 15.877 -16.739 -8.409  1.00   34.16 ? 2061 HOH A O    1 
HETATM 4226 O O    . HOH G 3 .   ? 14.690 -13.434 -7.274  1.00   32.75 ? 2062 HOH A O    1 
HETATM 4227 O O    . HOH G 3 .   ? 15.949 -20.681 -5.168  1.00   28.37 ? 2063 HOH A O    1 
HETATM 4228 O O    . HOH G 3 .   ? 12.895 -13.873 0.031   1.00   28.25 ? 2064 HOH A O    1 
HETATM 4229 O O    . HOH G 3 .   ? 40.880 -32.935 -11.400 1.00   15.64 ? 2065 HOH A O    1 
HETATM 4230 O O    . HOH G 3 .   ? 45.775 -32.684 -9.056  1.00   14.86 ? 2066 HOH A O    1 
HETATM 4231 O O    . HOH G 3 .   ? 43.183 -26.083 -12.693 1.00   33.00 ? 2067 HOH A O    1 
HETATM 4232 O O    . HOH G 3 .   ? 12.826 -11.576 -4.830  1.00   19.75 ? 2068 HOH A O    1 
HETATM 4233 O O    . HOH G 3 .   ? 11.785 -11.289 -0.799  1.00   33.20 ? 2069 HOH A O    1 
HETATM 4234 O O    . HOH G 3 .   ? 14.870 -8.914  -4.218  1.00   25.31 ? 2070 HOH A O    1 
HETATM 4235 O O    . HOH G 3 .   ? 16.101 -9.998  -6.298  1.00   25.98 ? 2071 HOH A O    1 
HETATM 4236 O O    . HOH G 3 .   ? 19.298 -11.508 -8.422  1.00   29.54 ? 2072 HOH A O    1 
HETATM 4237 O O    . HOH G 3 .   ? 20.153 -15.727 -7.889  1.00   37.32 ? 2073 HOH A O    1 
HETATM 4238 O O    . HOH G 3 .   ? 35.962 -40.156 -2.638  1.00   19.95 ? 2074 HOH A O    1 
HETATM 4239 O O    . HOH G 3 .   ? 33.732 -43.791 -11.980 1.00   45.49 ? 2075 HOH A O    1 
HETATM 4240 O O    . HOH G 3 .   ? 35.795 -39.757 -14.624 1.00   28.20 ? 2076 HOH A O    1 
HETATM 4241 O O    . HOH G 3 .   ? 20.869 1.698   2.163   1.00   40.75 ? 2077 HOH A O    1 
HETATM 4242 O O    . HOH G 3 .   ? 36.804 -41.918 5.398   1.00   37.68 ? 2078 HOH A O    1 
HETATM 4243 O O    . HOH G 3 .   ? 38.216 -38.441 7.066   1.00   24.10 ? 2079 HOH A O    1 
HETATM 4244 O O    . HOH G 3 .   ? 50.853 -33.701 -0.462  1.00   25.10 ? 2080 HOH A O    1 
HETATM 4245 O O    . HOH G 3 .   ? 43.926 -42.516 11.058  1.00   45.23 ? 2081 HOH A O    1 
HETATM 4246 O O    . HOH G 3 .   ? 21.388 -5.019  -2.872  1.00   13.42 ? 2082 HOH A O    1 
HETATM 4247 O O    . HOH G 3 .   ? 21.029 -2.347  -1.219  1.00   19.92 ? 2083 HOH A O    1 
HETATM 4248 O O    . HOH G 3 .   ? 26.771 1.924   -2.360  1.00   22.92 ? 2084 HOH A O    1 
HETATM 4249 O O    . HOH G 3 .   ? 24.691 3.476   -0.552  1.00   15.05 ? 2085 HOH A O    1 
HETATM 4250 O O    . HOH G 3 .   ? 51.182 -29.247 0.090   1.00   20.61 ? 2086 HOH A O    1 
HETATM 4251 O O    . HOH G 3 .   ? 58.652 -29.980 14.875  1.00   28.29 ? 2087 HOH A O    1 
HETATM 4252 O O    . HOH G 3 .   ? 56.888 -29.236 16.581  1.00   25.86 ? 2088 HOH A O    1 
HETATM 4253 O O    . HOH G 3 .   ? 24.560 -3.650  -4.224  1.00   13.64 ? 2089 HOH A O    1 
HETATM 4254 O O    . HOH G 3 .   ? 52.191 -20.900 5.028   1.00   31.85 ? 2090 HOH A O    1 
HETATM 4255 O O    . HOH G 3 .   ? 58.236 -27.835 4.230   1.00   30.89 ? 2091 HOH A O    1 
HETATM 4256 O O    . HOH G 3 .   ? 60.765 -30.541 7.647   1.00   30.08 ? 2092 HOH A O    1 
HETATM 4257 O O    . HOH G 3 .   ? 29.571 -1.995  -5.899  1.00   33.93 ? 2093 HOH A O    1 
HETATM 4258 O O    . HOH G 3 .   ? 30.701 -5.399  -7.080  1.00   35.99 ? 2094 HOH A O    1 
HETATM 4259 O O    . HOH G 3 .   ? 23.375 -8.909  -9.412  1.00   31.65 ? 2095 HOH A O    1 
HETATM 4260 O O    . HOH G 3 .   ? 26.788 -9.705  -7.287  1.00   13.92 ? 2096 HOH A O    1 
HETATM 4261 O O    . HOH G 3 .   ? 29.329 1.043   -0.422  1.00   16.20 ? 2097 HOH A O    1 
HETATM 4262 O O    . HOH G 3 .   ? 24.346 -1.081  -2.701  1.00   23.86 ? 2098 HOH A O    1 
HETATM 4263 O O    . HOH G 3 .   ? 33.101 -2.559  -2.143  1.00   22.25 ? 2099 HOH A O    1 
HETATM 4264 O O    . HOH G 3 .   ? 31.789 -3.003  -4.626  1.00   20.86 ? 2100 HOH A O    1 
HETATM 4265 O O    . HOH G 3 .   ? 37.059 -5.443  -8.453  1.00   25.64 ? 2101 HOH A O    1 
HETATM 4266 O O    . HOH G 3 .   ? 36.265 -10.493 -9.189  1.00   24.95 ? 2102 HOH A O    1 
HETATM 4267 O O    . HOH G 3 .   ? 37.828 -7.938  -8.995  1.00   16.15 ? 2103 HOH A O    1 
HETATM 4268 O O    . HOH G 3 .   ? 53.829 -29.910 19.365  1.00   26.29 ? 2104 HOH A O    1 
HETATM 4269 O O    . HOH G 3 .   ? 54.739 -27.466 16.124  1.00   22.52 ? 2105 HOH A O    1 
HETATM 4270 O O    . HOH G 3 .   ? 39.042 -32.311 14.666  1.00   18.93 ? 2106 HOH A O    1 
HETATM 4271 O O    . HOH G 3 .   ? 42.507 -34.746 16.848  1.00   44.64 ? 2107 HOH A O    1 
HETATM 4272 O O    . HOH G 3 .   ? 37.382 -29.121 20.623  1.00   19.87 ? 2108 HOH A O    1 
HETATM 4273 O O    . HOH G 3 .   ? 44.476 -38.560 12.572  1.00   42.12 ? 2109 HOH A O    1 
HETATM 4274 O O    . HOH G 3 .   ? 57.785 -32.501 18.812  1.00   24.37 ? 2110 HOH A O    1 
HETATM 4275 O O    . HOH G 3 .   ? 61.487 -33.238 16.806  1.00   25.34 ? 2111 HOH A O    1 
HETATM 4276 O O    . HOH G 3 .   ? 36.229 -5.373  2.053   1.00   7.50  ? 2112 HOH A O    1 
HETATM 4277 O O    . HOH G 3 .   ? 33.042 -8.516  4.716   1.00   27.33 ? 2113 HOH A O    1 
HETATM 4278 O O    . HOH G 3 .   ? 39.162 -11.760 2.283   1.00   5.53  ? 2114 HOH A O    1 
HETATM 4279 O O    . HOH G 3 .   ? 38.435 -35.085 10.556  1.00   17.50 ? 2115 HOH A O    1 
HETATM 4280 O O    . HOH G 3 .   ? 38.982 -31.134 12.241  1.00   11.18 ? 2116 HOH A O    1 
HETATM 4281 O O    . HOH G 3 .   ? 40.974 -40.764 12.923  1.00   44.34 ? 2117 HOH A O    1 
HETATM 4282 O O    . HOH G 3 .   ? 38.906 -15.291 8.596   1.00   13.33 ? 2118 HOH A O    1 
HETATM 4283 O O    . HOH G 3 .   ? 42.272 -16.952 6.746   1.00   26.97 ? 2119 HOH A O    1 
HETATM 4284 O O    . HOH G 3 .   ? 35.748 -34.533 11.064  1.00   29.92 ? 2120 HOH A O    1 
HETATM 4285 O O    . HOH G 3 .   ? 49.461 -21.931 -2.627  1.00   13.24 ? 2121 HOH A O    1 
HETATM 4286 O O    . HOH G 3 .   ? 50.999 -21.712 1.749   1.00   26.42 ? 2122 HOH A O    1 
HETATM 4287 O O    . HOH G 3 .   ? 50.764 -23.095 -4.493  1.00   33.07 ? 2123 HOH A O    1 
HETATM 4288 O O    . HOH G 3 .   ? 52.609 -23.743 -2.063  1.00   41.33 ? 2124 HOH A O    1 
HETATM 4289 O O    . HOH G 3 .   ? 38.745 -28.019 -8.571  1.00   9.17  ? 2125 HOH A O    1 
HETATM 4290 O O    . HOH G 3 .   ? 36.602 -33.999 -11.117 1.00   11.23 ? 2126 HOH A O    1 
HETATM 4291 O O    . HOH G 3 .   ? 28.779 -32.551 -10.466 1.00   17.58 ? 2127 HOH A O    1 
HETATM 4292 O O    . HOH G 3 .   ? 36.697 -27.494 -11.912 1.00   11.53 ? 2128 HOH A O    1 
HETATM 4293 O O    . HOH G 3 .   ? 40.864 -35.275 -10.033 1.00   10.09 ? 2129 HOH A O    1 
HETATM 4294 O O    . HOH G 3 .   ? 45.616 -30.101 -8.124  1.00   10.83 ? 2130 HOH A O    1 
HETATM 4295 O O    . HOH G 3 .   ? 43.824 -27.719 -9.585  1.00   27.19 ? 2131 HOH A O    1 
HETATM 4296 O O    . HOH G 3 .   ? 35.601 -40.565 -7.130  1.00   27.28 ? 2132 HOH A O    1 
HETATM 4297 O O    . HOH G 3 .   ? 34.688 -39.739 -5.534  1.00   26.45 ? 2133 HOH A O    1 
HETATM 4298 O O    . HOH G 3 .   ? 34.343 -37.558 -2.715  1.00   27.03 ? 2134 HOH A O    1 
HETATM 4299 O O    . HOH G 3 .   ? 49.792 -16.709 -2.892  1.00   32.11 ? 2135 HOH A O    1 
HETATM 4300 O O    . HOH G 3 .   ? 36.260 -41.671 -9.680  1.00   25.27 ? 2136 HOH A O    1 
HETATM 4301 O O    . HOH G 3 .   ? 35.038 -40.544 -11.877 1.00   22.98 ? 2137 HOH A O    1 
HETATM 4302 O O    . HOH G 3 .   ? 31.700 -35.764 -11.113 1.00   18.88 ? 2138 HOH A O    1 
HETATM 4303 O O    . HOH G 3 .   ? 33.525 -37.579 -12.132 1.00   24.78 ? 2139 HOH A O    1 
HETATM 4304 O O    . HOH G 3 .   ? 33.948 -34.806 -11.867 1.00   18.94 ? 2140 HOH A O    1 
HETATM 4305 O O    . HOH G 3 .   ? 51.824 -14.997 4.123   1.00   28.33 ? 2141 HOH A O    1 
HETATM 4306 O O    . HOH G 3 .   ? 48.407 -9.834  7.008   1.00   30.67 ? 2142 HOH A O    1 
HETATM 4307 O O    . HOH G 3 .   ? 50.521 -19.338 -3.005  1.00   21.61 ? 2143 HOH A O    1 
HETATM 4308 O O    . HOH G 3 .   ? 39.049 -42.526 -9.629  1.00   20.51 ? 2144 HOH A O    1 
HETATM 4309 O O    . HOH G 3 .   ? 41.164 -41.759 -11.235 1.00   28.13 ? 2145 HOH A O    1 
HETATM 4310 O O    . HOH G 3 .   ? 42.499 -39.306 -11.566 1.00   20.62 ? 2146 HOH A O    1 
HETATM 4311 O O    . HOH G 3 .   ? 52.436 -12.752 1.917   1.00   29.30 ? 2147 HOH A O    1 
HETATM 4312 O O    . HOH G 3 .   ? 50.655 -11.018 -1.281  1.00   31.62 ? 2148 HOH A O    1 
HETATM 4313 O O    . HOH G 3 .   ? 38.462 -39.261 -3.259  1.00   8.89  ? 2149 HOH A O    1 
HETATM 4314 O O    . HOH G 3 .   ? 43.040 -42.376 -8.667  1.00   32.98 ? 2150 HOH A O    1 
HETATM 4315 O O    . HOH G 3 .   ? 42.726 -35.718 -8.079  1.00   13.66 ? 2151 HOH A O    1 
HETATM 4316 O O    . HOH G 3 .   ? 45.283 -39.195 -5.151  1.00   18.47 ? 2152 HOH A O    1 
HETATM 4317 O O    . HOH G 3 .   ? 36.354 -43.027 -2.860  1.00   32.53 ? 2153 HOH A O    1 
HETATM 4318 O O    . HOH G 3 .   ? 39.712 -41.290 -1.083  1.00   13.25 ? 2154 HOH A O    1 
HETATM 4319 O O    . HOH G 3 .   ? 40.959 -49.778 -8.345  1.00   46.68 ? 2155 HOH A O    1 
HETATM 4320 O O    . HOH G 3 .   ? 36.640 -3.835  -5.056  1.00   33.47 ? 2156 HOH A O    1 
HETATM 4321 O O    . HOH G 3 .   ? 44.344 -42.333 -0.807  1.00   16.32 ? 2157 HOH A O    1 
HETATM 4322 O O    . HOH G 3 .   ? 45.547 -41.450 -2.168  1.00   24.85 ? 2158 HOH A O    1 
HETATM 4323 O O    . HOH G 3 .   ? 42.337 -48.505 -7.254  1.00   44.73 ? 2159 HOH A O    1 
HETATM 4324 O O    . HOH G 3 .   ? 44.888 -42.331 4.188   1.00   14.77 ? 2160 HOH A O    1 
HETATM 4325 O O    . HOH G 3 .   ? 46.491 -42.834 1.455   1.00   29.04 ? 2161 HOH A O    1 
HETATM 4326 O O    . HOH G 3 .   ? 37.279 -41.236 0.092   1.00   25.76 ? 2162 HOH A O    1 
HETATM 4327 O O    . HOH G 3 .   ? 38.441 -40.124 4.261   1.00   39.74 ? 2163 HOH A O    1 
HETATM 4328 O O    . HOH G 3 .   ? 41.339 -41.518 6.717   1.00   25.73 ? 2164 HOH A O    1 
HETATM 4329 O O    . HOH G 3 .   ? 40.240 -39.253 5.503   1.00   14.34 ? 2165 HOH A O    1 
HETATM 4330 O O    . HOH G 3 .   ? 46.563 -35.865 -6.189  1.00   13.84 ? 2166 HOH A O    1 
HETATM 4331 O O    . HOH G 3 .   ? 50.291 -36.302 -0.646  1.00   21.95 ? 2167 HOH A O    1 
HETATM 4332 O O    . HOH G 3 .   ? 48.739 -40.979 0.000   0.50   2.71  ? 2168 HOH A O    1 
HETATM 4333 O O    . HOH G 3 .   ? 47.352 -44.364 3.984   1.00   26.53 ? 2169 HOH A O    1 
HETATM 4334 O O    . HOH G 3 .   ? 46.872 -39.274 7.043   1.00   15.01 ? 2170 HOH A O    1 
HETATM 4335 O O    . HOH G 3 .   ? 49.950 -42.473 5.261   1.00   19.86 ? 2171 HOH A O    1 
HETATM 4336 O O    . HOH G 3 .   ? 47.064 -42.430 10.598  1.00   45.13 ? 2172 HOH A O    1 
HETATM 4337 O O    . HOH G 3 .   ? 50.627 -41.160 8.506   1.00   21.92 ? 2173 HOH A O    1 
HETATM 4338 O O    . HOH G 3 .   ? 50.463 -43.987 6.548   1.00   21.63 ? 2174 HOH A O    1 
HETATM 4339 O O    . HOH G 3 .   ? 43.825 -41.499 8.264   1.00   27.29 ? 2175 HOH A O    1 
HETATM 4340 O O    . HOH G 3 .   ? 27.911 -25.967 -11.863 1.00   19.78 ? 2176 HOH A O    1 
HETATM 4341 O O    . HOH G 3 .   ? 31.033 -39.583 1.957   1.00   25.89 ? 2177 HOH A O    1 
HETATM 4342 O O    . HOH G 3 .   ? 52.547 -33.747 1.754   1.00   18.42 ? 2178 HOH A O    1 
HETATM 4343 O O    . HOH G 3 .   ? 52.600 -30.816 2.227   1.00   20.77 ? 2179 HOH A O    1 
HETATM 4344 O O    . HOH G 3 .   ? 56.456 -36.711 1.522   1.00   16.94 ? 2180 HOH A O    1 
HETATM 4345 O O    . HOH G 3 .   ? 57.529 -33.744 2.790   1.00   37.40 ? 2181 HOH A O    1 
HETATM 4346 O O    . HOH G 3 .   ? 57.596 -35.199 6.151   1.00   27.12 ? 2182 HOH A O    1 
HETATM 4347 O O    . HOH G 3 .   ? 55.150 -34.336 8.771   1.00   14.47 ? 2183 HOH A O    1 
HETATM 4348 O O    . HOH G 3 .   ? 54.979 -38.042 8.947   1.00   17.21 ? 2184 HOH A O    1 
HETATM 4349 O O    . HOH G 3 .   ? 35.590 -39.680 7.354   1.00   43.79 ? 2185 HOH A O    1 
HETATM 4350 O O    . HOH G 3 .   ? 34.324 -41.458 3.731   1.00   43.53 ? 2186 HOH A O    1 
HETATM 4351 O O    . HOH G 3 .   ? 31.065 -37.834 8.535   1.00   44.39 ? 2187 HOH A O    1 
HETATM 4352 O O    . HOH G 3 .   ? 25.433 -34.233 8.946   1.00   30.76 ? 2188 HOH A O    1 
HETATM 4353 O O    . HOH G 3 .   ? 26.534 -26.322 16.603  1.00   15.89 ? 2189 HOH A O    1 
HETATM 4354 O O    . HOH G 3 .   ? 22.316 -31.518 11.833  1.00   34.66 ? 2190 HOH A O    1 
HETATM 4355 O O    . HOH G 3 .   ? 59.279 -27.705 9.994   1.00   26.52 ? 2191 HOH A O    1 
HETATM 4356 O O    . HOH G 3 .   ? 58.093 -30.139 11.793  1.00   24.68 ? 2192 HOH A O    1 
HETATM 4357 O O    . HOH G 3 .   ? 55.800 -22.391 12.527  1.00   29.18 ? 2193 HOH A O    1 
HETATM 4358 O O    . HOH G 3 .   ? 59.168 -27.857 17.873  1.00   43.02 ? 2194 HOH A O    1 
HETATM 4359 O O    . HOH G 3 .   ? 27.247 -23.691 17.042  1.00   17.46 ? 2195 HOH A O    1 
HETATM 4360 O O    . HOH G 3 .   ? 30.470 -26.886 18.187  1.00   20.29 ? 2196 HOH A O    1 
HETATM 4361 O O    . HOH G 3 .   ? 54.335 -20.800 7.720   1.00   31.16 ? 2197 HOH A O    1 
HETATM 4362 O O    . HOH G 3 .   ? 56.278 -25.197 5.386   1.00   33.52 ? 2198 HOH A O    1 
HETATM 4363 O O    . HOH G 3 .   ? 59.973 -27.578 7.268   1.00   32.71 ? 2199 HOH A O    1 
HETATM 4364 O O    . HOH G 3 .   ? 24.580 -22.864 17.792  1.00   20.69 ? 2200 HOH A O    1 
HETATM 4365 O O    . HOH G 3 .   ? 50.375 -22.920 6.028   1.00   11.51 ? 2201 HOH A O    1 
HETATM 4366 O O    . HOH G 3 .   ? 53.758 -24.315 4.123   1.00   36.26 ? 2202 HOH A O    1 
HETATM 4367 O O    . HOH G 3 .   ? 55.586 -28.295 4.078   1.00   32.09 ? 2203 HOH A O    1 
HETATM 4368 O O    . HOH G 3 .   ? 13.998 -17.022 17.337  1.00   35.95 ? 2204 HOH A O    1 
HETATM 4369 O O    . HOH G 3 .   ? 22.785 -25.377 19.171  1.00   41.36 ? 2205 HOH A O    1 
HETATM 4370 O O    . HOH G 3 .   ? 21.858 -22.446 20.878  1.00   31.12 ? 2206 HOH A O    1 
HETATM 4371 O O    . HOH G 3 .   ? 19.333 -31.127 14.517  1.00   22.41 ? 2207 HOH A O    1 
HETATM 4372 O O    . HOH G 3 .   ? 38.543 -23.102 15.795  1.00   11.57 ? 2208 HOH A O    1 
HETATM 4373 O O    . HOH G 3 .   ? 38.077 -19.651 14.410  1.00   27.02 ? 2209 HOH A O    1 
HETATM 4374 O O    . HOH G 3 .   ? 46.242 -22.110 16.555  1.00   19.03 ? 2210 HOH A O    1 
HETATM 4375 O O    . HOH G 3 .   ? 50.546 -22.614 15.891  1.00   35.46 ? 2211 HOH A O    1 
HETATM 4376 O O    . HOH G 3 .   ? 45.060 -27.447 19.281  1.00   22.42 ? 2212 HOH A O    1 
HETATM 4377 O O    . HOH G 3 .   ? 52.481 -28.525 17.304  1.00   18.96 ? 2213 HOH A O    1 
HETATM 4378 O O    . HOH G 3 .   ? 51.604 -26.601 18.834  1.00   39.14 ? 2214 HOH A O    1 
HETATM 4379 O O    . HOH G 3 .   ? 51.326 -31.772 18.220  1.00   19.18 ? 2215 HOH A O    1 
HETATM 4380 O O    . HOH G 3 .   ? 39.055 -31.432 17.240  1.00   31.01 ? 2216 HOH A O    1 
HETATM 4381 O O    . HOH G 3 .   ? 41.319 -32.957 16.176  1.00   23.38 ? 2217 HOH A O    1 
HETATM 4382 O O    . HOH G 3 .   ? 39.942 -29.320 19.194  1.00   27.39 ? 2218 HOH A O    1 
HETATM 4383 O O    . HOH G 3 .   ? 44.132 -35.937 11.075  1.00   21.05 ? 2219 HOH A O    1 
HETATM 4384 O O    . HOH G 3 .   ? 45.816 -37.557 10.963  1.00   45.66 ? 2220 HOH A O    1 
HETATM 4385 O O    . HOH G 3 .   ? 48.874 -36.757 12.300  1.00   19.21 ? 2221 HOH A O    1 
HETATM 4386 O O    . HOH G 3 .   ? 42.070 -34.309 11.864  1.00   19.02 ? 2222 HOH A O    1 
HETATM 4387 O O    . HOH G 3 .   ? 42.467 -34.107 14.825  1.00   30.48 ? 2223 HOH A O    1 
HETATM 4388 O O    . HOH G 3 .   ? 15.410 -31.863 11.808  1.00   35.47 ? 2224 HOH A O    1 
HETATM 4389 O O    . HOH G 3 .   ? 8.459  -26.898 15.038  1.00   36.58 ? 2225 HOH A O    1 
HETATM 4390 O O    . HOH G 3 .   ? 3.905  -24.763 11.946  1.00   42.98 ? 2226 HOH A O    1 
HETATM 4391 O O    . HOH G 3 .   ? 59.138 -32.166 16.415  1.00   29.44 ? 2227 HOH A O    1 
HETATM 4392 O O    . HOH G 3 .   ? 58.437 -36.356 16.875  1.00   22.19 ? 2228 HOH A O    1 
HETATM 4393 O O    . HOH G 3 .   ? 60.333 -35.539 15.005  1.00   20.96 ? 2229 HOH A O    1 
HETATM 4394 O O    . HOH G 3 .   ? 50.215 -39.338 10.933  0.84   14.92 ? 2230 HOH A O    1 
HETATM 4395 O O    . HOH G 3 .   ? 47.198 -39.449 10.611  1.00   28.43 ? 2231 HOH A O    1 
HETATM 4396 O O    . HOH G 3 .   ? 37.680 -36.018 7.851   1.00   21.80 ? 2232 HOH A O    1 
HETATM 4397 O O    . HOH G 3 .   ? 22.402 -7.669  19.296  1.00   26.68 ? 2233 HOH A O    1 
HETATM 4398 O O    . HOH G 3 .   ? 40.169 -32.983 10.555  1.00   9.41  ? 2234 HOH A O    1 
HETATM 4399 O O    . HOH G 3 .   ? 45.055 -39.231 8.895   1.00   11.79 ? 2235 HOH A O    1 
HETATM 4400 O O    . HOH G 3 .   ? 40.034 -39.744 7.599   1.00   47.36 ? 2236 HOH A O    1 
HETATM 4401 O O    . HOH G 3 .   ? 39.713 -37.579 11.317  1.00   39.83 ? 2237 HOH A O    1 
HETATM 4402 O O    . HOH G 3 .   ? 42.687 -39.912 11.402  1.00   27.24 ? 2238 HOH A O    1 
HETATM 4403 O O    . HOH G 3 .   ? 18.113 -5.622  15.496  1.00   23.54 ? 2239 HOH A O    1 
HETATM 4404 O O    . HOH G 3 .   ? 18.253 -9.053  17.165  1.00   20.70 ? 2240 HOH A O    1 
HETATM 4405 O O    . HOH G 3 .   ? 10.462 -17.906 14.289  1.00   48.37 ? 2241 HOH A O    1 
HETATM 4406 O O    . HOH G 3 .   ? 10.660 -22.700 15.466  1.00   40.81 ? 2242 HOH A O    1 
HETATM 4407 O O    . HOH G 3 .   ? 34.616 -22.331 10.661  1.00   10.23 ? 2243 HOH A O    1 
HETATM 4408 O O    . HOH G 3 .   ? 32.029 -24.746 7.758   1.00   8.91  ? 2244 HOH A O    1 
HETATM 4409 O O    . HOH G 3 .   ? 36.360 -31.920 12.162  1.00   14.08 ? 2245 HOH A O    1 
HETATM 4410 O O    . HOH G 3 .   ? 33.023 -33.069 13.162  1.00   39.29 ? 2246 HOH A O    1 
HETATM 4411 O O    . HOH G 3 .   ? 30.386 -33.339 11.443  1.00   37.40 ? 2247 HOH A O    1 
HETATM 4412 O O    . HOH G 3 .   ? 32.002 -33.835 9.944   1.00   27.65 ? 2248 HOH A O    1 
HETATM 4413 O O    . HOH G 3 .   ? 32.826 -30.776 17.066  1.00   40.52 ? 2249 HOH A O    1 
HETATM 4414 O O    . HOH G 3 .   ? 34.403 -31.759 15.100  1.00   32.11 ? 2250 HOH A O    1 
HETATM 4415 O O    . HOH G 3 .   ? 35.677 -29.720 19.053  1.00   20.07 ? 2251 HOH A O    1 
HETATM 4416 O O    . HOH G 3 .   ? 49.792 -25.436 5.120   1.00   21.55 ? 2252 HOH A O    1 
HETATM 4417 O O    . HOH G 3 .   ? 48.940 -22.463 0.069   1.00   12.25 ? 2253 HOH A O    1 
HETATM 4418 O O    . HOH G 3 .   ? 50.585 -25.111 2.473   1.00   21.52 ? 2254 HOH A O    1 
HETATM 4419 O O    . HOH G 3 .   ? 48.645 -29.912 0.203   1.00   14.33 ? 2255 HOH A O    1 
HETATM 4420 O O    . HOH G 3 .   ? 52.278 -27.134 1.788   1.00   25.59 ? 2256 HOH A O    1 
HETATM 4421 O O    . HOH G 3 .   ? 51.121 -25.649 -5.102  1.00   22.40 ? 2257 HOH A O    1 
HETATM 4422 O O    . HOH G 3 .   ? 44.500 -34.034 -7.216  1.00   17.24 ? 2258 HOH A O    1 
HETATM 4423 O O    . HOH G 3 .   ? 51.315 -21.629 -6.996  1.00   37.70 ? 2259 HOH A O    1 
HETATM 4424 O O    . HOH G 3 .   ? 49.309 -20.337 -8.896  1.00   33.47 ? 2260 HOH A O    1 
HETATM 4425 O O    . HOH G 3 .   ? 44.936 -15.583 -7.689  1.00   14.49 ? 2261 HOH A O    1 
HETATM 4426 O O    . HOH G 3 .   ? 47.343 -17.241 -7.365  1.00   22.58 ? 2262 HOH A O    1 
HETATM 4427 O O    . HOH G 3 .   ? 42.379 -18.676 -12.456 1.00   12.71 ? 2263 HOH A O    1 
HETATM 4428 O O    . HOH G 3 .   ? 44.707 -20.223 -13.138 1.00   30.09 ? 2264 HOH A O    1 
HETATM 4429 O O    . HOH G 3 .   ? 40.811 -24.892 -10.774 1.00   11.11 ? 2265 HOH A O    1 
HETATM 4430 O O    . HOH G 3 .   ? 49.635 -22.542 -12.787 1.00   34.31 ? 2266 HOH A O    1 
HETATM 4431 O O    . HOH G 3 .   ? 42.496 -15.436 -9.067  1.00   10.88 ? 2267 HOH A O    1 
HETATM 4432 O O    . HOH G 3 .   ? 39.852 -18.009 -13.272 1.00   10.21 ? 2268 HOH A O    1 
HETATM 4433 O O    . HOH G 3 .   ? 37.117 -21.774 -14.791 1.00   6.56  ? 2269 HOH A O    1 
HETATM 4434 O O    . HOH G 3 .   ? 38.382 -25.401 -11.793 1.00   7.14  ? 2270 HOH A O    1 
HETATM 4435 O O    . HOH G 3 .   ? 34.767 -21.668 -16.167 1.00   12.93 ? 2271 HOH A O    1 
HETATM 4436 O O    . HOH G 3 .   ? 30.888 -21.156 -15.875 1.00   32.40 ? 2272 HOH A O    1 
HETATM 4437 O O    . HOH G 3 .   ? 38.360 -10.757 -10.761 1.00   23.30 ? 2273 HOH A O    1 
HETATM 4438 O O    . HOH G 3 .   ? 33.675 -13.855 -14.797 1.00   38.84 ? 2274 HOH A O    1 
HETATM 4439 O O    . HOH G 3 .   ? 31.233 -26.522 -14.601 1.00   30.19 ? 2275 HOH A O    1 
HETATM 4440 O O    . HOH G 3 .   ? 34.040 -27.585 -11.381 1.00   13.21 ? 2276 HOH A O    1 
HETATM 4441 O O    . HOH G 3 .   ? 28.513 -23.993 -13.935 1.00   21.57 ? 2277 HOH A O    1 
HETATM 4442 O O    . HOH G 3 .   ? 32.177 -25.340 -15.919 1.00   16.40 ? 2278 HOH A O    1 
HETATM 4443 O O    . HOH G 3 .   ? 27.582 -20.374 -8.658  1.00   12.44 ? 2279 HOH A O    1 
HETATM 4444 O O    . HOH G 3 .   ? 25.741 -20.830 -12.146 1.00   32.35 ? 2280 HOH A O    1 
HETATM 4445 O O    . HOH G 3 .   ? 25.911 -17.691 -13.093 1.00   45.32 ? 2281 HOH A O    1 
HETATM 4446 O O    . HOH G 3 .   ? 26.142 -18.209 -9.944  1.00   24.57 ? 2282 HOH A O    1 
HETATM 4447 O O    . HOH G 3 .   ? 28.601 -14.142 -9.825  1.00   14.76 ? 2283 HOH A O    1 
HETATM 4448 O O    . HOH G 3 .   ? 27.684 -16.338 -8.204  1.00   11.79 ? 2284 HOH A O    1 
HETATM 4449 O O    . HOH G 3 .   ? 31.380 -15.831 -4.354  1.00   6.52  ? 2285 HOH A O    1 
HETATM 4450 O O    . HOH G 3 .   ? 30.364 -9.555  -10.635 1.00   31.77 ? 2286 HOH A O    1 
HETATM 4451 O O    . HOH G 3 .   ? 27.622 -12.014 -9.957  1.00   36.78 ? 2287 HOH A O    1 
HETATM 4452 O O    . HOH G 3 .   ? 40.932 -11.433 -10.528 1.00   15.87 ? 2288 HOH A O    1 
HETATM 4453 O O    . HOH G 3 .   ? 42.433 -12.741 -8.774  1.00   13.67 ? 2289 HOH A O    1 
HETATM 4454 O O    . HOH G 3 .   ? 47.374 -14.503 -6.587  1.00   40.10 ? 2290 HOH A O    1 
HETATM 4455 O O    . HOH G 3 .   ? 49.253 -14.729 -3.296  1.00   21.94 ? 2291 HOH A O    1 
HETATM 4456 O O    . HOH G 3 .   ? 46.268 -11.215 -7.213  1.00   27.74 ? 2292 HOH A O    1 
HETATM 4457 O O    . HOH G 3 .   ? 49.075 -9.155  1.830   1.00   12.53 ? 2293 HOH A O    1 
HETATM 4458 O O    . HOH G 3 .   ? 41.539 -9.414  2.649   1.00   6.35  ? 2294 HOH A O    1 
HETATM 4459 O O    . HOH G 3 .   ? 42.814 -6.485  1.895   1.00   5.53  ? 2295 HOH A O    1 
HETATM 4460 O O    . HOH G 3 .   ? 49.533 -15.357 -0.593  1.00   11.14 ? 2296 HOH A O    1 
HETATM 4461 O O    . HOH G 3 .   ? 49.117 -15.427 3.680   1.00   10.25 ? 2297 HOH A O    1 
HETATM 4462 O O    . HOH G 3 .   ? 51.385 -18.814 2.190   1.00   24.40 ? 2298 HOH A O    1 
HETATM 4463 O O    . HOH G 3 .   ? 51.664 -17.094 -0.323  1.00   27.32 ? 2299 HOH A O    1 
HETATM 4464 O O    . HOH G 3 .   ? 51.032 -18.167 5.127   1.00   16.90 ? 2300 HOH A O    1 
HETATM 4465 O O    . HOH G 3 .   ? 45.315 -10.439 8.123   1.00   30.66 ? 2301 HOH A O    1 
HETATM 4466 O O    . HOH G 3 .   ? 47.240 -11.265 8.067   1.00   41.74 ? 2302 HOH A O    1 
HETATM 4467 O O    . HOH G 3 .   ? 50.201 -12.927 0.734   1.00   20.48 ? 2303 HOH A O    1 
HETATM 4468 O O    . HOH G 3 .   ? 44.250 -12.619 10.491  1.00   34.90 ? 2304 HOH A O    1 
HETATM 4469 O O    . HOH G 3 .   ? 44.537 -5.074  7.525   1.00   8.16  ? 2305 HOH A O    1 
HETATM 4470 O O    . HOH G 3 .   ? 36.785 -3.866  4.297   1.00   6.11  ? 2306 HOH A O    1 
HETATM 4471 O O    . HOH G 3 .   ? 38.745 -5.658  0.833   1.00   5.83  ? 2307 HOH A O    1 
HETATM 4472 O O    . HOH G 3 .   ? 41.682 1.496   1.967   1.00   5.88  ? 2308 HOH A O    1 
HETATM 4473 O O    . HOH G 3 .   ? 38.160 -2.339  -5.557  1.00   19.43 ? 2309 HOH A O    1 
HETATM 4474 O O    . HOH G 3 .   ? 36.714 -4.421  -2.370  1.00   11.70 ? 2310 HOH A O    1 
HETATM 4475 O O    . HOH G 3 .   ? 40.625 -7.707  0.738   1.00   6.22  ? 2311 HOH A O    1 
HETATM 4476 O O    . HOH G 3 .   ? 48.686 -9.802  -3.403  1.00   14.92 ? 2312 HOH A O    1 
HETATM 4477 O O    . HOH G 3 .   ? 48.457 -5.975  1.823   1.00   19.36 ? 2313 HOH A O    1 
HETATM 4478 O O    . HOH G 3 .   ? 25.905 -12.083 -8.499  1.00   18.92 ? 2314 HOH A O    1 
HETATM 4479 O O    . HOH G 3 .   ? 20.759 -12.675 -9.768  1.00   41.31 ? 2315 HOH A O    1 
HETATM 4480 O O    . HOH G 3 .   ? 26.326 -29.448 -5.322  1.00   6.19  ? 2316 HOH A O    1 
HETATM 4481 O O    . HOH G 3 .   ? 22.199 -25.052 -8.620  1.00   19.17 ? 2317 HOH A O    1 
HETATM 4482 O O    . HOH G 3 .   ? 23.470 -20.784 -11.247 1.00   40.38 ? 2318 HOH A O    1 
HETATM 4483 O O    . HOH G 3 .   ? 23.006 -19.086 -9.866  1.00   41.23 ? 2319 HOH A O    1 
HETATM 4484 O O    . HOH G 3 .   ? 20.219 -30.916 -4.557  1.00   16.37 ? 2320 HOH A O    1 
HETATM 4485 O O    . HOH G 3 .   ? 18.851 -26.992 -6.008  1.00   13.31 ? 2321 HOH A O    1 
HETATM 4486 O O    . HOH G 3 .   ? 24.706 -31.388 -8.448  1.00   53.85 ? 2322 HOH A O    1 
HETATM 4487 O O    . HOH G 3 .   ? 26.683 -29.142 -12.929 1.00   19.97 ? 2323 HOH A O    1 
HETATM 4488 O O    . HOH G 3 .   ? 26.232 -31.857 -9.764  1.00   15.62 ? 2324 HOH A O    1 
HETATM 4489 O O    . HOH G 3 .   ? 30.018 -27.962 -11.480 1.00   14.81 ? 2325 HOH A O    1 
HETATM 4490 O O    . HOH G 3 .   ? 25.420 -37.750 -8.227  1.00   20.96 ? 2326 HOH A O    1 
HETATM 4491 O O    . HOH G 3 .   ? 24.887 -34.450 -1.289  0.0000 30.54 ? 2327 HOH A O    1 
HETATM 4492 O O    . HOH G 3 .   ? 20.320 -34.225 -3.550  1.00   13.34 ? 2328 HOH A O    1 
HETATM 4493 O O    . HOH G 3 .   ? 22.618 -33.602 -7.781  0.08   33.09 ? 2329 HOH A O    1 
HETATM 4494 O O    . HOH G 3 .   ? 27.439 -38.904 -6.698  1.00   17.73 ? 2330 HOH A O    1 
HETATM 4495 O O    . HOH G 3 .   ? 28.547 -39.324 -5.400  1.00   18.03 ? 2331 HOH A O    1 
HETATM 4496 O O    . HOH G 3 .   ? 28.966 -37.811 1.566   1.00   11.28 ? 2332 HOH A O    1 
HETATM 4497 O O    . HOH G 3 .   ? 32.841 -36.833 -0.894  1.00   11.20 ? 2333 HOH A O    1 
HETATM 4498 O O    . HOH G 3 .   ? 29.462 -41.762 -4.880  1.00   23.72 ? 2334 HOH A O    1 
HETATM 4499 O O    . HOH G 3 .   ? 31.190 -39.087 -5.957  1.00   18.22 ? 2335 HOH A O    1 
HETATM 4500 O O    . HOH G 3 .   ? 33.624 -39.473 -1.958  1.00   17.03 ? 2336 HOH A O    1 
HETATM 4501 O O    . HOH G 3 .   ? 20.241 -31.970 -2.167  1.00   23.03 ? 2337 HOH A O    1 
HETATM 4502 O O    . HOH G 3 .   ? 23.043 -33.556 2.456   1.00   25.05 ? 2338 HOH A O    1 
HETATM 4503 O O    . HOH G 3 .   ? 21.722 -31.691 2.364   1.00   39.97 ? 2339 HOH A O    1 
HETATM 4504 O O    . HOH G 3 .   ? 19.960 -34.860 1.014   1.00   22.18 ? 2340 HOH A O    1 
HETATM 4505 O O    . HOH G 3 .   ? 24.872 -34.357 4.126   1.00   12.82 ? 2341 HOH A O    1 
HETATM 4506 O O    . HOH G 3 .   ? 28.336 -36.774 4.060   1.00   14.84 ? 2342 HOH A O    1 
HETATM 4507 O O    . HOH G 3 .   ? 33.293 -37.963 1.534   1.00   20.76 ? 2343 HOH A O    1 
HETATM 4508 O O    . HOH G 3 .   ? 35.427 -37.232 5.158   1.00   24.87 ? 2344 HOH A O    1 
HETATM 4509 O O    . HOH G 3 .   ? 34.051 -38.922 5.870   1.00   46.50 ? 2345 HOH A O    1 
HETATM 4510 O O    . HOH G 3 .   ? 32.391 -35.969 7.498   1.00   20.89 ? 2346 HOH A O    1 
HETATM 4511 O O    . HOH G 3 .   ? 27.649 -32.626 10.491  1.00   14.28 ? 2347 HOH A O    1 
HETATM 4512 O O    . HOH G 3 .   ? 26.183 -36.078 7.939   1.00   33.77 ? 2348 HOH A O    1 
HETATM 4513 O O    . HOH G 3 .   ? 35.261 -35.342 7.607   1.00   18.47 ? 2349 HOH A O    1 
HETATM 4514 O O    . HOH G 3 .   ? 24.820 -27.748 13.408  1.00   13.59 ? 2350 HOH A O    1 
HETATM 4515 O O    . HOH G 3 .   ? 27.761 -27.519 14.443  1.00   15.00 ? 2351 HOH A O    1 
HETATM 4516 O O    . HOH G 3 .   ? 26.062 -31.642 12.576  1.00   29.02 ? 2352 HOH A O    1 
HETATM 4517 O O    . HOH G 3 .   ? 23.797 -33.863 6.555   1.00   19.29 ? 2353 HOH A O    1 
HETATM 4518 O O    . HOH G 3 .   ? 20.535 -32.214 4.171   1.00   32.77 ? 2354 HOH A O    1 
HETATM 4519 O O    . HOH G 3 .   ? 19.167 -30.802 6.512   1.00   23.36 ? 2355 HOH A O    1 
HETATM 4520 O O    . HOH G 3 .   ? 20.996 -32.654 9.923   1.00   24.73 ? 2356 HOH A O    1 
HETATM 4521 O O    . HOH G 3 .   ? 31.618 -30.711 14.649  1.00   19.83 ? 2357 HOH A O    1 
HETATM 4522 O O    . HOH G 3 .   ? 28.936 -23.241 14.871  1.00   8.70  ? 2358 HOH A O    1 
HETATM 4523 O O    . HOH G 3 .   ? 30.360 -24.319 18.950  1.00   17.93 ? 2359 HOH A O    1 
HETATM 4524 O O    . HOH G 3 .   ? 31.068 -20.842 17.895  1.00   8.48  ? 2360 HOH A O    1 
HETATM 4525 O O    . HOH G 3 .   ? 36.181 -23.666 17.144  1.00   7.52  ? 2361 HOH A O    1 
HETATM 4526 O O    . HOH G 3 .   ? 30.403 -16.856 15.207  1.00   17.47 ? 2362 HOH A O    1 
HETATM 4527 O O    . HOH G 3 .   ? 30.599 -18.039 17.792  1.00   7.54  ? 2363 HOH A O    1 
HETATM 4528 O O    . HOH G 3 .   ? 34.095 -17.437 15.171  1.00   23.13 ? 2364 HOH A O    1 
HETATM 4529 O O    . HOH G 3 .   ? 26.208 -19.249 12.351  1.00   5.31  ? 2365 HOH A O    1 
HETATM 4530 O O    . HOH G 3 .   ? 23.488 -20.100 18.342  1.00   13.93 ? 2366 HOH A O    1 
HETATM 4531 O O    . HOH G 3 .   ? 25.615 -17.213 20.883  1.00   16.27 ? 2367 HOH A O    1 
HETATM 4532 O O    . HOH G 3 .   ? 27.727 -18.549 21.451  1.00   12.72 ? 2368 HOH A O    1 
HETATM 4533 O O    . HOH G 3 .   ? 28.072 -21.984 22.815  1.00   26.89 ? 2369 HOH A O    1 
HETATM 4534 O O    . HOH G 3 .   ? 27.034 -12.349 18.513  1.00   13.10 ? 2370 HOH A O    1 
HETATM 4535 O O    . HOH G 3 .   ? 25.375 -13.313 19.023  1.00   20.30 ? 2371 HOH A O    1 
HETATM 4536 O O    . HOH G 3 .   ? 21.181 -22.168 15.840  1.00   23.19 ? 2372 HOH A O    1 
HETATM 4537 O O    . HOH G 3 .   ? 19.713 -19.479 18.228  1.00   19.71 ? 2373 HOH A O    1 
HETATM 4538 O O    . HOH G 3 .   ? 23.196 -23.863 15.698  1.00   14.86 ? 2374 HOH A O    1 
HETATM 4539 O O    . HOH G 3 .   ? 18.658 -13.374 18.169  1.00   22.78 ? 2375 HOH A O    1 
HETATM 4540 O O    . HOH G 3 .   ? 19.852 -17.211 20.075  1.00   14.59 ? 2376 HOH A O    1 
HETATM 4541 O O    . HOH G 3 .   ? 14.747 -15.816 14.745  1.00   21.39 ? 2377 HOH A O    1 
HETATM 4542 O O    . HOH G 3 .   ? 16.092 -18.047 18.505  1.00   25.96 ? 2378 HOH A O    1 
HETATM 4543 O O    . HOH G 3 .   ? 19.261 -22.794 14.324  1.00   17.25 ? 2379 HOH A O    1 
HETATM 4544 O O    . HOH G 3 .   ? 14.262 -21.072 19.341  1.00   25.18 ? 2380 HOH A O    1 
HETATM 4545 O O    . HOH G 3 .   ? 19.652 -26.585 15.568  1.00   17.89 ? 2381 HOH A O    1 
HETATM 4546 O O    . HOH G 3 .   ? 20.803 -23.911 18.312  1.00   24.82 ? 2382 HOH A O    1 
HETATM 4547 O O    . HOH G 3 .   ? 15.397 -27.956 11.014  1.00   16.33 ? 2383 HOH A O    1 
HETATM 4548 O O    . HOH G 3 .   ? 17.114 -29.570 15.411  1.00   15.56 ? 2384 HOH A O    1 
HETATM 4549 O O    . HOH G 3 .   ? 13.709 -28.611 13.194  1.00   20.03 ? 2385 HOH A O    1 
HETATM 4550 O O    . HOH G 3 .   ? 22.273 -27.449 12.968  1.00   17.47 ? 2386 HOH A O    1 
HETATM 4551 O O    . HOH G 3 .   ? 32.300 -14.201 11.764  1.00   14.54 ? 2387 HOH A O    1 
HETATM 4552 O O    . HOH G 3 .   ? 36.935 -12.244 15.787  1.00   25.45 ? 2388 HOH A O    1 
HETATM 4553 O O    . HOH G 3 .   ? 37.489 -15.113 14.824  1.00   37.92 ? 2389 HOH A O    1 
HETATM 4554 O O    . HOH G 3 .   ? 41.795 -9.732  12.442  1.00   30.97 ? 2390 HOH A O    1 
HETATM 4555 O O    . HOH G 3 .   ? 40.002 -8.273  14.019  1.00   23.73 ? 2391 HOH A O    1 
HETATM 4556 O O    . HOH G 3 .   ? 42.777 -10.667 10.829  1.00   32.05 ? 2392 HOH A O    1 
HETATM 4557 O O    . HOH G 3 .   ? 45.299 -8.821  12.527  1.00   32.12 ? 2393 HOH A O    1 
HETATM 4558 O O    . HOH G 3 .   ? 47.062 -6.548  10.703  1.00   45.74 ? 2394 HOH A O    1 
HETATM 4559 O O    . HOH G 3 .   ? 45.883 -5.012  11.710  1.00   31.91 ? 2395 HOH A O    1 
HETATM 4560 O O    . HOH G 3 .   ? 39.882 -5.478  13.083  1.00   7.88  ? 2396 HOH A O    1 
HETATM 4561 O O    . HOH G 3 .   ? 42.040 1.988   4.654   1.00   14.01 ? 2397 HOH A O    1 
HETATM 4562 O O    . HOH G 3 .   ? 43.429 2.348   7.963   1.00   23.14 ? 2398 HOH A O    1 
HETATM 4563 O O    . HOH G 3 .   ? 19.384 -30.799 1.757   1.00   13.59 ? 2399 HOH A O    1 
HETATM 4564 O O    . HOH G 3 .   ? 14.503 -26.956 4.797   1.00   13.07 ? 2400 HOH A O    1 
HETATM 4565 O O    . HOH G 3 .   ? 14.084 -29.590 7.665   1.00   14.16 ? 2401 HOH A O    1 
HETATM 4566 O O    . HOH G 3 .   ? 12.512 -30.881 9.086   1.00   19.57 ? 2402 HOH A O    1 
HETATM 4567 O O    . HOH G 3 .   ? 10.353 -33.464 11.623  1.00   19.72 ? 2403 HOH A O    1 
HETATM 4568 O O    . HOH G 3 .   ? 12.917 -32.528 12.480  1.00   36.21 ? 2404 HOH A O    1 
HETATM 4569 O O    . HOH G 3 .   ? 6.950  -30.569 11.384  1.00   14.49 ? 2405 HOH A O    1 
HETATM 4570 O O    . HOH G 3 .   ? 4.714  -25.656 6.229   1.00   35.75 ? 2406 HOH A O    1 
HETATM 4571 O O    . HOH G 3 .   ? 6.498  -27.989 13.386  1.00   24.35 ? 2407 HOH A O    1 
HETATM 4572 O O    . HOH G 3 .   ? 5.610  -21.608 2.935   1.00   36.77 ? 2408 HOH A O    1 
HETATM 4573 O O    . HOH G 3 .   ? 8.880  -23.203 2.113   1.00   12.88 ? 2409 HOH A O    1 
HETATM 4574 O O    . HOH G 3 .   ? 5.603  -23.123 10.129  1.00   33.48 ? 2410 HOH A O    1 
HETATM 4575 O O    . HOH G 3 .   ? 35.094 -0.409  5.474   1.00   10.54 ? 2411 HOH A O    1 
HETATM 4576 O O    . HOH G 3 .   ? 32.293 -2.006  16.338  1.00   11.53 ? 2412 HOH A O    1 
HETATM 4577 O O    . HOH G 3 .   ? 34.648 0.000   16.200  0.50   15.04 ? 2413 HOH A O    1 
HETATM 4578 O O    . HOH G 3 .   ? 40.539 4.069   8.703   1.00   23.62 ? 2414 HOH A O    1 
HETATM 4579 O O    . HOH G 3 .   ? 42.236 2.467   10.392  1.00   13.80 ? 2415 HOH A O    1 
HETATM 4580 O O    . HOH G 3 .   ? 46.877 -4.487  6.157   1.00   17.62 ? 2416 HOH A O    1 
HETATM 4581 O O    . HOH G 3 .   ? 40.907 -4.677  17.720  1.00   27.17 ? 2417 HOH A O    1 
HETATM 4582 O O    . HOH G 3 .   ? 41.488 -1.332  18.446  1.00   12.48 ? 2418 HOH A O    1 
HETATM 4583 O O    . HOH G 3 .   ? 39.384 -7.158  16.278  1.00   43.24 ? 2419 HOH A O    1 
HETATM 4584 O O    . HOH G 3 .   ? 31.017 -4.506  21.500  1.00   9.66  ? 2420 HOH A O    1 
HETATM 4585 O O    . HOH G 3 .   ? 36.191 -8.927  18.267  1.00   17.62 ? 2421 HOH A O    1 
HETATM 4586 O O    . HOH G 3 .   ? 30.486 -7.079  19.130  1.00   21.96 ? 2422 HOH A O    1 
HETATM 4587 O O    . HOH G 3 .   ? 40.399 -10.643 15.140  1.00   45.46 ? 2423 HOH A O    1 
HETATM 4588 O O    . HOH G 3 .   ? 28.672 -5.434  20.274  1.00   13.78 ? 2424 HOH A O    1 
HETATM 4589 O O    . HOH G 3 .   ? 31.061 -0.243  17.306  1.00   20.00 ? 2425 HOH A O    1 
HETATM 4590 O O    . HOH G 3 .   ? 34.588 -13.085 14.886  1.00   15.27 ? 2426 HOH A O    1 
HETATM 4591 O O    . HOH G 3 .   ? 34.132 -11.094 17.660  1.00   18.46 ? 2427 HOH A O    1 
HETATM 4592 O O    . HOH G 3 .   ? 22.433 -9.657  17.806  1.00   20.70 ? 2428 HOH A O    1 
HETATM 4593 O O    . HOH G 3 .   ? 23.657 -6.300  17.460  1.00   18.62 ? 2429 HOH A O    1 
HETATM 4594 O O    . HOH G 3 .   ? 27.279 -7.377  21.464  1.00   16.63 ? 2430 HOH A O    1 
HETATM 4595 O O    . HOH G 3 .   ? 17.481 -8.216  14.687  1.00   15.26 ? 2431 HOH A O    1 
HETATM 4596 O O    . HOH G 3 .   ? 12.970 -13.658 13.148  1.00   29.98 ? 2432 HOH A O    1 
HETATM 4597 O O    . HOH G 3 .   ? 17.528 -12.108 19.930  1.00   50.73 ? 2433 HOH A O    1 
HETATM 4598 O O    . HOH G 3 .   ? 11.398 -11.441 7.829   1.00   34.72 ? 2434 HOH A O    1 
HETATM 4599 O O    . HOH G 3 .   ? 11.677 -12.699 5.829   1.00   31.16 ? 2435 HOH A O    1 
HETATM 4600 O O    . HOH G 3 .   ? 11.212 -17.545 12.265  1.00   25.57 ? 2436 HOH A O    1 
HETATM 4601 O O    . HOH G 3 .   ? 13.679 -16.259 12.472  1.00   26.21 ? 2437 HOH A O    1 
HETATM 4602 O O    . HOH G 3 .   ? 10.179 -20.552 12.869  1.00   26.03 ? 2438 HOH A O    1 
HETATM 4603 O O    . HOH G 3 .   ? 34.304 -15.347 12.907  1.00   16.13 ? 2439 HOH A O    1 
HETATM 4604 O O    . HOH G 3 .   ? 10.239 -24.895 13.914  1.00   24.50 ? 2440 HOH A O    1 
HETATM 4605 O O    . HOH G 3 .   ? 31.271 -13.768 19.428  1.00   16.79 ? 2441 HOH A O    1 
HETATM 4606 O O    . HOH G 3 .   ? 44.919 -45.824 -2.165  1.00   41.15 ? 2442 HOH A O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 3   ? 0.2198 0.3557 0.4539 0.1182  -0.0437 -0.1145 28  SER A N   
2    C CA  . SER A 3   ? 0.1850 0.3431 0.4489 0.0787  -0.0267 -0.0933 28  SER A CA  
3    C C   . SER A 3   ? 0.1489 0.2658 0.4347 0.0711  -0.0157 -0.0608 28  SER A C   
4    O O   . SER A 3   ? 0.1566 0.2321 0.4131 0.0751  -0.0264 -0.0604 28  SER A O   
5    C CB  . SER A 3   ? 0.2080 0.4143 0.4574 0.1063  -0.0082 -0.1028 28  SER A CB  
6    O OG  . SER A 3   ? 0.1890 0.4243 0.4570 0.0899  0.0086  -0.1210 28  SER A OG  
11   N N   . VAL A 4   ? 0.1306 0.2082 0.4371 0.0320  -0.0133 -0.0529 29  VAL A N   
12   C CA  . VAL A 4   ? 0.1315 0.1666 0.4269 0.0261  -0.0143 -0.0517 29  VAL A CA  
13   C C   . VAL A 4   ? 0.1334 0.1497 0.4114 0.0349  -0.0254 -0.0434 29  VAL A C   
14   O O   . VAL A 4   ? 0.1249 0.1531 0.4016 0.0326  -0.0325 -0.0404 29  VAL A O   
15   C CB  . VAL A 4   ? 0.1547 0.1659 0.4294 0.0281  -0.0183 -0.0600 29  VAL A CB  
16   C CG1 . VAL A 4   ? 0.1741 0.1702 0.4239 0.0569  -0.0268 -0.0681 29  VAL A CG1 
17   C CG2 . VAL A 4   ? 0.1632 0.1952 0.4320 0.0293  -0.0190 -0.0619 29  VAL A CG2 
27   N N   . GLN A 5   ? 0.1425 0.1754 0.4226 0.0420  -0.0367 -0.0432 30  GLN A N   
28   C CA  . GLN A 5   ? 0.1532 0.1718 0.4276 0.0508  -0.0439 -0.0224 30  GLN A CA  
29   C C   . GLN A 5   ? 0.1618 0.1501 0.4342 0.0432  -0.0465 -0.0127 30  GLN A C   
30   O O   . GLN A 5   ? 0.1761 0.1342 0.4434 0.0299  -0.0513 -0.0194 30  GLN A O   
31   C CB  . GLN A 5   ? 0.1516 0.2066 0.4396 0.0522  -0.0473 -0.0086 30  GLN A CB  
32   C CG  . GLN A 5   ? 0.1669 0.2120 0.4492 0.0395  -0.0649 -0.0109 30  GLN A CG  
33   C CD  . GLN A 5   ? 0.1806 0.1978 0.4558 0.0296  -0.0740 -0.0105 30  GLN A CD  
34   O OE1 . GLN A 5   ? 0.1809 0.1932 0.4520 0.0075  -0.0824 0.0004  30  GLN A OE1 
35   N NE2 . GLN A 5   ? 0.1900 0.1862 0.4642 0.0440  -0.0714 -0.0237 30  GLN A NE2 
44   N N   . GLN A 6   ? 0.1687 0.1692 0.4327 0.0451  -0.0557 -0.0179 31  GLN A N   
45   C CA  . GLN A 6   ? 0.2045 0.1924 0.4302 0.0835  -0.0511 -0.0222 31  GLN A CA  
46   C C   . GLN A 6   ? 0.1949 0.1708 0.4101 0.0753  -0.0347 -0.0369 31  GLN A C   
47   O O   . GLN A 6   ? 0.1962 0.1501 0.4099 0.0611  -0.0454 -0.0425 31  GLN A O   
48   C CB  . GLN A 6   ? 0.2591 0.2647 0.4474 0.1010  -0.0617 -0.0277 31  GLN A CB  
49   C CG  . GLN A 6   ? 0.3251 0.3450 0.4688 0.1279  -0.0615 -0.0293 31  GLN A CG  
50   C CD  . GLN A 6   ? 0.3824 0.4097 0.4862 0.1543  -0.0591 -0.0358 31  GLN A CD  
51   O OE1 . GLN A 6   ? 0.3969 0.4434 0.4969 0.1635  -0.0544 -0.0265 31  GLN A OE1 
52   N NE2 . GLN A 6   ? 0.4043 0.4465 0.4920 0.1584  -0.0674 -0.0444 31  GLN A NE2 
61   N N   . GLN A 7   ? 0.1693 0.1560 0.3861 0.0587  -0.0107 -0.0425 32  GLN A N   
62   C CA  A GLN A 7   ? 0.1721 0.1589 0.3732 0.0673  -0.0031 -0.0382 32  GLN A CA  
63   C CA  B GLN A 7   ? 0.1641 0.1635 0.3677 0.0663  -0.0012 -0.0419 32  GLN A CA  
64   C C   . GLN A 7   ? 0.1747 0.1511 0.3555 0.0686  -0.0028 -0.0359 32  GLN A C   
65   O O   . GLN A 7   ? 0.1656 0.1490 0.3525 0.0549  -0.0108 -0.0660 32  GLN A O   
66   C CB  A GLN A 7   ? 0.1725 0.1705 0.3759 0.0729  0.0047  -0.0355 32  GLN A CB  
67   C CB  B GLN A 7   ? 0.1514 0.1823 0.3691 0.0643  0.0123  -0.0466 32  GLN A CB  
68   C CG  A GLN A 7   ? 0.1767 0.1847 0.3805 0.0792  0.0114  -0.0313 32  GLN A CG  
69   C CG  B GLN A 7   ? 0.1477 0.2135 0.3884 0.0639  0.0228  -0.0432 32  GLN A CG  
70   C CD  A GLN A 7   ? 0.1836 0.1939 0.3832 0.0824  0.0161  -0.0246 32  GLN A CD  
71   C CD  B GLN A 7   ? 0.1573 0.2374 0.4050 0.0539  0.0277  -0.0198 32  GLN A CD  
72   O OE1 A GLN A 7   ? 0.1889 0.1980 0.3841 0.0844  0.0194  -0.0211 32  GLN A OE1 
73   O OE1 B GLN A 7   ? 0.1580 0.2654 0.4091 0.0621  0.0389  -0.0061 32  GLN A OE1 
74   N NE2 A GLN A 7   ? 0.1863 0.1974 0.3836 0.0853  0.0147  -0.0236 32  GLN A NE2 
75   N NE2 B GLN A 7   ? 0.1737 0.2446 0.4146 0.0561  0.0109  -0.0164 32  GLN A NE2 
92   N N   . LEU A 8   ? 0.1413 0.1122 0.3555 0.0262  -0.0033 -0.0215 33  LEU A N   
93   C CA  . LEU A 8   ? 0.1341 0.0935 0.3482 0.0150  -0.0117 -0.0194 33  LEU A CA  
94   C C   . LEU A 8   ? 0.1710 0.0999 0.3605 0.0252  -0.0273 -0.0175 33  LEU A C   
95   O O   . LEU A 8   ? 0.1489 0.0930 0.3449 0.0171  -0.0309 -0.0170 33  LEU A O   
96   C CB  . LEU A 8   ? 0.1117 0.0859 0.3306 0.0062  -0.0055 -0.0194 33  LEU A CB  
97   C CG  . LEU A 8   ? 0.1015 0.0803 0.3171 0.0002  0.0070  -0.0127 33  LEU A CG  
98   C CD1 . LEU A 8   ? 0.1244 0.0937 0.3210 0.0061  0.0047  -0.0220 33  LEU A CD1 
99   C CD2 . LEU A 8   ? 0.0924 0.0940 0.3116 0.0129  0.0119  -0.0174 33  LEU A CD2 
111  N N   . GLU A 9   ? 0.1865 0.0992 0.3820 0.0098  -0.0403 -0.0132 34  GLU A N   
112  C CA  . GLU A 9   ? 0.2425 0.1169 0.4029 0.0374  -0.0545 -0.0116 34  GLU A CA  
113  C C   . GLU A 9   ? 0.2485 0.1281 0.3950 0.0581  -0.0533 -0.0235 34  GLU A C   
114  O O   . GLU A 9   ? 0.2411 0.1126 0.3957 0.0258  -0.0585 -0.0357 34  GLU A O   
115  C CB  . GLU A 9   ? 0.3083 0.1336 0.4229 0.0560  -0.0646 -0.0117 34  GLU A CB  
116  C CG  . GLU A 9   ? 0.3834 0.2201 0.4404 0.1112  -0.0691 -0.0199 34  GLU A CG  
117  C CD  . GLU A 9   ? 0.4469 0.2882 0.4549 0.1448  -0.0807 -0.0247 34  GLU A CD  
118  O OE1 . GLU A 9   ? 0.4717 0.2794 0.4620 0.1547  -0.0838 -0.0155 34  GLU A OE1 
119  O OE2 . GLU A 9   ? 0.4768 0.3364 0.4600 0.1635  -0.0851 -0.0251 34  GLU A OE2 
126  N N   . ALA A 10  ? 0.2454 0.1248 0.3804 0.0557  -0.0459 -0.0398 35  ALA A N   
127  C CA  . ALA A 10  ? 0.2693 0.1516 0.3825 0.0865  -0.0257 -0.0400 35  ALA A CA  
128  C C   . ALA A 10  ? 0.2623 0.1416 0.3594 0.0855  -0.0093 -0.0403 35  ALA A C   
129  O O   . ALA A 10  ? 0.2742 0.1304 0.3477 0.0753  0.0107  -0.0469 35  ALA A O   
130  C CB  . ALA A 10  ? 0.2879 0.1824 0.3912 0.1054  -0.0226 -0.0444 35  ALA A CB  
136  N N   . LEU A 11  ? 0.2111 0.1185 0.3349 0.0546  -0.0122 -0.0471 36  LEU A N   
137  C CA  . LEU A 11  ? 0.1705 0.0986 0.3170 0.0237  -0.0119 -0.0506 36  LEU A CA  
138  C C   . LEU A 11  ? 0.1915 0.1024 0.3106 0.0298  -0.0186 -0.0565 36  LEU A C   
139  O O   . LEU A 11  ? 0.2028 0.1164 0.3119 0.0227  -0.0192 -0.0793 36  LEU A O   
140  C CB  . LEU A 11  ? 0.1367 0.0902 0.3050 0.0101  0.0004  -0.0467 36  LEU A CB  
141  C CG  . LEU A 11  ? 0.1189 0.0857 0.3080 0.0012  0.0179  -0.0377 36  LEU A CG  
142  C CD1 . LEU A 11  ? 0.1599 0.1090 0.3103 0.0297  -0.0107 -0.0624 36  LEU A CD1 
143  C CD2 . LEU A 11  ? 0.0987 0.0770 0.2917 -0.0051 0.0409  -0.0170 36  LEU A CD2 
155  N N   . GLU A 12  ? 0.1731 0.0773 0.2943 0.0000  -0.0118 -0.0244 37  GLU A N   
156  C CA  . GLU A 12  ? 0.1727 0.0851 0.3033 -0.0166 -0.0241 -0.0274 37  GLU A CA  
157  C C   . GLU A 12  ? 0.1954 0.0897 0.3101 -0.0100 -0.0270 -0.0377 37  GLU A C   
158  O O   . GLU A 12  ? 0.1743 0.1002 0.2894 -0.0226 -0.0334 -0.0520 37  GLU A O   
159  C CB  . GLU A 12  ? 0.1423 0.0852 0.3012 -0.0088 -0.0331 -0.0309 37  GLU A CB  
160  C CG  . GLU A 12  ? 0.1196 0.0899 0.2941 0.0203  -0.0337 -0.0395 37  GLU A CG  
161  C CD  . GLU A 12  ? 0.0966 0.0903 0.3029 0.0118  -0.0529 -0.0427 37  GLU A CD  
162  O OE1 . GLU A 12  ? 0.0950 0.0865 0.3018 0.0093  -0.0505 -0.0373 37  GLU A OE1 
163  O OE2 . GLU A 12  ? 0.0924 0.0919 0.2738 0.0156  -0.0559 -0.0553 37  GLU A OE2 
170  N N   . LYS A 13  ? 0.2149 0.0962 0.2881 -0.0083 -0.0215 -0.0604 38  LYS A N   
171  C CA  . LYS A 13  ? 0.2399 0.0863 0.2938 -0.0075 0.0019  -0.0464 38  LYS A CA  
172  C C   . LYS A 13  ? 0.1881 0.0959 0.2644 -0.0275 0.0660  -0.0098 38  LYS A C   
173  O O   . LYS A 13  ? 0.1826 0.1319 0.2297 -0.0600 0.0924  -0.0502 38  LYS A O   
174  C CB  . LYS A 13  ? 0.3159 0.1223 0.3249 0.0510  -0.0174 -0.0624 38  LYS A CB  
175  C CG  . LYS A 13  ? 0.3610 0.1791 0.3292 0.0532  -0.0174 -0.0498 38  LYS A CG  
176  C CD  . LYS A 13  ? 0.4053 0.2343 0.3260 0.0536  0.0022  -0.0144 38  LYS A CD  
177  C CE  . LYS A 13  ? 0.4135 0.2352 0.3131 0.0440  0.0286  0.0071  38  LYS A CE  
178  N NZ  . LYS A 13  ? 0.3956 0.1739 0.2940 0.0229  0.0568  0.0075  38  LYS A NZ  
192  N N   . SER A 14  ? 0.1615 0.1490 0.2753 0.0103  0.1008  0.0380  39  SER A N   
193  C CA  . SER A 14  ? 0.1861 0.2268 0.2746 0.0492  0.1087  0.0296  39  SER A CA  
194  C C   . SER A 14  ? 0.1442 0.1242 0.2692 0.0086  0.1022  0.0186  39  SER A C   
195  O O   . SER A 14  ? 0.1770 0.0985 0.2368 0.0347  0.1168  0.0448  39  SER A O   
196  C CB  . SER A 14  ? 0.2335 0.2780 0.2656 0.0275  0.0877  0.0389  39  SER A CB  
197  O OG  . SER A 14  ? 0.2348 0.2953 0.2508 -0.0456 0.0738  0.0665  39  SER A OG  
203  N N   . SER A 15  ? 0.1176 0.1335 0.2865 -0.0084 0.0775  -0.0239 40  SER A N   
204  C CA  . SER A 15  ? 0.0965 0.0975 0.2790 -0.0145 0.0484  -0.0394 40  SER A CA  
205  C C   . SER A 15  ? 0.0850 0.0834 0.2373 -0.0146 0.0357  -0.0535 40  SER A C   
206  O O   . SER A 15  ? 0.1004 0.1241 0.2565 0.0179  0.0272  -0.0450 40  SER A O   
207  C CB  . SER A 15  ? 0.1190 0.1146 0.3019 -0.0256 0.0207  -0.0693 40  SER A CB  
208  O OG  . SER A 15  ? 0.1051 0.1248 0.2994 -0.0123 0.0044  -0.0874 40  SER A OG  
214  N N   . GLY A 16  ? 0.0836 0.0842 0.1925 -0.0140 0.0364  -0.0598 41  GLY A N   
215  C CA  . GLY A 16  ? 0.0928 0.1113 0.1826 -0.0262 0.0329  -0.0615 41  GLY A CA  
216  C C   . GLY A 16  ? 0.0807 0.1206 0.1575 -0.0266 0.0163  -0.0747 41  GLY A C   
217  O O   . GLY A 16  ? 0.0790 0.1544 0.1360 -0.0334 0.0089  -0.0678 41  GLY A O   
221  N N   . GLY A 17  ? 0.0804 0.1221 0.1667 0.0050  0.0099  -0.0801 42  GLY A N   
222  C CA  . GLY A 17  ? 0.0728 0.1211 0.1699 0.0115  -0.0117 -0.0831 42  GLY A CA  
223  C C   . GLY A 17  ? 0.0713 0.1178 0.1778 0.0217  -0.0312 -0.0816 42  GLY A C   
224  O O   . GLY A 17  ? 0.0967 0.1421 0.2024 0.0398  -0.0545 -0.0937 42  GLY A O   
228  N N   . ARG A 18  ? 0.0762 0.0627 0.1463 0.0076  -0.0125 -0.0459 43  ARG A N   
229  C CA  . ARG A 18  ? 0.0811 0.0516 0.1327 0.0058  -0.0219 -0.0351 43  ARG A CA  
230  C C   . ARG A 18  ? 0.0822 0.0522 0.1380 0.0186  -0.0236 -0.0298 43  ARG A C   
231  O O   . ARG A 18  ? 0.0716 0.0532 0.1269 0.0102  -0.0210 -0.0375 43  ARG A O   
232  C CB  . ARG A 18  ? 0.0864 0.0546 0.1367 0.0164  -0.0260 -0.0321 43  ARG A CB  
233  C CG  . ARG A 18  ? 0.1036 0.0491 0.1426 0.0104  -0.0358 -0.0057 43  ARG A CG  
234  C CD  . ARG A 18  ? 0.1070 0.0629 0.1507 0.0088  -0.0303 0.0161  43  ARG A CD  
235  N NE  . ARG A 18  ? 0.0933 0.0477 0.1352 -0.0200 -0.0266 0.0082  43  ARG A NE  
236  C CZ  . ARG A 18  ? 0.1106 0.0404 0.1253 -0.0109 -0.0260 0.0153  43  ARG A CZ  
237  N NH1 . ARG A 18  ? 0.1188 0.0535 0.1539 -0.0127 -0.0551 0.0108  43  ARG A NH1 
238  N NH2 . ARG A 18  ? 0.1177 0.0804 0.1055 0.0041  -0.0197 0.0078  43  ARG A NH2 
252  N N   . LEU A 19  ? 0.0778 0.0524 0.1431 0.0072  -0.0293 -0.0335 44  LEU A N   
253  C CA  . LEU A 19  ? 0.0787 0.0548 0.1584 0.0088  -0.0398 -0.0312 44  LEU A CA  
254  C C   . LEU A 19  ? 0.0845 0.0483 0.1490 -0.0014 -0.0434 -0.0161 44  LEU A C   
255  O O   . LEU A 19  ? 0.1136 0.0534 0.1613 0.0063  -0.0564 -0.0177 44  LEU A O   
256  C CB  . LEU A 19  ? 0.0832 0.0634 0.1680 0.0124  -0.0335 -0.0390 44  LEU A CB  
257  C CG  . LEU A 19  ? 0.0824 0.0674 0.1722 0.0023  -0.0337 -0.0407 44  LEU A CG  
258  C CD1 . LEU A 19  ? 0.0900 0.0842 0.1566 0.0139  -0.0373 -0.0495 44  LEU A CD1 
259  C CD2 . LEU A 19  ? 0.0831 0.0846 0.1824 0.0027  -0.0208 -0.0328 44  LEU A CD2 
271  N N   . GLY A 20  ? 0.0771 0.0374 0.1240 -0.0009 -0.0248 -0.0150 45  GLY A N   
272  C CA  . GLY A 20  ? 0.0757 0.0389 0.1247 0.0072  -0.0275 -0.0177 45  GLY A CA  
273  C C   . GLY A 20  ? 0.0667 0.0440 0.1135 0.0037  -0.0337 -0.0241 45  GLY A C   
274  O O   . GLY A 20  ? 0.0691 0.0478 0.1198 0.0132  -0.0387 -0.0150 45  GLY A O   
278  N N   . VAL A 21  ? 0.0727 0.0359 0.1253 0.0020  -0.0339 0.0019  46  VAL A N   
279  C CA  . VAL A 21  ? 0.0671 0.0424 0.1302 -0.0121 -0.0317 0.0023  46  VAL A CA  
280  C C   . VAL A 21  ? 0.0746 0.0408 0.1260 -0.0021 -0.0335 0.0163  46  VAL A C   
281  O O   . VAL A 21  ? 0.0825 0.0414 0.1300 -0.0005 -0.0469 0.0080  46  VAL A O   
282  C CB  . VAL A 21  ? 0.0797 0.0499 0.1264 -0.0030 -0.0254 -0.0007 46  VAL A CB  
283  C CG1 . VAL A 21  ? 0.0738 0.0638 0.1389 -0.0157 -0.0066 -0.0011 46  VAL A CG1 
284  C CG2 . VAL A 21  ? 0.1014 0.0633 0.1113 -0.0075 -0.0277 -0.0018 46  VAL A CG2 
294  N N   . ALA A 22  ? 0.0708 0.0334 0.1066 -0.0088 -0.0298 0.0085  47  ALA A N   
295  C CA  . ALA A 22  ? 0.0623 0.0441 0.1078 -0.0184 -0.0285 0.0063  47  ALA A CA  
296  C C   . ALA A 22  ? 0.0689 0.0404 0.0961 -0.0101 -0.0320 -0.0009 47  ALA A C   
297  O O   . ALA A 22  ? 0.0742 0.0456 0.0866 -0.0024 -0.0226 0.0060  47  ALA A O   
298  C CB  . ALA A 22  ? 0.0769 0.0382 0.1199 -0.0102 -0.0246 0.0115  47  ALA A CB  
304  N N   . LEU A 23  ? 0.0655 0.0449 0.1153 -0.0115 -0.0369 0.0091  48  LEU A N   
305  C CA  A LEU A 23  ? 0.0663 0.0606 0.1229 -0.0184 -0.0402 0.0049  48  LEU A CA  
306  C CA  B LEU A 23  ? 0.0652 0.0563 0.1174 -0.0131 -0.0335 0.0124  48  LEU A CA  
307  C C   . LEU A 23  ? 0.0726 0.0519 0.1149 -0.0240 -0.0320 0.0079  48  LEU A C   
308  O O   . LEU A 23  ? 0.1018 0.0517 0.1241 -0.0162 -0.0470 0.0157  48  LEU A O   
309  C CB  A LEU A 23  ? 0.0786 0.0733 0.1418 -0.0150 -0.0434 -0.0084 48  LEU A CB  
310  C CB  B LEU A 23  ? 0.0763 0.0661 0.1226 0.0054  -0.0212 0.0170  48  LEU A CB  
311  C CG  A LEU A 23  ? 0.0853 0.0787 0.1611 -0.0150 -0.0347 -0.0190 48  LEU A CG  
312  C CG  B LEU A 23  ? 0.0855 0.0834 0.1311 0.0011  -0.0041 0.0166  48  LEU A CG  
313  C CD1 A LEU A 23  ? 0.0976 0.0782 0.1635 0.0000  -0.0286 -0.0302 48  LEU A CD1 
314  C CD1 B LEU A 23  ? 0.0671 0.0664 0.1264 -0.0018 0.0050  0.0109  48  LEU A CD1 
315  C CD2 A LEU A 23  ? 0.0739 0.0782 0.1694 -0.0105 -0.0389 -0.0242 48  LEU A CD2 
316  C CD2 B LEU A 23  ? 0.1090 0.1084 0.1377 0.0081  0.0034  0.0253  48  LEU A CD2 
339  N N   . ILE A 24  ? 0.0648 0.0474 0.1120 -0.0176 -0.0306 0.0099  49  ILE A N   
340  C CA  . ILE A 24  ? 0.0730 0.0528 0.1063 -0.0072 -0.0288 0.0046  49  ILE A CA  
341  C C   . ILE A 24  ? 0.0667 0.0594 0.1106 -0.0130 -0.0293 0.0048  49  ILE A C   
342  O O   . ILE A 24  ? 0.0686 0.0527 0.1063 -0.0099 -0.0258 0.0082  49  ILE A O   
343  C CB  . ILE A 24  ? 0.0723 0.0846 0.1044 -0.0163 -0.0212 0.0030  49  ILE A CB  
344  C CG1 . ILE A 24  ? 0.0741 0.1023 0.1103 -0.0216 -0.0124 0.0131  49  ILE A CG1 
345  C CG2 . ILE A 24  ? 0.0818 0.1052 0.0920 0.0031  -0.0046 0.0080  49  ILE A CG2 
346  C CD1 . ILE A 24  ? 0.0863 0.1180 0.1159 -0.0175 -0.0081 -0.0041 49  ILE A CD1 
358  N N   . ASN A 25  ? 0.0619 0.0541 0.1104 -0.0097 -0.0275 0.0013  50  ASN A N   
359  C CA  . ASN A 25  ? 0.0605 0.0603 0.1139 -0.0079 -0.0125 0.0041  50  ASN A CA  
360  C C   . ASN A 25  ? 0.0664 0.0639 0.1062 -0.0171 -0.0149 0.0123  50  ASN A C   
361  O O   . ASN A 25  ? 0.0878 0.0611 0.1244 -0.0147 -0.0378 -0.0027 50  ASN A O   
362  C CB  . ASN A 25  ? 0.0801 0.0788 0.1437 0.0033  0.0020  -0.0066 50  ASN A CB  
363  C CG  . ASN A 25  ? 0.0987 0.1294 0.1917 0.0166  0.0273  0.0005  50  ASN A CG  
364  O OD1 . ASN A 25  ? 0.0696 0.1023 0.1843 -0.0135 0.0105  0.0047  50  ASN A OD1 
365  N ND2 . ASN A 25  ? 0.1312 0.2002 0.2377 0.0464  0.0511  0.0235  50  ASN A ND2 
372  N N   . THR A 26  ? 0.0823 0.0553 0.1058 -0.0162 -0.0255 0.0088  51  THR A N   
373  C CA  . THR A 26  ? 0.1005 0.0685 0.1167 -0.0076 -0.0371 0.0047  51  THR A CA  
374  C C   . THR A 26  ? 0.1420 0.0600 0.1461 -0.0034 -0.0674 -0.0078 51  THR A C   
375  O O   . THR A 26  ? 0.1720 0.0783 0.1513 0.0071  -0.0875 -0.0219 51  THR A O   
376  C CB  . THR A 26  ? 0.0980 0.0677 0.1085 -0.0054 -0.0068 0.0083  51  THR A CB  
377  O OG1 . THR A 26  ? 0.0802 0.0569 0.0863 -0.0116 -0.0036 -0.0073 51  THR A OG1 
378  C CG2 . THR A 26  ? 0.0961 0.0685 0.1169 -0.0063 0.0210  0.0321  51  THR A CG2 
386  N N   . ALA A 27  ? 0.1161 0.0727 0.1704 -0.0267 -0.0619 0.0055  52  ALA A N   
387  C CA  . ALA A 27  ? 0.1487 0.0994 0.2295 -0.0361 -0.0796 0.0059  52  ALA A CA  
388  C C   . ALA A 27  ? 0.1632 0.1108 0.2417 -0.0289 -0.1037 0.0081  52  ALA A C   
389  O O   . ALA A 27  ? 0.1879 0.1349 0.2671 -0.0198 -0.1242 -0.0041 52  ALA A O   
390  C CB  . ALA A 27  ? 0.1457 0.1395 0.2608 -0.0583 -0.0557 0.0281  52  ALA A CB  
396  N N   . ASP A 28  ? 0.1693 0.0975 0.2384 -0.0103 -0.1169 0.0117  53  ASP A N   
397  C CA  . ASP A 28  ? 0.1940 0.1212 0.2513 0.0085  -0.1298 -0.0034 53  ASP A CA  
398  C C   . ASP A 28  ? 0.2353 0.1445 0.2325 0.0287  -0.1384 -0.0205 53  ASP A C   
399  O O   . ASP A 28  ? 0.2584 0.1719 0.2276 0.0331  -0.1422 -0.0133 53  ASP A O   
400  C CB  . ASP A 28  ? 0.1866 0.1430 0.2938 0.0251  -0.1122 -0.0068 53  ASP A CB  
401  C CG  . ASP A 28  ? 0.1642 0.1533 0.3229 0.0383  -0.0867 0.0014  53  ASP A CG  
402  O OD1 . ASP A 28  ? 0.1412 0.1034 0.3166 -0.0019 -0.0930 0.0101  53  ASP A OD1 
403  O OD2 . ASP A 28  ? 0.1609 0.2336 0.3504 0.0571  -0.0564 -0.0115 53  ASP A OD2 
408  N N   . ASN A 29  ? 0.2301 0.1468 0.2205 0.0295  -0.1215 -0.0385 54  ASN A N   
409  C CA  . ASN A 29  ? 0.2537 0.1997 0.2185 0.0367  -0.0986 -0.0075 54  ASN A CA  
410  C C   . ASN A 29  ? 0.2099 0.1796 0.2090 -0.0016 -0.0836 0.0235  54  ASN A C   
411  O O   . ASN A 29  ? 0.2257 0.1946 0.2200 -0.0286 -0.0664 0.0346  54  ASN A O   
412  C CB  . ASN A 29  ? 0.3309 0.2770 0.2458 0.0811  -0.0774 -0.0063 54  ASN A CB  
413  C CG  . ASN A 29  ? 0.3806 0.3505 0.2674 0.0829  -0.0732 -0.0178 54  ASN A CG  
414  O OD1 . ASN A 29  ? 0.4061 0.3968 0.2834 0.0887  -0.0715 -0.0220 54  ASN A OD1 
415  N ND2 . ASN A 29  ? 0.3964 0.3504 0.2683 0.0844  -0.0587 -0.0071 54  ASN A ND2 
422  N N   . SER A 30  ? 0.1583 0.1066 0.1948 -0.0284 -0.0875 0.0207  55  SER A N   
423  C CA  . SER A 30  ? 0.1437 0.0907 0.2053 -0.0127 -0.0779 0.0152  55  SER A CA  
424  C C   . SER A 30  ? 0.1331 0.0758 0.1900 -0.0246 -0.0837 0.0208  55  SER A C   
425  O O   . SER A 30  ? 0.1519 0.0946 0.1846 -0.0102 -0.0840 0.0298  55  SER A O   
426  C CB  . SER A 30  ? 0.1431 0.1118 0.2313 0.0006  -0.0637 0.0019  55  SER A CB  
427  O OG  . SER A 30  ? 0.1315 0.1335 0.2430 0.0055  -0.0668 -0.0081 55  SER A OG  
433  N N   . GLN A 31  ? 0.1298 0.0998 0.1941 -0.0030 -0.0883 0.0194  56  GLN A N   
434  C CA  . GLN A 31  ? 0.1222 0.0925 0.2024 -0.0105 -0.0873 0.0049  56  GLN A CA  
435  C C   . GLN A 31  ? 0.1195 0.0771 0.1985 -0.0056 -0.0855 0.0152  56  GLN A C   
436  O O   . GLN A 31  ? 0.1443 0.1206 0.2088 0.0295  -0.0829 0.0166  56  GLN A O   
437  C CB  . GLN A 31  ? 0.1379 0.1359 0.2149 0.0108  -0.0903 -0.0065 56  GLN A CB  
438  C CG  . GLN A 31  ? 0.1638 0.1761 0.2188 0.0129  -0.0895 -0.0178 56  GLN A CG  
439  C CD  . GLN A 31  ? 0.2024 0.2484 0.2310 0.0010  -0.0671 -0.0164 56  GLN A CD  
440  O OE1 . GLN A 31  ? 0.2202 0.2537 0.2324 -0.0356 -0.0526 -0.0127 56  GLN A OE1 
441  N NE2 . GLN A 31  ? 0.2069 0.2918 0.2367 0.0025  -0.0564 -0.0214 56  GLN A NE2 
450  N N   . ILE A 32  ? 0.1022 0.0720 0.1974 -0.0147 -0.0698 0.0095  57  ILE A N   
451  C CA  . ILE A 32  ? 0.0933 0.0800 0.1979 0.0011  -0.0587 0.0010  57  ILE A CA  
452  C C   . ILE A 32  ? 0.0986 0.0615 0.1987 0.0023  -0.0601 0.0054  57  ILE A C   
453  O O   . ILE A 32  ? 0.0921 0.0540 0.1860 0.0057  -0.0504 0.0019  57  ILE A O   
454  C CB  . ILE A 32  ? 0.1147 0.1089 0.2051 -0.0060 -0.0398 -0.0011 57  ILE A CB  
455  C CG1 . ILE A 32  ? 0.1343 0.1783 0.2106 -0.0193 -0.0174 0.0086  57  ILE A CG1 
456  C CG2 . ILE A 32  ? 0.1376 0.1330 0.2162 0.0236  -0.0440 -0.0054 57  ILE A CG2 
457  C CD1 . ILE A 32  ? 0.1602 0.2208 0.2156 -0.0327 -0.0088 0.0112  57  ILE A CD1 
469  N N   . LEU A 33  ? 0.0880 0.0657 0.1985 0.0015  -0.0619 0.0100  59  LEU A N   
470  C CA  . LEU A 33  ? 0.0986 0.0652 0.2161 -0.0107 -0.0644 0.0142  59  LEU A CA  
471  C C   . LEU A 33  ? 0.1079 0.0679 0.2328 -0.0003 -0.0770 0.0032  59  LEU A C   
472  O O   . LEU A 33  ? 0.1092 0.0788 0.2598 0.0116  -0.0727 -0.0132 59  LEU A O   
473  C CB  . LEU A 33  ? 0.1035 0.0773 0.2160 -0.0135 -0.0657 0.0413  59  LEU A CB  
474  C CG  . LEU A 33  ? 0.1284 0.0943 0.2114 -0.0256 -0.0639 0.0405  59  LEU A CG  
475  C CD1 . LEU A 33  ? 0.1742 0.1337 0.2071 -0.0146 -0.0620 0.0429  59  LEU A CD1 
476  C CD2 . LEU A 33  ? 0.1187 0.0871 0.2139 -0.0345 -0.0632 0.0315  59  LEU A CD2 
488  N N   . TYR A 34  ? 0.0999 0.0609 0.2046 -0.0048 -0.0707 0.0078  60  TYR A N   
489  C CA  . TYR A 34  ? 0.1038 0.0607 0.2025 -0.0099 -0.0614 0.0104  60  TYR A CA  
490  C C   . TYR A 34  ? 0.1117 0.0616 0.2018 -0.0024 -0.0715 0.0095  60  TYR A C   
491  O O   . TYR A 34  ? 0.0927 0.0573 0.1891 -0.0036 -0.0657 0.0107  60  TYR A O   
492  C CB  . TYR A 34  ? 0.1011 0.0646 0.2329 -0.0046 -0.0585 0.0093  60  TYR A CB  
493  C CG  . TYR A 34  ? 0.0986 0.0702 0.2464 -0.0034 -0.0546 -0.0118 60  TYR A CG  
494  C CD1 . TYR A 34  ? 0.1133 0.0782 0.2695 0.0042  -0.0559 -0.0297 60  TYR A CD1 
495  C CD2 . TYR A 34  ? 0.1024 0.0784 0.2546 0.0162  -0.0560 -0.0143 60  TYR A CD2 
496  C CE1 . TYR A 34  ? 0.1073 0.0834 0.2828 0.0102  -0.0535 -0.0382 60  TYR A CE1 
497  C CE2 . TYR A 34  ? 0.0948 0.0769 0.2773 0.0068  -0.0533 -0.0234 60  TYR A CE2 
498  C CZ  . TYR A 34  ? 0.1053 0.0810 0.2918 0.0059  -0.0495 -0.0289 60  TYR A CZ  
499  O OH  . TYR A 34  ? 0.1099 0.0901 0.3129 0.0126  -0.0584 -0.0347 60  TYR A OH  
509  N N   . ARG A 35  ? 0.1077 0.0627 0.1923 -0.0021 -0.0717 0.0137  61  ARG A N   
510  C CA  . ARG A 35  ? 0.1025 0.0601 0.1919 -0.0127 -0.0592 0.0202  61  ARG A CA  
511  C C   . ARG A 35  ? 0.0927 0.0603 0.1842 -0.0124 -0.0632 0.0251  61  ARG A C   
512  O O   . ARG A 35  ? 0.0899 0.0589 0.1850 -0.0074 -0.0532 0.0255  61  ARG A O   
513  C CB  . ARG A 35  ? 0.1195 0.0604 0.2042 -0.0094 -0.0581 0.0114  61  ARG A CB  
514  C CG  . ARG A 35  ? 0.1236 0.0643 0.2250 0.0028  -0.0619 0.0042  61  ARG A CG  
515  C CD  . ARG A 35  ? 0.1204 0.0656 0.2290 0.0002  -0.0666 0.0044  61  ARG A CD  
516  N NE  . ARG A 35  ? 0.1185 0.0694 0.2439 -0.0020 -0.0701 0.0076  61  ARG A NE  
517  C CZ  . ARG A 35  ? 0.1331 0.0769 0.2685 -0.0039 -0.0776 -0.0019 61  ARG A CZ  
518  N NH1 . ARG A 35  ? 0.1399 0.0781 0.2690 -0.0059 -0.0667 0.0239  61  ARG A NH1 
519  N NH2 . ARG A 35  ? 0.1435 0.0812 0.2813 0.0095  -0.0799 -0.0116 61  ARG A NH2 
533  N N   . ALA A 36  ? 0.1016 0.0609 0.1766 -0.0079 -0.0696 0.0202  62  ALA A N   
534  C CA  . ALA A 36  ? 0.1096 0.0566 0.1707 -0.0107 -0.0690 0.0146  62  ALA A CA  
535  C C   . ALA A 36  ? 0.1114 0.0624 0.1554 -0.0203 -0.0753 0.0273  62  ALA A C   
536  O O   . ALA A 36  ? 0.1073 0.0624 0.1563 -0.0139 -0.0624 0.0248  62  ALA A O   
537  C CB  . ALA A 36  ? 0.1130 0.0694 0.1749 -0.0264 -0.0611 0.0144  62  ALA A CB  
543  N N   . ASP A 37  ? 0.1288 0.0625 0.1644 -0.0188 -0.0721 0.0243  63  ASP A N   
544  C CA  . ASP A 37  ? 0.1462 0.0812 0.1793 -0.0321 -0.0928 0.0369  63  ASP A CA  
545  C C   . ASP A 37  ? 0.1415 0.0899 0.1760 -0.0351 -0.0806 0.0511  63  ASP A C   
546  O O   . ASP A 37  ? 0.1683 0.1019 0.1842 -0.0558 -0.0742 0.0448  63  ASP A O   
547  C CB  . ASP A 37  ? 0.1673 0.1372 0.2125 -0.0344 -0.0985 0.0418  63  ASP A CB  
548  C CG  . ASP A 37  ? 0.2006 0.1791 0.2434 -0.0108 -0.1054 0.0203  63  ASP A CG  
549  O OD1 . ASP A 37  ? 0.2047 0.1653 0.2398 -0.0119 -0.1104 0.0207  63  ASP A OD1 
550  O OD2 . ASP A 37  ? 0.2325 0.2460 0.2757 0.0123  -0.1096 -0.0026 63  ASP A OD2 
555  N N   . GLU A 38  ? 0.1348 0.0773 0.1712 -0.0314 -0.0787 0.0399  64  GLU A N   
556  C CA  . GLU A 38  ? 0.1151 0.0746 0.1704 -0.0287 -0.0727 0.0298  64  GLU A CA  
557  C C   . GLU A 38  ? 0.1055 0.0649 0.1505 -0.0302 -0.0486 0.0287  64  GLU A C   
558  O O   . GLU A 38  ? 0.1050 0.0598 0.1524 -0.0233 -0.0324 0.0231  64  GLU A O   
559  C CB  . GLU A 38  ? 0.1219 0.0734 0.1949 -0.0256 -0.0660 0.0363  64  GLU A CB  
560  C CG  . GLU A 38  ? 0.1330 0.0780 0.2168 -0.0220 -0.0742 0.0387  64  GLU A CG  
561  C CD  . GLU A 38  ? 0.1407 0.0808 0.2490 -0.0145 -0.0800 0.0331  64  GLU A CD  
562  O OE1 . GLU A 38  ? 0.1410 0.0770 0.2560 -0.0093 -0.0822 0.0173  64  GLU A OE1 
563  O OE2 . GLU A 38  ? 0.1301 0.0808 0.2484 -0.0144 -0.0784 0.0351  64  GLU A OE2 
570  N N   . ARG A 39  ? 0.1170 0.0708 0.1408 -0.0390 -0.0449 0.0290  65  ARG A N   
571  C CA  . ARG A 39  ? 0.1160 0.0884 0.1255 -0.0353 -0.0297 0.0214  65  ARG A CA  
572  C C   . ARG A 39  ? 0.0982 0.0635 0.1209 -0.0298 -0.0230 0.0069  65  ARG A C   
573  O O   . ARG A 39  ? 0.1137 0.0530 0.1366 -0.0159 -0.0422 -0.0007 65  ARG A O   
574  C CB  . ARG A 39  ? 0.1566 0.1168 0.1275 -0.0391 -0.0130 0.0118  65  ARG A CB  
575  C CG  . ARG A 39  ? 0.2009 0.1544 0.1238 -0.0242 -0.0084 0.0132  65  ARG A CG  
576  C CD  . ARG A 39  ? 0.2436 0.1519 0.1223 -0.0166 -0.0200 0.0168  65  ARG A CD  
577  N NE  . ARG A 39  ? 0.2743 0.1633 0.1265 -0.0051 -0.0390 0.0083  65  ARG A NE  
578  C CZ  . ARG A 39  ? 0.2581 0.1518 0.1070 -0.0317 -0.0401 0.0044  65  ARG A CZ  
579  N NH1 . ARG A 39  ? 0.1850 0.1058 0.0819 -0.0499 -0.0371 0.0006  65  ARG A NH1 
580  N NH2 . ARG A 39  ? 0.2989 0.1986 0.1082 -0.0336 -0.0490 0.0210  65  ARG A NH2 
594  N N   . PHE A 40  ? 0.0817 0.0525 0.1058 -0.0143 -0.0028 0.0000  66  PHE A N   
595  C CA  . PHE A 40  ? 0.0737 0.0555 0.0893 -0.0181 0.0073  -0.0036 66  PHE A CA  
596  C C   . PHE A 40  ? 0.0770 0.0478 0.0788 -0.0260 0.0088  0.0058  66  PHE A C   
597  O O   . PHE A 40  ? 0.0785 0.0367 0.0733 -0.0082 -0.0030 -0.0082 66  PHE A O   
598  C CB  . PHE A 40  ? 0.0862 0.0450 0.0977 -0.0072 0.0072  -0.0117 66  PHE A CB  
599  C CG  . PHE A 40  ? 0.0776 0.0405 0.1215 -0.0162 -0.0033 -0.0155 66  PHE A CG  
600  C CD1 . PHE A 40  ? 0.0800 0.0540 0.1251 -0.0243 0.0067  -0.0138 66  PHE A CD1 
601  C CD2 . PHE A 40  ? 0.0754 0.0464 0.1245 -0.0103 -0.0024 -0.0164 66  PHE A CD2 
602  C CE1 . PHE A 40  ? 0.0797 0.0497 0.1306 -0.0271 -0.0084 -0.0046 66  PHE A CE1 
603  C CE2 . PHE A 40  ? 0.0837 0.0382 0.1276 -0.0085 0.0051  -0.0183 66  PHE A CE2 
604  C CZ  . PHE A 40  ? 0.0834 0.0454 0.1354 -0.0133 -0.0084 -0.0222 66  PHE A CZ  
614  N N   . ALA A 41  ? 0.0717 0.0395 0.0718 -0.0240 0.0065  -0.0102 67  ALA A N   
615  C CA  . ALA A 41  ? 0.0709 0.0472 0.0690 -0.0184 0.0032  0.0131  67  ALA A CA  
616  C C   . ALA A 41  ? 0.0779 0.0551 0.0646 -0.0211 0.0078  -0.0003 67  ALA A C   
617  O O   . ALA A 41  ? 0.0919 0.0471 0.0725 -0.0180 0.0201  -0.0047 67  ALA A O   
618  C CB  . ALA A 41  ? 0.0831 0.0532 0.0582 -0.0214 0.0050  0.0100  67  ALA A CB  
624  N N   . MET A 42  ? 0.0705 0.0391 0.0570 -0.0170 0.0072  0.0010  68  MET A N   
625  C CA  . MET A 42  ? 0.0664 0.0371 0.0543 -0.0125 -0.0039 0.0012  68  MET A CA  
626  C C   . MET A 42  ? 0.0644 0.0296 0.0505 -0.0183 -0.0117 -0.0050 68  MET A C   
627  O O   . MET A 42  ? 0.0672 0.0427 0.0488 -0.0104 -0.0001 0.0036  68  MET A O   
628  C CB  . MET A 42  ? 0.0736 0.0350 0.0586 -0.0125 -0.0041 0.0080  68  MET A CB  
629  C CG  . MET A 42  ? 0.0671 0.0475 0.0506 -0.0079 -0.0044 0.0025  68  MET A CG  
630  S SD  . MET A 42  ? 0.0785 0.0526 0.0536 -0.0178 -0.0020 0.0010  68  MET A SD  
631  C CE  . MET A 42  ? 0.0992 0.0475 0.0624 -0.0062 0.0059  0.0100  68  MET A CE  
641  N N   . CYS A 43  ? 0.0716 0.0417 0.0484 -0.0194 -0.0087 -0.0118 69  CYS A N   
642  C CA  . CYS A 43  ? 0.0652 0.0468 0.0583 -0.0174 0.0010  -0.0037 69  CYS A CA  
643  C C   . CYS A 43  ? 0.0572 0.0474 0.0557 -0.0073 0.0065  0.0028  69  CYS A C   
644  O O   . CYS A 43  ? 0.0702 0.0479 0.0608 -0.0023 0.0034  -0.0070 69  CYS A O   
645  C CB  . CYS A 43  ? 0.0810 0.0451 0.0629 -0.0085 -0.0058 0.0003  69  CYS A CB  
646  S SG  . CYS A 43  ? 0.0920 0.0500 0.0636 -0.0138 -0.0030 -0.0059 69  CYS A SG  
652  N N   . SER A 44  ? 0.0608 0.0483 0.0556 -0.0015 0.0040  -0.0025 70  SER A N   
653  C CA  . SER A 44  ? 0.0649 0.0478 0.0642 -0.0022 -0.0107 0.0057  70  SER A CA  
654  C C   . SER A 44  ? 0.0659 0.0479 0.0611 -0.0037 0.0016  0.0110  70  SER A C   
655  O O   . SER A 44  ? 0.0687 0.0427 0.0497 0.0018  0.0058  0.0064  70  SER A O   
656  C CB  . SER A 44  ? 0.0924 0.0635 0.0926 -0.0015 -0.0429 0.0010  70  SER A CB  
657  O OG  . SER A 44  ? 0.1185 0.0897 0.1306 -0.0116 -0.0682 0.0143  70  SER A OG  
663  N N   . THR A 45  ? 0.0531 0.0338 0.0545 -0.0022 -0.0026 0.0072  71  THR A N   
664  C CA  . THR A 45  ? 0.0586 0.0425 0.0618 -0.0108 0.0036  0.0059  71  THR A CA  
665  C C   . THR A 45  ? 0.0500 0.0429 0.0462 -0.0072 -0.0047 0.0056  71  THR A C   
666  O O   . THR A 45  ? 0.0657 0.0461 0.0416 -0.0074 -0.0033 -0.0032 71  THR A O   
667  C CB  . THR A 45  ? 0.0607 0.0454 0.0612 -0.0079 0.0018  0.0065  71  THR A CB  
668  O OG1 . THR A 45  ? 0.0554 0.0491 0.0541 -0.0118 -0.0038 0.0082  71  THR A OG1 
669  C CG2 . THR A 45  ? 0.0698 0.0440 0.0647 -0.0045 0.0006  0.0116  71  THR A CG2 
677  N N   . SER A 46  ? 0.0575 0.0413 0.0428 -0.0071 0.0004  -0.0028 72  SER A N   
678  C CA  . SER A 46  ? 0.0544 0.0471 0.0540 -0.0059 0.0061  0.0045  72  SER A CA  
679  C C   . SER A 46  ? 0.0516 0.0467 0.0432 -0.0112 0.0010  -0.0019 72  SER A C   
680  O O   . SER A 46  ? 0.0601 0.0488 0.0488 -0.0098 -0.0005 -0.0076 72  SER A O   
681  C CB  . SER A 46  ? 0.0701 0.0536 0.0684 -0.0009 0.0098  -0.0002 72  SER A CB  
682  O OG  . SER A 46  ? 0.0654 0.0697 0.0857 -0.0082 0.0125  -0.0080 72  SER A OG  
688  N N   . LYS A 47  ? 0.0612 0.0505 0.0446 -0.0061 0.0112  -0.0028 73  LYS A N   
689  C CA  . LYS A 47  ? 0.0629 0.0423 0.0514 0.0044  -0.0036 0.0037  73  LYS A CA  
690  C C   . LYS A 47  ? 0.0639 0.0321 0.0551 0.0014  0.0032  -0.0016 73  LYS A C   
691  O O   . LYS A 47  ? 0.0814 0.0389 0.0690 0.0061  -0.0025 -0.0030 73  LYS A O   
692  C CB  . LYS A 47  ? 0.0711 0.0461 0.0546 0.0131  -0.0041 -0.0082 73  LYS A CB  
693  C CG  . LYS A 47  ? 0.0666 0.0628 0.0672 0.0104  -0.0210 -0.0134 73  LYS A CG  
694  C CD  . LYS A 47  ? 0.0752 0.1304 0.0891 0.0169  -0.0163 -0.0146 73  LYS A CD  
695  C CE  . LYS A 47  ? 0.0869 0.1766 0.1028 0.0003  -0.0193 -0.0257 73  LYS A CE  
696  N NZ  . LYS A 47  ? 0.1020 0.1173 0.1106 0.0127  -0.0046 -0.0072 73  LYS A NZ  
710  N N   . VAL A 48  ? 0.0684 0.0382 0.0516 0.0009  -0.0023 -0.0087 74  VAL A N   
711  C CA  . VAL A 48  ? 0.0642 0.0408 0.0499 0.0000  0.0005  -0.0035 74  VAL A CA  
712  C C   . VAL A 48  ? 0.0677 0.0382 0.0426 -0.0088 -0.0007 0.0007  74  VAL A C   
713  O O   . VAL A 48  ? 0.0615 0.0485 0.0395 -0.0101 0.0050  -0.0045 74  VAL A O   
714  C CB  . VAL A 48  ? 0.0597 0.0649 0.0615 -0.0077 0.0026  0.0028  74  VAL A CB  
715  C CG1 . VAL A 48  ? 0.0674 0.0733 0.0792 -0.0085 0.0019  -0.0120 74  VAL A CG1 
716  C CG2 . VAL A 48  ? 0.0597 0.0829 0.0613 -0.0092 0.0075  -0.0131 74  VAL A CG2 
726  N N   . MET A 49  ? 0.0799 0.0354 0.0437 0.0015  0.0061  0.0010  75  MET A N   
727  C CA  . MET A 49  ? 0.0825 0.0446 0.0390 -0.0019 -0.0029 -0.0072 75  MET A CA  
728  C C   . MET A 49  ? 0.0771 0.0447 0.0466 -0.0123 -0.0019 0.0042  75  MET A C   
729  O O   . MET A 49  ? 0.0810 0.0447 0.0595 -0.0102 0.0075  0.0023  75  MET A O   
730  C CB  . MET A 49  ? 0.0833 0.0533 0.0423 -0.0179 -0.0059 0.0113  75  MET A CB  
731  C CG  . MET A 49  ? 0.0970 0.0584 0.0589 -0.0298 -0.0076 0.0074  75  MET A CG  
732  S SD  . MET A 49  ? 0.1159 0.0834 0.0973 -0.0337 -0.0378 0.0129  75  MET A SD  
733  C CE  . MET A 49  ? 0.1186 0.1208 0.1337 -0.0111 -0.0308 0.0002  75  MET A CE  
743  N N   . ALA A 50  ? 0.0668 0.0602 0.0417 -0.0114 0.0001  -0.0018 76  ALA A N   
744  C CA  . ALA A 50  ? 0.0603 0.0677 0.0450 -0.0265 0.0028  0.0011  76  ALA A CA  
745  C C   . ALA A 50  ? 0.0576 0.0686 0.0493 -0.0160 0.0028  0.0005  76  ALA A C   
746  O O   . ALA A 50  ? 0.0590 0.0776 0.0591 -0.0018 0.0082  -0.0052 76  ALA A O   
747  C CB  . ALA A 50  ? 0.0717 0.0647 0.0592 -0.0213 0.0085  0.0055  76  ALA A CB  
753  N N   . ALA A 51  ? 0.0596 0.0499 0.0542 -0.0078 0.0037  -0.0030 77  ALA A N   
754  C CA  . ALA A 51  ? 0.0518 0.0491 0.0595 -0.0130 0.0063  -0.0015 77  ALA A CA  
755  C C   . ALA A 51  ? 0.0645 0.0469 0.0530 0.0084  0.0136  0.0062  77  ALA A C   
756  O O   . ALA A 51  ? 0.0626 0.0525 0.0549 0.0070  0.0077  0.0060  77  ALA A O   
757  C CB  . ALA A 51  ? 0.0738 0.0625 0.0641 -0.0032 0.0014  0.0062  77  ALA A CB  
763  N N   . ALA A 52  ? 0.0559 0.0439 0.0581 -0.0120 0.0082  -0.0046 78  ALA A N   
764  C CA  . ALA A 52  ? 0.0467 0.0575 0.0628 -0.0164 0.0029  -0.0074 78  ALA A CA  
765  C C   . ALA A 52  ? 0.0506 0.0475 0.0609 -0.0128 0.0040  0.0038  78  ALA A C   
766  O O   . ALA A 52  ? 0.0616 0.0542 0.0577 -0.0111 0.0095  -0.0066 78  ALA A O   
767  C CB  . ALA A 52  ? 0.0650 0.0642 0.0636 -0.0098 0.0100  0.0044  78  ALA A CB  
773  N N   . ALA A 53  ? 0.0554 0.0539 0.0477 -0.0005 0.0068  -0.0070 79  ALA A N   
774  C CA  . ALA A 53  ? 0.0512 0.0543 0.0461 -0.0080 0.0004  0.0004  79  ALA A CA  
775  C C   . ALA A 53  ? 0.0468 0.0573 0.0449 -0.0089 -0.0010 -0.0033 79  ALA A C   
776  O O   . ALA A 53  ? 0.0592 0.0673 0.0501 -0.0042 0.0036  -0.0121 79  ALA A O   
777  C CB  . ALA A 53  ? 0.0637 0.0692 0.0582 -0.0072 0.0112  0.0028  79  ALA A CB  
783  N N   . VAL A 54  ? 0.0585 0.0677 0.0528 -0.0033 0.0049  -0.0027 80  VAL A N   
784  C CA  . VAL A 54  ? 0.0617 0.0641 0.0548 -0.0008 0.0050  -0.0001 80  VAL A CA  
785  C C   . VAL A 54  ? 0.0615 0.0581 0.0585 0.0060  0.0080  -0.0026 80  VAL A C   
786  O O   . VAL A 54  ? 0.0664 0.0543 0.0562 0.0060  0.0131  -0.0059 80  VAL A O   
787  C CB  . VAL A 54  ? 0.0665 0.0761 0.0657 0.0070  0.0071  -0.0035 80  VAL A CB  
788  C CG1 . VAL A 54  ? 0.0823 0.0700 0.0721 0.0045  0.0055  0.0015  80  VAL A CG1 
789  C CG2 . VAL A 54  ? 0.0499 0.0788 0.0708 -0.0088 -0.0039 -0.0112 80  VAL A CG2 
799  N N   . LEU A 55  ? 0.0522 0.0548 0.0617 -0.0063 0.0093  -0.0102 81  LEU A N   
800  C CA  . LEU A 55  ? 0.0626 0.0572 0.0662 -0.0064 0.0108  -0.0078 81  LEU A CA  
801  C C   . LEU A 55  ? 0.0566 0.0573 0.0673 -0.0165 0.0147  -0.0062 81  LEU A C   
802  O O   . LEU A 55  ? 0.0726 0.0492 0.0774 -0.0148 0.0188  -0.0114 81  LEU A O   
803  C CB  . LEU A 55  ? 0.0519 0.0658 0.0691 -0.0047 0.0224  -0.0055 81  LEU A CB  
804  C CG  . LEU A 55  ? 0.0584 0.0578 0.0654 -0.0115 0.0131  -0.0010 81  LEU A CG  
805  C CD1 . LEU A 55  ? 0.0597 0.0570 0.0672 -0.0053 0.0115  0.0091  81  LEU A CD1 
806  C CD2 . LEU A 55  ? 0.0708 0.0822 0.0700 0.0025  0.0217  0.0236  81  LEU A CD2 
818  N N   . LYS A 56  ? 0.0536 0.0549 0.0591 -0.0066 0.0130  -0.0073 82  LYS A N   
819  C CA  . LYS A 56  ? 0.0649 0.0624 0.0582 -0.0048 0.0141  -0.0021 82  LYS A CA  
820  C C   . LYS A 56  ? 0.0548 0.0689 0.0508 0.0062  0.0121  -0.0045 82  LYS A C   
821  O O   . LYS A 56  ? 0.0762 0.0752 0.0662 0.0036  0.0144  -0.0159 82  LYS A O   
822  C CB  . LYS A 56  ? 0.0595 0.0676 0.0591 -0.0006 -0.0030 -0.0017 82  LYS A CB  
823  C CG  . LYS A 56  ? 0.0499 0.0890 0.0686 0.0008  0.0040  -0.0120 82  LYS A CG  
824  C CD  . LYS A 56  ? 0.0622 0.1052 0.0859 -0.0034 -0.0001 -0.0271 82  LYS A CD  
825  C CE  . LYS A 56  ? 0.0558 0.1317 0.0918 -0.0162 -0.0053 -0.0342 82  LYS A CE  
826  N NZ  . LYS A 56  ? 0.0647 0.1633 0.1002 -0.0185 0.0145  -0.0280 82  LYS A NZ  
840  N N   . GLN A 57  ? 0.0634 0.0734 0.0654 0.0007  0.0145  -0.0109 83  GLN A N   
841  C CA  . GLN A 57  ? 0.0648 0.0882 0.0813 0.0169  0.0201  -0.0068 83  GLN A CA  
842  C C   . GLN A 57  ? 0.0705 0.0728 0.0811 0.0119  0.0198  -0.0217 83  GLN A C   
843  O O   . GLN A 57  ? 0.0851 0.0926 0.0732 0.0124  0.0321  -0.0114 83  GLN A O   
844  C CB  . GLN A 57  ? 0.0572 0.0878 0.0842 0.0027  0.0083  0.0070  83  GLN A CB  
845  C CG  . GLN A 57  ? 0.0680 0.0917 0.0974 0.0009  0.0070  -0.0056 83  GLN A CG  
846  C CD  . GLN A 57  ? 0.1044 0.1143 0.1094 -0.0010 0.0032  -0.0022 83  GLN A CD  
847  O OE1 . GLN A 57  ? 0.1270 0.1298 0.1178 -0.0185 -0.0164 0.0136  83  GLN A OE1 
848  N NE2 . GLN A 57  ? 0.0924 0.1516 0.1120 -0.0204 0.0019  -0.0057 83  GLN A NE2 
857  N N   . SER A 58  ? 0.0718 0.0662 0.0889 0.0110  0.0284  -0.0072 84  SER A N   
858  C CA  . SER A 58  ? 0.1027 0.0737 0.0910 0.0070  0.0242  -0.0092 84  SER A CA  
859  C C   . SER A 58  ? 0.1123 0.0840 0.0918 0.0094  0.0339  -0.0214 84  SER A C   
860  O O   . SER A 58  ? 0.1404 0.0676 0.1019 0.0125  0.0305  -0.0117 84  SER A O   
861  C CB  . SER A 58  ? 0.1111 0.0624 0.0920 0.0182  0.0239  -0.0082 84  SER A CB  
862  O OG  . SER A 58  ? 0.1264 0.0650 0.0938 0.0182  0.0404  0.0034  84  SER A OG  
868  N N   . GLU A 59  ? 0.1037 0.0727 0.1023 -0.0051 0.0323  -0.0142 85  GLU A N   
869  C CA  . GLU A 59  ? 0.1045 0.0840 0.1415 0.0043  0.0261  -0.0186 85  GLU A CA  
870  C C   . GLU A 59  ? 0.1009 0.1007 0.1360 0.0043  0.0142  -0.0357 85  GLU A C   
871  O O   . GLU A 59  ? 0.1118 0.1191 0.1701 0.0053  0.0071  -0.0520 85  GLU A O   
872  C CB  . GLU A 59  ? 0.0929 0.0914 0.1845 -0.0055 0.0373  -0.0284 85  GLU A CB  
873  C CG  . GLU A 59  ? 0.0893 0.0986 0.2416 -0.0183 0.0578  -0.0243 85  GLU A CG  
874  C CD  . GLU A 59  ? 0.1214 0.1024 0.2963 -0.0179 0.0801  -0.0124 85  GLU A CD  
875  O OE1 . GLU A 59  ? 0.1248 0.1696 0.3289 0.0309  0.0695  0.0462  85  GLU A OE1 
876  O OE2 . GLU A 59  ? 0.1393 0.1074 0.3604 -0.0144 0.0992  -0.0354 85  GLU A OE2 
883  N N   . SER A 60  ? 0.1094 0.1107 0.1097 0.0061  0.0170  -0.0416 86  SER A N   
884  C CA  . SER A 60  ? 0.1181 0.1436 0.1102 0.0233  0.0132  -0.0348 86  SER A CA  
885  C C   . SER A 60  ? 0.1361 0.1357 0.1210 0.0450  0.0195  -0.0337 86  SER A C   
886  O O   . SER A 60  ? 0.1585 0.1802 0.1130 0.0672  0.0287  -0.0379 86  SER A O   
887  C CB  . SER A 60  ? 0.1215 0.1808 0.0968 0.0309  0.0067  -0.0246 86  SER A CB  
888  O OG  . SER A 60  ? 0.1264 0.1906 0.0778 0.0369  0.0033  -0.0064 86  SER A OG  
894  N N   . ASP A 61  ? 0.1133 0.1218 0.1197 0.0269  0.0191  -0.0393 87  ASP A N   
895  C CA  . ASP A 61  ? 0.1253 0.1222 0.1163 0.0324  0.0208  -0.0326 87  ASP A CA  
896  C C   . ASP A 61  ? 0.1397 0.1060 0.1084 0.0093  0.0145  -0.0296 87  ASP A C   
897  O O   . ASP A 61  ? 0.1249 0.0904 0.0950 0.0116  0.0104  -0.0260 87  ASP A O   
898  C CB  . ASP A 61  ? 0.1311 0.1293 0.1183 0.0335  0.0300  -0.0240 87  ASP A CB  
899  C CG  . ASP A 61  ? 0.1297 0.1431 0.1398 0.0389  0.0291  -0.0241 87  ASP A CG  
900  O OD1 . ASP A 61  ? 0.1373 0.1575 0.1385 0.0576  0.0184  -0.0074 87  ASP A OD1 
901  O OD2 . ASP A 61  ? 0.1145 0.1723 0.1645 0.0200  0.0355  -0.0233 87  ASP A OD2 
906  N N   . LYS A 62  ? 0.1738 0.1107 0.1213 0.0034  0.0148  -0.0253 88  LYS A N   
907  C CA  . LYS A 62  ? 0.1899 0.1059 0.1460 -0.0268 0.0136  -0.0208 88  LYS A CA  
908  C C   . LYS A 62  ? 0.1733 0.0966 0.1374 -0.0243 0.0167  -0.0315 88  LYS A C   
909  O O   . LYS A 62  ? 0.1843 0.1220 0.1445 -0.0132 0.0021  -0.0198 88  LYS A O   
910  C CB  . LYS A 62  ? 0.2647 0.1235 0.1889 -0.0223 -0.0027 -0.0273 88  LYS A CB  
911  C CG  . LYS A 62  ? 0.3202 0.1364 0.2300 -0.0324 -0.0045 -0.0440 88  LYS A CG  
912  C CD  . LYS A 62  ? 0.3641 0.1747 0.2666 -0.0108 -0.0035 -0.0568 88  LYS A CD  
913  C CE  . LYS A 62  ? 0.4009 0.2127 0.2959 0.0018  -0.0131 -0.0705 88  LYS A CE  
914  N NZ  . LYS A 62  ? 0.4245 0.2481 0.3165 0.0092  -0.0202 -0.0726 88  LYS A NZ  
928  N N   . HIS A 63  ? 0.1647 0.0863 0.1368 0.0033  0.0150  -0.0400 89  HIS A N   
929  C CA  . HIS A 63  ? 0.1769 0.0916 0.1483 0.0207  0.0044  -0.0216 89  HIS A CA  
930  C C   . HIS A 63  ? 0.1495 0.0877 0.1212 0.0112  -0.0035 -0.0053 89  HIS A C   
931  O O   . HIS A 63  ? 0.1758 0.1056 0.1197 0.0258  -0.0119 -0.0030 89  HIS A O   
932  C CB  . HIS A 63  ? 0.2344 0.1183 0.1777 0.0510  -0.0025 -0.0426 89  HIS A CB  
933  C CG  . HIS A 63  ? 0.3032 0.1744 0.2017 0.0766  -0.0105 -0.0544 89  HIS A CG  
934  N ND1 . HIS A 63  ? 0.3417 0.1983 0.2087 0.0860  -0.0158 -0.0699 89  HIS A ND1 
935  C CD2 . HIS A 63  ? 0.3365 0.1607 0.2215 0.0900  -0.0167 -0.0374 89  HIS A CD2 
936  C CE1 . HIS A 63  ? 0.3565 0.1928 0.2146 0.0870  -0.0215 -0.0593 89  HIS A CE1 
937  N NE2 . HIS A 63  ? 0.3533 0.1756 0.2254 0.0860  -0.0170 -0.0409 89  HIS A NE2 
945  N N   . LEU A 64  ? 0.1257 0.0805 0.1100 0.0196  0.0061  0.0098  90  LEU A N   
946  C CA  . LEU A 64  ? 0.0935 0.0690 0.1067 0.0147  0.0134  0.0043  90  LEU A CA  
947  C C   . LEU A 64  ? 0.0881 0.0663 0.1076 0.0158  -0.0059 0.0045  90  LEU A C   
948  O O   . LEU A 64  ? 0.0964 0.0777 0.1076 0.0088  -0.0111 0.0053  90  LEU A O   
949  C CB  . LEU A 64  ? 0.0905 0.0848 0.0952 0.0141  0.0226  0.0046  90  LEU A CB  
950  C CG  . LEU A 64  ? 0.0843 0.0948 0.0919 0.0150  0.0105  0.0065  90  LEU A CG  
951  C CD1 . LEU A 64  ? 0.0938 0.1122 0.0927 0.0200  0.0024  0.0097  90  LEU A CD1 
952  C CD2 . LEU A 64  ? 0.0884 0.1023 0.0907 0.0094  0.0052  0.0199  90  LEU A CD2 
964  N N   . LEU A 65  ? 0.0807 0.0706 0.1093 0.0020  0.0003  -0.0044 91  LEU A N   
965  C CA  . LEU A 65  ? 0.0857 0.0842 0.1129 0.0164  0.0006  0.0050  91  LEU A CA  
966  C C   . LEU A 65  ? 0.0901 0.0640 0.0994 0.0130  0.0009  -0.0056 91  LEU A C   
967  O O   . LEU A 65  ? 0.1055 0.0776 0.0867 0.0123  -0.0031 -0.0078 91  LEU A O   
968  C CB  . LEU A 65  ? 0.0939 0.0972 0.1262 0.0128  -0.0161 0.0018  91  LEU A CB  
969  C CG  . LEU A 65  ? 0.0962 0.1229 0.1532 0.0135  -0.0356 -0.0182 91  LEU A CG  
970  C CD1 . LEU A 65  ? 0.1056 0.1972 0.1855 0.0342  -0.0289 -0.0095 91  LEU A CD1 
971  C CD2 . LEU A 65  ? 0.1344 0.1254 0.1775 0.0481  -0.0460 -0.0198 91  LEU A CD2 
983  N N   . ASN A 66  ? 0.0806 0.0565 0.1014 0.0098  -0.0024 -0.0010 92  ASN A N   
984  C CA  A ASN A 66  ? 0.1033 0.0655 0.1103 0.0181  -0.0084 0.0075  92  ASN A CA  
985  C CA  B ASN A 66  ? 0.1123 0.0584 0.1136 0.0160  -0.0035 0.0049  92  ASN A CA  
986  C C   . ASN A 66  ? 0.1063 0.0643 0.1076 0.0268  -0.0032 -0.0023 92  ASN A C   
987  O O   . ASN A 66  ? 0.1224 0.0831 0.1062 0.0418  -0.0130 -0.0133 92  ASN A O   
988  C CB  A ASN A 66  ? 0.1202 0.0913 0.1263 0.0221  -0.0142 0.0249  92  ASN A CB  
989  C CB  B ASN A 66  ? 0.1396 0.0843 0.1372 0.0156  0.0100  0.0033  92  ASN A CB  
990  C CG  A ASN A 66  ? 0.1476 0.1215 0.1398 0.0224  -0.0221 0.0384  92  ASN A CG  
991  C CG  B ASN A 66  ? 0.1690 0.1113 0.1540 -0.0005 0.0318  0.0019  92  ASN A CG  
992  O OD1 A ASN A 66  ? 0.1558 0.1460 0.1522 0.0191  -0.0209 0.0494  92  ASN A OD1 
993  O OD1 B ASN A 66  ? 0.2069 0.1244 0.1499 -0.0302 0.0431  -0.0032 92  ASN A OD1 
994  N ND2 A ASN A 66  ? 0.1596 0.1309 0.1351 0.0279  -0.0390 0.0414  92  ASN A ND2 
995  N ND2 B ASN A 66  ? 0.1570 0.1220 0.1689 -0.0100 0.0270  -0.0039 92  ASN A ND2 
1008 N N   . GLN A 67  ? 0.0940 0.0694 0.1076 0.0254  -0.0030 -0.0105 93  GLN A N   
1009 C CA  . GLN A 67  ? 0.0938 0.0783 0.1174 0.0279  0.0032  -0.0074 93  GLN A CA  
1010 C C   . GLN A 67  ? 0.0886 0.0872 0.1240 0.0118  0.0137  -0.0222 93  GLN A C   
1011 O O   . GLN A 67  ? 0.0916 0.0838 0.1266 0.0206  0.0292  -0.0287 93  GLN A O   
1012 C CB  . GLN A 67  ? 0.0895 0.0919 0.1194 0.0296  0.0243  -0.0043 93  GLN A CB  
1013 C CG  . GLN A 67  ? 0.0919 0.1086 0.1468 0.0118  0.0188  -0.0090 93  GLN A CG  
1014 C CD  . GLN A 67  ? 0.0898 0.1365 0.1778 0.0159  0.0142  0.0258  93  GLN A CD  
1015 O OE1 . GLN A 67  ? 0.1216 0.1514 0.1759 0.0217  0.0216  0.0281  93  GLN A OE1 
1016 N NE2 . GLN A 67  ? 0.1021 0.1496 0.2074 0.0144  0.0141  0.0613  93  GLN A NE2 
1025 N N   . ARG A 68  ? 0.0933 0.1114 0.1262 0.0320  0.0003  -0.0328 94  ARG A N   
1026 C CA  . ARG A 68  ? 0.1080 0.1282 0.1321 0.0341  -0.0063 -0.0435 94  ARG A CA  
1027 C C   . ARG A 68  ? 0.0828 0.1349 0.1288 0.0098  0.0031  -0.0430 94  ARG A C   
1028 O O   . ARG A 68  ? 0.0964 0.1699 0.1462 0.0112  0.0091  -0.0524 94  ARG A O   
1029 C CB  . ARG A 68  ? 0.1793 0.1836 0.1496 0.0519  -0.0256 -0.0672 94  ARG A CB  
1030 C CG  . ARG A 68  ? 0.2629 0.2383 0.1840 0.0574  -0.0252 -0.0504 94  ARG A CG  
1031 C CD  . ARG A 68  ? 0.3482 0.3101 0.2335 0.0679  -0.0476 -0.0556 94  ARG A CD  
1032 N NE  . ARG A 68  ? 0.3926 0.3540 0.2628 0.0782  -0.0807 -0.0721 94  ARG A NE  
1033 C CZ  . ARG A 68  ? 0.4125 0.3891 0.2828 0.0829  -0.0799 -0.0859 94  ARG A CZ  
1034 N NH1 . ARG A 68  ? 0.4179 0.4311 0.2952 0.0835  -0.0941 -0.0989 94  ARG A NH1 
1035 N NH2 . ARG A 68  ? 0.4148 0.3588 0.2783 0.0844  -0.0780 -0.0778 94  ARG A NH2 
1049 N N   . VAL A 69  ? 0.0713 0.1243 0.1262 0.0162  0.0050  -0.0251 95  VAL A N   
1050 C CA  . VAL A 69  ? 0.0756 0.1165 0.1357 0.0213  -0.0063 -0.0186 95  VAL A CA  
1051 C C   . VAL A 69  ? 0.0656 0.1009 0.1361 0.0156  -0.0075 -0.0229 95  VAL A C   
1052 O O   . VAL A 69  ? 0.0809 0.1087 0.1343 0.0310  -0.0122 -0.0294 95  VAL A O   
1053 C CB  . VAL A 69  ? 0.0669 0.1208 0.1565 0.0151  0.0056  0.0047  95  VAL A CB  
1054 C CG1 . VAL A 69  ? 0.0710 0.1412 0.1551 0.0309  0.0010  -0.0047 95  VAL A CG1 
1055 C CG2 . VAL A 69  ? 0.0822 0.1364 0.1789 0.0115  0.0049  0.0074  95  VAL A CG2 
1065 N N   . GLU A 70  ? 0.0745 0.1015 0.1496 0.0228  -0.0044 -0.0207 96  GLU A N   
1066 C CA  A GLU A 70  ? 0.0721 0.0996 0.1559 0.0168  -0.0182 -0.0181 96  GLU A CA  
1067 C CA  B GLU A 70  ? 0.0774 0.0947 0.1476 0.0141  -0.0177 -0.0159 96  GLU A CA  
1068 C C   . GLU A 70  ? 0.0894 0.0987 0.1482 0.0296  -0.0198 -0.0120 96  GLU A C   
1069 O O   . GLU A 70  ? 0.1336 0.1054 0.1404 0.0437  -0.0018 -0.0212 96  GLU A O   
1070 C CB  A GLU A 70  ? 0.0629 0.1093 0.1670 0.0143  -0.0176 -0.0176 96  GLU A CB  
1071 C CB  B GLU A 70  ? 0.0784 0.0981 0.1408 0.0055  -0.0158 -0.0102 96  GLU A CB  
1072 C CG  A GLU A 70  ? 0.0670 0.1139 0.1813 0.0243  -0.0126 -0.0264 96  GLU A CG  
1073 C CG  B GLU A 70  ? 0.0904 0.0902 0.1348 -0.0062 -0.0120 -0.0194 96  GLU A CG  
1074 C CD  A GLU A 70  ? 0.0841 0.1237 0.1930 0.0423  -0.0207 -0.0311 96  GLU A CD  
1075 C CD  B GLU A 70  ? 0.1194 0.0919 0.1203 0.0106  -0.0258 -0.0354 96  GLU A CD  
1076 O OE1 A GLU A 70  ? 0.1024 0.1398 0.1885 0.0619  -0.0279 -0.0233 96  GLU A OE1 
1077 O OE1 B GLU A 70  ? 0.1780 0.1172 0.1094 0.0665  -0.0541 -0.0208 96  GLU A OE1 
1078 O OE2 A GLU A 70  ? 0.0947 0.1402 0.2070 0.0340  -0.0240 -0.0315 96  GLU A OE2 
1079 O OE2 B GLU A 70  ? 0.1092 0.0995 0.1255 0.0177  -0.0224 -0.0520 96  GLU A OE2 
1092 N N   . ILE A 71  ? 0.0965 0.0906 0.1515 0.0191  -0.0353 -0.0136 97  ILE A N   
1093 C CA  . ILE A 71  ? 0.1076 0.0911 0.1558 0.0258  -0.0411 -0.0198 97  ILE A CA  
1094 C C   . ILE A 71  ? 0.1183 0.1080 0.1937 0.0297  -0.0625 -0.0052 97  ILE A C   
1095 O O   . ILE A 71  ? 0.1148 0.1356 0.1963 0.0343  -0.0729 -0.0103 97  ILE A O   
1096 C CB  . ILE A 71  ? 0.1188 0.1110 0.1425 0.0420  -0.0452 -0.0171 97  ILE A CB  
1097 C CG1 . ILE A 71  ? 0.0971 0.1118 0.1489 0.0348  -0.0381 -0.0305 97  ILE A CG1 
1098 C CG2 . ILE A 71  ? 0.1442 0.1162 0.1435 0.0429  -0.0389 -0.0093 97  ILE A CG2 
1099 C CD1 . ILE A 71  ? 0.1070 0.1352 0.1554 0.0324  -0.0435 -0.0207 97  ILE A CD1 
1111 N N   . LYS A 72  ? 0.1320 0.1198 0.2441 0.0041  -0.0875 -0.0053 98  LYS A N   
1112 C CA  . LYS A 72  ? 0.1730 0.1488 0.2622 -0.0117 -0.0860 0.0033  98  LYS A CA  
1113 C C   . LYS A 72  ? 0.1694 0.1353 0.2489 -0.0164 -0.0947 0.0128  98  LYS A C   
1114 O O   . LYS A 72  ? 0.1654 0.1151 0.2388 0.0010  -0.1074 0.0039  98  LYS A O   
1115 C CB  . LYS A 72  ? 0.2187 0.2076 0.2899 -0.0026 -0.0748 -0.0076 98  LYS A CB  
1116 C CG  . LYS A 72  ? 0.2733 0.2763 0.3058 0.0230  -0.0625 -0.0154 98  LYS A CG  
1117 C CD  . LYS A 72  ? 0.3153 0.3255 0.3171 0.0361  -0.0528 -0.0179 98  LYS A CD  
1118 C CE  . LYS A 72  ? 0.3495 0.3767 0.3290 0.0622  -0.0533 -0.0089 98  LYS A CE  
1119 N NZ  . LYS A 72  ? 0.3673 0.3947 0.3357 0.0608  -0.0597 -0.0057 98  LYS A NZ  
1133 N N   . LYS A 73  ? 0.1804 0.1689 0.2444 -0.0186 -0.1090 0.0105  99  LYS A N   
1134 C CA  . LYS A 73  ? 0.2019 0.1945 0.2380 -0.0263 -0.1219 -0.0048 99  LYS A CA  
1135 C C   . LYS A 73  ? 0.1981 0.1760 0.2407 -0.0316 -0.1054 -0.0028 99  LYS A C   
1136 O O   . LYS A 73  ? 0.2021 0.1777 0.2345 -0.0202 -0.1080 0.0082  99  LYS A O   
1137 C CB  . LYS A 73  ? 0.2371 0.2359 0.2433 -0.0272 -0.1374 -0.0190 99  LYS A CB  
1138 C CG  . LYS A 73  ? 0.2736 0.2846 0.2563 -0.0129 -0.1289 -0.0150 99  LYS A CG  
1139 C CD  . LYS A 73  ? 0.3125 0.3286 0.2715 -0.0001 -0.1173 -0.0113 99  LYS A CD  
1140 C CE  . LYS A 73  ? 0.3423 0.3800 0.2878 0.0191  -0.1037 -0.0030 99  LYS A CE  
1141 N NZ  . LYS A 73  ? 0.3524 0.3991 0.2978 0.0141  -0.0996 -0.0024 99  LYS A NZ  
1155 N N   . SER A 74  ? 0.1981 0.1762 0.2529 -0.0505 -0.0864 -0.0079 100 SER A N   
1156 C CA  . SER A 74  ? 0.2245 0.1977 0.2600 -0.0371 -0.0425 0.0106  100 SER A CA  
1157 C C   . SER A 74  ? 0.2135 0.1595 0.2366 -0.0273 -0.0382 0.0226  100 SER A C   
1158 O O   . SER A 74  ? 0.2467 0.1587 0.2344 -0.0255 -0.0288 0.0488  100 SER A O   
1159 C CB  . SER A 74  ? 0.2518 0.2610 0.2878 -0.0266 -0.0109 0.0080  100 SER A CB  
1160 O OG  . SER A 74  ? 0.2665 0.3009 0.3070 -0.0227 0.0033  -0.0027 100 SER A OG  
1166 N N   . ASP A 75  ? 0.1650 0.1313 0.2183 -0.0405 -0.0497 0.0184  101 ASP A N   
1167 C CA  . ASP A 75  ? 0.1732 0.1350 0.1943 -0.0102 -0.0586 0.0196  101 ASP A CA  
1168 C C   . ASP A 75  ? 0.2013 0.1496 0.1737 0.0252  -0.0758 0.0223  101 ASP A C   
1169 O O   . ASP A 75  ? 0.2313 0.1802 0.1712 0.0547  -0.0794 0.0141  101 ASP A O   
1170 C CB  . ASP A 75  ? 0.1752 0.1267 0.1965 -0.0027 -0.0508 0.0005  101 ASP A CB  
1171 C CG  . ASP A 75  ? 0.1923 0.1403 0.1982 -0.0061 -0.0285 0.0066  101 ASP A CG  
1172 O OD1 . ASP A 75  ? 0.2414 0.1668 0.2039 0.0146  0.0109  0.0116  101 ASP A OD1 
1173 O OD2 . ASP A 75  ? 0.1952 0.1376 0.2033 0.0073  -0.0383 -0.0029 101 ASP A OD2 
1178 N N   . LEU A 76  ? 0.1840 0.1466 0.1722 0.0004  -0.0800 0.0237  102 LEU A N   
1179 C CA  . LEU A 76  ? 0.1632 0.1475 0.1744 -0.0075 -0.0687 0.0212  102 LEU A CA  
1180 C C   . LEU A 76  ? 0.1436 0.1302 0.1798 -0.0255 -0.0501 0.0277  102 LEU A C   
1181 O O   . LEU A 76  ? 0.1526 0.1386 0.2051 0.0000  -0.0473 0.0175  102 LEU A O   
1182 C CB  . LEU A 76  ? 0.1673 0.1482 0.1756 -0.0151 -0.0654 0.0180  102 LEU A CB  
1183 C CG  . LEU A 76  ? 0.1832 0.1508 0.1755 -0.0063 -0.0463 0.0271  102 LEU A CG  
1184 C CD1 . LEU A 76  ? 0.2154 0.1894 0.1778 0.0263  -0.0582 0.0295  102 LEU A CD1 
1185 C CD2 . LEU A 76  ? 0.1774 0.1382 0.1808 -0.0257 -0.0225 0.0456  102 LEU A CD2 
1197 N N   . VAL A 77  ? 0.1508 0.1378 0.1801 -0.0301 -0.0338 0.0330  103 VAL A N   
1198 C CA  . VAL A 77  ? 0.1699 0.1464 0.1956 -0.0337 -0.0439 0.0157  103 VAL A CA  
1199 C C   . VAL A 77  ? 0.2505 0.2049 0.2140 -0.0081 -0.0555 -0.0052 103 VAL A C   
1200 O O   . VAL A 77  ? 0.2781 0.2578 0.2249 0.0135  -0.0420 0.0263  103 VAL A O   
1201 C CB  . VAL A 77  ? 0.1489 0.1214 0.2014 -0.0245 -0.0475 0.0251  103 VAL A CB  
1202 C CG1 . VAL A 77  ? 0.1760 0.1489 0.2067 -0.0036 -0.0484 0.0368  103 VAL A CG1 
1203 C CG2 . VAL A 77  ? 0.1290 0.1358 0.2061 -0.0177 -0.0548 0.0210  103 VAL A CG2 
1213 N N   . ASN A 78  ? 0.2827 0.2329 0.2270 -0.0137 -0.0598 -0.0406 104 ASN A N   
1214 C CA  . ASN A 78  ? 0.3231 0.2543 0.2359 -0.0001 -0.0534 -0.0168 104 ASN A CA  
1215 C C   . ASN A 78  ? 0.3525 0.2525 0.2255 0.0014  -0.0405 0.0003  104 ASN A C   
1216 O O   . ASN A 78  ? 0.3910 0.2992 0.2377 0.0195  -0.0360 -0.0150 104 ASN A O   
1217 C CB  . ASN A 78  ? 0.3463 0.2654 0.2534 0.0219  -0.0450 -0.0139 104 ASN A CB  
1218 C CG  . ASN A 78  ? 0.3743 0.2813 0.2698 0.0384  -0.0251 -0.0054 104 ASN A CG  
1219 O OD1 . ASN A 78  ? 0.3647 0.2427 0.2698 0.0116  -0.0107 0.0078  104 ASN A OD1 
1220 N ND2 . ASN A 78  ? 0.4088 0.3238 0.2833 0.0698  -0.0196 -0.0112 104 ASN A ND2 
1227 N N   . TYR A 79  ? 0.3200 0.1458 0.1952 -0.0411 -0.0357 0.0037  105 TYR A N   
1228 C CA  . TYR A 79  ? 0.3458 0.1216 0.1464 0.0151  -0.0027 0.0199  105 TYR A CA  
1229 C C   . TYR A 79  ? 0.3267 0.0982 0.1172 0.0032  -0.0246 -0.0025 105 TYR A C   
1230 O O   . TYR A 79  ? 0.3814 0.1172 0.1305 0.0305  -0.0635 -0.0044 105 TYR A O   
1231 C CB  . TYR A 79  ? 0.3752 0.1410 0.1469 -0.0340 0.0221  -0.0129 105 TYR A CB  
1232 C CG  . TYR A 79  ? 0.4107 0.1680 0.1691 -0.0776 0.0479  -0.0399 105 TYR A CG  
1233 C CD1 . TYR A 79  ? 0.4354 0.1997 0.1816 -0.0979 0.0711  -0.0439 105 TYR A CD1 
1234 C CD2 . TYR A 79  ? 0.4132 0.1622 0.1793 -0.1052 0.0640  -0.0363 105 TYR A CD2 
1235 C CE1 . TYR A 79  ? 0.4500 0.2444 0.1951 -0.0961 0.0912  -0.0550 105 TYR A CE1 
1236 C CE2 . TYR A 79  ? 0.4291 0.1778 0.1904 -0.1124 0.0881  -0.0439 105 TYR A CE2 
1237 C CZ  . TYR A 79  ? 0.4550 0.2237 0.2004 -0.1119 0.1095  -0.0503 105 TYR A CZ  
1238 O OH  . TYR A 79  ? 0.4875 0.2554 0.2119 -0.1046 0.1275  -0.0461 105 TYR A OH  
1248 N N   . ASN A 80  ? 0.2408 0.1036 0.1118 -0.0255 -0.0018 0.0028  106 ASN A N   
1249 C CA  A ASN A 80  ? 0.2047 0.1282 0.1139 -0.0167 0.0144  0.0114  106 ASN A CA  
1250 C CA  B ASN A 80  ? 0.2148 0.1203 0.1155 -0.0134 0.0174  0.0115  106 ASN A CA  
1251 C C   . ASN A 80  ? 0.1799 0.1110 0.1055 -0.0066 0.0078  0.0137  106 ASN A C   
1252 O O   . ASN A 80  ? 0.1395 0.1178 0.1129 -0.0065 -0.0043 0.0011  106 ASN A O   
1253 C CB  A ASN A 80  ? 0.1881 0.1520 0.1154 -0.0373 0.0212  0.0043  106 ASN A CB  
1254 C CB  B ASN A 80  ? 0.2267 0.1438 0.1276 -0.0108 0.0411  0.0149  106 ASN A CB  
1255 C CG  A ASN A 80  ? 0.1652 0.1951 0.1124 -0.0333 0.0140  0.0015  106 ASN A CG  
1256 C CG  B ASN A 80  ? 0.2326 0.1690 0.1349 -0.0010 0.0541  0.0227  106 ASN A CG  
1257 O OD1 A ASN A 80  ? 0.1733 0.2218 0.1441 -0.0345 0.0356  0.0144  106 ASN A OD1 
1258 O OD1 B ASN A 80  ? 0.2366 0.1880 0.1380 -0.0088 0.0578  0.0291  106 ASN A OD1 
1259 N ND2 A ASN A 80  ? 0.1552 0.1876 0.0965 -0.0298 -0.0024 0.0247  106 ASN A ND2 
1260 N ND2 B ASN A 80  ? 0.2321 0.1666 0.1338 0.0116  0.0622  0.0279  106 ASN A ND2 
1273 N N   . PRO A 81  ? 0.1555 0.1223 0.1079 0.0066  0.0166  0.0379  107 PRO A N   
1274 C CA  . PRO A 81  ? 0.1552 0.1267 0.1157 0.0152  0.0232  0.0272  107 PRO A CA  
1275 C C   . PRO A 81  ? 0.1405 0.1189 0.1135 0.0160  0.0092  0.0336  107 PRO A C   
1276 O O   . PRO A 81  ? 0.1689 0.1316 0.1187 0.0239  -0.0058 0.0288  107 PRO A O   
1277 C CB  . PRO A 81  ? 0.1629 0.1591 0.1343 0.0297  0.0317  0.0286  107 PRO A CB  
1278 C CG  . PRO A 81  ? 0.1677 0.1638 0.1511 0.0308  0.0196  0.0359  107 PRO A CG  
1279 C CD  . PRO A 81  ? 0.1787 0.1399 0.1389 0.0496  0.0181  0.0474  107 PRO A CD  
1287 N N   . ILE A 82  ? 0.1227 0.1161 0.1135 0.0087  0.0080  0.0518  108 ILE A N   
1288 C CA  . ILE A 82  ? 0.1152 0.1131 0.1114 0.0154  -0.0058 0.0465  108 ILE A CA  
1289 C C   . ILE A 82  ? 0.1075 0.1134 0.1037 0.0247  -0.0169 0.0464  108 ILE A C   
1290 O O   . ILE A 82  ? 0.1008 0.1096 0.1098 0.0058  -0.0264 0.0404  108 ILE A O   
1291 C CB  . ILE A 82  ? 0.1132 0.1060 0.1069 0.0113  -0.0063 0.0522  108 ILE A CB  
1292 C CG1 . ILE A 82  ? 0.1126 0.1184 0.1141 0.0101  -0.0005 0.0442  108 ILE A CG1 
1293 C CG2 . ILE A 82  ? 0.1268 0.1165 0.1196 0.0231  -0.0164 0.0397  108 ILE A CG2 
1294 C CD1 . ILE A 82  ? 0.1106 0.1535 0.1201 0.0126  0.0059  0.0521  108 ILE A CD1 
1306 N N   . ALA A 83  ? 0.0960 0.1135 0.1104 0.0173  -0.0140 0.0355  109 ALA A N   
1307 C CA  . ALA A 83  ? 0.1037 0.0933 0.1135 0.0229  -0.0153 0.0360  109 ALA A CA  
1308 C C   . ALA A 83  ? 0.1198 0.0851 0.1188 0.0298  -0.0246 0.0423  109 ALA A C   
1309 O O   . ALA A 83  ? 0.1207 0.0971 0.1381 0.0327  -0.0086 0.0508  109 ALA A O   
1310 C CB  . ALA A 83  ? 0.1178 0.1114 0.1221 0.0299  -0.0028 0.0541  109 ALA A CB  
1316 N N   . GLU A 84  ? 0.1126 0.1137 0.1131 0.0134  -0.0369 0.0279  110 GLU A N   
1317 C CA  . GLU A 84  ? 0.1564 0.1480 0.1151 0.0215  -0.0451 0.0224  110 GLU A CA  
1318 C C   . GLU A 84  ? 0.1627 0.1317 0.1163 0.0119  -0.0479 0.0295  110 GLU A C   
1319 O O   . GLU A 84  ? 0.1822 0.1614 0.1321 0.0258  -0.0668 0.0367  110 GLU A O   
1320 C CB  . GLU A 84  ? 0.2052 0.1983 0.1442 0.0335  -0.0502 -0.0142 110 GLU A CB  
1321 C CG  . GLU A 84  ? 0.2628 0.2665 0.1917 0.0451  -0.0299 -0.0202 110 GLU A CG  
1322 C CD  . GLU A 84  ? 0.3408 0.3394 0.2362 0.0670  -0.0328 -0.0413 110 GLU A CD  
1323 O OE1 . GLU A 84  ? 0.3857 0.3759 0.2505 0.0933  -0.0413 -0.0394 110 GLU A OE1 
1324 O OE2 . GLU A 84  ? 0.3765 0.3600 0.2534 0.0924  -0.0286 -0.0549 110 GLU A OE2 
1331 N N   . LYS A 85  ? 0.1584 0.1190 0.1066 0.0108  -0.0324 0.0287  111 LYS A N   
1332 C CA  . LYS A 85  ? 0.1702 0.1293 0.1177 0.0053  -0.0387 0.0380  111 LYS A CA  
1333 C C   . LYS A 85  ? 0.1986 0.1245 0.1240 0.0333  -0.0553 0.0380  111 LYS A C   
1334 O O   . LYS A 85  ? 0.2549 0.1626 0.1484 0.0662  -0.0455 0.0480  111 LYS A O   
1335 C CB  . LYS A 85  ? 0.1769 0.1481 0.1310 0.0011  -0.0183 0.0467  111 LYS A CB  
1336 C CG  . LYS A 85  ? 0.1871 0.1666 0.1450 -0.0143 0.0157  0.0614  111 LYS A CG  
1337 C CD  . LYS A 85  ? 0.2152 0.1878 0.1578 -0.0179 0.0182  0.0509  111 LYS A CD  
1338 C CE  . LYS A 85  ? 0.2467 0.2197 0.1769 0.0026  0.0130  0.0535  111 LYS A CE  
1339 N NZ  . LYS A 85  ? 0.2750 0.2609 0.1833 0.0295  0.0112  0.0606  111 LYS A NZ  
1353 N N   . HIS A 86  ? 0.1765 0.1128 0.1132 0.0197  -0.0582 0.0112  112 HIS A N   
1354 C CA  . HIS A 86  ? 0.1606 0.1094 0.1270 0.0233  -0.0512 0.0301  112 HIS A CA  
1355 C C   . HIS A 86  ? 0.1681 0.1183 0.1260 0.0238  -0.0555 0.0272  112 HIS A C   
1356 O O   . HIS A 86  ? 0.1761 0.1246 0.1331 0.0310  -0.0801 0.0099  112 HIS A O   
1357 C CB  . HIS A 86  ? 0.1473 0.1102 0.1473 0.0089  -0.0428 0.0281  112 HIS A CB  
1358 C CG  . HIS A 86  ? 0.1717 0.1121 0.1684 -0.0122 -0.0416 0.0227  112 HIS A CG  
1359 N ND1 . HIS A 86  ? 0.2052 0.1419 0.1856 -0.0362 -0.0245 0.0255  112 HIS A ND1 
1360 C CD2 . HIS A 86  ? 0.1959 0.1580 0.1846 -0.0095 -0.0622 0.0337  112 HIS A CD2 
1361 C CE1 . HIS A 86  ? 0.2233 0.1698 0.1992 -0.0222 -0.0240 0.0259  112 HIS A CE1 
1362 N NE2 . HIS A 86  ? 0.2095 0.1527 0.1972 -0.0264 -0.0438 0.0437  112 HIS A NE2 
1370 N N   . VAL A 87  ? 0.1578 0.1430 0.1224 0.0103  -0.0434 0.0010  113 VAL A N   
1371 C CA  . VAL A 87  ? 0.1481 0.1554 0.1419 0.0236  -0.0391 -0.0006 113 VAL A CA  
1372 C C   . VAL A 87  ? 0.1368 0.1583 0.1516 0.0290  -0.0440 0.0009  113 VAL A C   
1373 O O   . VAL A 87  ? 0.1475 0.1643 0.1428 0.0496  -0.0415 -0.0008 113 VAL A O   
1374 C CB  . VAL A 87  ? 0.1544 0.1530 0.1529 0.0149  -0.0322 -0.0149 113 VAL A CB  
1375 C CG1 . VAL A 87  ? 0.1682 0.1916 0.1739 0.0223  -0.0285 -0.0296 113 VAL A CG1 
1376 C CG2 . VAL A 87  ? 0.1471 0.1437 0.1471 -0.0029 -0.0277 0.0040  113 VAL A CG2 
1386 N N   . ASN A 88  ? 0.1240 0.1426 0.1650 0.0310  -0.0335 -0.0017 114 ASN A N   
1387 C CA  . ASN A 88  ? 0.1257 0.1793 0.1908 0.0509  -0.0544 -0.0093 114 ASN A CA  
1388 C C   . ASN A 88  ? 0.1397 0.1576 0.1883 0.0626  -0.0667 -0.0141 114 ASN A C   
1389 O O   . ASN A 88  ? 0.1701 0.1677 0.2003 0.0849  -0.0559 -0.0156 114 ASN A O   
1390 C CB  . ASN A 88  ? 0.1438 0.2354 0.2191 0.0544  -0.0504 -0.0062 114 ASN A CB  
1391 C CG  . ASN A 88  ? 0.1885 0.2775 0.2506 0.0619  -0.0431 0.0074  114 ASN A CG  
1392 O OD1 . ASN A 88  ? 0.1868 0.2686 0.2788 0.0489  -0.0514 0.0309  114 ASN A OD1 
1393 N ND2 . ASN A 88  ? 0.2238 0.3097 0.2507 0.0781  -0.0247 -0.0069 114 ASN A ND2 
1400 N N   . GLY A 89  ? 0.1387 0.1387 0.1838 0.0537  -0.0754 -0.0160 115 GLY A N   
1401 C CA  . GLY A 89  ? 0.1434 0.1088 0.1962 0.0495  -0.0659 -0.0038 115 GLY A CA  
1402 C C   . GLY A 89  ? 0.1244 0.1046 0.1860 0.0487  -0.0517 0.0007  115 GLY A C   
1403 O O   . GLY A 89  ? 0.1297 0.1032 0.1980 0.0219  -0.0747 0.0068  115 GLY A O   
1407 N N   . THR A 90  ? 0.1094 0.1118 0.1642 0.0389  -0.0415 -0.0018 116 THR A N   
1408 C CA  . THR A 90  ? 0.1009 0.1014 0.1577 0.0312  -0.0355 -0.0125 116 THR A CA  
1409 C C   . THR A 90  ? 0.0941 0.0799 0.1305 0.0193  -0.0212 -0.0044 116 THR A C   
1410 O O   . THR A 90  ? 0.1189 0.1279 0.1217 0.0459  -0.0176 0.0030  116 THR A O   
1411 C CB  . THR A 90  ? 0.1164 0.1109 0.1727 0.0422  -0.0347 -0.0169 116 THR A CB  
1412 O OG1 . THR A 90  ? 0.1391 0.1191 0.1693 0.0459  -0.0302 -0.0205 116 THR A OG1 
1413 C CG2 . THR A 90  ? 0.1201 0.0935 0.1790 0.0410  -0.0279 -0.0409 116 THR A CG2 
1421 N N   . MET A 91  ? 0.0928 0.0837 0.1259 0.0345  -0.0305 -0.0240 117 MET A N   
1422 C CA  . MET A 91  ? 0.0887 0.0819 0.1251 0.0161  -0.0208 -0.0142 117 MET A CA  
1423 C C   . MET A 91  ? 0.0860 0.0822 0.1103 0.0172  -0.0030 -0.0104 117 MET A C   
1424 O O   . MET A 91  ? 0.0812 0.1054 0.1143 0.0230  0.0010  -0.0066 117 MET A O   
1425 C CB  . MET A 91  ? 0.0959 0.0794 0.1251 0.0209  -0.0226 -0.0109 117 MET A CB  
1426 C CG  . MET A 91  ? 0.1089 0.0936 0.1230 0.0243  -0.0243 -0.0138 117 MET A CG  
1427 S SD  . MET A 91  ? 0.1089 0.0909 0.1044 0.0246  -0.0180 -0.0166 117 MET A SD  
1428 C CE  . MET A 91  ? 0.1134 0.1014 0.1100 0.0347  -0.0037 0.0003  117 MET A CE  
1438 N N   . THR A 92  ? 0.0828 0.0758 0.0960 0.0199  -0.0080 -0.0016 118 THR A N   
1439 C CA  . THR A 92  ? 0.0726 0.0644 0.0910 0.0231  -0.0034 -0.0083 118 THR A CA  
1440 C C   . THR A 92  ? 0.0697 0.0617 0.0858 0.0184  0.0091  -0.0034 118 THR A C   
1441 O O   . THR A 92  ? 0.0676 0.0585 0.0798 0.0270  0.0124  -0.0141 118 THR A O   
1442 C CB  . THR A 92  ? 0.0839 0.0583 0.1001 0.0299  -0.0011 -0.0116 118 THR A CB  
1443 O OG1 . THR A 92  ? 0.0882 0.0618 0.1088 0.0038  0.0013  -0.0016 118 THR A OG1 
1444 C CG2 . THR A 92  ? 0.0882 0.0804 0.1134 0.0224  -0.0105 -0.0084 118 THR A CG2 
1452 N N   . LEU A 93  ? 0.0739 0.0613 0.0839 0.0135  0.0063  -0.0087 119 LEU A N   
1453 C CA  . LEU A 93  ? 0.0739 0.0556 0.0784 0.0105  0.0119  0.0060  119 LEU A CA  
1454 C C   . LEU A 93  ? 0.0711 0.0626 0.0732 0.0060  0.0219  0.0027  119 LEU A C   
1455 O O   . LEU A 93  ? 0.0793 0.0597 0.0758 0.0152  0.0167  -0.0004 119 LEU A O   
1456 C CB  . LEU A 93  ? 0.0734 0.0629 0.0715 0.0179  0.0080  0.0068  119 LEU A CB  
1457 C CG  . LEU A 93  ? 0.0818 0.0818 0.0750 0.0240  0.0034  0.0067  119 LEU A CG  
1458 C CD1 . LEU A 93  ? 0.0791 0.1000 0.0755 0.0175  0.0171  0.0037  119 LEU A CD1 
1459 C CD2 . LEU A 93  ? 0.0876 0.0884 0.0620 0.0138  0.0007  0.0053  119 LEU A CD2 
1471 N N   . ALA A 94  ? 0.0679 0.0599 0.0841 0.0120  0.0102  -0.0002 120 ALA A N   
1472 C CA  . ALA A 94  ? 0.0674 0.0783 0.0869 0.0106  0.0051  -0.0131 120 ALA A CA  
1473 C C   . ALA A 94  ? 0.0563 0.0646 0.0804 0.0069  -0.0002 -0.0096 120 ALA A C   
1474 O O   . ALA A 94  ? 0.0747 0.0672 0.0817 0.0091  0.0094  -0.0096 120 ALA A O   
1475 C CB  . ALA A 94  ? 0.0833 0.0872 0.0790 0.0120  0.0042  -0.0220 120 ALA A CB  
1481 N N   . GLU A 95  ? 0.0689 0.0618 0.0732 0.0057  0.0070  0.0048  121 GLU A N   
1482 C CA  . GLU A 95  ? 0.0762 0.0586 0.0695 0.0155  0.0035  0.0184  121 GLU A CA  
1483 C C   . GLU A 95  ? 0.0738 0.0552 0.0677 0.0021  -0.0054 0.0033  121 GLU A C   
1484 O O   . GLU A 95  ? 0.0952 0.0603 0.0597 0.0206  -0.0058 -0.0041 121 GLU A O   
1485 C CB  . GLU A 95  ? 0.1008 0.0709 0.0938 0.0082  -0.0097 0.0147  121 GLU A CB  
1486 C CG  . GLU A 95  ? 0.1136 0.0850 0.1243 0.0232  0.0093  0.0265  121 GLU A CG  
1487 C CD  . GLU A 95  ? 0.1549 0.0991 0.1521 0.0408  0.0104  0.0589  121 GLU A CD  
1488 O OE1 . GLU A 95  ? 0.1250 0.0910 0.1345 0.0375  0.0011  0.0375  121 GLU A OE1 
1489 O OE2 . GLU A 95  ? 0.2039 0.1466 0.2000 0.0405  0.0112  0.0932  121 GLU A OE2 
1496 N N   . LEU A 96  ? 0.0751 0.0494 0.0733 0.0185  -0.0031 -0.0003 122 LEU A N   
1497 C CA  . LEU A 96  ? 0.0637 0.0597 0.0759 0.0106  0.0016  0.0076  122 LEU A CA  
1498 C C   . LEU A 96  ? 0.0649 0.0536 0.0783 0.0057  0.0058  0.0091  122 LEU A C   
1499 O O   . LEU A 96  ? 0.0664 0.0477 0.0842 0.0126  0.0087  0.0003  122 LEU A O   
1500 C CB  . LEU A 96  ? 0.0575 0.0576 0.0873 0.0090  0.0150  0.0072  122 LEU A CB  
1501 C CG  . LEU A 96  ? 0.0477 0.0616 0.1202 0.0025  0.0023  0.0083  122 LEU A CG  
1502 C CD1 . LEU A 96  ? 0.0540 0.0854 0.1326 0.0171  0.0018  -0.0126 122 LEU A CD1 
1503 C CD2 . LEU A 96  ? 0.0590 0.0731 0.1322 0.0097  -0.0106 0.0174  122 LEU A CD2 
1515 N N   . GLY A 97  ? 0.0606 0.0608 0.0818 0.0072  0.0084  -0.0054 123 GLY A N   
1516 C CA  . GLY A 97  ? 0.0588 0.0581 0.0833 0.0111  -0.0008 0.0050  123 GLY A CA  
1517 C C   . GLY A 97  ? 0.0466 0.0551 0.0827 0.0032  0.0042  0.0040  123 GLY A C   
1518 O O   . GLY A 97  ? 0.0645 0.0574 0.0794 0.0153  0.0052  -0.0059 123 GLY A O   
1522 N N   . ALA A 98  ? 0.0614 0.0588 0.0771 0.0031  0.0038  -0.0003 124 ALA A N   
1523 C CA  . ALA A 98  ? 0.0834 0.0584 0.0919 0.0147  0.0285  0.0009  124 ALA A CA  
1524 C C   . ALA A 98  ? 0.0834 0.0587 0.0837 0.0164  0.0253  0.0071  124 ALA A C   
1525 O O   . ALA A 98  ? 0.0851 0.0497 0.0944 0.0141  0.0258  0.0183  124 ALA A O   
1526 C CB  . ALA A 98  ? 0.0907 0.0488 0.1003 0.0126  0.0209  0.0021  124 ALA A CB  
1532 N N   . ALA A 99  ? 0.0792 0.0515 0.0694 0.0112  0.0172  0.0043  125 ALA A N   
1533 C CA  . ALA A 99  ? 0.0811 0.0611 0.0662 -0.0005 -0.0036 0.0063  125 ALA A CA  
1534 C C   . ALA A 99  ? 0.0726 0.0661 0.0603 0.0146  0.0099  0.0018  125 ALA A C   
1535 O O   . ALA A 99  ? 0.0877 0.0545 0.0482 0.0117  0.0042  -0.0038 125 ALA A O   
1536 C CB  . ALA A 99  ? 0.0878 0.0622 0.0740 0.0166  -0.0124 -0.0044 125 ALA A CB  
1542 N N   . ALA A 100 ? 0.0666 0.0490 0.0549 0.0179  0.0069  -0.0124 126 ALA A N   
1543 C CA  . ALA A 100 ? 0.0744 0.0569 0.0575 0.0193  0.0073  -0.0062 126 ALA A CA  
1544 C C   . ALA A 100 ? 0.0775 0.0423 0.0550 0.0077  0.0048  -0.0035 126 ALA A C   
1545 O O   . ALA A 100 ? 0.0809 0.0507 0.0794 0.0035  -0.0053 -0.0182 126 ALA A O   
1546 C CB  . ALA A 100 ? 0.0705 0.0656 0.0666 0.0187  -0.0056 -0.0069 126 ALA A CB  
1552 N N   . LEU A 101 ? 0.0694 0.0443 0.0582 0.0001  -0.0043 -0.0041 127 LEU A N   
1553 C CA  . LEU A 101 ? 0.0744 0.0611 0.0511 0.0090  -0.0021 -0.0022 127 LEU A CA  
1554 C C   . LEU A 101 ? 0.0691 0.0586 0.0485 0.0076  -0.0083 0.0006  127 LEU A C   
1555 O O   . LEU A 101 ? 0.1010 0.0694 0.0515 0.0398  -0.0029 -0.0087 127 LEU A O   
1556 C CB  . LEU A 101 ? 0.0764 0.0664 0.0439 0.0000  0.0041  0.0079  127 LEU A CB  
1557 C CG  . LEU A 101 ? 0.1043 0.0771 0.0543 -0.0206 0.0012  -0.0042 127 LEU A CG  
1558 C CD1 . LEU A 101 ? 0.1085 0.1014 0.0470 -0.0342 0.0168  -0.0251 127 LEU A CD1 
1559 C CD2 . LEU A 101 ? 0.1302 0.0906 0.0662 -0.0126 -0.0001 0.0010  127 LEU A CD2 
1571 N N   . GLN A 102 ? 0.0869 0.0628 0.0463 0.0247  -0.0058 0.0047  128 GLN A N   
1572 C CA  . GLN A 102 ? 0.0825 0.0761 0.0445 0.0194  0.0060  0.0054  128 GLN A CA  
1573 C C   . GLN A 102 ? 0.0829 0.0705 0.0476 0.0178  0.0030  0.0029  128 GLN A C   
1574 O O   . GLN A 102 ? 0.0945 0.0808 0.0445 0.0276  0.0138  -0.0019 128 GLN A O   
1575 C CB  . GLN A 102 ? 0.0830 0.0799 0.0618 -0.0039 0.0016  0.0073  128 GLN A CB  
1576 C CG  . GLN A 102 ? 0.0990 0.0861 0.0795 -0.0130 -0.0127 0.0083  128 GLN A CG  
1577 C CD  . GLN A 102 ? 0.1615 0.0914 0.1135 -0.0200 -0.0340 0.0247  128 GLN A CD  
1578 O OE1 . GLN A 102 ? 0.2235 0.0982 0.1593 -0.0022 -0.0523 0.0365  128 GLN A OE1 
1579 N NE2 . GLN A 102 ? 0.1827 0.0823 0.1136 -0.0372 -0.0328 0.0266  128 GLN A NE2 
1588 N N   . TYR A 103 ? 0.0853 0.0676 0.0527 0.0189  0.0010  -0.0015 129 TYR A N   
1589 C CA  . TYR A 103 ? 0.0811 0.0716 0.0509 0.0104  -0.0030 -0.0023 129 TYR A CA  
1590 C C   . TYR A 103 ? 0.1006 0.0737 0.0536 0.0140  0.0023  0.0108  129 TYR A C   
1591 O O   . TYR A 103 ? 0.1288 0.0974 0.0704 -0.0103 -0.0140 0.0002  129 TYR A O   
1592 C CB  . TYR A 103 ? 0.0817 0.0867 0.0536 0.0169  0.0041  0.0050  129 TYR A CB  
1593 C CG  . TYR A 103 ? 0.1034 0.0830 0.0502 0.0329  0.0036  -0.0036 129 TYR A CG  
1594 C CD1 . TYR A 103 ? 0.1104 0.0694 0.0617 0.0324  0.0003  0.0033  129 TYR A CD1 
1595 C CD2 . TYR A 103 ? 0.1160 0.0818 0.0624 0.0198  -0.0058 -0.0028 129 TYR A CD2 
1596 C CE1 . TYR A 103 ? 0.1351 0.0822 0.0702 0.0228  0.0167  0.0160  129 TYR A CE1 
1597 C CE2 . TYR A 103 ? 0.1299 0.0731 0.0730 0.0106  -0.0021 -0.0043 129 TYR A CE2 
1598 C CZ  . TYR A 103 ? 0.1419 0.0705 0.0846 0.0107  0.0127  0.0149  129 TYR A CZ  
1599 O OH  . TYR A 103 ? 0.1739 0.0963 0.1010 0.0287  0.0329  0.0136  129 TYR A OH  
1609 N N   . SER A 104 ? 0.0958 0.0586 0.0480 0.0118  0.0034  0.0055  130 SER A N   
1610 C CA  . SER A 104 ? 0.1058 0.0573 0.0604 0.0207  -0.0082 -0.0010 130 SER A CA  
1611 C C   . SER A 104 ? 0.1014 0.0649 0.0705 0.0161  0.0007  0.0010  130 SER A C   
1612 O O   . SER A 104 ? 0.1056 0.0638 0.0894 0.0140  -0.0047 0.0033  130 SER A O   
1613 C CB  . SER A 104 ? 0.1007 0.0549 0.0719 0.0027  -0.0118 0.0002  130 SER A CB  
1614 O OG  . SER A 104 ? 0.0955 0.0573 0.0676 0.0168  -0.0155 -0.0025 130 SER A OG  
1620 N N   . ASP A 105 ? 0.0883 0.0700 0.0667 0.0146  -0.0067 0.0049  131 ASP A N   
1621 C CA  . ASP A 105 ? 0.0910 0.0700 0.0679 0.0132  -0.0024 0.0163  131 ASP A CA  
1622 C C   . ASP A 105 ? 0.0839 0.0650 0.0625 0.0051  -0.0018 0.0207  131 ASP A C   
1623 O O   . ASP A 105 ? 0.0775 0.0816 0.0670 -0.0024 -0.0004 0.0222  131 ASP A O   
1624 C CB  . ASP A 105 ? 0.0895 0.0745 0.0723 0.0092  0.0051  0.0284  131 ASP A CB  
1625 C CG  . ASP A 105 ? 0.0963 0.0800 0.0773 0.0298  0.0009  0.0319  131 ASP A CG  
1626 O OD1 . ASP A 105 ? 0.0918 0.1001 0.0689 0.0174  -0.0093 0.0215  131 ASP A OD1 
1627 O OD2 . ASP A 105 ? 0.1005 0.1129 0.0815 0.0282  0.0076  0.0432  131 ASP A OD2 
1632 N N   . ASN A 106 ? 0.0923 0.0806 0.0676 0.0010  -0.0145 0.0159  132 ASN A N   
1633 C CA  . ASN A 106 ? 0.0919 0.0783 0.0771 -0.0077 -0.0132 0.0107  132 ASN A CA  
1634 C C   . ASN A 106 ? 0.0952 0.0729 0.0722 -0.0016 -0.0136 -0.0003 132 ASN A C   
1635 O O   . ASN A 106 ? 0.0909 0.0820 0.0657 -0.0044 -0.0008 0.0099  132 ASN A O   
1636 C CB  . ASN A 106 ? 0.0921 0.0810 0.0874 -0.0118 -0.0123 -0.0079 132 ASN A CB  
1637 C CG  . ASN A 106 ? 0.1220 0.0887 0.1149 -0.0117 -0.0068 -0.0166 132 ASN A CG  
1638 O OD1 . ASN A 106 ? 0.1157 0.0911 0.1331 -0.0018 -0.0087 0.0073  132 ASN A OD1 
1639 N ND2 . ASN A 106 ? 0.1558 0.1235 0.1406 -0.0051 0.0050  -0.0305 132 ASN A ND2 
1646 N N   . THR A 107 ? 0.0885 0.0816 0.0662 0.0126  -0.0180 0.0108  133 THR A N   
1647 C CA  . THR A 107 ? 0.0749 0.0870 0.0849 0.0031  -0.0181 0.0051  133 THR A CA  
1648 C C   . THR A 107 ? 0.0673 0.0818 0.0861 0.0163  -0.0093 0.0096  133 THR A C   
1649 O O   . THR A 107 ? 0.0684 0.0866 0.0905 0.0063  0.0047  0.0173  133 THR A O   
1650 C CB  . THR A 107 ? 0.0847 0.1005 0.1091 0.0057  -0.0181 0.0114  133 THR A CB  
1651 O OG1 . THR A 107 ? 0.1011 0.1274 0.1379 0.0148  -0.0312 -0.0088 133 THR A OG1 
1652 C CG2 . THR A 107 ? 0.0839 0.1023 0.1129 0.0104  -0.0186 0.0218  133 THR A CG2 
1660 N N   . ALA A 108 ? 0.0637 0.0737 0.0825 0.0126  0.0007  0.0150  134 ALA A N   
1661 C CA  . ALA A 108 ? 0.0609 0.0670 0.0817 0.0078  0.0054  0.0110  134 ALA A CA  
1662 C C   . ALA A 108 ? 0.0695 0.0446 0.0797 0.0030  0.0087  0.0014  134 ALA A C   
1663 O O   . ALA A 108 ? 0.0721 0.0597 0.0798 0.0048  0.0065  0.0029  134 ALA A O   
1664 C CB  . ALA A 108 ? 0.0684 0.0673 0.0791 0.0034  -0.0031 0.0044  134 ALA A CB  
1670 N N   . MET A 109 ? 0.0673 0.0554 0.0725 0.0099  0.0019  0.0097  135 MET A N   
1671 C CA  . MET A 109 ? 0.0529 0.0635 0.0688 0.0019  -0.0103 -0.0038 135 MET A CA  
1672 C C   . MET A 109 ? 0.0649 0.0561 0.0802 0.0128  -0.0065 0.0036  135 MET A C   
1673 O O   . MET A 109 ? 0.0750 0.0518 0.0776 0.0106  0.0012  -0.0012 135 MET A O   
1674 C CB  . MET A 109 ? 0.0664 0.0626 0.0652 0.0032  0.0009  -0.0034 135 MET A CB  
1675 C CG  . MET A 109 ? 0.0672 0.0618 0.0638 0.0029  0.0059  0.0091  135 MET A CG  
1676 S SD  . MET A 109 ? 0.0619 0.0604 0.0646 0.0008  -0.0102 0.0049  135 MET A SD  
1677 C CE  . MET A 109 ? 0.0789 0.0599 0.0593 0.0117  -0.0132 0.0091  135 MET A CE  
1687 N N   . ASN A 110 ? 0.0557 0.0539 0.0847 0.0029  0.0004  0.0106  136 ASN A N   
1688 C CA  . ASN A 110 ? 0.0559 0.0643 0.0792 -0.0092 0.0041  0.0065  136 ASN A CA  
1689 C C   . ASN A 110 ? 0.0663 0.0672 0.0727 0.0124  0.0029  0.0028  136 ASN A C   
1690 O O   . ASN A 110 ? 0.0696 0.0794 0.0791 0.0003  0.0076  0.0057  136 ASN A O   
1691 C CB  . ASN A 110 ? 0.0640 0.0816 0.0846 -0.0003 -0.0017 0.0138  136 ASN A CB  
1692 C CG  . ASN A 110 ? 0.0732 0.0682 0.0936 -0.0095 -0.0076 0.0124  136 ASN A CG  
1693 O OD1 . ASN A 110 ? 0.0791 0.0721 0.0955 0.0064  -0.0090 0.0109  136 ASN A OD1 
1694 N ND2 . ASN A 110 ? 0.1029 0.0678 0.1030 0.0108  -0.0280 -0.0007 136 ASN A ND2 
1701 N N   . LYS A 111 ? 0.0786 0.0610 0.0801 0.0177  0.0121  0.0031  137 LYS A N   
1702 C CA  . LYS A 111 ? 0.0821 0.0690 0.0907 0.0259  0.0056  0.0175  137 LYS A CA  
1703 C C   . LYS A 111 ? 0.0794 0.0636 0.0871 0.0150  0.0128  0.0109  137 LYS A C   
1704 O O   . LYS A 111 ? 0.0843 0.0684 0.0833 0.0159  0.0203  0.0089  137 LYS A O   
1705 C CB  . LYS A 111 ? 0.0862 0.0744 0.1071 0.0371  0.0030  0.0248  137 LYS A CB  
1706 C CG  . LYS A 111 ? 0.1028 0.1168 0.1346 0.0544  -0.0117 0.0212  137 LYS A CG  
1707 C CD  . LYS A 111 ? 0.1099 0.1475 0.1654 0.0300  -0.0300 0.0074  137 LYS A CD  
1708 C CE  . LYS A 111 ? 0.1205 0.1990 0.1934 0.0561  -0.0283 -0.0213 137 LYS A CE  
1709 N NZ  . LYS A 111 ? 0.1091 0.2173 0.2188 0.0558  -0.0354 -0.0436 137 LYS A NZ  
1723 N N   . LEU A 112 ? 0.0808 0.0641 0.0795 0.0072  0.0140  0.0132  138 LEU A N   
1724 C CA  . LEU A 112 ? 0.0907 0.0580 0.0710 0.0056  0.0107  0.0075  138 LEU A CA  
1725 C C   . LEU A 112 ? 0.0816 0.0596 0.0699 -0.0028 0.0003  0.0006  138 LEU A C   
1726 O O   . LEU A 112 ? 0.0802 0.0650 0.0776 -0.0035 0.0059  0.0040  138 LEU A O   
1727 C CB  . LEU A 112 ? 0.0889 0.0663 0.0701 -0.0021 0.0123  0.0060  138 LEU A CB  
1728 C CG  . LEU A 112 ? 0.0848 0.0793 0.0746 -0.0114 0.0182  0.0126  138 LEU A CG  
1729 C CD1 . LEU A 112 ? 0.0898 0.0871 0.0760 -0.0042 0.0179  -0.0076 138 LEU A CD1 
1730 C CD2 . LEU A 112 ? 0.0968 0.0773 0.0908 -0.0073 0.0173  0.0265  138 LEU A CD2 
1742 N N   . ILE A 113 ? 0.0868 0.0632 0.0662 -0.0062 0.0032  -0.0020 139 ILE A N   
1743 C CA  . ILE A 113 ? 0.0986 0.0649 0.0756 0.0034  0.0108  0.0050  139 ILE A CA  
1744 C C   . ILE A 113 ? 0.1048 0.0704 0.0855 0.0075  0.0173  0.0115  139 ILE A C   
1745 O O   . ILE A 113 ? 0.1053 0.0755 0.0831 0.0017  0.0244  0.0138  139 ILE A O   
1746 C CB  . ILE A 113 ? 0.0907 0.0696 0.0750 -0.0063 0.0077  0.0103  139 ILE A CB  
1747 C CG1 . ILE A 113 ? 0.0931 0.0741 0.0717 0.0082  -0.0043 0.0158  139 ILE A CG1 
1748 C CG2 . ILE A 113 ? 0.1122 0.0662 0.0932 -0.0024 0.0253  0.0036  139 ILE A CG2 
1749 C CD1 . ILE A 113 ? 0.0878 0.0581 0.0824 -0.0033 -0.0006 0.0147  139 ILE A CD1 
1761 N N   . ALA A 114 ? 0.0899 0.0756 0.0838 0.0013  0.0238  0.0083  140 ALA A N   
1762 C CA  . ALA A 114 ? 0.0951 0.0822 0.0928 0.0044  0.0281  0.0061  140 ALA A CA  
1763 C C   . ALA A 114 ? 0.1157 0.0883 0.0876 0.0029  0.0214  -0.0003 140 ALA A C   
1764 O O   . ALA A 114 ? 0.1166 0.0929 0.0913 -0.0014 0.0343  -0.0043 140 ALA A O   
1765 C CB  . ALA A 114 ? 0.0953 0.1013 0.1063 0.0092  0.0198  -0.0048 140 ALA A CB  
1771 N N   . HIS A 115 ? 0.1071 0.0763 0.0872 -0.0109 0.0193  -0.0032 141 HIS A N   
1772 C CA  . HIS A 115 ? 0.0923 0.0861 0.0969 0.0013  0.0225  0.0028  141 HIS A CA  
1773 C C   . HIS A 115 ? 0.1024 0.0753 0.0916 0.0045  0.0247  0.0001  141 HIS A C   
1774 O O   . HIS A 115 ? 0.1081 0.0796 0.1006 0.0018  0.0326  -0.0015 141 HIS A O   
1775 C CB  . HIS A 115 ? 0.0916 0.0848 0.1078 -0.0009 0.0202  0.0127  141 HIS A CB  
1776 C CG  . HIS A 115 ? 0.0812 0.1038 0.1244 -0.0171 0.0351  0.0219  141 HIS A CG  
1777 N ND1 . HIS A 115 ? 0.1256 0.1169 0.1528 -0.0249 0.0583  -0.0057 141 HIS A ND1 
1778 C CD2 . HIS A 115 ? 0.1068 0.1449 0.1363 -0.0274 0.0305  0.0547  141 HIS A CD2 
1779 C CE1 . HIS A 115 ? 0.1732 0.1307 0.1593 -0.0291 0.0664  -0.0031 141 HIS A CE1 
1780 N NE2 . HIS A 115 ? 0.1760 0.1560 0.1506 -0.0507 0.0272  0.0338  141 HIS A NE2 
1788 N N   . LEU A 116 ? 0.1021 0.0852 0.0868 0.0085  0.0223  -0.0039 142 LEU A N   
1789 C CA  . LEU A 116 ? 0.1093 0.0858 0.0847 0.0074  0.0338  0.0091  142 LEU A CA  
1790 C C   . LEU A 116 ? 0.1190 0.1089 0.0868 0.0065  0.0246  0.0110  142 LEU A C   
1791 O O   . LEU A 116 ? 0.1363 0.1469 0.0942 -0.0095 0.0158  0.0216  142 LEU A O   
1792 C CB  . LEU A 116 ? 0.0958 0.0733 0.0813 -0.0100 0.0190  0.0059  142 LEU A CB  
1793 C CG  . LEU A 116 ? 0.0943 0.0647 0.0872 0.0007  0.0148  -0.0012 142 LEU A CG  
1794 C CD1 . LEU A 116 ? 0.0844 0.0796 0.0940 0.0026  0.0062  -0.0026 142 LEU A CD1 
1795 C CD2 . LEU A 116 ? 0.0953 0.0887 0.0886 -0.0150 0.0100  -0.0092 142 LEU A CD2 
1807 N N   . GLY A 117 ? 0.1008 0.0925 0.0806 -0.0067 0.0226  0.0126  143 GLY A N   
1808 C CA  . GLY A 117 ? 0.0934 0.1122 0.0893 -0.0119 0.0353  0.0178  143 GLY A CA  
1809 C C   . GLY A 117 ? 0.0876 0.1036 0.0914 -0.0269 0.0334  0.0197  143 GLY A C   
1810 O O   . GLY A 117 ? 0.1222 0.1162 0.1139 -0.0220 0.0374  0.0266  143 GLY A O   
1814 N N   . GLY A 118 ? 0.0893 0.0992 0.0831 -0.0220 0.0240  0.0109  144 GLY A N   
1815 C CA  . GLY A 118 ? 0.0863 0.1049 0.0774 -0.0161 0.0166  0.0097  144 GLY A CA  
1816 C C   . GLY A 118 ? 0.0784 0.0973 0.0631 -0.0127 0.0100  0.0128  144 GLY A C   
1817 O O   . GLY A 118 ? 0.0812 0.0822 0.0640 -0.0175 0.0018  0.0054  144 GLY A O   
1821 N N   . PRO A 119 ? 0.0723 0.0915 0.0681 -0.0208 0.0092  0.0131  145 PRO A N   
1822 C CA  . PRO A 119 ? 0.0713 0.0837 0.0727 -0.0177 -0.0035 -0.0016 145 PRO A CA  
1823 C C   . PRO A 119 ? 0.0720 0.0813 0.0672 -0.0175 -0.0008 -0.0036 145 PRO A C   
1824 O O   . PRO A 119 ? 0.0928 0.0790 0.0693 -0.0140 -0.0083 -0.0122 145 PRO A O   
1825 C CB  . PRO A 119 ? 0.0882 0.0968 0.0787 -0.0057 -0.0042 0.0045  145 PRO A CB  
1826 C CG  . PRO A 119 ? 0.1062 0.1039 0.1033 -0.0085 -0.0104 0.0037  145 PRO A CG  
1827 C CD  . PRO A 119 ? 0.0765 0.0934 0.0859 -0.0310 0.0004  0.0136  145 PRO A CD  
1835 N N   . ASP A 120 ? 0.0694 0.0867 0.0553 -0.0085 0.0050  0.0049  146 ASP A N   
1836 C CA  . ASP A 120 ? 0.0834 0.0965 0.0652 -0.0268 0.0140  0.0116  146 ASP A CA  
1837 C C   . ASP A 120 ? 0.0762 0.1009 0.0661 -0.0083 0.0114  0.0012  146 ASP A C   
1838 O O   . ASP A 120 ? 0.0790 0.0993 0.0497 -0.0102 0.0064  0.0034  146 ASP A O   
1839 C CB  . ASP A 120 ? 0.1220 0.1466 0.0900 -0.0522 0.0051  0.0145  146 ASP A CB  
1840 C CG  . ASP A 120 ? 0.1887 0.2682 0.1260 -0.0257 0.0224  0.0068  146 ASP A CG  
1841 O OD1 . ASP A 120 ? 0.2258 0.3238 0.1436 0.0082  0.0376  0.0365  146 ASP A OD1 
1842 O OD2 . ASP A 120 ? 0.2477 0.3517 0.1673 0.0303  0.0132  -0.0110 146 ASP A OD2 
1847 N N   . LYS A 121 ? 0.0722 0.0981 0.0755 -0.0032 -0.0001 -0.0023 147 LYS A N   
1848 C CA  . LYS A 121 ? 0.0834 0.0811 0.0691 -0.0050 -0.0072 -0.0078 147 LYS A CA  
1849 C C   . LYS A 121 ? 0.0877 0.0728 0.0568 0.0026  -0.0044 0.0048  147 LYS A C   
1850 O O   . LYS A 121 ? 0.0838 0.0799 0.0569 -0.0112 0.0057  -0.0170 147 LYS A O   
1851 C CB  . LYS A 121 ? 0.0966 0.1161 0.1015 0.0161  -0.0001 -0.0051 147 LYS A CB  
1852 C CG  . LYS A 121 ? 0.1146 0.1611 0.1287 0.0295  0.0142  -0.0029 147 LYS A CG  
1853 C CD  . LYS A 121 ? 0.1461 0.2745 0.1493 0.0632  0.0281  -0.0032 147 LYS A CD  
1854 C CE  . LYS A 121 ? 0.1941 0.3184 0.1668 0.0586  0.0300  0.0040  147 LYS A CE  
1855 N NZ  . LYS A 121 ? 0.2498 0.3622 0.1803 0.0947  0.0313  0.0176  147 LYS A NZ  
1869 N N   . VAL A 122 ? 0.0773 0.0631 0.0550 -0.0080 -0.0072 -0.0005 148 VAL A N   
1870 C CA  . VAL A 122 ? 0.0755 0.0659 0.0528 -0.0172 0.0058  -0.0015 148 VAL A CA  
1871 C C   . VAL A 122 ? 0.0763 0.0705 0.0497 -0.0274 0.0147  -0.0049 148 VAL A C   
1872 O O   . VAL A 122 ? 0.0879 0.0781 0.0458 -0.0171 0.0079  -0.0074 148 VAL A O   
1873 C CB  . VAL A 122 ? 0.0857 0.0700 0.0473 -0.0014 0.0001  0.0051  148 VAL A CB  
1874 C CG1 . VAL A 122 ? 0.0936 0.0767 0.0422 -0.0061 -0.0048 0.0068  148 VAL A CG1 
1875 C CG2 . VAL A 122 ? 0.0869 0.0839 0.0563 0.0007  -0.0052 0.0039  148 VAL A CG2 
1885 N N   . THR A 123 ? 0.0718 0.0757 0.0480 -0.0231 0.0003  0.0006  149 THR A N   
1886 C CA  . THR A 123 ? 0.0752 0.0681 0.0603 -0.0152 -0.0099 -0.0006 149 THR A CA  
1887 C C   . THR A 123 ? 0.0850 0.0556 0.0516 -0.0230 0.0015  -0.0012 149 THR A C   
1888 O O   . THR A 123 ? 0.0893 0.0598 0.0423 -0.0133 -0.0034 -0.0010 149 THR A O   
1889 C CB  . THR A 123 ? 0.0783 0.0576 0.0729 -0.0300 -0.0022 -0.0033 149 THR A CB  
1890 O OG1 . THR A 123 ? 0.0852 0.0569 0.0804 -0.0290 -0.0025 -0.0023 149 THR A OG1 
1891 C CG2 . THR A 123 ? 0.1005 0.0675 0.0615 -0.0264 0.0052  -0.0025 149 THR A CG2 
1899 N N   . ALA A 124 ? 0.0726 0.0707 0.0505 -0.0106 0.0058  -0.0021 150 ALA A N   
1900 C CA  . ALA A 124 ? 0.0798 0.0822 0.0502 -0.0243 0.0074  -0.0116 150 ALA A CA  
1901 C C   . ALA A 124 ? 0.0817 0.0692 0.0472 -0.0109 0.0068  -0.0109 150 ALA A C   
1902 O O   . ALA A 124 ? 0.0871 0.0696 0.0465 -0.0168 0.0049  -0.0139 150 ALA A O   
1903 C CB  . ALA A 124 ? 0.0938 0.0970 0.0490 -0.0156 0.0150  -0.0120 150 ALA A CB  
1909 N N   . PHE A 125 ? 0.0704 0.0624 0.0542 -0.0069 0.0030  0.0018  151 PHE A N   
1910 C CA  . PHE A 125 ? 0.0817 0.0604 0.0476 -0.0164 -0.0031 -0.0168 151 PHE A CA  
1911 C C   . PHE A 125 ? 0.0727 0.0553 0.0464 -0.0196 0.0035  -0.0051 151 PHE A C   
1912 O O   . PHE A 125 ? 0.0799 0.0670 0.0407 -0.0217 0.0003  -0.0092 151 PHE A O   
1913 C CB  . PHE A 125 ? 0.0914 0.0586 0.0488 -0.0060 -0.0083 -0.0044 151 PHE A CB  
1914 C CG  . PHE A 125 ? 0.0822 0.0597 0.0523 -0.0110 -0.0048 0.0054  151 PHE A CG  
1915 C CD1 . PHE A 125 ? 0.0740 0.0632 0.0546 -0.0081 -0.0061 0.0104  151 PHE A CD1 
1916 C CD2 . PHE A 125 ? 0.0874 0.0775 0.0590 -0.0073 -0.0057 -0.0032 151 PHE A CD2 
1917 C CE1 . PHE A 125 ? 0.0938 0.0755 0.0600 -0.0031 -0.0006 -0.0136 151 PHE A CE1 
1918 C CE2 . PHE A 125 ? 0.0927 0.0868 0.0587 0.0000  -0.0040 -0.0095 151 PHE A CE2 
1919 C CZ  . PHE A 125 ? 0.0976 0.0679 0.0611 -0.0061 0.0004  0.0043  151 PHE A CZ  
1929 N N   . ALA A 126 ? 0.0696 0.0576 0.0525 -0.0170 -0.0063 -0.0077 152 ALA A N   
1930 C CA  . ALA A 126 ? 0.0743 0.0642 0.0528 -0.0111 -0.0017 -0.0133 152 ALA A CA  
1931 C C   . ALA A 126 ? 0.0721 0.0570 0.0441 -0.0174 0.0083  -0.0006 152 ALA A C   
1932 O O   . ALA A 126 ? 0.0744 0.0651 0.0483 -0.0102 -0.0078 -0.0034 152 ALA A O   
1933 C CB  . ALA A 126 ? 0.0868 0.0549 0.0584 -0.0095 -0.0175 -0.0204 152 ALA A CB  
1939 N N   . ARG A 127 ? 0.0832 0.0629 0.0520 -0.0207 0.0019  0.0048  153 ARG A N   
1940 C CA  A ARG A 127 ? 0.0912 0.0752 0.0560 -0.0060 0.0026  0.0085  153 ARG A CA  
1941 C CA  B ARG A 127 ? 0.0918 0.0696 0.0565 -0.0089 0.0008  0.0041  153 ARG A CA  
1942 C C   . ARG A 127 ? 0.0979 0.0763 0.0498 -0.0145 0.0004  -0.0009 153 ARG A C   
1943 O O   . ARG A 127 ? 0.1014 0.0840 0.0468 -0.0112 -0.0082 0.0050  153 ARG A O   
1944 C CB  A ARG A 127 ? 0.0948 0.0827 0.0670 0.0004  0.0083  0.0196  153 ARG A CB  
1945 C CB  B ARG A 127 ? 0.0959 0.0662 0.0692 -0.0036 0.0020  0.0066  153 ARG A CB  
1946 C CG  A ARG A 127 ? 0.0976 0.0839 0.0728 -0.0173 0.0106  0.0115  153 ARG A CG  
1947 C CG  B ARG A 127 ? 0.1009 0.0755 0.0793 -0.0096 0.0050  -0.0070 153 ARG A CG  
1948 C CD  A ARG A 127 ? 0.1213 0.0821 0.0711 -0.0122 0.0064  0.0047  153 ARG A CD  
1949 C CD  B ARG A 127 ? 0.1071 0.0770 0.0883 -0.0122 0.0070  -0.0087 153 ARG A CD  
1950 N NE  A ARG A 127 ? 0.1194 0.0829 0.0709 -0.0290 0.0008  0.0057  153 ARG A NE  
1951 N NE  B ARG A 127 ? 0.1016 0.0877 0.0953 -0.0357 0.0117  -0.0117 153 ARG A NE  
1952 C CZ  A ARG A 127 ? 0.1077 0.0945 0.0584 -0.0158 -0.0148 -0.0142 153 ARG A CZ  
1953 C CZ  B ARG A 127 ? 0.1317 0.0809 0.1014 -0.0298 -0.0152 -0.0217 153 ARG A CZ  
1954 N NH1 A ARG A 127 ? 0.0529 0.0779 0.0337 -0.0294 0.0024  -0.0159 153 ARG A NH1 
1955 N NH1 B ARG A 127 ? 0.1131 0.0841 0.0833 -0.0565 0.0141  -0.0089 153 ARG A NH1 
1956 N NH2 A ARG A 127 ? 0.1235 0.0766 0.0690 -0.0298 -0.0167 -0.0091 153 ARG A NH2 
1957 N NH2 B ARG A 127 ? 0.1654 0.0863 0.1233 -0.0105 -0.0401 -0.0257 153 ARG A NH2 
1984 N N   . SER A 128 ? 0.0941 0.0780 0.0449 -0.0229 0.0059  -0.0120 154 SER A N   
1985 C CA  . SER A 128 ? 0.0951 0.0887 0.0548 -0.0168 0.0042  -0.0077 154 SER A CA  
1986 C C   . SER A 128 ? 0.0931 0.0848 0.0571 -0.0147 -0.0040 -0.0065 154 SER A C   
1987 O O   . SER A 128 ? 0.1071 0.0876 0.0735 -0.0213 -0.0201 -0.0189 154 SER A O   
1988 C CB  . SER A 128 ? 0.1084 0.0825 0.0546 -0.0076 0.0083  -0.0165 154 SER A CB  
1989 O OG  . SER A 128 ? 0.1202 0.0653 0.0649 -0.0166 -0.0006 -0.0198 154 SER A OG  
1995 N N   . LEU A 129 ? 0.0958 0.0774 0.0516 -0.0136 -0.0043 -0.0122 155 LEU A N   
1996 C CA  . LEU A 129 ? 0.0955 0.0784 0.0675 -0.0136 -0.0018 -0.0019 155 LEU A CA  
1997 C C   . LEU A 129 ? 0.0901 0.1075 0.0732 -0.0077 -0.0057 0.0004  155 LEU A C   
1998 O O   . LEU A 129 ? 0.0981 0.1242 0.0820 0.0024  -0.0045 0.0069  155 LEU A O   
1999 C CB  . LEU A 129 ? 0.0969 0.0717 0.0839 -0.0147 0.0131  0.0060  155 LEU A CB  
2000 C CG  . LEU A 129 ? 0.0961 0.0883 0.0888 -0.0120 0.0124  0.0087  155 LEU A CG  
2001 C CD1 . LEU A 129 ? 0.0798 0.0993 0.0828 -0.0046 0.0114  0.0227  155 LEU A CD1 
2002 C CD2 . LEU A 129 ? 0.1132 0.0796 0.0950 -0.0115 0.0100  0.0040  155 LEU A CD2 
2014 N N   . GLY A 130 ? 0.0868 0.0970 0.0765 -0.0120 -0.0150 -0.0074 156 GLY A N   
2015 C CA  . GLY A 130 ? 0.1097 0.1063 0.0806 0.0039  -0.0268 -0.0097 156 GLY A CA  
2016 C C   . GLY A 130 ? 0.1023 0.0994 0.0829 -0.0060 -0.0320 -0.0061 156 GLY A C   
2017 O O   . GLY A 130 ? 0.1271 0.1128 0.0994 0.0075  -0.0415 -0.0060 156 GLY A O   
2021 N N   . ASP A 131 ? 0.0981 0.0840 0.0746 -0.0096 -0.0144 0.0028  157 ASP A N   
2022 C CA  . ASP A 131 ? 0.0906 0.0690 0.0753 -0.0173 -0.0134 -0.0083 157 ASP A CA  
2023 C C   . ASP A 131 ? 0.1169 0.0921 0.0856 -0.0183 -0.0029 -0.0076 157 ASP A C   
2024 O O   . ASP A 131 ? 0.1228 0.1074 0.0827 -0.0312 0.0228  -0.0223 157 ASP A O   
2025 C CB  . ASP A 131 ? 0.0997 0.0744 0.0630 -0.0033 0.0057  -0.0165 157 ASP A CB  
2026 C CG  . ASP A 131 ? 0.0795 0.0663 0.0666 -0.0227 0.0070  -0.0037 157 ASP A CG  
2027 O OD1 . ASP A 131 ? 0.0829 0.0617 0.0790 -0.0127 0.0005  0.0086  157 ASP A OD1 
2028 O OD2 . ASP A 131 ? 0.0925 0.0723 0.0672 -0.0299 0.0043  -0.0088 157 ASP A OD2 
2033 N N   . GLU A 132 ? 0.1395 0.1094 0.0994 -0.0344 -0.0312 0.0266  158 GLU A N   
2034 C CA  . GLU A 132 ? 0.1914 0.1326 0.1080 -0.0560 -0.0471 0.0430  158 GLU A CA  
2035 C C   . GLU A 132 ? 0.1840 0.1230 0.0965 -0.0610 -0.0251 0.0427  158 GLU A C   
2036 O O   . GLU A 132 ? 0.2265 0.1473 0.1045 -0.0778 -0.0098 0.0411  158 GLU A O   
2037 C CB  . GLU A 132 ? 0.2375 0.1987 0.1331 -0.0556 -0.0647 0.0520  158 GLU A CB  
2038 C CG  . GLU A 132 ? 0.2605 0.2726 0.1593 -0.0299 -0.0503 0.0732  158 GLU A CG  
2039 C CD  . GLU A 132 ? 0.2805 0.3303 0.1908 0.0079  -0.0313 0.0941  158 GLU A CD  
2040 O OE1 . GLU A 132 ? 0.2970 0.3533 0.2013 0.0486  -0.0193 0.0920  158 GLU A OE1 
2041 O OE2 . GLU A 132 ? 0.2854 0.3765 0.2123 0.0260  -0.0293 0.0922  158 GLU A OE2 
2048 N N   . THR A 133 ? 0.1304 0.1095 0.0829 -0.0372 -0.0240 0.0317  159 THR A N   
2049 C CA  . THR A 133 ? 0.1202 0.0925 0.0903 -0.0081 -0.0112 0.0304  159 THR A CA  
2050 C C   . THR A 133 ? 0.1073 0.0735 0.0715 -0.0181 -0.0042 0.0158  159 THR A C   
2051 O O   . THR A 133 ? 0.1067 0.0728 0.0828 -0.0279 -0.0007 0.0206  159 THR A O   
2052 C CB  . THR A 133 ? 0.1390 0.1017 0.1245 -0.0093 -0.0371 0.0321  159 THR A CB  
2053 O OG1 . THR A 133 ? 0.1562 0.1575 0.1342 0.0150  -0.0410 0.0157  159 THR A OG1 
2054 C CG2 . THR A 133 ? 0.1663 0.0845 0.1326 -0.0145 -0.0541 0.0222  159 THR A CG2 
2062 N N   . PHE A 134 ? 0.0870 0.0674 0.0617 -0.0234 -0.0043 0.0094  160 PHE A N   
2063 C CA  . PHE A 134 ? 0.0868 0.0572 0.0579 -0.0182 -0.0026 0.0028  160 PHE A CA  
2064 C C   . PHE A 134 ? 0.0843 0.0504 0.0453 -0.0173 -0.0011 -0.0039 160 PHE A C   
2065 O O   . PHE A 134 ? 0.0918 0.0753 0.0534 -0.0245 -0.0010 -0.0038 160 PHE A O   
2066 C CB  . PHE A 134 ? 0.0821 0.0498 0.0562 -0.0253 0.0008  -0.0022 160 PHE A CB  
2067 C CG  . PHE A 134 ? 0.0764 0.0486 0.0552 -0.0240 -0.0027 -0.0014 160 PHE A CG  
2068 C CD1 . PHE A 134 ? 0.0865 0.0518 0.0542 -0.0256 0.0019  -0.0072 160 PHE A CD1 
2069 C CD2 . PHE A 134 ? 0.0865 0.0547 0.0559 -0.0126 0.0042  -0.0012 160 PHE A CD2 
2070 C CE1 . PHE A 134 ? 0.0826 0.0541 0.0539 -0.0142 0.0055  -0.0125 160 PHE A CE1 
2071 C CE2 . PHE A 134 ? 0.0808 0.0518 0.0517 -0.0097 -0.0008 -0.0089 160 PHE A CE2 
2072 C CZ  . PHE A 134 ? 0.0825 0.0475 0.0559 -0.0112 -0.0079 -0.0062 160 PHE A CZ  
2082 N N   . ARG A 135 ? 0.0931 0.0531 0.0479 -0.0126 0.0024  0.0000  161 ARG A N   
2083 C CA  . ARG A 135 ? 0.0842 0.0557 0.0509 -0.0189 0.0013  0.0057  161 ARG A CA  
2084 C C   . ARG A 135 ? 0.0906 0.0482 0.0585 -0.0219 0.0002  -0.0008 161 ARG A C   
2085 O O   . ARG A 135 ? 0.0872 0.0625 0.0589 -0.0014 -0.0014 0.0054  161 ARG A O   
2086 C CB  . ARG A 135 ? 0.0859 0.0615 0.0671 -0.0166 0.0032  0.0147  161 ARG A CB  
2087 C CG  . ARG A 135 ? 0.0925 0.0633 0.0674 -0.0080 0.0079  0.0127  161 ARG A CG  
2088 C CD  . ARG A 135 ? 0.1078 0.0565 0.0573 -0.0222 0.0078  0.0072  161 ARG A CD  
2089 N NE  . ARG A 135 ? 0.1087 0.0577 0.0633 -0.0298 0.0041  0.0085  161 ARG A NE  
2090 C CZ  . ARG A 135 ? 0.1052 0.0719 0.0664 -0.0368 -0.0026 0.0061  161 ARG A CZ  
2091 N NH1 . ARG A 135 ? 0.1202 0.0763 0.0604 -0.0223 0.0029  0.0188  161 ARG A NH1 
2092 N NH2 . ARG A 135 ? 0.1140 0.0722 0.0935 -0.0403 -0.0039 0.0252  161 ARG A NH2 
2106 N N   . LEU A 136 ? 0.0984 0.0505 0.0523 -0.0199 0.0024  -0.0107 162 LEU A N   
2107 C CA  . LEU A 136 ? 0.0947 0.0488 0.0503 -0.0224 0.0062  -0.0023 162 LEU A CA  
2108 C C   . LEU A 136 ? 0.0945 0.0609 0.0666 -0.0110 -0.0023 -0.0033 162 LEU A C   
2109 O O   . LEU A 136 ? 0.1047 0.0934 0.0788 -0.0209 -0.0009 -0.0206 162 LEU A O   
2110 C CB  . LEU A 136 ? 0.0918 0.0633 0.0534 -0.0183 0.0134  0.0007  162 LEU A CB  
2111 C CG  . LEU A 136 ? 0.0947 0.0566 0.0533 -0.0273 0.0098  0.0077  162 LEU A CG  
2112 C CD1 . LEU A 136 ? 0.1503 0.0636 0.0534 -0.0217 0.0184  -0.0070 162 LEU A CD1 
2113 C CD2 . LEU A 136 ? 0.0832 0.0825 0.0527 -0.0075 -0.0052 0.0044  162 LEU A CD2 
2125 N N   . ASP A 137 ? 0.0808 0.0508 0.0669 -0.0233 -0.0002 0.0028  163 ASP A N   
2126 C CA  . ASP A 137 ? 0.0759 0.0560 0.0684 -0.0304 0.0086  -0.0016 163 ASP A CA  
2127 C C   . ASP A 137 ? 0.0739 0.0589 0.0628 -0.0153 0.0174  -0.0074 163 ASP A C   
2128 O O   . ASP A 137 ? 0.0962 0.0932 0.0708 -0.0113 0.0202  -0.0028 163 ASP A O   
2129 C CB  . ASP A 137 ? 0.0810 0.0705 0.0901 -0.0295 0.0129  0.0056  163 ASP A CB  
2130 C CG  . ASP A 137 ? 0.1028 0.0918 0.0960 -0.0250 0.0161  0.0212  163 ASP A CG  
2131 O OD1 . ASP A 137 ? 0.1159 0.1698 0.1152 -0.0029 0.0290  0.0629  163 ASP A OD1 
2132 O OD2 . ASP A 137 ? 0.0940 0.0636 0.0719 -0.0219 0.0051  0.0052  163 ASP A OD2 
2137 N N   . ARG A 138 ? 0.0762 0.0608 0.0683 -0.0054 0.0098  0.0007  164 ARG A N   
2138 C CA  . ARG A 138 ? 0.0749 0.0577 0.0843 -0.0059 0.0031  0.0037  164 ARG A CA  
2139 C C   . ARG A 138 ? 0.0808 0.0494 0.0922 -0.0002 0.0015  -0.0001 164 ARG A C   
2140 O O   . ARG A 138 ? 0.0878 0.0676 0.0911 -0.0153 0.0012  -0.0032 164 ARG A O   
2141 C CB  . ARG A 138 ? 0.0763 0.0609 0.0950 -0.0124 0.0033  0.0019  164 ARG A CB  
2142 C CG  . ARG A 138 ? 0.0725 0.0689 0.0971 -0.0153 0.0170  -0.0060 164 ARG A CG  
2143 C CD  . ARG A 138 ? 0.0793 0.0844 0.0955 -0.0173 0.0095  -0.0098 164 ARG A CD  
2144 N NE  . ARG A 138 ? 0.0713 0.0703 0.0851 -0.0195 0.0061  -0.0106 164 ARG A NE  
2145 C CZ  . ARG A 138 ? 0.0749 0.0548 0.0817 -0.0183 0.0048  -0.0126 164 ARG A CZ  
2146 N NH1 . ARG A 138 ? 0.0783 0.0688 0.0928 -0.0105 0.0126  -0.0129 164 ARG A NH1 
2147 N NH2 . ARG A 138 ? 0.0763 0.0750 0.0816 -0.0057 0.0062  -0.0122 164 ARG A NH2 
2161 N N   . THR A 139 ? 0.0786 0.0536 0.0916 -0.0068 -0.0005 0.0034  165 THR A N   
2162 C CA  . THR A 139 ? 0.0912 0.0647 0.1040 -0.0086 0.0144  0.0084  165 THR A CA  
2163 C C   . THR A 139 ? 0.0877 0.0690 0.0989 -0.0113 0.0006  0.0050  165 THR A C   
2164 O O   . THR A 139 ? 0.1113 0.0676 0.0968 -0.0038 0.0013  0.0032  165 THR A O   
2165 C CB  . THR A 139 ? 0.1027 0.0858 0.1164 0.0061  0.0241  0.0173  165 THR A CB  
2166 O OG1 . THR A 139 ? 0.0872 0.1260 0.1186 0.0101  0.0123  0.0148  165 THR A OG1 
2167 C CG2 . THR A 139 ? 0.1203 0.0879 0.1294 0.0031  0.0369  0.0108  165 THR A CG2 
2175 N N   . ALA A 140 ? 0.1022 0.0712 0.0936 0.0054  0.0044  0.0063  166 ALA A N   
2176 C CA  . ALA A 140 ? 0.1333 0.0978 0.1116 0.0149  -0.0004 0.0166  166 ALA A CA  
2177 C C   . ALA A 140 ? 0.1654 0.1047 0.1212 0.0413  -0.0379 -0.0057 166 ALA A C   
2178 O O   . ALA A 140 ? 0.1574 0.0934 0.1268 0.0225  -0.0595 -0.0138 166 ALA A O   
2185 N N   . PRO A 141 ? 0.1872 0.1171 0.1315 0.0327  -0.0566 -0.0245 167 PRO A N   
2186 C CA  . PRO A 141 ? 0.1985 0.1215 0.1206 0.0386  -0.0357 -0.0155 167 PRO A CA  
2187 C C   . PRO A 141 ? 0.1361 0.0892 0.1108 0.0118  -0.0275 -0.0153 167 PRO A C   
2188 O O   . PRO A 141 ? 0.1276 0.1067 0.1096 0.0029  -0.0220 -0.0149 167 PRO A O   
2189 C CB  . PRO A 141 ? 0.2392 0.1705 0.1253 0.0744  -0.0498 -0.0286 167 PRO A CB  
2190 C CG  . PRO A 141 ? 0.2339 0.1533 0.1388 0.0524  -0.0701 -0.0376 167 PRO A CG  
2191 C CD  . PRO A 141 ? 0.2069 0.1371 0.1476 0.0338  -0.0701 -0.0302 167 PRO A CD  
2199 N N   . THR A 142 ? 0.0998 0.0886 0.1111 -0.0006 -0.0152 -0.0212 168 THR A N   
2200 C CA  . THR A 142 ? 0.1008 0.0824 0.1140 0.0000  0.0031  -0.0172 168 THR A CA  
2201 C C   . THR A 142 ? 0.1017 0.0665 0.0999 -0.0161 0.0054  -0.0117 168 THR A C   
2202 O O   . THR A 142 ? 0.1069 0.0706 0.1057 -0.0084 0.0072  -0.0068 168 THR A O   
2203 C CB  . THR A 142 ? 0.0968 0.1027 0.1296 -0.0118 0.0024  -0.0249 168 THR A CB  
2204 O OG1 . THR A 142 ? 0.1021 0.1009 0.1218 0.0064  -0.0086 -0.0015 168 THR A OG1 
2205 C CG2 . THR A 142 ? 0.1080 0.1343 0.1531 -0.0140 -0.0005 -0.0294 168 THR A CG2 
2213 N N   . LEU A 143 ? 0.0981 0.0586 0.0833 -0.0019 -0.0037 -0.0134 169 LEU A N   
2214 C CA  . LEU A 143 ? 0.0948 0.0898 0.0829 -0.0023 -0.0128 0.0007  169 LEU A CA  
2215 C C   . LEU A 143 ? 0.0812 0.0844 0.0946 -0.0053 -0.0204 -0.0011 169 LEU A C   
2216 O O   . LEU A 143 ? 0.0882 0.1098 0.1110 0.0218  -0.0297 -0.0062 169 LEU A O   
2217 C CB  . LEU A 143 ? 0.0965 0.0922 0.0790 -0.0086 -0.0174 -0.0057 169 LEU A CB  
2218 C CG  . LEU A 143 ? 0.1095 0.0926 0.0998 -0.0298 -0.0049 -0.0024 169 LEU A CG  
2219 C CD1 . LEU A 143 ? 0.1373 0.1082 0.1103 -0.0403 0.0195  -0.0102 169 LEU A CD1 
2220 C CD2 . LEU A 143 ? 0.1007 0.0841 0.1053 -0.0197 -0.0013 0.0097  169 LEU A CD2 
2232 N N   . ASN A 144 ? 0.0813 0.0660 0.0914 0.0048  0.0029  0.0088  170 ASN A N   
2233 C CA  . ASN A 144 ? 0.0993 0.0704 0.0954 0.0040  0.0246  0.0167  170 ASN A CA  
2234 C C   . ASN A 144 ? 0.0797 0.0823 0.0746 -0.0053 0.0063  0.0164  170 ASN A C   
2235 O O   . ASN A 144 ? 0.0890 0.1090 0.0581 -0.0103 0.0070  0.0028  170 ASN A O   
2236 C CB  . ASN A 144 ? 0.1543 0.1069 0.1302 0.0437  0.0487  0.0324  170 ASN A CB  
2237 C CG  . ASN A 144 ? 0.2114 0.1546 0.1673 0.0701  0.0380  0.0536  170 ASN A CG  
2238 O OD1 . ASN A 144 ? 0.2157 0.1319 0.1746 0.0342  0.0463  0.0470  170 ASN A OD1 
2239 N ND2 . ASN A 144 ? 0.2690 0.1934 0.1902 0.0986  0.0294  0.0810  170 ASN A ND2 
2246 N N   . THR A 145 ? 0.0820 0.0738 0.0673 -0.0017 -0.0082 0.0004  171 THR A N   
2247 C CA  . THR A 145 ? 0.0906 0.0688 0.0650 -0.0074 -0.0093 -0.0130 171 THR A CA  
2248 C C   . THR A 145 ? 0.0834 0.0549 0.0515 -0.0167 -0.0009 0.0022  171 THR A C   
2249 O O   . THR A 145 ? 0.0863 0.0660 0.0525 -0.0147 -0.0083 -0.0071 171 THR A O   
2250 C CB  . THR A 145 ? 0.0829 0.0865 0.0785 -0.0171 -0.0016 -0.0178 171 THR A CB  
2251 O OG1 . THR A 145 ? 0.0844 0.0762 0.0726 -0.0165 -0.0012 -0.0062 171 THR A OG1 
2252 C CG2 . THR A 145 ? 0.0825 0.1189 0.0911 -0.0110 -0.0127 -0.0206 171 THR A CG2 
2260 N N   . ALA A 146 ? 0.0758 0.0647 0.0461 -0.0118 -0.0068 -0.0063 172 ALA A N   
2261 C CA  . ALA A 146 ? 0.0664 0.0474 0.0500 -0.0253 -0.0013 0.0042  172 ALA A CA  
2262 C C   . ALA A 146 ? 0.0753 0.0437 0.0498 -0.0229 0.0041  -0.0036 172 ALA A C   
2263 O O   . ALA A 146 ? 0.0791 0.0543 0.0579 -0.0105 -0.0002 -0.0055 172 ALA A O   
2264 C CB  . ALA A 146 ? 0.0763 0.0483 0.0601 -0.0082 -0.0015 0.0040  172 ALA A CB  
2270 N N   . ILE A 147 ? 0.0818 0.0448 0.0568 -0.0172 0.0083  0.0096  173 ILE A N   
2271 C CA  . ILE A 147 ? 0.0935 0.0503 0.0677 -0.0156 0.0058  0.0013  173 ILE A CA  
2272 C C   . ILE A 147 ? 0.0839 0.0475 0.0666 -0.0317 0.0057  -0.0022 173 ILE A C   
2273 O O   . ILE A 147 ? 0.0842 0.0480 0.0726 -0.0284 0.0014  -0.0068 173 ILE A O   
2274 C CB  . ILE A 147 ? 0.0811 0.0625 0.0687 -0.0340 0.0014  -0.0003 173 ILE A CB  
2275 C CG1 . ILE A 147 ? 0.0884 0.0714 0.0814 -0.0258 -0.0023 0.0115  173 ILE A CG1 
2276 C CG2 . ILE A 147 ? 0.0941 0.0689 0.0645 -0.0300 -0.0020 0.0073  173 ILE A CG2 
2277 C CD1 . ILE A 147 ? 0.1067 0.0949 0.0908 -0.0307 -0.0020 0.0096  173 ILE A CD1 
2289 N N   . PRO A 148 ? 0.0991 0.0499 0.0624 -0.0212 -0.0001 0.0086  174 PRO A N   
2290 C CA  . PRO A 148 ? 0.0979 0.0599 0.0707 -0.0180 0.0027  -0.0026 174 PRO A CA  
2291 C C   . PRO A 148 ? 0.0917 0.0478 0.0588 -0.0142 0.0045  -0.0001 174 PRO A C   
2292 O O   . PRO A 148 ? 0.0844 0.0518 0.0619 -0.0223 -0.0080 0.0069  174 PRO A O   
2293 C CB  . PRO A 148 ? 0.1089 0.0649 0.0802 -0.0219 0.0169  -0.0076 174 PRO A CB  
2294 C CG  . PRO A 148 ? 0.1219 0.0725 0.0804 -0.0117 0.0088  -0.0059 174 PRO A CG  
2295 C CD  . PRO A 148 ? 0.1153 0.0643 0.0686 -0.0224 -0.0017 -0.0018 174 PRO A CD  
2303 N N   . GLY A 149 ? 0.0899 0.0642 0.0612 -0.0194 0.0015  -0.0030 175 GLY A N   
2304 C CA  . GLY A 149 ? 0.0970 0.0747 0.0607 -0.0071 -0.0051 0.0030  175 GLY A CA  
2305 C C   . GLY A 149 ? 0.0852 0.0550 0.0519 -0.0298 0.0051  0.0086  175 GLY A C   
2306 O O   . GLY A 149 ? 0.1014 0.0713 0.0503 -0.0222 0.0123  0.0185  175 GLY A O   
2310 N N   . ASP A 150 ? 0.0760 0.0607 0.0564 -0.0211 0.0034  0.0004  176 ASP A N   
2311 C CA  . ASP A 150 ? 0.0772 0.0537 0.0486 -0.0307 0.0161  -0.0039 176 ASP A CA  
2312 C C   . ASP A 150 ? 0.0837 0.0511 0.0521 -0.0116 0.0176  -0.0032 176 ASP A C   
2313 O O   . ASP A 150 ? 0.0827 0.0616 0.0477 -0.0316 0.0117  0.0115  176 ASP A O   
2314 C CB  . ASP A 150 ? 0.0831 0.0450 0.0626 -0.0192 0.0103  -0.0074 176 ASP A CB  
2315 C CG  . ASP A 150 ? 0.0747 0.0527 0.0730 -0.0362 -0.0006 -0.0043 176 ASP A CG  
2316 O OD1 . ASP A 150 ? 0.0834 0.0588 0.0700 -0.0283 0.0082  -0.0057 176 ASP A OD1 
2317 O OD2 . ASP A 150 ? 0.0842 0.0665 0.0699 -0.0214 0.0088  0.0009  176 ASP A OD2 
2322 N N   . PRO A 151 ? 0.0936 0.0501 0.0538 -0.0272 0.0119  0.0006  177 PRO A N   
2323 C CA  . PRO A 151 ? 0.1006 0.0434 0.0535 -0.0300 0.0082  0.0017  177 PRO A CA  
2324 C C   . PRO A 151 ? 0.1011 0.0486 0.0610 -0.0242 0.0030  -0.0128 177 PRO A C   
2325 O O   . PRO A 151 ? 0.1081 0.0414 0.0568 -0.0185 0.0060  -0.0029 177 PRO A O   
2326 C CB  . PRO A 151 ? 0.1242 0.0580 0.0592 -0.0137 0.0132  -0.0044 177 PRO A CB  
2327 C CG  . PRO A 151 ? 0.1222 0.0639 0.0532 -0.0128 0.0331  -0.0014 177 PRO A CG  
2328 C CD  . PRO A 151 ? 0.1031 0.0648 0.0476 -0.0132 0.0230  0.0061  177 PRO A CD  
2336 N N   . ARG A 152 ? 0.0997 0.0407 0.0580 -0.0247 0.0032  -0.0130 178 ARG A N   
2337 C CA  . ARG A 152 ? 0.1040 0.0481 0.0630 -0.0105 0.0134  0.0027  178 ARG A CA  
2338 C C   . ARG A 152 ? 0.0910 0.0480 0.0472 -0.0135 0.0122  -0.0001 178 ARG A C   
2339 O O   . ARG A 152 ? 0.0827 0.0550 0.0520 -0.0264 0.0089  -0.0049 178 ARG A O   
2340 C CB  . ARG A 152 ? 0.0962 0.0668 0.0772 -0.0010 0.0057  0.0021  178 ARG A CB  
2341 C CG  . ARG A 152 ? 0.0872 0.0580 0.0849 -0.0264 0.0186  0.0007  178 ARG A CG  
2342 C CD  . ARG A 152 ? 0.0919 0.0611 0.0957 -0.0127 0.0143  -0.0017 178 ARG A CD  
2343 N NE  . ARG A 152 ? 0.0849 0.0550 0.1165 -0.0234 0.0149  -0.0090 178 ARG A NE  
2344 C CZ  . ARG A 152 ? 0.0757 0.0579 0.1314 -0.0293 0.0120  -0.0052 178 ARG A CZ  
2345 N NH1 . ARG A 152 ? 0.0812 0.0872 0.1452 -0.0028 0.0170  -0.0076 178 ARG A NH1 
2346 N NH2 . ARG A 152 ? 0.0927 0.0869 0.1268 -0.0169 -0.0021 -0.0214 178 ARG A NH2 
2360 N N   . ASP A 153 ? 0.0848 0.0514 0.0414 -0.0095 0.0121  0.0022  179 ASP A N   
2361 C CA  . ASP A 153 ? 0.0777 0.0564 0.0418 -0.0065 0.0050  0.0104  179 ASP A CA  
2362 C C   . ASP A 153 ? 0.0745 0.0420 0.0525 -0.0116 -0.0025 0.0095  179 ASP A C   
2363 O O   . ASP A 153 ? 0.0774 0.0530 0.0584 -0.0164 0.0016  0.0169  179 ASP A O   
2364 C CB  . ASP A 153 ? 0.0810 0.0406 0.0571 -0.0180 -0.0018 0.0021  179 ASP A CB  
2365 C CG  . ASP A 153 ? 0.0771 0.0431 0.0750 -0.0177 0.0032  -0.0029 179 ASP A CG  
2366 O OD1 . ASP A 153 ? 0.0773 0.0630 0.0767 -0.0146 0.0056  -0.0092 179 ASP A OD1 
2367 O OD2 . ASP A 153 ? 0.0790 0.0664 0.1032 -0.0179 0.0060  -0.0092 179 ASP A OD2 
2372 N N   . THR A 154 ? 0.0707 0.0544 0.0474 -0.0202 0.0013  0.0078  180 THR A N   
2373 C CA  . THR A 154 ? 0.0790 0.0439 0.0650 -0.0299 -0.0005 0.0078  180 THR A CA  
2374 C C   . THR A 154 ? 0.0813 0.0351 0.0606 -0.0107 -0.0005 0.0077  180 THR A C   
2375 O O   . THR A 154 ? 0.0781 0.0550 0.0582 -0.0219 -0.0013 0.0043  180 THR A O   
2376 C CB  . THR A 154 ? 0.0799 0.0542 0.0645 -0.0295 -0.0038 0.0036  180 THR A CB  
2377 O OG1 . THR A 154 ? 0.0849 0.0695 0.0668 -0.0255 -0.0009 0.0121  180 THR A OG1 
2378 C CG2 . THR A 154 ? 0.0787 0.0576 0.0666 -0.0194 -0.0042 0.0007  180 THR A CG2 
2386 N N   . THR A 155 ? 0.0820 0.0551 0.0552 -0.0234 -0.0012 -0.0101 181 THR A N   
2387 C CA  . THR A 155 ? 0.0736 0.0521 0.0647 -0.0231 -0.0129 0.0073  181 THR A CA  
2388 C C   . THR A 155 ? 0.0754 0.0526 0.0798 -0.0222 -0.0074 0.0045  181 THR A C   
2389 O O   . THR A 155 ? 0.0755 0.0598 0.1049 -0.0141 -0.0191 -0.0126 181 THR A O   
2390 C CB  . THR A 155 ? 0.0743 0.0495 0.0583 -0.0272 -0.0170 0.0128  181 THR A CB  
2391 O OG1 . THR A 155 ? 0.0928 0.0481 0.0549 -0.0268 -0.0198 0.0091  181 THR A OG1 
2392 C CG2 . THR A 155 ? 0.0727 0.0430 0.0652 -0.0214 -0.0134 0.0121  181 THR A CG2 
2400 N N   . THR A 156 ? 0.0835 0.0469 0.0763 -0.0171 -0.0258 0.0080  182 THR A N   
2401 C CA  . THR A 156 ? 0.0822 0.0579 0.0855 -0.0145 -0.0384 0.0063  182 THR A CA  
2402 C C   . THR A 156 ? 0.0755 0.0458 0.0869 -0.0175 -0.0275 0.0007  182 THR A C   
2403 O O   . THR A 156 ? 0.0840 0.0363 0.0968 -0.0155 -0.0132 0.0047  182 THR A O   
2404 C CB  . THR A 156 ? 0.1040 0.0553 0.1062 -0.0250 -0.0384 0.0158  182 THR A CB  
2405 O OG1 . THR A 156 ? 0.1164 0.0573 0.1148 -0.0244 -0.0499 0.0161  182 THR A OG1 
2406 C CG2 . THR A 156 ? 0.1158 0.0594 0.1240 -0.0222 -0.0273 0.0098  182 THR A CG2 
2414 N N   . PRO A 157 ? 0.0732 0.0378 0.0968 -0.0118 -0.0185 0.0055  183 PRO A N   
2415 C CA  . PRO A 157 ? 0.0646 0.0368 0.0918 -0.0144 -0.0190 0.0090  183 PRO A CA  
2416 C C   . PRO A 157 ? 0.0672 0.0542 0.1005 -0.0073 -0.0099 0.0099  183 PRO A C   
2417 O O   . PRO A 157 ? 0.0704 0.0457 0.1116 -0.0045 -0.0112 0.0011  183 PRO A O   
2418 C CB  . PRO A 157 ? 0.0740 0.0435 0.1042 -0.0055 -0.0169 0.0051  183 PRO A CB  
2419 C CG  . PRO A 157 ? 0.0795 0.0358 0.1066 0.0078  -0.0249 -0.0024 183 PRO A CG  
2420 C CD  . PRO A 157 ? 0.0798 0.0376 0.1056 -0.0045 -0.0196 -0.0046 183 PRO A CD  
2428 N N   . LEU A 158 ? 0.0779 0.0487 0.1062 -0.0147 -0.0318 0.0055  184 LEU A N   
2429 C CA  . LEU A 158 ? 0.0847 0.0645 0.1159 -0.0055 -0.0335 0.0094  184 LEU A CA  
2430 C C   . LEU A 158 ? 0.0766 0.0654 0.1063 -0.0167 -0.0268 0.0193  184 LEU A C   
2431 O O   . LEU A 158 ? 0.0827 0.0537 0.1061 -0.0234 -0.0210 0.0158  184 LEU A O   
2432 C CB  . LEU A 158 ? 0.1066 0.0908 0.1479 -0.0027 -0.0604 0.0023  184 LEU A CB  
2433 C CG  . LEU A 158 ? 0.1428 0.1015 0.1670 0.0022  -0.0867 -0.0063 184 LEU A CG  
2434 C CD1 . LEU A 158 ? 0.1277 0.1228 0.1826 -0.0151 -0.0812 -0.0197 184 LEU A CD1 
2435 C CD2 . LEU A 158 ? 0.1872 0.1355 0.1789 0.0319  -0.1053 -0.0091 184 LEU A CD2 
2447 N N   . ALA A 159 ? 0.0710 0.0625 0.1010 -0.0104 -0.0218 0.0163  185 ALA A N   
2448 C CA  . ALA A 159 ? 0.0689 0.0654 0.0906 -0.0112 -0.0149 0.0216  185 ALA A CA  
2449 C C   . ALA A 159 ? 0.0642 0.0594 0.0832 -0.0149 -0.0191 0.0145  185 ALA A C   
2450 O O   . ALA A 159 ? 0.0785 0.0508 0.0839 -0.0111 -0.0106 0.0092  185 ALA A O   
2451 C CB  . ALA A 159 ? 0.0805 0.0633 0.0933 -0.0170 -0.0110 0.0236  185 ALA A CB  
2457 N N   . MET A 160 ? 0.0645 0.0562 0.0679 -0.0143 -0.0122 0.0170  186 MET A N   
2458 C CA  A MET A 160 ? 0.0598 0.0506 0.0634 -0.0048 -0.0086 0.0155  186 MET A CA  
2459 C CA  B MET A 160 ? 0.0618 0.0547 0.0652 -0.0070 -0.0081 0.0141  186 MET A CA  
2460 C C   . MET A 160 ? 0.0605 0.0526 0.0601 -0.0017 -0.0119 0.0109  186 MET A C   
2461 O O   . MET A 160 ? 0.0647 0.0433 0.0626 -0.0090 -0.0069 -0.0020 186 MET A O   
2462 C CB  A MET A 160 ? 0.0689 0.0528 0.0684 -0.0087 -0.0110 0.0036  186 MET A CB  
2463 C CB  B MET A 160 ? 0.0696 0.0613 0.0725 -0.0108 -0.0045 0.0051  186 MET A CB  
2464 C CG  A MET A 160 ? 0.0602 0.0514 0.0610 -0.0110 -0.0005 0.0002  186 MET A CG  
2465 C CG  B MET A 160 ? 0.0665 0.0689 0.0720 -0.0112 0.0076  0.0043  186 MET A CG  
2466 S SD  A MET A 160 ? 0.0709 0.0602 0.0608 0.0013  -0.0147 -0.0033 186 MET A SD  
2467 S SD  B MET A 160 ? 0.0664 0.0746 0.0756 -0.0128 0.0064  0.0049  186 MET A SD  
2468 C CE  A MET A 160 ? 0.0611 0.0801 0.0668 -0.0035 -0.0035 0.0063  186 MET A CE  
2469 C CE  B MET A 160 ? 0.0679 0.0722 0.0790 -0.0085 0.0047  -0.0053 186 MET A CE  
2488 N N   . ALA A 161 ? 0.0629 0.0410 0.0693 -0.0152 -0.0122 0.0092  187 ALA A N   
2489 C CA  . ALA A 161 ? 0.0721 0.0417 0.0779 -0.0153 -0.0123 -0.0021 187 ALA A CA  
2490 C C   . ALA A 161 ? 0.0536 0.0454 0.0794 -0.0186 -0.0102 0.0006  187 ALA A C   
2491 O O   . ALA A 161 ? 0.0689 0.0569 0.0806 -0.0183 -0.0131 -0.0013 187 ALA A O   
2492 C CB  . ALA A 161 ? 0.0819 0.0637 0.0716 -0.0104 -0.0106 -0.0020 187 ALA A CB  
2498 N N   . GLN A 162 ? 0.0750 0.0546 0.0841 -0.0151 -0.0143 0.0100  188 GLN A N   
2499 C CA  . GLN A 162 ? 0.0841 0.0649 0.0855 -0.0152 -0.0319 0.0044  188 GLN A CA  
2500 C C   . GLN A 162 ? 0.0847 0.0638 0.0752 -0.0170 -0.0119 0.0078  188 GLN A C   
2501 O O   . GLN A 162 ? 0.0807 0.0640 0.0753 -0.0221 -0.0199 0.0018  188 GLN A O   
2502 C CB  . GLN A 162 ? 0.1201 0.0736 0.1083 -0.0090 -0.0420 0.0115  188 GLN A CB  
2503 C CG  . GLN A 162 ? 0.1635 0.1285 0.1337 0.0036  -0.0322 0.0151  188 GLN A CG  
2504 C CD  . GLN A 162 ? 0.2097 0.2130 0.1678 0.0311  -0.0095 0.0461  188 GLN A CD  
2505 O OE1 . GLN A 162 ? 0.2468 0.2597 0.1903 0.0562  0.0097  0.0764  188 GLN A OE1 
2506 N NE2 . GLN A 162 ? 0.2279 0.2386 0.1710 0.0452  -0.0224 0.0507  188 GLN A NE2 
2515 N N   . THR A 163 ? 0.0819 0.0597 0.0752 -0.0214 -0.0129 0.0115  189 THR A N   
2516 C CA  . THR A 163 ? 0.0813 0.0603 0.0727 -0.0211 0.0047  0.0135  189 THR A CA  
2517 C C   . THR A 163 ? 0.0632 0.0579 0.0605 -0.0261 0.0024  0.0029  189 THR A C   
2518 O O   . THR A 163 ? 0.0720 0.0573 0.0685 -0.0217 -0.0004 0.0037  189 THR A O   
2519 C CB  . THR A 163 ? 0.0915 0.0732 0.0834 -0.0200 0.0100  0.0135  189 THR A CB  
2520 O OG1 . THR A 163 ? 0.0983 0.0811 0.0768 -0.0354 0.0120  0.0028  189 THR A OG1 
2521 C CG2 . THR A 163 ? 0.0967 0.0976 0.1051 -0.0273 0.0079  0.0095  189 THR A CG2 
2529 N N   . LEU A 164 ? 0.0673 0.0493 0.0582 -0.0175 0.0035  -0.0016 190 LEU A N   
2530 C CA  . LEU A 164 ? 0.0638 0.0492 0.0574 -0.0163 -0.0008 0.0010  190 LEU A CA  
2531 C C   . LEU A 164 ? 0.0667 0.0490 0.0545 -0.0151 -0.0003 0.0030  190 LEU A C   
2532 O O   . LEU A 164 ? 0.0752 0.0453 0.0540 -0.0175 -0.0038 -0.0019 190 LEU A O   
2533 C CB  . LEU A 164 ? 0.0593 0.0416 0.0666 -0.0174 -0.0074 -0.0076 190 LEU A CB  
2534 C CG  . LEU A 164 ? 0.0704 0.0448 0.0647 -0.0188 0.0044  -0.0055 190 LEU A CG  
2535 C CD1 . LEU A 164 ? 0.0828 0.0489 0.0597 -0.0040 -0.0038 0.0089  190 LEU A CD1 
2536 C CD2 . LEU A 164 ? 0.0657 0.0491 0.0629 -0.0093 -0.0123 -0.0089 190 LEU A CD2 
2548 N N   . LYS A 165 ? 0.0599 0.0502 0.0555 -0.0225 -0.0074 -0.0025 191 LYS A N   
2549 C CA  A LYS A 165 ? 0.0711 0.0619 0.0547 -0.0198 -0.0034 -0.0049 191 LYS A CA  
2550 C CA  B LYS A 165 ? 0.0695 0.0579 0.0553 -0.0239 -0.0126 -0.0085 191 LYS A CA  
2551 C C   . LYS A 165 ? 0.0580 0.0614 0.0539 -0.0263 -0.0138 -0.0105 191 LYS A C   
2552 O O   . LYS A 165 ? 0.0678 0.0565 0.0706 -0.0332 -0.0067 -0.0128 191 LYS A O   
2553 C CB  A LYS A 165 ? 0.0720 0.0852 0.0666 -0.0185 0.0149  0.0020  191 LYS A CB  
2554 C CB  B LYS A 165 ? 0.0665 0.0683 0.0670 -0.0340 -0.0152 -0.0099 191 LYS A CB  
2555 C CG  A LYS A 165 ? 0.1126 0.1130 0.0850 0.0061  0.0138  0.0053  191 LYS A CG  
2556 C CG  B LYS A 165 ? 0.1047 0.0909 0.0862 -0.0086 -0.0278 -0.0046 191 LYS A CG  
2557 C CD  A LYS A 165 ? 0.1526 0.1794 0.1110 0.0174  0.0009  -0.0058 191 LYS A CD  
2558 C CD  B LYS A 165 ? 0.1462 0.1571 0.1147 0.0129  -0.0311 -0.0017 191 LYS A CD  
2559 C CE  A LYS A 165 ? 0.1785 0.2241 0.1329 0.0144  -0.0179 -0.0040 191 LYS A CE  
2560 C CE  B LYS A 165 ? 0.1811 0.2091 0.1365 0.0357  -0.0368 -0.0026 191 LYS A CE  
2561 N NZ  A LYS A 165 ? 0.2101 0.2415 0.1484 0.0526  -0.0222 -0.0003 191 LYS A NZ  
2562 N NZ  B LYS A 165 ? 0.1883 0.2159 0.1446 0.0501  -0.0304 -0.0182 191 LYS A NZ  
2589 N N   . ASN A 166 ? 0.0662 0.0608 0.0536 -0.0212 -0.0078 0.0004  192 ASN A N   
2590 C CA  A ASN A 166 ? 0.0730 0.0671 0.0587 -0.0259 -0.0121 -0.0133 192 ASN A CA  
2591 C CA  B ASN A 166 ? 0.0755 0.0754 0.0644 -0.0172 -0.0107 -0.0014 192 ASN A CA  
2592 C C   . ASN A 166 ? 0.0672 0.0612 0.0549 -0.0235 -0.0092 -0.0064 192 ASN A C   
2593 O O   . ASN A 166 ? 0.0712 0.0697 0.0654 -0.0205 -0.0068 -0.0069 192 ASN A O   
2594 C CB  A ASN A 166 ? 0.0721 0.0965 0.0626 -0.0338 -0.0213 0.0004  192 ASN A CB  
2595 C CB  B ASN A 166 ? 0.0820 0.0997 0.0809 -0.0186 -0.0216 0.0116  192 ASN A CB  
2596 C CG  A ASN A 166 ? 0.0899 0.1389 0.0799 -0.0333 -0.0215 0.0244  192 ASN A CG  
2597 C CG  B ASN A 166 ? 0.0974 0.1433 0.1008 -0.0088 -0.0323 0.0212  192 ASN A CG  
2598 O OD1 A ASN A 166 ? 0.1190 0.2012 0.1031 -0.0245 -0.0423 0.0574  192 ASN A OD1 
2599 O OD1 B ASN A 166 ? 0.1192 0.1482 0.0986 0.0059  -0.0320 -0.0162 192 ASN A OD1 
2600 N ND2 A ASN A 166 ? 0.1159 0.1325 0.0760 0.0078  -0.0158 0.0234  192 ASN A ND2 
2601 N ND2 B ASN A 166 ? 0.1057 0.1692 0.1215 -0.0014 -0.0416 0.0598  192 ASN A ND2 
2614 N N   . LEU A 167 ? 0.0697 0.0482 0.0449 -0.0161 0.0004  -0.0059 193 LEU A N   
2615 C CA  . LEU A 167 ? 0.0617 0.0525 0.0662 -0.0231 0.0021  -0.0100 193 LEU A CA  
2616 C C   . LEU A 167 ? 0.0608 0.0552 0.0723 -0.0281 0.0078  -0.0034 193 LEU A C   
2617 O O   . LEU A 167 ? 0.0871 0.0533 0.0763 -0.0245 0.0159  -0.0060 193 LEU A O   
2618 C CB  . LEU A 167 ? 0.0629 0.0507 0.0647 -0.0238 -0.0066 -0.0108 193 LEU A CB  
2619 C CG  . LEU A 167 ? 0.0602 0.0632 0.0660 -0.0167 -0.0123 0.0024  193 LEU A CG  
2620 C CD1 . LEU A 167 ? 0.0703 0.0695 0.0794 -0.0250 -0.0113 0.0024  193 LEU A CD1 
2621 C CD2 . LEU A 167 ? 0.0584 0.0787 0.0686 -0.0164 -0.0044 0.0085  193 LEU A CD2 
2633 N N   . THR A 168 ? 0.0603 0.0563 0.0639 -0.0095 0.0075  0.0008  194 THR A N   
2634 C CA  . THR A 168 ? 0.0649 0.0538 0.0672 -0.0144 0.0166  0.0027  194 THR A CA  
2635 C C   . THR A 168 ? 0.0742 0.0437 0.0764 -0.0133 0.0137  -0.0014 194 THR A C   
2636 O O   . THR A 168 ? 0.0856 0.0418 0.0951 -0.0141 0.0246  0.0065  194 THR A O   
2637 C CB  . THR A 168 ? 0.0664 0.0541 0.0656 -0.0152 0.0117  0.0067  194 THR A CB  
2638 O OG1 . THR A 168 ? 0.0757 0.0557 0.0799 -0.0100 0.0043  -0.0011 194 THR A OG1 
2639 C CG2 . THR A 168 ? 0.0836 0.0759 0.0594 -0.0154 0.0073  -0.0021 194 THR A CG2 
2647 N N   . LEU A 169 ? 0.0660 0.0525 0.0672 -0.0221 0.0102  -0.0083 195 LEU A N   
2648 C CA  . LEU A 169 ? 0.0692 0.0725 0.0775 -0.0266 0.0130  -0.0144 195 LEU A CA  
2649 C C   . LEU A 169 ? 0.0784 0.1179 0.0873 -0.0475 0.0134  -0.0400 195 LEU A C   
2650 O O   . LEU A 169 ? 0.1082 0.1944 0.1079 -0.0645 0.0194  -0.0635 195 LEU A O   
2651 C CB  . LEU A 169 ? 0.0694 0.0737 0.0809 -0.0210 0.0117  -0.0077 195 LEU A CB  
2652 C CG  . LEU A 169 ? 0.0668 0.1007 0.0878 -0.0110 0.0110  -0.0069 195 LEU A CG  
2653 C CD1 . LEU A 169 ? 0.0647 0.1084 0.0890 -0.0074 0.0004  -0.0175 195 LEU A CD1 
2654 C CD2 . LEU A 169 ? 0.0942 0.1045 0.0918 -0.0018 0.0143  0.0106  195 LEU A CD2 
2666 N N   . GLY A 170 ? 0.0736 0.1047 0.0854 -0.0297 0.0086  -0.0496 196 GLY A N   
2667 C CA  . GLY A 170 ? 0.0628 0.1059 0.0852 -0.0286 0.0105  -0.0434 196 GLY A CA  
2668 C C   . GLY A 170 ? 0.0632 0.0898 0.0816 -0.0410 0.0125  -0.0207 196 GLY A C   
2669 O O   . GLY A 170 ? 0.0917 0.0728 0.0984 -0.0234 0.0158  -0.0199 196 GLY A O   
2673 N N   . LYS A 171 ? 0.0659 0.1087 0.0732 -0.0225 0.0039  -0.0132 197 LYS A N   
2674 C CA  . LYS A 171 ? 0.0751 0.1196 0.0681 -0.0090 -0.0023 -0.0199 197 LYS A CA  
2675 C C   . LYS A 171 ? 0.0644 0.1012 0.0624 -0.0253 0.0054  -0.0098 197 LYS A C   
2676 O O   . LYS A 171 ? 0.0848 0.1145 0.0844 -0.0209 0.0167  -0.0219 197 LYS A O   
2677 C CB  . LYS A 171 ? 0.1017 0.1964 0.0926 -0.0009 -0.0117 -0.0218 197 LYS A CB  
2678 C CG  . LYS A 171 ? 0.1834 0.2230 0.1150 0.0389  -0.0103 -0.0057 197 LYS A CG  
2679 C CD  . LYS A 171 ? 0.2980 0.2719 0.1435 0.1276  0.0069  0.0332  197 LYS A CD  
2680 C CE  . LYS A 171 ? 0.3840 0.3319 0.1773 0.1705  0.0065  0.0418  197 LYS A CE  
2681 N NZ  . LYS A 171 ? 0.4269 0.3715 0.1910 0.1557  0.0116  0.0489  197 LYS A NZ  
2695 N N   . ALA A 172 ? 0.0583 0.0880 0.0416 -0.0245 0.0099  -0.0069 198 ALA A N   
2696 C CA  . ALA A 172 ? 0.0583 0.0973 0.0544 -0.0191 0.0057  0.0013  198 ALA A CA  
2697 C C   . ALA A 172 ? 0.0565 0.0947 0.0613 -0.0165 0.0038  -0.0093 198 ALA A C   
2698 O O   . ALA A 172 ? 0.0665 0.1172 0.0766 -0.0012 0.0145  0.0179  198 ALA A O   
2699 C CB  . ALA A 172 ? 0.0668 0.1010 0.0595 -0.0292 0.0039  -0.0164 198 ALA A CB  
2705 N N   . LEU A 173 ? 0.0573 0.0819 0.0647 -0.0124 0.0200  -0.0153 199 LEU A N   
2706 C CA  . LEU A 173 ? 0.0662 0.0833 0.0777 -0.0195 0.0213  -0.0137 199 LEU A CA  
2707 C C   . LEU A 173 ? 0.0792 0.0916 0.0820 -0.0229 0.0288  -0.0060 199 LEU A C   
2708 O O   . LEU A 173 ? 0.0802 0.0974 0.0734 -0.0183 0.0022  0.0043  199 LEU A O   
2709 C CB  . LEU A 173 ? 0.0685 0.0691 0.0712 -0.0209 0.0224  -0.0049 199 LEU A CB  
2710 C CG  . LEU A 173 ? 0.0734 0.0861 0.0703 -0.0188 0.0116  -0.0003 199 LEU A CG  
2711 C CD1 . LEU A 173 ? 0.0702 0.0911 0.0726 -0.0168 0.0074  -0.0191 199 LEU A CD1 
2712 C CD2 . LEU A 173 ? 0.0845 0.1561 0.0727 -0.0398 0.0104  0.0080  199 LEU A CD2 
2724 N N   . ALA A 174 ? 0.1025 0.0701 0.1257 -0.0283 0.0631  -0.0260 200 ALA A N   
2725 C CA  . ALA A 174 ? 0.1277 0.0749 0.1419 -0.0351 0.0754  -0.0354 200 ALA A CA  
2726 C C   . ALA A 174 ? 0.0823 0.0700 0.1146 -0.0303 0.0469  -0.0214 200 ALA A C   
2727 O O   . ALA A 174 ? 0.0639 0.0618 0.1090 -0.0238 -0.0008 -0.0085 200 ALA A O   
2728 C CB  . ALA A 174 ? 0.1760 0.0886 0.1832 -0.0256 0.1037  -0.0330 200 ALA A CB  
2734 N N   . GLU A 175 ? 0.0943 0.0831 0.1020 -0.0370 0.0392  -0.0370 201 GLU A N   
2735 C CA  A GLU A 175 ? 0.0763 0.0730 0.0934 -0.0305 0.0251  -0.0349 201 GLU A CA  
2736 C CA  B GLU A 175 ? 0.0735 0.0713 0.0937 -0.0279 0.0263  -0.0304 201 GLU A CA  
2737 C C   . GLU A 175 ? 0.0593 0.0790 0.1014 -0.0218 0.0213  -0.0219 201 GLU A C   
2738 O O   . GLU A 175 ? 0.0529 0.0908 0.0843 -0.0091 -0.0049 -0.0329 201 GLU A O   
2739 C CB  A GLU A 175 ? 0.0773 0.0835 0.0935 -0.0293 0.0094  -0.0217 201 GLU A CB  
2740 C CB  B GLU A 175 ? 0.0679 0.0692 0.0900 -0.0141 0.0125  -0.0182 201 GLU A CB  
2741 C CG  A GLU A 175 ? 0.0633 0.0804 0.0801 -0.0386 -0.0093 -0.0121 201 GLU A CG  
2742 C CG  B GLU A 175 ? 0.0548 0.0837 0.0839 -0.0098 -0.0104 -0.0073 201 GLU A CG  
2743 C CD  A GLU A 175 ? 0.0768 0.1122 0.0708 -0.0042 -0.0225 -0.0259 201 GLU A CD  
2744 C CD  B GLU A 175 ? 0.0395 0.0690 0.0688 -0.0183 -0.0100 -0.0127 201 GLU A CD  
2745 O OE1 A GLU A 175 ? 0.0722 0.0882 0.0878 -0.0051 -0.0182 -0.0085 201 GLU A OE1 
2746 O OE1 B GLU A 175 ? 0.0342 0.0658 0.0656 -0.0074 -0.0146 -0.0224 201 GLU A OE1 
2747 O OE2 A GLU A 175 ? 0.1029 0.1434 0.0560 0.0689  -0.0166 -0.0230 201 GLU A OE2 
2748 O OE2 B GLU A 175 ? 0.0384 0.1347 0.0470 0.0156  0.0047  0.0225  201 GLU A OE2 
2761 N N   . THR A 176 ? 0.0643 0.0716 0.1439 -0.0163 0.0339  -0.0270 202 THR A N   
2762 C CA  . THR A 176 ? 0.0718 0.0631 0.1700 -0.0108 0.0231  -0.0256 202 THR A CA  
2763 C C   . THR A 176 ? 0.0612 0.0604 0.1441 -0.0212 0.0222  -0.0209 202 THR A C   
2764 O O   . THR A 176 ? 0.0831 0.0626 0.1427 -0.0177 -0.0086 -0.0024 202 THR A O   
2765 C CB  . THR A 176 ? 0.0980 0.0591 0.2116 -0.0089 0.0164  -0.0237 202 THR A CB  
2766 O OG1 . THR A 176 ? 0.1057 0.0725 0.2171 -0.0239 0.0123  -0.0208 202 THR A OG1 
2767 C CG2 . THR A 176 ? 0.1219 0.0869 0.2446 0.0326  -0.0029 -0.0337 202 THR A CG2 
2775 N N   . GLN A 177 ? 0.0656 0.0669 0.1256 -0.0262 0.0350  -0.0226 203 GLN A N   
2776 C CA  . GLN A 177 ? 0.0747 0.0636 0.1400 -0.0143 0.0405  -0.0306 203 GLN A CA  
2777 C C   . GLN A 177 ? 0.0725 0.0595 0.1147 -0.0186 0.0317  -0.0225 203 GLN A C   
2778 O O   . GLN A 177 ? 0.0723 0.0664 0.1011 -0.0146 0.0174  -0.0183 203 GLN A O   
2779 C CB  . GLN A 177 ? 0.0823 0.0634 0.1630 -0.0124 0.0549  -0.0339 203 GLN A CB  
2780 C CG  . GLN A 177 ? 0.1151 0.0821 0.1971 -0.0075 0.0838  -0.0091 203 GLN A CG  
2781 C CD  . GLN A 177 ? 0.1740 0.1205 0.2193 0.0073  0.1130  -0.0098 203 GLN A CD  
2782 O OE1 . GLN A 177 ? 0.1635 0.1037 0.2227 -0.0424 0.1069  -0.0545 203 GLN A OE1 
2783 N NE2 . GLN A 177 ? 0.2114 0.1297 0.2145 0.0459  0.1081  0.0016  203 GLN A NE2 
2792 N N   . ARG A 178 ? 0.0652 0.0665 0.1070 -0.0127 0.0218  -0.0333 204 ARG A N   
2793 C CA  A ARG A 178 ? 0.0608 0.0505 0.0944 -0.0192 0.0181  -0.0271 204 ARG A CA  
2794 C CA  B ARG A 178 ? 0.0609 0.0519 0.0993 -0.0162 0.0142  -0.0319 204 ARG A CA  
2795 C C   . ARG A 178 ? 0.0579 0.0500 0.0983 -0.0138 0.0127  -0.0233 204 ARG A C   
2796 O O   . ARG A 178 ? 0.0611 0.0579 0.0865 -0.0126 0.0014  -0.0153 204 ARG A O   
2797 C CB  A ARG A 178 ? 0.0607 0.0568 0.0787 -0.0242 0.0166  -0.0138 204 ARG A CB  
2798 C CB  B ARG A 178 ? 0.0595 0.0608 0.0933 -0.0156 0.0014  -0.0332 204 ARG A CB  
2799 C CG  A ARG A 178 ? 0.0628 0.0520 0.0641 -0.0233 0.0268  0.0009  204 ARG A CG  
2800 C CG  B ARG A 178 ? 0.0594 0.0521 0.0873 -0.0119 -0.0018 -0.0341 204 ARG A CG  
2801 C CD  A ARG A 178 ? 0.0778 0.0718 0.0749 -0.0134 0.0228  -0.0023 204 ARG A CD  
2802 C CD  B ARG A 178 ? 0.0776 0.0819 0.0993 0.0225  -0.0109 -0.0365 204 ARG A CD  
2803 N NE  A ARG A 178 ? 0.0783 0.0640 0.0901 -0.0402 0.0132  -0.0096 204 ARG A NE  
2804 N NE  B ARG A 178 ? 0.0744 0.1050 0.1122 0.0069  -0.0169 -0.0339 204 ARG A NE  
2805 C CZ  A ARG A 178 ? 0.1232 0.0684 0.0953 -0.0458 0.0298  -0.0061 204 ARG A CZ  
2806 C CZ  B ARG A 178 ? 0.0601 0.1386 0.1218 -0.0006 -0.0176 -0.0631 204 ARG A CZ  
2807 N NH1 A ARG A 178 ? 0.1574 0.0772 0.0826 -0.0517 0.0353  -0.0072 204 ARG A NH1 
2808 N NH1 B ARG A 178 ? 0.0647 0.1817 0.1261 -0.0198 -0.0103 -0.0551 204 ARG A NH1 
2809 N NH2 A ARG A 178 ? 0.1654 0.0985 0.1074 0.0193  0.0447  -0.0083 204 ARG A NH2 
2810 N NH2 B ARG A 178 ? 0.0843 0.1237 0.1215 -0.0025 -0.0084 -0.0721 204 ARG A NH2 
2837 N N   . ALA A 179 ? 0.0686 0.0436 0.1135 -0.0169 0.0185  -0.0178 205 ALA A N   
2838 C CA  . ALA A 179 ? 0.0584 0.0560 0.1173 -0.0207 0.0242  -0.0046 205 ALA A CA  
2839 C C   . ALA A 179 ? 0.0670 0.0557 0.1173 -0.0091 0.0236  -0.0052 205 ALA A C   
2840 O O   . ALA A 179 ? 0.0742 0.0595 0.1193 -0.0161 0.0345  -0.0038 205 ALA A O   
2841 C CB  . ALA A 179 ? 0.0708 0.0863 0.1305 -0.0300 0.0073  -0.0123 205 ALA A CB  
2847 N N   . GLN A 180 ? 0.0679 0.0451 0.1170 -0.0158 0.0175  -0.0087 206 GLN A N   
2848 C CA  . GLN A 180 ? 0.0769 0.0517 0.1201 0.0007  0.0095  0.0025  206 GLN A CA  
2849 C C   . GLN A 180 ? 0.0776 0.0554 0.1054 -0.0049 0.0015  -0.0014 206 GLN A C   
2850 O O   . GLN A 180 ? 0.0780 0.0598 0.1052 -0.0085 0.0057  0.0143  206 GLN A O   
2851 C CB  . GLN A 180 ? 0.0728 0.0546 0.1364 -0.0135 0.0011  0.0094  206 GLN A CB  
2852 C CG  . GLN A 180 ? 0.0756 0.0839 0.1468 -0.0037 0.0065  0.0130  206 GLN A CG  
2853 C CD  . GLN A 180 ? 0.1089 0.0838 0.1561 0.0108  -0.0002 0.0242  206 GLN A CD  
2854 O OE1 . GLN A 180 ? 0.1652 0.1131 0.1766 0.0582  -0.0063 0.0272  206 GLN A OE1 
2855 N NE2 . GLN A 180 ? 0.1141 0.1026 0.1345 0.0020  0.0017  0.0361  206 GLN A NE2 
2864 N N   . LEU A 181 ? 0.0693 0.0503 0.0868 -0.0090 0.0015  -0.0023 207 LEU A N   
2865 C CA  . LEU A 181 ? 0.0744 0.0506 0.0812 -0.0136 -0.0078 -0.0043 207 LEU A CA  
2866 C C   . LEU A 181 ? 0.0829 0.0341 0.0746 -0.0046 -0.0116 -0.0014 207 LEU A C   
2867 O O   . LEU A 181 ? 0.0898 0.0489 0.0714 -0.0056 -0.0112 0.0014  207 LEU A O   
2868 C CB  . LEU A 181 ? 0.0726 0.0525 0.0758 -0.0132 -0.0075 0.0052  207 LEU A CB  
2869 C CG  . LEU A 181 ? 0.0670 0.0569 0.0721 -0.0099 -0.0128 0.0067  207 LEU A CG  
2870 C CD1 . LEU A 181 ? 0.0837 0.0589 0.0921 -0.0177 -0.0163 -0.0047 207 LEU A CD1 
2871 C CD2 . LEU A 181 ? 0.0762 0.0532 0.0613 -0.0119 -0.0070 -0.0048 207 LEU A CD2 
2883 N N   . VAL A 182 ? 0.0666 0.0442 0.0707 -0.0121 0.0035  0.0034  208 VAL A N   
2884 C CA  . VAL A 182 ? 0.0696 0.0567 0.0744 -0.0130 0.0091  -0.0025 208 VAL A CA  
2885 C C   . VAL A 182 ? 0.0793 0.0503 0.0852 -0.0122 0.0079  0.0051  208 VAL A C   
2886 O O   . VAL A 182 ? 0.0873 0.0610 0.0785 -0.0109 0.0048  -0.0018 208 VAL A O   
2887 C CB  . VAL A 182 ? 0.0788 0.0847 0.0785 0.0013  0.0026  -0.0153 208 VAL A CB  
2888 C CG1 . VAL A 182 ? 0.0893 0.0931 0.0914 0.0012  0.0124  -0.0178 208 VAL A CG1 
2889 C CG2 . VAL A 182 ? 0.0944 0.1059 0.0808 0.0228  -0.0094 -0.0254 208 VAL A CG2 
2899 N N   . THR A 183 ? 0.1004 0.0572 0.0932 -0.0157 0.0025  0.0118  209 THR A N   
2900 C CA  . THR A 183 ? 0.1269 0.0580 0.1026 -0.0013 -0.0036 0.0200  209 THR A CA  
2901 C C   . THR A 183 ? 0.1164 0.0720 0.0868 0.0038  -0.0014 0.0201  209 THR A C   
2902 O O   . THR A 183 ? 0.1217 0.0751 0.0773 -0.0040 0.0064  0.0169  209 THR A O   
2903 C CB  . THR A 183 ? 0.1712 0.0661 0.1076 0.0050  -0.0017 0.0192  209 THR A CB  
2904 O OG1 . THR A 183 ? 0.1725 0.0728 0.1110 -0.0208 0.0073  0.0247  209 THR A OG1 
2905 C CG2 . THR A 183 ? 0.2009 0.0808 0.1104 0.0250  -0.0109 0.0229  209 THR A CG2 
2913 N N   . TRP A 184 ? 0.1049 0.0747 0.0851 -0.0144 -0.0118 0.0258  210 TRP A N   
2914 C CA  . TRP A 184 ? 0.0835 0.0723 0.0822 -0.0108 -0.0177 0.0158  210 TRP A CA  
2915 C C   . TRP A 184 ? 0.0898 0.0709 0.0604 -0.0123 -0.0097 0.0279  210 TRP A C   
2916 O O   . TRP A 184 ? 0.1113 0.1011 0.0615 -0.0006 -0.0070 0.0245  210 TRP A O   
2917 C CB  . TRP A 184 ? 0.0785 0.0668 0.1088 -0.0028 -0.0095 -0.0036 210 TRP A CB  
2918 C CG  . TRP A 184 ? 0.0752 0.0707 0.1207 0.0027  -0.0208 -0.0053 210 TRP A CG  
2919 C CD1 . TRP A 184 ? 0.0962 0.0861 0.1322 0.0180  -0.0171 0.0067  210 TRP A CD1 
2920 C CD2 . TRP A 184 ? 0.0735 0.0767 0.1300 0.0074  -0.0262 -0.0148 210 TRP A CD2 
2921 N NE1 . TRP A 184 ? 0.0962 0.0981 0.1463 0.0356  -0.0344 0.0012  210 TRP A NE1 
2922 C CE2 . TRP A 184 ? 0.0732 0.1000 0.1505 0.0080  -0.0208 -0.0134 210 TRP A CE2 
2923 C CE3 . TRP A 184 ? 0.0788 0.0762 0.1230 0.0076  -0.0157 -0.0261 210 TRP A CE3 
2924 C CZ2 . TRP A 184 ? 0.0752 0.1140 0.1658 0.0216  -0.0112 -0.0383 210 TRP A CZ2 
2925 C CZ3 . TRP A 184 ? 0.0751 0.0967 0.1369 0.0051  -0.0152 -0.0434 210 TRP A CZ3 
2926 C CH2 . TRP A 184 ? 0.0690 0.1118 0.1578 0.0073  -0.0168 -0.0477 210 TRP A CH2 
2937 N N   . LEU A 185 ? 0.0811 0.0676 0.0592 -0.0069 -0.0106 0.0165  211 LEU A N   
2938 C CA  . LEU A 185 ? 0.0744 0.0637 0.0584 -0.0198 -0.0044 0.0047  211 LEU A CA  
2939 C C   . LEU A 185 ? 0.0822 0.0608 0.0590 -0.0135 -0.0003 0.0061  211 LEU A C   
2940 O O   . LEU A 185 ? 0.0906 0.0591 0.0561 -0.0099 -0.0006 0.0062  211 LEU A O   
2941 C CB  . LEU A 185 ? 0.0820 0.0632 0.0498 -0.0204 0.0016  0.0084  211 LEU A CB  
2942 C CG  . LEU A 185 ? 0.1048 0.0704 0.0462 -0.0213 -0.0050 0.0080  211 LEU A CG  
2943 C CD1 . LEU A 185 ? 0.1106 0.0757 0.0517 -0.0014 -0.0015 0.0074  211 LEU A CD1 
2944 C CD2 . LEU A 185 ? 0.1311 0.0846 0.0566 -0.0499 -0.0107 0.0139  211 LEU A CD2 
2956 N N   . LYS A 186 ? 0.0868 0.0662 0.0669 -0.0198 0.0085  0.0118  212 LYS A N   
2957 C CA  . LYS A 186 ? 0.0998 0.0638 0.0758 -0.0141 0.0125  0.0150  212 LYS A CA  
2958 C C   . LYS A 186 ? 0.1342 0.0694 0.0683 -0.0124 0.0145  0.0072  212 LYS A C   
2959 O O   . LYS A 186 ? 0.1614 0.1366 0.0696 -0.0108 0.0326  0.0149  212 LYS A O   
2960 C CB  . LYS A 186 ? 0.0967 0.0730 0.0832 -0.0210 0.0221  0.0067  212 LYS A CB  
2961 C CG  . LYS A 186 ? 0.1143 0.0837 0.0985 -0.0194 0.0283  -0.0003 212 LYS A CG  
2962 C CD  . LYS A 186 ? 0.1399 0.1070 0.1317 -0.0193 0.0166  -0.0291 212 LYS A CD  
2963 C CE  . LYS A 186 ? 0.1523 0.1219 0.1634 -0.0317 0.0270  -0.0518 212 LYS A CE  
2964 N NZ  . LYS A 186 ? 0.1548 0.1257 0.1984 -0.0487 0.0439  -0.0461 212 LYS A NZ  
2978 N N   . GLY A 187 ? 0.1277 0.0671 0.0681 -0.0002 -0.0078 0.0158  213 GLY A N   
2979 C CA  . GLY A 187 ? 0.1476 0.0577 0.0651 0.0095  -0.0138 0.0211  213 GLY A CA  
2980 C C   . GLY A 187 ? 0.1365 0.0479 0.0669 0.0114  -0.0141 0.0034  213 GLY A C   
2981 O O   . GLY A 187 ? 0.1425 0.0635 0.0852 0.0065  -0.0135 0.0188  213 GLY A O   
2985 N N   . ASN A 188 ? 0.1157 0.0437 0.0497 0.0078  0.0075  -0.0021 214 ASN A N   
2986 C CA  . ASN A 188 ? 0.0964 0.0460 0.0477 0.0077  0.0046  0.0013  214 ASN A CA  
2987 C C   . ASN A 188 ? 0.0834 0.0573 0.0473 0.0126  0.0004  0.0011  214 ASN A C   
2988 O O   . ASN A 188 ? 0.0870 0.0726 0.0555 0.0070  -0.0039 0.0050  214 ASN A O   
2989 C CB  . ASN A 188 ? 0.1029 0.0528 0.0456 0.0023  0.0002  -0.0014 214 ASN A CB  
2990 C CG  . ASN A 188 ? 0.1023 0.0531 0.0477 0.0088  -0.0136 0.0060  214 ASN A CG  
2991 O OD1 . ASN A 188 ? 0.0917 0.0566 0.0562 0.0064  -0.0024 -0.0010 214 ASN A OD1 
2992 N ND2 . ASN A 188 ? 0.0969 0.0515 0.0601 -0.0043 -0.0109 0.0039  214 ASN A ND2 
2999 N N   . THR A 189 ? 0.0792 0.0687 0.0482 0.0131  0.0055  0.0010  215 THR A N   
3000 C CA  . THR A 189 ? 0.0894 0.0763 0.0480 0.0161  0.0023  0.0045  215 THR A CA  
3001 C C   . THR A 189 ? 0.0817 0.0722 0.0445 0.0126  -0.0048 0.0123  215 THR A C   
3002 O O   . THR A 189 ? 0.0931 0.0851 0.0514 0.0165  0.0045  0.0047  215 THR A O   
3003 C CB  . THR A 189 ? 0.0968 0.0766 0.0497 0.0126  0.0085  0.0073  215 THR A CB  
3004 O OG1 . THR A 189 ? 0.0867 0.0823 0.0522 0.0194  -0.0017 -0.0069 215 THR A OG1 
3005 C CG2 . THR A 189 ? 0.1058 0.0706 0.0478 0.0109  0.0066  -0.0023 215 THR A CG2 
3013 N N   . THR A 190 ? 0.0920 0.0734 0.0463 0.0106  -0.0023 -0.0006 216 THR A N   
3014 C CA  . THR A 190 ? 0.0962 0.0637 0.0429 0.0072  -0.0066 -0.0077 216 THR A CA  
3015 C C   . THR A 190 ? 0.1029 0.0645 0.0448 0.0204  -0.0004 0.0016  216 THR A C   
3016 O O   . THR A 190 ? 0.1133 0.0678 0.0696 0.0100  -0.0024 -0.0097 216 THR A O   
3017 C CB  . THR A 190 ? 0.0874 0.0784 0.0458 0.0042  -0.0170 -0.0054 216 THR A CB  
3018 O OG1 . THR A 190 ? 0.0949 0.0614 0.0512 0.0072  -0.0052 -0.0166 216 THR A OG1 
3019 C CG2 . THR A 190 ? 0.1035 0.0975 0.0450 0.0052  0.0077  0.0005  216 THR A CG2 
3027 N N   . GLY A 191 ? 0.0947 0.0697 0.0585 0.0239  -0.0082 0.0020  217 GLY A N   
3028 C CA  . GLY A 191 ? 0.0897 0.0881 0.0643 0.0178  -0.0022 0.0113  217 GLY A CA  
3029 C C   . GLY A 191 ? 0.0863 0.0709 0.0549 0.0016  0.0025  -0.0015 217 GLY A C   
3030 O O   . GLY A 191 ? 0.0864 0.0623 0.0544 0.0085  0.0059  -0.0058 217 GLY A O   
3034 N N   . SER A 192 ? 0.1030 0.0711 0.0533 0.0232  0.0018  -0.0123 218 SER A N   
3035 C CA  . SER A 192 ? 0.1259 0.0745 0.0597 0.0182  0.0169  -0.0048 218 SER A CA  
3036 C C   . SER A 192 ? 0.1113 0.0707 0.0640 -0.0009 0.0166  -0.0080 218 SER A C   
3037 O O   . SER A 192 ? 0.1068 0.0802 0.0846 -0.0075 0.0237  -0.0080 218 SER A O   
3038 C CB  . SER A 192 ? 0.1601 0.0897 0.0793 0.0188  0.0352  0.0015  218 SER A CB  
3039 O OG  . SER A 192 ? 0.1900 0.1331 0.1063 0.0001  0.0152  -0.0113 218 SER A OG  
3045 N N   . ALA A 193 ? 0.0973 0.0668 0.0539 0.0049  0.0094  -0.0191 219 ALA A N   
3046 C CA  . ALA A 193 ? 0.0880 0.0609 0.0620 0.0031  0.0024  -0.0141 219 ALA A CA  
3047 C C   . ALA A 193 ? 0.0831 0.0653 0.0545 -0.0132 0.0058  -0.0173 219 ALA A C   
3048 O O   . ALA A 193 ? 0.1216 0.0616 0.0505 -0.0072 -0.0087 -0.0231 219 ALA A O   
3049 C CB  . ALA A 193 ? 0.1057 0.0841 0.0599 0.0185  -0.0271 -0.0278 219 ALA A CB  
3055 N N   . SER A 194 ? 0.0861 0.0634 0.0461 -0.0039 0.0035  -0.0129 220 SER A N   
3056 C CA  . SER A 194 ? 0.0757 0.0768 0.0479 -0.0141 0.0023  -0.0172 220 SER A CA  
3057 C C   . SER A 194 ? 0.0711 0.0641 0.0503 0.0032  0.0109  -0.0236 220 SER A C   
3058 O O   . SER A 194 ? 0.0713 0.0643 0.0660 -0.0004 0.0070  -0.0214 220 SER A O   
3059 C CB  . SER A 194 ? 0.0745 0.1440 0.0642 -0.0342 -0.0185 -0.0140 220 SER A CB  
3060 O OG  . SER A 194 ? 0.1110 0.2165 0.0921 -0.0177 -0.0082 -0.0282 220 SER A OG  
3066 N N   . ILE A 195 ? 0.0668 0.0531 0.0540 -0.0115 0.0097  -0.0193 221 ILE A N   
3067 C CA  . ILE A 195 ? 0.0615 0.0590 0.0550 -0.0018 0.0120  -0.0123 221 ILE A CA  
3068 C C   . ILE A 195 ? 0.0652 0.0729 0.0620 0.0042  0.0137  -0.0205 221 ILE A C   
3069 O O   . ILE A 195 ? 0.0688 0.0897 0.0696 -0.0117 0.0115  -0.0300 221 ILE A O   
3070 C CB  . ILE A 195 ? 0.0492 0.0513 0.0516 -0.0086 0.0070  -0.0086 221 ILE A CB  
3071 C CG1 . ILE A 195 ? 0.0529 0.0627 0.0564 -0.0035 -0.0004 -0.0129 221 ILE A CG1 
3072 C CG2 . ILE A 195 ? 0.0659 0.0619 0.0589 -0.0062 0.0049  -0.0072 221 ILE A CG2 
3073 C CD1 . ILE A 195 ? 0.0641 0.0462 0.0658 -0.0051 0.0015  -0.0134 221 ILE A CD1 
3085 N N   . ARG A 196 ? 0.0632 0.0798 0.0700 -0.0183 0.0065  -0.0165 222 ARG A N   
3086 C CA  . ARG A 196 ? 0.0907 0.0746 0.0685 -0.0366 0.0160  -0.0130 222 ARG A CA  
3087 C C   . ARG A 196 ? 0.0955 0.0864 0.0731 -0.0232 0.0212  -0.0238 222 ARG A C   
3088 O O   . ARG A 196 ? 0.1101 0.0984 0.0789 -0.0453 0.0299  -0.0341 222 ARG A O   
3089 C CB  . ARG A 196 ? 0.1201 0.0729 0.0708 -0.0241 0.0253  -0.0138 222 ARG A CB  
3090 C CG  . ARG A 196 ? 0.1275 0.0579 0.0656 -0.0268 0.0161  -0.0123 222 ARG A CG  
3091 C CD  . ARG A 196 ? 0.1454 0.0699 0.0753 -0.0105 0.0264  0.0046  222 ARG A CD  
3092 N NE  . ARG A 196 ? 0.1371 0.0729 0.0783 -0.0307 0.0259  -0.0060 222 ARG A NE  
3093 C CZ  . ARG A 196 ? 0.1409 0.0878 0.0803 -0.0542 0.0355  -0.0179 222 ARG A CZ  
3094 N NH1 . ARG A 196 ? 0.1971 0.0739 0.1074 -0.0423 0.0533  -0.0184 222 ARG A NH1 
3095 N NH2 . ARG A 196 ? 0.1322 0.1022 0.0824 -0.0388 0.0391  -0.0389 222 ARG A NH2 
3109 N N   . ALA A 197 ? 0.0914 0.0731 0.0510 -0.0142 0.0160  -0.0140 223 ALA A N   
3110 C CA  . ALA A 197 ? 0.0920 0.0819 0.0520 -0.0049 0.0134  -0.0294 223 ALA A CA  
3111 C C   . ALA A 197 ? 0.0855 0.0758 0.0684 -0.0317 0.0155  -0.0360 223 ALA A C   
3112 O O   . ALA A 197 ? 0.0975 0.1122 0.0660 -0.0073 0.0267  -0.0248 223 ALA A O   
3113 C CB  . ALA A 197 ? 0.0865 0.0868 0.0602 0.0069  0.0107  -0.0195 223 ALA A CB  
3119 N N   . GLY A 198 ? 0.0707 0.0927 0.0804 -0.0155 0.0093  -0.0304 224 GLY A N   
3120 C CA  . GLY A 198 ? 0.0726 0.0962 0.0894 -0.0130 0.0002  -0.0329 224 GLY A CA  
3121 C C   . GLY A 198 ? 0.0771 0.0891 0.1116 -0.0175 0.0036  -0.0182 224 GLY A C   
3122 O O   . GLY A 198 ? 0.0868 0.1118 0.1415 -0.0154 -0.0074 -0.0134 224 GLY A O   
3126 N N   . LEU A 199 ? 0.0873 0.0862 0.1067 -0.0220 0.0048  -0.0243 225 LEU A N   
3127 C CA  . LEU A 199 ? 0.0946 0.1011 0.1109 -0.0357 0.0131  -0.0380 225 LEU A CA  
3128 C C   . LEU A 199 ? 0.1032 0.1062 0.1278 -0.0444 0.0204  -0.0451 225 LEU A C   
3129 O O   . LEU A 199 ? 0.1042 0.1115 0.1240 -0.0318 0.0120  -0.0392 225 LEU A O   
3130 C CB  . LEU A 199 ? 0.1093 0.1209 0.1120 -0.0519 0.0175  -0.0382 225 LEU A CB  
3131 C CG  . LEU A 199 ? 0.1244 0.1599 0.1194 -0.0782 0.0200  -0.0410 225 LEU A CG  
3132 C CD1 . LEU A 199 ? 0.1301 0.1781 0.1240 -0.0815 0.0409  -0.0358 225 LEU A CD1 
3133 C CD2 . LEU A 199 ? 0.1536 0.1696 0.1215 -0.0819 0.0073  -0.0444 225 LEU A CD2 
3145 N N   . PRO A 200 ? 0.1290 0.1225 0.1496 -0.0426 0.0457  -0.0440 226 PRO A N   
3146 C CA  . PRO A 200 ? 0.1595 0.1263 0.1596 -0.0585 0.0665  -0.0306 226 PRO A CA  
3147 C C   . PRO A 200 ? 0.2034 0.1097 0.1515 -0.0428 0.0847  -0.0061 226 PRO A C   
3148 O O   . PRO A 200 ? 0.2130 0.1056 0.1482 -0.0413 0.0934  -0.0135 226 PRO A O   
3149 C CB  . PRO A 200 ? 0.1503 0.1607 0.1725 -0.0688 0.0632  -0.0487 226 PRO A CB  
3150 C CG  . PRO A 200 ? 0.1445 0.1693 0.1763 -0.0557 0.0463  -0.0729 226 PRO A CG  
3151 C CD  . PRO A 200 ? 0.1196 0.1536 0.1676 -0.0524 0.0404  -0.0621 226 PRO A CD  
3159 N N   . LYS A 201 ? 0.2317 0.1201 0.1503 -0.0388 0.0877  0.0070  227 LYS A N   
3160 C CA  . LYS A 201 ? 0.2397 0.1494 0.1354 -0.0506 0.0673  0.0049  227 LYS A CA  
3161 C C   . LYS A 201 ? 0.2471 0.1618 0.1158 -0.0501 0.0522  0.0016  227 LYS A C   
3162 O O   . LYS A 201 ? 0.2460 0.1752 0.1170 -0.0498 0.0287  0.0005  227 LYS A O   
3163 C CB  . LYS A 201 ? 0.2468 0.1683 0.1499 -0.0495 0.0535  -0.0076 227 LYS A CB  
3164 C CG  . LYS A 201 ? 0.2699 0.1982 0.1710 -0.0383 0.0357  -0.0404 227 LYS A CG  
3165 C CD  . LYS A 201 ? 0.2829 0.2414 0.1796 -0.0348 0.0291  -0.0622 227 LYS A CD  
3166 C CE  . LYS A 201 ? 0.2814 0.2659 0.1833 -0.0496 0.0233  -0.0826 227 LYS A CE  
3167 N NZ  . LYS A 201 ? 0.2658 0.2763 0.1857 -0.0817 0.0201  -0.0920 227 LYS A NZ  
3181 N N   . SER A 202 ? 0.2199 0.1244 0.1062 -0.0807 0.0549  -0.0178 228 SER A N   
3182 C CA  . SER A 202 ? 0.2134 0.1476 0.1443 -0.0510 0.0545  -0.0104 228 SER A CA  
3183 C C   . SER A 202 ? 0.1956 0.1261 0.1288 -0.0287 0.0474  -0.0099 228 SER A C   
3184 O O   . SER A 202 ? 0.2027 0.1151 0.1258 -0.0080 0.0296  -0.0153 228 SER A O   
3185 C CB  . SER A 202 ? 0.2157 0.1718 0.2066 -0.0721 0.0490  -0.0222 228 SER A CB  
3186 O OG  . SER A 202 ? 0.2303 0.2099 0.2514 -0.0492 0.0383  -0.0280 228 SER A OG  
3192 N N   . TRP A 203 ? 0.1693 0.1070 0.1304 -0.0235 0.0542  -0.0201 229 TRP A N   
3193 C CA  . TRP A 203 ? 0.1396 0.1097 0.1270 -0.0339 0.0420  -0.0231 229 TRP A CA  
3194 C C   . TRP A 203 ? 0.1315 0.0955 0.1044 -0.0472 0.0328  -0.0236 229 TRP A C   
3195 O O   . TRP A 203 ? 0.1585 0.1199 0.0994 -0.0112 0.0079  -0.0366 229 TRP A O   
3196 C CB  . TRP A 203 ? 0.1096 0.1150 0.1356 -0.0424 0.0408  -0.0290 229 TRP A CB  
3197 C CG  . TRP A 203 ? 0.1016 0.1194 0.1534 -0.0326 0.0293  -0.0461 229 TRP A CG  
3198 C CD1 . TRP A 203 ? 0.1079 0.1163 0.1714 -0.0344 0.0355  -0.0385 229 TRP A CD1 
3199 C CD2 . TRP A 203 ? 0.0806 0.1202 0.1673 -0.0311 0.0170  -0.0484 229 TRP A CD2 
3200 N NE1 . TRP A 203 ? 0.1101 0.1434 0.1931 -0.0397 0.0248  -0.0212 229 TRP A NE1 
3201 C CE2 . TRP A 203 ? 0.1085 0.1590 0.1986 -0.0118 0.0136  -0.0350 229 TRP A CE2 
3202 C CE3 . TRP A 203 ? 0.0815 0.1166 0.1664 -0.0107 0.0029  -0.0376 229 TRP A CE3 
3203 C CZ2 . TRP A 203 ? 0.1053 0.1591 0.2149 -0.0259 0.0084  -0.0166 229 TRP A CZ2 
3204 C CZ3 . TRP A 203 ? 0.0984 0.1352 0.1833 -0.0038 -0.0090 -0.0346 229 TRP A CZ3 
3205 C CH2 . TRP A 203 ? 0.1214 0.1564 0.2114 -0.0062 -0.0129 -0.0267 229 TRP A CH2 
3216 N N   . VAL A 204 ? 0.1155 0.1192 0.0930 -0.0394 0.0237  -0.0348 230 VAL A N   
3217 C CA  . VAL A 204 ? 0.1167 0.1128 0.0823 -0.0206 0.0135  -0.0075 230 VAL A CA  
3218 C C   . VAL A 204 ? 0.0983 0.0922 0.0754 -0.0210 0.0083  -0.0069 230 VAL A C   
3219 O O   . VAL A 204 ? 0.1010 0.0882 0.0864 -0.0244 0.0002  -0.0069 230 VAL A O   
3220 C CB  . VAL A 204 ? 0.1445 0.0926 0.0897 -0.0231 0.0130  -0.0019 230 VAL A CB  
3221 C CG1 . VAL A 204 ? 0.1575 0.1085 0.0918 -0.0026 0.0333  0.0161  230 VAL A CG1 
3222 C CG2 . VAL A 204 ? 0.1487 0.0930 0.0862 -0.0255 0.0224  -0.0080 230 VAL A CG2 
3232 N N   . VAL A 205 ? 0.0976 0.0853 0.0568 -0.0074 0.0095  0.0161  231 VAL A N   
3233 C CA  A VAL A 205 ? 0.1100 0.0734 0.0570 -0.0107 0.0044  0.0033  231 VAL A CA  
3234 C CA  B VAL A 205 ? 0.0924 0.0763 0.0576 -0.0127 0.0047  0.0112  231 VAL A CA  
3235 C C   . VAL A 205 ? 0.0916 0.0644 0.0641 -0.0234 -0.0055 0.0034  231 VAL A C   
3236 O O   . VAL A 205 ? 0.1170 0.0755 0.0694 -0.0102 -0.0177 0.0015  231 VAL A O   
3237 C CB  A VAL A 205 ? 0.1403 0.0922 0.0622 -0.0005 0.0185  -0.0132 231 VAL A CB  
3238 C CB  B VAL A 205 ? 0.0870 0.0821 0.0547 -0.0130 0.0106  0.0091  231 VAL A CB  
3239 C CG1 A VAL A 205 ? 0.1595 0.0487 0.0686 -0.0017 0.0188  -0.0141 231 VAL A CG1 
3240 C CG1 B VAL A 205 ? 0.0918 0.0884 0.0595 -0.0062 0.0081  0.0089  231 VAL A CG1 
3241 C CG2 A VAL A 205 ? 0.1441 0.1247 0.0627 -0.0131 0.0116  -0.0149 231 VAL A CG2 
3242 C CG2 B VAL A 205 ? 0.0809 0.0763 0.0489 -0.0228 0.0183  0.0088  231 VAL A CG2 
3261 N N   . GLY A 206 ? 0.0700 0.0641 0.0846 -0.0353 -0.0109 0.0102  232 GLY A N   
3262 C CA  . GLY A 206 ? 0.0622 0.0678 0.0991 -0.0294 -0.0042 0.0164  232 GLY A CA  
3263 C C   . GLY A 206 ? 0.0456 0.0619 0.0886 -0.0162 -0.0076 0.0262  232 GLY A C   
3264 O O   . GLY A 206 ? 0.0605 0.0658 0.1103 -0.0114 -0.0258 0.0274  232 GLY A O   
3268 N N   . ASP A 207 ? 0.0547 0.0519 0.0689 -0.0076 0.0014  0.0232  233 ASP A N   
3269 C CA  . ASP A 207 ? 0.0573 0.0342 0.0635 -0.0055 0.0013  0.0037  233 ASP A CA  
3270 C C   . ASP A 207 ? 0.0534 0.0368 0.0577 0.0008  -0.0003 -0.0002 233 ASP A C   
3271 O O   . ASP A 207 ? 0.0523 0.0436 0.0628 0.0010  -0.0022 0.0070  233 ASP A O   
3272 C CB  . ASP A 207 ? 0.0604 0.0406 0.0631 0.0022  0.0069  0.0098  233 ASP A CB  
3273 C CG  . ASP A 207 ? 0.0734 0.0361 0.0566 -0.0023 0.0105  -0.0028 233 ASP A CG  
3274 O OD1 . ASP A 207 ? 0.0846 0.0541 0.0604 0.0027  0.0041  0.0060  233 ASP A OD1 
3275 O OD2 . ASP A 207 ? 0.0816 0.0428 0.0536 0.0007  0.0152  -0.0025 233 ASP A OD2 
3280 N N   . LYS A 208 ? 0.0493 0.0361 0.0517 -0.0105 0.0007  0.0118  234 LYS A N   
3281 C CA  . LYS A 208 ? 0.0573 0.0292 0.0553 -0.0038 -0.0059 0.0054  234 LYS A CA  
3282 C C   . LYS A 208 ? 0.0477 0.0363 0.0493 -0.0105 -0.0005 0.0083  234 LYS A C   
3283 O O   . LYS A 208 ? 0.0539 0.0312 0.0451 -0.0019 0.0011  0.0087  234 LYS A O   
3284 C CB  . LYS A 208 ? 0.0513 0.0312 0.0539 -0.0083 0.0038  0.0015  234 LYS A CB  
3285 C CG  . LYS A 208 ? 0.0538 0.0301 0.0522 -0.0065 0.0001  -0.0051 234 LYS A CG  
3286 C CD  . LYS A 208 ? 0.0659 0.0339 0.0554 -0.0088 -0.0048 0.0000  234 LYS A CD  
3287 C CE  . LYS A 208 ? 0.0694 0.0406 0.0513 0.0010  -0.0043 0.0074  234 LYS A CE  
3288 N NZ  . LYS A 208 ? 0.0814 0.0418 0.0434 -0.0014 -0.0036 0.0021  234 LYS A NZ  
3302 N N   . THR A 209 ? 0.0602 0.0293 0.0564 -0.0023 -0.0025 -0.0047 235 THR A N   
3303 C CA  . THR A 209 ? 0.0560 0.0311 0.0523 -0.0040 -0.0061 0.0024  235 THR A CA  
3304 C C   . THR A 209 ? 0.0664 0.0392 0.0474 0.0032  -0.0028 -0.0011 235 THR A C   
3305 O O   . THR A 209 ? 0.0616 0.0431 0.0566 0.0002  -0.0024 -0.0015 235 THR A O   
3306 C CB  . THR A 209 ? 0.0732 0.0496 0.0499 -0.0059 -0.0123 0.0073  235 THR A CB  
3307 O OG1 . THR A 209 ? 0.0994 0.0531 0.0616 -0.0028 -0.0097 0.0091  235 THR A OG1 
3308 C CG2 . THR A 209 ? 0.0989 0.0551 0.0505 -0.0142 0.0007  0.0036  235 THR A CG2 
3316 N N   . GLY A 210 ? 0.0637 0.0373 0.0585 -0.0071 -0.0011 -0.0040 236 GLY A N   
3317 C CA  . GLY A 210 ? 0.0701 0.0493 0.0817 -0.0234 0.0014  0.0012  236 GLY A CA  
3318 C C   . GLY A 210 ? 0.0738 0.0372 0.1132 -0.0033 -0.0074 0.0035  236 GLY A C   
3319 O O   . GLY A 210 ? 0.0944 0.0644 0.1849 0.0023  -0.0353 -0.0365 236 GLY A O   
3323 N N   . SER A 211 ? 0.0854 0.0524 0.1298 0.0073  -0.0337 -0.0239 237 SER A N   
3324 C CA  . SER A 211 ? 0.1066 0.0603 0.1543 -0.0158 -0.0205 -0.0235 237 SER A CA  
3325 C C   . SER A 211 ? 0.0719 0.0699 0.1583 0.0008  -0.0346 -0.0407 237 SER A C   
3326 O O   . SER A 211 ? 0.0861 0.0889 0.2376 0.0089  -0.0275 -0.0621 237 SER A O   
3327 C CB  . SER A 211 ? 0.1796 0.1224 0.1821 -0.0376 0.0066  -0.0239 237 SER A CB  
3328 O OG  . SER A 211 ? 0.2585 0.2343 0.2017 -0.0168 -0.0021 -0.0063 237 SER A OG  
3334 N N   . GLY A 212 ? 0.0695 0.0660 0.1027 -0.0047 -0.0138 -0.0077 238 GLY A N   
3335 C CA  . GLY A 212 ? 0.0792 0.0838 0.0871 -0.0118 -0.0043 -0.0018 238 GLY A CA  
3336 C C   . GLY A 212 ? 0.0667 0.0775 0.0727 -0.0088 -0.0107 -0.0051 238 GLY A C   
3337 O O   . GLY A 212 ? 0.0882 0.0795 0.0655 -0.0137 -0.0133 -0.0037 238 GLY A O   
3341 N N   . ASP A 213 ? 0.0597 0.0858 0.0775 -0.0073 -0.0050 0.0022  240 ASP A N   
3342 C CA  . ASP A 213 ? 0.0631 0.0849 0.0833 -0.0218 -0.0115 0.0090  240 ASP A CA  
3343 C C   . ASP A 213 ? 0.0658 0.0724 0.0621 -0.0259 -0.0075 0.0074  240 ASP A C   
3344 O O   . ASP A 213 ? 0.0714 0.0780 0.0528 -0.0103 -0.0041 -0.0037 240 ASP A O   
3345 C CB  . ASP A 213 ? 0.0814 0.1270 0.1004 -0.0074 -0.0204 0.0243  240 ASP A CB  
3346 C CG  . ASP A 213 ? 0.0956 0.2406 0.1411 -0.0143 -0.0178 0.0764  240 ASP A CG  
3347 O OD1 . ASP A 213 ? 0.1117 0.2836 0.1640 -0.0013 -0.0326 0.0927  240 ASP A OD1 
3348 O OD2 . ASP A 213 ? 0.1023 0.3101 0.1647 0.0110  -0.0089 0.0985  240 ASP A OD2 
3353 N N   . TYR A 214 ? 0.0759 0.0678 0.0576 -0.0318 -0.0099 0.0050  241 TYR A N   
3354 C CA  . TYR A 214 ? 0.0865 0.0566 0.0540 -0.0210 -0.0107 -0.0008 241 TYR A CA  
3355 C C   . TYR A 214 ? 0.0842 0.0485 0.0528 -0.0114 -0.0089 -0.0063 241 TYR A C   
3356 O O   . TYR A 214 ? 0.0796 0.0541 0.0536 -0.0103 -0.0039 -0.0105 241 TYR A O   
3357 C CB  . TYR A 214 ? 0.0978 0.0579 0.0535 -0.0143 -0.0181 0.0101  241 TYR A CB  
3358 C CG  . TYR A 214 ? 0.1080 0.0573 0.0501 -0.0409 0.0039  -0.0061 241 TYR A CG  
3359 C CD1 . TYR A 214 ? 0.1104 0.0778 0.0466 -0.0339 0.0069  -0.0057 241 TYR A CD1 
3360 C CD2 . TYR A 214 ? 0.1302 0.0612 0.0635 -0.0421 0.0196  -0.0116 241 TYR A CD2 
3361 C CE1 . TYR A 214 ? 0.1265 0.1143 0.0655 -0.0393 0.0069  -0.0143 241 TYR A CE1 
3362 C CE2 . TYR A 214 ? 0.1415 0.0807 0.0743 -0.0554 0.0171  -0.0193 241 TYR A CE2 
3363 C CZ  . TYR A 214 ? 0.1342 0.1224 0.0903 -0.0753 0.0210  -0.0147 241 TYR A CZ  
3364 O OH  . TYR A 214 ? 0.1528 0.1604 0.1256 -0.0898 0.0372  -0.0280 241 TYR A OH  
3374 N N   . GLY A 215 ? 0.0767 0.0575 0.0435 -0.0189 -0.0031 -0.0099 242 GLY A N   
3375 C CA  . GLY A 215 ? 0.0647 0.0584 0.0538 -0.0324 -0.0082 -0.0099 242 GLY A CA  
3376 C C   . GLY A 215 ? 0.0695 0.0549 0.0574 -0.0184 0.0086  -0.0017 242 GLY A C   
3377 O O   . GLY A 215 ? 0.0738 0.0481 0.0720 -0.0166 0.0078  -0.0105 242 GLY A O   
3381 N N   . THR A 216 ? 0.0593 0.0530 0.0553 -0.0082 0.0053  -0.0031 243 THR A N   
3382 C CA  . THR A 216 ? 0.0533 0.0413 0.0600 -0.0114 -0.0034 -0.0124 243 THR A CA  
3383 C C   . THR A 216 ? 0.0545 0.0502 0.0649 -0.0054 0.0025  -0.0115 243 THR A C   
3384 O O   . THR A 216 ? 0.0698 0.0511 0.0743 -0.0085 -0.0092 -0.0076 243 THR A O   
3385 C CB  . THR A 216 ? 0.0682 0.0425 0.0608 -0.0056 0.0042  -0.0126 243 THR A CB  
3386 O OG1 . THR A 216 ? 0.0756 0.0540 0.0585 -0.0144 -0.0033 -0.0083 243 THR A OG1 
3387 C CG2 . THR A 216 ? 0.0669 0.0548 0.0519 -0.0082 0.0106  -0.0190 243 THR A CG2 
3395 N N   . THR A 217 ? 0.0606 0.0389 0.0604 -0.0094 0.0001  -0.0094 244 THR A N   
3396 C CA  . THR A 217 ? 0.0708 0.0419 0.0682 -0.0140 -0.0049 -0.0143 244 THR A CA  
3397 C C   . THR A 217 ? 0.0569 0.0340 0.0696 -0.0119 0.0071  -0.0094 244 THR A C   
3398 O O   . THR A 217 ? 0.0662 0.0403 0.0743 -0.0046 0.0024  -0.0122 244 THR A O   
3399 C CB  . THR A 217 ? 0.0883 0.0538 0.0566 -0.0225 -0.0041 -0.0207 244 THR A CB  
3400 O OG1 . THR A 217 ? 0.1049 0.0625 0.0649 -0.0256 -0.0054 -0.0147 244 THR A OG1 
3401 C CG2 . THR A 217 ? 0.1017 0.0644 0.0500 -0.0208 -0.0047 -0.0027 244 THR A CG2 
3409 N N   . ASN A 218 ? 0.0585 0.0295 0.0617 -0.0063 -0.0019 -0.0172 245 ASN A N   
3410 C CA  . ASN A 218 ? 0.0582 0.0323 0.0545 -0.0036 -0.0038 -0.0134 245 ASN A CA  
3411 C C   . ASN A 218 ? 0.0560 0.0352 0.0408 -0.0007 -0.0055 -0.0128 245 ASN A C   
3412 O O   . ASN A 218 ? 0.0621 0.0389 0.0456 0.0049  -0.0009 -0.0063 245 ASN A O   
3413 C CB  . ASN A 218 ? 0.0699 0.0398 0.0587 -0.0022 -0.0013 -0.0074 245 ASN A CB  
3414 C CG  . ASN A 218 ? 0.0576 0.0348 0.0660 -0.0227 -0.0064 -0.0097 245 ASN A CG  
3415 O OD1 . ASN A 218 ? 0.0772 0.0361 0.0712 -0.0075 -0.0087 -0.0020 245 ASN A OD1 
3416 N ND2 . ASN A 218 ? 0.0732 0.0484 0.0587 -0.0130 0.0045  0.0035  245 ASN A ND2 
3423 N N   . ASP A 219 ? 0.0490 0.0333 0.0389 -0.0076 -0.0055 -0.0065 246 ASP A N   
3424 C CA  . ASP A 219 ? 0.0487 0.0346 0.0534 -0.0163 -0.0002 0.0038  246 ASP A CA  
3425 C C   . ASP A 219 ? 0.0477 0.0271 0.0507 -0.0085 -0.0057 0.0022  246 ASP A C   
3426 O O   . ASP A 219 ? 0.0665 0.0353 0.0510 0.0052  -0.0141 -0.0005 246 ASP A O   
3427 C CB  . ASP A 219 ? 0.0559 0.0405 0.0509 -0.0150 -0.0089 -0.0043 246 ASP A CB  
3428 C CG  . ASP A 219 ? 0.0544 0.0536 0.0620 -0.0222 0.0061  -0.0018 246 ASP A CG  
3429 O OD1 . ASP A 219 ? 0.0690 0.0431 0.0568 0.0034  0.0132  -0.0104 246 ASP A OD1 
3430 O OD2 . ASP A 219 ? 0.0691 0.0459 0.0765 -0.0005 0.0130  0.0112  246 ASP A OD2 
3435 N N   . ILE A 220 ? 0.0509 0.0256 0.0515 -0.0025 -0.0050 0.0002  247 ILE A N   
3436 C CA  . ILE A 220 ? 0.0451 0.0345 0.0502 -0.0111 -0.0051 -0.0036 247 ILE A CA  
3437 C C   . ILE A 220 ? 0.0519 0.0319 0.0517 -0.0068 -0.0053 -0.0084 247 ILE A C   
3438 O O   . ILE A 220 ? 0.0540 0.0329 0.0631 0.0011  -0.0079 -0.0008 247 ILE A O   
3439 C CB  . ILE A 220 ? 0.0587 0.0327 0.0520 -0.0093 -0.0106 -0.0059 247 ILE A CB  
3440 C CG1 . ILE A 220 ? 0.0625 0.0381 0.0543 0.0003  -0.0056 -0.0033 247 ILE A CG1 
3441 C CG2 . ILE A 220 ? 0.0605 0.0375 0.0488 -0.0043 -0.0082 -0.0129 247 ILE A CG2 
3442 C CD1 . ILE A 220 ? 0.0532 0.0569 0.0601 -0.0050 0.0035  -0.0011 247 ILE A CD1 
3454 N N   . ALA A 221 ? 0.0573 0.0346 0.0589 -0.0125 -0.0140 -0.0024 248 ALA A N   
3455 C CA  . ALA A 221 ? 0.0550 0.0391 0.0639 -0.0124 -0.0042 -0.0042 248 ALA A CA  
3456 C C   . ALA A 221 ? 0.0447 0.0428 0.0645 -0.0064 0.0052  -0.0058 248 ALA A C   
3457 O O   . ALA A 221 ? 0.0541 0.0336 0.0655 -0.0095 0.0006  -0.0097 248 ALA A O   
3458 C CB  . ALA A 221 ? 0.0570 0.0506 0.0688 -0.0073 -0.0104 -0.0085 248 ALA A CB  
3464 N N   . VAL A 222 ? 0.0463 0.0384 0.0723 -0.0180 -0.0062 0.0007  249 VAL A N   
3465 C CA  A VAL A 222 ? 0.0680 0.0450 0.0788 -0.0056 -0.0093 -0.0037 249 VAL A CA  
3466 C CA  B VAL A 222 ? 0.0587 0.0508 0.0793 -0.0119 -0.0027 -0.0064 249 VAL A CA  
3467 C C   . VAL A 222 ? 0.0639 0.0605 0.0755 -0.0334 -0.0125 -0.0093 249 VAL A C   
3468 O O   . VAL A 222 ? 0.0701 0.0821 0.0730 -0.0203 -0.0172 0.0079  249 VAL A O   
3469 C CB  A VAL A 222 ? 0.0835 0.0474 0.0762 -0.0125 -0.0156 -0.0036 249 VAL A CB  
3470 C CB  B VAL A 222 ? 0.0613 0.0575 0.0833 -0.0074 0.0073  -0.0085 249 VAL A CB  
3471 C CG1 A VAL A 222 ? 0.0543 0.0448 0.0583 -0.0248 -0.0158 -0.0025 249 VAL A CG1 
3472 C CG1 B VAL A 222 ? 0.0645 0.1002 0.0867 0.0167  0.0171  -0.0097 249 VAL A CG1 
3473 C CG2 A VAL A 222 ? 0.0993 0.0704 0.0679 0.0191  -0.0190 -0.0131 249 VAL A CG2 
3474 C CG2 B VAL A 222 ? 0.0524 0.0375 0.0747 -0.0189 0.0075  -0.0181 249 VAL A CG2 
3493 N N   . ILE A 223 ? 0.0605 0.0958 0.0655 -0.0375 -0.0065 0.0149  250 ILE A N   
3494 C CA  . ILE A 223 ? 0.0694 0.0901 0.0623 -0.0341 -0.0055 0.0121  250 ILE A CA  
3495 C C   . ILE A 223 ? 0.0691 0.0923 0.0638 -0.0241 0.0046  0.0074  250 ILE A C   
3496 O O   . ILE A 223 ? 0.0723 0.0873 0.0668 -0.0265 -0.0022 0.0042  250 ILE A O   
3497 C CB  . ILE A 223 ? 0.0866 0.1035 0.0695 -0.0327 -0.0195 0.0119  250 ILE A CB  
3498 C CG1 . ILE A 223 ? 0.1076 0.0957 0.0895 -0.0447 -0.0253 0.0063  250 ILE A CG1 
3499 C CG2 . ILE A 223 ? 0.0914 0.1137 0.0737 -0.0372 -0.0102 0.0017  250 ILE A CG2 
3500 C CD1 . ILE A 223 ? 0.1257 0.1028 0.1007 -0.0447 -0.0333 0.0031  250 ILE A CD1 
3512 N N   . TRP A 224 ? 0.0689 0.0834 0.0613 -0.0290 0.0072  0.0136  251 TRP A N   
3513 C CA  . TRP A 224 ? 0.0735 0.0945 0.0852 -0.0408 0.0026  0.0017  251 TRP A CA  
3514 C C   . TRP A 224 ? 0.0872 0.1095 0.0866 -0.0366 0.0129  0.0051  251 TRP A C   
3515 O O   . TRP A 224 ? 0.0993 0.1405 0.0908 -0.0349 0.0231  0.0221  251 TRP A O   
3516 C CB  . TRP A 224 ? 0.0818 0.0906 0.0945 -0.0380 -0.0135 0.0144  251 TRP A CB  
3517 C CG  . TRP A 224 ? 0.0884 0.0813 0.0922 -0.0246 -0.0185 0.0147  251 TRP A CG  
3518 C CD1 . TRP A 224 ? 0.0965 0.0842 0.0911 -0.0190 -0.0367 0.0051  251 TRP A CD1 
3519 C CD2 . TRP A 224 ? 0.0785 0.0722 0.0816 -0.0266 -0.0216 0.0025  251 TRP A CD2 
3520 N NE1 . TRP A 224 ? 0.1053 0.0841 0.0984 -0.0128 -0.0316 -0.0101 251 TRP A NE1 
3521 C CE2 . TRP A 224 ? 0.0938 0.0797 0.0936 -0.0042 -0.0244 -0.0058 251 TRP A CE2 
3522 C CE3 . TRP A 224 ? 0.0841 0.0820 0.0845 -0.0218 -0.0016 0.0032  251 TRP A CE3 
3523 C CZ2 . TRP A 224 ? 0.1068 0.0941 0.1012 0.0189  -0.0077 -0.0165 251 TRP A CZ2 
3524 C CZ3 . TRP A 224 ? 0.0790 0.0876 0.0895 -0.0150 0.0061  -0.0051 251 TRP A CZ3 
3525 C CH2 . TRP A 224 ? 0.0974 0.0947 0.1001 0.0129  -0.0058 -0.0196 251 TRP A CH2 
3536 N N   . PRO A 225 ? 0.0875 0.1312 0.0880 -0.0118 0.0228  0.0051  252 PRO A N   
3537 C CA  . PRO A 225 ? 0.1090 0.1336 0.1053 -0.0068 0.0305  -0.0049 252 PRO A CA  
3538 C C   . PRO A 225 ? 0.1169 0.1152 0.1079 -0.0363 0.0568  -0.0096 252 PRO A C   
3539 O O   . PRO A 225 ? 0.1153 0.1202 0.1158 -0.0375 0.0320  -0.0085 252 PRO A O   
3540 C CB  . PRO A 225 ? 0.1155 0.1259 0.1291 0.0072  0.0276  -0.0006 252 PRO A CB  
3541 C CG  . PRO A 225 ? 0.1013 0.1217 0.1162 -0.0026 0.0062  0.0120  252 PRO A CG  
3542 C CD  . PRO A 225 ? 0.0791 0.1180 0.0925 -0.0250 0.0052  0.0028  252 PRO A CD  
3550 N N   . GLU A 226 ? 0.1559 0.1135 0.0993 -0.0267 0.0460  -0.0072 254 GLU A N   
3551 C CA  . GLU A 226 ? 0.1549 0.1184 0.1098 -0.0584 0.0432  -0.0108 254 GLU A CA  
3552 C C   . GLU A 226 ? 0.1464 0.1269 0.1108 -0.0619 0.0569  -0.0397 254 GLU A C   
3553 O O   . GLU A 226 ? 0.1709 0.1392 0.1338 -0.0772 0.0661  -0.0626 254 GLU A O   
3554 C CB  . GLU A 226 ? 0.1654 0.1429 0.1082 -0.0545 0.0316  0.0018  254 GLU A CB  
3555 C CG  . GLU A 226 ? 0.1649 0.1676 0.1114 -0.0469 0.0228  0.0166  254 GLU A CG  
3556 C CD  . GLU A 226 ? 0.1738 0.1589 0.1422 -0.0660 -0.0037 0.0152  254 GLU A CD  
3557 O OE1 . GLU A 226 ? 0.1818 0.1879 0.1746 -0.0579 -0.0200 0.0308  254 GLU A OE1 
3558 O OE2 . GLU A 226 ? 0.1827 0.1671 0.1474 -0.0525 0.0094  0.0158  254 GLU A OE2 
3565 N N   . ASN A 227 ? 0.1112 0.1279 0.1027 -0.0548 0.0491  -0.0264 255 ASN A N   
3566 C CA  . ASN A 227 ? 0.0968 0.1376 0.1105 -0.0562 0.0421  -0.0444 255 ASN A CA  
3567 C C   . ASN A 227 ? 0.0907 0.1598 0.1074 -0.0260 0.0246  -0.0423 255 ASN A C   
3568 O O   . ASN A 227 ? 0.0934 0.2377 0.1115 -0.0235 0.0197  -0.0337 255 ASN A O   
3569 C CB  . ASN A 227 ? 0.1186 0.1484 0.1182 -0.0548 0.0444  -0.0476 255 ASN A CB  
3570 C CG  . ASN A 227 ? 0.1490 0.1221 0.1208 -0.0535 0.0668  -0.0482 255 ASN A CG  
3571 O OD1 . ASN A 227 ? 0.1724 0.1168 0.1369 -0.0591 0.0696  -0.0582 255 ASN A OD1 
3572 N ND2 . ASN A 227 ? 0.1900 0.1105 0.1060 -0.0321 0.0707  -0.0307 255 ASN A ND2 
3579 N N   . HIS A 228 ? 0.0879 0.1097 0.1022 -0.0248 0.0278  -0.0313 256 HIS A N   
3580 C CA  . HIS A 228 ? 0.0946 0.0941 0.1084 -0.0180 0.0305  -0.0235 256 HIS A CA  
3581 C C   . HIS A 228 ? 0.0761 0.0619 0.1017 -0.0285 0.0061  -0.0110 256 HIS A C   
3582 O O   . HIS A 228 ? 0.0821 0.0685 0.0980 -0.0191 0.0039  -0.0025 256 HIS A O   
3583 C CB  . HIS A 228 ? 0.1501 0.1373 0.1368 0.0141  0.0440  -0.0140 256 HIS A CB  
3584 C CG  . HIS A 228 ? 0.2234 0.2767 0.1777 0.0929  0.0408  -0.0197 256 HIS A CG  
3585 N ND1 . HIS A 228 ? 0.2783 0.3582 0.2033 0.1527  0.0433  -0.0288 256 HIS A ND1 
3586 C CD2 . HIS A 228 ? 0.2302 0.3360 0.1801 0.1040  0.0586  -0.0130 256 HIS A CD2 
3587 C CE1 . HIS A 228 ? 0.2793 0.3877 0.2077 0.1512  0.0407  -0.0293 256 HIS A CE1 
3588 N NE2 . HIS A 228 ? 0.2639 0.3838 0.2013 0.1489  0.0510  -0.0282 256 HIS A NE2 
3596 N N   . ALA A 229 ? 0.0660 0.0731 0.0884 -0.0175 0.0005  -0.0028 257 ALA A N   
3597 C CA  . ALA A 229 ? 0.0617 0.0651 0.0749 -0.0294 -0.0026 -0.0143 257 ALA A CA  
3598 C C   . ALA A 229 ? 0.0708 0.0465 0.0716 -0.0130 0.0094  -0.0076 257 ALA A C   
3599 O O   . ALA A 229 ? 0.0627 0.0524 0.0810 -0.0111 0.0112  -0.0184 257 ALA A O   
3600 C CB  . ALA A 229 ? 0.0673 0.0874 0.0756 -0.0213 -0.0044 -0.0077 257 ALA A CB  
3606 N N   . PRO A 230 ? 0.0641 0.0503 0.0652 -0.0152 0.0087  -0.0182 258 PRO A N   
3607 C CA  . PRO A 230 ? 0.0689 0.0549 0.0741 -0.0091 0.0007  -0.0106 258 PRO A CA  
3608 C C   . PRO A 230 ? 0.0639 0.0596 0.0670 -0.0099 -0.0025 -0.0148 258 PRO A C   
3609 O O   . PRO A 230 ? 0.0686 0.0570 0.0662 -0.0108 -0.0017 -0.0055 258 PRO A O   
3610 C CB  . PRO A 230 ? 0.0723 0.0505 0.0770 -0.0068 0.0001  0.0014  258 PRO A CB  
3611 C CG  . PRO A 230 ? 0.0712 0.0583 0.0667 -0.0095 0.0057  -0.0068 258 PRO A CG  
3612 C CD  . PRO A 230 ? 0.0677 0.0603 0.0628 -0.0059 -0.0019 -0.0114 258 PRO A CD  
3620 N N   . LEU A 231 ? 0.0601 0.0580 0.0700 -0.0240 -0.0133 -0.0126 259 LEU A N   
3621 C CA  . LEU A 231 ? 0.0654 0.0511 0.0832 -0.0266 -0.0076 -0.0093 259 LEU A CA  
3622 C C   . LEU A 231 ? 0.0631 0.0498 0.0793 -0.0273 -0.0141 -0.0128 259 LEU A C   
3623 O O   . LEU A 231 ? 0.0635 0.0821 0.0963 -0.0142 -0.0111 0.0203  259 LEU A O   
3624 C CB  . LEU A 231 ? 0.0742 0.0657 0.0988 -0.0180 0.0019  -0.0255 259 LEU A CB  
3625 C CG  . LEU A 231 ? 0.0826 0.0839 0.1130 -0.0037 -0.0012 -0.0376 259 LEU A CG  
3626 C CD1 . LEU A 231 ? 0.1092 0.1090 0.1174 -0.0041 0.0041  -0.0363 259 LEU A CD1 
3627 C CD2 . LEU A 231 ? 0.0654 0.0993 0.1278 -0.0066 0.0060  -0.0242 259 LEU A CD2 
3639 N N   . VAL A 232 ? 0.0627 0.0385 0.0745 -0.0255 0.0006  -0.0080 260 VAL A N   
3640 C CA  . VAL A 232 ? 0.0609 0.0394 0.0711 -0.0130 0.0020  -0.0021 260 VAL A CA  
3641 C C   . VAL A 232 ? 0.0512 0.0569 0.0709 -0.0168 -0.0091 0.0137  260 VAL A C   
3642 O O   . VAL A 232 ? 0.0547 0.0472 0.0874 -0.0128 -0.0227 0.0060  260 VAL A O   
3643 C CB  . VAL A 232 ? 0.0694 0.0551 0.0807 -0.0058 0.0039  -0.0024 260 VAL A CB  
3644 C CG1 . VAL A 232 ? 0.0627 0.0781 0.0777 -0.0105 -0.0055 0.0099  260 VAL A CG1 
3645 C CG2 . VAL A 232 ? 0.0793 0.0676 0.0890 -0.0104 0.0079  -0.0135 260 VAL A CG2 
3655 N N   . LEU A 233 ? 0.0465 0.0444 0.0708 -0.0072 -0.0129 0.0021  261 LEU A N   
3656 C CA  . LEU A 233 ? 0.0553 0.0437 0.0700 -0.0058 -0.0118 -0.0045 261 LEU A CA  
3657 C C   . LEU A 233 ? 0.0568 0.0357 0.0670 -0.0013 -0.0132 -0.0104 261 LEU A C   
3658 O O   . LEU A 233 ? 0.0667 0.0410 0.0703 -0.0057 -0.0190 -0.0057 261 LEU A O   
3659 C CB  . LEU A 233 ? 0.0489 0.0579 0.0833 -0.0132 -0.0108 -0.0090 261 LEU A CB  
3660 C CG  . LEU A 233 ? 0.0614 0.0546 0.0861 -0.0018 -0.0097 -0.0144 261 LEU A CG  
3661 C CD1 . LEU A 233 ? 0.0683 0.0519 0.0805 0.0043  -0.0018 -0.0173 261 LEU A CD1 
3662 C CD2 . LEU A 233 ? 0.0770 0.0733 0.0932 0.0029  -0.0061 -0.0273 261 LEU A CD2 
3674 N N   . VAL A 234 ? 0.0546 0.0317 0.0818 -0.0041 -0.0184 0.0010  262 VAL A N   
3675 C CA  . VAL A 234 ? 0.0582 0.0332 0.0766 -0.0057 -0.0141 -0.0027 262 VAL A CA  
3676 C C   . VAL A 234 ? 0.0563 0.0283 0.0786 -0.0127 -0.0173 0.0004  262 VAL A C   
3677 O O   . VAL A 234 ? 0.0660 0.0402 0.0917 0.0020  -0.0262 -0.0065 262 VAL A O   
3678 C CB  . VAL A 234 ? 0.0662 0.0444 0.0846 -0.0127 -0.0135 -0.0019 262 VAL A CB  
3679 C CG1 . VAL A 234 ? 0.0765 0.0539 0.1052 -0.0103 -0.0112 -0.0022 262 VAL A CG1 
3680 C CG2 . VAL A 234 ? 0.0670 0.0540 0.0794 -0.0179 -0.0140 -0.0070 262 VAL A CG2 
3690 N N   . THR A 235 ? 0.0601 0.0361 0.0753 -0.0025 -0.0171 -0.0003 263 THR A N   
3691 C CA  . THR A 235 ? 0.0657 0.0252 0.0887 0.0027  -0.0102 -0.0098 263 THR A CA  
3692 C C   . THR A 235 ? 0.0573 0.0246 0.0814 -0.0062 -0.0085 -0.0070 263 THR A C   
3693 O O   . THR A 235 ? 0.0611 0.0312 0.0866 -0.0050 -0.0056 -0.0071 263 THR A O   
3694 C CB  . THR A 235 ? 0.0604 0.0407 0.0921 -0.0041 -0.0124 -0.0176 263 THR A CB  
3695 O OG1 . THR A 235 ? 0.0645 0.0388 0.0816 -0.0038 -0.0091 -0.0180 263 THR A OG1 
3696 C CG2 . THR A 235 ? 0.0668 0.0476 0.0991 -0.0002 -0.0045 -0.0163 263 THR A CG2 
3704 N N   . TYR A 236 ? 0.0550 0.0335 0.0796 0.0015  -0.0188 -0.0212 264 TYR A N   
3705 C CA  . TYR A 236 ? 0.0560 0.0379 0.0804 -0.0031 -0.0188 -0.0210 264 TYR A CA  
3706 C C   . TYR A 236 ? 0.0564 0.0398 0.0843 -0.0113 -0.0199 -0.0031 264 TYR A C   
3707 O O   . TYR A 236 ? 0.0663 0.0479 0.1032 0.0000  -0.0298 -0.0217 264 TYR A O   
3708 C CB  . TYR A 236 ? 0.0599 0.0437 0.0878 -0.0026 -0.0099 -0.0035 264 TYR A CB  
3709 C CG  . TYR A 236 ? 0.0511 0.0339 0.0801 -0.0142 -0.0117 -0.0068 264 TYR A CG  
3710 C CD1 . TYR A 236 ? 0.0639 0.0384 0.0790 -0.0047 -0.0092 0.0031  264 TYR A CD1 
3711 C CD2 . TYR A 236 ? 0.0745 0.0513 0.0853 -0.0100 0.0018  0.0098  264 TYR A CD2 
3712 C CE1 . TYR A 236 ? 0.0703 0.0302 0.0707 -0.0058 -0.0122 -0.0147 264 TYR A CE1 
3713 C CE2 . TYR A 236 ? 0.0802 0.0550 0.0770 0.0043  -0.0044 -0.0112 264 TYR A CE2 
3714 C CZ  . TYR A 236 ? 0.0775 0.0364 0.0698 -0.0054 -0.0078 -0.0183 264 TYR A CZ  
3715 O OH  . TYR A 236 ? 0.0827 0.0447 0.0648 -0.0147 -0.0020 0.0006  264 TYR A OH  
3725 N N   . PHE A 237 ? 0.0520 0.0338 0.0908 -0.0045 -0.0074 -0.0068 265 PHE A N   
3726 C CA  . PHE A 237 ? 0.0565 0.0278 0.0884 0.0010  -0.0025 -0.0093 265 PHE A CA  
3727 C C   . PHE A 237 ? 0.0562 0.0353 0.0778 -0.0006 0.0042  -0.0227 265 PHE A C   
3728 O O   . PHE A 237 ? 0.0618 0.0389 0.0705 -0.0037 0.0009  -0.0069 265 PHE A O   
3729 C CB  . PHE A 237 ? 0.0705 0.0467 0.1005 -0.0053 0.0057  -0.0146 265 PHE A CB  
3730 C CG  . PHE A 237 ? 0.0831 0.0429 0.0985 -0.0076 0.0083  -0.0195 265 PHE A CG  
3731 C CD1 . PHE A 237 ? 0.1051 0.0542 0.1091 0.0014  -0.0106 -0.0365 265 PHE A CD1 
3732 C CD2 . PHE A 237 ? 0.0898 0.0459 0.0921 -0.0071 0.0171  -0.0094 265 PHE A CD2 
3733 C CE1 . PHE A 237 ? 0.1172 0.0756 0.1213 0.0065  -0.0184 -0.0366 265 PHE A CE1 
3734 C CE2 . PHE A 237 ? 0.1013 0.0520 0.0972 -0.0240 -0.0001 -0.0123 265 PHE A CE2 
3735 C CZ  . PHE A 237 ? 0.1080 0.0505 0.1078 -0.0089 -0.0003 -0.0287 265 PHE A CZ  
3745 N N   . THR A 238 ? 0.0622 0.0388 0.0638 -0.0072 0.0000  -0.0129 266 THR A N   
3746 C CA  . THR A 238 ? 0.0708 0.0399 0.0633 -0.0159 0.0035  -0.0168 266 THR A CA  
3747 C C   . THR A 238 ? 0.0771 0.0422 0.0704 -0.0197 0.0094  -0.0094 266 THR A C   
3748 O O   . THR A 238 ? 0.0720 0.0406 0.0897 -0.0062 -0.0014 -0.0181 266 THR A O   
3749 C CB  . THR A 238 ? 0.0661 0.0526 0.0678 -0.0074 -0.0043 -0.0159 266 THR A CB  
3750 O OG1 . THR A 238 ? 0.0608 0.0607 0.0675 -0.0102 0.0054  -0.0032 266 THR A OG1 
3751 C CG2 . THR A 238 ? 0.0829 0.0549 0.0621 -0.0069 -0.0116 -0.0102 266 THR A CG2 
3759 N N   . GLN A 239 ? 0.0711 0.0327 0.0575 -0.0148 0.0100  -0.0058 267 GLN A N   
3760 C CA  . GLN A 239 ? 0.0931 0.0378 0.0643 -0.0154 0.0130  -0.0145 267 GLN A CA  
3761 C C   . GLN A 239 ? 0.1057 0.0498 0.0591 -0.0183 0.0213  -0.0218 267 GLN A C   
3762 O O   . GLN A 239 ? 0.1013 0.0521 0.0664 -0.0277 0.0118  -0.0136 267 GLN A O   
3763 C CB  . GLN A 239 ? 0.1036 0.0420 0.0707 -0.0082 0.0157  -0.0105 267 GLN A CB  
3764 C CG  . GLN A 239 ? 0.0907 0.0621 0.0716 -0.0268 0.0206  -0.0021 267 GLN A CG  
3765 C CD  . GLN A 239 ? 0.1045 0.0621 0.0663 -0.0252 0.0233  -0.0210 267 GLN A CD  
3766 O OE1 . GLN A 239 ? 0.1361 0.0532 0.0741 -0.0246 0.0311  -0.0212 267 GLN A OE1 
3767 N NE2 . GLN A 239 ? 0.1084 0.0573 0.0609 -0.0187 0.0184  -0.0121 267 GLN A NE2 
3776 N N   . PRO A 240 ? 0.1174 0.0526 0.0788 -0.0349 0.0197  -0.0171 268 PRO A N   
3777 C CA  . PRO A 240 ? 0.1601 0.0543 0.0965 -0.0284 0.0425  -0.0082 268 PRO A CA  
3778 C C   . PRO A 240 ? 0.1523 0.0834 0.0974 -0.0553 0.0469  -0.0204 268 PRO A C   
3779 O O   . PRO A 240 ? 0.2011 0.1072 0.1126 -0.0682 0.0542  -0.0198 268 PRO A O   
3780 C CB  . PRO A 240 ? 0.1797 0.0566 0.1188 -0.0142 0.0448  -0.0180 268 PRO A CB  
3781 C CG  . PRO A 240 ? 0.1779 0.0562 0.1141 -0.0068 0.0389  -0.0202 268 PRO A CG  
3782 C CD  . PRO A 240 ? 0.1328 0.0498 0.0866 -0.0203 0.0148  -0.0242 268 PRO A CD  
3790 N N   . GLU A 241 ? 0.1161 0.0891 0.0888 -0.0551 0.0249  -0.0292 269 GLU A N   
3791 C CA  . GLU A 241 ? 0.1355 0.1145 0.0924 -0.0650 0.0291  -0.0325 269 GLU A CA  
3792 C C   . GLU A 241 ? 0.1268 0.1133 0.0750 -0.0671 0.0207  -0.0252 269 GLU A C   
3793 O O   . GLU A 241 ? 0.1284 0.1158 0.0681 -0.0610 0.0145  -0.0304 269 GLU A O   
3794 C CB  . GLU A 241 ? 0.1403 0.1839 0.1137 -0.0461 0.0174  -0.0553 269 GLU A CB  
3795 C CG  . GLU A 241 ? 0.1482 0.1653 0.1091 -0.0386 -0.0002 -0.0536 269 GLU A CG  
3796 C CD  . GLU A 241 ? 0.1369 0.1175 0.1060 -0.0100 0.0120  -0.0420 269 GLU A CD  
3797 O OE1 . GLU A 241 ? 0.1032 0.1136 0.1145 -0.0142 0.0119  -0.0099 269 GLU A OE1 
3798 O OE2 . GLU A 241 ? 0.1410 0.1271 0.1102 -0.0063 0.0168  -0.0342 269 GLU A OE2 
3805 N N   . GLN A 242 ? 0.1187 0.1109 0.0745 -0.0662 0.0156  -0.0227 270 GLN A N   
3806 C CA  A GLN A 242 ? 0.1182 0.1376 0.0827 -0.0634 0.0085  -0.0245 270 GLN A CA  
3807 C CA  B GLN A 242 ? 0.1156 0.1340 0.0780 -0.0659 0.0110  -0.0171 270 GLN A CA  
3808 C C   . GLN A 242 ? 0.1144 0.1301 0.0765 -0.0681 -0.0043 -0.0145 270 GLN A C   
3809 O O   . GLN A 242 ? 0.1025 0.1310 0.0758 -0.0442 -0.0176 -0.0007 270 GLN A O   
3810 C CB  A GLN A 242 ? 0.1226 0.1527 0.1091 -0.0563 0.0067  -0.0416 270 GLN A CB  
3811 C CB  B GLN A 242 ? 0.1141 0.1515 0.0915 -0.0569 0.0193  -0.0150 270 GLN A CB  
3812 C CG  A GLN A 242 ? 0.1174 0.1745 0.1340 -0.0631 0.0079  -0.0559 270 GLN A CG  
3813 C CG  B GLN A 242 ? 0.1107 0.1735 0.1045 -0.0528 0.0253  -0.0143 270 GLN A CG  
3814 C CD  A GLN A 242 ? 0.1345 0.1960 0.1562 -0.0506 0.0037  -0.0730 270 GLN A CD  
3815 C CD  B GLN A 242 ? 0.1241 0.1832 0.1163 -0.0447 0.0260  -0.0056 270 GLN A CD  
3816 O OE1 A GLN A 242 ? 0.1604 0.2186 0.1803 -0.0044 0.0199  -0.0644 270 GLN A OE1 
3817 O OE1 B GLN A 242 ? 0.1444 0.2260 0.1219 -0.0090 0.0308  0.0102  270 GLN A OE1 
3818 N NE2 A GLN A 242 ? 0.1285 0.1823 0.1528 -0.0553 -0.0087 -0.0722 270 GLN A NE2 
3819 N NE2 B GLN A 242 ? 0.1134 0.1494 0.1169 -0.0712 0.0236  0.0019  270 GLN A NE2 
3836 N N   . LYS A 243 ? 0.1358 0.1415 0.0792 -0.0681 -0.0122 -0.0198 271 LYS A N   
3837 C CA  . LYS A 243 ? 0.1519 0.1599 0.0884 -0.0700 -0.0204 -0.0227 271 LYS A CA  
3838 C C   . LYS A 243 ? 0.1589 0.1114 0.0726 -0.0514 -0.0050 -0.0284 271 LYS A C   
3839 O O   . LYS A 243 ? 0.2080 0.1060 0.0675 -0.0031 -0.0009 -0.0194 271 LYS A O   
3840 C CB  . LYS A 243 ? 0.1874 0.2592 0.1257 -0.0902 -0.0374 -0.0265 271 LYS A CB  
3841 C CG  . LYS A 243 ? 0.2003 0.3396 0.1694 -0.1126 -0.0420 -0.0279 271 LYS A CG  
3842 C CD  . LYS A 243 ? 0.2600 0.4374 0.2140 -0.0422 -0.0272 -0.0260 271 LYS A CD  
3843 C CE  . LYS A 243 ? 0.3121 0.4885 0.2454 0.0009  -0.0279 -0.0292 271 LYS A CE  
3844 N NZ  . LYS A 243 ? 0.3397 0.5235 0.2602 0.0236  -0.0288 -0.0241 271 LYS A NZ  
3858 N N   . ALA A 244 ? 0.1455 0.0855 0.0760 -0.0523 -0.0009 -0.0198 272 ALA A N   
3859 C CA  . ALA A 244 ? 0.1514 0.0841 0.0660 -0.0529 0.0117  -0.0136 272 ALA A CA  
3860 C C   . ALA A 244 ? 0.1506 0.0868 0.0589 -0.0315 0.0113  -0.0245 272 ALA A C   
3861 O O   . ALA A 244 ? 0.1601 0.0846 0.0584 -0.0232 0.0187  -0.0209 272 ALA A O   
3862 C CB  . ALA A 244 ? 0.1548 0.0633 0.0712 -0.0341 0.0141  -0.0209 272 ALA A CB  
3868 N N   . GLU A 245 ? 0.1484 0.0898 0.0644 -0.0320 0.0130  -0.0212 273 GLU A N   
3869 C CA  . GLU A 245 ? 0.1499 0.0828 0.0660 -0.0324 0.0077  -0.0041 273 GLU A CA  
3870 C C   . GLU A 245 ? 0.1672 0.0676 0.0623 -0.0305 0.0042  -0.0023 273 GLU A C   
3871 O O   . GLU A 245 ? 0.1932 0.0889 0.0713 -0.0268 -0.0090 -0.0004 273 GLU A O   
3872 C CB  . GLU A 245 ? 0.1422 0.0805 0.0739 -0.0075 0.0158  -0.0110 273 GLU A CB  
3873 C CG  . GLU A 245 ? 0.1359 0.0893 0.0722 0.0040  0.0041  -0.0233 273 GLU A CG  
3874 C CD  . GLU A 245 ? 0.1290 0.0796 0.0864 -0.0115 0.0126  0.0029  273 GLU A CD  
3875 O OE1 . GLU A 245 ? 0.1509 0.1384 0.1102 0.0163  0.0188  0.0137  273 GLU A OE1 
3876 O OE2 . GLU A 245 ? 0.1055 0.1153 0.0817 -0.0003 0.0160  -0.0226 273 GLU A OE2 
3883 N N   . ASN A 246 ? 0.1628 0.0865 0.0673 -0.0314 -0.0062 -0.0043 274 ASN A N   
3884 C CA  . ASN A 246 ? 0.1601 0.0766 0.0622 -0.0427 0.0000  -0.0168 274 ASN A CA  
3885 C C   . ASN A 246 ? 0.1569 0.0788 0.0583 -0.0323 0.0151  -0.0008 274 ASN A C   
3886 O O   . ASN A 246 ? 0.1733 0.0770 0.0653 -0.0150 0.0038  -0.0039 274 ASN A O   
3887 C CB  . ASN A 246 ? 0.1786 0.1009 0.0808 -0.0152 -0.0033 -0.0014 274 ASN A CB  
3888 C CG  . ASN A 246 ? 0.1725 0.1416 0.0974 -0.0082 0.0009  -0.0025 274 ASN A CG  
3889 O OD1 . ASN A 246 ? 0.1780 0.2339 0.1053 0.0197  0.0123  0.0182  274 ASN A OD1 
3890 N ND2 . ASN A 246 ? 0.1356 0.1244 0.0888 -0.0332 0.0048  -0.0030 274 ASN A ND2 
3897 N N   . ARG A 247 ? 0.1441 0.0771 0.0666 -0.0431 0.0198  -0.0095 275 ARG A N   
3898 C CA  . ARG A 247 ? 0.1527 0.0680 0.0607 -0.0239 0.0340  -0.0129 275 ARG A CA  
3899 C C   . ARG A 247 ? 0.1273 0.0636 0.0578 -0.0254 0.0266  -0.0063 275 ARG A C   
3900 O O   . ARG A 247 ? 0.1422 0.0653 0.0721 -0.0152 0.0282  -0.0154 275 ARG A O   
3901 C CB  . ARG A 247 ? 0.1682 0.0641 0.0772 -0.0230 0.0302  -0.0236 275 ARG A CB  
3902 C CG  . ARG A 247 ? 0.1859 0.0655 0.0840 -0.0175 0.0379  -0.0218 275 ARG A CG  
3903 C CD  . ARG A 247 ? 0.1750 0.0923 0.0800 -0.0305 0.0259  -0.0229 275 ARG A CD  
3904 N NE  . ARG A 247 ? 0.1721 0.0658 0.0694 -0.0041 0.0036  -0.0243 275 ARG A NE  
3905 C CZ  . ARG A 247 ? 0.2148 0.0719 0.0982 0.0005  -0.0440 -0.0203 275 ARG A CZ  
3906 N NH1 . ARG A 247 ? 0.2845 0.0759 0.1020 0.0009  -0.0586 0.0018  275 ARG A NH1 
3907 N NH2 . ARG A 247 ? 0.2136 0.0928 0.1303 0.0253  -0.0668 -0.0398 275 ARG A NH2 
3921 N N   . ASN A 248 ? 0.1185 0.0638 0.0739 -0.0233 0.0185  -0.0060 276 ASN A N   
3922 C CA  . ASN A 248 ? 0.1003 0.0537 0.0964 -0.0356 0.0229  -0.0025 276 ASN A CA  
3923 C C   . ASN A 248 ? 0.1053 0.0427 0.0950 -0.0163 0.0104  -0.0040 276 ASN A C   
3924 O O   . ASN A 248 ? 0.1184 0.0413 0.1021 -0.0095 0.0019  -0.0129 276 ASN A O   
3925 C CB  . ASN A 248 ? 0.1209 0.0645 0.1368 -0.0063 0.0209  -0.0175 276 ASN A CB  
3926 C CG  . ASN A 248 ? 0.1721 0.0746 0.1723 0.0155  0.0233  0.0023  276 ASN A CG  
3927 O OD1 . ASN A 248 ? 0.1979 0.1013 0.1685 0.0163  0.0567  -0.0083 276 ASN A OD1 
3928 N ND2 . ASN A 248 ? 0.1572 0.1383 0.1904 0.0464  0.0148  0.0492  276 ASN A ND2 
3935 N N   . ASP A 249 ? 0.1010 0.0496 0.0892 -0.0020 -0.0042 -0.0155 277 ASP A N   
3936 C CA  . ASP A 249 ? 0.1029 0.0481 0.0827 -0.0038 0.0062  -0.0088 277 ASP A CA  
3937 C C   . ASP A 249 ? 0.1020 0.0607 0.0872 -0.0169 -0.0015 -0.0211 277 ASP A C   
3938 O O   . ASP A 249 ? 0.1049 0.0706 0.0919 -0.0152 0.0052  -0.0250 277 ASP A O   
3939 C CB  . ASP A 249 ? 0.1173 0.0774 0.0978 0.0143  0.0119  -0.0173 277 ASP A CB  
3940 C CG  . ASP A 249 ? 0.1540 0.0707 0.1575 -0.0001 0.0069  -0.0524 277 ASP A CG  
3941 O OD1 . ASP A 249 ? 0.1994 0.0717 0.1699 -0.0041 0.0581  -0.0280 277 ASP A OD1 
3942 O OD2 . ASP A 249 ? 0.1842 0.0907 0.2409 0.0247  -0.0025 -0.0552 277 ASP A OD2 
3947 N N   . ILE A 250 ? 0.1070 0.0584 0.0866 -0.0088 -0.0126 -0.0133 278 ILE A N   
3948 C CA  . ILE A 250 ? 0.1070 0.0614 0.0835 -0.0176 -0.0075 -0.0073 278 ILE A CA  
3949 C C   . ILE A 250 ? 0.0768 0.0647 0.0892 -0.0187 -0.0051 -0.0111 278 ILE A C   
3950 O O   . ILE A 250 ? 0.0905 0.0645 0.0981 -0.0093 -0.0053 -0.0280 278 ILE A O   
3951 C CB  . ILE A 250 ? 0.1331 0.0567 0.0975 -0.0339 -0.0228 -0.0030 278 ILE A CB  
3952 C CG1 . ILE A 250 ? 0.1610 0.0694 0.1247 -0.0315 -0.0382 0.0091  278 ILE A CG1 
3953 C CG2 . ILE A 250 ? 0.1450 0.0978 0.0938 -0.0255 -0.0257 -0.0045 278 ILE A CG2 
3954 C CD1 . ILE A 250 ? 0.1706 0.1009 0.1400 -0.0326 -0.0312 -0.0092 278 ILE A CD1 
3966 N N   . LEU A 251 ? 0.0676 0.0749 0.0867 -0.0130 0.0064  -0.0139 279 LEU A N   
3967 C CA  . LEU A 251 ? 0.0578 0.0680 0.0790 -0.0206 0.0044  -0.0164 279 LEU A CA  
3968 C C   . LEU A 251 ? 0.0667 0.0698 0.0835 0.0057  0.0023  -0.0288 279 LEU A C   
3969 O O   . LEU A 251 ? 0.0721 0.0796 0.1020 -0.0062 0.0048  -0.0309 279 LEU A O   
3970 C CB  . LEU A 251 ? 0.0691 0.0667 0.0741 -0.0193 0.0059  -0.0179 279 LEU A CB  
3971 C CG  . LEU A 251 ? 0.0611 0.0552 0.0769 -0.0158 0.0017  -0.0267 279 LEU A CG  
3972 C CD1 . LEU A 251 ? 0.0649 0.0584 0.0713 -0.0100 0.0056  -0.0115 279 LEU A CD1 
3973 C CD2 . LEU A 251 ? 0.0736 0.0601 0.0923 -0.0174 -0.0006 -0.0201 279 LEU A CD2 
3985 N N   . ALA A 252 ? 0.0720 0.0739 0.0903 -0.0069 0.0019  -0.0306 280 ALA A N   
3986 C CA  . ALA A 252 ? 0.0794 0.0639 0.1128 -0.0170 0.0213  -0.0225 280 ALA A CA  
3987 C C   . ALA A 252 ? 0.0777 0.0721 0.1227 -0.0121 0.0250  -0.0368 280 ALA A C   
3988 O O   . ALA A 252 ? 0.0797 0.0755 0.1300 -0.0103 0.0390  -0.0308 280 ALA A O   
3989 C CB  . ALA A 252 ? 0.0979 0.0744 0.1155 -0.0076 0.0247  -0.0253 280 ALA A CB  
3995 N N   . ALA A 253 ? 0.0882 0.0744 0.1347 -0.0114 0.0194  -0.0463 281 ALA A N   
3996 C CA  . ALA A 253 ? 0.0927 0.0815 0.1551 0.0048  0.0264  -0.0515 281 ALA A CA  
3997 C C   . ALA A 253 ? 0.0850 0.0803 0.1568 0.0115  0.0151  -0.0523 281 ALA A C   
3998 O O   . ALA A 253 ? 0.0875 0.0862 0.1617 0.0102  0.0226  -0.0403 281 ALA A O   
3999 C CB  . ALA A 253 ? 0.0916 0.0802 0.1723 0.0011  0.0185  -0.0513 281 ALA A CB  
4005 N N   . ALA A 254 ? 0.0735 0.0647 0.1599 -0.0122 0.0098  -0.0368 282 ALA A N   
4006 C CA  . ALA A 254 ? 0.0698 0.0690 0.1536 0.0023  -0.0022 -0.0257 282 ALA A CA  
4007 C C   . ALA A 254 ? 0.0675 0.0701 0.1412 0.0114  0.0019  -0.0222 282 ALA A C   
4008 O O   . ALA A 254 ? 0.0758 0.0795 0.1400 0.0126  0.0023  -0.0270 282 ALA A O   
4009 C CB  . ALA A 254 ? 0.0719 0.0743 0.1457 -0.0088 -0.0051 -0.0136 282 ALA A CB  
4015 N N   . ALA A 255 ? 0.0742 0.0711 0.1313 0.0057  0.0038  -0.0295 283 ALA A N   
4016 C CA  . ALA A 255 ? 0.0820 0.0660 0.1382 0.0074  0.0010  -0.0388 283 ALA A CA  
4017 C C   . ALA A 255 ? 0.0790 0.0771 0.1540 0.0034  0.0091  -0.0374 283 ALA A C   
4018 O O   . ALA A 255 ? 0.0780 0.0939 0.1607 0.0029  -0.0092 -0.0343 283 ALA A O   
4019 C CB  . ALA A 255 ? 0.0912 0.0707 0.1354 -0.0016 0.0095  -0.0075 283 ALA A CB  
4025 N N   . LYS A 256 ? 0.0811 0.0883 0.1641 0.0011  0.0301  -0.0377 284 LYS A N   
4026 C CA  . LYS A 256 ? 0.0812 0.1018 0.1996 -0.0093 0.0320  -0.0434 284 LYS A CA  
4027 C C   . LYS A 256 ? 0.0737 0.1202 0.2229 -0.0001 0.0320  -0.0376 284 LYS A C   
4028 O O   . LYS A 256 ? 0.0770 0.1385 0.2406 -0.0023 0.0338  -0.0280 284 LYS A O   
4029 C CB  . LYS A 256 ? 0.1088 0.1318 0.2170 -0.0205 0.0603  -0.0280 284 LYS A CB  
4030 C CG  . LYS A 256 ? 0.1697 0.1861 0.2289 0.0145  0.0761  -0.0249 284 LYS A CG  
4031 C CD  . LYS A 256 ? 0.2331 0.2626 0.2485 0.0328  0.0941  -0.0007 284 LYS A CD  
4032 C CE  . LYS A 256 ? 0.2879 0.3155 0.2657 0.0399  0.0928  0.0092  284 LYS A CE  
4033 N NZ  . LYS A 256 ? 0.3302 0.3561 0.2847 0.0502  0.0810  0.0145  284 LYS A NZ  
4047 N N   . ILE A 257 ? 0.0755 0.1130 0.2275 0.0138  0.0181  -0.0429 285 ILE A N   
4048 C CA  . ILE A 257 ? 0.0755 0.1177 0.2415 0.0092  0.0084  -0.0328 285 ILE A CA  
4049 C C   . ILE A 257 ? 0.0789 0.1393 0.2351 0.0186  -0.0033 -0.0332 285 ILE A C   
4050 O O   . ILE A 257 ? 0.0949 0.1838 0.2441 0.0389  -0.0086 -0.0536 285 ILE A O   
4051 C CB  . ILE A 257 ? 0.0972 0.1298 0.2634 0.0245  0.0097  -0.0365 285 ILE A CB  
4052 C CG1 . ILE A 257 ? 0.1028 0.1004 0.2732 0.0242  0.0066  -0.0423 285 ILE A CG1 
4053 C CG2 . ILE A 257 ? 0.1013 0.1193 0.2699 0.0280  0.0007  -0.0439 285 ILE A CG2 
4054 C CD1 . ILE A 257 ? 0.1041 0.1167 0.2902 0.0260  0.0011  -0.0511 285 ILE A CD1 
4066 N N   . VAL A 258 ? 0.0710 0.1146 0.2233 0.0056  -0.0035 -0.0217 286 VAL A N   
4067 C CA  . VAL A 258 ? 0.0830 0.1247 0.2186 0.0019  -0.0186 -0.0244 286 VAL A CA  
4068 C C   . VAL A 258 ? 0.1050 0.1335 0.2298 -0.0186 -0.0258 -0.0256 286 VAL A C   
4069 O O   . VAL A 258 ? 0.1231 0.1477 0.2279 -0.0207 -0.0321 -0.0179 286 VAL A O   
4070 C CB  . VAL A 258 ? 0.0995 0.1105 0.1975 0.0246  -0.0167 -0.0301 286 VAL A CB  
4071 C CG1 . VAL A 258 ? 0.1185 0.0935 0.1951 0.0079  -0.0279 -0.0124 286 VAL A CG1 
4072 C CG2 . VAL A 258 ? 0.0834 0.1124 0.1885 0.0164  -0.0226 -0.0427 286 VAL A CG2 
4082 N N   . THR A 259 ? 0.1342 0.1392 0.2470 -0.0365 -0.0245 -0.0343 287 THR A N   
4083 C CA  . THR A 259 ? 0.1560 0.1621 0.2673 -0.0720 -0.0272 -0.0401 287 THR A CA  
4084 C C   . THR A 259 ? 0.1941 0.2568 0.3137 -0.0742 -0.0080 -0.0293 287 THR A C   
4085 O O   . THR A 259 ? 0.1836 0.2578 0.3118 -0.1019 -0.0142 -0.0262 287 THR A O   
4086 C CB  . THR A 259 ? 0.1638 0.1411 0.2471 -0.0699 -0.0316 -0.0304 287 THR A CB  
4087 O OG1 . THR A 259 ? 0.1680 0.1510 0.2442 -0.0756 -0.0135 -0.0054 287 THR A OG1 
4088 C CG2 . THR A 259 ? 0.1748 0.1609 0.2376 -0.0317 -0.0358 -0.0422 287 THR A CG2 
4096 N N   . HIS A 260 ? 0.2429 0.3361 0.3621 -0.0721 0.0048  -0.0395 288 HIS A N   
4097 C CA  . HIS A 260 ? 0.3220 0.4617 0.4176 -0.0110 0.0117  -0.0212 288 HIS A CA  
4098 C C   . HIS A 260 ? 0.3889 0.5178 0.4558 0.0333  -0.0057 -0.0141 288 HIS A C   
4099 O O   . HIS A 260 ? 0.3871 0.5096 0.4624 0.0396  -0.0102 -0.0232 288 HIS A O   
4100 C CB  . HIS A 260 ? 0.3350 0.5105 0.4309 0.0039  0.0291  -0.0099 288 HIS A CB  
4101 C CG  . HIS A 260 ? 0.3556 0.5598 0.4433 0.0210  0.0409  0.0055  288 HIS A CG  
4102 N ND1 . HIS A 260 ? 0.3670 0.5803 0.4481 0.0338  0.0421  0.0101  288 HIS A ND1 
4103 C CD2 . HIS A 260 ? 0.3631 0.5810 0.4474 0.0277  0.0495  0.0144  288 HIS A CD2 
4104 C CE1 . HIS A 260 ? 0.3686 0.5906 0.4494 0.0339  0.0482  0.0151  288 HIS A CE1 
4105 N NE2 . HIS A 260 ? 0.3715 0.5946 0.4500 0.0370  0.0514  0.0157  288 HIS A NE2 
4113 N N   . GLY A 261 ? 0.4603 0.5727 0.4874 0.0681  -0.0269 -0.0022 289 GLY A N   
4114 C CA  . GLY A 261 ? 0.5154 0.6150 0.5119 0.1048  -0.0511 0.0017  289 GLY A CA  
4115 C C   . GLY A 261 ? 0.5650 0.6517 0.5357 0.1434  -0.0683 0.0121  289 GLY A C   
4116 O O   . GLY A 261 ? 0.5766 0.6678 0.5384 0.1484  -0.0637 0.0167  289 GLY A O   
4120 N N   . PHE A 262 ? 0.5957 0.6605 0.5548 0.1678  -0.0832 0.0151  290 PHE A N   
4121 C CA  . PHE A 262 ? 0.6210 0.6627 0.5688 0.1797  -0.0979 0.0168  290 PHE A CA  
4122 C C   . PHE A 262 ? 0.6190 0.6483 0.5704 0.1789  -0.1022 0.0210  290 PHE A C   
4123 O O   . PHE A 262 ? 0.6011 0.6392 0.5722 0.1683  -0.1015 0.0247  290 PHE A O   
4124 C CB  . PHE A 262 ? 0.6349 0.6701 0.5780 0.1824  -0.1072 0.0159  290 PHE A CB  
4125 C CG  . PHE A 262 ? 0.6527 0.6808 0.5860 0.2075  -0.1142 0.0154  290 PHE A CG  
4126 C CD1 . PHE A 262 ? 0.6590 0.6889 0.5883 0.2170  -0.1217 0.0143  290 PHE A CD1 
4127 C CD2 . PHE A 262 ? 0.6638 0.6861 0.5909 0.2207  -0.1078 0.0225  290 PHE A CD2 
4128 C CE1 . PHE A 262 ? 0.6654 0.6891 0.5907 0.2179  -0.1189 0.0183  290 PHE A CE1 
4129 C CE2 . PHE A 262 ? 0.6653 0.6884 0.5923 0.2182  -0.1077 0.0242  290 PHE A CE2 
4130 C CZ  . PHE A 262 ? 0.6665 0.6896 0.5924 0.2170  -0.1132 0.0222  290 PHE A CZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   26  ?   ?   ?   A . n 
A 1 2   ASN 2   27  ?   ?   ?   A . n 
A 1 3   SER 3   28  28  SER SER A . n 
A 1 4   VAL 4   29  29  VAL VAL A . n 
A 1 5   GLN 5   30  30  GLN GLN A . n 
A 1 6   GLN 6   31  31  GLN GLN A . n 
A 1 7   GLN 7   32  32  GLN GLN A . n 
A 1 8   LEU 8   33  33  LEU LEU A . n 
A 1 9   GLU 9   34  34  GLU GLU A . n 
A 1 10  ALA 10  35  35  ALA ALA A . n 
A 1 11  LEU 11  36  36  LEU LEU A . n 
A 1 12  GLU 12  37  37  GLU GLU A . n 
A 1 13  LYS 13  38  38  LYS LYS A . n 
A 1 14  SER 14  39  39  SER SER A . n 
A 1 15  SER 15  40  40  SER SER A . n 
A 1 16  GLY 16  41  41  GLY GLY A . n 
A 1 17  GLY 17  42  42  GLY GLY A . n 
A 1 18  ARG 18  43  43  ARG ARG A . n 
A 1 19  LEU 19  44  44  LEU LEU A . n 
A 1 20  GLY 20  45  45  GLY GLY A . n 
A 1 21  VAL 21  46  46  VAL VAL A . n 
A 1 22  ALA 22  47  47  ALA ALA A . n 
A 1 23  LEU 23  48  48  LEU LEU A . n 
A 1 24  ILE 24  49  49  ILE ILE A . n 
A 1 25  ASN 25  50  50  ASN ASN A . n 
A 1 26  THR 26  51  51  THR THR A . n 
A 1 27  ALA 27  52  52  ALA ALA A . n 
A 1 28  ASP 28  53  53  ASP ASP A . n 
A 1 29  ASN 29  54  54  ASN ASN A . n 
A 1 30  SER 30  55  55  SER SER A . n 
A 1 31  GLN 31  56  56  GLN GLN A . n 
A 1 32  ILE 32  57  57  ILE ILE A . n 
A 1 33  LEU 33  59  59  LEU LEU A . n 
A 1 34  TYR 34  60  60  TYR TYR A . n 
A 1 35  ARG 35  61  61  ARG ARG A . n 
A 1 36  ALA 36  62  62  ALA ALA A . n 
A 1 37  ASP 37  63  63  ASP ASP A . n 
A 1 38  GLU 38  64  64  GLU GLU A . n 
A 1 39  ARG 39  65  65  ARG ARG A . n 
A 1 40  PHE 40  66  66  PHE PHE A . n 
A 1 41  ALA 41  67  67  ALA ALA A . n 
A 1 42  MET 42  68  68  MET MET A . n 
A 1 43  CYS 43  69  69  CYS CYS A . n 
A 1 44  SER 44  70  70  SER SER A . n 
A 1 45  THR 45  71  71  THR THR A . n 
A 1 46  SER 46  72  72  SER SER A . n 
A 1 47  LYS 47  73  73  LYS LYS A . n 
A 1 48  VAL 48  74  74  VAL VAL A . n 
A 1 49  MET 49  75  75  MET MET A . n 
A 1 50  ALA 50  76  76  ALA ALA A . n 
A 1 51  ALA 51  77  77  ALA ALA A . n 
A 1 52  ALA 52  78  78  ALA ALA A . n 
A 1 53  ALA 53  79  79  ALA ALA A . n 
A 1 54  VAL 54  80  80  VAL VAL A . n 
A 1 55  LEU 55  81  81  LEU LEU A . n 
A 1 56  LYS 56  82  82  LYS LYS A . n 
A 1 57  GLN 57  83  83  GLN GLN A . n 
A 1 58  SER 58  84  84  SER SER A . n 
A 1 59  GLU 59  85  85  GLU GLU A . n 
A 1 60  SER 60  86  86  SER SER A . n 
A 1 61  ASP 61  87  87  ASP ASP A . n 
A 1 62  LYS 62  88  88  LYS LYS A . n 
A 1 63  HIS 63  89  89  HIS HIS A . n 
A 1 64  LEU 64  90  90  LEU LEU A . n 
A 1 65  LEU 65  91  91  LEU LEU A . n 
A 1 66  ASN 66  92  92  ASN ASN A . n 
A 1 67  GLN 67  93  93  GLN GLN A . n 
A 1 68  ARG 68  94  94  ARG ARG A . n 
A 1 69  VAL 69  95  95  VAL VAL A . n 
A 1 70  GLU 70  96  96  GLU GLU A . n 
A 1 71  ILE 71  97  97  ILE ILE A . n 
A 1 72  LYS 72  98  98  LYS LYS A . n 
A 1 73  LYS 73  99  99  LYS LYS A . n 
A 1 74  SER 74  100 100 SER SER A . n 
A 1 75  ASP 75  101 101 ASP ASP A . n 
A 1 76  LEU 76  102 102 LEU LEU A . n 
A 1 77  VAL 77  103 103 VAL VAL A . n 
A 1 78  ASN 78  104 104 ASN ASN A . n 
A 1 79  TYR 79  105 105 TYR TYR A . n 
A 1 80  ASN 80  106 106 ASN ASN A . n 
A 1 81  PRO 81  107 107 PRO PRO A . n 
A 1 82  ILE 82  108 108 ILE ILE A . n 
A 1 83  ALA 83  109 109 ALA ALA A . n 
A 1 84  GLU 84  110 110 GLU GLU A . n 
A 1 85  LYS 85  111 111 LYS LYS A . n 
A 1 86  HIS 86  112 112 HIS HIS A . n 
A 1 87  VAL 87  113 113 VAL VAL A . n 
A 1 88  ASN 88  114 114 ASN ASN A . n 
A 1 89  GLY 89  115 115 GLY GLY A . n 
A 1 90  THR 90  116 116 THR THR A . n 
A 1 91  MET 91  117 117 MET MET A . n 
A 1 92  THR 92  118 118 THR THR A . n 
A 1 93  LEU 93  119 119 LEU LEU A . n 
A 1 94  ALA 94  120 120 ALA ALA A . n 
A 1 95  GLU 95  121 121 GLU GLU A . n 
A 1 96  LEU 96  122 122 LEU LEU A . n 
A 1 97  GLY 97  123 123 GLY GLY A . n 
A 1 98  ALA 98  124 124 ALA ALA A . n 
A 1 99  ALA 99  125 125 ALA ALA A . n 
A 1 100 ALA 100 126 126 ALA ALA A . n 
A 1 101 LEU 101 127 127 LEU LEU A . n 
A 1 102 GLN 102 128 128 GLN GLN A . n 
A 1 103 TYR 103 129 129 TYR TYR A . n 
A 1 104 SER 104 130 130 SER SER A . n 
A 1 105 ASP 105 131 131 ASP ASP A . n 
A 1 106 ASN 106 132 132 ASN ASN A . n 
A 1 107 THR 107 133 133 THR THR A . n 
A 1 108 ALA 108 134 134 ALA ALA A . n 
A 1 109 MET 109 135 135 MET MET A . n 
A 1 110 ASN 110 136 136 ASN ASN A . n 
A 1 111 LYS 111 137 137 LYS LYS A . n 
A 1 112 LEU 112 138 138 LEU LEU A . n 
A 1 113 ILE 113 139 139 ILE ILE A . n 
A 1 114 ALA 114 140 140 ALA ALA A . n 
A 1 115 HIS 115 141 141 HIS HIS A . n 
A 1 116 LEU 116 142 142 LEU LEU A . n 
A 1 117 GLY 117 143 143 GLY GLY A . n 
A 1 118 GLY 118 144 144 GLY GLY A . n 
A 1 119 PRO 119 145 145 PRO PRO A . n 
A 1 120 ASP 120 146 146 ASP ASP A . n 
A 1 121 LYS 121 147 147 LYS LYS A . n 
A 1 122 VAL 122 148 148 VAL VAL A . n 
A 1 123 THR 123 149 149 THR THR A . n 
A 1 124 ALA 124 150 150 ALA ALA A . n 
A 1 125 PHE 125 151 151 PHE PHE A . n 
A 1 126 ALA 126 152 152 ALA ALA A . n 
A 1 127 ARG 127 153 153 ARG ARG A . n 
A 1 128 SER 128 154 154 SER SER A . n 
A 1 129 LEU 129 155 155 LEU LEU A . n 
A 1 130 GLY 130 156 156 GLY GLY A . n 
A 1 131 ASP 131 157 157 ASP ASP A . n 
A 1 132 GLU 132 158 158 GLU GLU A . n 
A 1 133 THR 133 159 159 THR THR A . n 
A 1 134 PHE 134 160 160 PHE PHE A . n 
A 1 135 ARG 135 161 161 ARG ARG A . n 
A 1 136 LEU 136 162 162 LEU LEU A . n 
A 1 137 ASP 137 163 163 ASP ASP A . n 
A 1 138 ARG 138 164 164 ARG ARG A . n 
A 1 139 THR 139 165 165 THR THR A . n 
A 1 140 ALA 140 166 166 ALA ALA A . n 
A 1 141 PRO 141 167 167 PRO PRO A . n 
A 1 142 THR 142 168 168 THR THR A . n 
A 1 143 LEU 143 169 169 LEU LEU A . n 
A 1 144 ASN 144 170 170 ASN ASN A . n 
A 1 145 THR 145 171 171 THR THR A . n 
A 1 146 ALA 146 172 172 ALA ALA A . n 
A 1 147 ILE 147 173 173 ILE ILE A . n 
A 1 148 PRO 148 174 174 PRO PRO A . n 
A 1 149 GLY 149 175 175 GLY GLY A . n 
A 1 150 ASP 150 176 176 ASP ASP A . n 
A 1 151 PRO 151 177 177 PRO PRO A . n 
A 1 152 ARG 152 178 178 ARG ARG A . n 
A 1 153 ASP 153 179 179 ASP ASP A . n 
A 1 154 THR 154 180 180 THR THR A . n 
A 1 155 THR 155 181 181 THR THR A . n 
A 1 156 THR 156 182 182 THR THR A . n 
A 1 157 PRO 157 183 183 PRO PRO A . n 
A 1 158 LEU 158 184 184 LEU LEU A . n 
A 1 159 ALA 159 185 185 ALA ALA A . n 
A 1 160 MET 160 186 186 MET MET A . n 
A 1 161 ALA 161 187 187 ALA ALA A . n 
A 1 162 GLN 162 188 188 GLN GLN A . n 
A 1 163 THR 163 189 189 THR THR A . n 
A 1 164 LEU 164 190 190 LEU LEU A . n 
A 1 165 LYS 165 191 191 LYS LYS A . n 
A 1 166 ASN 166 192 192 ASN ASN A . n 
A 1 167 LEU 167 193 193 LEU LEU A . n 
A 1 168 THR 168 194 194 THR THR A . n 
A 1 169 LEU 169 195 195 LEU LEU A . n 
A 1 170 GLY 170 196 196 GLY GLY A . n 
A 1 171 LYS 171 197 197 LYS LYS A . n 
A 1 172 ALA 172 198 198 ALA ALA A . n 
A 1 173 LEU 173 199 199 LEU LEU A . n 
A 1 174 ALA 174 200 200 ALA ALA A . n 
A 1 175 GLU 175 201 201 GLU GLU A . n 
A 1 176 THR 176 202 202 THR THR A . n 
A 1 177 GLN 177 203 203 GLN GLN A . n 
A 1 178 ARG 178 204 204 ARG ARG A . n 
A 1 179 ALA 179 205 205 ALA ALA A . n 
A 1 180 GLN 180 206 206 GLN GLN A . n 
A 1 181 LEU 181 207 207 LEU LEU A . n 
A 1 182 VAL 182 208 208 VAL VAL A . n 
A 1 183 THR 183 209 209 THR THR A . n 
A 1 184 TRP 184 210 210 TRP TRP A . n 
A 1 185 LEU 185 211 211 LEU LEU A . n 
A 1 186 LYS 186 212 212 LYS LYS A . n 
A 1 187 GLY 187 213 213 GLY GLY A . n 
A 1 188 ASN 188 214 214 ASN ASN A . n 
A 1 189 THR 189 215 215 THR THR A . n 
A 1 190 THR 190 216 216 THR THR A . n 
A 1 191 GLY 191 217 217 GLY GLY A . n 
A 1 192 SER 192 218 218 SER SER A . n 
A 1 193 ALA 193 219 219 ALA ALA A . n 
A 1 194 SER 194 220 220 SER SER A . n 
A 1 195 ILE 195 221 221 ILE ILE A . n 
A 1 196 ARG 196 222 222 ARG ARG A . n 
A 1 197 ALA 197 223 223 ALA ALA A . n 
A 1 198 GLY 198 224 224 GLY GLY A . n 
A 1 199 LEU 199 225 225 LEU LEU A . n 
A 1 200 PRO 200 226 226 PRO PRO A . n 
A 1 201 LYS 201 227 227 LYS LYS A . n 
A 1 202 SER 202 228 228 SER SER A . n 
A 1 203 TRP 203 229 229 TRP TRP A . n 
A 1 204 VAL 204 230 230 VAL VAL A . n 
A 1 205 VAL 205 231 231 VAL VAL A . n 
A 1 206 GLY 206 232 232 GLY GLY A . n 
A 1 207 ASP 207 233 233 ASP ASP A . n 
A 1 208 LYS 208 234 234 LYS LYS A . n 
A 1 209 THR 209 235 235 THR THR A . n 
A 1 210 GLY 210 236 236 GLY GLY A . n 
A 1 211 SER 211 237 237 SER SER A . n 
A 1 212 GLY 212 238 238 GLY GLY A . n 
A 1 213 ASP 213 240 240 ASP ASP A . n 
A 1 214 TYR 214 241 241 TYR TYR A . n 
A 1 215 GLY 215 242 242 GLY GLY A . n 
A 1 216 THR 216 243 243 THR THR A . n 
A 1 217 THR 217 244 244 THR THR A . n 
A 1 218 ASN 218 245 245 ASN ASN A . n 
A 1 219 ASP 219 246 246 ASP ASP A . n 
A 1 220 ILE 220 247 247 ILE ILE A . n 
A 1 221 ALA 221 248 248 ALA ALA A . n 
A 1 222 VAL 222 249 249 VAL VAL A . n 
A 1 223 ILE 223 250 250 ILE ILE A . n 
A 1 224 TRP 224 251 251 TRP TRP A . n 
A 1 225 PRO 225 252 252 PRO PRO A . n 
A 1 226 GLU 226 254 254 GLU GLU A . n 
A 1 227 ASN 227 255 255 ASN ASN A . n 
A 1 228 HIS 228 256 256 HIS HIS A . n 
A 1 229 ALA 229 257 257 ALA ALA A . n 
A 1 230 PRO 230 258 258 PRO PRO A . n 
A 1 231 LEU 231 259 259 LEU LEU A . n 
A 1 232 VAL 232 260 260 VAL VAL A . n 
A 1 233 LEU 233 261 261 LEU LEU A . n 
A 1 234 VAL 234 262 262 VAL VAL A . n 
A 1 235 THR 235 263 263 THR THR A . n 
A 1 236 TYR 236 264 264 TYR TYR A . n 
A 1 237 PHE 237 265 265 PHE PHE A . n 
A 1 238 THR 238 266 266 THR THR A . n 
A 1 239 GLN 239 267 267 GLN GLN A . n 
A 1 240 PRO 240 268 268 PRO PRO A . n 
A 1 241 GLU 241 269 269 GLU GLU A . n 
A 1 242 GLN 242 270 270 GLN GLN A . n 
A 1 243 LYS 243 271 271 LYS LYS A . n 
A 1 244 ALA 244 272 272 ALA ALA A . n 
A 1 245 GLU 245 273 273 GLU GLU A . n 
A 1 246 ASN 246 274 274 ASN ASN A . n 
A 1 247 ARG 247 275 275 ARG ARG A . n 
A 1 248 ASN 248 276 276 ASN ASN A . n 
A 1 249 ASP 249 277 277 ASP ASP A . n 
A 1 250 ILE 250 278 278 ILE ILE A . n 
A 1 251 LEU 251 279 279 LEU LEU A . n 
A 1 252 ALA 252 280 280 ALA ALA A . n 
A 1 253 ALA 253 281 281 ALA ALA A . n 
A 1 254 ALA 254 282 282 ALA ALA A . n 
A 1 255 ALA 255 283 283 ALA ALA A . n 
A 1 256 LYS 256 284 284 LYS LYS A . n 
A 1 257 ILE 257 285 285 ILE ILE A . n 
A 1 258 VAL 258 286 286 VAL VAL A . n 
A 1 259 THR 259 287 287 THR THR A . n 
A 1 260 HIS 260 288 288 HIS HIS A . n 
A 1 261 GLY 261 289 289 GLY GLY A . n 
A 1 262 PHE 262 290 290 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   1291 1291 SO4 SO4 A . 
C 2 SO4 1   1292 1292 SO4 SO4 A . 
D 2 SO4 1   1293 1293 SO4 SO4 A . 
E 2 SO4 1   1294 1294 SO4 SO4 A . 
F 2 SO4 1   1295 1295 SO4 SO4 A . 
G 3 HOH 1   2001 2001 HOH HOH A . 
G 3 HOH 2   2002 2002 HOH HOH A . 
G 3 HOH 3   2003 2003 HOH HOH A . 
G 3 HOH 4   2004 2004 HOH HOH A . 
G 3 HOH 5   2005 2005 HOH HOH A . 
G 3 HOH 6   2006 2006 HOH HOH A . 
G 3 HOH 7   2007 2007 HOH HOH A . 
G 3 HOH 8   2008 2008 HOH HOH A . 
G 3 HOH 9   2009 2009 HOH HOH A . 
G 3 HOH 10  2010 2010 HOH HOH A . 
G 3 HOH 11  2011 2011 HOH HOH A . 
G 3 HOH 12  2012 2012 HOH HOH A . 
G 3 HOH 13  2013 2013 HOH HOH A . 
G 3 HOH 14  2014 2014 HOH HOH A . 
G 3 HOH 15  2015 2015 HOH HOH A . 
G 3 HOH 16  2016 2016 HOH HOH A . 
G 3 HOH 17  2017 2017 HOH HOH A . 
G 3 HOH 18  2018 2018 HOH HOH A . 
G 3 HOH 19  2019 2019 HOH HOH A . 
G 3 HOH 20  2020 2020 HOH HOH A . 
G 3 HOH 21  2021 2021 HOH HOH A . 
G 3 HOH 22  2022 2022 HOH HOH A . 
G 3 HOH 23  2023 2023 HOH HOH A . 
G 3 HOH 24  2024 2024 HOH HOH A . 
G 3 HOH 25  2025 2025 HOH HOH A . 
G 3 HOH 26  2026 2026 HOH HOH A . 
G 3 HOH 27  2027 2027 HOH HOH A . 
G 3 HOH 28  2028 2028 HOH HOH A . 
G 3 HOH 29  2029 2029 HOH HOH A . 
G 3 HOH 30  2030 2030 HOH HOH A . 
G 3 HOH 31  2031 2031 HOH HOH A . 
G 3 HOH 32  2032 2032 HOH HOH A . 
G 3 HOH 33  2033 2033 HOH HOH A . 
G 3 HOH 34  2034 2034 HOH HOH A . 
G 3 HOH 35  2035 2035 HOH HOH A . 
G 3 HOH 36  2036 2036 HOH HOH A . 
G 3 HOH 37  2037 2037 HOH HOH A . 
G 3 HOH 38  2038 2038 HOH HOH A . 
G 3 HOH 39  2039 2039 HOH HOH A . 
G 3 HOH 40  2040 2040 HOH HOH A . 
G 3 HOH 41  2041 2041 HOH HOH A . 
G 3 HOH 42  2042 2042 HOH HOH A . 
G 3 HOH 43  2043 2043 HOH HOH A . 
G 3 HOH 44  2044 2044 HOH HOH A . 
G 3 HOH 45  2045 2045 HOH HOH A . 
G 3 HOH 46  2046 2046 HOH HOH A . 
G 3 HOH 47  2047 2047 HOH HOH A . 
G 3 HOH 48  2048 2048 HOH HOH A . 
G 3 HOH 49  2049 2049 HOH HOH A . 
G 3 HOH 50  2050 2050 HOH HOH A . 
G 3 HOH 51  2051 2051 HOH HOH A . 
G 3 HOH 52  2052 2052 HOH HOH A . 
G 3 HOH 53  2053 2053 HOH HOH A . 
G 3 HOH 54  2054 2054 HOH HOH A . 
G 3 HOH 55  2055 2055 HOH HOH A . 
G 3 HOH 56  2056 2056 HOH HOH A . 
G 3 HOH 57  2057 2057 HOH HOH A . 
G 3 HOH 58  2058 2058 HOH HOH A . 
G 3 HOH 59  2059 2059 HOH HOH A . 
G 3 HOH 60  2060 2060 HOH HOH A . 
G 3 HOH 61  2061 2061 HOH HOH A . 
G 3 HOH 62  2062 2062 HOH HOH A . 
G 3 HOH 63  2063 2063 HOH HOH A . 
G 3 HOH 64  2064 2064 HOH HOH A . 
G 3 HOH 65  2065 2065 HOH HOH A . 
G 3 HOH 66  2066 2066 HOH HOH A . 
G 3 HOH 67  2067 2067 HOH HOH A . 
G 3 HOH 68  2068 2068 HOH HOH A . 
G 3 HOH 69  2069 2069 HOH HOH A . 
G 3 HOH 70  2070 2070 HOH HOH A . 
G 3 HOH 71  2071 2071 HOH HOH A . 
G 3 HOH 72  2072 2072 HOH HOH A . 
G 3 HOH 73  2073 2073 HOH HOH A . 
G 3 HOH 74  2074 2074 HOH HOH A . 
G 3 HOH 75  2075 2075 HOH HOH A . 
G 3 HOH 76  2076 2076 HOH HOH A . 
G 3 HOH 77  2077 2077 HOH HOH A . 
G 3 HOH 78  2078 2078 HOH HOH A . 
G 3 HOH 79  2079 2079 HOH HOH A . 
G 3 HOH 80  2080 2080 HOH HOH A . 
G 3 HOH 81  2081 2081 HOH HOH A . 
G 3 HOH 82  2082 2082 HOH HOH A . 
G 3 HOH 83  2083 2083 HOH HOH A . 
G 3 HOH 84  2084 2084 HOH HOH A . 
G 3 HOH 85  2085 2085 HOH HOH A . 
G 3 HOH 86  2086 2086 HOH HOH A . 
G 3 HOH 87  2087 2087 HOH HOH A . 
G 3 HOH 88  2088 2088 HOH HOH A . 
G 3 HOH 89  2089 2089 HOH HOH A . 
G 3 HOH 90  2090 2090 HOH HOH A . 
G 3 HOH 91  2091 2091 HOH HOH A . 
G 3 HOH 92  2092 2092 HOH HOH A . 
G 3 HOH 93  2093 2093 HOH HOH A . 
G 3 HOH 94  2094 2094 HOH HOH A . 
G 3 HOH 95  2095 2095 HOH HOH A . 
G 3 HOH 96  2096 2096 HOH HOH A . 
G 3 HOH 97  2097 2097 HOH HOH A . 
G 3 HOH 98  2098 2098 HOH HOH A . 
G 3 HOH 99  2099 2099 HOH HOH A . 
G 3 HOH 100 2100 2100 HOH HOH A . 
G 3 HOH 101 2101 2101 HOH HOH A . 
G 3 HOH 102 2102 2102 HOH HOH A . 
G 3 HOH 103 2103 2103 HOH HOH A . 
G 3 HOH 104 2104 2104 HOH HOH A . 
G 3 HOH 105 2105 2105 HOH HOH A . 
G 3 HOH 106 2106 2106 HOH HOH A . 
G 3 HOH 107 2107 2107 HOH HOH A . 
G 3 HOH 108 2108 2108 HOH HOH A . 
G 3 HOH 109 2109 2109 HOH HOH A . 
G 3 HOH 110 2110 2110 HOH HOH A . 
G 3 HOH 111 2111 2111 HOH HOH A . 
G 3 HOH 112 2112 2112 HOH HOH A . 
G 3 HOH 113 2113 2113 HOH HOH A . 
G 3 HOH 114 2114 2114 HOH HOH A . 
G 3 HOH 115 2115 2115 HOH HOH A . 
G 3 HOH 116 2116 2116 HOH HOH A . 
G 3 HOH 117 2117 2117 HOH HOH A . 
G 3 HOH 118 2118 2118 HOH HOH A . 
G 3 HOH 119 2119 2119 HOH HOH A . 
G 3 HOH 120 2120 2120 HOH HOH A . 
G 3 HOH 121 2121 2121 HOH HOH A . 
G 3 HOH 122 2122 2122 HOH HOH A . 
G 3 HOH 123 2123 2123 HOH HOH A . 
G 3 HOH 124 2124 2124 HOH HOH A . 
G 3 HOH 125 2125 2125 HOH HOH A . 
G 3 HOH 126 2126 2126 HOH HOH A . 
G 3 HOH 127 2127 2127 HOH HOH A . 
G 3 HOH 128 2128 2128 HOH HOH A . 
G 3 HOH 129 2129 2129 HOH HOH A . 
G 3 HOH 130 2130 2130 HOH HOH A . 
G 3 HOH 131 2131 2131 HOH HOH A . 
G 3 HOH 132 2132 2132 HOH HOH A . 
G 3 HOH 133 2133 2133 HOH HOH A . 
G 3 HOH 134 2134 2134 HOH HOH A . 
G 3 HOH 135 2135 2135 HOH HOH A . 
G 3 HOH 136 2136 2136 HOH HOH A . 
G 3 HOH 137 2137 2137 HOH HOH A . 
G 3 HOH 138 2138 2138 HOH HOH A . 
G 3 HOH 139 2139 2139 HOH HOH A . 
G 3 HOH 140 2140 2140 HOH HOH A . 
G 3 HOH 141 2141 2141 HOH HOH A . 
G 3 HOH 142 2142 2142 HOH HOH A . 
G 3 HOH 143 2143 2143 HOH HOH A . 
G 3 HOH 144 2144 2144 HOH HOH A . 
G 3 HOH 145 2145 2145 HOH HOH A . 
G 3 HOH 146 2146 2146 HOH HOH A . 
G 3 HOH 147 2147 2147 HOH HOH A . 
G 3 HOH 148 2148 2148 HOH HOH A . 
G 3 HOH 149 2149 2149 HOH HOH A . 
G 3 HOH 150 2150 2150 HOH HOH A . 
G 3 HOH 151 2151 2151 HOH HOH A . 
G 3 HOH 152 2152 2152 HOH HOH A . 
G 3 HOH 153 2153 2153 HOH HOH A . 
G 3 HOH 154 2154 2154 HOH HOH A . 
G 3 HOH 155 2155 2155 HOH HOH A . 
G 3 HOH 156 2156 2156 HOH HOH A . 
G 3 HOH 157 2157 2157 HOH HOH A . 
G 3 HOH 158 2158 2158 HOH HOH A . 
G 3 HOH 159 2159 2159 HOH HOH A . 
G 3 HOH 160 2160 2160 HOH HOH A . 
G 3 HOH 161 2161 2161 HOH HOH A . 
G 3 HOH 162 2162 2162 HOH HOH A . 
G 3 HOH 163 2163 2163 HOH HOH A . 
G 3 HOH 164 2164 2164 HOH HOH A . 
G 3 HOH 165 2165 2165 HOH HOH A . 
G 3 HOH 166 2166 2166 HOH HOH A . 
G 3 HOH 167 2167 2167 HOH HOH A . 
G 3 HOH 168 2168 2168 HOH HOH A . 
G 3 HOH 169 2169 2169 HOH HOH A . 
G 3 HOH 170 2170 2170 HOH HOH A . 
G 3 HOH 171 2171 2171 HOH HOH A . 
G 3 HOH 172 2172 2172 HOH HOH A . 
G 3 HOH 173 2173 2173 HOH HOH A . 
G 3 HOH 174 2174 2174 HOH HOH A . 
G 3 HOH 175 2175 2175 HOH HOH A . 
G 3 HOH 176 2176 2176 HOH HOH A . 
G 3 HOH 177 2177 2177 HOH HOH A . 
G 3 HOH 178 2178 2178 HOH HOH A . 
G 3 HOH 179 2179 2179 HOH HOH A . 
G 3 HOH 180 2180 2180 HOH HOH A . 
G 3 HOH 181 2181 2181 HOH HOH A . 
G 3 HOH 182 2182 2182 HOH HOH A . 
G 3 HOH 183 2183 2183 HOH HOH A . 
G 3 HOH 184 2184 2184 HOH HOH A . 
G 3 HOH 185 2185 2185 HOH HOH A . 
G 3 HOH 186 2186 2186 HOH HOH A . 
G 3 HOH 187 2187 2187 HOH HOH A . 
G 3 HOH 188 2188 2188 HOH HOH A . 
G 3 HOH 189 2189 2189 HOH HOH A . 
G 3 HOH 190 2190 2190 HOH HOH A . 
G 3 HOH 191 2191 2191 HOH HOH A . 
G 3 HOH 192 2192 2192 HOH HOH A . 
G 3 HOH 193 2193 2193 HOH HOH A . 
G 3 HOH 194 2194 2194 HOH HOH A . 
G 3 HOH 195 2195 2195 HOH HOH A . 
G 3 HOH 196 2196 2196 HOH HOH A . 
G 3 HOH 197 2197 2197 HOH HOH A . 
G 3 HOH 198 2198 2198 HOH HOH A . 
G 3 HOH 199 2199 2199 HOH HOH A . 
G 3 HOH 200 2200 2200 HOH HOH A . 
G 3 HOH 201 2201 2201 HOH HOH A . 
G 3 HOH 202 2202 2202 HOH HOH A . 
G 3 HOH 203 2203 2203 HOH HOH A . 
G 3 HOH 204 2204 2204 HOH HOH A . 
G 3 HOH 205 2205 2205 HOH HOH A . 
G 3 HOH 206 2206 2206 HOH HOH A . 
G 3 HOH 207 2207 2207 HOH HOH A . 
G 3 HOH 208 2208 2208 HOH HOH A . 
G 3 HOH 209 2209 2209 HOH HOH A . 
G 3 HOH 210 2210 2210 HOH HOH A . 
G 3 HOH 211 2211 2211 HOH HOH A . 
G 3 HOH 212 2212 2212 HOH HOH A . 
G 3 HOH 213 2213 2213 HOH HOH A . 
G 3 HOH 214 2214 2214 HOH HOH A . 
G 3 HOH 215 2215 2215 HOH HOH A . 
G 3 HOH 216 2216 2216 HOH HOH A . 
G 3 HOH 217 2217 2217 HOH HOH A . 
G 3 HOH 218 2218 2218 HOH HOH A . 
G 3 HOH 219 2219 2219 HOH HOH A . 
G 3 HOH 220 2220 2220 HOH HOH A . 
G 3 HOH 221 2221 2221 HOH HOH A . 
G 3 HOH 222 2222 2222 HOH HOH A . 
G 3 HOH 223 2223 2223 HOH HOH A . 
G 3 HOH 224 2224 2224 HOH HOH A . 
G 3 HOH 225 2225 2225 HOH HOH A . 
G 3 HOH 226 2226 2226 HOH HOH A . 
G 3 HOH 227 2227 2227 HOH HOH A . 
G 3 HOH 228 2228 2228 HOH HOH A . 
G 3 HOH 229 2229 2229 HOH HOH A . 
G 3 HOH 230 2230 2230 HOH HOH A . 
G 3 HOH 231 2231 2231 HOH HOH A . 
G 3 HOH 232 2232 2232 HOH HOH A . 
G 3 HOH 233 2233 2233 HOH HOH A . 
G 3 HOH 234 2234 2234 HOH HOH A . 
G 3 HOH 235 2235 2235 HOH HOH A . 
G 3 HOH 236 2236 2236 HOH HOH A . 
G 3 HOH 237 2237 2237 HOH HOH A . 
G 3 HOH 238 2238 2238 HOH HOH A . 
G 3 HOH 239 2239 2239 HOH HOH A . 
G 3 HOH 240 2240 2240 HOH HOH A . 
G 3 HOH 241 2241 2241 HOH HOH A . 
G 3 HOH 242 2242 2242 HOH HOH A . 
G 3 HOH 243 2243 2243 HOH HOH A . 
G 3 HOH 244 2244 2244 HOH HOH A . 
G 3 HOH 245 2245 2245 HOH HOH A . 
G 3 HOH 246 2246 2246 HOH HOH A . 
G 3 HOH 247 2247 2247 HOH HOH A . 
G 3 HOH 248 2248 2248 HOH HOH A . 
G 3 HOH 249 2249 2249 HOH HOH A . 
G 3 HOH 250 2250 2250 HOH HOH A . 
G 3 HOH 251 2251 2251 HOH HOH A . 
G 3 HOH 252 2252 2252 HOH HOH A . 
G 3 HOH 253 2253 2253 HOH HOH A . 
G 3 HOH 254 2254 2254 HOH HOH A . 
G 3 HOH 255 2255 2255 HOH HOH A . 
G 3 HOH 256 2256 2256 HOH HOH A . 
G 3 HOH 257 2257 2257 HOH HOH A . 
G 3 HOH 258 2258 2258 HOH HOH A . 
G 3 HOH 259 2259 2259 HOH HOH A . 
G 3 HOH 260 2260 2260 HOH HOH A . 
G 3 HOH 261 2261 2261 HOH HOH A . 
G 3 HOH 262 2262 2262 HOH HOH A . 
G 3 HOH 263 2263 2263 HOH HOH A . 
G 3 HOH 264 2264 2264 HOH HOH A . 
G 3 HOH 265 2265 2265 HOH HOH A . 
G 3 HOH 266 2266 2266 HOH HOH A . 
G 3 HOH 267 2267 2267 HOH HOH A . 
G 3 HOH 268 2268 2268 HOH HOH A . 
G 3 HOH 269 2269 2269 HOH HOH A . 
G 3 HOH 270 2270 2270 HOH HOH A . 
G 3 HOH 271 2271 2271 HOH HOH A . 
G 3 HOH 272 2272 2272 HOH HOH A . 
G 3 HOH 273 2273 2273 HOH HOH A . 
G 3 HOH 274 2274 2274 HOH HOH A . 
G 3 HOH 275 2275 2275 HOH HOH A . 
G 3 HOH 276 2276 2276 HOH HOH A . 
G 3 HOH 277 2277 2277 HOH HOH A . 
G 3 HOH 278 2278 2278 HOH HOH A . 
G 3 HOH 279 2279 2279 HOH HOH A . 
G 3 HOH 280 2280 2280 HOH HOH A . 
G 3 HOH 281 2281 2281 HOH HOH A . 
G 3 HOH 282 2282 2282 HOH HOH A . 
G 3 HOH 283 2283 2283 HOH HOH A . 
G 3 HOH 284 2284 2284 HOH HOH A . 
G 3 HOH 285 2285 2285 HOH HOH A . 
G 3 HOH 286 2286 2286 HOH HOH A . 
G 3 HOH 287 2287 2287 HOH HOH A . 
G 3 HOH 288 2288 2288 HOH HOH A . 
G 3 HOH 289 2289 2289 HOH HOH A . 
G 3 HOH 290 2290 2290 HOH HOH A . 
G 3 HOH 291 2291 2291 HOH HOH A . 
G 3 HOH 292 2292 2292 HOH HOH A . 
G 3 HOH 293 2293 2293 HOH HOH A . 
G 3 HOH 294 2294 2294 HOH HOH A . 
G 3 HOH 295 2295 2295 HOH HOH A . 
G 3 HOH 296 2296 2296 HOH HOH A . 
G 3 HOH 297 2297 2297 HOH HOH A . 
G 3 HOH 298 2298 2298 HOH HOH A . 
G 3 HOH 299 2299 2299 HOH HOH A . 
G 3 HOH 300 2300 2300 HOH HOH A . 
G 3 HOH 301 2301 2301 HOH HOH A . 
G 3 HOH 302 2302 2302 HOH HOH A . 
G 3 HOH 303 2303 2303 HOH HOH A . 
G 3 HOH 304 2304 2304 HOH HOH A . 
G 3 HOH 305 2305 2305 HOH HOH A . 
G 3 HOH 306 2306 2306 HOH HOH A . 
G 3 HOH 307 2307 2307 HOH HOH A . 
G 3 HOH 308 2308 2308 HOH HOH A . 
G 3 HOH 309 2309 2309 HOH HOH A . 
G 3 HOH 310 2310 2310 HOH HOH A . 
G 3 HOH 311 2311 2311 HOH HOH A . 
G 3 HOH 312 2312 2312 HOH HOH A . 
G 3 HOH 313 2313 2313 HOH HOH A . 
G 3 HOH 314 2314 2314 HOH HOH A . 
G 3 HOH 315 2315 2315 HOH HOH A . 
G 3 HOH 316 2316 2316 HOH HOH A . 
G 3 HOH 317 2317 2317 HOH HOH A . 
G 3 HOH 318 2318 2318 HOH HOH A . 
G 3 HOH 319 2319 2319 HOH HOH A . 
G 3 HOH 320 2320 2320 HOH HOH A . 
G 3 HOH 321 2321 2321 HOH HOH A . 
G 3 HOH 322 2322 2322 HOH HOH A . 
G 3 HOH 323 2323 2323 HOH HOH A . 
G 3 HOH 324 2324 2324 HOH HOH A . 
G 3 HOH 325 2325 2325 HOH HOH A . 
G 3 HOH 326 2326 2326 HOH HOH A . 
G 3 HOH 327 2327 2327 HOH HOH A . 
G 3 HOH 328 2328 2328 HOH HOH A . 
G 3 HOH 329 2329 2329 HOH HOH A . 
G 3 HOH 330 2330 2330 HOH HOH A . 
G 3 HOH 331 2331 2331 HOH HOH A . 
G 3 HOH 332 2332 2332 HOH HOH A . 
G 3 HOH 333 2333 2333 HOH HOH A . 
G 3 HOH 334 2334 2334 HOH HOH A . 
G 3 HOH 335 2335 2335 HOH HOH A . 
G 3 HOH 336 2336 2336 HOH HOH A . 
G 3 HOH 337 2337 2337 HOH HOH A . 
G 3 HOH 338 2338 2338 HOH HOH A . 
G 3 HOH 339 2339 2339 HOH HOH A . 
G 3 HOH 340 2340 2340 HOH HOH A . 
G 3 HOH 341 2341 2341 HOH HOH A . 
G 3 HOH 342 2342 2342 HOH HOH A . 
G 3 HOH 343 2343 2343 HOH HOH A . 
G 3 HOH 344 2344 2344 HOH HOH A . 
G 3 HOH 345 2345 2345 HOH HOH A . 
G 3 HOH 346 2346 2346 HOH HOH A . 
G 3 HOH 347 2347 2347 HOH HOH A . 
G 3 HOH 348 2348 2348 HOH HOH A . 
G 3 HOH 349 2349 2349 HOH HOH A . 
G 3 HOH 350 2350 2350 HOH HOH A . 
G 3 HOH 351 2351 2351 HOH HOH A . 
G 3 HOH 352 2352 2352 HOH HOH A . 
G 3 HOH 353 2353 2353 HOH HOH A . 
G 3 HOH 354 2354 2354 HOH HOH A . 
G 3 HOH 355 2355 2355 HOH HOH A . 
G 3 HOH 356 2356 2356 HOH HOH A . 
G 3 HOH 357 2357 2357 HOH HOH A . 
G 3 HOH 358 2358 2358 HOH HOH A . 
G 3 HOH 359 2359 2359 HOH HOH A . 
G 3 HOH 360 2360 2360 HOH HOH A . 
G 3 HOH 361 2361 2361 HOH HOH A . 
G 3 HOH 362 2362 2362 HOH HOH A . 
G 3 HOH 363 2363 2363 HOH HOH A . 
G 3 HOH 364 2364 2364 HOH HOH A . 
G 3 HOH 365 2365 2365 HOH HOH A . 
G 3 HOH 366 2366 2366 HOH HOH A . 
G 3 HOH 367 2367 2367 HOH HOH A . 
G 3 HOH 368 2368 2368 HOH HOH A . 
G 3 HOH 369 2369 2369 HOH HOH A . 
G 3 HOH 370 2370 2370 HOH HOH A . 
G 3 HOH 371 2371 2371 HOH HOH A . 
G 3 HOH 372 2372 2372 HOH HOH A . 
G 3 HOH 373 2373 2373 HOH HOH A . 
G 3 HOH 374 2374 2374 HOH HOH A . 
G 3 HOH 375 2375 2375 HOH HOH A . 
G 3 HOH 376 2376 2376 HOH HOH A . 
G 3 HOH 377 2377 2377 HOH HOH A . 
G 3 HOH 378 2378 2378 HOH HOH A . 
G 3 HOH 379 2379 2379 HOH HOH A . 
G 3 HOH 380 2380 2380 HOH HOH A . 
G 3 HOH 381 2381 2381 HOH HOH A . 
G 3 HOH 382 2382 2382 HOH HOH A . 
G 3 HOH 383 2383 2383 HOH HOH A . 
G 3 HOH 384 2384 2384 HOH HOH A . 
G 3 HOH 385 2385 2385 HOH HOH A . 
G 3 HOH 386 2386 2386 HOH HOH A . 
G 3 HOH 387 2387 2387 HOH HOH A . 
G 3 HOH 388 2388 2388 HOH HOH A . 
G 3 HOH 389 2389 2389 HOH HOH A . 
G 3 HOH 390 2390 2390 HOH HOH A . 
G 3 HOH 391 2391 2391 HOH HOH A . 
G 3 HOH 392 2392 2392 HOH HOH A . 
G 3 HOH 393 2393 2393 HOH HOH A . 
G 3 HOH 394 2394 2394 HOH HOH A . 
G 3 HOH 395 2395 2395 HOH HOH A . 
G 3 HOH 396 2396 2396 HOH HOH A . 
G 3 HOH 397 2397 2397 HOH HOH A . 
G 3 HOH 398 2398 2398 HOH HOH A . 
G 3 HOH 399 2399 2399 HOH HOH A . 
G 3 HOH 400 2400 2400 HOH HOH A . 
G 3 HOH 401 2401 2401 HOH HOH A . 
G 3 HOH 402 2402 2402 HOH HOH A . 
G 3 HOH 403 2403 2403 HOH HOH A . 
G 3 HOH 404 2404 2404 HOH HOH A . 
G 3 HOH 405 2405 2405 HOH HOH A . 
G 3 HOH 406 2406 2406 HOH HOH A . 
G 3 HOH 407 2407 2407 HOH HOH A . 
G 3 HOH 408 2408 2408 HOH HOH A . 
G 3 HOH 409 2409 2409 HOH HOH A . 
G 3 HOH 410 2410 2410 HOH HOH A . 
G 3 HOH 411 2411 2411 HOH HOH A . 
G 3 HOH 412 2412 2412 HOH HOH A . 
G 3 HOH 413 2413 2413 HOH HOH A . 
G 3 HOH 414 2414 2414 HOH HOH A . 
G 3 HOH 415 2415 2415 HOH HOH A . 
G 3 HOH 416 2416 2416 HOH HOH A . 
G 3 HOH 417 2417 2417 HOH HOH A . 
G 3 HOH 418 2418 2418 HOH HOH A . 
G 3 HOH 419 2419 2419 HOH HOH A . 
G 3 HOH 420 2420 2420 HOH HOH A . 
G 3 HOH 421 2421 2421 HOH HOH A . 
G 3 HOH 422 2422 2422 HOH HOH A . 
G 3 HOH 423 2423 2423 HOH HOH A . 
G 3 HOH 424 2424 2424 HOH HOH A . 
G 3 HOH 425 2425 2425 HOH HOH A . 
G 3 HOH 426 2426 2426 HOH HOH A . 
G 3 HOH 427 2427 2427 HOH HOH A . 
G 3 HOH 428 2428 2428 HOH HOH A . 
G 3 HOH 429 2429 2429 HOH HOH A . 
G 3 HOH 430 2430 2430 HOH HOH A . 
G 3 HOH 431 2431 2431 HOH HOH A . 
G 3 HOH 432 2432 2432 HOH HOH A . 
G 3 HOH 433 2433 2433 HOH HOH A . 
G 3 HOH 434 2434 2434 HOH HOH A . 
G 3 HOH 435 2435 2435 HOH HOH A . 
G 3 HOH 436 2436 2436 HOH HOH A . 
G 3 HOH 437 2437 2437 HOH HOH A . 
G 3 HOH 438 2438 2438 HOH HOH A . 
G 3 HOH 439 2439 2439 HOH HOH A . 
G 3 HOH 440 2440 2440 HOH HOH A . 
G 3 HOH 441 2441 2441 HOH HOH A . 
G 3 HOH 442 2442 2442 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 2034 ? G HOH . 
2 1 A HOH 2036 ? G HOH . 
3 1 A HOH 2168 ? G HOH . 
4 1 A HOH 2413 ? G HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-12-16 
2 'Structure model' 1 1 2016-01-27 
3 'Structure model' 2 0 2019-10-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' Advisory                   
3 3 'Structure model' 'Atomic model'             
4 3 'Structure model' 'Data collection'          
5 3 'Structure model' 'Experimental preparation' 
6 3 'Structure model' Other                      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' atom_site                       
2 3 'Structure model' exptl_crystal_grow              
3 3 'Structure model' pdbx_database_status            
4 3 'Structure model' pdbx_unobs_or_zero_occ_residues 
5 3 'Structure model' reflns                          
6 3 'Structure model' reflns_shell                    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_atom_site.B_iso_or_equiv'            
2 3 'Structure model' '_atom_site.Cartn_x'                   
3 3 'Structure model' '_atom_site.Cartn_y'                   
4 3 'Structure model' '_atom_site.Cartn_z'                   
5 3 'Structure model' '_pdbx_database_status.status_code_sf' 
6 3 'Structure model' '_reflns.d_resolution_low'             
7 3 'Structure model' '_reflns.pdbx_Rmerge_I_obs'            
8 3 'Structure model' '_reflns.pdbx_Rpim_I_all'              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 ? ? ? ? 
XDS    'data reduction' .                 ? 2 ? ? ? ? 
XDS    'data scaling'   .                 ? 3 ? ? ? ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 2330 ? ? O A HOH 2331 ? ? 1.76 
2  1 O2  A SO4 1295 ? ? O A HOH 2313 ? ? 1.81 
3  1 O   A HOH 2370 ? ? O A HOH 2371 ? ? 1.99 
4  1 O   A HOH 2020 ? ? O A HOH 2021 ? ? 1.99 
5  1 O   A HOH 2275 ? ? O A HOH 2278 ? ? 2.01 
6  1 O   A HOH 2132 ? ? O A HOH 2133 ? ? 2.02 
7  1 O   A HOH 2157 ? ? O A HOH 2158 ? ? 2.02 
8  1 O   A HOH 2046 ? ? O A HOH 2055 ? ? 2.03 
9  1 O   A HOH 2171 ? ? O A HOH 2174 ? ? 2.05 
10 1 O   A HOH 2322 ? ? O A HOH 2324 ? ? 2.07 
11 1 O   A HOH 2038 ? ? O A HOH 2412 ? ? 2.08 
12 1 O   A HOH 2135 ? ? O A HOH 2291 ? ? 2.09 
13 1 NH2 A ARG 204  ? B O A HOH 2322 ? ? 2.09 
14 1 O   A HOH 2301 ? ? O A HOH 2302 ? ? 2.10 
15 1 O   A HOH 2390 ? ? O A HOH 2392 ? ? 2.11 
16 1 NE2 A GLN 203  ? ? O A HOH 2134 ? ? 2.11 
17 1 O   A HOH 2217 ? ? O A HOH 2223 ? ? 2.11 
18 1 O   A HOH 2107 ? ? O A HOH 2223 ? ? 2.12 
19 1 O   A HOH 2142 ? ? O A HOH 2302 ? ? 2.13 
20 1 O   A HOH 2165 ? ? O A HOH 2236 ? ? 2.16 
21 1 O   A HOH 2005 ? ? O A HOH 2006 ? ? 2.17 
22 1 O   A HOH 2155 ? ? O A HOH 2159 ? ? 2.17 
23 1 OD1 A ASN 192  ? A O A HOH 2317 ? ? 2.17 
24 1 O   A HOH 2016 ? ? O A HOH 2017 ? ? 2.18 
25 1 O   A HOH 2051 ? ? O A HOH 2084 ? ? 2.18 
26 1 O   A HOH 2134 ? ? O A HOH 2336 ? ? 2.18 
27 1 O   A HOH 2394 ? ? O A HOH 2395 ? ? 2.18 
28 1 O   A HOH 2241 ? ? O A HOH 2436 ? ? 2.19 
29 1 O   A HOH 2156 ? ? O A HOH 2309 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O  A HOH 2020 ? ? 1_555 O A HOH 2326 ? ? 4_655 1.65 
2 1 O  A HOH 2038 ? ? 1_555 O A HOH 2425 ? ? 5_555 1.93 
3 1 O  A HOH 2140 ? ? 1_555 O A HOH 2371 ? ? 2_544 2.00 
4 1 O  A HOH 2152 ? ? 1_555 O A HOH 2171 ? ? 4_645 2.15 
5 1 O  A HOH 2107 ? ? 1_555 O A HOH 2407 ? ? 5_545 2.17 
6 1 O  A HOH 2057 ? ? 1_555 O A HOH 2404 ? ? 4_655 2.19 
7 1 O1 A SO4 1295 ? ? 1_555 O A HOH 2408 ? ? 4_655 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 69  ? ? 50.83   -142.40 
2 1 VAL A 103 ? ? -118.26 -137.25 
3 1 TYR A 105 ? ? -162.20 92.53   
4 1 ASN A 106 ? ? -142.98 59.88   
5 1 ASN A 114 ? ? 80.16   -6.07   
6 1 SER A 220 ? ? -101.40 -127.88 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 26 ? A ALA 1 
2 1 Y 1 A ASN 27 ? A ASN 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#