data_5ABT
# 
_entry.id   5ABT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ABT         
PDBE  EBI-64641    
WWPDB D_1290064641 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 5AC6 unspecified 'S. ENTERICA HISA WITH MUTATIONS D7N, D10G, DUP13-15, Q24L, G102A' 
PDB 5AC7 unspecified 'S. ENTERICA HISA WITH MUTATIONS D7N, D10G, DUP13-15, Q24L, G102A' 
PDB 5AC8 unspecified 'S. ENTERICA HISA WITH MUTATIONS D10G, DUP13-15, G102A'            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5ABT 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-08-08 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, X.'       1 
'Soderholm, A.' 2 
'Newton, M.'    3 
'Nasvall, J.'   4 
'Andersson, D.' 5 
'Patrick, W.'   6 
'Selmer, M.'    7 
# 
_citation.id                        primary 
_citation.title                     'The Protein Structures, Functions and Dynamics of Adaptive Evolution' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Newton, M.'    1 
primary 'Guo, X.'       2 
primary 'Soderholm, A.' 3 
primary 'Nasvall, J.'   4 
primary 'Andersson, D.' 5 
primary 'Patrick, W.'   6 
primary 'Selmer, M.'    7 
# 
_cell.entry_id           5ABT 
_cell.length_a           46.555 
_cell.length_b           46.555 
_cell.length_c           196.378 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5ABT 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO) METHYLIDENE AMINO] IMIDAZOLE-4-CARBOXAMIDE ISOMERASE' 27133.023 
1   5.3.1.16 YES ? ? 
2 non-polymer syn 
;[(2R,3S,4R,5R)-5-[4-aminocarbonyl-5-[(E)-[[(2R,3R,4S,5R)-3,4-bis(oxidanyl)-5-(phosphonooxymethyl)oxolan-2-yl]amino]methylideneamino]imidazol-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methyl dihydrogen phosphate
;
577.331   1   ?        ?   ? ? 
3 water       nat water 18.015    226 ?        ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PHOSPHORIBOSYLFORMIMINO-5-AMINOIMIDAZOLE CARBOXAMIDE RIBOTIDE ISOMERASE, HISA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MIIPALNLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGG
GVRTEEDVAALLKAGVARVVIASTAMKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETY
LPVGLKHVLCTDISRAGTLAGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQ
CWQNVKGHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MIIPALNLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGG
GVRTEEDVAALLKAGVARVVIASTAMKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETY
LPVGLKHVLCTDISRAGTLAGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQ
CWQNVKGHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   ILE n 
1 4   PRO n 
1 5   ALA n 
1 6   LEU n 
1 7   ASN n 
1 8   LEU n 
1 9   ILE n 
1 10  ASP n 
1 11  GLY n 
1 12  THR n 
1 13  VAL n 
1 14  VAL n 
1 15  ARG n 
1 16  LEU n 
1 17  HIS n 
1 18  GLN n 
1 19  GLY n 
1 20  ASP n 
1 21  TYR n 
1 22  ALA n 
1 23  ARG n 
1 24  GLN n 
1 25  ARG n 
1 26  ASP n 
1 27  TYR n 
1 28  GLY n 
1 29  ASN n 
1 30  ASP n 
1 31  PRO n 
1 32  LEU n 
1 33  PRO n 
1 34  ARG n 
1 35  LEU n 
1 36  GLN n 
1 37  ASP n 
1 38  TYR n 
1 39  ALA n 
1 40  ALA n 
1 41  GLN n 
1 42  GLY n 
1 43  ALA n 
1 44  GLY n 
1 45  VAL n 
1 46  LEU n 
1 47  HIS n 
1 48  LEU n 
1 49  VAL n 
1 50  ASP n 
1 51  LEU n 
1 52  THR n 
1 53  GLY n 
1 54  ALA n 
1 55  LYS n 
1 56  ASP n 
1 57  PRO n 
1 58  ALA n 
1 59  LYS n 
1 60  ARG n 
1 61  GLN n 
1 62  ILE n 
1 63  PRO n 
1 64  LEU n 
1 65  ILE n 
1 66  LYS n 
1 67  THR n 
1 68  LEU n 
1 69  VAL n 
1 70  ALA n 
1 71  GLY n 
1 72  VAL n 
1 73  ASN n 
1 74  VAL n 
1 75  PRO n 
1 76  VAL n 
1 77  GLN n 
1 78  VAL n 
1 79  GLY n 
1 80  GLY n 
1 81  GLY n 
1 82  VAL n 
1 83  ARG n 
1 84  THR n 
1 85  GLU n 
1 86  GLU n 
1 87  ASP n 
1 88  VAL n 
1 89  ALA n 
1 90  ALA n 
1 91  LEU n 
1 92  LEU n 
1 93  LYS n 
1 94  ALA n 
1 95  GLY n 
1 96  VAL n 
1 97  ALA n 
1 98  ARG n 
1 99  VAL n 
1 100 VAL n 
1 101 ILE n 
1 102 ALA n 
1 103 SER n 
1 104 THR n 
1 105 ALA n 
1 106 MET n 
1 107 LYS n 
1 108 SER n 
1 109 PRO n 
1 110 ASP n 
1 111 VAL n 
1 112 VAL n 
1 113 LYS n 
1 114 GLY n 
1 115 TRP n 
1 116 PHE n 
1 117 GLU n 
1 118 ARG n 
1 119 PHE n 
1 120 GLY n 
1 121 ALA n 
1 122 GLN n 
1 123 ALA n 
1 124 LEU n 
1 125 VAL n 
1 126 LEU n 
1 127 ALA n 
1 128 LEU n 
1 129 ASP n 
1 130 VAL n 
1 131 ARG n 
1 132 ILE n 
1 133 ASP n 
1 134 GLU n 
1 135 HIS n 
1 136 GLY n 
1 137 THR n 
1 138 LYS n 
1 139 GLN n 
1 140 VAL n 
1 141 ALA n 
1 142 VAL n 
1 143 SER n 
1 144 GLY n 
1 145 TRP n 
1 146 GLN n 
1 147 GLU n 
1 148 ASN n 
1 149 SER n 
1 150 GLY n 
1 151 VAL n 
1 152 SER n 
1 153 LEU n 
1 154 GLU n 
1 155 GLN n 
1 156 LEU n 
1 157 VAL n 
1 158 GLU n 
1 159 THR n 
1 160 TYR n 
1 161 LEU n 
1 162 PRO n 
1 163 VAL n 
1 164 GLY n 
1 165 LEU n 
1 166 LYS n 
1 167 HIS n 
1 168 VAL n 
1 169 LEU n 
1 170 CYS n 
1 171 THR n 
1 172 ASP n 
1 173 ILE n 
1 174 SER n 
1 175 ARG n 
1 176 ALA n 
1 177 GLY n 
1 178 THR n 
1 179 LEU n 
1 180 ALA n 
1 181 GLY n 
1 182 SER n 
1 183 ASN n 
1 184 VAL n 
1 185 SER n 
1 186 LEU n 
1 187 TYR n 
1 188 GLU n 
1 189 GLU n 
1 190 VAL n 
1 191 CYS n 
1 192 ALA n 
1 193 ARG n 
1 194 TYR n 
1 195 PRO n 
1 196 GLN n 
1 197 ILE n 
1 198 ALA n 
1 199 PHE n 
1 200 GLN n 
1 201 SER n 
1 202 SER n 
1 203 GLY n 
1 204 GLY n 
1 205 ILE n 
1 206 GLY n 
1 207 ASP n 
1 208 ILE n 
1 209 ASP n 
1 210 ASP n 
1 211 ILE n 
1 212 ALA n 
1 213 ALA n 
1 214 LEU n 
1 215 ARG n 
1 216 GLY n 
1 217 THR n 
1 218 GLY n 
1 219 VAL n 
1 220 ARG n 
1 221 GLY n 
1 222 VAL n 
1 223 ILE n 
1 224 VAL n 
1 225 GLY n 
1 226 ARG n 
1 227 ALA n 
1 228 LEU n 
1 229 LEU n 
1 230 GLU n 
1 231 GLY n 
1 232 LYS n 
1 233 PHE n 
1 234 THR n 
1 235 VAL n 
1 236 LYS n 
1 237 GLU n 
1 238 ALA n 
1 239 ILE n 
1 240 GLN n 
1 241 CYS n 
1 242 TRP n 
1 243 GLN n 
1 244 ASN n 
1 245 VAL n 
1 246 LYS n 
1 247 GLY n 
1 248 HIS n 
1 249 HIS n 
1 250 HIS n 
1 251 HIS n 
1 252 HIS n 
1 253 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SALMONELLA ENTERICA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     28901 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PEXP5-CT 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    V7IJE3_SALET 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          V7IJE3 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5ABT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 245 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             V7IJE3 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  245 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       245 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5ABT LYS A 246 ? UNP V7IJE3 ?   ?   'expression tag'      246 1  
1 5ABT GLY A 247 ? UNP V7IJE3 ?   ?   'expression tag'      247 2  
1 5ABT HIS A 248 ? UNP V7IJE3 ?   ?   'expression tag'      248 3  
1 5ABT HIS A 249 ? UNP V7IJE3 ?   ?   'expression tag'      249 4  
1 5ABT HIS A 250 ? UNP V7IJE3 ?   ?   'expression tag'      250 5  
1 5ABT HIS A 251 ? UNP V7IJE3 ?   ?   'expression tag'      251 6  
1 5ABT HIS A 252 ? UNP V7IJE3 ?   ?   'expression tag'      252 7  
1 5ABT HIS A 253 ? UNP V7IJE3 ?   ?   'expression tag'      253 8  
1 5ABT ASN A 7   ? UNP V7IJE3 ASP 7   'engineered mutation' 7   9  
1 5ABT ALA A 102 ? UNP V7IJE3 GLY 102 'engineered mutation' 102 10 
1 5ABT MET A 106 ? UNP V7IJE3 VAL 106 'engineered mutation' 106 11 
1 5ABT ALA A 176 ? UNP V7IJE3 ASP 176 'engineered mutation' 176 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'        75.067  
GUO non-polymer         . 
;[(2R,3S,4R,5R)-5-[4-aminocarbonyl-5-[(E)-[[(2R,3R,4S,5R)-3,4-bis(oxidanyl)-5-(phosphonooxymethyl)oxolan-2-yl]amino]methylideneamino]imidazol-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methyl dihydrogen phosphate
;
? 'C15 H25 N5 O15 P2' 577.331 
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          5ABT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.53 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'MORPHEUS SCREEN H9, pH 8.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2015-07-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979490 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             0.979490 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5ABT 
_reflns.observed_criterion_sigma_I   2.05 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            1.65 
_reflns.number_obs                   112168 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.8 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.64 
_reflns.B_iso_Wilson_estimate        19.33 
_reflns.pdbx_redundancy              2.55 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.65 
_reflns_shell.d_res_low              1.75 
_reflns_shell.percent_possible_all   97.4 
_reflns_shell.Rmerge_I_obs           0.41 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.05 
_reflns_shell.pdbx_redundancy        2.56 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5ABT 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30686 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.318 
_refine.ls_d_res_high                            1.650 
_refine.ls_percent_reflns_obs                    99.33 
_refine.ls_R_factor_obs                          0.1656 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1645 
_refine.ls_R_factor_R_free                       0.1874 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1464 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               25.77 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'RESIDUES 247-253 ARE DISORDERED. K246 IS REPLACED BY ALANINE DUE TO POOR DENSITY' 
_refine.pdbx_starting_model                      'PDB ENTRY 5A5W' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.14 
_refine.pdbx_overall_phase_error                 17.27 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1841 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             226 
_refine_hist.number_atoms_total               2104 
_refine_hist.d_res_high                       1.650 
_refine_hist.d_res_low                        40.318 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 1968 'X-RAY DIFFRACTION' ? 
f_angle_d          1.440  ? ? 2693 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.790 ? ? 772  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.062  ? ? 321  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 350  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.6498 1.7088  2781 0.1914 99.00  0.2101 . . 176 . . 
'X-RAY DIFFRACTION' . 1.7088 1.7772  2840 0.1779 99.00  0.2517 . . 137 . . 
'X-RAY DIFFRACTION' . 1.7772 1.8581  2893 0.1717 99.00  0.2082 . . 134 . . 
'X-RAY DIFFRACTION' . 1.8581 1.9560  2856 0.1707 99.00  0.1964 . . 156 . . 
'X-RAY DIFFRACTION' . 1.9560 2.0786  2861 0.1702 99.00  0.2196 . . 135 . . 
'X-RAY DIFFRACTION' . 2.0786 2.2391  2933 0.1699 99.00  0.2018 . . 152 . . 
'X-RAY DIFFRACTION' . 2.2391 2.4644  2950 0.1664 100.00 0.1988 . . 111 . . 
'X-RAY DIFFRACTION' . 2.4644 2.8209  2942 0.1746 100.00 0.1770 . . 130 . . 
'X-RAY DIFFRACTION' . 2.8209 3.5537  3006 0.1728 100.00 0.1880 . . 159 . . 
'X-RAY DIFFRACTION' . 3.5537 40.3298 3160 0.1446 100.00 0.1624 . . 174 . . 
# 
_struct.entry_id                  5ABT 
_struct.title                     'S.enterica HisA mutant D7N, G102A, V106M, D176A' 
_struct.pdbx_descriptor           
'1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO) METHYLIDENE AMINO] IMIDAZOLE-4-CARBOXAMIDE ISOMERASE (E.C.5.3.1.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5ABT 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'ISOMERASE, PROTEIN EVOLUTION, IAD MODEL, TRPF' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 18  ? ASP A 20  ? GLN A 18  ASP A 20  5 ? 3  
HELX_P HELX_P2  2  ASP A 30  ? GLN A 41  ? ASP A 30  GLN A 41  1 ? 12 
HELX_P HELX_P3  3  LEU A 51  ? ASP A 56  ? LEU A 51  ASP A 56  1 ? 6  
HELX_P HELX_P4  4  PRO A 57  ? ARG A 60  ? PRO A 57  ARG A 60  5 ? 4  
HELX_P HELX_P5  5  GLN A 61  ? GLY A 71  ? GLN A 61  GLY A 71  1 ? 11 
HELX_P HELX_P6  6  THR A 84  ? ALA A 94  ? THR A 84  ALA A 94  1 ? 11 
HELX_P HELX_P7  7  ALA A 102 ? SER A 108 ? ALA A 102 SER A 108 1 ? 7  
HELX_P HELX_P8  8  SER A 108 ? GLY A 120 ? SER A 108 GLY A 120 1 ? 13 
HELX_P HELX_P9  9  LEU A 153 ? LEU A 161 ? LEU A 153 LEU A 161 1 ? 9  
HELX_P HELX_P10 10 PRO A 162 ? GLY A 164 ? PRO A 162 GLY A 164 5 ? 3  
HELX_P HELX_P11 11 ASN A 183 ? TYR A 194 ? ASN A 183 TYR A 194 1 ? 12 
HELX_P HELX_P12 12 ASP A 207 ? ALA A 213 ? ASP A 207 ALA A 213 1 ? 7  
HELX_P HELX_P13 13 GLY A 225 ? GLU A 230 ? GLY A 225 GLU A 230 1 ? 6  
HELX_P HELX_P14 14 THR A 234 ? LYS A 246 ? THR A 234 LYS A 246 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 11 ? 
AB ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? parallel      
AA 8 9 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 2   ? ILE A 9   ? ILE A 2   ILE A 9   
AA 2 GLY A 221 ? VAL A 224 ? GLY A 221 VAL A 224 
AA 3 ALA A 198 ? SER A 202 ? ALA A 198 SER A 202 
AA 4 HIS A 167 ? THR A 171 ? HIS A 167 THR A 171 
AA 5 LEU A 124 ? ALA A 127 ? LEU A 124 ALA A 127 
AA 6 ARG A 98  ? ILE A 101 ? ARG A 98  ILE A 101 
AA 7 VAL A 76  ? GLY A 79  ? VAL A 76  GLY A 79  
AA 8 LEU A 46  ? ASP A 50  ? LEU A 46  ASP A 50  
AA 9 ILE A 2   ? ILE A 9   ? ILE A 2   ILE A 9   
AB 1 VAL A 130 ? ILE A 132 ? VAL A 130 ILE A 132 
AB 2 LYS A 138 ? VAL A 142 ? LYS A 138 VAL A 142 
AB 3 GLU A 147 ? SER A 152 ? GLU A 147 SER A 152 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 3   ? N ILE A 3   O VAL A 222 ? O VAL A 222 
AA 2 3 N ILE A 223 ? N ILE A 223 O SER A 201 ? O SER A 201 
AA 3 4 N GLN A 200 ? N GLN A 200 O VAL A 168 ? O VAL A 168 
AA 4 5 N LEU A 169 ? N LEU A 169 O LEU A 126 ? O LEU A 126 
AA 5 6 N VAL A 125 ? N VAL A 125 O VAL A 99  ? O VAL A 99  
AA 6 7 N VAL A 100 ? N VAL A 100 O VAL A 78  ? O VAL A 78  
AA 7 8 N GLN A 77  ? N GLN A 77  O LEU A 46  ? O LEU A 46  
AA 8 9 N VAL A 224 ? N VAL A 224 O ILE A 3   ? O ILE A 3   
AB 1 2 N ARG A 131 ? N ARG A 131 O GLN A 139 ? O GLN A 139 
AB 2 3 N VAL A 142 ? N VAL A 142 O GLU A 147 ? O GLU A 147 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    32 
_struct_site.details              'BINDING SITE FOR RESIDUE GUO A 1247' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 32 ASN A 7   ? ASN A 7    . ? 1_555 ? 
2  AC1 32 GLY A 19  ? GLY A 19   . ? 1_555 ? 
3  AC1 32 HIS A 47  ? HIS A 47   . ? 1_555 ? 
4  AC1 32 VAL A 49  ? VAL A 49   . ? 1_555 ? 
5  AC1 32 LEU A 51  ? LEU A 51   . ? 1_555 ? 
6  AC1 32 GLY A 80  ? GLY A 80   . ? 1_555 ? 
7  AC1 32 GLY A 81  ? GLY A 81   . ? 1_555 ? 
8  AC1 32 ARG A 83  ? ARG A 83   . ? 1_555 ? 
9  AC1 32 VAL A 100 ? VAL A 100  . ? 1_555 ? 
10 AC1 32 ALA A 102 ? ALA A 102  . ? 1_555 ? 
11 AC1 32 SER A 103 ? SER A 103  . ? 1_555 ? 
12 AC1 32 ASP A 129 ? ASP A 129  . ? 1_555 ? 
13 AC1 32 GLY A 144 ? GLY A 144  . ? 1_555 ? 
14 AC1 32 TRP A 145 ? TRP A 145  . ? 1_555 ? 
15 AC1 32 ALA A 176 ? ALA A 176  . ? 1_555 ? 
16 AC1 32 GLY A 177 ? GLY A 177  . ? 1_555 ? 
17 AC1 32 SER A 202 ? SER A 202  . ? 1_555 ? 
18 AC1 32 GLY A 203 ? GLY A 203  . ? 1_555 ? 
19 AC1 32 GLY A 204 ? GLY A 204  . ? 1_555 ? 
20 AC1 32 ILE A 223 ? ILE A 223  . ? 1_555 ? 
21 AC1 32 GLY A 225 ? GLY A 225  . ? 1_555 ? 
22 AC1 32 ARG A 226 ? ARG A 226  . ? 1_555 ? 
23 AC1 32 HOH C .   ? HOH A 2076 . ? 1_555 ? 
24 AC1 32 HOH C .   ? HOH A 2080 . ? 1_555 ? 
25 AC1 32 HOH C .   ? HOH A 2100 . ? 1_555 ? 
26 AC1 32 HOH C .   ? HOH A 2101 . ? 1_555 ? 
27 AC1 32 HOH C .   ? HOH A 2148 . ? 1_555 ? 
28 AC1 32 HOH C .   ? HOH A 2173 . ? 1_555 ? 
29 AC1 32 HOH C .   ? HOH A 2197 . ? 1_555 ? 
30 AC1 32 HOH C .   ? HOH A 2198 . ? 1_555 ? 
31 AC1 32 HOH C .   ? HOH A 2225 . ? 1_555 ? 
32 AC1 32 HOH C .   ? HOH A 2226 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5ABT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5ABT 
_atom_sites.fract_transf_matrix[1][1]   0.021480 
_atom_sites.fract_transf_matrix[1][2]   0.012401 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024803 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005092 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? -15.100 11.379 -13.679 1.00 24.38 ? 1    MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? -15.728 12.254 -14.656 1.00 23.56 ? 1    MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? -14.781 12.596 -15.808 1.00 20.91 ? 1    MET A C   1 
ATOM   4    O O   . MET A 1 1   ? -13.581 12.777 -15.603 1.00 21.46 ? 1    MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? -16.200 13.516 -13.957 1.00 34.34 ? 1    MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? -16.847 14.560 -14.827 1.00 43.77 ? 1    MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? -16.930 16.072 -13.857 1.00 86.73 ? 1    MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? -15.390 15.932 -12.946 1.00 43.39 ? 1    MET A CE  1 
ATOM   9    N N   . ILE A 1 2   ? -15.336 12.667 -17.015 1.00 18.29 ? 2    ILE A N   1 
ATOM   10   C CA  . ILE A 1 2   ? -14.587 13.128 -18.184 1.00 16.74 ? 2    ILE A CA  1 
ATOM   11   C C   . ILE A 1 2   ? -14.368 14.629 -18.096 1.00 15.79 ? 2    ILE A C   1 
ATOM   12   O O   . ILE A 1 2   ? -15.313 15.391 -17.825 1.00 17.60 ? 2    ILE A O   1 
ATOM   13   C CB  . ILE A 1 2   ? -15.327 12.783 -19.495 1.00 18.65 ? 2    ILE A CB  1 
ATOM   14   C CG1 . ILE A 1 2   ? -15.580 11.273 -19.594 1.00 23.07 ? 2    ILE A CG1 1 
ATOM   15   C CG2 . ILE A 1 2   ? -14.560 13.301 -20.718 1.00 18.88 ? 2    ILE A CG2 1 
ATOM   16   C CD1 . ILE A 1 2   ? -14.309 10.411 -19.603 1.00 21.75 ? 2    ILE A CD1 1 
ATOM   17   N N   . ILE A 1 3   ? -13.119 15.061 -18.313 1.00 14.76 ? 3    ILE A N   1 
ATOM   18   C CA  . ILE A 1 3   ? -12.780 16.476 -18.251 1.00 14.37 ? 3    ILE A CA  1 
ATOM   19   C C   . ILE A 1 3   ? -12.144 16.883 -19.571 1.00 13.37 ? 3    ILE A C   1 
ATOM   20   O O   . ILE A 1 3   ? -10.937 16.717 -19.770 1.00 15.04 ? 3    ILE A O   1 
ATOM   21   C CB  . ILE A 1 3   ? -11.795 16.789 -17.084 1.00 15.60 ? 3    ILE A CB  1 
ATOM   22   C CG1 . ILE A 1 3   ? -12.330 16.229 -15.751 1.00 16.28 ? 3    ILE A CG1 1 
ATOM   23   C CG2 . ILE A 1 3   ? -11.513 18.291 -17.006 1.00 16.63 ? 3    ILE A CG2 1 
ATOM   24   C CD1 . ILE A 1 3   ? -11.345 16.410 -14.595 1.00 21.39 ? 3    ILE A CD1 1 
ATOM   25   N N   . PRO A 1 4   ? -12.951 17.397 -20.505 1.00 13.69 ? 4    PRO A N   1 
ATOM   26   C CA  . PRO A 1 4   ? -12.375 17.908 -21.757 1.00 13.55 ? 4    PRO A CA  1 
ATOM   27   C C   . PRO A 1 4   ? -11.423 19.072 -21.506 1.00 14.30 ? 4    PRO A C   1 
ATOM   28   O O   . PRO A 1 4   ? -11.689 19.892 -20.623 1.00 15.22 ? 4    PRO A O   1 
ATOM   29   C CB  . PRO A 1 4   ? -13.609 18.369 -22.551 1.00 14.96 ? 4    PRO A CB  1 
ATOM   30   C CG  . PRO A 1 4   ? -14.749 17.594 -21.948 1.00 15.88 ? 4    PRO A CG  1 
ATOM   31   C CD  . PRO A 1 4   ? -14.419 17.503 -20.482 1.00 16.23 ? 4    PRO A CD  1 
ATOM   32   N N   . ALA A 1 5   ? -10.333 19.135 -22.270 1.00 12.01 ? 5    ALA A N   1 
ATOM   33   C CA  . ALA A 1 5   ? -9.311  20.155 -22.083 1.00 11.12 ? 5    ALA A CA  1 
ATOM   34   C C   . ALA A 1 5   ? -9.067  20.931 -23.358 1.00 11.65 ? 5    ALA A C   1 
ATOM   35   O O   . ALA A 1 5   ? -8.998  20.341 -24.437 1.00 13.31 ? 5    ALA A O   1 
ATOM   36   C CB  . ALA A 1 5   ? -7.975  19.513 -21.615 1.00 14.02 ? 5    ALA A CB  1 
ATOM   37   N N   . LEU A 1 6   ? -8.887  22.243 -23.223 1.00 11.50 ? 6    LEU A N   1 
ATOM   38   C CA  . LEU A 1 6   ? -8.348  23.057 -24.293 1.00 11.07 ? 6    LEU A CA  1 
ATOM   39   C C   . LEU A 1 6   ? -7.055  23.700 -23.816 1.00 11.11 ? 6    LEU A C   1 
ATOM   40   O O   . LEU A 1 6   ? -6.913  24.059 -22.639 1.00 13.87 ? 6    LEU A O   1 
ATOM   41   C CB  . LEU A 1 6   ? -9.322  24.145 -24.732 1.00 13.74 ? 6    LEU A CB  1 
ATOM   42   C CG  . LEU A 1 6   ? -10.643 23.682 -25.345 1.00 14.85 ? 6    LEU A CG  1 
ATOM   43   C CD1 . LEU A 1 6   ? -11.412 24.924 -25.824 1.00 17.92 ? 6    LEU A CD1 1 
ATOM   44   C CD2 . LEU A 1 6   ? -10.385 22.704 -26.485 1.00 14.98 ? 6    LEU A CD2 1 
ATOM   45   N N   . ASN A 1 7   ? -6.112  23.821 -24.740 1.00 11.64 ? 7    ASN A N   1 
ATOM   46   C CA  . ASN A 1 7   ? -4.851  24.517 -24.496 1.00 11.60 ? 7    ASN A CA  1 
ATOM   47   C C   . ASN A 1 7   ? -4.766  25.718 -25.427 1.00 14.79 ? 7    ASN A C   1 
ATOM   48   O O   . ASN A 1 7   ? -5.067  25.594 -26.611 1.00 15.53 ? 7    ASN A O   1 
ATOM   49   C CB  . ASN A 1 7   ? -3.652  23.602 -24.740 1.00 11.99 ? 7    ASN A CB  1 
ATOM   50   C CG  . ASN A 1 7   ? -3.647  22.359 -23.863 1.00 13.50 ? 7    ASN A CG  1 
ATOM   51   O OD1 . ASN A 1 7   ? -2.915  21.417 -24.147 1.00 16.42 ? 7    ASN A OD1 1 
ATOM   52   N ND2 . ASN A 1 7   ? -4.452  22.347 -22.807 1.00 13.55 ? 7    ASN A ND2 1 
ATOM   53   N N   . LEU A 1 8   ? -4.333  26.862 -24.908 1.00 12.56 ? 8    LEU A N   1 
ATOM   54   C CA  . LEU A 1 8   ? -4.403  28.112 -25.676 1.00 13.97 ? 8    LEU A CA  1 
ATOM   55   C C   . LEU A 1 8   ? -3.068  28.795 -25.845 1.00 15.90 ? 8    LEU A C   1 
ATOM   56   O O   . LEU A 1 8   ? -2.386  29.042 -24.855 1.00 14.79 ? 8    LEU A O   1 
ATOM   57   C CB  . LEU A 1 8   ? -5.356  29.084 -24.981 1.00 14.35 ? 8    LEU A CB  1 
ATOM   58   C CG  . LEU A 1 8   ? -6.739  28.490 -24.766 1.00 16.74 ? 8    LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 8   ? -7.478  29.352 -23.746 1.00 21.17 ? 8    LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 8   ? -7.495  28.430 -26.080 1.00 21.29 ? 8    LEU A CD2 1 
ATOM   61   N N   . ILE A 1 9   ? -2.703  29.103 -27.095 1.00 13.76 ? 9    ILE A N   1 
ATOM   62   C CA  . ILE A 1 9   ? -1.529  29.935 -27.362 1.00 16.83 ? 9    ILE A CA  1 
ATOM   63   C C   . ILE A 1 9   ? -2.000  31.165 -28.127 1.00 18.77 ? 9    ILE A C   1 
ATOM   64   O O   . ILE A 1 9   ? -2.478  31.046 -29.257 1.00 19.91 ? 9    ILE A O   1 
ATOM   65   C CB  . ILE A 1 9   ? -0.450  29.179 -28.162 1.00 18.36 ? 9    ILE A CB  1 
ATOM   66   C CG1 . ILE A 1 9   ? 0.193   28.097 -27.296 1.00 18.35 ? 9    ILE A CG1 1 
ATOM   67   C CG2 . ILE A 1 9   ? 0.646   30.138 -28.632 1.00 20.52 ? 9    ILE A CG2 1 
ATOM   68   C CD1 . ILE A 1 9   ? 1.266   27.316 -28.025 1.00 19.16 ? 9    ILE A CD1 1 
ATOM   69   N N   A ASP A 1 10  ? -1.896  32.330 -27.491 0.50 18.59 ? 10   ASP A N   1 
ATOM   70   N N   B ASP A 1 10  ? -1.884  32.329 -27.489 0.50 18.68 ? 10   ASP A N   1 
ATOM   71   C CA  A ASP A 1 10  ? -2.267  33.603 -28.110 0.50 21.28 ? 10   ASP A CA  1 
ATOM   72   C CA  B ASP A 1 10  ? -2.270  33.613 -28.079 0.50 21.21 ? 10   ASP A CA  1 
ATOM   73   C C   A ASP A 1 10  ? -3.644  33.573 -28.765 0.50 22.77 ? 10   ASP A C   1 
ATOM   74   C C   B ASP A 1 10  ? -3.637  33.565 -28.759 0.50 22.70 ? 10   ASP A C   1 
ATOM   75   O O   A ASP A 1 10  ? -3.810  34.039 -29.890 0.50 24.29 ? 10   ASP A O   1 
ATOM   76   O O   B ASP A 1 10  ? -3.786  34.006 -29.898 0.50 24.17 ? 10   ASP A O   1 
ATOM   77   C CB  A ASP A 1 10  ? -1.214  34.016 -29.144 0.50 24.08 ? 10   ASP A CB  1 
ATOM   78   C CB  B ASP A 1 10  ? -1.210  34.085 -29.081 0.50 24.96 ? 10   ASP A CB  1 
ATOM   79   C CG  A ASP A 1 10  ? 0.080   34.470 -28.501 0.50 26.85 ? 10   ASP A CG  1 
ATOM   80   C CG  B ASP A 1 10  ? -1.305  35.573 -29.369 0.50 32.38 ? 10   ASP A CG  1 
ATOM   81   O OD1 A ASP A 1 10  ? 0.020   35.086 -27.417 0.50 30.66 ? 10   ASP A OD1 1 
ATOM   82   O OD1 B ASP A 1 10  ? -1.728  36.329 -28.467 0.50 35.84 ? 10   ASP A OD1 1 
ATOM   83   O OD2 A ASP A 1 10  ? 1.155   34.218 -29.082 0.50 30.18 ? 10   ASP A OD2 1 
ATOM   84   O OD2 B ASP A 1 10  ? -0.967  35.988 -30.496 0.50 39.63 ? 10   ASP A OD2 1 
ATOM   85   N N   . GLY A 1 11  ? -4.625  33.017 -28.059 1.00 19.01 ? 11   GLY A N   1 
ATOM   86   C CA  . GLY A 1 11  ? -5.988  32.962 -28.558 1.00 22.04 ? 11   GLY A CA  1 
ATOM   87   C C   . GLY A 1 11  ? -6.341  31.754 -29.402 1.00 22.72 ? 11   GLY A C   1 
ATOM   88   O O   . GLY A 1 11  ? -7.509  31.539 -29.722 1.00 26.31 ? 11   GLY A O   1 
ATOM   89   N N   . THR A 1 12  ? -5.339  30.955 -29.749 1.00 20.19 ? 12   THR A N   1 
ATOM   90   C CA  . THR A 1 12  ? -5.523  29.818 -30.640 1.00 20.02 ? 12   THR A CA  1 
ATOM   91   C C   . THR A 1 12  ? -5.545  28.516 -29.850 1.00 17.89 ? 12   THR A C   1 
ATOM   92   O O   . THR A 1 12  ? -4.731  28.319 -28.952 1.00 17.67 ? 12   THR A O   1 
ATOM   93   C CB  . THR A 1 12  ? -4.402  29.749 -31.691 1.00 24.14 ? 12   THR A CB  1 
ATOM   94   O OG1 . THR A 1 12  ? -4.511  30.871 -32.576 1.00 30.52 ? 12   THR A OG1 1 
ATOM   95   C CG2 . THR A 1 12  ? -4.525  28.492 -32.515 1.00 24.23 ? 12   THR A CG2 1 
ATOM   96   N N   . VAL A 1 13  ? -6.475  27.633 -30.194 1.00 17.39 ? 13   VAL A N   1 
ATOM   97   C CA  . VAL A 1 13  ? -6.515  26.298 -29.606 1.00 15.45 ? 13   VAL A CA  1 
ATOM   98   C C   . VAL A 1 13  ? -5.410  25.446 -30.223 1.00 18.20 ? 13   VAL A C   1 
ATOM   99   O O   . VAL A 1 13  ? -5.331  25.331 -31.449 1.00 16.53 ? 13   VAL A O   1 
ATOM   100  C CB  . VAL A 1 13  ? -7.892  25.632 -29.845 1.00 16.82 ? 13   VAL A CB  1 
ATOM   101  C CG1 . VAL A 1 13  ? -7.888  24.179 -29.343 1.00 16.24 ? 13   VAL A CG1 1 
ATOM   102  C CG2 . VAL A 1 13  ? -8.987  26.442 -29.152 1.00 14.93 ? 13   VAL A CG2 1 
ATOM   103  N N   . VAL A 1 14  ? -4.550  24.823 -29.431 1.00 14.61 ? 14   VAL A N   1 
ATOM   104  C CA  . VAL A 1 14  ? -3.463  24.052 -29.977 1.00 15.94 ? 14   VAL A CA  1 
ATOM   105  C C   . VAL A 1 14  ? -3.239  22.779 -29.189 1.00 17.38 ? 14   VAL A C   1 
ATOM   106  O O   . VAL A 1 14  ? -3.736  22.635 -28.102 1.00 17.73 ? 14   VAL A O   1 
ATOM   107  C CB  . VAL A 1 14  ? -2.143  24.839 -29.856 1.00 17.04 ? 14   VAL A CB  1 
ATOM   108  C CG1 . VAL A 1 14  ? -2.221  26.142 -30.610 1.00 20.49 ? 14   VAL A CG1 1 
ATOM   109  C CG2 . VAL A 1 14  ? -1.813  25.108 -28.393 1.00 18.91 ? 14   VAL A CG2 1 
ATOM   110  N N   A ARG A 1 15  ? -2.495  21.877 -29.790 0.56 16.69 ? 15   ARG A N   1 
ATOM   111  N N   B ARG A 1 15  ? -2.454  21.887 -29.753 0.44 17.79 ? 15   ARG A N   1 
ATOM   112  C CA  A ARG A 1 15  ? -2.092  20.600 -29.236 0.56 15.80 ? 15   ARG A CA  1 
ATOM   113  C CA  B ARG A 1 15  ? -2.026  20.706 -29.048 0.44 15.32 ? 15   ARG A CA  1 
ATOM   114  C C   A ARG A 1 15  ? -0.579  20.627 -29.353 0.56 15.22 ? 15   ARG A C   1 
ATOM   115  C C   B ARG A 1 15  ? -0.531  20.639 -29.287 0.44 15.58 ? 15   ARG A C   1 
ATOM   116  O O   A ARG A 1 15  ? -0.059  20.941 -30.402 0.56 16.63 ? 15   ARG A O   1 
ATOM   117  O O   B ARG A 1 15  ? -0.064  20.893 -30.383 0.44 16.17 ? 15   ARG A O   1 
ATOM   118  C CB  A ARG A 1 15  ? -2.671  19.451 -30.083 0.56 17.20 ? 15   ARG A CB  1 
ATOM   119  C CB  B ARG A 1 15  ? -2.732  19.430 -29.459 0.44 14.59 ? 15   ARG A CB  1 
ATOM   120  C CG  A ARG A 1 15  ? -2.135  18.031 -29.948 0.56 17.15 ? 15   ARG A CG  1 
ATOM   121  C CG  B ARG A 1 15  ? -2.189  18.778 -30.669 0.44 19.60 ? 15   ARG A CG  1 
ATOM   122  C CD  A ARG A 1 15  ? -0.631  17.893 -30.076 0.56 16.32 ? 15   ARG A CD  1 
ATOM   123  C CD  B ARG A 1 15  ? -1.077  17.784 -30.444 0.44 19.67 ? 15   ARG A CD  1 
ATOM   124  N NE  A ARG A 1 15  ? -0.096  16.840 -30.919 0.56 20.86 ? 15   ARG A NE  1 
ATOM   125  N NE  B ARG A 1 15  ? -0.946  17.161 -31.743 0.44 24.57 ? 15   ARG A NE  1 
ATOM   126  C CZ  A ARG A 1 15  ? 0.794   17.067 -31.882 0.56 20.77 ? 15   ARG A CZ  1 
ATOM   127  C CZ  B ARG A 1 15  ? 0.075   17.328 -32.569 0.44 23.39 ? 15   ARG A CZ  1 
ATOM   128  N NH1 A ARG A 1 15  ? 1.181   18.296 -32.125 0.56 22.71 ? 15   ARG A NH1 1 
ATOM   129  N NH1 B ARG A 1 15  ? 1.120   18.058 -32.209 0.44 21.96 ? 15   ARG A NH1 1 
ATOM   130  N NH2 A ARG A 1 15  ? 1.288   16.078 -32.602 0.56 22.57 ? 15   ARG A NH2 1 
ATOM   131  N NH2 B ARG A 1 15  ? 0.030   16.743 -33.759 0.44 23.12 ? 15   ARG A NH2 1 
ATOM   132  N N   . LEU A 1 16  ? 0.118   20.270 -28.286 1.00 15.11 ? 16   LEU A N   1 
ATOM   133  C CA  . LEU A 1 16  ? 1.567   20.206 -28.342 1.00 14.87 ? 16   LEU A CA  1 
ATOM   134  C C   . LEU A 1 16  ? 1.997   18.761 -28.167 1.00 16.52 ? 16   LEU A C   1 
ATOM   135  O O   . LEU A 1 16  ? 1.571   18.112 -27.256 1.00 17.49 ? 16   LEU A O   1 
ATOM   136  C CB  . LEU A 1 16  ? 2.207   21.012 -27.224 1.00 14.08 ? 16   LEU A CB  1 
ATOM   137  C CG  . LEU A 1 16  ? 1.997   22.514 -27.110 1.00 16.15 ? 16   LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 16  ? 2.856   23.126 -26.011 1.00 16.34 ? 16   LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 16  ? 2.236   23.204 -28.434 1.00 18.40 ? 16   LEU A CD2 1 
ATOM   140  N N   . HIS A 1 17  ? 2.843   18.266 -29.050 1.00 13.89 ? 17   HIS A N   1 
ATOM   141  C CA  . HIS A 1 17  ? 3.371   16.911 -28.903 1.00 14.29 ? 17   HIS A CA  1 
ATOM   142  C C   . HIS A 1 17  ? 4.263   16.834 -27.677 1.00 12.51 ? 17   HIS A C   1 
ATOM   143  O O   . HIS A 1 17  ? 5.321   17.473 -27.637 1.00 14.94 ? 17   HIS A O   1 
ATOM   144  C CB  . HIS A 1 17  ? 4.167   16.502 -30.142 1.00 15.88 ? 17   HIS A CB  1 
ATOM   145  C CG  . HIS A 1 17  ? 4.746   15.126 -30.051 1.00 15.55 ? 17   HIS A CG  1 
ATOM   146  N ND1 . HIS A 1 17  ? 4.177   14.039 -30.681 1.00 20.47 ? 17   HIS A ND1 1 
ATOM   147  C CD2 . HIS A 1 17  ? 5.849   14.660 -29.417 1.00 16.37 ? 17   HIS A CD2 1 
ATOM   148  C CE1 . HIS A 1 17  ? 4.895   12.962 -30.421 1.00 22.49 ? 17   HIS A CE1 1 
ATOM   149  N NE2 . HIS A 1 17  ? 5.920   13.311 -29.662 1.00 19.24 ? 17   HIS A NE2 1 
ATOM   150  N N   . GLN A 1 18  ? 3.826   16.074 -26.673 1.00 12.39 ? 18   GLN A N   1 
ATOM   151  C CA  . GLN A 1 18  ? 4.566   15.948 -25.417 1.00 12.89 ? 18   GLN A CA  1 
ATOM   152  C C   . GLN A 1 18  ? 4.855   17.322 -24.803 1.00 13.88 ? 18   GLN A C   1 
ATOM   153  O O   . GLN A 1 18  ? 5.851   17.510 -24.104 1.00 16.18 ? 18   GLN A O   1 
ATOM   154  C CB  . GLN A 1 18  ? 5.857   15.135 -25.632 1.00 17.45 ? 18   GLN A CB  1 
ATOM   155  C CG  . GLN A 1 18  ? 5.566   13.685 -26.043 1.00 16.61 ? 18   GLN A CG  1 
ATOM   156  C CD  . GLN A 1 18  ? 6.800   12.889 -26.377 1.00 20.36 ? 18   GLN A CD  1 
ATOM   157  O OE1 . GLN A 1 18  ? 7.813   13.441 -26.818 1.00 21.82 ? 18   GLN A OE1 1 
ATOM   158  N NE2 . GLN A 1 18  ? 6.720   11.574 -26.187 1.00 18.53 ? 18   GLN A NE2 1 
ATOM   159  N N   . GLY A 1 19  ? 3.946   18.273 -25.035 1.00 12.57 ? 19   GLY A N   1 
ATOM   160  C CA  . GLY A 1 19  ? 4.085   19.597 -24.454 1.00 14.86 ? 19   GLY A CA  1 
ATOM   161  C C   . GLY A 1 19  ? 5.244   20.411 -25.012 1.00 15.34 ? 19   GLY A C   1 
ATOM   162  O O   . GLY A 1 19  ? 5.623   21.445 -24.442 1.00 14.33 ? 19   GLY A O   1 
ATOM   163  N N   . ASP A 1 20  ? 5.810   19.959 -26.132 1.00 13.04 ? 20   ASP A N   1 
ATOM   164  C CA  . ASP A 1 20  ? 6.908   20.676 -26.778 1.00 15.00 ? 20   ASP A CA  1 
ATOM   165  C C   . ASP A 1 20  ? 6.355   21.854 -27.572 1.00 15.33 ? 20   ASP A C   1 
ATOM   166  O O   . ASP A 1 20  ? 5.583   21.655 -28.506 1.00 16.15 ? 20   ASP A O   1 
ATOM   167  C CB  . ASP A 1 20  ? 7.687   19.721 -27.688 1.00 16.41 ? 20   ASP A CB  1 
ATOM   168  C CG  . ASP A 1 20  ? 8.951   20.342 -28.278 1.00 20.40 ? 20   ASP A CG  1 
ATOM   169  O OD1 . ASP A 1 20  ? 9.080   21.585 -28.337 1.00 20.57 ? 20   ASP A OD1 1 
ATOM   170  O OD2 . ASP A 1 20  ? 9.825   19.556 -28.697 1.00 22.71 ? 20   ASP A OD2 1 
ATOM   171  N N   . TYR A 1 21  ? 6.729   23.073 -27.187 1.00 16.95 ? 21   TYR A N   1 
ATOM   172  C CA  . TYR A 1 21  ? 6.207   24.268 -27.855 1.00 17.74 ? 21   TYR A CA  1 
ATOM   173  C C   . TYR A 1 21  ? 6.624   24.384 -29.312 1.00 20.50 ? 21   TYR A C   1 
ATOM   174  O O   . TYR A 1 21  ? 6.045   25.188 -30.061 1.00 19.58 ? 21   TYR A O   1 
ATOM   175  C CB  . TYR A 1 21  ? 6.640   25.529 -27.109 1.00 19.57 ? 21   TYR A CB  1 
ATOM   176  C CG  . TYR A 1 21  ? 5.862   25.837 -25.859 1.00 19.43 ? 21   TYR A CG  1 
ATOM   177  C CD1 . TYR A 1 21  ? 6.157   25.199 -24.657 1.00 18.35 ? 21   TYR A CD1 1 
ATOM   178  C CD2 . TYR A 1 21  ? 4.871   26.812 -25.857 1.00 16.65 ? 21   TYR A CD2 1 
ATOM   179  C CE1 . TYR A 1 21  ? 5.454   25.499 -23.492 1.00 18.93 ? 21   TYR A CE1 1 
ATOM   180  C CE2 . TYR A 1 21  ? 4.168   27.120 -24.697 1.00 17.22 ? 21   TYR A CE2 1 
ATOM   181  C CZ  . TYR A 1 21  ? 4.461   26.462 -23.518 1.00 18.25 ? 21   TYR A CZ  1 
ATOM   182  O OH  . TYR A 1 21  ? 3.768   26.768 -22.360 1.00 18.34 ? 21   TYR A OH  1 
ATOM   183  N N   . ALA A 1 22  ? 7.621   23.599 -29.718 1.00 17.13 ? 22   ALA A N   1 
ATOM   184  C CA  . ALA A 1 22  ? 8.075   23.592 -31.107 1.00 19.32 ? 22   ALA A CA  1 
ATOM   185  C C   . ALA A 1 22  ? 7.293   22.571 -31.934 1.00 21.09 ? 22   ALA A C   1 
ATOM   186  O O   . ALA A 1 22  ? 7.557   22.380 -33.124 1.00 22.64 ? 22   ALA A O   1 
ATOM   187  C CB  . ALA A 1 22  ? 9.572   23.290 -31.175 1.00 20.66 ? 22   ALA A CB  1 
ATOM   188  N N   . ARG A 1 23  ? 6.331   21.906 -31.303 1.00 18.33 ? 23   ARG A N   1 
ATOM   189  C CA  . ARG A 1 23  ? 5.597   20.828 -31.960 1.00 17.58 ? 23   ARG A CA  1 
ATOM   190  C C   . ARG A 1 23  ? 4.076   21.025 -31.865 1.00 17.35 ? 23   ARG A C   1 
ATOM   191  O O   . ARG A 1 23  ? 3.339   20.217 -31.266 1.00 17.90 ? 23   ARG A O   1 
ATOM   192  C CB  . ARG A 1 23  ? 6.032   19.480 -31.362 1.00 16.84 ? 23   ARG A CB  1 
ATOM   193  C CG  . ARG A 1 23  ? 7.550   19.269 -31.518 1.00 18.36 ? 23   ARG A CG  1 
ATOM   194  C CD  . ARG A 1 23  ? 8.023   17.905 -31.056 1.00 19.66 ? 23   ARG A CD  1 
ATOM   195  N NE  . ARG A 1 23  ? 7.549   16.844 -31.937 1.00 18.65 ? 23   ARG A NE  1 
ATOM   196  C CZ  . ARG A 1 23  ? 7.961   15.581 -31.866 1.00 18.59 ? 23   ARG A CZ  1 
ATOM   197  N NH1 . ARG A 1 23  ? 8.865   15.232 -30.964 1.00 20.51 ? 23   ARG A NH1 1 
ATOM   198  N NH2 . ARG A 1 23  ? 7.469   14.669 -32.700 1.00 20.37 ? 23   ARG A NH2 1 
ATOM   199  N N   . GLN A 1 24  ? 3.608   22.106 -32.481 1.00 23.36 ? 24   GLN A N   1 
ATOM   200  C CA  . GLN A 1 24  ? 2.196   22.481 -32.382 1.00 22.28 ? 24   GLN A CA  1 
ATOM   201  C C   . GLN A 1 24  ? 1.366   21.961 -33.537 1.00 22.61 ? 24   GLN A C   1 
ATOM   202  O O   . GLN A 1 24  ? 1.860   21.796 -34.656 1.00 23.91 ? 24   GLN A O   1 
ATOM   203  C CB  . GLN A 1 24  ? 2.038   23.997 -32.331 1.00 24.29 ? 24   GLN A CB  1 
ATOM   204  C CG  . GLN A 1 24  ? 2.928   24.712 -31.364 1.00 30.41 ? 24   GLN A CG  1 
ATOM   205  C CD  . GLN A 1 24  ? 2.680   26.204 -31.371 1.00 32.36 ? 24   GLN A CD  1 
ATOM   206  O OE1 . GLN A 1 24  ? 1.684   26.678 -31.927 1.00 31.29 ? 24   GLN A OE1 1 
ATOM   207  N NE2 . GLN A 1 24  ? 3.608   26.958 -30.789 1.00 32.72 ? 24   GLN A NE2 1 
ATOM   208  N N   . ARG A 1 25  ? 0.097   21.699 -33.245 1.00 21.59 ? 25   ARG A N   1 
ATOM   209  C CA  . ARG A 1 25  ? -0.925  21.610 -34.263 1.00 22.86 ? 25   ARG A CA  1 
ATOM   210  C C   . ARG A 1 25  ? -2.042  22.561 -33.845 1.00 21.05 ? 25   ARG A C   1 
ATOM   211  O O   . ARG A 1 25  ? -2.419  22.626 -32.660 1.00 22.16 ? 25   ARG A O   1 
ATOM   212  C CB  . ARG A 1 25  ? -1.438  20.183 -34.423 1.00 26.85 ? 25   ARG A CB  1 
ATOM   213  C CG  . ARG A 1 25  ? -2.544  20.023 -35.455 1.00 38.89 ? 25   ARG A CG  1 
ATOM   214  C CD  . ARG A 1 25  ? -2.018  19.466 -36.771 1.00 48.34 ? 25   ARG A CD  1 
ATOM   215  N NE  . ARG A 1 25  ? -1.163  18.272 -36.650 1.00 47.12 ? 25   ARG A NE  1 
ATOM   216  C CZ  . ARG A 1 25  ? -1.517  17.026 -36.970 1.00 43.02 ? 25   ARG A CZ  1 
ATOM   217  N NH1 . ARG A 1 25  ? -2.740  16.763 -37.419 1.00 46.72 ? 25   ARG A NH1 1 
ATOM   218  N NH2 . ARG A 1 25  ? -0.647  16.031 -36.822 1.00 38.05 ? 25   ARG A NH2 1 
ATOM   219  N N   . ASP A 1 26  ? -2.653  23.313 -34.707 1.00 21.58 ? 26   ASP A N   1 
ATOM   220  C CA  . ASP A 1 26  ? -3.658  24.367 -34.613 1.00 27.61 ? 26   ASP A CA  1 
ATOM   221  C C   . ASP A 1 26  ? -5.080  23.868 -34.905 1.00 20.95 ? 26   ASP A C   1 
ATOM   222  O O   . ASP A 1 26  ? -5.275  23.024 -35.781 1.00 24.47 ? 26   ASP A O   1 
ATOM   223  C CB  . ASP A 1 26  ? -3.259  25.493 -35.574 1.00 37.24 ? 26   ASP A CB  1 
ATOM   224  C CG  . ASP A 1 26  ? -4.212  26.663 -35.554 1.00 55.23 ? 26   ASP A CG  1 
ATOM   225  O OD1 . ASP A 1 26  ? -4.319  27.339 -34.520 1.00 69.15 ? 26   ASP A OD1 1 
ATOM   226  O OD2 . ASP A 1 26  ? -4.853  26.924 -36.592 1.00 59.83 ? 26   ASP A OD2 1 
ATOM   227  N N   . TYR A 1 27  ? -5.899  24.449 -34.037 1.00 20.04 ? 27   TYR A N   1 
ATOM   228  C CA  . TYR A 1 27  ? -7.324  24.100 -34.115 1.00 20.55 ? 27   TYR A CA  1 
ATOM   229  C C   . TYR A 1 27  ? -8.241  25.314 -34.059 1.00 20.84 ? 27   TYR A C   1 
ATOM   230  O O   . TYR A 1 27  ? -9.341  25.253 -33.523 1.00 21.42 ? 27   TYR A O   1 
ATOM   231  C CB  . TYR A 1 27  ? -7.677  23.115 -33.001 1.00 19.63 ? 27   TYR A CB  1 
ATOM   232  C CG  . TYR A 1 27  ? -7.079  21.761 -33.256 1.00 20.16 ? 27   TYR A CG  1 
ATOM   233  C CD1 . TYR A 1 27  ? -7.769  20.835 -34.032 1.00 25.82 ? 27   TYR A CD1 1 
ATOM   234  C CD2 . TYR A 1 27  ? -5.821  21.418 -32.773 1.00 19.85 ? 27   TYR A CD2 1 
ATOM   235  C CE1 . TYR A 1 27  ? -7.255  19.612 -34.299 1.00 31.43 ? 27   TYR A CE1 1 
ATOM   236  C CE2 . TYR A 1 27  ? -5.276  20.156 -33.039 1.00 30.36 ? 27   TYR A CE2 1 
ATOM   237  C CZ  . TYR A 1 27  ? -6.018  19.267 -33.813 1.00 31.80 ? 27   TYR A CZ  1 
ATOM   238  O OH  . TYR A 1 27  ? -5.559  18.015 -34.116 1.00 43.76 ? 27   TYR A OH  1 
ATOM   239  N N   . GLY A 1 28  ? -7.784  26.425 -34.620 1.00 22.80 ? 28   GLY A N   1 
ATOM   240  C CA  . GLY A 1 28  ? -8.638  27.590 -34.749 1.00 27.26 ? 28   GLY A CA  1 
ATOM   241  C C   . GLY A 1 28  ? -8.608  28.537 -33.570 1.00 26.95 ? 28   GLY A C   1 
ATOM   242  O O   . GLY A 1 28  ? -8.077  28.219 -32.499 1.00 26.48 ? 28   GLY A O   1 
ATOM   243  N N   . ASN A 1 29  ? -9.183  29.719 -33.768 1.00 25.67 ? 29   ASN A N   1 
ATOM   244  C CA  A ASN A 1 29  ? -9.177  30.732 -32.723 0.61 25.60 ? 29   ASN A CA  1 
ATOM   245  C CA  B ASN A 1 29  ? -9.188  30.759 -32.750 0.39 26.29 ? 29   ASN A CA  1 
ATOM   246  C C   . ASN A 1 29  ? -10.568 30.965 -32.148 1.00 25.39 ? 29   ASN A C   1 
ATOM   247  O O   . ASN A 1 29  ? -10.899 32.071 -31.723 1.00 23.15 ? 29   ASN A O   1 
ATOM   248  C CB  A ASN A 1 29  ? -8.597  32.043 -33.258 0.61 30.51 ? 29   ASN A CB  1 
ATOM   249  C CB  B ASN A 1 29  ? -8.689  32.087 -33.330 0.39 30.98 ? 29   ASN A CB  1 
ATOM   250  C CG  A ASN A 1 29  ? -9.448  32.650 -34.350 0.61 34.16 ? 29   ASN A CG  1 
ATOM   251  C CG  B ASN A 1 29  ? -7.260  32.013 -33.822 0.39 33.61 ? 29   ASN A CG  1 
ATOM   252  O OD1 A ASN A 1 29  ? -10.011 31.939 -35.180 0.61 39.89 ? 29   ASN A OD1 1 
ATOM   253  O OD1 B ASN A 1 29  ? -6.548  31.050 -33.553 0.39 39.05 ? 29   ASN A OD1 1 
ATOM   254  N ND2 A ASN A 1 29  ? -9.545  33.974 -34.356 0.61 41.00 ? 29   ASN A ND2 1 
ATOM   255  N ND2 B ASN A 1 29  ? -6.828  33.044 -34.542 0.39 41.07 ? 29   ASN A ND2 1 
ATOM   256  N N   . ASP A 1 30  ? -11.374 29.902 -32.113 1.00 22.45 ? 30   ASP A N   1 
ATOM   257  C CA  . ASP A 1 30  ? -12.729 29.996 -31.555 1.00 21.18 ? 30   ASP A CA  1 
ATOM   258  C C   . ASP A 1 30  ? -12.968 29.001 -30.420 1.00 23.73 ? 30   ASP A C   1 
ATOM   259  O O   . ASP A 1 30  ? -13.854 28.149 -30.514 1.00 21.49 ? 30   ASP A O   1 
ATOM   260  C CB  . ASP A 1 30  ? -13.785 29.800 -32.653 1.00 23.48 ? 30   ASP A CB  1 
ATOM   261  C CG  . ASP A 1 30  ? -13.654 28.466 -33.370 1.00 26.21 ? 30   ASP A CG  1 
ATOM   262  O OD1 . ASP A 1 30  ? -12.545 27.900 -33.413 1.00 29.03 ? 30   ASP A OD1 1 
ATOM   263  O OD2 . ASP A 1 30  ? -14.677 28.005 -33.920 1.00 30.47 ? 30   ASP A OD2 1 
ATOM   264  N N   . PRO A 1 31  ? -12.194 29.121 -29.329 1.00 18.68 ? 31   PRO A N   1 
ATOM   265  C CA  . PRO A 1 31  ? -12.386 28.180 -28.217 1.00 16.83 ? 31   PRO A CA  1 
ATOM   266  C C   . PRO A 1 31  ? -13.773 28.216 -27.559 1.00 18.26 ? 31   PRO A C   1 
ATOM   267  O O   . PRO A 1 31  ? -14.229 27.170 -27.097 1.00 18.64 ? 31   PRO A O   1 
ATOM   268  C CB  . PRO A 1 31  ? -11.311 28.613 -27.205 1.00 16.31 ? 31   PRO A CB  1 
ATOM   269  C CG  . PRO A 1 31  ? -10.959 30.022 -27.565 1.00 20.79 ? 31   PRO A CG  1 
ATOM   270  C CD  . PRO A 1 31  ? -11.107 30.080 -29.054 1.00 20.95 ? 31   PRO A CD  1 
ATOM   271  N N   . LEU A 1 32  ? -14.449 29.363 -27.512 1.00 20.55 ? 32   LEU A N   1 
ATOM   272  C CA  . LEU A 1 32  ? -15.700 29.410 -26.753 1.00 20.12 ? 32   LEU A CA  1 
ATOM   273  C C   . LEU A 1 32  ? -16.788 28.483 -27.333 1.00 20.62 ? 32   LEU A C   1 
ATOM   274  O O   . LEU A 1 32  ? -17.354 27.687 -26.586 1.00 20.43 ? 32   LEU A O   1 
ATOM   275  C CB  . LEU A 1 32  ? -16.231 30.849 -26.635 1.00 24.30 ? 32   LEU A CB  1 
ATOM   276  C CG  . LEU A 1 32  ? -17.535 30.990 -25.836 1.00 24.30 ? 32   LEU A CG  1 
ATOM   277  C CD1 . LEU A 1 32  ? -17.456 30.333 -24.452 1.00 21.46 ? 32   LEU A CD1 1 
ATOM   278  C CD2 . LEU A 1 32  ? -17.924 32.465 -25.721 1.00 29.90 ? 32   LEU A CD2 1 
ATOM   279  N N   . PRO A 1 33  ? -17.077 28.543 -28.613 1.00 19.31 ? 33   PRO A N   1 
ATOM   280  C CA  . PRO A 1 33  ? -18.093 27.625 -29.122 1.00 21.69 ? 33   PRO A CA  1 
ATOM   281  C C   . PRO A 1 33  ? -17.683 26.184 -28.924 1.00 20.54 ? 33   PRO A C   1 
ATOM   282  O O   . PRO A 1 33  ? -18.491 25.345 -28.727 1.00 22.49 ? 33   PRO A O   1 
ATOM   283  C CB  . PRO A 1 33  ? -18.220 27.978 -30.605 1.00 24.66 ? 33   PRO A CB  1 
ATOM   284  C CG  . PRO A 1 33  ? -17.232 29.021 -30.863 1.00 25.24 ? 33   PRO A CG  1 
ATOM   285  C CD  . PRO A 1 33  ? -16.724 29.565 -29.591 1.00 23.54 ? 33   PRO A CD  1 
ATOM   286  N N   . ARG A 1 34  ? -16.378 25.936 -28.966 1.00 20.12 ? 34   ARG A N   1 
ATOM   287  C CA  . ARG A 1 34  ? -15.851 24.591 -28.772 1.00 18.28 ? 34   ARG A CA  1 
ATOM   288  C C   . ARG A 1 34  ? -16.214 24.080 -27.380 1.00 20.60 ? 34   ARG A C   1 
ATOM   289  O O   . ARG A 1 34  ? -16.646 22.938 -27.222 1.00 19.69 ? 34   ARG A O   1 
ATOM   290  C CB  . ARG A 1 34  ? -14.334 24.575 -28.961 1.00 23.28 ? 34   ARG A CB  1 
ATOM   291  C CG  . ARG A 1 34  ? -13.834 23.472 -29.880 1.00 26.25 ? 34   ARG A CG  1 
ATOM   292  C CD  . ARG A 1 34  ? -12.318 23.487 -29.987 1.00 22.81 ? 34   ARG A CD  1 
ATOM   293  N NE  . ARG A 1 34  ? -11.869 23.697 -31.361 1.00 21.34 ? 34   ARG A NE  1 
ATOM   294  C CZ  . ARG A 1 34  ? -11.959 22.785 -32.323 1.00 18.89 ? 34   ARG A CZ  1 
ATOM   295  N NH1 . ARG A 1 34  ? -12.483 21.595 -32.065 1.00 18.82 ? 34   ARG A NH1 1 
ATOM   296  N NH2 . ARG A 1 34  ? -11.524 23.062 -33.545 1.00 19.40 ? 34   ARG A NH2 1 
ATOM   297  N N   . LEU A 1 35  ? -16.037 24.933 -26.376 1.00 17.64 ? 35   LEU A N   1 
ATOM   298  C CA  . LEU A 1 35  ? -16.347 24.578 -25.016 1.00 22.22 ? 35   LEU A CA  1 
ATOM   299  C C   . LEU A 1 35  ? -17.835 24.429 -24.799 1.00 20.88 ? 35   LEU A C   1 
ATOM   300  O O   . LEU A 1 35  ? -18.273 23.624 -24.063 1.00 20.58 ? 35   LEU A O   1 
ATOM   301  C CB  . LEU A 1 35  ? -15.884 25.661 -24.066 1.00 21.09 ? 35   LEU A CB  1 
ATOM   302  C CG  . LEU A 1 35  ? -14.400 25.821 -23.882 1.00 22.95 ? 35   LEU A CG  1 
ATOM   303  C CD1 . LEU A 1 35  ? -14.179 26.979 -22.951 1.00 23.84 ? 35   LEU A CD1 1 
ATOM   304  C CD2 . LEU A 1 35  ? -13.833 24.595 -23.213 1.00 17.74 ? 35   LEU A CD2 1 
ATOM   305  N N   . GLN A 1 36  ? -18.573 25.303 -25.460 1.00 18.81 ? 36   GLN A N   1 
ATOM   306  C CA  . GLN A 1 36  ? -20.016 25.250 -25.297 1.00 19.47 ? 36   GLN A CA  1 
ATOM   307  C C   . GLN A 1 36  ? -20.571 23.959 -25.888 1.00 21.98 ? 36   GLN A C   1 
ATOM   308  O O   . GLN A 1 36  ? -21.536 23.393 -25.364 1.00 23.49 ? 36   GLN A O   1 
ATOM   309  C CB  . GLN A 1 36  ? -20.660 26.477 -25.941 1.00 21.82 ? 36   GLN A CB  1 
ATOM   310  C CG  . GLN A 1 36  ? -20.350 27.761 -25.158 1.00 21.88 ? 36   GLN A CG  1 
ATOM   311  C CD  . GLN A 1 36  ? -20.759 29.027 -25.883 1.00 30.76 ? 36   GLN A CD  1 
ATOM   312  O OE1 . GLN A 1 36  ? -20.936 29.034 -27.108 1.00 27.08 ? 36   GLN A OE1 1 
ATOM   313  N NE2 . GLN A 1 36  ? -20.923 30.112 -25.123 1.00 24.32 ? 36   GLN A NE2 1 
ATOM   314  N N   . ASP A 1 37  ? -19.955 23.474 -26.961 1.00 19.09 ? 37   ASP A N   1 
ATOM   315  C CA  . ASP A 1 37  ? -20.394 22.202 -27.513 1.00 23.35 ? 37   ASP A CA  1 
ATOM   316  C C   . ASP A 1 37  ? -20.023 21.060 -26.568 1.00 19.23 ? 37   ASP A C   1 
ATOM   317  O O   . ASP A 1 37  ? -20.787 20.117 -26.414 1.00 21.87 ? 37   ASP A O   1 
ATOM   318  C CB  . ASP A 1 37  ? -19.807 21.967 -28.903 1.00 23.02 ? 37   ASP A CB  1 
ATOM   319  C CG  . ASP A 1 37  ? -20.591 22.669 -29.982 1.00 24.97 ? 37   ASP A CG  1 
ATOM   320  O OD1 . ASP A 1 37  ? -21.728 23.107 -29.694 1.00 29.96 ? 37   ASP A OD1 1 
ATOM   321  O OD2 . ASP A 1 37  ? -20.076 22.784 -31.112 1.00 25.82 ? 37   ASP A OD2 1 
ATOM   322  N N   . TYR A 1 38  ? -18.858 21.149 -25.926 1.00 18.53 ? 38   TYR A N   1 
ATOM   323  C CA  . TYR A 1 38  ? -18.492 20.146 -24.937 1.00 17.89 ? 38   TYR A CA  1 
ATOM   324  C C   . TYR A 1 38  ? -19.512 20.107 -23.802 1.00 20.45 ? 38   TYR A C   1 
ATOM   325  O O   . TYR A 1 38  ? -19.916 19.036 -23.353 1.00 21.16 ? 38   TYR A O   1 
ATOM   326  C CB  . TYR A 1 38  ? -17.101 20.433 -24.354 1.00 16.60 ? 38   TYR A CB  1 
ATOM   327  C CG  . TYR A 1 38  ? -15.929 20.144 -25.266 1.00 16.25 ? 38   TYR A CG  1 
ATOM   328  C CD1 . TYR A 1 38  ? -16.061 19.321 -26.375 1.00 16.21 ? 38   TYR A CD1 1 
ATOM   329  C CD2 . TYR A 1 38  ? -14.676 20.681 -24.993 1.00 16.32 ? 38   TYR A CD2 1 
ATOM   330  C CE1 . TYR A 1 38  ? -14.973 19.044 -27.195 1.00 18.44 ? 38   TYR A CE1 1 
ATOM   331  C CE2 . TYR A 1 38  ? -13.583 20.416 -25.802 1.00 16.44 ? 38   TYR A CE2 1 
ATOM   332  C CZ  . TYR A 1 38  ? -13.742 19.601 -26.910 1.00 16.75 ? 38   TYR A CZ  1 
ATOM   333  O OH  . TYR A 1 38  ? -12.645 19.342 -27.700 1.00 18.32 ? 38   TYR A OH  1 
ATOM   334  N N   . ALA A 1 39  ? -19.900 21.281 -23.320 1.00 19.68 ? 39   ALA A N   1 
ATOM   335  C CA  . ALA A 1 39  ? -20.817 21.372 -22.185 1.00 22.58 ? 39   ALA A CA  1 
ATOM   336  C C   . ALA A 1 39  ? -22.194 20.851 -22.583 1.00 24.85 ? 39   ALA A C   1 
ATOM   337  O O   . ALA A 1 39  ? -22.892 20.217 -21.784 1.00 25.40 ? 39   ALA A O   1 
ATOM   338  C CB  . ALA A 1 39  ? -20.911 22.805 -21.682 1.00 22.12 ? 39   ALA A CB  1 
ATOM   339  N N   . ALA A 1 40  ? -22.572 21.092 -23.832 1.00 26.50 ? 40   ALA A N   1 
ATOM   340  C CA  . ALA A 1 40  ? -23.878 20.651 -24.302 1.00 28.74 ? 40   ALA A CA  1 
ATOM   341  C C   . ALA A 1 40  ? -23.913 19.133 -24.493 1.00 26.74 ? 40   ALA A C   1 
ATOM   342  O O   . ALA A 1 40  ? -24.986 18.515 -24.447 1.00 29.63 ? 40   ALA A O   1 
ATOM   343  C CB  . ALA A 1 40  ? -24.237 21.371 -25.581 1.00 24.66 ? 40   ALA A CB  1 
ATOM   344  N N   . GLN A 1 41  ? -22.741 18.535 -24.693 1.00 26.94 ? 41   GLN A N   1 
ATOM   345  C CA  . GLN A 1 41  ? -22.611 17.080 -24.789 1.00 23.50 ? 41   GLN A CA  1 
ATOM   346  C C   . GLN A 1 41  ? -22.648 16.423 -23.417 1.00 28.30 ? 41   GLN A C   1 
ATOM   347  O O   . GLN A 1 41  ? -22.611 15.190 -23.314 1.00 28.07 ? 41   GLN A O   1 
ATOM   348  C CB  . GLN A 1 41  ? -21.314 16.684 -25.499 1.00 25.96 ? 41   GLN A CB  1 
ATOM   349  C CG  . GLN A 1 41  ? -21.263 16.991 -26.988 1.00 36.45 ? 41   GLN A CG  1 
ATOM   350  C CD  . GLN A 1 41  ? -21.397 15.749 -27.856 1.00 41.45 ? 41   GLN A CD  1 
ATOM   351  O OE1 . GLN A 1 41  ? -20.947 14.665 -27.490 1.00 39.00 ? 41   GLN A OE1 1 
ATOM   352  N NE2 . GLN A 1 41  ? -22.019 15.906 -29.018 1.00 48.17 ? 41   GLN A NE2 1 
ATOM   353  N N   . GLY A 1 42  ? -22.674 17.243 -22.368 1.00 24.08 ? 42   GLY A N   1 
ATOM   354  C CA  . GLY A 1 42  ? -22.789 16.746 -21.012 1.00 22.92 ? 42   GLY A CA  1 
ATOM   355  C C   . GLY A 1 42  ? -21.567 16.892 -20.116 1.00 23.72 ? 42   GLY A C   1 
ATOM   356  O O   . GLY A 1 42  ? -21.570 16.393 -18.995 1.00 26.10 ? 42   GLY A O   1 
ATOM   357  N N   . ALA A 1 43  ? -20.521 17.560 -20.600 1.00 21.39 ? 43   ALA A N   1 
ATOM   358  C CA  . ALA A 1 43  ? -19.304 17.727 -19.806 1.00 19.76 ? 43   ALA A CA  1 
ATOM   359  C C   . ALA A 1 43  ? -19.600 18.400 -18.469 1.00 21.31 ? 43   ALA A C   1 
ATOM   360  O O   . ALA A 1 43  ? -20.256 19.438 -18.418 1.00 25.62 ? 43   ALA A O   1 
ATOM   361  C CB  . ALA A 1 43  ? -18.260 18.533 -20.602 1.00 18.65 ? 43   ALA A CB  1 
ATOM   362  N N   . GLY A 1 44  ? -19.135 17.794 -17.382 1.00 23.38 ? 44   GLY A N   1 
ATOM   363  C CA  . GLY A 1 44  ? -19.405 18.308 -16.051 1.00 25.70 ? 44   GLY A CA  1 
ATOM   364  C C   . GLY A 1 44  ? -18.375 19.282 -15.512 1.00 24.95 ? 44   GLY A C   1 
ATOM   365  O O   . GLY A 1 44  ? -18.672 20.080 -14.610 1.00 26.71 ? 44   GLY A O   1 
ATOM   366  N N   . VAL A 1 45  ? -17.159 19.199 -16.048 1.00 22.07 ? 45   VAL A N   1 
ATOM   367  C CA  . VAL A 1 45  ? -16.063 20.085 -15.693 1.00 18.30 ? 45   VAL A CA  1 
ATOM   368  C C   . VAL A 1 45  ? -15.248 20.271 -16.972 1.00 18.03 ? 45   VAL A C   1 
ATOM   369  O O   . VAL A 1 45  ? -15.206 19.355 -17.797 1.00 19.70 ? 45   VAL A O   1 
ATOM   370  C CB  . VAL A 1 45  ? -15.164 19.503 -14.566 1.00 22.17 ? 45   VAL A CB  1 
ATOM   371  C CG1 . VAL A 1 45  ? -13.924 20.344 -14.364 1.00 24.53 ? 45   VAL A CG1 1 
ATOM   372  C CG2 . VAL A 1 45  ? -15.933 19.414 -13.251 1.00 29.30 ? 45   VAL A CG2 1 
ATOM   373  N N   . LEU A 1 46  ? -14.677 21.459 -17.156 1.00 15.51 ? 46   LEU A N   1 
ATOM   374  C CA  . LEU A 1 46  ? -13.803 21.756 -18.299 1.00 14.67 ? 46   LEU A CA  1 
ATOM   375  C C   . LEU A 1 46  ? -12.443 22.226 -17.807 1.00 16.65 ? 46   LEU A C   1 
ATOM   376  O O   . LEU A 1 46  ? -12.341 22.845 -16.743 1.00 16.56 ? 46   LEU A O   1 
ATOM   377  C CB  . LEU A 1 46  ? -14.444 22.823 -19.201 1.00 16.11 ? 46   LEU A CB  1 
ATOM   378  C CG  . LEU A 1 46  ? -15.795 22.427 -19.807 1.00 16.70 ? 46   LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 46  ? -16.469 23.668 -20.377 1.00 21.71 ? 46   LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 46  ? -15.636 21.379 -20.905 1.00 21.22 ? 46   LEU A CD2 1 
ATOM   381  N N   . HIS A 1 47  ? -11.397 21.944 -18.583 1.00 13.42 ? 47   HIS A N   1 
ATOM   382  C CA  . HIS A 1 47  ? -10.036 22.249 -18.182 1.00 11.58 ? 47   HIS A CA  1 
ATOM   383  C C   . HIS A 1 47  ? -9.404  23.159 -19.209 1.00 14.09 ? 47   HIS A C   1 
ATOM   384  O O   . HIS A 1 47  ? -9.447  22.858 -20.403 1.00 14.73 ? 47   HIS A O   1 
ATOM   385  C CB  . HIS A 1 47  ? -9.226  20.953 -18.046 1.00 12.11 ? 47   HIS A CB  1 
ATOM   386  C CG  . HIS A 1 47  ? -7.806  21.156 -17.633 1.00 13.87 ? 47   HIS A CG  1 
ATOM   387  N ND1 . HIS A 1 47  ? -7.452  21.682 -16.412 1.00 16.31 ? 47   HIS A ND1 1 
ATOM   388  C CD2 . HIS A 1 47  ? -6.650  20.875 -18.277 1.00 11.97 ? 47   HIS A CD2 1 
ATOM   389  C CE1 . HIS A 1 47  ? -6.133  21.743 -16.328 1.00 19.31 ? 47   HIS A CE1 1 
ATOM   390  N NE2 . HIS A 1 47  ? -5.621  21.251 -17.443 1.00 13.79 ? 47   HIS A NE2 1 
ATOM   391  N N   . LEU A 1 48  ? -8.812  24.260 -18.758 1.00 12.45 ? 48   LEU A N   1 
ATOM   392  C CA  . LEU A 1 48  ? -8.129  25.177 -19.664 1.00 12.74 ? 48   LEU A CA  1 
ATOM   393  C C   . LEU A 1 48  ? -6.672  25.359 -19.250 1.00 15.24 ? 48   LEU A C   1 
ATOM   394  O O   . LEU A 1 48  ? -6.396  25.594 -18.075 1.00 15.10 ? 48   LEU A O   1 
ATOM   395  C CB  . LEU A 1 48  ? -8.796  26.553 -19.661 1.00 14.52 ? 48   LEU A CB  1 
ATOM   396  C CG  . LEU A 1 48  ? -10.244 26.656 -20.113 1.00 16.83 ? 48   LEU A CG  1 
ATOM   397  C CD1 . LEU A 1 48  ? -10.679 28.104 -20.034 1.00 17.83 ? 48   LEU A CD1 1 
ATOM   398  C CD2 . LEU A 1 48  ? -10.362 26.143 -21.546 1.00 18.42 ? 48   LEU A CD2 1 
ATOM   399  N N   . VAL A 1 49  ? -5.750  25.281 -20.206 1.00 12.53 ? 49   VAL A N   1 
ATOM   400  C CA  . VAL A 1 49  ? -4.363  25.655 -19.952 1.00 11.91 ? 49   VAL A CA  1 
ATOM   401  C C   . VAL A 1 49  ? -3.978  26.853 -20.803 1.00 13.24 ? 49   VAL A C   1 
ATOM   402  O O   . VAL A 1 49  ? -4.158  26.857 -22.018 1.00 14.93 ? 49   VAL A O   1 
ATOM   403  C CB  . VAL A 1 49  ? -3.381  24.507 -20.253 1.00 10.90 ? 49   VAL A CB  1 
ATOM   404  C CG1 . VAL A 1 49  ? -1.933  24.962 -20.053 1.00 13.38 ? 49   VAL A CG1 1 
ATOM   405  C CG2 . VAL A 1 49  ? -3.703  23.308 -19.376 1.00 14.33 ? 49   VAL A CG2 1 
ATOM   406  N N   . ASP A 1 50  ? -3.449  27.864 -20.136 1.00 13.20 ? 50   ASP A N   1 
ATOM   407  C CA  . ASP A 1 50  ? -2.918  29.049 -20.781 1.00 12.10 ? 50   ASP A CA  1 
ATOM   408  C C   . ASP A 1 50  ? -1.462  28.742 -21.072 1.00 16.22 ? 50   ASP A C   1 
ATOM   409  O O   . ASP A 1 50  ? -0.594  28.900 -20.203 1.00 16.27 ? 50   ASP A O   1 
ATOM   410  C CB  . ASP A 1 50  ? -3.097  30.244 -19.840 1.00 15.50 ? 50   ASP A CB  1 
ATOM   411  C CG  . ASP A 1 50  ? -2.547  31.546 -20.393 1.00 17.65 ? 50   ASP A CG  1 
ATOM   412  O OD1 . ASP A 1 50  ? -1.929  31.556 -21.474 1.00 18.50 ? 50   ASP A OD1 1 
ATOM   413  O OD2 . ASP A 1 50  ? -2.725  32.569 -19.694 1.00 21.07 ? 50   ASP A OD2 1 
ATOM   414  N N   . LEU A 1 51  ? -1.186  28.240 -22.272 1.00 14.60 ? 51   LEU A N   1 
ATOM   415  C CA  . LEU A 1 51  ? 0.182   27.847 -22.604 1.00 14.96 ? 51   LEU A CA  1 
ATOM   416  C C   . LEU A 1 51  ? 1.087   29.065 -22.797 1.00 15.23 ? 51   LEU A C   1 
ATOM   417  O O   . LEU A 1 51  ? 2.279   29.009 -22.511 1.00 16.13 ? 51   LEU A O   1 
ATOM   418  C CB  . LEU A 1 51  ? 0.199   26.973 -23.855 1.00 13.51 ? 51   LEU A CB  1 
ATOM   419  C CG  . LEU A 1 51  ? -0.183  25.505 -23.666 1.00 12.57 ? 51   LEU A CG  1 
ATOM   420  C CD1 . LEU A 1 51  ? -0.293  24.842 -25.027 1.00 13.14 ? 51   LEU A CD1 1 
ATOM   421  C CD2 . LEU A 1 51  ? 0.841   24.785 -22.824 1.00 16.13 ? 51   LEU A CD2 1 
ATOM   422  N N   . THR A 1 52  ? 0.525   30.170 -23.281 1.00 15.54 ? 52   THR A N   1 
ATOM   423  C CA  . THR A 1 52  ? 1.292   31.406 -23.401 1.00 15.54 ? 52   THR A CA  1 
ATOM   424  C C   . THR A 1 52  ? 1.767   31.827 -22.013 1.00 18.42 ? 52   THR A C   1 
ATOM   425  O O   . THR A 1 52  ? 2.941   32.122 -21.799 1.00 17.65 ? 52   THR A O   1 
ATOM   426  C CB  . THR A 1 52  ? 0.449   32.517 -24.063 1.00 18.74 ? 52   THR A CB  1 
ATOM   427  O OG1 . THR A 1 52  ? 0.200   32.138 -25.421 1.00 20.42 ? 52   THR A OG1 1 
ATOM   428  C CG2 . THR A 1 52  ? 1.175   33.848 -24.038 1.00 19.66 ? 52   THR A CG2 1 
ATOM   429  N N   . GLY A 1 53  ? 0.848   31.812 -21.059 1.00 16.61 ? 53   GLY A N   1 
ATOM   430  C CA  . GLY A 1 53  ? 1.182   32.137 -19.686 1.00 18.83 ? 53   GLY A CA  1 
ATOM   431  C C   . GLY A 1 53  ? 2.109   31.143 -18.999 1.00 17.54 ? 53   GLY A C   1 
ATOM   432  O O   . GLY A 1 53  ? 2.947   31.547 -18.197 1.00 19.18 ? 53   GLY A O   1 
ATOM   433  N N   . ALA A 1 54  ? 1.962   29.849 -19.292 1.00 14.43 ? 54   ALA A N   1 
ATOM   434  C CA  . ALA A 1 54  ? 2.841   28.840 -18.687 1.00 15.15 ? 54   ALA A CA  1 
ATOM   435  C C   . ALA A 1 54  ? 4.285   29.064 -19.133 1.00 18.77 ? 54   ALA A C   1 
ATOM   436  O O   . ALA A 1 54  ? 5.216   28.786 -18.382 1.00 21.08 ? 54   ALA A O   1 
ATOM   437  C CB  . ALA A 1 54  ? 2.390   27.428 -19.049 1.00 14.22 ? 54   ALA A CB  1 
ATOM   438  N N   . LYS A 1 55  ? 4.469   29.572 -20.347 1.00 16.56 ? 55   LYS A N   1 
ATOM   439  C CA  . LYS A 1 55  ? 5.820   29.809 -20.868 1.00 17.82 ? 55   LYS A CA  1 
ATOM   440  C C   . LYS A 1 55  ? 6.381   31.147 -20.399 1.00 19.02 ? 55   LYS A C   1 
ATOM   441  O O   . LYS A 1 55  ? 7.582   31.281 -20.135 1.00 23.40 ? 55   LYS A O   1 
ATOM   442  C CB  . LYS A 1 55  ? 5.816   29.744 -22.396 1.00 20.00 ? 55   LYS A CB  1 
ATOM   443  C CG  . LYS A 1 55  ? 7.206   29.666 -23.023 1.00 26.61 ? 55   LYS A CG  1 
ATOM   444  C CD  . LYS A 1 55  ? 7.109   29.486 -24.526 1.00 28.36 ? 55   LYS A CD  1 
ATOM   445  C CE  . LYS A 1 55  ? 8.471   29.225 -25.139 1.00 42.69 ? 55   LYS A CE  1 
ATOM   446  N NZ  . LYS A 1 55  ? 8.365   29.054 -26.611 1.00 50.78 ? 55   LYS A NZ  1 
ATOM   447  N N   . ASP A 1 56  ? 5.511   32.143 -20.323 1.00 20.19 ? 56   ASP A N   1 
ATOM   448  C CA  . ASP A 1 56  ? 5.867   33.456 -19.799 1.00 19.94 ? 56   ASP A CA  1 
ATOM   449  C C   . ASP A 1 56  ? 4.715   34.014 -18.984 1.00 21.00 ? 56   ASP A C   1 
ATOM   450  O O   . ASP A 1 56  ? 3.752   34.525 -19.556 1.00 22.22 ? 56   ASP A O   1 
ATOM   451  C CB  . ASP A 1 56  ? 6.214   34.430 -20.922 1.00 22.95 ? 56   ASP A CB  1 
ATOM   452  C CG  . ASP A 1 56  ? 6.766   35.748 -20.392 1.00 25.62 ? 56   ASP A CG  1 
ATOM   453  O OD1 . ASP A 1 56  ? 6.677   35.982 -19.169 1.00 28.34 ? 56   ASP A OD1 1 
ATOM   454  O OD2 . ASP A 1 56  ? 7.289   36.545 -21.197 1.00 30.46 ? 56   ASP A OD2 1 
ATOM   455  N N   . PRO A 1 57  ? 4.813   33.939 -17.645 1.00 21.61 ? 57   PRO A N   1 
ATOM   456  C CA  . PRO A 1 57  ? 3.728   34.414 -16.779 1.00 19.53 ? 57   PRO A CA  1 
ATOM   457  C C   . PRO A 1 57  ? 3.389   35.887 -16.984 1.00 28.00 ? 57   PRO A C   1 
ATOM   458  O O   . PRO A 1 57  ? 2.299   36.314 -16.590 1.00 32.43 ? 57   PRO A O   1 
ATOM   459  C CB  . PRO A 1 57  ? 4.281   34.162 -15.369 1.00 20.47 ? 57   PRO A CB  1 
ATOM   460  C CG  . PRO A 1 57  ? 5.186   33.021 -15.540 1.00 24.44 ? 57   PRO A CG  1 
ATOM   461  C CD  . PRO A 1 57  ? 5.869   33.278 -16.861 1.00 22.80 ? 57   PRO A CD  1 
ATOM   462  N N   . ALA A 1 58  ? 4.294   36.647 -17.599 1.00 23.69 ? 58   ALA A N   1 
ATOM   463  C CA  . ALA A 1 58  ? 4.024   38.040 -17.936 1.00 29.64 ? 58   ALA A CA  1 
ATOM   464  C C   . ALA A 1 58  ? 2.965   38.178 -19.027 1.00 29.36 ? 58   ALA A C   1 
ATOM   465  O O   . ALA A 1 58  ? 2.352   39.230 -19.177 1.00 36.19 ? 58   ALA A O   1 
ATOM   466  C CB  . ALA A 1 58  ? 5.307   38.731 -18.375 1.00 30.41 ? 58   ALA A CB  1 
ATOM   467  N N   . LYS A 1 59  ? 2.752   37.112 -19.792 1.00 25.59 ? 59   LYS A N   1 
ATOM   468  C CA  . LYS A 1 59  ? 1.919   37.195 -20.978 1.00 26.53 ? 59   LYS A CA  1 
ATOM   469  C C   . LYS A 1 59  ? 0.668   36.332 -20.863 1.00 24.00 ? 59   LYS A C   1 
ATOM   470  O O   . LYS A 1 59  ? 0.127   35.879 -21.875 1.00 26.24 ? 59   LYS A O   1 
ATOM   471  C CB  . LYS A 1 59  ? 2.730   36.789 -22.210 1.00 27.88 ? 59   LYS A CB  1 
ATOM   472  C CG  . LYS A 1 59  ? 3.804   37.810 -22.565 1.00 29.84 ? 59   LYS A CG  1 
ATOM   473  C CD  . LYS A 1 59  ? 4.617   37.389 -23.778 1.00 35.64 ? 59   LYS A CD  1 
ATOM   474  C CE  . LYS A 1 59  ? 5.658   38.460 -24.118 1.00 44.73 ? 59   LYS A CE  1 
ATOM   475  N NZ  . LYS A 1 59  ? 6.652   38.002 -25.128 1.00 46.73 ? 59   LYS A NZ  1 
ATOM   476  N N   . ARG A 1 60  ? 0.203   36.119 -19.636 1.00 23.50 ? 60   ARG A N   1 
ATOM   477  C CA  . ARG A 1 60  ? -1.032  35.365 -19.425 1.00 20.76 ? 60   ARG A CA  1 
ATOM   478  C C   . ARG A 1 60  ? -2.200  35.993 -20.186 1.00 21.71 ? 60   ARG A C   1 
ATOM   479  O O   . ARG A 1 60  ? -2.270  37.215 -20.365 1.00 24.08 ? 60   ARG A O   1 
ATOM   480  C CB  . ARG A 1 60  ? -1.365  35.268 -17.937 1.00 20.19 ? 60   ARG A CB  1 
ATOM   481  C CG  . ARG A 1 60  ? -0.357  34.447 -17.132 1.00 23.83 ? 60   ARG A CG  1 
ATOM   482  C CD  . ARG A 1 60  ? -0.654  34.470 -15.635 1.00 24.18 ? 60   ARG A CD  1 
ATOM   483  N NE  . ARG A 1 60  ? -2.013  34.024 -15.346 1.00 25.91 ? 60   ARG A NE  1 
ATOM   484  C CZ  . ARG A 1 60  ? -2.746  34.475 -14.333 1.00 27.79 ? 60   ARG A CZ  1 
ATOM   485  N NH1 . ARG A 1 60  ? -2.242  35.388 -13.509 1.00 24.86 ? 60   ARG A NH1 1 
ATOM   486  N NH2 . ARG A 1 60  ? -3.981  34.028 -14.151 1.00 31.20 ? 60   ARG A NH2 1 
ATOM   487  N N   . GLN A 1 61  ? -3.112  35.134 -20.625 1.00 20.72 ? 61   GLN A N   1 
ATOM   488  C CA  . GLN A 1 61  ? -4.272  35.527 -21.402 1.00 19.56 ? 61   GLN A CA  1 
ATOM   489  C C   . GLN A 1 61  ? -5.469  35.728 -20.497 1.00 25.41 ? 61   GLN A C   1 
ATOM   490  O O   . GLN A 1 61  ? -6.501  35.078 -20.658 1.00 22.01 ? 61   GLN A O   1 
ATOM   491  C CB  . GLN A 1 61  ? -4.579  34.470 -22.460 1.00 18.72 ? 61   GLN A CB  1 
ATOM   492  C CG  . GLN A 1 61  ? -3.387  34.167 -23.353 1.00 19.94 ? 61   GLN A CG  1 
ATOM   493  C CD  . GLN A 1 61  ? -3.666  33.036 -24.304 1.00 19.32 ? 61   GLN A CD  1 
ATOM   494  O OE1 . GLN A 1 61  ? -4.342  33.216 -25.318 1.00 22.10 ? 61   GLN A OE1 1 
ATOM   495  N NE2 . GLN A 1 61  ? -3.162  31.850 -23.972 1.00 19.57 ? 61   GLN A NE2 1 
ATOM   496  N N   . ILE A 1 62  ? -5.318  36.643 -19.548 1.00 24.60 ? 62   ILE A N   1 
ATOM   497  C CA  . ILE A 1 62  ? -6.347  36.901 -18.548 1.00 25.71 ? 62   ILE A CA  1 
ATOM   498  C C   . ILE A 1 62  ? -7.718  37.291 -19.132 1.00 24.92 ? 62   ILE A C   1 
ATOM   499  O O   . ILE A 1 62  ? -8.731  36.727 -18.705 1.00 26.57 ? 62   ILE A O   1 
ATOM   500  C CB  . ILE A 1 62  ? -5.861  37.978 -17.551 1.00 33.70 ? 62   ILE A CB  1 
ATOM   501  C CG1 . ILE A 1 62  ? -4.613  37.467 -16.812 1.00 32.90 ? 62   ILE A CG1 1 
ATOM   502  C CG2 . ILE A 1 62  ? -6.971  38.363 -16.592 1.00 39.61 ? 62   ILE A CG2 1 
ATOM   503  C CD1 . ILE A 1 62  ? -3.970  38.481 -15.897 1.00 39.97 ? 62   ILE A CD1 1 
ATOM   504  N N   . PRO A 1 63  ? -7.770  38.235 -20.103 1.00 28.25 ? 63   PRO A N   1 
ATOM   505  C CA  . PRO A 1 63  ? -9.081  38.568 -20.682 1.00 26.34 ? 63   PRO A CA  1 
ATOM   506  C C   . PRO A 1 63  ? -9.776  37.390 -21.367 1.00 26.02 ? 63   PRO A C   1 
ATOM   507  O O   . PRO A 1 63  ? -10.988 37.223 -21.221 1.00 29.52 ? 63   PRO A O   1 
ATOM   508  C CB  . PRO A 1 63  ? -8.745  39.648 -21.721 1.00 31.94 ? 63   PRO A CB  1 
ATOM   509  C CG  . PRO A 1 63  ? -7.456  40.209 -21.294 1.00 31.80 ? 63   PRO A CG  1 
ATOM   510  C CD  . PRO A 1 63  ? -6.703  39.071 -20.688 1.00 31.29 ? 63   PRO A CD  1 
ATOM   511  N N   . LEU A 1 64  ? -9.021  36.596 -22.119 1.00 22.90 ? 64   LEU A N   1 
ATOM   512  C CA  . LEU A 1 64  ? -9.605  35.464 -22.830 1.00 20.08 ? 64   LEU A CA  1 
ATOM   513  C C   . LEU A 1 64  ? -10.155 34.444 -21.847 1.00 19.90 ? 64   LEU A C   1 
ATOM   514  O O   . LEU A 1 64  ? -11.265 33.953 -22.013 1.00 24.49 ? 64   LEU A O   1 
ATOM   515  C CB  . LEU A 1 64  ? -8.580  34.810 -23.751 1.00 22.54 ? 64   LEU A CB  1 
ATOM   516  C CG  . LEU A 1 64  ? -9.051  33.532 -24.452 1.00 25.37 ? 64   LEU A CG  1 
ATOM   517  C CD1 . LEU A 1 64  ? -10.285 33.805 -25.325 1.00 25.14 ? 64   LEU A CD1 1 
ATOM   518  C CD2 . LEU A 1 64  ? -7.925  32.953 -25.279 1.00 23.37 ? 64   LEU A CD2 1 
ATOM   519  N N   . ILE A 1 65  ? -9.366  34.117 -20.830 1.00 22.85 ? 65   ILE A N   1 
ATOM   520  C CA  . ILE A 1 65  ? -9.798  33.164 -19.810 1.00 24.02 ? 65   ILE A CA  1 
ATOM   521  C C   . ILE A 1 65  ? -11.112 33.595 -19.151 1.00 25.78 ? 65   ILE A C   1 
ATOM   522  O O   . ILE A 1 65  ? -12.010 32.777 -18.933 1.00 23.92 ? 65   ILE A O   1 
ATOM   523  C CB  . ILE A 1 65  ? -8.714  32.979 -18.737 1.00 26.54 ? 65   ILE A CB  1 
ATOM   524  C CG1 . ILE A 1 65  ? -7.510  32.273 -19.343 1.00 25.60 ? 65   ILE A CG1 1 
ATOM   525  C CG2 . ILE A 1 65  ? -9.250  32.188 -17.547 1.00 23.54 ? 65   ILE A CG2 1 
ATOM   526  C CD1 . ILE A 1 65  ? -6.315  32.279 -18.437 1.00 32.26 ? 65   ILE A CD1 1 
ATOM   527  N N   . LYS A 1 66  ? -11.233 34.884 -18.856 1.00 24.66 ? 66   LYS A N   1 
ATOM   528  C CA  . LYS A 1 66  ? -12.449 35.405 -18.241 1.00 26.83 ? 66   LYS A CA  1 
ATOM   529  C C   . LYS A 1 66  ? -13.672 35.186 -19.133 1.00 27.96 ? 66   LYS A C   1 
ATOM   530  O O   . LYS A 1 66  ? -14.740 34.802 -18.649 1.00 29.50 ? 66   LYS A O   1 
ATOM   531  C CB  . LYS A 1 66  ? -12.293 36.894 -17.924 1.00 30.52 ? 66   LYS A CB  1 
ATOM   532  C CG  . LYS A 1 66  ? -11.384 37.192 -16.751 1.00 36.43 ? 66   LYS A CG  1 
ATOM   533  C CD  . LYS A 1 66  ? -11.292 38.691 -16.533 1.00 40.98 ? 66   LYS A CD  1 
ATOM   534  C CE  . LYS A 1 66  ? -10.408 39.032 -15.350 1.00 41.93 ? 66   LYS A CE  1 
ATOM   535  N NZ  . LYS A 1 66  ? -10.324 40.505 -15.157 1.00 48.23 ? 66   LYS A NZ  1 
ATOM   536  N N   . THR A 1 67  ? -13.506 35.408 -20.433 1.00 27.67 ? 67   THR A N   1 
ATOM   537  C CA  A THR A 1 67  ? -14.592 35.258 -21.396 0.54 26.62 ? 67   THR A CA  1 
ATOM   538  C CA  B THR A 1 67  ? -14.623 35.262 -21.368 0.46 25.73 ? 67   THR A CA  1 
ATOM   539  C C   . THR A 1 67  ? -15.050 33.806 -21.500 1.00 23.33 ? 67   THR A C   1 
ATOM   540  O O   . THR A 1 67  ? -16.240 33.519 -21.626 1.00 29.04 ? 67   THR A O   1 
ATOM   541  C CB  A THR A 1 67  ? -14.160 35.759 -22.792 0.54 30.52 ? 67   THR A CB  1 
ATOM   542  C CB  B THR A 1 67  ? -14.287 35.806 -22.775 0.46 30.30 ? 67   THR A CB  1 
ATOM   543  O OG1 A THR A 1 67  ? -13.864 37.159 -22.724 0.54 35.72 ? 67   THR A OG1 1 
ATOM   544  O OG1 B THR A 1 67  ? -13.206 35.058 -23.343 0.46 30.65 ? 67   THR A OG1 1 
ATOM   545  C CG2 A THR A 1 67  ? -15.250 35.527 -23.813 0.54 33.18 ? 67   THR A CG2 1 
ATOM   546  C CG2 B THR A 1 67  ? -13.906 37.272 -22.701 0.46 34.82 ? 67   THR A CG2 1 
ATOM   547  N N   . LEU A 1 68  ? -14.082 32.892 -21.458 1.00 21.90 ? 68   LEU A N   1 
ATOM   548  C CA  . LEU A 1 68  ? -14.367 31.470 -21.597 1.00 19.57 ? 68   LEU A CA  1 
ATOM   549  C C   . LEU A 1 68  ? -15.089 30.925 -20.367 1.00 22.49 ? 68   LEU A C   1 
ATOM   550  O O   . LEU A 1 68  ? -16.063 30.185 -20.491 1.00 25.49 ? 68   LEU A O   1 
ATOM   551  C CB  . LEU A 1 68  ? -13.071 30.686 -21.845 1.00 18.94 ? 68   LEU A CB  1 
ATOM   552  C CG  . LEU A 1 68  ? -12.350 31.043 -23.147 1.00 19.65 ? 68   LEU A CG  1 
ATOM   553  C CD1 . LEU A 1 68  ? -11.043 30.275 -23.321 1.00 16.79 ? 68   LEU A CD1 1 
ATOM   554  C CD2 . LEU A 1 68  ? -13.269 30.793 -24.338 1.00 22.23 ? 68   LEU A CD2 1 
ATOM   555  N N   . VAL A 1 69  ? -14.601 31.285 -19.181 1.00 20.47 ? 69   VAL A N   1 
ATOM   556  C CA  . VAL A 1 69  ? -15.213 30.838 -17.931 1.00 20.34 ? 69   VAL A CA  1 
ATOM   557  C C   . VAL A 1 69  ? -16.645 31.375 -17.809 1.00 26.90 ? 69   VAL A C   1 
ATOM   558  O O   . VAL A 1 69  ? -17.558 30.662 -17.396 1.00 27.82 ? 69   VAL A O   1 
ATOM   559  C CB  . VAL A 1 69  ? -14.349 31.275 -16.720 1.00 21.57 ? 69   VAL A CB  1 
ATOM   560  C CG1 . VAL A 1 69  ? -15.082 31.069 -15.410 1.00 25.50 ? 69   VAL A CG1 1 
ATOM   561  C CG2 . VAL A 1 69  ? -13.030 30.509 -16.718 1.00 22.43 ? 69   VAL A CG2 1 
ATOM   562  N N   . ALA A 1 70  ? -16.847 32.621 -18.214 1.00 24.76 ? 70   ALA A N   1 
ATOM   563  C CA  . ALA A 1 70  ? -18.165 33.236 -18.097 1.00 28.46 ? 70   ALA A CA  1 
ATOM   564  C C   . ALA A 1 70  ? -19.124 32.722 -19.166 1.00 29.33 ? 70   ALA A C   1 
ATOM   565  O O   . ALA A 1 70  ? -20.343 32.851 -19.029 1.00 31.71 ? 70   ALA A O   1 
ATOM   566  C CB  . ALA A 1 70  ? -18.048 34.746 -18.172 1.00 29.80 ? 70   ALA A CB  1 
ATOM   567  N N   . GLY A 1 71  ? -18.571 32.135 -20.224 1.00 25.21 ? 71   GLY A N   1 
ATOM   568  C CA  . GLY A 1 71  ? -19.357 31.725 -21.374 1.00 24.25 ? 71   GLY A CA  1 
ATOM   569  C C   . GLY A 1 71  ? -19.930 30.322 -21.294 1.00 24.44 ? 71   GLY A C   1 
ATOM   570  O O   . GLY A 1 71  ? -20.622 29.873 -22.207 1.00 27.91 ? 71   GLY A O   1 
ATOM   571  N N   . VAL A 1 72  ? -19.619 29.611 -20.216 1.00 24.63 ? 72   VAL A N   1 
ATOM   572  C CA  . VAL A 1 72  ? -20.201 28.292 -20.006 1.00 24.55 ? 72   VAL A CA  1 
ATOM   573  C C   . VAL A 1 72  ? -20.813 28.228 -18.626 1.00 28.65 ? 72   VAL A C   1 
ATOM   574  O O   . VAL A 1 72  ? -20.503 29.050 -17.766 1.00 33.48 ? 72   VAL A O   1 
ATOM   575  C CB  . VAL A 1 72  ? -19.169 27.164 -20.164 1.00 24.33 ? 72   VAL A CB  1 
ATOM   576  C CG1 . VAL A 1 72  ? -18.681 27.096 -21.601 1.00 27.09 ? 72   VAL A CG1 1 
ATOM   577  C CG2 . VAL A 1 72  ? -17.985 27.352 -19.201 1.00 23.35 ? 72   VAL A CG2 1 
ATOM   578  N N   . ASN A 1 73  ? -21.676 27.246 -18.413 1.00 31.27 ? 73   ASN A N   1 
ATOM   579  C CA  . ASN A 1 73  ? -22.371 27.126 -17.141 1.00 34.35 ? 73   ASN A CA  1 
ATOM   580  C C   . ASN A 1 73  ? -22.000 25.844 -16.414 1.00 36.61 ? 73   ASN A C   1 
ATOM   581  O O   . ASN A 1 73  ? -22.810 25.278 -15.679 1.00 40.49 ? 73   ASN A O   1 
ATOM   582  C CB  . ASN A 1 73  ? -23.886 27.198 -17.354 1.00 49.41 ? 73   ASN A CB  1 
ATOM   583  C CG  . ASN A 1 73  ? -24.297 28.393 -18.200 1.00 65.62 ? 73   ASN A CG  1 
ATOM   584  O OD1 . ASN A 1 73  ? -24.854 28.240 -19.288 1.00 73.72 ? 73   ASN A OD1 1 
ATOM   585  N ND2 . ASN A 1 73  ? -24.013 29.592 -17.704 1.00 68.73 ? 73   ASN A ND2 1 
ATOM   586  N N   . VAL A 1 74  ? -20.771 25.382 -16.631 1.00 27.90 ? 74   VAL A N   1 
ATOM   587  C CA  . VAL A 1 74  ? -20.234 24.277 -15.860 1.00 28.23 ? 74   VAL A CA  1 
ATOM   588  C C   . VAL A 1 74  ? -18.916 24.746 -15.260 1.00 26.39 ? 74   VAL A C   1 
ATOM   589  O O   . VAL A 1 74  ? -18.353 25.741 -15.726 1.00 24.13 ? 74   VAL A O   1 
ATOM   590  C CB  . VAL A 1 74  ? -20.027 23.005 -16.712 1.00 29.55 ? 74   VAL A CB  1 
ATOM   591  C CG1 . VAL A 1 74  ? -21.358 22.546 -17.304 1.00 33.07 ? 74   VAL A CG1 1 
ATOM   592  C CG2 . VAL A 1 74  ? -19.004 23.247 -17.789 1.00 28.42 ? 74   VAL A CG2 1 
ATOM   593  N N   . PRO A 1 75  ? -18.449 24.063 -14.204 1.00 22.62 ? 75   PRO A N   1 
ATOM   594  C CA  . PRO A 1 75  ? -17.187 24.438 -13.558 1.00 21.15 ? 75   PRO A CA  1 
ATOM   595  C C   . PRO A 1 75  ? -16.008 24.346 -14.509 1.00 19.03 ? 75   PRO A C   1 
ATOM   596  O O   . PRO A 1 75  ? -15.927 23.397 -15.287 1.00 19.34 ? 75   PRO A O   1 
ATOM   597  C CB  . PRO A 1 75  ? -17.046 23.412 -12.433 1.00 24.90 ? 75   PRO A CB  1 
ATOM   598  C CG  . PRO A 1 75  ? -18.433 22.966 -12.152 1.00 28.74 ? 75   PRO A CG  1 
ATOM   599  C CD  . PRO A 1 75  ? -19.165 23.018 -13.449 1.00 25.11 ? 75   PRO A CD  1 
ATOM   600  N N   . VAL A 1 76  ? -15.118 25.331 -14.437 1.00 18.09 ? 76   VAL A N   1 
ATOM   601  C CA  . VAL A 1 76  ? -13.902 25.324 -15.243 1.00 16.05 ? 76   VAL A CA  1 
ATOM   602  C C   . VAL A 1 76  ? -12.678 25.407 -14.344 1.00 18.75 ? 76   VAL A C   1 
ATOM   603  O O   . VAL A 1 76  ? -12.621 26.252 -13.449 1.00 18.32 ? 76   VAL A O   1 
ATOM   604  C CB  . VAL A 1 76  ? -13.861 26.496 -16.234 1.00 17.96 ? 76   VAL A CB  1 
ATOM   605  C CG1 . VAL A 1 76  ? -12.587 26.441 -17.052 1.00 18.50 ? 76   VAL A CG1 1 
ATOM   606  C CG2 . VAL A 1 76  ? -15.077 26.460 -17.152 1.00 18.87 ? 76   VAL A CG2 1 
ATOM   607  N N   . GLN A 1 77  ? -11.694 24.543 -14.576 1.00 16.55 ? 77   GLN A N   1 
ATOM   608  C CA  . GLN A 1 77  ? -10.433 24.712 -13.870 1.00 15.01 ? 77   GLN A CA  1 
ATOM   609  C C   . GLN A 1 77  ? -9.396  25.280 -14.839 1.00 14.39 ? 77   GLN A C   1 
ATOM   610  O O   . GLN A 1 77  ? -9.443  25.032 -16.027 1.00 16.66 ? 77   GLN A O   1 
ATOM   611  C CB  . GLN A 1 77  ? -9.969  23.399 -13.208 1.00 25.46 ? 77   GLN A CB  1 
ATOM   612  C CG  . GLN A 1 77  ? -10.016 22.175 -14.077 1.00 29.28 ? 77   GLN A CG  1 
ATOM   613  C CD  . GLN A 1 77  ? -9.519  20.920 -13.365 1.00 18.70 ? 77   GLN A CD  1 
ATOM   614  O OE1 . GLN A 1 77  ? -10.001 20.556 -12.286 1.00 24.11 ? 77   GLN A OE1 1 
ATOM   615  N NE2 . GLN A 1 77  ? -8.542  20.258 -13.971 1.00 18.56 ? 77   GLN A NE2 1 
ATOM   616  N N   . VAL A 1 78  ? -8.505  26.106 -14.316 1.00 14.09 ? 78   VAL A N   1 
ATOM   617  C CA  . VAL A 1 78  ? -7.603  26.887 -15.157 1.00 15.08 ? 78   VAL A CA  1 
ATOM   618  C C   . VAL A 1 78  ? -6.187  26.839 -14.612 1.00 16.48 ? 78   VAL A C   1 
ATOM   619  O O   . VAL A 1 78  ? -5.963  27.080 -13.421 1.00 16.15 ? 78   VAL A O   1 
ATOM   620  C CB  . VAL A 1 78  ? -8.038  28.373 -15.260 1.00 14.87 ? 78   VAL A CB  1 
ATOM   621  C CG1 . VAL A 1 78  ? -7.001  29.180 -16.015 1.00 16.78 ? 78   VAL A CG1 1 
ATOM   622  C CG2 . VAL A 1 78  ? -9.393  28.493 -15.953 1.00 17.51 ? 78   VAL A CG2 1 
ATOM   623  N N   . GLY A 1 79  ? -5.229  26.528 -15.484 1.00 14.88 ? 79   GLY A N   1 
ATOM   624  C CA  . GLY A 1 79  ? -3.836  26.567 -15.096 1.00 15.66 ? 79   GLY A CA  1 
ATOM   625  C C   . GLY A 1 79  ? -3.000  27.245 -16.164 1.00 13.99 ? 79   GLY A C   1 
ATOM   626  O O   . GLY A 1 79  ? -3.462  27.432 -17.296 1.00 14.57 ? 79   GLY A O   1 
ATOM   627  N N   . GLY A 1 80  ? -1.775  27.599 -15.783 1.00 15.30 ? 80   GLY A N   1 
ATOM   628  C CA  . GLY A 1 80  ? -0.774  28.090 -16.715 1.00 16.05 ? 80   GLY A CA  1 
ATOM   629  C C   . GLY A 1 80  ? -0.330  29.489 -16.349 1.00 18.45 ? 80   GLY A C   1 
ATOM   630  O O   . GLY A 1 80  ? -1.022  30.461 -16.675 1.00 18.51 ? 80   GLY A O   1 
ATOM   631  N N   . GLY A 1 81  ? 0.803   29.588 -15.653 1.00 16.16 ? 81   GLY A N   1 
ATOM   632  C CA  . GLY A 1 81  ? 1.395   30.878 -15.329 1.00 19.68 ? 81   GLY A CA  1 
ATOM   633  C C   . GLY A 1 81  ? 0.975   31.520 -14.016 1.00 20.70 ? 81   GLY A C   1 
ATOM   634  O O   . GLY A 1 81  ? 1.354   32.657 -13.734 1.00 22.20 ? 81   GLY A O   1 
ATOM   635  N N   . VAL A 1 82  ? 0.191   30.813 -13.205 1.00 18.80 ? 82   VAL A N   1 
ATOM   636  C CA  . VAL A 1 82  ? -0.171  31.330 -11.887 1.00 18.47 ? 82   VAL A CA  1 
ATOM   637  C C   . VAL A 1 82  ? 1.094   31.387 -11.024 1.00 22.58 ? 82   VAL A C   1 
ATOM   638  O O   . VAL A 1 82  ? 1.836   30.411 -10.969 1.00 21.47 ? 82   VAL A O   1 
ATOM   639  C CB  . VAL A 1 82  ? -1.255  30.453 -11.214 1.00 20.09 ? 82   VAL A CB  1 
ATOM   640  C CG1 . VAL A 1 82  ? -1.479  30.868 -9.759  1.00 26.25 ? 82   VAL A CG1 1 
ATOM   641  C CG2 . VAL A 1 82  ? -2.574  30.492 -12.017 1.00 18.98 ? 82   VAL A CG2 1 
ATOM   642  N N   . ARG A 1 83  ? 1.355   32.521 -10.365 1.00 22.15 ? 83   ARG A N   1 
ATOM   643  C CA  . ARG A 1 83  ? 2.589   32.666 -9.576  1.00 24.53 ? 83   ARG A CA  1 
ATOM   644  C C   . ARG A 1 83  ? 2.374   33.253 -8.181  1.00 25.98 ? 83   ARG A C   1 
ATOM   645  O O   . ARG A 1 83  ? 3.202   33.062 -7.278  1.00 26.88 ? 83   ARG A O   1 
ATOM   646  C CB  . ARG A 1 83  ? 3.605   33.535 -10.333 1.00 21.86 ? 83   ARG A CB  1 
ATOM   647  C CG  . ARG A 1 83  ? 4.198   32.892 -11.570 1.00 22.06 ? 83   ARG A CG  1 
ATOM   648  C CD  . ARG A 1 83  ? 4.938   31.616 -11.218 1.00 24.68 ? 83   ARG A CD  1 
ATOM   649  N NE  . ARG A 1 83  ? 5.644   31.057 -12.364 1.00 22.26 ? 83   ARG A NE  1 
ATOM   650  C CZ  . ARG A 1 83  ? 5.114   30.154 -13.184 1.00 22.14 ? 83   ARG A CZ  1 
ATOM   651  N NH1 . ARG A 1 83  ? 3.871   29.734 -12.988 1.00 19.57 ? 83   ARG A NH1 1 
ATOM   652  N NH2 . ARG A 1 83  ? 5.823   29.681 -14.203 1.00 21.68 ? 83   ARG A NH2 1 
ATOM   653  N N   . THR A 1 84  ? 1.272   33.973 -8.000  1.00 23.44 ? 84   THR A N   1 
ATOM   654  C CA  . THR A 1 84  ? 1.015   34.651 -6.735  1.00 24.80 ? 84   THR A CA  1 
ATOM   655  C C   . THR A 1 84  ? -0.361  34.348 -6.161  1.00 24.71 ? 84   THR A C   1 
ATOM   656  O O   . THR A 1 84  ? -1.275  33.910 -6.859  1.00 23.95 ? 84   THR A O   1 
ATOM   657  C CB  . THR A 1 84  ? 1.130   36.172 -6.880  1.00 30.01 ? 84   THR A CB  1 
ATOM   658  O OG1 . THR A 1 84  ? 0.021   36.663 -7.645  1.00 31.48 ? 84   THR A OG1 1 
ATOM   659  C CG2 . THR A 1 84  ? 2.436   36.556 -7.567  1.00 33.13 ? 84   THR A CG2 1 
ATOM   660  N N   . GLU A 1 85  ? -0.496  34.605 -4.869  1.00 29.55 ? 85   GLU A N   1 
ATOM   661  C CA  . GLU A 1 85  ? -1.768  34.492 -4.186  1.00 28.32 ? 85   GLU A CA  1 
ATOM   662  C C   . GLU A 1 85  ? -2.836  35.385 -4.826  1.00 29.05 ? 85   GLU A C   1 
ATOM   663  O O   . GLU A 1 85  ? -4.017  35.035 -4.860  1.00 29.89 ? 85   GLU A O   1 
ATOM   664  C CB  . GLU A 1 85  ? -1.558  34.845 -2.713  1.00 35.35 ? 85   GLU A CB  1 
ATOM   665  C CG  . GLU A 1 85  ? -2.788  34.961 -1.882  1.00 39.00 ? 85   GLU A CG  1 
ATOM   666  C CD  . GLU A 1 85  ? -2.450  35.472 -0.491  1.00 44.30 ? 85   GLU A CD  1 
ATOM   667  O OE1 . GLU A 1 85  ? -1.246  35.600 -0.174  1.00 44.77 ? 85   GLU A OE1 1 
ATOM   668  O OE2 . GLU A 1 85  ? -3.380  35.752 0.278   1.00 45.20 ? 85   GLU A OE2 1 
ATOM   669  N N   . GLU A 1 86  ? -2.408  36.535 -5.340  1.00 33.91 ? 86   GLU A N   1 
ATOM   670  C CA  . GLU A 1 86  ? -3.307  37.476 -5.997  1.00 33.52 ? 86   GLU A CA  1 
ATOM   671  C C   . GLU A 1 86  ? -3.783  36.926 -7.347  1.00 31.41 ? 86   GLU A C   1 
ATOM   672  O O   . GLU A 1 86  ? -4.931  37.149 -7.737  1.00 28.18 ? 86   GLU A O   1 
ATOM   673  C CB  . GLU A 1 86  ? -2.622  38.835 -6.170  1.00 41.98 ? 86   GLU A CB  1 
ATOM   674  C CG  . GLU A 1 86  ? -2.230  39.500 -4.845  1.00 53.82 ? 86   GLU A CG  1 
ATOM   675  C CD  . GLU A 1 86  ? -0.962  38.916 -4.214  1.00 64.22 ? 86   GLU A CD  1 
ATOM   676  O OE1 . GLU A 1 86  ? -0.016  38.563 -4.950  1.00 53.43 ? 86   GLU A OE1 1 
ATOM   677  O OE2 . GLU A 1 86  ? -0.915  38.809 -2.969  1.00 79.73 ? 86   GLU A OE2 1 
ATOM   678  N N   . ASP A 1 87  ? -2.903  36.200 -8.041  1.00 26.59 ? 87   ASP A N   1 
ATOM   679  C CA  . ASP A 1 87  ? -3.284  35.502 -9.270  1.00 27.75 ? 87   ASP A CA  1 
ATOM   680  C C   . ASP A 1 87  ? -4.431  34.536 -9.006  1.00 23.69 ? 87   ASP A C   1 
ATOM   681  O O   . ASP A 1 87  ? -5.424  34.500 -9.743  1.00 25.48 ? 87   ASP A O   1 
ATOM   682  C CB  . ASP A 1 87  ? -2.109  34.718 -9.851  1.00 21.78 ? 87   ASP A CB  1 
ATOM   683  C CG  . ASP A 1 87  ? -1.020  35.604 -10.419 1.00 27.72 ? 87   ASP A CG  1 
ATOM   684  O OD1 . ASP A 1 87  ? -1.308  36.781 -10.730 1.00 27.07 ? 87   ASP A OD1 1 
ATOM   685  O OD2 . ASP A 1 87  ? 0.126   35.110 -10.564 1.00 27.53 ? 87   ASP A OD2 1 
ATOM   686  N N   . VAL A 1 88  ? -4.271  33.737 -7.957  1.00 24.25 ? 88   VAL A N   1 
ATOM   687  C CA  . VAL A 1 88  ? -5.277  32.756 -7.582  1.00 23.24 ? 88   VAL A CA  1 
ATOM   688  C C   . VAL A 1 88  ? -6.599  33.450 -7.246  1.00 26.57 ? 88   VAL A C   1 
ATOM   689  O O   . VAL A 1 88  ? -7.664  33.079 -7.752  1.00 24.73 ? 88   VAL A O   1 
ATOM   690  C CB  . VAL A 1 88  ? -4.819  31.901 -6.388  1.00 24.73 ? 88   VAL A CB  1 
ATOM   691  C CG1 . VAL A 1 88  ? -5.898  30.883 -6.027  1.00 24.52 ? 88   VAL A CG1 1 
ATOM   692  C CG2 . VAL A 1 88  ? -3.491  31.200 -6.701  1.00 22.24 ? 88   VAL A CG2 1 
ATOM   693  N N   . ALA A 1 89  ? -6.525  34.474 -6.403  1.00 26.27 ? 89   ALA A N   1 
ATOM   694  C CA  . ALA A 1 89  ? -7.721  35.187 -5.981  1.00 29.52 ? 89   ALA A CA  1 
ATOM   695  C C   . ALA A 1 89  ? -8.499  35.754 -7.171  1.00 29.45 ? 89   ALA A C   1 
ATOM   696  O O   . ALA A 1 89  ? -9.729  35.686 -7.212  1.00 27.06 ? 89   ALA A O   1 
ATOM   697  C CB  . ALA A 1 89  ? -7.348  36.302 -5.006  1.00 30.39 ? 89   ALA A CB  1 
ATOM   698  N N   . ALA A 1 90  ? -7.772  36.293 -8.142  1.00 27.11 ? 90   ALA A N   1 
ATOM   699  C CA  . ALA A 1 90  ? -8.393  36.932 -9.297  1.00 29.48 ? 90   ALA A CA  1 
ATOM   700  C C   . ALA A 1 90  ? -9.110  35.925 -10.193 1.00 30.21 ? 90   ALA A C   1 
ATOM   701  O O   . ALA A 1 90  ? -10.173 36.221 -10.752 1.00 28.47 ? 90   ALA A O   1 
ATOM   702  C CB  . ALA A 1 90  ? -7.357  37.694 -10.089 1.00 29.97 ? 90   ALA A CB  1 
ATOM   703  N N   . LEU A 1 91  ? -8.533  34.736 -10.329 1.00 23.98 ? 91   LEU A N   1 
ATOM   704  C CA  . LEU A 1 91  ? -9.168  33.701 -11.132 1.00 22.80 ? 91   LEU A CA  1 
ATOM   705  C C   . LEU A 1 91  ? -10.457 33.243 -10.463 1.00 26.55 ? 91   LEU A C   1 
ATOM   706  O O   . LEU A 1 91  ? -11.487 33.118 -11.124 1.00 27.50 ? 91   LEU A O   1 
ATOM   707  C CB  . LEU A 1 91  ? -8.225  32.517 -11.349 1.00 21.19 ? 91   LEU A CB  1 
ATOM   708  C CG  . LEU A 1 91  ? -7.086  32.757 -12.341 1.00 20.31 ? 91   LEU A CG  1 
ATOM   709  C CD1 . LEU A 1 91  ? -6.084  31.613 -12.275 1.00 21.38 ? 91   LEU A CD1 1 
ATOM   710  C CD2 . LEU A 1 91  ? -7.625  32.924 -13.753 1.00 25.47 ? 91   LEU A CD2 1 
ATOM   711  N N   . LEU A 1 92  ? -10.404 33.009 -9.153  1.00 23.91 ? 92   LEU A N   1 
ATOM   712  C CA  . LEU A 1 92  ? -11.587 32.581 -8.412  1.00 23.79 ? 92   LEU A CA  1 
ATOM   713  C C   . LEU A 1 92  ? -12.677 33.643 -8.471  1.00 27.25 ? 92   LEU A C   1 
ATOM   714  O O   . LEU A 1 92  ? -13.859 33.327 -8.611  1.00 28.44 ? 92   LEU A O   1 
ATOM   715  C CB  . LEU A 1 92  ? -11.226 32.277 -6.956  1.00 24.34 ? 92   LEU A CB  1 
ATOM   716  C CG  . LEU A 1 92  ? -10.259 31.107 -6.779  1.00 24.71 ? 92   LEU A CG  1 
ATOM   717  C CD1 . LEU A 1 92  ? -9.776  31.023 -5.339  1.00 25.25 ? 92   LEU A CD1 1 
ATOM   718  C CD2 . LEU A 1 92  ? -10.895 29.793 -7.218  1.00 25.24 ? 92   LEU A CD2 1 
ATOM   719  N N   . LYS A 1 93  ? -12.265 34.904 -8.397  1.00 24.44 ? 93   LYS A N   1 
ATOM   720  C CA  . LYS A 1 93  ? -13.206 36.017 -8.467  1.00 29.94 ? 93   LYS A CA  1 
ATOM   721  C C   . LYS A 1 93  ? -13.906 36.056 -9.823  1.00 33.18 ? 93   LYS A C   1 
ATOM   722  O O   . LYS A 1 93  ? -15.069 36.455 -9.918  1.00 36.53 ? 93   LYS A O   1 
ATOM   723  C CB  . LYS A 1 93  ? -12.491 37.338 -8.201  1.00 33.96 ? 93   LYS A CB  1 
ATOM   724  C CG  . LYS A 1 93  ? -13.416 38.552 -8.218  1.00 41.68 ? 93   LYS A CG  1 
ATOM   725  C CD  . LYS A 1 93  ? -12.676 39.831 -7.874  1.00 45.91 ? 93   LYS A CD  1 
ATOM   726  C CE  . LYS A 1 93  ? -13.636 41.013 -7.810  1.00 55.34 ? 93   LYS A CE  1 
ATOM   727  N NZ  . LYS A 1 93  ? -14.834 40.698 -6.980  1.00 56.17 ? 93   LYS A NZ  1 
ATOM   728  N N   . ALA A 1 94  ? -13.208 35.622 -10.871 1.00 28.06 ? 94   ALA A N   1 
ATOM   729  C CA  . ALA A 1 94  ? -13.774 35.665 -12.216 1.00 28.82 ? 94   ALA A CA  1 
ATOM   730  C C   . ALA A 1 94  ? -14.590 34.407 -12.524 1.00 35.24 ? 94   ALA A C   1 
ATOM   731  O O   . ALA A 1 94  ? -14.999 34.179 -13.666 1.00 37.94 ? 94   ALA A O   1 
ATOM   732  C CB  . ALA A 1 94  ? -12.671 35.855 -13.247 1.00 29.22 ? 94   ALA A CB  1 
ATOM   733  N N   . GLY A 1 95  ? -14.824 33.593 -11.500 1.00 32.50 ? 95   GLY A N   1 
ATOM   734  C CA  . GLY A 1 95  ? -15.709 32.449 -11.633 1.00 31.03 ? 95   GLY A CA  1 
ATOM   735  C C   . GLY A 1 95  ? -15.038 31.097 -11.808 1.00 25.84 ? 95   GLY A C   1 
ATOM   736  O O   . GLY A 1 95  ? -15.724 30.076 -11.893 1.00 28.07 ? 95   GLY A O   1 
ATOM   737  N N   . VAL A 1 96  ? -13.708 31.080 -11.894 1.00 21.80 ? 96   VAL A N   1 
ATOM   738  C CA  . VAL A 1 96  ? -12.969 29.821 -11.991 1.00 20.31 ? 96   VAL A CA  1 
ATOM   739  C C   . VAL A 1 96  ? -13.257 28.941 -10.769 1.00 24.67 ? 96   VAL A C   1 
ATOM   740  O O   . VAL A 1 96  ? -13.252 29.430 -9.636  1.00 24.15 ? 96   VAL A O   1 
ATOM   741  C CB  . VAL A 1 96  ? -11.449 30.073 -12.121 1.00 19.55 ? 96   VAL A CB  1 
ATOM   742  C CG1 . VAL A 1 96  ? -10.647 28.778 -11.985 1.00 21.00 ? 96   VAL A CG1 1 
ATOM   743  C CG2 . VAL A 1 96  ? -11.130 30.755 -13.451 1.00 23.34 ? 96   VAL A CG2 1 
ATOM   744  N N   . ALA A 1 97  ? -13.536 27.660 -11.009 1.00 20.83 ? 97   ALA A N   1 
ATOM   745  C CA  . ALA A 1 97  ? -13.890 26.723 -9.936  1.00 27.43 ? 97   ALA A CA  1 
ATOM   746  C C   . ALA A 1 97  ? -12.666 26.278 -9.151  1.00 27.45 ? 97   ALA A C   1 
ATOM   747  O O   . ALA A 1 97  ? -12.692 26.223 -7.918  1.00 25.09 ? 97   ALA A O   1 
ATOM   748  C CB  . ALA A 1 97  ? -14.612 25.510 -10.498 1.00 23.23 ? 97   ALA A CB  1 
ATOM   749  N N   . ARG A 1 98  ? -11.597 25.957 -9.873  1.00 20.31 ? 98   ARG A N   1 
ATOM   750  C CA  . ARG A 1 98  ? -10.355 25.490 -9.261  1.00 19.96 ? 98   ARG A CA  1 
ATOM   751  C C   . ARG A 1 98  ? -9.174  26.057 -10.026 1.00 19.87 ? 98   ARG A C   1 
ATOM   752  O O   . ARG A 1 98  ? -9.218  26.131 -11.251 1.00 18.53 ? 98   ARG A O   1 
ATOM   753  C CB  . ARG A 1 98  ? -10.271 23.961 -9.267  1.00 20.42 ? 98   ARG A CB  1 
ATOM   754  C CG  . ARG A 1 98  ? -11.304 23.299 -8.392  1.00 28.68 ? 98   ARG A CG  1 
ATOM   755  C CD  . ARG A 1 98  ? -11.047 21.826 -8.253  1.00 36.08 ? 98   ARG A CD  1 
ATOM   756  N NE  . ARG A 1 98  ? -11.233 21.090 -9.497  1.00 39.25 ? 98   ARG A NE  1 
ATOM   757  C CZ  . ARG A 1 98  ? -12.133 20.126 -9.654  1.00 40.61 ? 98   ARG A CZ  1 
ATOM   758  N NH1 . ARG A 1 98  ? -12.933 19.802 -8.646  1.00 41.13 ? 98   ARG A NH1 1 
ATOM   759  N NH2 . ARG A 1 98  ? -12.230 19.484 -10.810 1.00 34.82 ? 98   ARG A NH2 1 
ATOM   760  N N   . VAL A 1 99  ? -8.121  26.448 -9.312  1.00 17.02 ? 99   VAL A N   1 
ATOM   761  C CA  . VAL A 1 99  ? -6.921  26.964 -9.954  1.00 19.28 ? 99   VAL A CA  1 
ATOM   762  C C   . VAL A 1 99  ? -5.856  25.873 -9.920  1.00 18.75 ? 99   VAL A C   1 
ATOM   763  O O   . VAL A 1 99  ? -5.592  25.281 -8.873  1.00 17.42 ? 99   VAL A O   1 
ATOM   764  C CB  . VAL A 1 99  ? -6.422  28.262 -9.262  1.00 18.59 ? 99   VAL A CB  1 
ATOM   765  C CG1 . VAL A 1 99  ? -5.116  28.737 -9.880  1.00 19.89 ? 99   VAL A CG1 1 
ATOM   766  C CG2 . VAL A 1 99  ? -7.489  29.356 -9.349  1.00 19.75 ? 99   VAL A CG2 1 
ATOM   767  N N   . VAL A 1 100 ? -5.270  25.598 -11.084 1.00 14.59 ? 100  VAL A N   1 
ATOM   768  C CA  . VAL A 1 100 ? -4.312  24.502 -11.266 1.00 14.22 ? 100  VAL A CA  1 
ATOM   769  C C   . VAL A 1 100 ? -2.910  25.090 -11.224 1.00 15.92 ? 100  VAL A C   1 
ATOM   770  O O   . VAL A 1 100 ? -2.610  26.020 -11.960 1.00 17.37 ? 100  VAL A O   1 
ATOM   771  C CB  . VAL A 1 100 ? -4.532  23.770 -12.606 1.00 12.95 ? 100  VAL A CB  1 
ATOM   772  C CG1 . VAL A 1 100 ? -3.586  22.592 -12.725 1.00 15.15 ? 100  VAL A CG1 1 
ATOM   773  C CG2 . VAL A 1 100 ? -5.994  23.332 -12.779 1.00 15.64 ? 100  VAL A CG2 1 
ATOM   774  N N   . ILE A 1 101 ? -2.067  24.556 -10.345 1.00 14.58 ? 101  ILE A N   1 
ATOM   775  C CA  A ILE A 1 101 ? -0.751  25.119 -10.066 0.40 16.06 ? 101  ILE A CA  1 
ATOM   776  C CA  B ILE A 1 101 ? -0.740  25.120 -10.109 0.60 14.87 ? 101  ILE A CA  1 
ATOM   777  C C   . ILE A 1 101 ? 0.335   24.041 -10.124 1.00 17.59 ? 101  ILE A C   1 
ATOM   778  O O   . ILE A 1 101 ? 0.157   22.941 -9.580  1.00 17.42 ? 101  ILE A O   1 
ATOM   779  C CB  A ILE A 1 101 ? -0.747  25.792 -8.675  0.40 18.02 ? 101  ILE A CB  1 
ATOM   780  C CB  B ILE A 1 101 ? -0.678  25.868 -8.762  0.60 17.76 ? 101  ILE A CB  1 
ATOM   781  C CG1 A ILE A 1 101 ? -1.873  26.824 -8.585  0.40 19.96 ? 101  ILE A CG1 1 
ATOM   782  C CG1 B ILE A 1 101 ? -0.996  24.911 -7.607  0.60 19.83 ? 101  ILE A CG1 1 
ATOM   783  C CG2 A ILE A 1 101 ? 0.594   26.423 -8.370  0.40 17.93 ? 101  ILE A CG2 1 
ATOM   784  C CG2 B ILE A 1 101 ? -1.638  27.044 -8.768  0.60 18.61 ? 101  ILE A CG2 1 
ATOM   785  C CD1 A ILE A 1 101 ? -2.298  27.150 -7.170  0.40 22.19 ? 101  ILE A CD1 1 
ATOM   786  C CD1 B ILE A 1 101 ? -0.809  25.526 -6.239  0.60 25.75 ? 101  ILE A CD1 1 
ATOM   787  N N   . ALA A 1 102 ? 1.459   24.345 -10.767 1.00 15.82 ? 102  ALA A N   1 
ATOM   788  C CA  . ALA A 1 102 ? 2.576   23.407 -10.768 1.00 16.43 ? 102  ALA A CA  1 
ATOM   789  C C   . ALA A 1 102 ? 3.863   24.080 -10.294 1.00 17.31 ? 102  ALA A C   1 
ATOM   790  O O   . ALA A 1 102 ? 4.392   23.756 -9.229  1.00 17.22 ? 102  ALA A O   1 
ATOM   791  C CB  . ALA A 1 102 ? 2.781   22.802 -12.161 1.00 17.74 ? 102  ALA A CB  1 
ATOM   792  N N   . SER A 1 103 ? 4.352   25.023 -11.096 1.00 16.43 ? 103  SER A N   1 
ATOM   793  C CA  . SER A 1 103 ? 5.669   25.624 -10.889 1.00 14.56 ? 103  SER A CA  1 
ATOM   794  C C   . SER A 1 103 ? 5.901   26.159 -9.490  1.00 17.44 ? 103  SER A C   1 
ATOM   795  O O   . SER A 1 103 ? 6.869   25.780 -8.831  1.00 20.57 ? 103  SER A O   1 
ATOM   796  C CB  . SER A 1 103 ? 5.890   26.753 -11.906 1.00 17.00 ? 103  SER A CB  1 
ATOM   797  O OG  . SER A 1 103 ? 6.008   26.222 -13.219 1.00 17.09 ? 103  SER A OG  1 
ATOM   798  N N   . THR A 1 104 ? 5.019   27.044 -9.032  1.00 16.02 ? 104  THR A N   1 
ATOM   799  C CA  . THR A 1 104 ? 5.236   27.688 -7.738  1.00 17.70 ? 104  THR A CA  1 
ATOM   800  C C   . THR A 1 104 ? 5.070   26.699 -6.584  1.00 22.64 ? 104  THR A C   1 
ATOM   801  O O   . THR A 1 104 ? 5.665   26.868 -5.520  1.00 21.19 ? 104  THR A O   1 
ATOM   802  C CB  . THR A 1 104 ? 4.280   28.874 -7.552  1.00 20.67 ? 104  THR A CB  1 
ATOM   803  O OG1 . THR A 1 104 ? 4.399   29.747 -8.683  1.00 20.86 ? 104  THR A OG1 1 
ATOM   804  C CG2 . THR A 1 104 ? 4.622   29.652 -6.278  1.00 20.38 ? 104  THR A CG2 1 
ATOM   805  N N   . ALA A 1 105 ? 4.253   25.669 -6.791  1.00 17.40 ? 105  ALA A N   1 
ATOM   806  C CA  . ALA A 1 105 ? 4.082   24.637 -5.770  1.00 18.94 ? 105  ALA A CA  1 
ATOM   807  C C   . ALA A 1 105 ? 5.366   23.839 -5.565  1.00 22.50 ? 105  ALA A C   1 
ATOM   808  O O   . ALA A 1 105 ? 5.642   23.346 -4.464  1.00 22.24 ? 105  ALA A O   1 
ATOM   809  C CB  . ALA A 1 105 ? 2.944   23.720 -6.134  1.00 19.74 ? 105  ALA A CB  1 
ATOM   810  N N   . MET A 1 106 ? 6.165   23.714 -6.620  1.00 18.75 ? 106  MET A N   1 
ATOM   811  C CA  . MET A 1 106 ? 7.468   23.081 -6.478  1.00 18.27 ? 106  MET A CA  1 
ATOM   812  C C   . MET A 1 106 ? 8.494   24.073 -5.928  1.00 20.52 ? 106  MET A C   1 
ATOM   813  O O   . MET A 1 106 ? 9.279   23.744 -5.032  1.00 23.92 ? 106  MET A O   1 
ATOM   814  C CB  . MET A 1 106 ? 7.932   22.513 -7.828  1.00 19.83 ? 106  MET A CB  1 
ATOM   815  C CG  . MET A 1 106 ? 9.302   21.842 -7.788  1.00 23.15 ? 106  MET A CG  1 
ATOM   816  S SD  . MET A 1 106 ? 10.607  23.024 -8.129  1.00 24.92 ? 106  MET A SD  1 
ATOM   817  C CE  . MET A 1 106 ? 11.965  22.248 -7.259  1.00 29.87 ? 106  MET A CE  1 
ATOM   818  N N   . LYS A 1 107 ? 8.474   25.294 -6.452  1.00 20.03 ? 107  LYS A N   1 
ATOM   819  C CA  . LYS A 1 107 ? 9.548   26.260 -6.181  1.00 21.46 ? 107  LYS A CA  1 
ATOM   820  C C   . LYS A 1 107 ? 9.442   26.923 -4.823  1.00 26.27 ? 107  LYS A C   1 
ATOM   821  O O   . LYS A 1 107 ? 10.461  27.260 -4.216  1.00 29.13 ? 107  LYS A O   1 
ATOM   822  C CB  . LYS A 1 107 ? 9.576   27.348 -7.264  1.00 25.11 ? 107  LYS A CB  1 
ATOM   823  C CG  . LYS A 1 107 ? 10.090  26.868 -8.624  1.00 27.43 ? 107  LYS A CG  1 
ATOM   824  C CD  . LYS A 1 107 ? 11.579  26.542 -8.590  1.00 37.32 ? 107  LYS A CD  1 
ATOM   825  C CE  . LYS A 1 107 ? 12.073  25.895 -9.888  1.00 34.91 ? 107  LYS A CE  1 
ATOM   826  N NZ  . LYS A 1 107 ? 12.154  26.849 -11.028 1.00 38.30 ? 107  LYS A NZ  1 
ATOM   827  N N   . SER A 1 108 ? 8.216   27.122 -4.352  1.00 23.85 ? 108  SER A N   1 
ATOM   828  C CA  . SER A 1 108 ? 7.995   27.883 -3.135  1.00 25.05 ? 108  SER A CA  1 
ATOM   829  C C   . SER A 1 108 ? 6.917   27.264 -2.249  1.00 26.12 ? 108  SER A C   1 
ATOM   830  O O   . SER A 1 108 ? 5.835   27.840 -2.087  1.00 25.16 ? 108  SER A O   1 
ATOM   831  C CB  . SER A 1 108 ? 7.613   29.322 -3.490  1.00 27.30 ? 108  SER A CB  1 
ATOM   832  O OG  . SER A 1 108 ? 8.545   29.885 -4.402  1.00 31.62 ? 108  SER A OG  1 
ATOM   833  N N   . PRO A 1 109 ? 7.210   26.093 -1.661  1.00 27.35 ? 109  PRO A N   1 
ATOM   834  C CA  . PRO A 1 109 ? 6.244   25.348 -0.843  1.00 29.79 ? 109  PRO A CA  1 
ATOM   835  C C   . PRO A 1 109 ? 5.655   26.147 0.323   1.00 27.89 ? 109  PRO A C   1 
ATOM   836  O O   . PRO A 1 109 ? 4.463   26.038 0.577   1.00 29.19 ? 109  PRO A O   1 
ATOM   837  C CB  . PRO A 1 109 ? 7.069   24.168 -0.315  1.00 33.26 ? 109  PRO A CB  1 
ATOM   838  C CG  . PRO A 1 109 ? 8.171   24.024 -1.258  1.00 32.51 ? 109  PRO A CG  1 
ATOM   839  C CD  . PRO A 1 109 ? 8.506   25.403 -1.728  1.00 29.31 ? 109  PRO A CD  1 
ATOM   840  N N   . ASP A 1 110 ? 6.469   26.930 1.022   1.00 28.75 ? 110  ASP A N   1 
ATOM   841  C CA  . ASP A 1 110 ? 5.955   27.709 2.142   1.00 33.73 ? 110  ASP A CA  1 
ATOM   842  C C   . ASP A 1 110 ? 4.928   28.728 1.676   1.00 33.16 ? 110  ASP A C   1 
ATOM   843  O O   . ASP A 1 110 ? 3.925   28.965 2.355   1.00 35.92 ? 110  ASP A O   1 
ATOM   844  C CB  . ASP A 1 110 ? 7.096   28.409 2.876   1.00 35.20 ? 110  ASP A CB  1 
ATOM   845  C CG  . ASP A 1 110 ? 7.981   27.439 3.615   1.00 49.61 ? 110  ASP A CG  1 
ATOM   846  O OD1 . ASP A 1 110 ? 7.465   26.393 4.066   1.00 52.17 ? 110  ASP A OD1 1 
ATOM   847  O OD2 . ASP A 1 110 ? 9.192   27.717 3.729   1.00 53.97 ? 110  ASP A OD2 1 
ATOM   848  N N   . VAL A 1 111 ? 5.173   29.325 0.513   1.00 30.40 ? 111  VAL A N   1 
ATOM   849  C CA  . VAL A 1 111 ? 4.225   30.264 -0.068  1.00 29.71 ? 111  VAL A CA  1 
ATOM   850  C C   . VAL A 1 111 ? 2.909   29.572 -0.428  1.00 33.29 ? 111  VAL A C   1 
ATOM   851  O O   . VAL A 1 111 ? 1.828   30.062 -0.087  1.00 34.52 ? 111  VAL A O   1 
ATOM   852  C CB  . VAL A 1 111 ? 4.803   30.947 -1.322  1.00 34.22 ? 111  VAL A CB  1 
ATOM   853  C CG1 . VAL A 1 111 ? 3.731   31.750 -2.048  1.00 33.66 ? 111  VAL A CG1 1 
ATOM   854  C CG2 . VAL A 1 111 ? 5.985   31.827 -0.948  1.00 32.01 ? 111  VAL A CG2 1 
ATOM   855  N N   . VAL A 1 112 ? 2.997   28.426 -1.099  1.00 25.89 ? 112  VAL A N   1 
ATOM   856  C CA  . VAL A 1 112 ? 1.791   27.758 -1.580  1.00 25.97 ? 112  VAL A CA  1 
ATOM   857  C C   . VAL A 1 112 ? 1.013   27.114 -0.422  1.00 26.04 ? 112  VAL A C   1 
ATOM   858  O O   . VAL A 1 112 ? -0.215  27.038 -0.473  1.00 28.27 ? 112  VAL A O   1 
ATOM   859  C CB  . VAL A 1 112 ? 2.140   26.731 -2.682  1.00 21.97 ? 112  VAL A CB  1 
ATOM   860  C CG1 . VAL A 1 112 ? 0.921   25.913 -3.085  1.00 23.22 ? 112  VAL A CG1 1 
ATOM   861  C CG2 . VAL A 1 112 ? 2.653   27.479 -3.904  1.00 22.51 ? 112  VAL A CG2 1 
ATOM   862  N N   . LYS A 1 113 ? 1.706   26.698 0.638   1.00 24.79 ? 113  LYS A N   1 
ATOM   863  C CA  . LYS A 1 113 ? 1.000   26.272 1.849   1.00 26.51 ? 113  LYS A CA  1 
ATOM   864  C C   . LYS A 1 113 ? 0.092   27.394 2.362   1.00 28.92 ? 113  LYS A C   1 
ATOM   865  O O   . LYS A 1 113 ? -0.998  27.139 2.868   1.00 29.09 ? 113  LYS A O   1 
ATOM   866  C CB  . LYS A 1 113 ? 1.983   25.840 2.942   1.00 32.47 ? 113  LYS A CB  1 
ATOM   867  C CG  . LYS A 1 113 ? 2.578   24.462 2.705   1.00 31.89 ? 113  LYS A CG  1 
ATOM   868  C CD  . LYS A 1 113 ? 3.618   24.109 3.755   1.00 33.72 ? 113  LYS A CD  1 
ATOM   869  C CE  . LYS A 1 113 ? 4.111   22.679 3.563   1.00 39.00 ? 113  LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 113 ? 5.066   22.282 4.635   1.00 44.04 ? 113  LYS A NZ  1 
ATOM   871  N N   . GLY A 1 114 ? 0.543   28.639 2.219   1.00 33.40 ? 114  GLY A N   1 
ATOM   872  C CA  . GLY A 1 114 ? -0.257  29.788 2.607   1.00 33.64 ? 114  GLY A CA  1 
ATOM   873  C C   . GLY A 1 114 ? -1.495  29.928 1.732   1.00 29.80 ? 114  GLY A C   1 
ATOM   874  O O   . GLY A 1 114 ? -2.555  30.354 2.199   1.00 32.36 ? 114  GLY A O   1 
ATOM   875  N N   . TRP A 1 115 ? -1.366  29.558 0.458   1.00 27.14 ? 115  TRP A N   1 
ATOM   876  C CA  . TRP A 1 115 ? -2.507  29.586 -0.458  1.00 26.14 ? 115  TRP A CA  1 
ATOM   877  C C   . TRP A 1 115 ? -3.552  28.577 -0.019  1.00 26.21 ? 115  TRP A C   1 
ATOM   878  O O   . TRP A 1 115 ? -4.745  28.849 -0.068  1.00 25.55 ? 115  TRP A O   1 
ATOM   879  C CB  . TRP A 1 115 ? -2.087  29.275 -1.892  1.00 24.16 ? 115  TRP A CB  1 
ATOM   880  C CG  . TRP A 1 115 ? -1.124  30.233 -2.491  1.00 27.63 ? 115  TRP A CG  1 
ATOM   881  C CD1 . TRP A 1 115 ? -0.601  31.347 -1.905  1.00 32.20 ? 115  TRP A CD1 1 
ATOM   882  C CD2 . TRP A 1 115 ? -0.559  30.162 -3.804  1.00 26.36 ? 115  TRP A CD2 1 
ATOM   883  N NE1 . TRP A 1 115 ? 0.261   31.973 -2.773  1.00 32.41 ? 115  TRP A NE1 1 
ATOM   884  C CE2 . TRP A 1 115 ? 0.308   31.261 -3.944  1.00 26.03 ? 115  TRP A CE2 1 
ATOM   885  C CE3 . TRP A 1 115 ? -0.690  29.263 -4.871  1.00 23.11 ? 115  TRP A CE3 1 
ATOM   886  C CZ2 . TRP A 1 115 ? 1.037   31.491 -5.103  1.00 23.99 ? 115  TRP A CZ2 1 
ATOM   887  C CZ3 . TRP A 1 115 ? 0.037   29.494 -6.031  1.00 26.69 ? 115  TRP A CZ3 1 
ATOM   888  C CH2 . TRP A 1 115 ? 0.889   30.602 -6.138  1.00 28.46 ? 115  TRP A CH2 1 
ATOM   889  N N   . PHE A 1 116 ? -3.093  27.399 0.396   1.00 29.28 ? 116  PHE A N   1 
ATOM   890  C CA  . PHE A 1 116 ? -4.009  26.370 0.867   1.00 30.79 ? 116  PHE A CA  1 
ATOM   891  C C   . PHE A 1 116 ? -4.769  26.888 2.084   1.00 31.54 ? 116  PHE A C   1 
ATOM   892  O O   . PHE A 1 116 ? -5.965  26.656 2.210   1.00 31.84 ? 116  PHE A O   1 
ATOM   893  C CB  . PHE A 1 116 ? -3.268  25.069 1.201   1.00 24.88 ? 116  PHE A CB  1 
ATOM   894  C CG  . PHE A 1 116 ? -3.096  24.152 0.020   1.00 26.76 ? 116  PHE A CG  1 
ATOM   895  C CD1 . PHE A 1 116 ? -4.100  23.250 -0.321  1.00 29.79 ? 116  PHE A CD1 1 
ATOM   896  C CD2 . PHE A 1 116 ? -1.942  24.189 -0.749  1.00 24.36 ? 116  PHE A CD2 1 
ATOM   897  C CE1 . PHE A 1 116 ? -3.961  22.404 -1.412  1.00 24.79 ? 116  PHE A CE1 1 
ATOM   898  C CE2 . PHE A 1 116 ? -1.788  23.338 -1.850  1.00 28.43 ? 116  PHE A CE2 1 
ATOM   899  C CZ  . PHE A 1 116 ? -2.800  22.445 -2.180  1.00 24.31 ? 116  PHE A CZ  1 
ATOM   900  N N   . GLU A 1 117 ? -4.074  27.616 2.958   1.00 28.06 ? 117  GLU A N   1 
ATOM   901  C CA  . GLU A 1 117 ? -4.714  28.191 4.138   1.00 30.15 ? 117  GLU A CA  1 
ATOM   902  C C   . GLU A 1 117 ? -5.765  29.250 3.784   1.00 34.73 ? 117  GLU A C   1 
ATOM   903  O O   . GLU A 1 117 ? -6.839  29.316 4.402   1.00 36.22 ? 117  GLU A O   1 
ATOM   904  C CB  . GLU A 1 117 ? -3.649  28.796 5.059   1.00 31.67 ? 117  GLU A CB  1 
ATOM   905  C CG  . GLU A 1 117 ? -4.202  29.588 6.244   1.00 44.97 ? 117  GLU A CG  1 
ATOM   906  C CD  . GLU A 1 117 ? -4.922  28.709 7.250   1.00 52.74 ? 117  GLU A CD  1 
ATOM   907  O OE1 . GLU A 1 117 ? -4.549  27.521 7.373   1.00 54.21 ? 117  GLU A OE1 1 
ATOM   908  O OE2 . GLU A 1 117 ? -5.857  29.203 7.920   1.00 53.44 ? 117  GLU A OE2 1 
ATOM   909  N N   . ARG A 1 118 ? -5.460  30.101 2.813   1.00 29.53 ? 118  ARG A N   1 
ATOM   910  C CA  . ARG A 1 118 ? -6.398  31.161 2.451   1.00 30.54 ? 118  ARG A CA  1 
ATOM   911  C C   . ARG A 1 118 ? -7.592  30.641 1.653   1.00 29.64 ? 118  ARG A C   1 
ATOM   912  O O   . ARG A 1 118 ? -8.741  30.937 1.980   1.00 32.26 ? 118  ARG A O   1 
ATOM   913  C CB  . ARG A 1 118 ? -5.708  32.268 1.649   1.00 29.98 ? 118  ARG A CB  1 
ATOM   914  C CG  . ARG A 1 118 ? -6.709  33.262 1.072   1.00 36.57 ? 118  ARG A CG  1 
ATOM   915  C CD  . ARG A 1 118 ? -6.045  34.444 0.412   1.00 34.83 ? 118  ARG A CD  1 
ATOM   916  N NE  . ARG A 1 118 ? -7.019  35.277 -0.286  1.00 39.95 ? 118  ARG A NE  1 
ATOM   917  C CZ  . ARG A 1 118 ? -6.711  36.360 -0.993  1.00 38.20 ? 118  ARG A CZ  1 
ATOM   918  N NH1 . ARG A 1 118 ? -5.450  36.753 -1.101  1.00 39.39 ? 118  ARG A NH1 1 
ATOM   919  N NH2 . ARG A 1 118 ? -7.668  37.045 -1.602  1.00 36.37 ? 118  ARG A NH2 1 
ATOM   920  N N   . PHE A 1 119 ? -7.317  29.869 0.607   1.00 28.04 ? 119  PHE A N   1 
ATOM   921  C CA  . PHE A 1 119 ? -8.354  29.508 -0.352  1.00 29.74 ? 119  PHE A CA  1 
ATOM   922  C C   . PHE A 1 119 ? -9.021  28.179 -0.064  1.00 27.69 ? 119  PHE A C   1 
ATOM   923  O O   . PHE A 1 119 ? -10.140 27.931 -0.521  1.00 32.99 ? 119  PHE A O   1 
ATOM   924  C CB  . PHE A 1 119 ? -7.780  29.480 -1.771  1.00 27.23 ? 119  PHE A CB  1 
ATOM   925  C CG  . PHE A 1 119 ? -7.147  30.773 -2.188  1.00 27.63 ? 119  PHE A CG  1 
ATOM   926  C CD1 . PHE A 1 119 ? -7.931  31.890 -2.438  1.00 28.16 ? 119  PHE A CD1 1 
ATOM   927  C CD2 . PHE A 1 119 ? -5.773  30.871 -2.334  1.00 28.78 ? 119  PHE A CD2 1 
ATOM   928  C CE1 . PHE A 1 119 ? -7.357  33.082 -2.830  1.00 28.85 ? 119  PHE A CE1 1 
ATOM   929  C CE2 . PHE A 1 119 ? -5.184  32.066 -2.719  1.00 26.40 ? 119  PHE A CE2 1 
ATOM   930  C CZ  . PHE A 1 119 ? -5.978  33.176 -2.964  1.00 27.95 ? 119  PHE A CZ  1 
ATOM   931  N N   . GLY A 1 120 ? -8.337  27.313 0.670   1.00 27.98 ? 120  GLY A N   1 
ATOM   932  C CA  . GLY A 1 120 ? -8.875  25.990 0.927   1.00 24.90 ? 120  GLY A CA  1 
ATOM   933  C C   . GLY A 1 120 ? -8.507  25.022 -0.178  1.00 26.56 ? 120  GLY A C   1 
ATOM   934  O O   . GLY A 1 120 ? -8.298  25.416 -1.327  1.00 27.52 ? 120  GLY A O   1 
ATOM   935  N N   . ALA A 1 121 ? -8.431  23.744 0.171   1.00 26.56 ? 121  ALA A N   1 
ATOM   936  C CA  . ALA A 1 121 ? -7.950  22.727 -0.750  1.00 27.46 ? 121  ALA A CA  1 
ATOM   937  C C   . ALA A 1 121 ? -8.938  22.409 -1.864  1.00 24.40 ? 121  ALA A C   1 
ATOM   938  O O   . ALA A 1 121 ? -8.581  21.774 -2.848  1.00 24.00 ? 121  ALA A O   1 
ATOM   939  C CB  . ALA A 1 121 ? -7.610  21.461 0.006   1.00 30.24 ? 121  ALA A CB  1 
ATOM   940  N N   . GLN A 1 122 ? -10.180 22.834 -1.713  1.00 29.56 ? 122  GLN A N   1 
ATOM   941  C CA  . GLN A 1 122 ? -11.158 22.564 -2.746  1.00 28.27 ? 122  GLN A CA  1 
ATOM   942  C C   . GLN A 1 122 ? -10.928 23.448 -3.956  1.00 26.01 ? 122  GLN A C   1 
ATOM   943  O O   . GLN A 1 122 ? -11.367 23.130 -5.065  1.00 32.07 ? 122  GLN A O   1 
ATOM   944  C CB  . GLN A 1 122 ? -12.574 22.759 -2.199  1.00 31.72 ? 122  GLN A CB  1 
ATOM   945  C CG  . GLN A 1 122 ? -13.149 21.476 -1.681  1.00 42.94 ? 122  GLN A CG  1 
ATOM   946  C CD  . GLN A 1 122 ? -13.414 20.509 -2.810  1.00 55.00 ? 122  GLN A CD  1 
ATOM   947  O OE1 . GLN A 1 122 ? -13.176 19.315 -2.688  1.00 59.10 ? 122  GLN A OE1 1 
ATOM   948  N NE2 . GLN A 1 122 ? -13.915 21.026 -3.922  1.00 62.48 ? 122  GLN A NE2 1 
ATOM   949  N N   . ALA A 1 123 ? -10.224 24.555 -3.749  1.00 24.81 ? 123  ALA A N   1 
ATOM   950  C CA  . ALA A 1 123 ? -10.064 25.559 -4.793  1.00 22.04 ? 123  ALA A CA  1 
ATOM   951  C C   . ALA A 1 123 ? -8.763  25.394 -5.579  1.00 23.90 ? 123  ALA A C   1 
ATOM   952  O O   . ALA A 1 123 ? -8.547  26.100 -6.558  1.00 24.48 ? 123  ALA A O   1 
ATOM   953  C CB  . ALA A 1 123 ? -10.126 26.954 -4.188  1.00 28.25 ? 123  ALA A CB  1 
ATOM   954  N N   . LEU A 1 124 ? -7.906  24.476 -5.140  1.00 20.79 ? 124  LEU A N   1 
ATOM   955  C CA  . LEU A 1 124 ? -6.572  24.311 -5.738  1.00 19.23 ? 124  LEU A CA  1 
ATOM   956  C C   . LEU A 1 124 ? -6.326  22.903 -6.262  1.00 20.49 ? 124  LEU A C   1 
ATOM   957  O O   . LEU A 1 124 ? -6.602  21.913 -5.587  1.00 21.31 ? 124  LEU A O   1 
ATOM   958  C CB  . LEU A 1 124 ? -5.489  24.658 -4.716  1.00 20.13 ? 124  LEU A CB  1 
ATOM   959  C CG  . LEU A 1 124 ? -5.631  26.005 -4.006  1.00 24.76 ? 124  LEU A CG  1 
ATOM   960  C CD1 . LEU A 1 124 ? -4.568  26.124 -2.930  1.00 24.94 ? 124  LEU A CD1 1 
ATOM   961  C CD2 . LEU A 1 124 ? -5.510  27.140 -5.003  1.00 27.74 ? 124  LEU A CD2 1 
ATOM   962  N N   . VAL A 1 125 ? -5.782  22.820 -7.472  1.00 17.61 ? 125  VAL A N   1 
ATOM   963  C CA  . VAL A 1 125 ? -5.364  21.550 -8.047  1.00 17.41 ? 125  VAL A CA  1 
ATOM   964  C C   . VAL A 1 125 ? -3.864  21.582 -8.215  1.00 16.25 ? 125  VAL A C   1 
ATOM   965  O O   . VAL A 1 125 ? -3.333  22.482 -8.853  1.00 18.52 ? 125  VAL A O   1 
ATOM   966  C CB  . VAL A 1 125 ? -6.017  21.281 -9.423  1.00 17.70 ? 125  VAL A CB  1 
ATOM   967  C CG1 . VAL A 1 125 ? -5.527  19.954 -9.993  1.00 18.30 ? 125  VAL A CG1 1 
ATOM   968  C CG2 . VAL A 1 125 ? -7.542  21.287 -9.286  1.00 19.56 ? 125  VAL A CG2 1 
ATOM   969  N N   . LEU A 1 126 ? -3.175  20.628 -7.599  1.00 16.48 ? 126  LEU A N   1 
ATOM   970  C CA  . LEU A 1 126 ? -1.736  20.529 -7.754  1.00 16.17 ? 126  LEU A CA  1 
ATOM   971  C C   . LEU A 1 126 ? -1.438  19.742 -9.009  1.00 19.81 ? 126  LEU A C   1 
ATOM   972  O O   . LEU A 1 126 ? -1.799  18.575 -9.111  1.00 17.74 ? 126  LEU A O   1 
ATOM   973  C CB  . LEU A 1 126 ? -1.119  19.851 -6.528  1.00 17.54 ? 126  LEU A CB  1 
ATOM   974  C CG  . LEU A 1 126 ? 0.372   19.540 -6.485  1.00 23.69 ? 126  LEU A CG  1 
ATOM   975  C CD1 . LEU A 1 126 ? 1.163   20.804 -6.681  1.00 25.77 ? 126  LEU A CD1 1 
ATOM   976  C CD2 . LEU A 1 126 ? 0.719   18.893 -5.153  1.00 24.16 ? 126  LEU A CD2 1 
ATOM   977  N N   . ALA A 1 127 ? -0.791  20.375 -9.979  1.00 15.13 ? 127  ALA A N   1 
ATOM   978  C CA  . ALA A 1 127 ? -0.389  19.641 -11.169 1.00 14.95 ? 127  ALA A CA  1 
ATOM   979  C C   . ALA A 1 127 ? 1.005   19.071 -11.002 1.00 19.19 ? 127  ALA A C   1 
ATOM   980  O O   . ALA A 1 127 ? 1.969   19.806 -10.812 1.00 19.94 ? 127  ALA A O   1 
ATOM   981  C CB  . ALA A 1 127 ? -0.453  20.534 -12.385 1.00 16.10 ? 127  ALA A CB  1 
ATOM   982  N N   . LEU A 1 128 ? 1.092   17.748 -11.075 1.00 14.18 ? 128  LEU A N   1 
ATOM   983  C CA  . LEU A 1 128 ? 2.346   17.041 -10.935 1.00 14.95 ? 128  LEU A CA  1 
ATOM   984  C C   . LEU A 1 128 ? 2.577   16.302 -12.237 1.00 19.12 ? 128  LEU A C   1 
ATOM   985  O O   . LEU A 1 128 ? 2.266   15.123 -12.386 1.00 19.49 ? 128  LEU A O   1 
ATOM   986  C CB  . LEU A 1 128 ? 2.291   16.096 -9.735  1.00 18.54 ? 128  LEU A CB  1 
ATOM   987  C CG  . LEU A 1 128 ? 2.037   16.833 -8.422  1.00 18.09 ? 128  LEU A CG  1 
ATOM   988  C CD1 . LEU A 1 128 ? 1.895   15.825 -7.278  1.00 19.27 ? 128  LEU A CD1 1 
ATOM   989  C CD2 . LEU A 1 128 ? 3.165   17.810 -8.132  1.00 22.99 ? 128  LEU A CD2 1 
ATOM   990  N N   . ASP A 1 129 ? 3.103   17.033 -13.200 1.00 16.28 ? 129  ASP A N   1 
ATOM   991  C CA  . ASP A 1 129 ? 3.300   16.502 -14.540 1.00 15.29 ? 129  ASP A CA  1 
ATOM   992  C C   . ASP A 1 129 ? 4.703   15.946 -14.633 1.00 19.74 ? 129  ASP A C   1 
ATOM   993  O O   . ASP A 1 129 ? 5.661   16.623 -14.270 1.00 17.85 ? 129  ASP A O   1 
ATOM   994  C CB  . ASP A 1 129 ? 3.047   17.596 -15.574 1.00 13.99 ? 129  ASP A CB  1 
ATOM   995  C CG  . ASP A 1 129 ? 1.621   18.119 -15.510 1.00 15.50 ? 129  ASP A CG  1 
ATOM   996  O OD1 . ASP A 1 129 ? 0.703   17.323 -15.199 1.00 16.71 ? 129  ASP A OD1 1 
ATOM   997  O OD2 . ASP A 1 129 ? 1.399   19.307 -15.793 1.00 16.71 ? 129  ASP A OD2 1 
ATOM   998  N N   . VAL A 1 130 ? 4.835   14.702 -15.076 1.00 13.89 ? 130  VAL A N   1 
ATOM   999  C CA  . VAL A 1 130 ? 6.088   13.994 -14.804 1.00 14.85 ? 130  VAL A CA  1 
ATOM   1000 C C   . VAL A 1 130 ? 6.742   13.424 -16.045 1.00 17.13 ? 130  VAL A C   1 
ATOM   1001 O O   . VAL A 1 130 ? 6.082   13.018 -17.012 1.00 16.06 ? 130  VAL A O   1 
ATOM   1002 C CB  . VAL A 1 130 ? 5.887   12.840 -13.777 1.00 17.60 ? 130  VAL A CB  1 
ATOM   1003 C CG1 . VAL A 1 130 ? 5.508   13.399 -12.412 1.00 18.30 ? 130  VAL A CG1 1 
ATOM   1004 C CG2 . VAL A 1 130 ? 4.828   11.860 -14.270 1.00 16.92 ? 130  VAL A CG2 1 
ATOM   1005 N N   . ARG A 1 131 ? 8.063   13.449 -16.014 1.00 16.10 ? 131  ARG A N   1 
ATOM   1006 C CA  . ARG A 1 131 ? 8.880   12.655 -16.904 1.00 15.93 ? 131  ARG A CA  1 
ATOM   1007 C C   . ARG A 1 131 ? 9.421   11.504 -16.091 1.00 19.20 ? 131  ARG A C   1 
ATOM   1008 O O   . ARG A 1 131 ? 10.179  11.702 -15.134 1.00 19.60 ? 131  ARG A O   1 
ATOM   1009 C CB  . ARG A 1 131 ? 10.006  13.487 -17.507 1.00 16.17 ? 131  ARG A CB  1 
ATOM   1010 C CG  . ARG A 1 131 ? 9.505   14.580 -18.422 1.00 19.18 ? 131  ARG A CG  1 
ATOM   1011 C CD  . ARG A 1 131 ? 10.614  15.266 -19.213 1.00 21.92 ? 131  ARG A CD  1 
ATOM   1012 N NE  . ARG A 1 131 ? 10.034  16.123 -20.246 1.00 21.57 ? 131  ARG A NE  1 
ATOM   1013 C CZ  . ARG A 1 131 ? 9.839   17.430 -20.118 1.00 23.75 ? 131  ARG A CZ  1 
ATOM   1014 N NH1 . ARG A 1 131 ? 10.208  18.056 -19.007 1.00 28.30 ? 131  ARG A NH1 1 
ATOM   1015 N NH2 . ARG A 1 131 ? 9.275   18.112 -21.109 1.00 24.16 ? 131  ARG A NH2 1 
ATOM   1016 N N   . ILE A 1 132 ? 9.027   10.296 -16.455 1.00 17.71 ? 132  ILE A N   1 
ATOM   1017 C CA  . ILE A 1 132 ? 9.436   9.121  -15.692 1.00 16.45 ? 132  ILE A CA  1 
ATOM   1018 C C   . ILE A 1 132 ? 10.716  8.538  -16.281 1.00 20.98 ? 132  ILE A C   1 
ATOM   1019 O O   . ILE A 1 132 ? 10.746  8.164  -17.456 1.00 20.11 ? 132  ILE A O   1 
ATOM   1020 C CB  . ILE A 1 132 ? 8.310   8.073  -15.676 1.00 19.43 ? 132  ILE A CB  1 
ATOM   1021 C CG1 . ILE A 1 132 ? 7.005   8.742  -15.224 1.00 23.75 ? 132  ILE A CG1 1 
ATOM   1022 C CG2 . ILE A 1 132 ? 8.697   6.893  -14.777 1.00 25.65 ? 132  ILE A CG2 1 
ATOM   1023 C CD1 . ILE A 1 132 ? 5.767   7.863  -15.368 1.00 27.35 ? 132  ILE A CD1 1 
ATOM   1024 N N   . ASP A 1 133 ? 11.778  8.469  -15.478 1.00 23.74 ? 133  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 133 ? 13.068  8.040  -16.018 1.00 26.67 ? 133  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 133 ? 13.208  6.515  -15.989 1.00 28.48 ? 133  ASP A C   1 
ATOM   1027 O O   . ASP A 1 133 ? 12.262  5.802  -15.621 1.00 28.63 ? 133  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 133 ? 14.244  8.747  -15.294 1.00 27.18 ? 133  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 133 ? 14.461  8.294  -13.849 1.00 29.53 ? 133  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 133 ? 13.911  7.268  -13.407 1.00 26.41 ? 133  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 133 ? 15.240  8.986  -13.148 1.00 29.18 ? 133  ASP A OD2 1 
ATOM   1032 N N   . GLU A 1 134 ? 14.375  6.025  -16.409 1.00 32.12 ? 134  GLU A N   1 
ATOM   1033 C CA  . GLU A 1 134 ? 14.615  4.590  -16.550 1.00 35.53 ? 134  GLU A CA  1 
ATOM   1034 C C   . GLU A 1 134 ? 14.512  3.864  -15.221 1.00 36.58 ? 134  GLU A C   1 
ATOM   1035 O O   . GLU A 1 134 ? 14.170  2.681  -15.171 1.00 38.68 ? 134  GLU A O   1 
ATOM   1036 C CB  . GLU A 1 134 ? 15.992  4.338  -17.165 1.00 46.90 ? 134  GLU A CB  1 
ATOM   1037 C CG  . GLU A 1 134 ? 16.542  5.512  -17.955 1.00 64.52 ? 134  GLU A CG  1 
ATOM   1038 C CD  . GLU A 1 134 ? 17.614  5.095  -18.948 1.00 84.29 ? 134  GLU A CD  1 
ATOM   1039 O OE1 . GLU A 1 134 ? 18.256  4.045  -18.729 1.00 90.82 ? 134  GLU A OE1 1 
ATOM   1040 O OE2 . GLU A 1 134 ? 17.809  5.817  -19.951 1.00 89.93 ? 134  GLU A OE2 1 
ATOM   1041 N N   . HIS A 1 135 ? 14.812  4.583  -14.146 1.00 31.38 ? 135  HIS A N   1 
ATOM   1042 C CA  . HIS A 1 135 ? 14.779  4.015  -12.805 1.00 32.76 ? 135  HIS A CA  1 
ATOM   1043 C C   . HIS A 1 135 ? 13.382  4.035  -12.211 1.00 32.53 ? 135  HIS A C   1 
ATOM   1044 O O   . HIS A 1 135 ? 13.138  3.430  -11.172 1.00 38.06 ? 135  HIS A O   1 
ATOM   1045 C CB  . HIS A 1 135 ? 15.737  4.775  -11.897 1.00 31.83 ? 135  HIS A CB  1 
ATOM   1046 C CG  . HIS A 1 135 ? 17.130  4.851  -12.434 1.00 40.23 ? 135  HIS A CG  1 
ATOM   1047 N ND1 . HIS A 1 135 ? 17.986  3.773  -12.428 1.00 43.23 ? 135  HIS A ND1 1 
ATOM   1048 C CD2 . HIS A 1 135 ? 17.806  5.869  -13.015 1.00 41.61 ? 135  HIS A CD2 1 
ATOM   1049 C CE1 . HIS A 1 135 ? 19.138  4.127  -12.971 1.00 49.46 ? 135  HIS A CE1 1 
ATOM   1050 N NE2 . HIS A 1 135 ? 19.055  5.393  -13.334 1.00 45.26 ? 135  HIS A NE2 1 
ATOM   1051 N N   . GLY A 1 136 ? 12.469  4.744  -12.867 1.00 27.87 ? 136  GLY A N   1 
ATOM   1052 C CA  . GLY A 1 136 ? 11.095  4.802  -12.414 1.00 25.69 ? 136  GLY A CA  1 
ATOM   1053 C C   . GLY A 1 136 ? 10.763  6.056  -11.630 1.00 26.90 ? 136  GLY A C   1 
ATOM   1054 O O   . GLY A 1 136 ? 9.633   6.223  -11.188 1.00 27.92 ? 136  GLY A O   1 
ATOM   1055 N N   . THR A 1 137 ? 11.743  6.939  -11.459 1.00 22.75 ? 137  THR A N   1 
ATOM   1056 C CA  . THR A 1 137 ? 11.498  8.186  -10.742 1.00 21.01 ? 137  THR A CA  1 
ATOM   1057 C C   . THR A 1 137 ? 10.548  9.059  -11.538 1.00 22.48 ? 137  THR A C   1 
ATOM   1058 O O   . THR A 1 137 ? 10.785  9.310  -12.715 1.00 20.21 ? 137  THR A O   1 
ATOM   1059 C CB  . THR A 1 137 ? 12.789  8.962  -10.478 1.00 21.93 ? 137  THR A CB  1 
ATOM   1060 O OG1 . THR A 1 137 ? 13.678  8.141  -9.717  1.00 25.04 ? 137  THR A OG1 1 
ATOM   1061 C CG2 . THR A 1 137 ? 12.484  10.247 -9.707  1.00 21.86 ? 137  THR A CG2 1 
ATOM   1062 N N   . LYS A 1 138 ? 9.481   9.514  -10.882 1.00 18.11 ? 138  LYS A N   1 
ATOM   1063 C CA  . LYS A 1 138 ? 8.482   10.369 -11.519 1.00 16.82 ? 138  LYS A CA  1 
ATOM   1064 C C   . LYS A 1 138 ? 8.874   11.828 -11.313 1.00 19.02 ? 138  LYS A C   1 
ATOM   1065 O O   . LYS A 1 138 ? 8.400   12.475 -10.383 1.00 19.83 ? 138  LYS A O   1 
ATOM   1066 C CB  . LYS A 1 138 ? 7.099   10.083 -10.932 1.00 20.82 ? 138  LYS A CB  1 
ATOM   1067 C CG  . LYS A 1 138 ? 6.676   8.607  -10.947 1.00 20.86 ? 138  LYS A CG  1 
ATOM   1068 C CD  . LYS A 1 138 ? 5.358   8.426  -10.188 1.00 22.26 ? 138  LYS A CD  1 
ATOM   1069 C CE  . LYS A 1 138 ? 4.973   6.966  -9.998  1.00 23.46 ? 138  LYS A CE  1 
ATOM   1070 N NZ  . LYS A 1 138 ? 5.868   6.281  -9.026  1.00 23.44 ? 138  LYS A NZ  1 
ATOM   1071 N N   . GLN A 1 139 ? 9.763   12.339 -12.156 1.00 17.94 ? 139  GLN A N   1 
ATOM   1072 C CA  . GLN A 1 139 ? 10.289  13.686 -11.957 1.00 18.22 ? 139  GLN A CA  1 
ATOM   1073 C C   . GLN A 1 139 ? 9.307   14.746 -12.414 1.00 19.72 ? 139  GLN A C   1 
ATOM   1074 O O   . GLN A 1 139 ? 8.866   14.751 -13.555 1.00 18.97 ? 139  GLN A O   1 
ATOM   1075 C CB  . GLN A 1 139 ? 11.613  13.882 -12.689 1.00 19.78 ? 139  GLN A CB  1 
ATOM   1076 C CG  . GLN A 1 139 ? 12.368  15.084 -12.159 1.00 35.35 ? 139  GLN A CG  1 
ATOM   1077 C CD  . GLN A 1 139 ? 13.528  15.504 -13.030 1.00 35.90 ? 139  GLN A CD  1 
ATOM   1078 O OE1 . GLN A 1 139 ? 14.171  16.520 -12.766 1.00 37.69 ? 139  GLN A OE1 1 
ATOM   1079 N NE2 . GLN A 1 139 ? 13.801  14.733 -14.079 1.00 31.76 ? 139  GLN A NE2 1 
ATOM   1080 N N   . VAL A 1 140 ? 8.970   15.649 -11.506 1.00 17.53 ? 140  VAL A N   1 
ATOM   1081 C CA  . VAL A 1 140 ? 8.031   16.721 -11.815 1.00 15.23 ? 140  VAL A CA  1 
ATOM   1082 C C   . VAL A 1 140 ? 8.664   17.806 -12.691 1.00 17.35 ? 140  VAL A C   1 
ATOM   1083 O O   . VAL A 1 140 ? 9.752   18.311 -12.400 1.00 18.42 ? 140  VAL A O   1 
ATOM   1084 C CB  . VAL A 1 140 ? 7.483   17.338 -10.517 1.00 17.57 ? 140  VAL A CB  1 
ATOM   1085 C CG1 . VAL A 1 140 ? 6.685   18.602 -10.802 1.00 19.03 ? 140  VAL A CG1 1 
ATOM   1086 C CG2 . VAL A 1 140 ? 6.624   16.307 -9.791  1.00 18.02 ? 140  VAL A CG2 1 
ATOM   1087 N N   . ALA A 1 141 ? 7.975   18.142 -13.782 1.00 14.12 ? 141  ALA A N   1 
ATOM   1088 C CA  . ALA A 1 141 ? 8.418   19.222 -14.659 1.00 16.15 ? 141  ALA A CA  1 
ATOM   1089 C C   . ALA A 1 141 ? 7.714   20.517 -14.287 1.00 17.72 ? 141  ALA A C   1 
ATOM   1090 O O   . ALA A 1 141 ? 6.592   20.497 -13.774 1.00 16.95 ? 141  ALA A O   1 
ATOM   1091 C CB  . ALA A 1 141 ? 8.157   18.870 -16.131 1.00 19.28 ? 141  ALA A CB  1 
ATOM   1092 N N   . VAL A 1 142 ? 8.385   21.640 -14.529 1.00 14.89 ? 142  VAL A N   1 
ATOM   1093 C CA  . VAL A 1 142 ? 7.833   22.957 -14.211 1.00 15.18 ? 142  VAL A CA  1 
ATOM   1094 C C   . VAL A 1 142 ? 8.162   23.937 -15.349 1.00 18.74 ? 142  VAL A C   1 
ATOM   1095 O O   . VAL A 1 142 ? 8.806   23.555 -16.329 1.00 17.18 ? 142  VAL A O   1 
ATOM   1096 C CB  . VAL A 1 142 ? 8.388   23.500 -12.857 1.00 17.57 ? 142  VAL A CB  1 
ATOM   1097 C CG1 . VAL A 1 142 ? 7.932   22.612 -11.686 1.00 22.64 ? 142  VAL A CG1 1 
ATOM   1098 C CG2 . VAL A 1 142 ? 9.915   23.624 -12.902 1.00 18.97 ? 142  VAL A CG2 1 
ATOM   1099 N N   . SER A 1 143 ? 7.730   25.188 -15.211 1.00 16.57 ? 143  SER A N   1 
ATOM   1100 C CA  . SER A 1 143 ? 7.956   26.218 -16.228 1.00 15.49 ? 143  SER A CA  1 
ATOM   1101 C C   . SER A 1 143 ? 7.481   25.774 -17.603 1.00 16.34 ? 143  SER A C   1 
ATOM   1102 O O   . SER A 1 143 ? 8.271   25.705 -18.553 1.00 17.68 ? 143  SER A O   1 
ATOM   1103 C CB  . SER A 1 143 ? 9.439   26.595 -16.306 1.00 17.00 ? 143  SER A CB  1 
ATOM   1104 O OG  . SER A 1 143 ? 9.902   27.101 -15.069 1.00 23.34 ? 143  SER A OG  1 
ATOM   1105 N N   . GLY A 1 144 ? 6.194   25.471 -17.713 1.00 14.75 ? 144  GLY A N   1 
ATOM   1106 C CA  . GLY A 1 144 ? 5.645   24.975 -18.964 1.00 15.44 ? 144  GLY A CA  1 
ATOM   1107 C C   . GLY A 1 144 ? 6.293   23.680 -19.431 1.00 14.91 ? 144  GLY A C   1 
ATOM   1108 O O   . GLY A 1 144 ? 6.394   23.439 -20.638 1.00 15.55 ? 144  GLY A O   1 
ATOM   1109 N N   . TRP A 1 145 ? 6.709   22.859 -18.463 1.00 14.58 ? 145  TRP A N   1 
ATOM   1110 C CA  . TRP A 1 145 ? 7.428   21.588 -18.666 1.00 17.39 ? 145  TRP A CA  1 
ATOM   1111 C C   . TRP A 1 145 ? 8.817   21.768 -19.271 1.00 19.31 ? 145  TRP A C   1 
ATOM   1112 O O   . TRP A 1 145 ? 9.453   20.787 -19.649 1.00 18.83 ? 145  TRP A O   1 
ATOM   1113 C CB  . TRP A 1 145 ? 6.642   20.612 -19.562 1.00 12.26 ? 145  TRP A CB  1 
ATOM   1114 C CG  . TRP A 1 145 ? 5.251   20.260 -19.071 1.00 11.56 ? 145  TRP A CG  1 
ATOM   1115 C CD1 . TRP A 1 145 ? 4.650   20.646 -17.904 1.00 13.82 ? 145  TRP A CD1 1 
ATOM   1116 C CD2 . TRP A 1 145 ? 4.293   19.457 -19.769 1.00 11.62 ? 145  TRP A CD2 1 
ATOM   1117 N NE1 . TRP A 1 145 ? 3.377   20.124 -17.832 1.00 14.59 ? 145  TRP A NE1 1 
ATOM   1118 C CE2 . TRP A 1 145 ? 3.135   19.388 -18.966 1.00 13.38 ? 145  TRP A CE2 1 
ATOM   1119 C CE3 . TRP A 1 145 ? 4.311   18.782 -20.993 1.00 12.59 ? 145  TRP A CE3 1 
ATOM   1120 C CZ2 . TRP A 1 145 ? 1.995   18.679 -19.361 1.00 13.69 ? 145  TRP A CZ2 1 
ATOM   1121 C CZ3 . TRP A 1 145 ? 3.186   18.084 -21.391 1.00 13.44 ? 145  TRP A CZ3 1 
ATOM   1122 C CH2 . TRP A 1 145 ? 2.043   18.031 -20.573 1.00 12.94 ? 145  TRP A CH2 1 
ATOM   1123 N N   . GLN A 1 146 ? 9.294   23.005 -19.360 1.00 16.59 ? 146  GLN A N   1 
ATOM   1124 C CA  . GLN A 1 146 ? 10.612  23.255 -19.952 1.00 16.77 ? 146  GLN A CA  1 
ATOM   1125 C C   . GLN A 1 146 ? 11.754  22.966 -18.992 1.00 21.45 ? 146  GLN A C   1 
ATOM   1126 O O   . GLN A 1 146 ? 12.913  22.876 -19.403 1.00 25.56 ? 146  GLN A O   1 
ATOM   1127 C CB  . GLN A 1 146 ? 10.731  24.703 -20.416 1.00 19.47 ? 146  GLN A CB  1 
ATOM   1128 C CG  . GLN A 1 146 ? 9.677   25.154 -21.394 1.00 19.35 ? 146  GLN A CG  1 
ATOM   1129 C CD  . GLN A 1 146 ? 9.758   26.652 -21.595 1.00 23.44 ? 146  GLN A CD  1 
ATOM   1130 O OE1 . GLN A 1 146 ? 10.268  27.127 -22.617 1.00 25.91 ? 146  GLN A OE1 1 
ATOM   1131 N NE2 . GLN A 1 146 ? 9.297   27.411 -20.595 1.00 25.77 ? 146  GLN A NE2 1 
ATOM   1132 N N   . GLU A 1 147 ? 11.426  22.872 -17.709 1.00 19.57 ? 147  GLU A N   1 
ATOM   1133 C CA  A GLU A 1 147 ? 12.408  22.596 -16.670 0.45 19.68 ? 147  GLU A CA  1 
ATOM   1134 C CA  B GLU A 1 147 ? 12.419  22.589 -16.683 0.55 19.24 ? 147  GLU A CA  1 
ATOM   1135 C C   . GLU A 1 147 ? 12.121  21.285 -15.957 1.00 21.25 ? 147  GLU A C   1 
ATOM   1136 O O   . GLU A 1 147 ? 10.984  21.023 -15.562 1.00 20.80 ? 147  GLU A O   1 
ATOM   1137 C CB  A GLU A 1 147 ? 12.423  23.721 -15.640 0.45 23.00 ? 147  GLU A CB  1 
ATOM   1138 C CB  B GLU A 1 147 ? 12.485  23.738 -15.673 0.55 23.11 ? 147  GLU A CB  1 
ATOM   1139 C CG  A GLU A 1 147 ? 13.068  25.008 -16.090 0.45 28.25 ? 147  GLU A CG  1 
ATOM   1140 C CG  B GLU A 1 147 ? 13.448  23.498 -14.511 0.55 28.58 ? 147  GLU A CG  1 
ATOM   1141 C CD  A GLU A 1 147 ? 13.064  26.042 -14.985 0.45 35.86 ? 147  GLU A CD  1 
ATOM   1142 C CD  B GLU A 1 147 ? 13.511  24.674 -13.556 0.55 37.34 ? 147  GLU A CD  1 
ATOM   1143 O OE1 A GLU A 1 147 ? 13.317  25.665 -13.820 0.45 42.26 ? 147  GLU A OE1 1 
ATOM   1144 O OE1 B GLU A 1 147 ? 13.053  25.772 -13.938 0.55 41.51 ? 147  GLU A OE1 1 
ATOM   1145 O OE2 A GLU A 1 147 ? 12.790  27.222 -15.274 0.45 35.24 ? 147  GLU A OE2 1 
ATOM   1146 O OE2 B GLU A 1 147 ? 14.020  24.501 -12.427 0.55 32.34 ? 147  GLU A OE2 1 
ATOM   1147 N N   . ASN A 1 148 ? 13.150  20.464 -15.779 1.00 23.49 ? 148  ASN A N   1 
ATOM   1148 C CA  . ASN A 1 148 ? 13.009  19.278 -14.954 1.00 18.66 ? 148  ASN A CA  1 
ATOM   1149 C C   . ASN A 1 148 ? 13.402  19.659 -13.532 1.00 19.46 ? 148  ASN A C   1 
ATOM   1150 O O   . ASN A 1 148 ? 14.511  20.141 -13.295 1.00 24.59 ? 148  ASN A O   1 
ATOM   1151 C CB  . ASN A 1 148 ? 13.869  18.134 -15.499 1.00 21.86 ? 148  ASN A CB  1 
ATOM   1152 C CG  . ASN A 1 148 ? 13.341  17.600 -16.814 1.00 27.53 ? 148  ASN A CG  1 
ATOM   1153 O OD1 . ASN A 1 148 ? 12.150  17.316 -16.945 1.00 28.20 ? 148  ASN A OD1 1 
ATOM   1154 N ND2 . ASN A 1 148 ? 14.216  17.498 -17.811 1.00 33.61 ? 148  ASN A ND2 1 
ATOM   1155 N N   . SER A 1 149 ? 12.485  19.483 -12.585 1.00 20.36 ? 149  SER A N   1 
ATOM   1156 C CA  . SER A 1 149 ? 12.660  20.093 -11.262 1.00 21.89 ? 149  SER A CA  1 
ATOM   1157 C C   . SER A 1 149 ? 13.604  19.365 -10.324 1.00 23.02 ? 149  SER A C   1 
ATOM   1158 O O   . SER A 1 149 ? 14.032  19.941 -9.326  1.00 25.44 ? 149  SER A O   1 
ATOM   1159 C CB  . SER A 1 149 ? 11.321  20.216 -10.551 1.00 19.46 ? 149  SER A CB  1 
ATOM   1160 O OG  . SER A 1 149 ? 10.903  18.964 -10.037 1.00 19.33 ? 149  SER A OG  1 
ATOM   1161 N N   . GLY A 1 150 ? 13.886  18.103 -10.606 1.00 23.44 ? 150  GLY A N   1 
ATOM   1162 C CA  . GLY A 1 150 ? 14.707  17.308 -9.703  1.00 25.34 ? 150  GLY A CA  1 
ATOM   1163 C C   . GLY A 1 150 ? 13.952  16.762 -8.497  1.00 25.81 ? 150  GLY A C   1 
ATOM   1164 O O   . GLY A 1 150 ? 14.554  16.141 -7.613  1.00 30.40 ? 150  GLY A O   1 
ATOM   1165 N N   . VAL A 1 151 ? 12.639  16.991 -8.455  1.00 23.00 ? 151  VAL A N   1 
ATOM   1166 C CA  . VAL A 1 151 ? 11.790  16.538 -7.355  1.00 21.59 ? 151  VAL A CA  1 
ATOM   1167 C C   . VAL A 1 151 ? 10.717  15.550 -7.840  1.00 22.53 ? 151  VAL A C   1 
ATOM   1168 O O   . VAL A 1 151 ? 10.138  15.739 -8.904  1.00 22.22 ? 151  VAL A O   1 
ATOM   1169 C CB  . VAL A 1 151 ? 11.109  17.739 -6.665  1.00 26.05 ? 151  VAL A CB  1 
ATOM   1170 C CG1 . VAL A 1 151 ? 10.150  17.282 -5.594  1.00 31.47 ? 151  VAL A CG1 1 
ATOM   1171 C CG2 . VAL A 1 151 ? 12.157  18.690 -6.093  1.00 30.56 ? 151  VAL A CG2 1 
ATOM   1172 N N   . SER A 1 152 ? 10.448  14.503 -7.063  1.00 22.11 ? 152  SER A N   1 
ATOM   1173 C CA  . SER A 1 152 ? 9.475   13.487 -7.482  1.00 20.21 ? 152  SER A CA  1 
ATOM   1174 C C   . SER A 1 152 ? 8.029   13.867 -7.176  1.00 17.89 ? 152  SER A C   1 
ATOM   1175 O O   . SER A 1 152 ? 7.766   14.713 -6.319  1.00 18.96 ? 152  SER A O   1 
ATOM   1176 C CB  . SER A 1 152 ? 9.788   12.152 -6.816  1.00 22.53 ? 152  SER A CB  1 
ATOM   1177 O OG  . SER A 1 152 ? 9.391   12.163 -5.453  1.00 22.25 ? 152  SER A OG  1 
ATOM   1178 N N   . LEU A 1 153 ? 7.107   13.237 -7.905  1.00 17.40 ? 153  LEU A N   1 
ATOM   1179 C CA  . LEU A 1 153 ? 5.670   13.388 -7.645  1.00 17.16 ? 153  LEU A CA  1 
ATOM   1180 C C   . LEU A 1 153 ? 5.368   13.156 -6.175  1.00 20.38 ? 153  LEU A C   1 
ATOM   1181 O O   . LEU A 1 153 ? 4.679   13.959 -5.543  1.00 18.32 ? 153  LEU A O   1 
ATOM   1182 C CB  . LEU A 1 153 ? 4.857   12.415 -8.517  1.00 19.63 ? 153  LEU A CB  1 
ATOM   1183 C CG  . LEU A 1 153 ? 3.343   12.360 -8.292  1.00 19.35 ? 153  LEU A CG  1 
ATOM   1184 C CD1 . LEU A 1 153 ? 2.642   12.051 -9.591  1.00 20.54 ? 153  LEU A CD1 1 
ATOM   1185 C CD2 . LEU A 1 153 ? 2.965   11.298 -7.271  1.00 22.91 ? 153  LEU A CD2 1 
ATOM   1186 N N   . GLU A 1 154 ? 5.911   12.062 -5.636  1.00 19.03 ? 154  GLU A N   1 
ATOM   1187 C CA  . GLU A 1 154 ? 5.614   11.655 -4.271  1.00 21.66 ? 154  GLU A CA  1 
ATOM   1188 C C   . GLU A 1 154 ? 6.145   12.655 -3.251  1.00 22.75 ? 154  GLU A C   1 
ATOM   1189 O O   . GLU A 1 154 ? 5.478   12.937 -2.244  1.00 21.08 ? 154  GLU A O   1 
ATOM   1190 C CB  . GLU A 1 154 ? 6.186   10.264 -3.991  1.00 23.03 ? 154  GLU A CB  1 
ATOM   1191 C CG  . GLU A 1 154 ? 5.534   9.131  -4.793  1.00 23.46 ? 154  GLU A CG  1 
ATOM   1192 C CD  . GLU A 1 154 ? 6.179   8.883  -6.153  1.00 26.00 ? 154  GLU A CD  1 
ATOM   1193 O OE1 . GLU A 1 154 ? 6.953   9.737  -6.654  1.00 21.53 ? 154  GLU A OE1 1 
ATOM   1194 O OE2 . GLU A 1 154 ? 5.921   7.804  -6.721  1.00 29.26 ? 154  GLU A OE2 1 
ATOM   1195 N N   . GLN A 1 155 ? 7.326   13.213 -3.504  1.00 20.16 ? 155  GLN A N   1 
ATOM   1196 C CA  . GLN A 1 155 ? 7.836   14.222 -2.576  1.00 20.27 ? 155  GLN A CA  1 
ATOM   1197 C C   . GLN A 1 155 ? 6.875   15.417 -2.501  1.00 19.46 ? 155  GLN A C   1 
ATOM   1198 O O   . GLN A 1 155 ? 6.601   15.932 -1.416  1.00 21.91 ? 155  GLN A O   1 
ATOM   1199 C CB  . GLN A 1 155 ? 9.235   14.707 -2.969  1.00 20.69 ? 155  GLN A CB  1 
ATOM   1200 C CG  . GLN A 1 155 ? 9.764   15.763 -1.988  1.00 22.44 ? 155  GLN A CG  1 
ATOM   1201 C CD  . GLN A 1 155 ? 11.098  16.356 -2.392  1.00 25.29 ? 155  GLN A CD  1 
ATOM   1202 O OE1 . GLN A 1 155 ? 11.939  15.678 -2.979  1.00 24.88 ? 155  GLN A OE1 1 
ATOM   1203 N NE2 . GLN A 1 155 ? 11.287  17.643 -2.095  1.00 31.58 ? 155  GLN A NE2 1 
ATOM   1204 N N   . LEU A 1 156 ? 6.342   15.843 -3.644  1.00 18.46 ? 156  LEU A N   1 
ATOM   1205 C CA  . LEU A 1 156 ? 5.465   17.010 -3.644  1.00 17.81 ? 156  LEU A CA  1 
ATOM   1206 C C   . LEU A 1 156 ? 4.090   16.693 -3.056  1.00 19.08 ? 156  LEU A C   1 
ATOM   1207 O O   . LEU A 1 156 ? 3.519   17.516 -2.349  1.00 20.44 ? 156  LEU A O   1 
ATOM   1208 C CB  . LEU A 1 156 ? 5.342   17.584 -5.062  1.00 19.33 ? 156  LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 156 ? 6.519   18.507 -5.378  1.00 22.88 ? 156  LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 156 ? 6.502   18.973 -6.840  1.00 20.03 ? 156  LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 156 ? 6.506   19.717 -4.445  1.00 32.03 ? 156  LEU A CD2 1 
ATOM   1212 N N   . VAL A 1 157 ? 3.565   15.501 -3.322  1.00 18.01 ? 157  VAL A N   1 
ATOM   1213 C CA  . VAL A 1 157 ? 2.349   15.069 -2.638  1.00 18.64 ? 157  VAL A CA  1 
ATOM   1214 C C   . VAL A 1 157 ? 2.542   15.116 -1.119  1.00 19.78 ? 157  VAL A C   1 
ATOM   1215 O O   . VAL A 1 157 ? 1.718   15.679 -0.397  1.00 20.81 ? 157  VAL A O   1 
ATOM   1216 C CB  . VAL A 1 157 ? 1.923   13.642 -3.057  1.00 19.00 ? 157  VAL A CB  1 
ATOM   1217 C CG1 . VAL A 1 157 ? 0.782   13.139 -2.177  1.00 20.13 ? 157  VAL A CG1 1 
ATOM   1218 C CG2 . VAL A 1 157 ? 1.505   13.616 -4.529  1.00 19.59 ? 157  VAL A CG2 1 
ATOM   1219 N N   . GLU A 1 158 ? 3.642   14.556 -0.629  1.00 20.42 ? 158  GLU A N   1 
ATOM   1220 C CA  . GLU A 1 158 ? 3.857   14.533 0.819   1.00 21.60 ? 158  GLU A CA  1 
ATOM   1221 C C   . GLU A 1 158 ? 4.093   15.939 1.372   1.00 24.23 ? 158  GLU A C   1 
ATOM   1222 O O   . GLU A 1 158 ? 3.873   16.196 2.556   1.00 23.03 ? 158  GLU A O   1 
ATOM   1223 C CB  . GLU A 1 158 ? 5.035   13.613 1.179   1.00 22.42 ? 158  GLU A CB  1 
ATOM   1224 C CG  . GLU A 1 158 ? 4.848   12.147 0.786   1.00 22.80 ? 158  GLU A CG  1 
ATOM   1225 C CD  . GLU A 1 158 ? 3.756   11.421 1.572   1.00 28.34 ? 158  GLU A CD  1 
ATOM   1226 O OE1 . GLU A 1 158 ? 3.200   11.987 2.549   1.00 25.07 ? 158  GLU A OE1 1 
ATOM   1227 O OE2 . GLU A 1 158 ? 3.467   10.257 1.221   1.00 25.23 ? 158  GLU A OE2 1 
ATOM   1228 N N   . THR A 1 159 ? 4.529   16.851 0.513   1.00 20.88 ? 159  THR A N   1 
ATOM   1229 C CA  . THR A 1 159 ? 4.753   18.226 0.931   1.00 21.25 ? 159  THR A CA  1 
ATOM   1230 C C   . THR A 1 159 ? 3.444   18.900 1.321   1.00 21.49 ? 159  THR A C   1 
ATOM   1231 O O   . THR A 1 159 ? 3.394   19.667 2.290   1.00 23.42 ? 159  THR A O   1 
ATOM   1232 C CB  . THR A 1 159 ? 5.447   19.029 -0.185  1.00 22.87 ? 159  THR A CB  1 
ATOM   1233 O OG1 . THR A 1 159 ? 6.744   18.472 -0.419  1.00 21.89 ? 159  THR A OG1 1 
ATOM   1234 C CG2 . THR A 1 159 ? 5.582   20.500 0.184   1.00 23.24 ? 159  THR A CG2 1 
ATOM   1235 N N   . TYR A 1 160 ? 2.376   18.610 0.575   1.00 21.30 ? 160  TYR A N   1 
ATOM   1236 C CA  . TYR A 1 160 ? 1.117   19.334 0.753   1.00 21.15 ? 160  TYR A CA  1 
ATOM   1237 C C   . TYR A 1 160 ? 0.000   18.546 1.429   1.00 24.05 ? 160  TYR A C   1 
ATOM   1238 O O   . TYR A 1 160 ? -1.024  19.123 1.790   1.00 23.90 ? 160  TYR A O   1 
ATOM   1239 C CB  . TYR A 1 160 ? 0.618   19.847 -0.605  1.00 20.74 ? 160  TYR A CB  1 
ATOM   1240 C CG  . TYR A 1 160 ? 1.530   20.908 -1.149  1.00 20.13 ? 160  TYR A CG  1 
ATOM   1241 C CD1 . TYR A 1 160 ? 1.513   22.189 -0.614  1.00 20.63 ? 160  TYR A CD1 1 
ATOM   1242 C CD2 . TYR A 1 160 ? 2.449   20.623 -2.157  1.00 19.48 ? 160  TYR A CD2 1 
ATOM   1243 C CE1 . TYR A 1 160 ? 2.364   23.173 -1.094  1.00 24.76 ? 160  TYR A CE1 1 
ATOM   1244 C CE2 . TYR A 1 160 ? 3.298   21.603 -2.645  1.00 20.27 ? 160  TYR A CE2 1 
ATOM   1245 C CZ  . TYR A 1 160 ? 3.255   22.874 -2.100  1.00 23.38 ? 160  TYR A CZ  1 
ATOM   1246 O OH  . TYR A 1 160 ? 4.093   23.859 -2.584  1.00 26.42 ? 160  TYR A OH  1 
ATOM   1247 N N   . LEU A 1 161 ? 0.174   17.242 1.608   1.00 23.34 ? 161  LEU A N   1 
ATOM   1248 C CA  . LEU A 1 161 ? -0.828  16.474 2.353   1.00 23.42 ? 161  LEU A CA  1 
ATOM   1249 C C   . LEU A 1 161 ? -1.138  17.058 3.754   1.00 25.11 ? 161  LEU A C   1 
ATOM   1250 O O   . LEU A 1 161 ? -2.299  17.087 4.140   1.00 26.00 ? 161  LEU A O   1 
ATOM   1251 C CB  . LEU A 1 161 ? -0.405  15.008 2.493   1.00 24.84 ? 161  LEU A CB  1 
ATOM   1252 C CG  . LEU A 1 161 ? -0.810  14.058 1.357   1.00 26.82 ? 161  LEU A CG  1 
ATOM   1253 C CD1 . LEU A 1 161 ? -0.303  12.644 1.597   1.00 28.80 ? 161  LEU A CD1 1 
ATOM   1254 C CD2 . LEU A 1 161 ? -2.315  14.052 1.159   1.00 23.92 ? 161  LEU A CD2 1 
ATOM   1255 N N   . PRO A 1 162 ? -0.121  17.546 4.502   1.00 25.29 ? 162  PRO A N   1 
ATOM   1256 C CA  . PRO A 1 162 ? -0.481  18.079 5.830   1.00 26.95 ? 162  PRO A CA  1 
ATOM   1257 C C   . PRO A 1 162 ? -1.296  19.380 5.816   1.00 27.69 ? 162  PRO A C   1 
ATOM   1258 O O   . PRO A 1 162 ? -1.873  19.724 6.859   1.00 30.02 ? 162  PRO A O   1 
ATOM   1259 C CB  . PRO A 1 162 ? 0.882   18.321 6.496   1.00 30.45 ? 162  PRO A CB  1 
ATOM   1260 C CG  . PRO A 1 162 ? 1.818   17.413 5.791   1.00 26.21 ? 162  PRO A CG  1 
ATOM   1261 C CD  . PRO A 1 162 ? 1.338   17.431 4.352   1.00 27.51 ? 162  PRO A CD  1 
ATOM   1262 N N   . VAL A 1 163 ? -1.353  20.096 4.693   1.00 27.17 ? 163  VAL A N   1 
ATOM   1263 C CA  . VAL A 1 163 ? -2.195  21.289 4.633   1.00 26.99 ? 163  VAL A CA  1 
ATOM   1264 C C   . VAL A 1 163 ? -3.488  20.998 3.874   1.00 30.80 ? 163  VAL A C   1 
ATOM   1265 O O   . VAL A 1 163 ? -4.219  21.912 3.491   1.00 30.57 ? 163  VAL A O   1 
ATOM   1266 C CB  . VAL A 1 163 ? -1.461  22.502 3.996   1.00 26.35 ? 163  VAL A CB  1 
ATOM   1267 C CG1 . VAL A 1 163 ? -0.233  22.874 4.831   1.00 28.17 ? 163  VAL A CG1 1 
ATOM   1268 C CG2 . VAL A 1 163 ? -1.073  22.231 2.545   1.00 25.32 ? 163  VAL A CG2 1 
ATOM   1269 N N   . GLY A 1 164 ? -3.756  19.715 3.657   1.00 26.50 ? 164  GLY A N   1 
ATOM   1270 C CA  . GLY A 1 164 ? -5.045  19.274 3.163   1.00 26.94 ? 164  GLY A CA  1 
ATOM   1271 C C   . GLY A 1 164 ? -5.176  19.024 1.670   1.00 25.54 ? 164  GLY A C   1 
ATOM   1272 O O   . GLY A 1 164 ? -6.296  18.994 1.163   1.00 27.26 ? 164  GLY A O   1 
ATOM   1273 N N   . LEU A 1 165 ? -4.052  18.845 0.976   1.00 23.94 ? 165  LEU A N   1 
ATOM   1274 C CA  . LEU A 1 165 ? -4.061  18.553 -0.460  1.00 24.06 ? 165  LEU A CA  1 
ATOM   1275 C C   . LEU A 1 165 ? -5.128  17.514 -0.819  1.00 23.04 ? 165  LEU A C   1 
ATOM   1276 O O   . LEU A 1 165 ? -5.221  16.474 -0.178  1.00 25.72 ? 165  LEU A O   1 
ATOM   1277 C CB  . LEU A 1 165 ? -2.679  18.064 -0.905  1.00 21.08 ? 165  LEU A CB  1 
ATOM   1278 C CG  . LEU A 1 165 ? -2.579  17.583 -2.358  1.00 19.82 ? 165  LEU A CG  1 
ATOM   1279 C CD1 . LEU A 1 165 ? -2.766  18.743 -3.330  1.00 19.19 ? 165  LEU A CD1 1 
ATOM   1280 C CD2 . LEU A 1 165 ? -1.256  16.864 -2.588  1.00 20.21 ? 165  LEU A CD2 1 
ATOM   1281 N N   . LYS A 1 166 ? -5.945  17.809 -1.829  1.00 22.91 ? 166  LYS A N   1 
ATOM   1282 C CA  . LYS A 1 166 ? -7.045  16.922 -2.182  1.00 23.83 ? 166  LYS A CA  1 
ATOM   1283 C C   . LYS A 1 166 ? -7.139  16.621 -3.688  1.00 24.74 ? 166  LYS A C   1 
ATOM   1284 O O   . LYS A 1 166 ? -7.577  15.539 -4.083  1.00 29.47 ? 166  LYS A O   1 
ATOM   1285 C CB  . LYS A 1 166 ? -8.372  17.520 -1.683  1.00 33.95 ? 166  LYS A CB  1 
ATOM   1286 C CG  . LYS A 1 166 ? -9.603  16.886 -2.290  1.00 39.58 ? 166  LYS A CG  1 
ATOM   1287 C CD  . LYS A 1 166 ? -10.868 17.244 -1.538  1.00 52.37 ? 166  LYS A CD  1 
ATOM   1288 C CE  . LYS A 1 166 ? -12.031 16.467 -2.125  1.00 54.09 ? 166  LYS A CE  1 
ATOM   1289 N NZ  . LYS A 1 166 ? -13.332 17.166 -1.957  1.00 64.23 ? 166  LYS A NZ  1 
ATOM   1290 N N   . HIS A 1 167 ? -6.731  17.577 -4.519  1.00 22.73 ? 167  HIS A N   1 
ATOM   1291 C CA  . HIS A 1 167 ? -6.844  17.442 -5.972  1.00 21.79 ? 167  HIS A CA  1 
ATOM   1292 C C   . HIS A 1 167 ? -5.477  17.466 -6.601  1.00 19.74 ? 167  HIS A C   1 
ATOM   1293 O O   . HIS A 1 167 ? -4.725  18.408 -6.380  1.00 20.44 ? 167  HIS A O   1 
ATOM   1294 C CB  . HIS A 1 167 ? -7.679  18.568 -6.581  1.00 20.13 ? 167  HIS A CB  1 
ATOM   1295 C CG  . HIS A 1 167 ? -9.090  18.603 -6.095  1.00 23.07 ? 167  HIS A CG  1 
ATOM   1296 N ND1 . HIS A 1 167 ? -10.032 17.682 -6.495  1.00 22.00 ? 167  HIS A ND1 1 
ATOM   1297 C CD2 . HIS A 1 167 ? -9.717  19.439 -5.234  1.00 23.88 ? 167  HIS A CD2 1 
ATOM   1298 C CE1 . HIS A 1 167 ? -11.182 17.949 -5.900  1.00 23.76 ? 167  HIS A CE1 1 
ATOM   1299 N NE2 . HIS A 1 167 ? -11.019 19.013 -5.133  1.00 28.35 ? 167  HIS A NE2 1 
ATOM   1300 N N   . VAL A 1 168 ? -5.172  16.436 -7.384  1.00 17.47 ? 168  VAL A N   1 
ATOM   1301 C CA  . VAL A 1 168 ? -3.914  16.368 -8.137  1.00 16.33 ? 168  VAL A CA  1 
ATOM   1302 C C   . VAL A 1 168 ? -4.186  16.012 -9.584  1.00 17.82 ? 168  VAL A C   1 
ATOM   1303 O O   . VAL A 1 168 ? -4.925  15.083 -9.868  1.00 18.10 ? 168  VAL A O   1 
ATOM   1304 C CB  . VAL A 1 168 ? -2.948  15.331 -7.536  1.00 16.40 ? 168  VAL A CB  1 
ATOM   1305 C CG1 . VAL A 1 168 ? -1.748  15.101 -8.468  1.00 19.19 ? 168  VAL A CG1 1 
ATOM   1306 C CG2 . VAL A 1 168 ? -2.478  15.783 -6.144  1.00 21.66 ? 168  VAL A CG2 1 
ATOM   1307 N N   . LEU A 1 169 ? -3.583  16.768 -10.501 1.00 14.70 ? 169  LEU A N   1 
ATOM   1308 C CA  . LEU A 1 169 ? -3.624  16.456 -11.911 1.00 16.02 ? 169  LEU A CA  1 
ATOM   1309 C C   . LEU A 1 169 ? -2.244  15.882 -12.226 1.00 18.49 ? 169  LEU A C   1 
ATOM   1310 O O   . LEU A 1 169 ? -1.239  16.515 -11.935 1.00 17.75 ? 169  LEU A O   1 
ATOM   1311 C CB  . LEU A 1 169 ? -3.922  17.721 -12.717 1.00 18.48 ? 169  LEU A CB  1 
ATOM   1312 C CG  . LEU A 1 169 ? -4.111  17.713 -14.229 1.00 19.75 ? 169  LEU A CG  1 
ATOM   1313 C CD1 . LEU A 1 169 ? -4.654  19.069 -14.624 1.00 20.43 ? 169  LEU A CD1 1 
ATOM   1314 C CD2 . LEU A 1 169 ? -2.802  17.480 -14.952 1.00 16.53 ? 169  LEU A CD2 1 
ATOM   1315 N N   . CYS A 1 170 ? -2.198  14.685 -12.792 1.00 13.60 ? 170  CYS A N   1 
ATOM   1316 C CA  . CYS A 1 170 ? -0.923  14.048 -13.095 1.00 15.25 ? 170  CYS A CA  1 
ATOM   1317 C C   . CYS A 1 170 ? -0.844  13.655 -14.561 1.00 19.84 ? 170  CYS A C   1 
ATOM   1318 O O   . CYS A 1 170 ? -1.554  12.738 -14.997 1.00 15.77 ? 170  CYS A O   1 
ATOM   1319 C CB  . CYS A 1 170 ? -0.742  12.824 -12.201 1.00 20.19 ? 170  CYS A CB  1 
ATOM   1320 S SG  . CYS A 1 170 ? 0.720   11.863 -12.589 1.00 23.46 ? 170  CYS A SG  1 
ATOM   1321 N N   . THR A 1 171 ? -0.012  14.376 -15.319 1.00 14.75 ? 171  THR A N   1 
ATOM   1322 C CA  . THR A 1 171 ? 0.216   14.066 -16.723 1.00 13.80 ? 171  THR A CA  1 
ATOM   1323 C C   . THR A 1 171 ? 1.466   13.234 -16.851 1.00 15.40 ? 171  THR A C   1 
ATOM   1324 O O   . THR A 1 171 ? 2.493   13.589 -16.286 1.00 14.97 ? 171  THR A O   1 
ATOM   1325 C CB  . THR A 1 171 ? 0.403   15.327 -17.573 1.00 15.03 ? 171  THR A CB  1 
ATOM   1326 O OG1 . THR A 1 171 ? -0.673  16.234 -17.314 1.00 13.53 ? 171  THR A OG1 1 
ATOM   1327 C CG2 . THR A 1 171 ? 0.457   14.987 -19.062 1.00 15.74 ? 171  THR A CG2 1 
ATOM   1328 N N   . ASP A 1 172 ? 1.395   12.149 -17.605 1.00 12.13 ? 172  ASP A N   1 
ATOM   1329 C CA  . ASP A 1 172 ? 2.619   11.522 -18.094 1.00 13.26 ? 172  ASP A CA  1 
ATOM   1330 C C   . ASP A 1 172 ? 2.990   12.267 -19.358 1.00 12.97 ? 172  ASP A C   1 
ATOM   1331 O O   . ASP A 1 172 ? 2.360   12.106 -20.415 1.00 14.12 ? 172  ASP A O   1 
ATOM   1332 C CB  . ASP A 1 172 ? 2.435   10.028 -18.355 1.00 15.39 ? 172  ASP A CB  1 
ATOM   1333 C CG  . ASP A 1 172 ? 3.722   9.345  -18.823 1.00 21.67 ? 172  ASP A CG  1 
ATOM   1334 O OD1 . ASP A 1 172 ? 4.665   10.038 -19.261 1.00 19.48 ? 172  ASP A OD1 1 
ATOM   1335 O OD2 . ASP A 1 172 ? 3.776   8.100  -18.763 1.00 20.97 ? 172  ASP A OD2 1 
ATOM   1336 N N   . ILE A 1 173 ? 4.023   13.091 -19.236 1.00 12.44 ? 173  ILE A N   1 
ATOM   1337 C CA  . ILE A 1 173 ? 4.408   14.002 -20.305 1.00 12.05 ? 173  ILE A CA  1 
ATOM   1338 C C   . ILE A 1 173 ? 4.760   13.259 -21.600 1.00 13.00 ? 173  ILE A C   1 
ATOM   1339 O O   . ILE A 1 173 ? 4.529   13.755 -22.711 1.00 13.60 ? 173  ILE A O   1 
ATOM   1340 C CB  . ILE A 1 173 ? 5.573   14.888 -19.805 1.00 13.09 ? 173  ILE A CB  1 
ATOM   1341 C CG1 . ILE A 1 173 ? 5.017   15.859 -18.764 1.00 12.25 ? 173  ILE A CG1 1 
ATOM   1342 C CG2 . ILE A 1 173 ? 6.230   15.636 -20.949 1.00 14.31 ? 173  ILE A CG2 1 
ATOM   1343 C CD1 . ILE A 1 173 ? 6.080   16.699 -18.035 1.00 13.12 ? 173  ILE A CD1 1 
ATOM   1344 N N   . SER A 1 174 ? 5.283   12.039 -21.470 1.00 13.47 ? 174  SER A N   1 
ATOM   1345 C CA  . SER A 1 174 ? 5.621   11.255 -22.657 1.00 14.05 ? 174  SER A CA  1 
ATOM   1346 C C   . SER A 1 174 ? 4.396   10.854 -23.467 1.00 14.72 ? 174  SER A C   1 
ATOM   1347 O O   . SER A 1 174 ? 4.513   10.532 -24.656 1.00 15.93 ? 174  SER A O   1 
ATOM   1348 C CB  . SER A 1 174 ? 6.406   9.999  -22.271 1.00 19.45 ? 174  SER A CB  1 
ATOM   1349 O OG  . SER A 1 174 ? 5.561   9.007  -21.721 1.00 18.92 ? 174  SER A OG  1 
ATOM   1350 N N   . ARG A 1 175 ? 3.228   10.867 -22.823 1.00 14.76 ? 175  ARG A N   1 
ATOM   1351 C CA  . ARG A 1 175 ? 1.984   10.490 -23.500 1.00 14.39 ? 175  ARG A CA  1 
ATOM   1352 C C   . ARG A 1 175 ? 1.203   11.702 -23.992 1.00 14.48 ? 175  ARG A C   1 
ATOM   1353 O O   . ARG A 1 175 ? 0.349   11.581 -24.880 1.00 14.08 ? 175  ARG A O   1 
ATOM   1354 C CB  . ARG A 1 175 ? 1.070   9.680  -22.567 1.00 12.76 ? 175  ARG A CB  1 
ATOM   1355 C CG  . ARG A 1 175 ? 1.731   8.505  -21.840 1.00 18.60 ? 175  ARG A CG  1 
ATOM   1356 C CD  . ARG A 1 175 ? 2.266   7.487  -22.793 1.00 23.10 ? 175  ARG A CD  1 
ATOM   1357 N NE  . ARG A 1 175 ? 2.807   6.337  -22.067 1.00 27.79 ? 175  ARG A NE  1 
ATOM   1358 C CZ  . ARG A 1 175 ? 2.107   5.244  -21.791 1.00 29.95 ? 175  ARG A CZ  1 
ATOM   1359 N NH1 . ARG A 1 175 ? 0.842   5.158  -22.173 1.00 26.61 ? 175  ARG A NH1 1 
ATOM   1360 N NH2 . ARG A 1 175 ? 2.672   4.235  -21.135 1.00 29.36 ? 175  ARG A NH2 1 
ATOM   1361 N N   . ALA A 1 176 ? 1.455   12.856 -23.386 1.00 13.60 ? 176  ALA A N   1 
ATOM   1362 C CA  . ALA A 1 176 ? 0.674   14.062 -23.682 1.00 12.52 ? 176  ALA A CA  1 
ATOM   1363 C C   . ALA A 1 176 ? 0.663   14.391 -25.169 1.00 13.71 ? 176  ALA A C   1 
ATOM   1364 O O   . ALA A 1 176 ? 1.709   14.522 -25.804 1.00 13.47 ? 176  ALA A O   1 
ATOM   1365 C CB  . ALA A 1 176 ? 1.224   15.254 -22.876 1.00 12.41 ? 176  ALA A CB  1 
ATOM   1366 N N   . GLY A 1 177 ? -0.534  14.509 -25.732 1.00 12.99 ? 177  GLY A N   1 
ATOM   1367 C CA  . GLY A 1 177 ? -0.670  14.939 -27.119 1.00 14.58 ? 177  GLY A CA  1 
ATOM   1368 C C   . GLY A 1 177 ? -0.278  13.906 -28.161 1.00 15.48 ? 177  GLY A C   1 
ATOM   1369 O O   . GLY A 1 177 ? -0.131  14.251 -29.334 1.00 19.56 ? 177  GLY A O   1 
ATOM   1370 N N   . THR A 1 178 ? -0.144  12.637 -27.778 1.00 13.72 ? 178  THR A N   1 
ATOM   1371 C CA  . THR A 1 178 ? 0.376   11.628 -28.713 1.00 12.79 ? 178  THR A CA  1 
ATOM   1372 C C   . THR A 1 178 ? -0.630  10.598 -29.222 1.00 15.12 ? 178  THR A C   1 
ATOM   1373 O O   . THR A 1 178 ? -0.333  9.860  -30.183 1.00 18.48 ? 178  THR A O   1 
ATOM   1374 C CB  . THR A 1 178 ? 1.512   10.808 -28.085 1.00 16.20 ? 178  THR A CB  1 
ATOM   1375 O OG1 . THR A 1 178 ? 0.976   10.008 -27.022 1.00 18.54 ? 178  THR A OG1 1 
ATOM   1376 C CG2 . THR A 1 178 ? 2.619   11.708 -27.582 1.00 18.35 ? 178  THR A CG2 1 
ATOM   1377 N N   . LEU A 1 179 ? -1.786  10.511 -28.551 1.00 15.62 ? 179  LEU A N   1 
ATOM   1378 C CA  . LEU A 1 179 ? -2.829  9.503  -28.799 1.00 16.12 ? 179  LEU A CA  1 
ATOM   1379 C C   . LEU A 1 179 ? -2.370  8.073  -28.494 1.00 17.27 ? 179  LEU A C   1 
ATOM   1380 O O   . LEU A 1 179 ? -3.028  7.122  -28.909 1.00 22.63 ? 179  LEU A O   1 
ATOM   1381 C CB  . LEU A 1 179 ? -3.333  9.556  -30.258 1.00 17.41 ? 179  LEU A CB  1 
ATOM   1382 C CG  . LEU A 1 179 ? -3.856  10.900 -30.763 1.00 18.75 ? 179  LEU A CG  1 
ATOM   1383 C CD1 . LEU A 1 179 ? -4.115  10.805 -32.258 1.00 22.33 ? 179  LEU A CD1 1 
ATOM   1384 C CD2 . LEU A 1 179 ? -5.131  11.308 -30.032 1.00 17.98 ? 179  LEU A CD2 1 
ATOM   1385 N N   . ALA A 1 180 ? -1.263  7.930  -27.767 1.00 17.56 ? 180  ALA A N   1 
ATOM   1386 C CA  . ALA A 1 180 ? -0.652  6.610  -27.546 1.00 19.13 ? 180  ALA A CA  1 
ATOM   1387 C C   . ALA A 1 180 ? -1.317  5.804  -26.435 1.00 21.97 ? 180  ALA A C   1 
ATOM   1388 O O   . ALA A 1 180 ? -0.966  4.635  -26.214 1.00 26.03 ? 180  ALA A O   1 
ATOM   1389 C CB  . ALA A 1 180 ? 0.824   6.776  -27.242 1.00 21.55 ? 180  ALA A CB  1 
ATOM   1390 N N   . GLY A 1 181 ? -2.264  6.426  -25.734 1.00 18.26 ? 181  GLY A N   1 
ATOM   1391 C CA  . GLY A 1 181 ? -2.877  5.837  -24.550 1.00 18.42 ? 181  GLY A CA  1 
ATOM   1392 C C   . GLY A 1 181 ? -2.360  6.498  -23.274 1.00 21.48 ? 181  GLY A C   1 
ATOM   1393 O O   . GLY A 1 181 ? -1.238  6.997  -23.236 1.00 18.23 ? 181  GLY A O   1 
ATOM   1394 N N   . SER A 1 182 ? -3.175  6.529  -22.222 1.00 20.82 ? 182  SER A N   1 
ATOM   1395 C CA  . SER A 1 182 ? -2.707  7.081  -20.948 1.00 19.22 ? 182  SER A CA  1 
ATOM   1396 C C   . SER A 1 182 ? -1.900  6.026  -20.173 1.00 19.70 ? 182  SER A C   1 
ATOM   1397 O O   . SER A 1 182 ? -1.993  4.835  -20.463 1.00 23.15 ? 182  SER A O   1 
ATOM   1398 C CB  . SER A 1 182 ? -3.895  7.595  -20.119 1.00 21.18 ? 182  SER A CB  1 
ATOM   1399 O OG  . SER A 1 182 ? -4.428  8.805  -20.664 1.00 20.41 ? 182  SER A OG  1 
ATOM   1400 N N   . ASN A 1 183 ? -1.095  6.467  -19.209 1.00 17.54 ? 183  ASN A N   1 
ATOM   1401 C CA  . ASN A 1 183 ? -0.243  5.542  -18.461 1.00 16.95 ? 183  ASN A CA  1 
ATOM   1402 C C   . ASN A 1 183 ? -1.016  4.868  -17.327 1.00 20.19 ? 183  ASN A C   1 
ATOM   1403 O O   . ASN A 1 183 ? -0.989  5.313  -16.178 1.00 23.40 ? 183  ASN A O   1 
ATOM   1404 C CB  . ASN A 1 183 ? 0.983   6.270  -17.924 1.00 19.24 ? 183  ASN A CB  1 
ATOM   1405 C CG  . ASN A 1 183 ? 2.038   5.317  -17.372 1.00 19.91 ? 183  ASN A CG  1 
ATOM   1406 O OD1 . ASN A 1 183 ? 1.744   4.169  -17.038 1.00 22.51 ? 183  ASN A OD1 1 
ATOM   1407 N ND2 . ASN A 1 183 ? 3.268   5.804  -17.258 1.00 22.79 ? 183  ASN A ND2 1 
ATOM   1408 N N   . VAL A 1 184 ? -1.699  3.784  -17.666 1.00 19.67 ? 184  VAL A N   1 
ATOM   1409 C CA  . VAL A 1 184 ? -2.577  3.100  -16.722 1.00 19.96 ? 184  VAL A CA  1 
ATOM   1410 C C   . VAL A 1 184 ? -1.845  2.691  -15.443 1.00 24.61 ? 184  VAL A C   1 
ATOM   1411 O O   . VAL A 1 184 ? -2.346  2.920  -14.345 1.00 25.84 ? 184  VAL A O   1 
ATOM   1412 C CB  . VAL A 1 184 ? -3.225  1.859  -17.372 1.00 24.55 ? 184  VAL A CB  1 
ATOM   1413 C CG1 . VAL A 1 184 ? -4.112  1.137  -16.367 1.00 28.57 ? 184  VAL A CG1 1 
ATOM   1414 C CG2 . VAL A 1 184 ? -4.043  2.268  -18.583 1.00 27.02 ? 184  VAL A CG2 1 
ATOM   1415 N N   . SER A 1 185 ? -0.657  2.117  -15.587 1.00 29.45 ? 185  SER A N   1 
ATOM   1416 C CA  . SER A 1 185 ? 0.132   1.673  -14.432 1.00 31.86 ? 185  SER A CA  1 
ATOM   1417 C C   . SER A 1 185 ? 0.474   2.817  -13.479 1.00 29.68 ? 185  SER A C   1 
ATOM   1418 O O   . SER A 1 185 ? 0.478   2.637  -12.262 1.00 29.98 ? 185  SER A O   1 
ATOM   1419 C CB  . SER A 1 185 ? 1.420   0.994  -14.895 1.00 38.20 ? 185  SER A CB  1 
ATOM   1420 O OG  . SER A 1 185 ? 1.126   -0.086 -15.760 1.00 48.05 ? 185  SER A OG  1 
ATOM   1421 N N   . LEU A 1 186 ? 0.766   3.989  -14.038 1.00 24.49 ? 186  LEU A N   1 
ATOM   1422 C CA  . LEU A 1 186 ? 1.043   5.153  -13.224 1.00 22.76 ? 186  LEU A CA  1 
ATOM   1423 C C   . LEU A 1 186 ? -0.136  5.479  -12.297 1.00 25.77 ? 186  LEU A C   1 
ATOM   1424 O O   . LEU A 1 186 ? 0.047   5.707  -11.103 1.00 25.90 ? 186  LEU A O   1 
ATOM   1425 C CB  . LEU A 1 186 ? 1.378   6.351  -14.128 1.00 20.37 ? 186  LEU A CB  1 
ATOM   1426 C CG  . LEU A 1 186 ? 1.387   7.730  -13.479 1.00 21.31 ? 186  LEU A CG  1 
ATOM   1427 C CD1 . LEU A 1 186 ? 2.521   7.824  -12.468 1.00 23.66 ? 186  LEU A CD1 1 
ATOM   1428 C CD2 . LEU A 1 186 ? 1.524   8.801  -14.549 1.00 18.99 ? 186  LEU A CD2 1 
ATOM   1429 N N   . TYR A 1 187 ? -1.348  5.499  -12.841 1.00 23.10 ? 187  TYR A N   1 
ATOM   1430 C CA  . TYR A 1 187 ? -2.509  5.905  -12.047 1.00 25.25 ? 187  TYR A CA  1 
ATOM   1431 C C   . TYR A 1 187 ? -2.931  4.818  -11.070 1.00 25.11 ? 187  TYR A C   1 
ATOM   1432 O O   . TYR A 1 187 ? -3.339  5.120  -9.949  1.00 28.32 ? 187  TYR A O   1 
ATOM   1433 C CB  . TYR A 1 187 ? -3.662  6.307  -12.972 1.00 21.86 ? 187  TYR A CB  1 
ATOM   1434 C CG  . TYR A 1 187 ? -3.202  7.422  -13.864 1.00 19.51 ? 187  TYR A CG  1 
ATOM   1435 C CD1 . TYR A 1 187 ? -2.830  8.640  -13.325 1.00 19.37 ? 187  TYR A CD1 1 
ATOM   1436 C CD2 . TYR A 1 187 ? -3.065  7.234  -15.231 1.00 21.66 ? 187  TYR A CD2 1 
ATOM   1437 C CE1 . TYR A 1 187 ? -2.356  9.664  -14.126 1.00 16.89 ? 187  TYR A CE1 1 
ATOM   1438 C CE2 . TYR A 1 187 ? -2.589  8.248  -16.052 1.00 17.22 ? 187  TYR A CE2 1 
ATOM   1439 C CZ  . TYR A 1 187 ? -2.237  9.459  -15.488 1.00 20.53 ? 187  TYR A CZ  1 
ATOM   1440 O OH  . TYR A 1 187 ? -1.757  10.448 -16.302 1.00 18.10 ? 187  TYR A OH  1 
ATOM   1441 N N   . GLU A 1 188 ? -2.800  3.559  -11.477 1.00 26.98 ? 188  GLU A N   1 
ATOM   1442 C CA  . GLU A 1 188 ? -3.033  2.445  -10.550 1.00 29.59 ? 188  GLU A CA  1 
ATOM   1443 C C   . GLU A 1 188 ? -2.176  2.593  -9.297  1.00 32.32 ? 188  GLU A C   1 
ATOM   1444 O O   . GLU A 1 188 ? -2.658  2.427  -8.169  1.00 32.33 ? 188  GLU A O   1 
ATOM   1445 C CB  . GLU A 1 188 ? -2.730  1.101  -11.219 1.00 36.77 ? 188  GLU A CB  1 
ATOM   1446 C CG  . GLU A 1 188 ? -3.727  0.677  -12.280 1.00 47.72 ? 188  GLU A CG  1 
ATOM   1447 C CD  . GLU A 1 188 ? -3.312  -0.607 -12.986 1.00 56.45 ? 188  GLU A CD  1 
ATOM   1448 O OE1 . GLU A 1 188 ? -2.106  -0.937 -12.965 1.00 58.41 ? 188  GLU A OE1 1 
ATOM   1449 O OE2 . GLU A 1 188 ? -4.195  -1.291 -13.552 1.00 57.32 ? 188  GLU A OE2 1 
ATOM   1450 N N   . GLU A 1 189 ? -0.904  2.912  -9.499  1.00 29.36 ? 189  GLU A N   1 
ATOM   1451 C CA  . GLU A 1 189 ? 0.024   3.018  -8.385  1.00 29.62 ? 189  GLU A CA  1 
ATOM   1452 C C   . GLU A 1 189 ? -0.292  4.226  -7.508  1.00 28.50 ? 189  GLU A C   1 
ATOM   1453 O O   . GLU A 1 189 ? -0.455  4.090  -6.299  1.00 36.64 ? 189  GLU A O   1 
ATOM   1454 C CB  . GLU A 1 189 ? 1.471   3.111  -8.876  1.00 30.51 ? 189  GLU A CB  1 
ATOM   1455 C CG  . GLU A 1 189 ? 2.440   3.440  -7.746  1.00 31.56 ? 189  GLU A CG  1 
ATOM   1456 C CD  . GLU A 1 189 ? 3.883   3.522  -8.193  1.00 38.16 ? 189  GLU A CD  1 
ATOM   1457 O OE1 . GLU A 1 189 ? 4.175   3.184  -9.359  1.00 43.56 ? 189  GLU A OE1 1 
ATOM   1458 O OE2 . GLU A 1 189 ? 4.726   3.923  -7.366  1.00 51.91 ? 189  GLU A OE2 1 
ATOM   1459 N N   . VAL A 1 190 ? -0.376  5.412  -8.108  1.00 24.63 ? 190  VAL A N   1 
ATOM   1460 C CA  . VAL A 1 190 ? -0.487  6.610  -7.285  1.00 24.74 ? 190  VAL A CA  1 
ATOM   1461 C C   . VAL A 1 190 ? -1.854  6.686  -6.608  1.00 26.72 ? 190  VAL A C   1 
ATOM   1462 O O   . VAL A 1 190 ? -1.950  7.145  -5.475  1.00 23.93 ? 190  VAL A O   1 
ATOM   1463 C CB  . VAL A 1 190 ? -0.202  7.913  -8.087  1.00 20.15 ? 190  VAL A CB  1 
ATOM   1464 C CG1 . VAL A 1 190 ? 1.212   7.874  -8.670  1.00 23.72 ? 190  VAL A CG1 1 
ATOM   1465 C CG2 . VAL A 1 190 ? -1.245  8.160  -9.195  1.00 21.33 ? 190  VAL A CG2 1 
ATOM   1466 N N   . CYS A 1 191 ? -2.902  6.198  -7.265  1.00 22.13 ? 191  CYS A N   1 
ATOM   1467 C CA  . CYS A 1 191 ? -4.226  6.272  -6.666  1.00 22.67 ? 191  CYS A CA  1 
ATOM   1468 C C   . CYS A 1 191 ? -4.305  5.382  -5.438  1.00 29.50 ? 191  CYS A C   1 
ATOM   1469 O O   . CYS A 1 191 ? -4.955  5.734  -4.456  1.00 29.42 ? 191  CYS A O   1 
ATOM   1470 C CB  . CYS A 1 191 ? -5.312  5.873  -7.656  1.00 22.55 ? 191  CYS A CB  1 
ATOM   1471 S SG  . CYS A 1 191 ? -5.605  7.117  -8.927  1.00 26.85 ? 191  CYS A SG  1 
ATOM   1472 N N   . ALA A 1 192 ? -3.632  4.238  -5.502  1.00 26.52 ? 192  ALA A N   1 
ATOM   1473 C CA  . ALA A 1 192 ? -3.636  3.290  -4.396  1.00 29.43 ? 192  ALA A CA  1 
ATOM   1474 C C   . ALA A 1 192 ? -2.811  3.810  -3.222  1.00 31.31 ? 192  ALA A C   1 
ATOM   1475 O O   . ALA A 1 192 ? -3.165  3.593  -2.063  1.00 29.57 ? 192  ALA A O   1 
ATOM   1476 C CB  . ALA A 1 192 ? -3.116  1.945  -4.860  1.00 30.61 ? 192  ALA A CB  1 
ATOM   1477 N N   . ARG A 1 193 ? -1.714  4.441  -3.602  1.00 28.38 ? 193  ARG A N   1 
ATOM   1478 C CA  A ARG A 1 193 ? -0.834  5.049  -2.517  0.55 27.47 ? 193  ARG A CA  1 
ATOM   1479 C CA  B ARG A 1 193 ? -0.933  5.104  -2.579  0.45 27.34 ? 193  ARG A CA  1 
ATOM   1480 C C   . ARG A 1 193 ? -1.496  6.289  -1.675  1.00 33.01 ? 193  ARG A C   1 
ATOM   1481 O O   . ARG A 1 193 ? -1.198  6.745  -0.527  1.00 37.42 ? 193  ARG A O   1 
ATOM   1482 C CB  A ARG A 1 193 ? 0.511   5.448  -3.127  0.55 33.49 ? 193  ARG A CB  1 
ATOM   1483 C CB  B ARG A 1 193 ? 0.443   5.501  -3.130  0.45 32.88 ? 193  ARG A CB  1 
ATOM   1484 C CG  A ARG A 1 193 ? 1.395   4.278  -3.439  0.55 38.25 ? 193  ARG A CG  1 
ATOM   1485 C CG  B ARG A 1 193 ? 1.319   4.328  -3.507  0.45 36.84 ? 193  ARG A CG  1 
ATOM   1486 C CD  A ARG A 1 193 ? 2.802   4.534  -2.968  0.55 40.48 ? 193  ARG A CD  1 
ATOM   1487 C CD  B ARG A 1 193 ? 2.776   4.729  -3.571  0.45 38.25 ? 193  ARG A CD  1 
ATOM   1488 N NE  A ARG A 1 193 ? 3.297   3.354  -2.281  0.55 41.57 ? 193  ARG A NE  1 
ATOM   1489 N NE  B ARG A 1 193 ? 3.437   4.439  -2.311  0.45 39.84 ? 193  ARG A NE  1 
ATOM   1490 C CZ  A ARG A 1 193 ? 4.186   3.376  -1.299  0.55 36.90 ? 193  ARG A CZ  1 
ATOM   1491 C CZ  B ARG A 1 193 ? 4.199   5.288  -1.639  0.45 38.09 ? 193  ARG A CZ  1 
ATOM   1492 N NH1 A ARG A 1 193 ? 4.700   4.528  -0.878  0.55 37.74 ? 193  ARG A NH1 1 
ATOM   1493 N NH1 B ARG A 1 193 ? 4.442   6.527  -2.090  0.45 28.23 ? 193  ARG A NH1 1 
ATOM   1494 N NH2 A ARG A 1 193 ? 4.557   2.236  -0.738  0.55 44.67 ? 193  ARG A NH2 1 
ATOM   1495 N NH2 B ARG A 1 193 ? 4.722   4.879  -0.500  0.45 39.12 ? 193  ARG A NH2 1 
ATOM   1496 N N   . TYR A 1 194 ? -2.331  6.950  -2.493  1.00 25.60 ? 194  TYR A N   1 
ATOM   1497 C CA  . TYR A 1 194 ? -2.931  8.143  -1.924  1.00 29.29 ? 194  TYR A CA  1 
ATOM   1498 C C   . TYR A 1 194 ? -4.440  8.146  -2.122  1.00 26.78 ? 194  TYR A C   1 
ATOM   1499 O O   . TYR A 1 194 ? -4.968  8.938  -2.903  1.00 24.81 ? 194  TYR A O   1 
ATOM   1500 C CB  . TYR A 1 194 ? -2.293  9.394  -2.543  1.00 27.14 ? 194  TYR A CB  1 
ATOM   1501 C CG  . TYR A 1 194 ? -0.805  9.464  -2.285  1.00 27.10 ? 194  TYR A CG  1 
ATOM   1502 C CD1 . TYR A 1 194 ? -0.325  9.740  -1.008  1.00 32.38 ? 194  TYR A CD1 1 
ATOM   1503 C CD2 . TYR A 1 194 ? 0.116   9.228  -3.295  1.00 29.02 ? 194  TYR A CD2 1 
ATOM   1504 C CE1 . TYR A 1 194 ? 1.026   9.796  -0.748  1.00 32.51 ? 194  TYR A CE1 1 
ATOM   1505 C CE2 . TYR A 1 194 ? 1.486   9.291  -3.043  1.00 26.66 ? 194  TYR A CE2 1 
ATOM   1506 C CZ  . TYR A 1 194 ? 1.925   9.574  -1.760  1.00 33.00 ? 194  TYR A CZ  1 
ATOM   1507 O OH  . TYR A 1 194 ? 3.272   9.632  -1.476  1.00 38.14 ? 194  TYR A OH  1 
ATOM   1508 N N   . PRO A 1 195 ? -5.152  7.263  -1.402  1.00 28.18 ? 195  PRO A N   1 
ATOM   1509 C CA  . PRO A 1 195 ? -6.605  7.147  -1.567  1.00 27.21 ? 195  PRO A CA  1 
ATOM   1510 C C   . PRO A 1 195 ? -7.365  8.394  -1.120  1.00 29.68 ? 195  PRO A C   1 
ATOM   1511 O O   . PRO A 1 195 ? -8.549  8.520  -1.429  1.00 29.61 ? 195  PRO A O   1 
ATOM   1512 C CB  . PRO A 1 195 ? -6.980  5.943  -0.679  1.00 33.89 ? 195  PRO A CB  1 
ATOM   1513 C CG  . PRO A 1 195 ? -5.691  5.301  -0.279  1.00 37.06 ? 195  PRO A CG  1 
ATOM   1514 C CD  . PRO A 1 195 ? -4.637  6.363  -0.352  1.00 32.99 ? 195  PRO A CD  1 
ATOM   1515 N N   . GLN A 1 196 ? -6.691  9.303  -0.422  1.00 28.45 ? 196  GLN A N   1 
ATOM   1516 C CA  . GLN A 1 196 ? -7.341  10.515 0.058   1.00 30.68 ? 196  GLN A CA  1 
ATOM   1517 C C   . GLN A 1 196 ? -7.239  11.645 -0.963  1.00 27.40 ? 196  GLN A C   1 
ATOM   1518 O O   . GLN A 1 196 ? -7.780  12.726 -0.747  1.00 30.26 ? 196  GLN A O   1 
ATOM   1519 C CB  . GLN A 1 196 ? -6.746  10.958 1.402   1.00 29.91 ? 196  GLN A CB  1 
ATOM   1520 C CG  . GLN A 1 196 ? -5.319  11.517 1.357   1.00 36.02 ? 196  GLN A CG  1 
ATOM   1521 C CD  . GLN A 1 196 ? -4.248  10.435 1.332   1.00 43.20 ? 196  GLN A CD  1 
ATOM   1522 O OE1 . GLN A 1 196 ? -4.415  9.396  0.694   1.00 42.68 ? 196  GLN A OE1 1 
ATOM   1523 N NE2 . GLN A 1 196 ? -3.146  10.672 2.040   1.00 40.04 ? 196  GLN A NE2 1 
ATOM   1524 N N   . ILE A 1 197 ? -6.525  11.389 -2.061  1.00 23.75 ? 197  ILE A N   1 
ATOM   1525 C CA  A ILE A 1 197 ? -6.394  12.377 -3.129  0.66 24.32 ? 197  ILE A CA  1 
ATOM   1526 C CA  B ILE A 1 197 ? -6.360  12.355 -3.147  0.34 24.17 ? 197  ILE A CA  1 
ATOM   1527 C C   . ILE A 1 197 ? -7.252  12.001 -4.330  1.00 24.53 ? 197  ILE A C   1 
ATOM   1528 O O   . ILE A 1 197 ? -7.330  10.829 -4.709  1.00 21.70 ? 197  ILE A O   1 
ATOM   1529 C CB  A ILE A 1 197 ? -4.929  12.533 -3.567  0.66 23.29 ? 197  ILE A CB  1 
ATOM   1530 C CB  B ILE A 1 197 ? -4.897  12.410 -3.638  0.34 22.95 ? 197  ILE A CB  1 
ATOM   1531 C CG1 A ILE A 1 197 ? -4.120  13.154 -2.432  0.66 26.29 ? 197  ILE A CG1 1 
ATOM   1532 C CG1 B ILE A 1 197 ? -3.951  12.737 -2.483  0.34 25.39 ? 197  ILE A CG1 1 
ATOM   1533 C CG2 A ILE A 1 197 ? -4.811  13.388 -4.841  0.66 20.61 ? 197  ILE A CG2 1 
ATOM   1534 C CG2 B ILE A 1 197 ? -4.741  13.415 -4.783  0.34 21.15 ? 197  ILE A CG2 1 
ATOM   1535 C CD1 A ILE A 1 197 ? -2.679  13.290 -2.743  0.66 21.71 ? 197  ILE A CD1 1 
ATOM   1536 C CD1 B ILE A 1 197 ? -4.222  14.068 -1.854  0.34 24.85 ? 197  ILE A CD1 1 
ATOM   1537 N N   . ALA A 1 198 ? -7.915  13.009 -4.903  1.00 20.75 ? 198  ALA A N   1 
ATOM   1538 C CA  . ALA A 1 198 ? -8.693  12.837 -6.127  1.00 20.07 ? 198  ALA A CA  1 
ATOM   1539 C C   . ALA A 1 198 ? -7.771  13.140 -7.313  1.00 18.79 ? 198  ALA A C   1 
ATOM   1540 O O   . ALA A 1 198 ? -7.474  14.301 -7.611  1.00 21.92 ? 198  ALA A O   1 
ATOM   1541 C CB  . ALA A 1 198 ? -9.904  13.739 -6.135  1.00 20.40 ? 198  ALA A CB  1 
ATOM   1542 N N   . PHE A 1 199 ? -7.284  12.084 -7.950  1.00 18.27 ? 199  PHE A N   1 
ATOM   1543 C CA  . PHE A 1 199 ? -6.384  12.227 -9.088  1.00 17.04 ? 199  PHE A CA  1 
ATOM   1544 C C   . PHE A 1 199 ? -7.133  12.411 -10.389 1.00 17.78 ? 199  PHE A C   1 
ATOM   1545 O O   . PHE A 1 199 ? -8.164  11.783 -10.620 1.00 17.65 ? 199  PHE A O   1 
ATOM   1546 C CB  . PHE A 1 199 ? -5.484  11.004 -9.217  1.00 17.78 ? 199  PHE A CB  1 
ATOM   1547 C CG  . PHE A 1 199 ? -4.373  10.959 -8.210  1.00 19.35 ? 199  PHE A CG  1 
ATOM   1548 C CD1 . PHE A 1 199 ? -3.185  11.626 -8.448  1.00 21.74 ? 199  PHE A CD1 1 
ATOM   1549 C CD2 . PHE A 1 199 ? -4.526  10.257 -7.022  1.00 20.47 ? 199  PHE A CD2 1 
ATOM   1550 C CE1 . PHE A 1 199 ? -2.143  11.586 -7.504  1.00 20.54 ? 199  PHE A CE1 1 
ATOM   1551 C CE2 . PHE A 1 199 ? -3.499  10.208 -6.087  1.00 20.32 ? 199  PHE A CE2 1 
ATOM   1552 C CZ  . PHE A 1 199 ? -2.308  10.876 -6.333  1.00 21.66 ? 199  PHE A CZ  1 
ATOM   1553 N N   . GLN A 1 200 ? -6.597  13.280 -11.229 1.00 15.35 ? 200  GLN A N   1 
ATOM   1554 C CA  . GLN A 1 200 ? -7.073  13.447 -12.594 1.00 14.51 ? 200  GLN A CA  1 
ATOM   1555 C C   . GLN A 1 200 ? -6.008  12.871 -13.503 1.00 16.11 ? 200  GLN A C   1 
ATOM   1556 O O   . GLN A 1 200 ? -4.888  13.347 -13.493 1.00 15.64 ? 200  GLN A O   1 
ATOM   1557 C CB  . GLN A 1 200 ? -7.315  14.920 -12.914 1.00 15.32 ? 200  GLN A CB  1 
ATOM   1558 C CG  . GLN A 1 200 ? -8.369  15.573 -12.018 1.00 18.07 ? 200  GLN A CG  1 
ATOM   1559 C CD  . GLN A 1 200 ? -8.412  17.088 -12.179 1.00 15.33 ? 200  GLN A CD  1 
ATOM   1560 O OE1 . GLN A 1 200 ? -8.013  17.625 -13.206 1.00 17.89 ? 200  GLN A OE1 1 
ATOM   1561 N NE2 . GLN A 1 200 ? -8.917  17.778 -11.168 1.00 19.19 ? 200  GLN A NE2 1 
ATOM   1562 N N   . SER A 1 201 ? -6.352  11.843 -14.271 1.00 14.15 ? 201  SER A N   1 
ATOM   1563 C CA  . SER A 1 201 ? -5.418  11.311 -15.258 1.00 14.80 ? 201  SER A CA  1 
ATOM   1564 C C   . SER A 1 201 ? -5.307  12.305 -16.388 1.00 15.15 ? 201  SER A C   1 
ATOM   1565 O O   . SER A 1 201 ? -6.235  13.068 -16.652 1.00 15.62 ? 201  SER A O   1 
ATOM   1566 C CB  . SER A 1 201 ? -5.873  9.937  -15.778 1.00 17.02 ? 201  SER A CB  1 
ATOM   1567 O OG  . SER A 1 201 ? -7.089  10.032 -16.510 1.00 18.26 ? 201  SER A OG  1 
ATOM   1568 N N   . SER A 1 202 ? -4.161  12.306 -17.053 1.00 14.06 ? 202  SER A N   1 
ATOM   1569 C CA  . SER A 1 202 ? -3.910  13.314 -18.064 1.00 12.05 ? 202  SER A CA  1 
ATOM   1570 C C   . SER A 1 202 ? -2.832  12.892 -19.055 1.00 14.88 ? 202  SER A C   1 
ATOM   1571 O O   . SER A 1 202 ? -1.727  12.480 -18.658 1.00 14.95 ? 202  SER A O   1 
ATOM   1572 C CB  . SER A 1 202 ? -3.537  14.627 -17.370 1.00 13.80 ? 202  SER A CB  1 
ATOM   1573 O OG  . SER A 1 202 ? -3.056  15.587 -18.288 1.00 14.03 ? 202  SER A OG  1 
ATOM   1574 N N   . GLY A 1 203 ? -3.153  12.994 -20.348 1.00 13.98 ? 203  GLY A N   1 
ATOM   1575 C CA  . GLY A 1 203 ? -2.168  12.789 -21.399 1.00 11.99 ? 203  GLY A CA  1 
ATOM   1576 C C   . GLY A 1 203 ? -2.288  11.429 -22.050 1.00 15.12 ? 203  GLY A C   1 
ATOM   1577 O O   . GLY A 1 203 ? -2.210  10.384 -21.380 1.00 16.78 ? 203  GLY A O   1 
ATOM   1578 N N   . GLY A 1 204 ? -2.503  11.447 -23.358 1.00 12.80 ? 204  GLY A N   1 
ATOM   1579 C CA  . GLY A 1 204 ? -2.396  10.244 -24.158 1.00 13.91 ? 204  GLY A CA  1 
ATOM   1580 C C   . GLY A 1 204 ? -3.670  9.573  -24.632 1.00 13.86 ? 204  GLY A C   1 
ATOM   1581 O O   . GLY A 1 204 ? -3.599  8.686  -25.483 1.00 17.86 ? 204  GLY A O   1 
ATOM   1582 N N   . ILE A 1 205 ? -4.827  9.945  -24.091 1.00 14.25 ? 205  ILE A N   1 
ATOM   1583 C CA  . ILE A 1 205 ? -6.053  9.281  -24.540 1.00 15.45 ? 205  ILE A CA  1 
ATOM   1584 C C   . ILE A 1 205 ? -6.171  9.371  -26.064 1.00 17.81 ? 205  ILE A C   1 
ATOM   1585 O O   . ILE A 1 205 ? -6.024  10.451 -26.654 1.00 19.08 ? 205  ILE A O   1 
ATOM   1586 C CB  . ILE A 1 205 ? -7.305  9.884  -23.874 1.00 15.00 ? 205  ILE A CB  1 
ATOM   1587 C CG1 . ILE A 1 205 ? -7.303  9.605  -22.365 1.00 18.80 ? 205  ILE A CG1 1 
ATOM   1588 C CG2 . ILE A 1 205 ? -8.568  9.349  -24.529 1.00 18.56 ? 205  ILE A CG2 1 
ATOM   1589 C CD1 . ILE A 1 205 ? -7.344  8.139  -21.983 1.00 19.85 ? 205  ILE A CD1 1 
ATOM   1590 N N   . GLY A 1 206 ? -6.361  8.221  -26.707 1.00 16.87 ? 206  GLY A N   1 
ATOM   1591 C CA  . GLY A 1 206 ? -6.423  8.173  -28.155 1.00 18.10 ? 206  GLY A CA  1 
ATOM   1592 C C   . GLY A 1 206 ? -7.713  7.596  -28.720 1.00 22.64 ? 206  GLY A C   1 
ATOM   1593 O O   . GLY A 1 206 ? -8.033  7.824  -29.888 1.00 24.49 ? 206  GLY A O   1 
ATOM   1594 N N   . ASP A 1 207 ? -8.435  6.827  -27.911 1.00 19.57 ? 207  ASP A N   1 
ATOM   1595 C CA  . ASP A 1 207 ? -9.743  6.307  -28.322 1.00 20.82 ? 207  ASP A CA  1 
ATOM   1596 C C   . ASP A 1 207 ? -10.563 5.912  -27.107 1.00 23.39 ? 207  ASP A C   1 
ATOM   1597 O O   . ASP A 1 207 ? -10.090 6.005  -25.974 1.00 22.61 ? 207  ASP A O   1 
ATOM   1598 C CB  . ASP A 1 207 ? -9.596  5.119  -29.283 1.00 27.94 ? 207  ASP A CB  1 
ATOM   1599 C CG  . ASP A 1 207 ? -8.740  3.997  -28.724 1.00 32.76 ? 207  ASP A CG  1 
ATOM   1600 O OD1 . ASP A 1 207 ? -8.709  3.794  -27.491 1.00 30.94 ? 207  ASP A OD1 1 
ATOM   1601 O OD2 . ASP A 1 207 ? -8.108  3.284  -29.538 1.00 41.60 ? 207  ASP A OD2 1 
ATOM   1602 N N   . ILE A 1 208 ? -11.791 5.453  -27.339 1.00 25.14 ? 208  ILE A N   1 
ATOM   1603 C CA  . ILE A 1 208 ? -12.690 5.122  -26.233 1.00 22.32 ? 208  ILE A CA  1 
ATOM   1604 C C   . ILE A 1 208 ? -12.133 4.012  -25.343 1.00 24.09 ? 208  ILE A C   1 
ATOM   1605 O O   . ILE A 1 208 ? -12.302 4.039  -24.125 1.00 27.62 ? 208  ILE A O   1 
ATOM   1606 C CB  . ILE A 1 208 ? -14.083 4.733  -26.762 1.00 25.61 ? 208  ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 208 ? -14.832 5.982  -27.196 1.00 29.36 ? 208  ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 208 ? -14.894 4.049  -25.686 1.00 30.23 ? 208  ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 208 ? -15.123 6.943  -26.058 1.00 28.35 ? 208  ILE A CD1 1 
ATOM   1610 N N   . ASP A 1 209 ? -11.452 3.044  -25.950 1.00 26.00 ? 209  ASP A N   1 
ATOM   1611 C CA  . ASP A 1 209 ? -10.862 1.944  -25.199 1.00 28.20 ? 209  ASP A CA  1 
ATOM   1612 C C   . ASP A 1 209 ? -9.825  2.429  -24.178 1.00 23.72 ? 209  ASP A C   1 
ATOM   1613 O O   . ASP A 1 209 ? -9.682  1.829  -23.113 1.00 27.54 ? 209  ASP A O   1 
ATOM   1614 C CB  . ASP A 1 209 ? -10.220 0.929  -26.151 1.00 30.44 ? 209  ASP A CB  1 
ATOM   1615 C CG  . ASP A 1 209 ? -11.246 0.185  -26.991 1.00 43.83 ? 209  ASP A CG  1 
ATOM   1616 O OD1 . ASP A 1 209 ? -12.410 0.079  -26.551 1.00 42.11 ? 209  ASP A OD1 1 
ATOM   1617 O OD2 . ASP A 1 209 ? -10.884 -0.297 -28.086 1.00 51.49 ? 209  ASP A OD2 1 
ATOM   1618 N N   . ASP A 1 210 ? -9.119  3.507  -24.514 1.00 21.72 ? 210  ASP A N   1 
ATOM   1619 C CA  . ASP A 1 210 ? -8.113  4.097  -23.620 1.00 20.29 ? 210  ASP A CA  1 
ATOM   1620 C C   . ASP A 1 210 ? -8.752  4.653  -22.352 1.00 22.59 ? 210  ASP A C   1 
ATOM   1621 O O   . ASP A 1 210 ? -8.166  4.609  -21.262 1.00 21.33 ? 210  ASP A O   1 
ATOM   1622 C CB  . ASP A 1 210 ? -7.341  5.211  -24.337 1.00 21.41 ? 210  ASP A CB  1 
ATOM   1623 C CG  . ASP A 1 210 ? -6.331  4.681  -25.336 1.00 23.91 ? 210  ASP A CG  1 
ATOM   1624 O OD1 . ASP A 1 210 ? -5.920  3.504  -25.217 1.00 27.25 ? 210  ASP A OD1 1 
ATOM   1625 O OD2 . ASP A 1 210 ? -5.923  5.456  -26.227 1.00 22.03 ? 210  ASP A OD2 1 
ATOM   1626 N N   . ILE A 1 211 ? -9.955  5.190  -22.503 1.00 23.16 ? 211  ILE A N   1 
ATOM   1627 C CA  . ILE A 1 211 ? -10.715 5.669  -21.362 1.00 21.66 ? 211  ILE A CA  1 
ATOM   1628 C C   . ILE A 1 211 ? -11.148 4.471  -20.509 1.00 24.04 ? 211  ILE A C   1 
ATOM   1629 O O   . ILE A 1 211 ? -10.957 4.446  -19.289 1.00 24.71 ? 211  ILE A O   1 
ATOM   1630 C CB  . ILE A 1 211 ? -11.932 6.478  -21.812 1.00 19.76 ? 211  ILE A CB  1 
ATOM   1631 C CG1 . ILE A 1 211 ? -11.471 7.765  -22.501 1.00 20.59 ? 211  ILE A CG1 1 
ATOM   1632 C CG2 . ILE A 1 211 ? -12.849 6.783  -20.629 1.00 25.19 ? 211  ILE A CG2 1 
ATOM   1633 C CD1 . ILE A 1 211 ? -12.606 8.585  -23.060 1.00 23.21 ? 211  ILE A CD1 1 
ATOM   1634 N N   . ALA A 1 212 ? -11.718 3.470  -21.174 1.00 24.28 ? 212  ALA A N   1 
ATOM   1635 C CA  . ALA A 1 212 ? -12.179 2.259  -20.500 1.00 26.71 ? 212  ALA A CA  1 
ATOM   1636 C C   . ALA A 1 212 ? -11.048 1.604  -19.708 1.00 30.73 ? 212  ALA A C   1 
ATOM   1637 O O   . ALA A 1 212 ? -11.263 1.064  -18.628 1.00 27.14 ? 212  ALA A O   1 
ATOM   1638 C CB  . ALA A 1 212 ? -12.760 1.277  -21.515 1.00 27.77 ? 212  ALA A CB  1 
ATOM   1639 N N   . ALA A 1 213 ? -9.835  1.682  -20.243 1.00 28.11 ? 213  ALA A N   1 
ATOM   1640 C CA  . ALA A 1 213 ? -8.669  1.073  -19.615 1.00 29.13 ? 213  ALA A CA  1 
ATOM   1641 C C   . ALA A 1 213 ? -8.339  1.683  -18.250 1.00 26.39 ? 213  ALA A C   1 
ATOM   1642 O O   . ALA A 1 213 ? -7.621  1.076  -17.460 1.00 28.02 ? 213  ALA A O   1 
ATOM   1643 C CB  . ALA A 1 213 ? -7.472  1.182  -20.538 1.00 24.58 ? 213  ALA A CB  1 
ATOM   1644 N N   . LEU A 1 214 ? -8.865  2.874  -17.971 1.00 25.74 ? 214  LEU A N   1 
ATOM   1645 C CA  . LEU A 1 214 ? -8.601  3.556  -16.694 1.00 23.43 ? 214  LEU A CA  1 
ATOM   1646 C C   . LEU A 1 214 ? -9.606  3.231  -15.582 1.00 24.35 ? 214  LEU A C   1 
ATOM   1647 O O   . LEU A 1 214 ? -9.451  3.670  -14.442 1.00 28.60 ? 214  LEU A O   1 
ATOM   1648 C CB  . LEU A 1 214 ? -8.593  5.071  -16.925 1.00 22.02 ? 214  LEU A CB  1 
ATOM   1649 C CG  . LEU A 1 214 ? -7.412  5.587  -17.743 1.00 20.11 ? 214  LEU A CG  1 
ATOM   1650 C CD1 . LEU A 1 214 ? -7.629  7.056  -18.071 1.00 20.45 ? 214  LEU A CD1 1 
ATOM   1651 C CD2 . LEU A 1 214 ? -6.105  5.391  -16.988 1.00 24.58 ? 214  LEU A CD2 1 
ATOM   1652 N N   . ARG A 1 215 ? -10.656 2.542  -15.934 1.00 29.83 ? 215  ARG A N   1 
ATOM   1653 C CA  . ARG A 1 215 ? -11.771 2.263  -15.039 1.00 32.43 ? 215  ARG A CA  1 
ATOM   1654 C C   . ARG A 1 215 ? -11.478 1.699  -13.684 1.00 30.37 ? 215  ARG A C   1 
ATOM   1655 O O   . ARG A 1 215 ? -12.185 1.942  -12.763 1.00 40.61 ? 215  ARG A O   1 
ATOM   1656 C CB  . ARG A 1 215 ? -12.774 1.367  -15.760 1.00 35.31 ? 215  ARG A CB  1 
ATOM   1657 C CG  . ARG A 1 215 ? -12.303 -0.089 -15.731 1.00 48.25 ? 215  ARG A CG  1 
ATOM   1658 C CD  . ARG A 1 215 ? -13.277 -1.136 -16.276 1.00 56.88 ? 215  ARG A CD  1 
ATOM   1659 N NE  . ARG A 1 215 ? -13.300 -1.118 -17.729 1.00 56.19 ? 215  ARG A NE  1 
ATOM   1660 C CZ  . ARG A 1 215 ? -14.075 -1.912 -18.440 1.00 58.22 ? 215  ARG A CZ  1 
ATOM   1661 N NH1 . ARG A 1 215 ? -14.876 -2.751 -17.781 1.00 58.43 ? 215  ARG A NH1 1 
ATOM   1662 N NH2 . ARG A 1 215 ? -14.102 -1.848 -19.772 1.00 49.49 ? 215  ARG A NH2 1 
ATOM   1663 N N   . GLY A 1 216 ? -10.427 0.942  -13.593 1.00 30.53 ? 216  GLY A N   1 
ATOM   1664 C CA  . GLY A 1 216 ? -10.069 0.281  -12.348 1.00 36.78 ? 216  GLY A CA  1 
ATOM   1665 C C   . GLY A 1 216 ? -8.975  0.966  -11.545 1.00 35.80 ? 216  GLY A C   1 
ATOM   1666 O O   . GLY A 1 216 ? -8.581  0.490  -10.477 1.00 38.29 ? 216  GLY A O   1 
ATOM   1667 N N   . THR A 1 217 ? -8.485  2.095  -12.046 1.00 27.97 ? 217  THR A N   1 
ATOM   1668 C CA  . THR A 1 217 ? -7.341  2.754  -11.431 1.00 29.94 ? 217  THR A CA  1 
ATOM   1669 C C   . THR A 1 217 ? -7.704  3.510  -10.166 1.00 31.95 ? 217  THR A C   1 
ATOM   1670 O O   . THR A 1 217 ? -6.877  3.657  -9.264  1.00 32.32 ? 217  THR A O   1 
ATOM   1671 C CB  . THR A 1 217 ? -6.687  3.758  -12.393 1.00 26.64 ? 217  THR A CB  1 
ATOM   1672 O OG1 . THR A 1 217 ? -7.661  4.731  -12.771 1.00 25.76 ? 217  THR A OG1 1 
ATOM   1673 C CG2 . THR A 1 217 ? -6.165  3.059  -13.641 1.00 28.90 ? 217  THR A CG2 1 
ATOM   1674 N N   . GLY A 1 218 ? -8.925  4.031  -10.127 1.00 26.59 ? 218  GLY A N   1 
ATOM   1675 C CA  . GLY A 1 218 ? -9.364  4.839  -9.008  1.00 28.27 ? 218  GLY A CA  1 
ATOM   1676 C C   . GLY A 1 218 ? -9.264  6.336  -9.263  1.00 24.60 ? 218  GLY A C   1 
ATOM   1677 O O   . GLY A 1 218 ? -9.513  7.119  -8.345  1.00 27.33 ? 218  GLY A O   1 
ATOM   1678 N N   . VAL A 1 219 ? -8.884  6.741  -10.477 1.00 23.15 ? 219  VAL A N   1 
ATOM   1679 C CA  . VAL A 1 219 ? -8.827  8.175  -10.780 1.00 20.74 ? 219  VAL A CA  1 
ATOM   1680 C C   . VAL A 1 219 ? -10.235 8.758  -10.696 1.00 21.33 ? 219  VAL A C   1 
ATOM   1681 O O   . VAL A 1 219 ? -11.217 8.071  -10.985 1.00 27.02 ? 219  VAL A O   1 
ATOM   1682 C CB  . VAL A 1 219 ? -8.220  8.494  -12.183 1.00 26.77 ? 219  VAL A CB  1 
ATOM   1683 C CG1 . VAL A 1 219 ? -6.748  8.069  -12.262 1.00 25.00 ? 219  VAL A CG1 1 
ATOM   1684 C CG2 . VAL A 1 219 ? -9.040  7.878  -13.314 1.00 26.36 ? 219  VAL A CG2 1 
ATOM   1685 N N   . ARG A 1 220 ? -10.333 10.019 -10.280 1.00 22.91 ? 220  ARG A N   1 
ATOM   1686 C CA  . ARG A 1 220 ? -11.632 10.668 -10.137 1.00 24.48 ? 220  ARG A CA  1 
ATOM   1687 C C   . ARG A 1 220 ? -11.974 11.541 -11.342 1.00 20.55 ? 220  ARG A C   1 
ATOM   1688 O O   . ARG A 1 220 ? -13.121 11.958 -11.513 1.00 27.01 ? 220  ARG A O   1 
ATOM   1689 C CB  . ARG A 1 220 ? -11.677 11.509 -8.857  1.00 26.26 ? 220  ARG A CB  1 
ATOM   1690 C CG  . ARG A 1 220 ? -11.500 10.685 -7.586  1.00 27.89 ? 220  ARG A CG  1 
ATOM   1691 C CD  . ARG A 1 220 ? -12.691 9.788  -7.322  1.00 33.34 ? 220  ARG A CD  1 
ATOM   1692 N NE  . ARG A 1 220 ? -12.525 9.073  -6.058  1.00 46.56 ? 220  ARG A NE  1 
ATOM   1693 C CZ  . ARG A 1 220 ? -13.505 8.467  -5.395  1.00 55.45 ? 220  ARG A CZ  1 
ATOM   1694 N NH1 . ARG A 1 220 ? -14.746 8.480  -5.866  1.00 53.01 ? 220  ARG A NH1 1 
ATOM   1695 N NH2 . ARG A 1 220 ? -13.242 7.849  -4.252  1.00 57.32 ? 220  ARG A NH2 1 
ATOM   1696 N N   . GLY A 1 221 ? -10.981 11.814 -12.179 1.00 18.50 ? 221  GLY A N   1 
ATOM   1697 C CA  . GLY A 1 221 ? -11.223 12.565 -13.389 1.00 18.92 ? 221  GLY A CA  1 
ATOM   1698 C C   . GLY A 1 221 ? -10.328 12.054 -14.491 1.00 18.77 ? 221  GLY A C   1 
ATOM   1699 O O   . GLY A 1 221 ? -9.249  11.528 -14.220 1.00 18.58 ? 221  GLY A O   1 
ATOM   1700 N N   . VAL A 1 222 ? -10.787 12.191 -15.731 1.00 15.69 ? 222  VAL A N   1 
ATOM   1701 C CA  . VAL A 1 222 ? -10.027 11.743 -16.898 1.00 16.72 ? 222  VAL A CA  1 
ATOM   1702 C C   . VAL A 1 222 ? -9.930  12.902 -17.863 1.00 13.87 ? 222  VAL A C   1 
ATOM   1703 O O   . VAL A 1 222 ? -10.914 13.253 -18.516 1.00 15.73 ? 222  VAL A O   1 
ATOM   1704 C CB  . VAL A 1 222 ? -10.699 10.540 -17.611 1.00 15.26 ? 222  VAL A CB  1 
ATOM   1705 C CG1 . VAL A 1 222 ? -9.940  10.159 -18.870 1.00 15.81 ? 222  VAL A CG1 1 
ATOM   1706 C CG2 . VAL A 1 222 ? -10.775 9.339  -16.688 1.00 17.16 ? 222  VAL A CG2 1 
ATOM   1707 N N   . ILE A 1 223 ? -8.757  13.533 -17.942 1.00 13.02 ? 223  ILE A N   1 
ATOM   1708 C CA  . ILE A 1 223 ? -8.590  14.653 -18.862 1.00 11.50 ? 223  ILE A CA  1 
ATOM   1709 C C   . ILE A 1 223 ? -8.383  14.137 -20.265 1.00 14.46 ? 223  ILE A C   1 
ATOM   1710 O O   . ILE A 1 223 ? -7.616  13.202 -20.474 1.00 15.28 ? 223  ILE A O   1 
ATOM   1711 C CB  . ILE A 1 223 ? -7.406  15.554 -18.441 1.00 12.87 ? 223  ILE A CB  1 
ATOM   1712 C CG1 . ILE A 1 223 ? -7.720  16.140 -17.066 1.00 20.11 ? 223  ILE A CG1 1 
ATOM   1713 C CG2 . ILE A 1 223 ? -7.128  16.650 -19.462 1.00 13.78 ? 223  ILE A CG2 1 
ATOM   1714 C CD1 . ILE A 1 223 ? -6.749  17.142 -16.601 1.00 23.70 ? 223  ILE A CD1 1 
ATOM   1715 N N   . VAL A 1 224 ? -9.104  14.732 -21.216 1.00 14.57 ? 224  VAL A N   1 
ATOM   1716 C CA  . VAL A 1 224 ? -8.971  14.392 -22.629 1.00 12.10 ? 224  VAL A CA  1 
ATOM   1717 C C   . VAL A 1 224 ? -8.827  15.659 -23.455 1.00 12.46 ? 224  VAL A C   1 
ATOM   1718 O O   . VAL A 1 224 ? -9.699  16.521 -23.401 1.00 13.12 ? 224  VAL A O   1 
ATOM   1719 C CB  . VAL A 1 224 ? -10.204 13.610 -23.152 1.00 14.86 ? 224  VAL A CB  1 
ATOM   1720 C CG1 . VAL A 1 224 ? -10.005 13.193 -24.617 1.00 19.18 ? 224  VAL A CG1 1 
ATOM   1721 C CG2 . VAL A 1 224 ? -10.507 12.408 -22.260 1.00 14.92 ? 224  VAL A CG2 1 
ATOM   1722 N N   . GLY A 1 225 ? -7.726  15.791 -24.189 1.00 12.46 ? 225  GLY A N   1 
ATOM   1723 C CA  . GLY A 1 225 ? -7.508  16.958 -25.030 1.00 12.38 ? 225  GLY A CA  1 
ATOM   1724 C C   . GLY A 1 225 ? -7.531  16.627 -26.515 1.00 12.05 ? 225  GLY A C   1 
ATOM   1725 O O   . GLY A 1 225 ? -8.574  16.782 -27.179 1.00 14.06 ? 225  GLY A O   1 
ATOM   1726 N N   . ARG A 1 226 ? -6.395  16.161 -27.027 1.00 13.52 ? 226  ARG A N   1 
ATOM   1727 C CA  . ARG A 1 226 ? -6.210  15.927 -28.457 1.00 12.21 ? 226  ARG A CA  1 
ATOM   1728 C C   . ARG A 1 226 ? -7.271  15.020 -29.099 1.00 13.74 ? 226  ARG A C   1 
ATOM   1729 O O   . ARG A 1 226 ? -7.731  15.314 -30.196 1.00 16.43 ? 226  ARG A O   1 
ATOM   1730 C CB  . ARG A 1 226 ? -4.821  15.336 -28.718 1.00 12.77 ? 226  ARG A CB  1 
ATOM   1731 C CG  . ARG A 1 226 ? -4.561  15.084 -30.192 1.00 15.27 ? 226  ARG A CG  1 
ATOM   1732 C CD  . ARG A 1 226 ? -3.199  14.419 -30.455 1.00 17.29 ? 226  ARG A CD  1 
ATOM   1733 N NE  . ARG A 1 226 ? -3.056  14.243 -31.901 1.00 22.16 ? 226  ARG A NE  1 
ATOM   1734 C CZ  . ARG A 1 226 ? -1.977  13.787 -32.521 1.00 22.70 ? 226  ARG A CZ  1 
ATOM   1735 N NH1 . ARG A 1 226 ? -0.902  13.444 -31.845 1.00 25.58 ? 226  ARG A NH1 1 
ATOM   1736 N NH2 . ARG A 1 226 ? -1.981  13.694 -33.844 1.00 28.09 ? 226  ARG A NH2 1 
ATOM   1737 N N   . ALA A 1 227 ? -7.667  13.930 -28.436 1.00 12.88 ? 227  ALA A N   1 
ATOM   1738 C CA  . ALA A 1 227 ? -8.589  12.992 -29.083 1.00 13.81 ? 227  ALA A CA  1 
ATOM   1739 C C   . ALA A 1 227 ? -9.915  13.672 -29.389 1.00 15.54 ? 227  ALA A C   1 
ATOM   1740 O O   . ALA A 1 227 ? -10.531 13.393 -30.404 1.00 17.49 ? 227  ALA A O   1 
ATOM   1741 C CB  . ALA A 1 227 ? -8.819  11.762 -28.220 1.00 14.22 ? 227  ALA A CB  1 
ATOM   1742 N N   . LEU A 1 228 ? -10.352 14.573 -28.520 1.00 14.79 ? 228  LEU A N   1 
ATOM   1743 C CA  . LEU A 1 228 ? -11.597 15.283 -28.785 1.00 15.78 ? 228  LEU A CA  1 
ATOM   1744 C C   . LEU A 1 228 ? -11.451 16.323 -29.902 1.00 16.83 ? 228  LEU A C   1 
ATOM   1745 O O   . LEU A 1 228 ? -12.377 16.492 -30.705 1.00 17.62 ? 228  LEU A O   1 
ATOM   1746 C CB  . LEU A 1 228 ? -12.117 15.938 -27.510 1.00 14.11 ? 228  LEU A CB  1 
ATOM   1747 C CG  . LEU A 1 228 ? -12.729 14.987 -26.467 1.00 16.13 ? 228  LEU A CG  1 
ATOM   1748 C CD1 . LEU A 1 228 ? -13.003 15.732 -25.174 1.00 17.61 ? 228  LEU A CD1 1 
ATOM   1749 C CD2 . LEU A 1 228 ? -14.016 14.324 -26.969 1.00 16.63 ? 228  LEU A CD2 1 
ATOM   1750 N N   . LEU A 1 229 ? -10.306 16.995 -29.977 1.00 16.83 ? 229  LEU A N   1 
ATOM   1751 C CA  . LEU A 1 229 ? -10.065 17.955 -31.066 1.00 14.77 ? 229  LEU A CA  1 
ATOM   1752 C C   . LEU A 1 229 ? -10.064 17.253 -32.416 1.00 18.05 ? 229  LEU A C   1 
ATOM   1753 O O   . LEU A 1 229 ? -10.493 17.825 -33.422 1.00 20.15 ? 229  LEU A O   1 
ATOM   1754 C CB  . LEU A 1 229 ? -8.732  18.681 -30.890 1.00 15.04 ? 229  LEU A CB  1 
ATOM   1755 C CG  . LEU A 1 229 ? -8.565  19.531 -29.628 1.00 16.65 ? 229  LEU A CG  1 
ATOM   1756 C CD1 . LEU A 1 229 ? -7.150  20.030 -29.535 1.00 19.17 ? 229  LEU A CD1 1 
ATOM   1757 C CD2 . LEU A 1 229 ? -9.552  20.687 -29.629 1.00 19.83 ? 229  LEU A CD2 1 
ATOM   1758 N N   . GLU A 1 230 ? -9.544  16.026 -32.442 1.00 16.43 ? 230  GLU A N   1 
ATOM   1759 C CA  . GLU A 1 230 ? -9.470  15.261 -33.685 1.00 17.06 ? 230  GLU A CA  1 
ATOM   1760 C C   . GLU A 1 230 ? -10.731 14.464 -33.979 1.00 18.10 ? 230  GLU A C   1 
ATOM   1761 O O   . GLU A 1 230 ? -10.852 13.866 -35.046 1.00 23.77 ? 230  GLU A O   1 
ATOM   1762 C CB  . GLU A 1 230 ? -8.288  14.306 -33.655 1.00 18.36 ? 230  GLU A CB  1 
ATOM   1763 C CG  . GLU A 1 230 ? -6.973  15.027 -33.630 1.00 23.21 ? 230  GLU A CG  1 
ATOM   1764 C CD  . GLU A 1 230 ? -5.824  14.186 -34.144 1.00 36.09 ? 230  GLU A CD  1 
ATOM   1765 O OE1 . GLU A 1 230 ? -6.028  12.990 -34.435 1.00 46.33 ? 230  GLU A OE1 1 
ATOM   1766 O OE2 . GLU A 1 230 ? -4.708  14.733 -34.256 1.00 42.12 ? 230  GLU A OE2 1 
ATOM   1767 N N   . GLY A 1 231 ? -11.674 14.440 -33.047 1.00 17.28 ? 231  GLY A N   1 
ATOM   1768 C CA  . GLY A 1 231 ? -12.925 13.748 -33.296 1.00 19.23 ? 231  GLY A CA  1 
ATOM   1769 C C   . GLY A 1 231 ? -12.797 12.234 -33.297 1.00 19.38 ? 231  GLY A C   1 
ATOM   1770 O O   . GLY A 1 231 ? -13.541 11.558 -34.006 1.00 22.02 ? 231  GLY A O   1 
ATOM   1771 N N   . LYS A 1 232 ? -11.856 11.699 -32.513 1.00 19.80 ? 232  LYS A N   1 
ATOM   1772 C CA  . LYS A 1 232 ? -11.738 10.250 -32.343 1.00 19.88 ? 232  LYS A CA  1 
ATOM   1773 C C   . LYS A 1 232 ? -13.005 9.666  -31.726 1.00 19.22 ? 232  LYS A C   1 
ATOM   1774 O O   . LYS A 1 232 ? -13.366 8.510  -31.963 1.00 24.65 ? 232  LYS A O   1 
ATOM   1775 C CB  . LYS A 1 232 ? -10.524 9.907  -31.473 1.00 18.90 ? 232  LYS A CB  1 
ATOM   1776 C CG  . LYS A 1 232 ? -9.196  10.373 -32.041 1.00 19.59 ? 232  LYS A CG  1 
ATOM   1777 C CD  . LYS A 1 232 ? -8.923  9.765  -33.404 1.00 26.55 ? 232  LYS A CD  1 
ATOM   1778 C CE  . LYS A 1 232 ? -7.605  10.258 -33.963 1.00 29.55 ? 232  LYS A CE  1 
ATOM   1779 N NZ  . LYS A 1 232 ? -7.193  9.447  -35.146 1.00 37.54 ? 232  LYS A NZ  1 
ATOM   1780 N N   . PHE A 1 233 ? -13.670 10.478 -30.915 1.00 19.46 ? 233  PHE A N   1 
ATOM   1781 C CA  . PHE A 1 233 ? -14.942 10.151 -30.292 1.00 20.68 ? 233  PHE A CA  1 
ATOM   1782 C C   . PHE A 1 233 ? -15.559 11.458 -29.817 1.00 20.17 ? 233  PHE A C   1 
ATOM   1783 O O   . PHE A 1 233 ? -14.903 12.509 -29.832 1.00 19.83 ? 233  PHE A O   1 
ATOM   1784 C CB  . PHE A 1 233 ? -14.785 9.162  -29.129 1.00 19.85 ? 233  PHE A CB  1 
ATOM   1785 C CG  . PHE A 1 233 ? -13.715 9.543  -28.139 1.00 17.55 ? 233  PHE A CG  1 
ATOM   1786 C CD1 . PHE A 1 233 ? -13.965 10.476 -27.137 1.00 18.40 ? 233  PHE A CD1 1 
ATOM   1787 C CD2 . PHE A 1 233 ? -12.465 8.962  -28.212 1.00 19.41 ? 233  PHE A CD2 1 
ATOM   1788 C CE1 . PHE A 1 233 ? -12.968 10.838 -26.235 1.00 18.58 ? 233  PHE A CE1 1 
ATOM   1789 C CE2 . PHE A 1 233 ? -11.460 9.310  -27.310 1.00 19.52 ? 233  PHE A CE2 1 
ATOM   1790 C CZ  . PHE A 1 233 ? -11.716 10.249 -26.317 1.00 17.75 ? 233  PHE A CZ  1 
ATOM   1791 N N   . THR A 1 234 ? -16.825 11.402 -29.423 1.00 21.18 ? 234  THR A N   1 
ATOM   1792 C CA  . THR A 1 234 ? -17.516 12.584 -28.934 1.00 20.86 ? 234  THR A CA  1 
ATOM   1793 C C   . THR A 1 234 ? -17.468 12.619 -27.417 1.00 20.18 ? 234  THR A C   1 
ATOM   1794 O O   . THR A 1 234 ? -17.255 11.593 -26.781 1.00 20.36 ? 234  THR A O   1 
ATOM   1795 C CB  . THR A 1 234 ? -18.983 12.609 -29.384 1.00 26.78 ? 234  THR A CB  1 
ATOM   1796 O OG1 . THR A 1 234 ? -19.680 11.503 -28.788 1.00 28.23 ? 234  THR A OG1 1 
ATOM   1797 C CG2 . THR A 1 234 ? -19.067 12.512 -30.895 1.00 26.17 ? 234  THR A CG2 1 
ATOM   1798 N N   . VAL A 1 235 ? -17.668 13.798 -26.841 1.00 19.39 ? 235  VAL A N   1 
ATOM   1799 C CA  . VAL A 1 235 ? -17.756 13.921 -25.389 1.00 20.24 ? 235  VAL A CA  1 
ATOM   1800 C C   . VAL A 1 235 ? -18.876 13.031 -24.843 1.00 21.46 ? 235  VAL A C   1 
ATOM   1801 O O   . VAL A 1 235 ? -18.699 12.353 -23.830 1.00 23.54 ? 235  VAL A O   1 
ATOM   1802 C CB  . VAL A 1 235 ? -17.977 15.387 -24.957 1.00 21.34 ? 235  VAL A CB  1 
ATOM   1803 C CG1 . VAL A 1 235 ? -18.525 15.467 -23.531 1.00 26.76 ? 235  VAL A CG1 1 
ATOM   1804 C CG2 . VAL A 1 235 ? -16.686 16.173 -25.071 1.00 20.13 ? 235  VAL A CG2 1 
ATOM   1805 N N   . LYS A 1 236 ? -20.019 13.003 -25.526 1.00 23.78 ? 236  LYS A N   1 
ATOM   1806 C CA  . LYS A 1 236 ? -21.116 12.133 -25.097 1.00 26.24 ? 236  LYS A CA  1 
ATOM   1807 C C   . LYS A 1 236 ? -20.676 10.668 -25.026 1.00 28.11 ? 236  LYS A C   1 
ATOM   1808 O O   . LYS A 1 236 ? -20.993 9.966  -24.065 1.00 28.95 ? 236  LYS A O   1 
ATOM   1809 C CB  . LYS A 1 236 ? -22.312 12.285 -26.038 1.00 29.19 ? 236  LYS A CB  1 
ATOM   1810 C CG  . LYS A 1 236 ? -23.578 11.627 -25.540 1.00 35.53 ? 236  LYS A CG  1 
ATOM   1811 C CD  . LYS A 1 236 ? -24.774 12.099 -26.349 1.00 43.38 ? 236  LYS A CD  1 
ATOM   1812 C CE  . LYS A 1 236 ? -25.392 10.956 -27.139 1.00 58.44 ? 236  LYS A CE  1 
ATOM   1813 N NZ  . LYS A 1 236 ? -26.622 11.377 -27.867 1.00 63.20 ? 236  LYS A NZ  1 
ATOM   1814 N N   . GLU A 1 237 ? -19.914 10.219 -26.025 1.00 25.75 ? 237  GLU A N   1 
ATOM   1815 C CA  . GLU A 1 237 ? -19.432 8.840  -26.039 1.00 28.86 ? 237  GLU A CA  1 
ATOM   1816 C C   . GLU A 1 237 ? -18.461 8.581  -24.887 1.00 30.96 ? 237  GLU A C   1 
ATOM   1817 O O   . GLU A 1 237 ? -18.523 7.536  -24.246 1.00 29.68 ? 237  GLU A O   1 
ATOM   1818 C CB  . GLU A 1 237 ? -18.776 8.508  -27.385 1.00 27.28 ? 237  GLU A CB  1 
ATOM   1819 C CG  . GLU A 1 237 ? -19.793 8.343  -28.513 1.00 30.35 ? 237  GLU A CG  1 
ATOM   1820 C CD  . GLU A 1 237 ? -19.197 8.407  -29.918 1.00 36.27 ? 237  GLU A CD  1 
ATOM   1821 O OE1 . GLU A 1 237 ? -18.035 8.832  -30.091 1.00 30.73 ? 237  GLU A OE1 1 
ATOM   1822 O OE2 . GLU A 1 237 ? -19.917 8.027  -30.870 1.00 38.28 ? 237  GLU A OE2 1 
ATOM   1823 N N   . ALA A 1 238 ? -17.578 9.543  -24.625 1.00 23.15 ? 238  ALA A N   1 
ATOM   1824 C CA  . ALA A 1 238 ? -16.605 9.423  -23.540 1.00 22.09 ? 238  ALA A CA  1 
ATOM   1825 C C   . ALA A 1 238 ? -17.304 9.305  -22.185 1.00 25.55 ? 238  ALA A C   1 
ATOM   1826 O O   . ALA A 1 238 ? -16.934 8.483  -21.352 1.00 25.53 ? 238  ALA A O   1 
ATOM   1827 C CB  . ALA A 1 238 ? -15.654 10.624 -23.543 1.00 18.93 ? 238  ALA A CB  1 
ATOM   1828 N N   . ILE A 1 239 ? -18.311 10.146 -21.975 1.00 22.17 ? 239  ILE A N   1 
ATOM   1829 C CA  . ILE A 1 239 ? -19.061 10.159 -20.722 1.00 25.54 ? 239  ILE A CA  1 
ATOM   1830 C C   . ILE A 1 239 ? -19.797 8.836  -20.522 1.00 29.60 ? 239  ILE A C   1 
ATOM   1831 O O   . ILE A 1 239 ? -19.797 8.277  -19.420 1.00 30.27 ? 239  ILE A O   1 
ATOM   1832 C CB  . ILE A 1 239 ? -20.062 11.349 -20.685 1.00 24.81 ? 239  ILE A CB  1 
ATOM   1833 C CG1 . ILE A 1 239 ? -19.292 12.666 -20.575 1.00 24.05 ? 239  ILE A CG1 1 
ATOM   1834 C CG2 . ILE A 1 239 ? -21.045 11.210 -19.517 1.00 27.82 ? 239  ILE A CG2 1 
ATOM   1835 C CD1 . ILE A 1 239 ? -20.157 13.883 -20.722 1.00 28.24 ? 239  ILE A CD1 1 
ATOM   1836 N N   . GLN A 1 240 ? -20.392 8.324  -21.594 1.00 29.73 ? 240  GLN A N   1 
ATOM   1837 C CA  . GLN A 1 240 ? -21.110 7.051  -21.539 1.00 32.28 ? 240  GLN A CA  1 
ATOM   1838 C C   . GLN A 1 240 ? -20.168 5.940  -21.078 1.00 32.53 ? 240  GLN A C   1 
ATOM   1839 O O   . GLN A 1 240 ? -20.518 5.127  -20.224 1.00 36.91 ? 240  GLN A O   1 
ATOM   1840 C CB  . GLN A 1 240 ? -21.716 6.710  -22.908 1.00 38.05 ? 240  GLN A CB  1 
ATOM   1841 C CG  . GLN A 1 240 ? -22.835 5.651  -22.914 1.00 55.49 ? 240  GLN A CG  1 
ATOM   1842 C CD  . GLN A 1 240 ? -23.739 5.672  -21.681 1.00 64.92 ? 240  GLN A CD  1 
ATOM   1843 O OE1 . GLN A 1 240 ? -24.019 4.636  -21.071 1.00 73.60 ? 240  GLN A OE1 1 
ATOM   1844 N NE2 . GLN A 1 240 ? -24.201 6.863  -21.313 1.00 66.25 ? 240  GLN A NE2 1 
ATOM   1845 N N   . CYS A 1 241 ? -18.958 5.935  -21.630 1.00 29.92 ? 241  CYS A N   1 
ATOM   1846 C CA  . CYS A 1 241 ? -17.949 4.936  -21.300 1.00 30.35 ? 241  CYS A CA  1 
ATOM   1847 C C   . CYS A 1 241 ? -17.568 4.969  -19.823 1.00 30.40 ? 241  CYS A C   1 
ATOM   1848 O O   . CYS A 1 241 ? -17.421 3.927  -19.184 1.00 36.79 ? 241  CYS A O   1 
ATOM   1849 C CB  . CYS A 1 241 ? -16.709 5.155  -22.176 1.00 41.30 ? 241  CYS A CB  1 
ATOM   1850 S SG  . CYS A 1 241 ? -15.325 4.041  -21.873 1.00 36.53 ? 241  CYS A SG  1 
ATOM   1851 N N   . TRP A 1 242 ? -17.429 6.169  -19.277 1.00 34.60 ? 242  TRP A N   1 
ATOM   1852 C CA  . TRP A 1 242 ? -16.941 6.325  -17.912 1.00 31.26 ? 242  TRP A CA  1 
ATOM   1853 C C   . TRP A 1 242 ? -18.033 6.063  -16.886 1.00 38.16 ? 242  TRP A C   1 
ATOM   1854 O O   . TRP A 1 242 ? -17.761 5.537  -15.811 1.00 38.65 ? 242  TRP A O   1 
ATOM   1855 C CB  . TRP A 1 242 ? -16.359 7.720  -17.700 1.00 31.75 ? 242  TRP A CB  1 
ATOM   1856 C CG  . TRP A 1 242 ? -15.600 7.822  -16.418 1.00 35.19 ? 242  TRP A CG  1 
ATOM   1857 C CD1 . TRP A 1 242 ? -15.962 8.515  -15.298 1.00 43.20 ? 242  TRP A CD1 1 
ATOM   1858 C CD2 . TRP A 1 242 ? -14.353 7.191  -16.114 1.00 31.02 ? 242  TRP A CD2 1 
ATOM   1859 N NE1 . TRP A 1 242 ? -15.010 8.359  -14.315 1.00 38.55 ? 242  TRP A NE1 1 
ATOM   1860 C CE2 . TRP A 1 242 ? -14.011 7.551  -14.794 1.00 31.13 ? 242  TRP A CE2 1 
ATOM   1861 C CE3 . TRP A 1 242 ? -13.485 6.360  -16.832 1.00 26.47 ? 242  TRP A CE3 1 
ATOM   1862 C CZ2 . TRP A 1 242 ? -12.844 7.110  -14.179 1.00 26.88 ? 242  TRP A CZ2 1 
ATOM   1863 C CZ3 . TRP A 1 242 ? -12.334 5.916  -16.216 1.00 27.27 ? 242  TRP A CZ3 1 
ATOM   1864 C CH2 . TRP A 1 242 ? -12.018 6.297  -14.906 1.00 24.94 ? 242  TRP A CH2 1 
ATOM   1865 N N   . GLN A 1 243 ? -19.262 6.437  -17.222 1.00 40.46 ? 243  GLN A N   1 
ATOM   1866 C CA  . GLN A 1 243 ? -20.423 6.160  -16.379 1.00 44.61 ? 243  GLN A CA  1 
ATOM   1867 C C   . GLN A 1 243 ? -20.564 4.676  -16.082 1.00 47.82 ? 243  GLN A C   1 
ATOM   1868 O O   . GLN A 1 243 ? -20.618 4.257  -14.924 1.00 44.19 ? 243  GLN A O   1 
ATOM   1869 C CB  . GLN A 1 243 ? -21.705 6.651  -17.053 1.00 48.44 ? 243  GLN A CB  1 
ATOM   1870 C CG  . GLN A 1 243 ? -21.880 8.155  -17.088 1.00 60.63 ? 243  GLN A CG  1 
ATOM   1871 C CD  . GLN A 1 243 ? -23.316 8.569  -16.841 1.00 73.63 ? 243  GLN A CD  1 
ATOM   1872 O OE1 . GLN A 1 243 ? -24.202 7.723  -16.710 1.00 78.27 ? 243  GLN A OE1 1 
ATOM   1873 N NE2 . GLN A 1 243 ? -23.557 9.875  -16.787 1.00 79.26 ? 243  GLN A NE2 1 
ATOM   1874 N N   . ASN A 1 244 ? -20.463 3.964  -17.188 1.00 56.30 ? 244  ASN A N   1 
ATOM   1875 C CA  . ASN A 1 244 ? -20.550 2.553  -17.300 1.00 61.67 ? 244  ASN A CA  1 
ATOM   1876 C C   . ASN A 1 244 ? -19.407 1.767  -16.657 1.00 65.51 ? 244  ASN A C   1 
ATOM   1877 O O   . ASN A 1 244 ? -19.677 0.809  -15.956 1.00 64.27 ? 244  ASN A O   1 
ATOM   1878 C CB  . ASN A 1 244 ? -20.633 2.196  -18.781 1.00 63.28 ? 244  ASN A CB  1 
ATOM   1879 C CG  . ASN A 1 244 ? -21.954 2.597  -19.424 1.00 68.99 ? 244  ASN A CG  1 
ATOM   1880 O OD1 . ASN A 1 244 ? -22.899 2.980  -18.768 1.00 70.85 ? 244  ASN A OD1 1 
ATOM   1881 N ND2 . ASN A 1 244 ? -22.007 2.486  -20.724 1.00 71.51 ? 244  ASN A ND2 1 
ATOM   1882 N N   . VAL A 1 245 ? -18.140 2.140  -16.897 1.00 64.02 ? 245  VAL A N   1 
ATOM   1883 C CA  . VAL A 1 245 ? -17.061 1.346  -16.313 1.00 63.40 ? 245  VAL A CA  1 
ATOM   1884 C C   . VAL A 1 245 ? -17.066 1.488  -14.820 1.00 72.90 ? 245  VAL A C   1 
ATOM   1885 O O   . VAL A 1 245 ? -16.420 0.713  -14.140 1.00 72.98 ? 245  VAL A O   1 
ATOM   1886 C CB  . VAL A 1 245 ? -15.681 1.622  -16.887 1.00 58.08 ? 245  VAL A CB  1 
ATOM   1887 C CG1 . VAL A 1 245 ? -15.694 1.572  -18.389 1.00 58.26 ? 245  VAL A CG1 1 
ATOM   1888 C CG2 . VAL A 1 245 ? -15.158 2.951  -16.409 1.00 59.94 ? 245  VAL A CG2 1 
ATOM   1889 N N   . LYS A 1 246 ? -17.745 2.515  -14.297 1.00 80.15 ? 246  LYS A N   1 
ATOM   1890 C CA  . LYS A 1 246 ? -17.787 2.737  -12.855 1.00 80.49 ? 246  LYS A CA  1 
ATOM   1891 C C   . LYS A 1 246 ? -18.916 1.956  -12.256 1.00 80.20 ? 246  LYS A C   1 
ATOM   1892 O O   . LYS A 1 246 ? -20.053 2.254  -12.535 1.00 82.92 ? 246  LYS A O   1 
ATOM   1893 C CB  . LYS A 1 246 ? -17.951 4.218  -12.506 1.00 82.50 ? 246  LYS A CB  1 
HETATM 1894 P P1  . GUO B 2 .   ? -4.020  14.924 -24.313 1.00 12.94 ? 1247 GUO A P1  1 
HETATM 1895 C C6  . GUO B 2 .   ? -2.652  16.679 -22.922 1.00 14.73 ? 1247 GUO A C6  1 
HETATM 1896 C C9  . GUO B 2 .   ? -2.475  17.151 -21.472 1.00 14.79 ? 1247 GUO A C9  1 
HETATM 1897 O O11 . GUO B 2 .   ? -1.496  18.231 -21.569 1.00 13.97 ? 1247 GUO A O11 1 
HETATM 1898 C C12 . GUO B 2 .   ? -3.761  17.797 -20.880 1.00 13.15 ? 1247 GUO A C12 1 
HETATM 1899 O O14 . GUO B 2 .   ? -3.731  17.802 -19.424 1.00 13.86 ? 1247 GUO A O14 1 
HETATM 1900 C C16 . GUO B 2 .   ? -3.574  19.211 -21.394 1.00 13.22 ? 1247 GUO A C16 1 
HETATM 1901 O O18 . GUO B 2 .   ? -4.349  20.211 -20.673 1.00 14.35 ? 1247 GUO A O18 1 
HETATM 1902 C C20 . GUO B 2 .   ? -2.118  19.413 -21.044 1.00 14.30 ? 1247 GUO A C20 1 
HETATM 1903 N N22 . GUO B 2 .   ? -1.587  20.522 -21.785 1.00 15.08 ? 1247 GUO A N22 1 
HETATM 1904 C C24 . GUO B 2 .   ? -0.615  21.349 -21.368 1.00 14.28 ? 1247 GUO A C24 1 
HETATM 1905 N N26 . GUO B 2 .   ? -0.115  21.318 -20.188 1.00 12.92 ? 1247 GUO A N26 1 
HETATM 1906 C C27 . GUO B 2 .   ? 0.968   22.134 -19.832 1.00 11.00 ? 1247 GUO A C27 1 
HETATM 1907 C C28 . GUO B 2 .   ? 2.164   22.376 -20.424 1.00 11.15 ? 1247 GUO A C28 1 
HETATM 1908 C C29 . GUO B 2 .   ? 2.699   21.934 -21.725 1.00 13.92 ? 1247 GUO A C29 1 
HETATM 1909 O O2P . GUO B 2 .   ? -5.359  14.203 -24.078 1.00 13.78 ? 1247 GUO A O2P 1 
HETATM 1910 O O30 . GUO B 2 .   ? 2.033   21.350 -22.567 1.00 13.02 ? 1247 GUO A O30 1 
HETATM 1911 N N31 . GUO B 2 .   ? 3.916   22.377 -22.045 1.00 13.60 ? 1247 GUO A N31 1 
HETATM 1912 N N34 . GUO B 2 .   ? 2.913   23.205 -19.601 1.00 12.15 ? 1247 GUO A N34 1 
HETATM 1913 C C35 . GUO B 2 .   ? 2.145   23.422 -18.547 1.00 12.61 ? 1247 GUO A C35 1 
HETATM 1914 N N37 . GUO B 2 .   ? 0.993   22.758 -18.643 1.00 12.77 ? 1247 GUO A N37 1 
HETATM 1915 C C38 . GUO B 2 .   ? -0.082  22.857 -17.625 1.00 11.14 ? 1247 GUO A C38 1 
HETATM 1916 O O3P . GUO B 2 .   ? -2.946  13.904 -24.671 1.00 14.00 ? 1247 GUO A O3P 1 
HETATM 1917 O O40 . GUO B 2 .   ? 0.039   24.173 -17.073 1.00 13.87 ? 1247 GUO A O40 1 
HETATM 1918 C C41 . GUO B 2 .   ? 0.019   21.952 -16.436 1.00 12.89 ? 1247 GUO A C41 1 
HETATM 1919 O O43 . GUO B 2 .   ? -0.554  20.699 -16.786 1.00 13.23 ? 1247 GUO A O43 1 
HETATM 1920 C C45 . GUO B 2 .   ? -0.876  22.677 -15.455 1.00 13.89 ? 1247 GUO A C45 1 
HETATM 1921 O O47 . GUO B 2 .   ? -2.262  22.550 -15.836 1.00 14.86 ? 1247 GUO A O47 1 
HETATM 1922 C C49 . GUO B 2 .   ? -0.408  24.106 -15.683 1.00 12.11 ? 1247 GUO A C49 1 
HETATM 1923 O O4P . GUO B 2 .   ? -4.141  16.003 -25.403 1.00 13.42 ? 1247 GUO A O4P 1 
HETATM 1924 C C51 . GUO B 2 .   ? 0.811   24.366 -14.794 1.00 13.76 ? 1247 GUO A C51 1 
HETATM 1925 O O54 . GUO B 2 .   ? 1.235   25.679 -15.059 1.00 15.03 ? 1247 GUO A O54 1 
HETATM 1926 P P55 . GUO B 2 .   ? 2.263   26.397 -14.006 1.00 16.15 ? 1247 GUO A P55 1 
HETATM 1927 O O56 . GUO B 2 .   ? 1.543   26.532 -12.655 1.00 15.31 ? 1247 GUO A O56 1 
HETATM 1928 O O57 . GUO B 2 .   ? 2.614   27.764 -14.577 1.00 16.11 ? 1247 GUO A O57 1 
HETATM 1929 O O58 . GUO B 2 .   ? 3.537   25.573 -13.881 1.00 15.58 ? 1247 GUO A O58 1 
HETATM 1930 O O5P . GUO B 2 .   ? -3.669  15.677 -22.958 1.00 11.55 ? 1247 GUO A O5P 1 
HETATM 1931 O O   . HOH C 3 .   ? -18.289 12.200 -17.055 1.00 25.37 ? 2001 HOH A O   1 
HETATM 1932 O O   . HOH C 3 .   ? -17.978 15.268 -17.886 1.00 25.29 ? 2002 HOH A O   1 
HETATM 1933 O O   . HOH C 3 .   ? -10.371 18.892 -26.338 1.00 15.78 ? 2003 HOH A O   1 
HETATM 1934 O O   . HOH C 3 .   ? -6.792  19.892 -26.101 1.00 20.98 ? 2004 HOH A O   1 
HETATM 1935 O O   . HOH C 3 .   ? 3.845   30.809 -26.157 1.00 42.22 ? 2005 HOH A O   1 
HETATM 1936 O O   . HOH C 3 .   ? -7.679  35.860 -27.561 1.00 45.48 ? 2006 HOH A O   1 
HETATM 1937 O O   . HOH C 3 .   ? -11.971 33.722 -28.382 1.00 37.47 ? 2007 HOH A O   1 
HETATM 1938 O O   . HOH C 3 .   ? -6.320  22.334 -27.036 1.00 15.58 ? 2008 HOH A O   1 
HETATM 1939 O O   . HOH C 3 .   ? -1.105  19.897 -25.732 1.00 19.73 ? 2009 HOH A O   1 
HETATM 1940 O O   . HOH C 3 .   ? -4.766  19.196 -24.850 1.00 36.98 ? 2010 HOH A O   1 
HETATM 1941 O O   . HOH C 3 .   ? 9.709   8.196  -22.288 1.00 40.40 ? 2011 HOH A O   1 
HETATM 1942 O O   . HOH C 3 .   ? -0.960  30.759 -31.790 1.00 30.87 ? 2012 HOH A O   1 
HETATM 1943 O O   . HOH C 3 .   ? -3.616  33.511 -32.713 1.00 48.64 ? 2013 HOH A O   1 
HETATM 1944 O O   . HOH C 3 .   ? 2.293   32.819 -27.083 1.00 36.92 ? 2014 HOH A O   1 
HETATM 1945 O O   . HOH C 3 .   ? -5.363  35.687 -25.731 1.00 27.58 ? 2015 HOH A O   1 
HETATM 1946 O O   . HOH C 3 .   ? -9.495  33.538 -29.074 1.00 31.25 ? 2016 HOH A O   1 
HETATM 1947 O O   . HOH C 3 .   ? -15.978 32.843 -30.306 1.00 37.34 ? 2017 HOH A O   1 
HETATM 1948 O O   . HOH C 3 .   ? -25.082 23.151 -22.017 1.00 39.98 ? 2018 HOH A O   1 
HETATM 1949 O O   . HOH C 3 .   ? -22.666 26.718 -22.272 1.00 38.61 ? 2019 HOH A O   1 
HETATM 1950 O O   . HOH C 3 .   ? -18.762 33.008 -29.217 1.00 46.45 ? 2020 HOH A O   1 
HETATM 1951 O O   . HOH C 3 .   ? -22.617 32.892 -22.808 1.00 54.34 ? 2021 HOH A O   1 
HETATM 1952 O O   . HOH C 3 .   ? 1.965   13.259 -32.603 1.00 26.41 ? 2022 HOH A O   1 
HETATM 1953 O O   . HOH C 3 .   ? 4.547   15.271 -33.382 1.00 36.02 ? 2023 HOH A O   1 
HETATM 1954 O O   . HOH C 3 .   ? 7.363   33.201 -24.155 1.00 30.89 ? 2024 HOH A O   1 
HETATM 1955 O O   . HOH C 3 .   ? 8.469   17.289 -23.966 1.00 22.53 ? 2025 HOH A O   1 
HETATM 1956 O O   . HOH C 3 .   ? 9.409   15.717 -26.267 1.00 23.77 ? 2026 HOH A O   1 
HETATM 1957 O O   . HOH C 3 .   ? 8.600   9.232  -26.061 1.00 46.03 ? 2027 HOH A O   1 
HETATM 1958 O O   . HOH C 3 .   ? 9.500   10.366 -24.176 1.00 41.73 ? 2028 HOH A O   1 
HETATM 1959 O O   . HOH C 3 .   ? 7.719   22.242 -22.749 1.00 16.16 ? 2029 HOH A O   1 
HETATM 1960 O O   . HOH C 3 .   ? -4.086  38.952 -23.381 1.00 42.95 ? 2030 HOH A O   1 
HETATM 1961 O O   . HOH C 3 .   ? -4.742  38.338 -12.361 1.00 44.36 ? 2031 HOH A O   1 
HETATM 1962 O O   . HOH C 3 .   ? 11.292  23.055 -27.992 1.00 29.86 ? 2032 HOH A O   1 
HETATM 1963 O O   . HOH C 3 .   ? 9.019   23.236 -25.107 1.00 22.42 ? 2033 HOH A O   1 
HETATM 1964 O O   . HOH C 3 .   ? 9.932   16.785 -28.698 1.00 23.65 ? 2034 HOH A O   1 
HETATM 1965 O O   . HOH C 3 .   ? -18.119 35.904 -25.180 1.00 37.25 ? 2035 HOH A O   1 
HETATM 1966 O O   . HOH C 3 .   ? -17.632 37.784 -20.991 1.00 41.74 ? 2036 HOH A O   1 
HETATM 1967 O O   . HOH C 3 .   ? 5.139   24.124 -33.883 1.00 28.50 ? 2037 HOH A O   1 
HETATM 1968 O O   . HOH C 3 .   ? -18.866 30.964 -13.928 1.00 40.79 ? 2038 HOH A O   1 
HETATM 1969 O O   . HOH C 3 .   ? 1.324   29.411 -32.377 1.00 31.88 ? 2039 HOH A O   1 
HETATM 1970 O O   . HOH C 3 .   ? 3.320   30.446 -31.475 1.00 42.99 ? 2040 HOH A O   1 
HETATM 1971 O O   . HOH C 3 .   ? 4.709   21.607 -35.989 1.00 29.50 ? 2041 HOH A O   1 
HETATM 1972 O O   . HOH C 3 .   ? -1.418  22.966 -37.329 1.00 29.27 ? 2042 HOH A O   1 
HETATM 1973 O O   . HOH C 3 .   ? -11.313 26.329 -31.703 1.00 22.44 ? 2043 HOH A O   1 
HETATM 1974 O O   . HOH C 3 .   ? -10.867 24.528 -36.412 1.00 40.26 ? 2044 HOH A O   1 
HETATM 1975 O O   . HOH C 3 .   ? -10.013 40.410 -9.299  1.00 44.14 ? 2045 HOH A O   1 
HETATM 1976 O O   . HOH C 3 .   ? -13.580 39.373 -12.440 1.00 44.78 ? 2046 HOH A O   1 
HETATM 1977 O O   . HOH C 3 .   ? -8.658  24.832 -37.714 1.00 46.37 ? 2047 HOH A O   1 
HETATM 1978 O O   . HOH C 3 .   ? -10.755 29.751 -36.195 1.00 46.84 ? 2048 HOH A O   1 
HETATM 1979 O O   . HOH C 3 .   ? -12.600 32.157 -35.553 1.00 48.94 ? 2049 HOH A O   1 
HETATM 1980 O O   . HOH C 3 .   ? -13.972 26.077 -3.082  1.00 50.16 ? 2050 HOH A O   1 
HETATM 1981 O O   . HOH C 3 .   ? -11.624 15.162 -9.487  1.00 37.87 ? 2051 HOH A O   1 
HETATM 1982 O O   . HOH C 3 .   ? -12.558 35.652 -30.568 1.00 50.70 ? 2052 HOH A O   1 
HETATM 1983 O O   . HOH C 3 .   ? -12.041 27.171 -35.791 1.00 29.47 ? 2053 HOH A O   1 
HETATM 1984 O O   . HOH C 3 .   ? -13.955 31.836 -28.961 1.00 26.37 ? 2054 HOH A O   1 
HETATM 1985 O O   . HOH C 3 .   ? 8.901   29.650 -11.210 1.00 34.76 ? 2055 HOH A O   1 
HETATM 1986 O O   . HOH C 3 .   ? 12.446  21.622 -3.537  1.00 29.70 ? 2056 HOH A O   1 
HETATM 1987 O O   . HOH C 3 .   ? -21.091 25.985 -29.919 1.00 39.90 ? 2057 HOH A O   1 
HETATM 1988 O O   . HOH C 3 .   ? -16.447 20.963 -29.488 1.00 24.15 ? 2058 HOH A O   1 
HETATM 1989 O O   . HOH C 3 .   ? -13.824 19.846 -30.321 1.00 27.92 ? 2059 HOH A O   1 
HETATM 1990 O O   . HOH C 3 .   ? -11.707 20.524 -34.621 1.00 23.33 ? 2060 HOH A O   1 
HETATM 1991 O O   . HOH C 3 .   ? -23.572 24.632 -23.937 1.00 34.10 ? 2061 HOH A O   1 
HETATM 1992 O O   . HOH C 3 .   ? -22.524 27.752 -28.895 1.00 57.27 ? 2062 HOH A O   1 
HETATM 1993 O O   . HOH C 3 .   ? -20.384 31.085 -28.702 1.00 46.05 ? 2063 HOH A O   1 
HETATM 1994 O O   . HOH C 3 .   ? -21.771 32.817 -25.786 1.00 39.27 ? 2064 HOH A O   1 
HETATM 1995 O O   . HOH C 3 .   ? -22.566 19.626 -28.346 1.00 42.20 ? 2065 HOH A O   1 
HETATM 1996 O O   . HOH C 3 .   ? -17.345 22.559 -31.264 1.00 20.11 ? 2066 HOH A O   1 
HETATM 1997 O O   . HOH C 3 .   ? -24.054 22.462 -19.410 1.00 42.84 ? 2067 HOH A O   1 
HETATM 1998 O O   . HOH C 3 .   ? -22.789 19.946 -19.268 1.00 29.14 ? 2068 HOH A O   1 
HETATM 1999 O O   . HOH C 3 .   ? -23.723 13.142 -21.785 1.00 36.89 ? 2069 HOH A O   1 
HETATM 2000 O O   . HOH C 3 .   ? 13.462  11.498 -17.874 1.00 31.23 ? 2070 HOH A O   1 
HETATM 2001 O O   . HOH C 3 .   ? 9.144   11.688 -20.331 1.00 24.86 ? 2071 HOH A O   1 
HETATM 2002 O O   . HOH C 3 .   ? 7.302   4.667  -17.651 1.00 35.10 ? 2072 HOH A O   1 
HETATM 2003 O O   . HOH C 3 .   ? 5.122   4.921  -13.193 1.00 32.76 ? 2073 HOH A O   1 
HETATM 2004 O O   . HOH C 3 .   ? 10.931  8.241  -6.238  1.00 23.64 ? 2074 HOH A O   1 
HETATM 2005 O O   . HOH C 3 .   ? -21.082 19.977 -13.283 1.00 30.64 ? 2075 HOH A O   1 
HETATM 2006 O O   . HOH C 3 .   ? -3.075  20.071 -17.930 1.00 14.12 ? 2076 HOH A O   1 
HETATM 2007 O O   . HOH C 3 .   ? 14.728  21.196 -4.840  1.00 45.55 ? 2077 HOH A O   1 
HETATM 2008 O O   . HOH C 3 .   ? -3.200  32.081 -16.925 1.00 25.16 ? 2078 HOH A O   1 
HETATM 2009 O O   . HOH C 3 .   ? 4.729   32.855 -23.950 1.00 26.97 ? 2079 HOH A O   1 
HETATM 2010 O O   . HOH C 3 .   ? 4.890   27.599 -15.988 1.00 17.46 ? 2080 HOH A O   1 
HETATM 2011 O O   . HOH C 3 .   ? 7.889   29.283 -17.642 1.00 25.94 ? 2081 HOH A O   1 
HETATM 2012 O O   . HOH C 3 .   ? 8.207   32.710 -26.532 1.00 39.62 ? 2082 HOH A O   1 
HETATM 2013 O O   . HOH C 3 .   ? 7.874   35.949 -23.776 1.00 37.70 ? 2083 HOH A O   1 
HETATM 2014 O O   . HOH C 3 .   ? 0.495   37.997 -16.585 1.00 40.04 ? 2084 HOH A O   1 
HETATM 2015 O O   . HOH C 3 .   ? -0.939  37.143 -23.849 1.00 39.52 ? 2085 HOH A O   1 
HETATM 2016 O O   . HOH C 3 .   ? -4.041  1.555  -28.913 1.00 58.68 ? 2086 HOH A O   1 
HETATM 2017 O O   . HOH C 3 .   ? -5.101  35.745 -12.233 1.00 27.97 ? 2087 HOH A O   1 
HETATM 2018 O O   . HOH C 3 .   ? 1.234   35.264 -12.991 1.00 29.29 ? 2088 HOH A O   1 
HETATM 2019 O O   . HOH C 3 .   ? -0.920  -0.472 -6.698  1.00 50.54 ? 2089 HOH A O   1 
HETATM 2020 O O   . HOH C 3 .   ? -12.528 39.474 -20.537 1.00 40.44 ? 2090 HOH A O   1 
HETATM 2021 O O   . HOH C 3 .   ? -6.318  37.336 -23.558 1.00 25.98 ? 2091 HOH A O   1 
HETATM 2022 O O   . HOH C 3 .   ? -11.300 11.078 -3.228  1.00 42.60 ? 2092 HOH A O   1 
HETATM 2023 O O   . HOH C 3 .   ? -15.100 35.478 -15.951 1.00 30.62 ? 2093 HOH A O   1 
HETATM 2024 O O   . HOH C 3 .   ? -18.323 35.042 -22.477 1.00 31.80 ? 2094 HOH A O   1 
HETATM 2025 O O   . HOH C 3 .   ? -12.440 40.046 -23.444 1.00 49.42 ? 2095 HOH A O   1 
HETATM 2026 O O   . HOH C 3 .   ? -13.787 34.123 -26.365 1.00 43.75 ? 2096 HOH A O   1 
HETATM 2027 O O   . HOH C 3 .   ? -17.740 28.598 -15.440 1.00 25.58 ? 2097 HOH A O   1 
HETATM 2028 O O   . HOH C 3 .   ? -22.969 25.228 -19.951 1.00 41.65 ? 2098 HOH A O   1 
HETATM 2029 O O   . HOH C 3 .   ? -16.130 27.802 -13.414 1.00 23.32 ? 2099 HOH A O   1 
HETATM 2030 O O   . HOH C 3 .   ? -0.819  27.786 -13.113 1.00 16.30 ? 2100 HOH A O   1 
HETATM 2031 O O   . HOH C 3 .   ? 2.622   27.744 -10.392 1.00 18.17 ? 2101 HOH A O   1 
HETATM 2032 O O   . HOH C 3 .   ? -21.946 5.396  -26.222 1.00 41.49 ? 2102 HOH A O   1 
HETATM 2033 O O   . HOH C 3 .   ? 8.510   29.875 -15.247 1.00 34.23 ? 2103 HOH A O   1 
HETATM 2034 O O   . HOH C 3 .   ? 1.774   34.833 -3.211  1.00 30.72 ? 2104 HOH A O   1 
HETATM 2035 O O   . HOH C 3 .   ? 1.357   34.464 -0.508  1.00 42.59 ? 2105 HOH A O   1 
HETATM 2036 O O   . HOH C 3 .   ? -6.404  39.615 -7.062  1.00 40.18 ? 2106 HOH A O   1 
HETATM 2037 O O   . HOH C 3 .   ? -3.080  38.911 -10.343 1.00 44.85 ? 2107 HOH A O   1 
HETATM 2038 O O   . HOH C 3 .   ? -11.274 35.676 -5.059  1.00 34.04 ? 2108 HOH A O   1 
HETATM 2039 O O   . HOH C 3 .   ? -9.046  39.611 -7.269  1.00 38.44 ? 2109 HOH A O   1 
HETATM 2040 O O   . HOH C 3 .   ? -11.025 38.818 -11.321 1.00 41.10 ? 2110 HOH A O   1 
HETATM 2041 O O   . HOH C 3 .   ? -14.959 30.634 -8.022  1.00 32.26 ? 2111 HOH A O   1 
HETATM 2042 O O   . HOH C 3 .   ? -14.150 26.555 -5.755  1.00 43.77 ? 2112 HOH A O   1 
HETATM 2043 O O   . HOH C 3 .   ? -13.244 17.172 -11.065 1.00 44.34 ? 2113 HOH A O   1 
HETATM 2044 O O   . HOH C 3 .   ? -13.286 21.488 -6.135  1.00 38.56 ? 2114 HOH A O   1 
HETATM 2045 O O   . HOH C 3 .   ? 4.372   20.710 -9.804  1.00 34.09 ? 2115 HOH A O   1 
HETATM 2046 O O   . HOH C 3 .   ? 7.149   29.949 -9.001  1.00 31.79 ? 2116 HOH A O   1 
HETATM 2047 O O   . HOH C 3 .   ? 9.698   21.152 -3.713  1.00 27.64 ? 2117 HOH A O   1 
HETATM 2048 O O   . HOH C 3 .   ? 11.935  24.455 -3.954  1.00 37.52 ? 2118 HOH A O   1 
HETATM 2049 O O   . HOH C 3 .   ? 9.404   27.559 -12.143 1.00 51.12 ? 2119 HOH A O   1 
HETATM 2050 O O   . HOH C 3 .   ? 8.181   31.223 -6.637  1.00 35.13 ? 2120 HOH A O   1 
HETATM 2051 O O   . HOH C 3 .   ? 10.688  30.698 -2.880  1.00 45.50 ? 2121 HOH A O   1 
HETATM 2052 O O   . HOH C 3 .   ? 8.569   29.219 0.107   1.00 37.00 ? 2122 HOH A O   1 
HETATM 2053 O O   . HOH C 3 .   ? 3.298   29.067 4.869   1.00 41.47 ? 2123 HOH A O   1 
HETATM 2054 O O   . HOH C 3 .   ? 1.722   32.524 1.150   1.00 44.73 ? 2124 HOH A O   1 
HETATM 2055 O O   . HOH C 3 .   ? -2.506  32.374 4.144   1.00 34.99 ? 2125 HOH A O   1 
HETATM 2056 O O   . HOH C 3 .   ? -10.434 36.166 -1.966  1.00 46.32 ? 2126 HOH A O   1 
HETATM 2057 O O   . HOH C 3 .   ? -11.784 26.029 -1.088  1.00 33.26 ? 2127 HOH A O   1 
HETATM 2058 O O   . HOH C 3 .   ? -8.202  23.424 3.064   1.00 49.19 ? 2128 HOH A O   1 
HETATM 2059 O O   . HOH C 3 .   ? -6.307  20.409 -3.321  1.00 18.38 ? 2129 HOH A O   1 
HETATM 2060 O O   . HOH C 3 .   ? 4.153   19.610 -12.809 1.00 16.86 ? 2130 HOH A O   1 
HETATM 2061 O O   . HOH C 3 .   ? 3.173   21.294 -14.898 1.00 18.95 ? 2131 HOH A O   1 
HETATM 2062 O O   . HOH C 3 .   ? 12.828  12.027 -15.398 1.00 24.33 ? 2132 HOH A O   1 
HETATM 2063 O O   . HOH C 3 .   ? 9.805   14.990 -22.845 1.00 30.20 ? 2133 HOH A O   1 
HETATM 2064 O O   . HOH C 3 .   ? 9.209   20.311 -23.293 1.00 40.85 ? 2134 HOH A O   1 
HETATM 2065 O O   . HOH C 3 .   ? 7.317   9.862  -18.870 1.00 20.17 ? 2135 HOH A O   1 
HETATM 2066 O O   . HOH C 3 .   ? 8.332   7.566  -19.789 1.00 36.52 ? 2136 HOH A O   1 
HETATM 2067 O O   . HOH C 3 .   ? 11.359  10.291 -19.813 1.00 42.24 ? 2137 HOH A O   1 
HETATM 2068 O O   . HOH C 3 .   ? 10.373  4.064  -16.319 1.00 51.57 ? 2138 HOH A O   1 
HETATM 2069 O O   . HOH C 3 .   ? 16.058  8.277  -10.676 1.00 28.61 ? 2139 HOH A O   1 
HETATM 2070 O O   . HOH C 3 .   ? 11.455  4.788  -8.646  1.00 45.57 ? 2140 HOH A O   1 
HETATM 2071 O O   . HOH C 3 .   ? 7.470   4.692  -11.665 1.00 33.70 ? 2141 HOH A O   1 
HETATM 2072 O O   . HOH C 3 .   ? 8.719   5.997  -8.581  1.00 32.28 ? 2142 HOH A O   1 
HETATM 2073 O O   . HOH C 3 .   ? 12.967  6.835  -7.280  1.00 30.64 ? 2143 HOH A O   1 
HETATM 2074 O O   . HOH C 3 .   ? 8.971   8.590  -8.118  1.00 20.54 ? 2144 HOH A O   1 
HETATM 2075 O O   . HOH C 3 .   ? 10.675  16.630 -14.983 1.00 31.32 ? 2145 HOH A O   1 
HETATM 2076 O O   . HOH C 3 .   ? 16.943  17.072 -12.793 1.00 35.12 ? 2146 HOH A O   1 
HETATM 2077 O O   . HOH C 3 .   ? 14.887  13.237 -11.184 1.00 39.00 ? 2147 HOH A O   1 
HETATM 2078 O O   . HOH C 3 .   ? 4.508   23.739 -15.816 1.00 16.20 ? 2148 HOH A O   1 
HETATM 2079 O O   . HOH C 3 .   ? 9.767   25.991 -25.036 1.00 33.22 ? 2149 HOH A O   1 
HETATM 2080 O O   . HOH C 3 .   ? 11.918  28.924 -22.981 1.00 49.45 ? 2150 HOH A O   1 
HETATM 2081 O O   . HOH C 3 .   ? 15.690  21.390 -16.644 1.00 45.59 ? 2151 HOH A O   1 
HETATM 2082 O O   . HOH C 3 .   ? 15.505  19.835 -7.042  1.00 35.67 ? 2152 HOH A O   1 
HETATM 2083 O O   . HOH C 3 .   ? 14.309  13.691 -6.839  1.00 44.44 ? 2153 HOH A O   1 
HETATM 2084 O O   . HOH C 3 .   ? 12.196  13.686 -4.755  1.00 24.18 ? 2154 HOH A O   1 
HETATM 2085 O O   . HOH C 3 .   ? 10.541  10.072 -4.249  1.00 22.01 ? 2155 HOH A O   1 
HETATM 2086 O O   . HOH C 3 .   ? 5.477   5.676  -4.754  1.00 34.17 ? 2156 HOH A O   1 
HETATM 2087 O O   . HOH C 3 .   ? 14.478  16.843 -3.602  1.00 38.02 ? 2157 HOH A O   1 
HETATM 2088 O O   . HOH C 3 .   ? 9.043   19.862 -1.338  1.00 28.18 ? 2158 HOH A O   1 
HETATM 2089 O O   . HOH C 3 .   ? 13.557  19.340 -0.676  1.00 40.43 ? 2159 HOH A O   1 
HETATM 2090 O O   . HOH C 3 .   ? 1.333   9.483  3.149   1.00 34.85 ? 2160 HOH A O   1 
HETATM 2091 O O   . HOH C 3 .   ? -2.853  18.580 9.227   1.00 38.25 ? 2161 HOH A O   1 
HETATM 2092 O O   . HOH C 3 .   ? -8.578  18.152 2.356   1.00 41.79 ? 2162 HOH A O   1 
HETATM 2093 O O   . HOH C 3 .   ? -7.364  14.641 0.855   1.00 39.38 ? 2163 HOH A O   1 
HETATM 2094 O O   . HOH C 3 .   ? -9.412  16.040 -8.724  1.00 18.99 ? 2164 HOH A O   1 
HETATM 2095 O O   . HOH C 3 .   ? -13.286 14.843 -7.407  1.00 36.43 ? 2165 HOH A O   1 
HETATM 2096 O O   . HOH C 3 .   ? 5.745   6.469  -19.533 1.00 44.33 ? 2166 HOH A O   1 
HETATM 2097 O O   . HOH C 3 .   ? 8.519   12.700 -22.869 1.00 27.34 ? 2167 HOH A O   1 
HETATM 2098 O O   . HOH C 3 .   ? 4.303   8.200  -26.265 1.00 38.06 ? 2168 HOH A O   1 
HETATM 2099 O O   . HOH C 3 .   ? 5.703   6.540  -22.961 1.00 32.99 ? 2169 HOH A O   1 
HETATM 2100 O O   . HOH C 3 .   ? -0.147  2.868  -24.169 1.00 42.15 ? 2170 HOH A O   1 
HETATM 2101 O O   . HOH C 3 .   ? 0.576   2.576  -20.334 1.00 45.03 ? 2171 HOH A O   1 
HETATM 2102 O O   . HOH C 3 .   ? 5.277   4.178  -20.245 1.00 51.88 ? 2172 HOH A O   1 
HETATM 2103 O O   . HOH C 3 .   ? -3.315  12.200 -26.708 1.00 16.60 ? 2173 HOH A O   1 
HETATM 2104 O O   . HOH C 3 .   ? -0.366  7.300  -31.409 1.00 45.43 ? 2174 HOH A O   1 
HETATM 2105 O O   . HOH C 3 .   ? 1.639   10.638 -32.004 1.00 29.75 ? 2175 HOH A O   1 
HETATM 2106 O O   . HOH C 3 .   ? -4.424  4.787  -28.185 1.00 31.14 ? 2176 HOH A O   1 
HETATM 2107 O O   . HOH C 3 .   ? -3.323  2.539  -26.158 1.00 37.46 ? 2177 HOH A O   1 
HETATM 2108 O O   . HOH C 3 .   ? -0.149  3.090  -28.287 1.00 52.95 ? 2178 HOH A O   1 
HETATM 2109 O O   . HOH C 3 .   ? -5.431  4.844  -21.446 1.00 25.08 ? 2179 HOH A O   1 
HETATM 2110 O O   . HOH C 3 .   ? -2.255  2.999  -22.393 1.00 29.17 ? 2180 HOH A O   1 
HETATM 2111 O O   . HOH C 3 .   ? -6.355  10.753 -19.167 1.00 17.01 ? 2181 HOH A O   1 
HETATM 2112 O O   . HOH C 3 .   ? -0.994  9.448  -18.937 1.00 18.59 ? 2182 HOH A O   1 
HETATM 2113 O O   . HOH C 3 .   ? 0.532   1.145  -18.091 1.00 36.18 ? 2183 HOH A O   1 
HETATM 2114 O O   . HOH C 3 .   ? 5.354   4.251  -15.915 1.00 25.89 ? 2184 HOH A O   1 
HETATM 2115 O O   . HOH C 3 .   ? 3.521   3.132  -11.743 1.00 39.72 ? 2185 HOH A O   1 
HETATM 2116 O O   . HOH C 3 .   ? 0.847   0.050  -11.100 1.00 42.86 ? 2186 HOH A O   1 
HETATM 2117 O O   . HOH C 3 .   ? -5.256  2.014  -7.720  1.00 31.55 ? 2187 HOH A O   1 
HETATM 2118 O O   . HOH C 3 .   ? -6.676  -0.686 -12.775 1.00 45.15 ? 2188 HOH A O   1 
HETATM 2119 O O   . HOH C 3 .   ? 0.368   1.431  -5.065  1.00 45.66 ? 2189 HOH A O   1 
HETATM 2120 O O   . HOH C 3 .   ? -6.689  8.158  -5.035  1.00 25.64 ? 2190 HOH A O   1 
HETATM 2121 O O   . HOH C 3 .   ? -0.393  1.279  -2.244  1.00 45.83 ? 2191 HOH A O   1 
HETATM 2122 O O   . HOH C 3 .   ? -5.333  2.175  -1.346  1.00 49.15 ? 2192 HOH A O   1 
HETATM 2123 O O   . HOH C 3 .   ? -0.956  8.373  1.840   1.00 36.80 ? 2193 HOH A O   1 
HETATM 2124 O O   . HOH C 3 .   ? -10.370 13.067 -2.037  1.00 32.97 ? 2194 HOH A O   1 
HETATM 2125 O O   . HOH C 3 .   ? -8.076  9.432  -7.335  1.00 20.36 ? 2195 HOH A O   1 
HETATM 2126 O O   . HOH C 3 .   ? -9.889  9.496  -4.702  1.00 34.50 ? 2196 HOH A O   1 
HETATM 2127 O O   . HOH C 3 .   ? -5.460  12.332 -22.185 1.00 14.62 ? 2197 HOH A O   1 
HETATM 2128 O O   . HOH C 3 .   ? -6.611  12.938 -26.103 1.00 18.37 ? 2198 HOH A O   1 
HETATM 2129 O O   . HOH C 3 .   ? -11.666 2.525  -28.919 1.00 41.26 ? 2199 HOH A O   1 
HETATM 2130 O O   . HOH C 3 .   ? -6.210  2.023  -27.624 1.00 52.92 ? 2200 HOH A O   1 
HETATM 2131 O O   . HOH C 3 .   ? -12.811 5.205  -29.886 1.00 30.83 ? 2201 HOH A O   1 
HETATM 2132 O O   . HOH C 3 .   ? -10.049 -0.862 -22.570 1.00 29.63 ? 2202 HOH A O   1 
HETATM 2133 O O   . HOH C 3 .   ? -14.585 0.027  -24.303 1.00 50.67 ? 2203 HOH A O   1 
HETATM 2134 O O   . HOH C 3 .   ? -4.847  2.323  -22.771 1.00 27.44 ? 2204 HOH A O   1 
HETATM 2135 O O   . HOH C 3 .   ? -11.131 -1.872 -19.748 1.00 47.96 ? 2205 HOH A O   1 
HETATM 2136 O O   . HOH C 3 .   ? -6.376  -1.262 -18.021 1.00 29.82 ? 2206 HOH A O   1 
HETATM 2137 O O   . HOH C 3 .   ? -8.087  0.124  -15.020 1.00 37.71 ? 2207 HOH A O   1 
HETATM 2138 O O   . HOH C 3 .   ? -12.942 6.225  -9.949  1.00 44.95 ? 2208 HOH A O   1 
HETATM 2139 O O   . HOH C 3 .   ? -15.187 11.080 -9.899  1.00 39.30 ? 2209 HOH A O   1 
HETATM 2140 O O   . HOH C 3 .   ? -15.041 15.743 -30.309 1.00 29.21 ? 2210 HOH A O   1 
HETATM 2141 O O   . HOH C 3 .   ? -10.049 18.297 -36.000 1.00 31.07 ? 2211 HOH A O   1 
HETATM 2142 O O   . HOH C 3 .   ? -12.481 14.674 -37.508 1.00 32.41 ? 2212 HOH A O   1 
HETATM 2143 O O   . HOH C 3 .   ? -16.386 11.673 -33.446 1.00 31.18 ? 2213 HOH A O   1 
HETATM 2144 O O   . HOH C 3 .   ? -14.485 12.558 -36.419 1.00 37.90 ? 2214 HOH A O   1 
HETATM 2145 O O   . HOH C 3 .   ? -16.251 14.178 -32.232 1.00 26.62 ? 2215 HOH A O   1 
HETATM 2146 O O   . HOH C 3 .   ? -22.081 10.952 -29.767 1.00 33.15 ? 2216 HOH A O   1 
HETATM 2147 O O   . HOH C 3 .   ? -17.409 16.079 -28.648 1.00 24.74 ? 2217 HOH A O   1 
HETATM 2148 O O   . HOH C 3 .   ? -23.071 7.776  -26.077 1.00 47.93 ? 2218 HOH A O   1 
HETATM 2149 O O   . HOH C 3 .   ? -23.232 10.429 -22.310 1.00 36.68 ? 2219 HOH A O   1 
HETATM 2150 O O   . HOH C 3 .   ? -19.199 5.068  -25.379 1.00 32.78 ? 2220 HOH A O   1 
HETATM 2151 O O   . HOH C 3 .   ? -17.548 9.245  -32.717 1.00 36.07 ? 2221 HOH A O   1 
HETATM 2152 O O   . HOH C 3 .   ? -22.582 7.173  -30.043 1.00 47.12 ? 2222 HOH A O   1 
HETATM 2153 O O   . HOH C 3 .   ? -23.879 8.718  -20.026 1.00 46.29 ? 2223 HOH A O   1 
HETATM 2154 O O   . HOH C 3 .   ? -16.155 1.524  -23.263 1.00 41.23 ? 2224 HOH A O   1 
HETATM 2155 O O   . HOH C 3 .   ? 0.592   19.135 -23.643 1.00 15.77 ? 2225 HOH A O   1 
HETATM 2156 O O   . HOH C 3 .   ? -2.553  17.570 -26.617 1.00 23.11 ? 2226 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 0.2233 0.3401 0.3629 -0.0076 0.0310  0.1642  1   MET A N   
2    C CA  . MET A 1   ? 0.2149 0.3309 0.3492 -0.0015 0.0369  0.1525  1   MET A CA  
3    C C   . MET A 1   ? 0.1890 0.2865 0.3191 -0.0030 0.0297  0.1329  1   MET A C   
4    O O   . MET A 1   ? 0.2034 0.2896 0.3223 -0.0029 0.0257  0.1288  1   MET A O   
5    C CB  . MET A 1   ? 0.3639 0.4756 0.4655 0.0101  0.0569  0.1527  1   MET A CB  
6    C CG  . MET A 1   ? 0.4798 0.5945 0.5887 0.0244  0.0695  0.1521  1   MET A CG  
7    S SD  . MET A 1   ? 1.0569 1.1272 1.1113 0.0390  0.1081  0.1420  1   MET A SD  
8    C CE  . MET A 1   ? 0.5385 0.5800 0.5302 0.0095  0.0942  0.1256  1   MET A CE  
9    N N   . ILE A 2   ? 0.1508 0.2538 0.2903 -0.0100 0.0265  0.1269  2   ILE A N   
10   C CA  . ILE A 2   ? 0.1395 0.2276 0.2687 -0.0147 0.0218  0.1077  2   ILE A CA  
11   C C   . ILE A 2   ? 0.1344 0.2223 0.2431 0.0004  0.0256  0.1038  2   ILE A C   
12   O O   . ILE A 2   ? 0.1518 0.2539 0.2631 0.0118  0.0370  0.1175  2   ILE A O   
13   C CB  . ILE A 2   ? 0.1589 0.2576 0.2920 -0.0406 0.0150  0.1064  2   ILE A CB  
14   C CG1 . ILE A 2   ? 0.2212 0.2991 0.3563 -0.0655 0.0182  0.1050  2   ILE A CG1 
15   C CG2 . ILE A 2   ? 0.1727 0.2567 0.2879 -0.0500 0.0115  0.0860  2   ILE A CG2 
16   C CD1 . ILE A 2   ? 0.2222 0.2471 0.3569 -0.0611 0.0350  0.0880  2   ILE A CD1 
17   N N   . ILE A 3   ? 0.1338 0.2025 0.2244 0.0010  0.0215  0.0891  3   ILE A N   
18   C CA  . ILE A 3   ? 0.1434 0.1991 0.2036 0.0081  0.0262  0.0822  3   ILE A CA  
19   C C   . ILE A 3   ? 0.1308 0.1853 0.1921 0.0032  0.0167  0.0691  3   ILE A C   
20   O O   . ILE A 3   ? 0.1561 0.2027 0.2125 -0.0016 0.0099  0.0613  3   ILE A O   
21   C CB  . ILE A 3   ? 0.1773 0.2158 0.1995 0.0010  0.0260  0.0818  3   ILE A CB  
22   C CG1 . ILE A 3   ? 0.1867 0.2297 0.2020 -0.0027 0.0336  0.0958  3   ILE A CG1 
23   C CG2 . ILE A 3   ? 0.2179 0.2244 0.1897 -0.0016 0.0363  0.0699  3   ILE A CG2 
24   C CD1 . ILE A 3   ? 0.2679 0.3061 0.2389 -0.0264 0.0268  0.1034  3   ILE A CD1 
25   N N   . PRO A 4   ? 0.1250 0.1963 0.1988 0.0027  0.0163  0.0743  4   PRO A N   
26   C CA  . PRO A 4   ? 0.1242 0.1976 0.1931 -0.0066 0.0065  0.0637  4   PRO A CA  
27   C C   . PRO A 4   ? 0.1517 0.2004 0.1913 0.0020  0.0089  0.0543  4   PRO A C   
28   O O   . PRO A 4   ? 0.1776 0.2044 0.1961 0.0132  0.0245  0.0587  4   PRO A O   
29   C CB  . PRO A 4   ? 0.1208 0.2327 0.2150 -0.0114 0.0040  0.0875  4   PRO A CB  
30   C CG  . PRO A 4   ? 0.1169 0.2518 0.2347 -0.0120 0.0083  0.1086  4   PRO A CG  
31   C CD  . PRO A 4   ? 0.1379 0.2396 0.2390 0.0081  0.0237  0.1000  4   PRO A CD  
32   N N   . ALA A 5   ? 0.1263 0.1720 0.1581 -0.0073 -0.0016 0.0411  5   ALA A N   
33   C CA  . ALA A 5   ? 0.1313 0.1586 0.1326 -0.0078 -0.0044 0.0351  5   ALA A CA  
34   C C   . ALA A 5   ? 0.1355 0.1703 0.1369 -0.0128 -0.0118 0.0302  5   ALA A C   
35   O O   . ALA A 5   ? 0.1451 0.1984 0.1624 -0.0239 -0.0181 0.0248  5   ALA A O   
36   C CB  . ALA A 5   ? 0.1672 0.1982 0.1675 -0.0149 -0.0120 0.0369  5   ALA A CB  
37   N N   . LEU A 6   ? 0.1498 0.1625 0.1248 -0.0099 -0.0075 0.0307  6   LEU A N   
38   C CA  . LEU A 6   ? 0.1437 0.1620 0.1147 -0.0167 -0.0171 0.0279  6   LEU A CA  
39   C C   . LEU A 6   ? 0.1666 0.1600 0.0957 -0.0285 -0.0230 0.0202  6   LEU A C   
40   O O   . LEU A 6   ? 0.2267 0.1856 0.1149 -0.0352 -0.0142 0.0191  6   LEU A O   
41   C CB  . LEU A 6   ? 0.1736 0.1902 0.1582 -0.0053 -0.0052 0.0452  6   LEU A CB  
42   C CG  . LEU A 6   ? 0.1550 0.2196 0.1896 -0.0023 -0.0060 0.0704  6   LEU A CG  
43   C CD1 . LEU A 6   ? 0.1798 0.2558 0.2451 0.0124  0.0073  0.1046  6   LEU A CD1 
44   C CD2 . LEU A 6   ? 0.1414 0.2446 0.1830 -0.0307 -0.0292 0.0616  6   LEU A CD2 
45   N N   . ASN A 7   ? 0.1165 0.1686 0.1573 -0.0122 0.0174  0.0271  7   ASN A N   
46   C CA  . ASN A 7   ? 0.1223 0.1654 0.1531 -0.0113 0.0137  0.0285  7   ASN A CA  
47   C C   . ASN A 7   ? 0.1644 0.2027 0.1949 -0.0127 0.0064  0.0317  7   ASN A C   
48   O O   . ASN A 7   ? 0.1726 0.2159 0.2015 -0.0146 0.0045  0.0348  7   ASN A O   
49   C CB  . ASN A 7   ? 0.1289 0.1716 0.1550 -0.0154 0.0170  0.0291  7   ASN A CB  
50   C CG  . ASN A 7   ? 0.1488 0.1910 0.1734 -0.0117 0.0259  0.0297  7   ASN A CG  
51   O OD1 . ASN A 7   ? 0.1869 0.2275 0.2096 -0.0133 0.0294  0.0301  7   ASN A OD1 
52   N ND2 . ASN A 7   ? 0.1490 0.1920 0.1740 -0.0049 0.0313  0.0313  7   ASN A ND2 
53   N N   . LEU A 8   ? 0.1389 0.1670 0.1711 -0.0104 0.0026  0.0307  8   LEU A N   
54   C CA  . LEU A 8   ? 0.1596 0.1765 0.1946 -0.0103 -0.0016 0.0370  8   LEU A CA  
55   C C   . LEU A 8   ? 0.1855 0.1915 0.2270 -0.0175 -0.0009 0.0398  8   LEU A C   
56   O O   . LEU A 8   ? 0.1695 0.1732 0.2191 -0.0184 -0.0031 0.0299  8   LEU A O   
57   C CB  . LEU A 8   ? 0.1651 0.1750 0.2050 -0.0010 -0.0061 0.0326  8   LEU A CB  
58   C CG  . LEU A 8   ? 0.1901 0.2154 0.2304 0.0058  -0.0051 0.0296  8   LEU A CG  
59   C CD1 . LEU A 8   ? 0.2458 0.2678 0.2907 0.0170  -0.0076 0.0222  8   LEU A CD1 
60   C CD2 . LEU A 8   ? 0.2453 0.2789 0.2848 0.0071  -0.0083 0.0359  8   LEU A CD2 
61   N N   . ILE A 9   ? 0.1604 0.1627 0.1996 -0.0217 0.0026  0.0527  9   ILE A N   
62   C CA  . ILE A 9   ? 0.1987 0.1896 0.2513 -0.0301 0.0068  0.0588  9   ILE A CA  
63   C C   . ILE A 9   ? 0.2295 0.2007 0.2831 -0.0265 0.0086  0.0740  9   ILE A C   
64   O O   . ILE A 9   ? 0.2482 0.2237 0.2848 -0.0203 0.0113  0.0880  9   ILE A O   
65   C CB  . ILE A 9   ? 0.2144 0.2191 0.2639 -0.0373 0.0147  0.0648  9   ILE A CB  
66   C CG1 . ILE A 9   ? 0.2086 0.2284 0.2603 -0.0390 0.0129  0.0505  9   ILE A CG1 
67   C CG2 . ILE A 9   ? 0.2389 0.2338 0.3070 -0.0471 0.0230  0.0753  9   ILE A CG2 
68   C CD1 . ILE A 9   ? 0.2143 0.2490 0.2645 -0.0438 0.0202  0.0540  9   ILE A CD1 
69   N N   A ASP A 10  ? 0.2279 0.1776 0.3007 -0.0279 0.0064  0.0701  10  ASP A N   
70   N N   B ASP A 10  ? 0.2290 0.1787 0.3019 -0.0280 0.0064  0.0700  10  ASP A N   
71   C CA  A ASP A 10  ? 0.2693 0.1924 0.3470 -0.0235 0.0095  0.0860  10  ASP A CA  
72   C CA  B ASP A 10  ? 0.2683 0.1912 0.3463 -0.0235 0.0093  0.0855  10  ASP A CA  
73   C C   A ASP A 10  ? 0.2947 0.2212 0.3492 -0.0070 0.0055  0.0958  10  ASP A C   
74   C C   B ASP A 10  ? 0.2938 0.2205 0.3483 -0.0071 0.0055  0.0957  10  ASP A C   
75   O O   A ASP A 10  ? 0.3207 0.2387 0.3636 -0.0003 0.0110  0.1174  10  ASP A O   
76   O O   B ASP A 10  ? 0.3190 0.2377 0.3616 -0.0006 0.0112  0.1173  10  ASP A O   
77   C CB  A ASP A 10  ? 0.3050 0.2190 0.3907 -0.0334 0.0236  0.1069  10  ASP A CB  
78   C CB  B ASP A 10  ? 0.3162 0.2286 0.4037 -0.0337 0.0233  0.1062  10  ASP A CB  
79   C CG  A ASP A 10  ? 0.3305 0.2371 0.4525 -0.0505 0.0272  0.0965  10  ASP A CG  
80   C CG  B ASP A 10  ? 0.4169 0.2923 0.5209 -0.0324 0.0292  0.1216  10  ASP A CG  
81   O OD1 A ASP A 10  ? 0.3760 0.2698 0.5192 -0.0517 0.0182  0.0771  10  ASP A OD1 
82   O OD1 B ASP A 10  ? 0.4617 0.3176 0.5823 -0.0294 0.0208  0.1072  10  ASP A OD1 
83   O OD2 A ASP A 10  ? 0.3665 0.2840 0.4960 -0.0611 0.0382  0.1045  10  ASP A OD2 
84   O OD2 B ASP A 10  ? 0.5141 0.3843 0.6073 -0.0313 0.0411  0.1415  10  ASP A OD2 
85   N N   . GLY A 11  ? 0.2440 0.1859 0.2925 0.0009  -0.0034 0.0804  11  GLY A N   
86   C CA  . GLY A 11  ? 0.2837 0.2356 0.3182 0.0162  -0.0091 0.0844  11  GLY A CA  
87   C C   . GLY A 11  ? 0.2881 0.2694 0.3058 0.0179  -0.0101 0.0854  11  GLY A C   
88   O O   . GLY A 11  ? 0.3300 0.3277 0.3419 0.0295  -0.0171 0.0825  11  GLY A O   
89   N N   . THR A 12  ? 0.2545 0.2446 0.2679 0.0069  -0.0041 0.0864  12  THR A N   
90   C CA  . THR A 12  ? 0.2489 0.2643 0.2474 0.0087  -0.0052 0.0847  12  THR A CA  
91   C C   . THR A 12  ? 0.2141 0.2448 0.2207 0.0006  -0.0059 0.0666  12  THR A C   
92   O O   . THR A 12  ? 0.2107 0.2346 0.2262 -0.0081 -0.0017 0.0614  12  THR A O   
93   C CB  . THR A 12  ? 0.3051 0.3209 0.2911 0.0051  0.0038  0.0988  12  THR A CB  
94   O OG1 . THR A 12  ? 0.3943 0.3964 0.3689 0.0156  0.0074  0.1206  12  THR A OG1 
95   C CG2 . THR A 12  ? 0.3022 0.3451 0.2733 0.0080  0.0014  0.0909  12  THR A CG2 
96   N N   . VAL A 13  ? 0.2012 0.2530 0.2067 0.0046  -0.0111 0.0570  13  VAL A N   
97   C CA  . VAL A 13  ? 0.1697 0.2323 0.1850 -0.0033 -0.0088 0.0430  13  VAL A CA  
98   C C   . VAL A 13  ? 0.2062 0.2724 0.2128 -0.0094 -0.0041 0.0428  13  VAL A C   
99   O O   . VAL A 13  ? 0.1860 0.2629 0.1790 -0.0045 -0.0064 0.0451  13  VAL A O   
100  C CB  . VAL A 13  ? 0.1761 0.2603 0.2025 0.0004  -0.0151 0.0308  13  VAL A CB  
101  C CG1 . VAL A 13  ? 0.1619 0.2522 0.2028 -0.0095 -0.0093 0.0187  13  VAL A CG1 
102  C CG2 . VAL A 13  ? 0.1481 0.2331 0.1860 0.0077  -0.0183 0.0303  13  VAL A CG2 
103  N N   . VAL A 14  ? 0.1611 0.2211 0.1729 -0.0170 0.0023  0.0394  14  VAL A N   
104  C CA  . VAL A 14  ? 0.1787 0.2428 0.1839 -0.0206 0.0069  0.0386  14  VAL A CA  
105  C C   . VAL A 14  ? 0.1945 0.2578 0.2082 -0.0246 0.0112  0.0291  14  VAL A C   
106  O O   . VAL A 14  ? 0.1977 0.2556 0.2203 -0.0247 0.0128  0.0270  14  VAL A O   
107  C CB  . VAL A 14  ? 0.1959 0.2514 0.2001 -0.0243 0.0122  0.0487  14  VAL A CB  
108  C CG1 . VAL A 14  ? 0.2437 0.2932 0.2419 -0.0211 0.0124  0.0629  14  VAL A CG1 
109  C CG2 . VAL A 14  ? 0.2189 0.2645 0.2351 -0.0272 0.0125  0.0450  14  VAL A CG2 
110  N N   A ARG A 15  ? 0.1855 0.2539 0.1947 -0.0255 0.0141  0.0248  15  ARG A N   
111  N N   B ARG A 15  ? 0.1995 0.2676 0.2088 -0.0256 0.0143  0.0250  15  ARG A N   
112  C CA  A ARG A 15  ? 0.1736 0.2376 0.1891 -0.0269 0.0193  0.0178  15  ARG A CA  
113  C CA  B ARG A 15  ? 0.1679 0.2305 0.1837 -0.0269 0.0197  0.0192  15  ARG A CA  
114  C C   A ARG A 15  ? 0.1678 0.2339 0.1768 -0.0262 0.0233  0.0218  15  ARG A C   
115  C C   B ARG A 15  ? 0.1723 0.2380 0.1816 -0.0262 0.0235  0.0221  15  ARG A C   
116  O O   A ARG A 15  ? 0.1852 0.2610 0.1856 -0.0253 0.0237  0.0244  15  ARG A O   
117  O O   B ARG A 15  ? 0.1794 0.2550 0.1800 -0.0253 0.0237  0.0240  15  ARG A O   
118  C CB  A ARG A 15  ? 0.1876 0.2579 0.2081 -0.0271 0.0175  0.0042  15  ARG A CB  
119  C CB  B ARG A 15  ? 0.1550 0.2194 0.1798 -0.0280 0.0199  0.0067  15  ARG A CB  
120  C CG  A ARG A 15  ? 0.1873 0.2500 0.2143 -0.0272 0.0234  -0.0042 15  ARG A CG  
121  C CG  B ARG A 15  ? 0.2180 0.2914 0.2353 -0.0257 0.0183  -0.0024 15  ARG A CG  
122  C CD  A ARG A 15  ? 0.1801 0.2440 0.1959 -0.0231 0.0274  -0.0006 15  ARG A CD  
123  C CD  B ARG A 15  ? 0.2212 0.2877 0.2385 -0.0238 0.0251  -0.0052 15  ARG A CD  
124  N NE  A ARG A 15  ? 0.2371 0.3047 0.2509 -0.0192 0.0285  -0.0127 15  ARG A NE  
125  N NE  B ARG A 15  ? 0.2814 0.3594 0.2929 -0.0201 0.0218  -0.0189 15  ARG A NE  
126  C CZ  A ARG A 15  ? 0.2354 0.3183 0.2353 -0.0145 0.0288  -0.0132 15  ARG A CZ  
127  C CZ  B ARG A 15  ? 0.2674 0.3582 0.2631 -0.0144 0.0234  -0.0175 15  ARG A CZ  
128  N NH1 A ARG A 15  ? 0.2598 0.3529 0.2501 -0.0153 0.0293  -0.0001 15  ARG A NH1 
129  N NH1 B ARG A 15  ? 0.2503 0.3432 0.2410 -0.0146 0.0290  -0.0032 15  ARG A NH1 
130  N NH2 A ARG A 15  ? 0.2576 0.3451 0.2548 -0.0085 0.0300  -0.0264 15  ARG A NH2 
131  N NH2 B ARG A 15  ? 0.2623 0.3663 0.2498 -0.0081 0.0196  -0.0326 15  ARG A NH2 
132  N N   . LEU A 16  ? 0.1670 0.2272 0.1800 -0.0246 0.0267  0.0225  16  LEU A N   
133  C CA  . LEU A 16  ? 0.1616 0.2293 0.1740 -0.0230 0.0295  0.0233  16  LEU A CA  
134  C C   . LEU A 16  ? 0.1835 0.2481 0.1959 -0.0170 0.0336  0.0172  16  LEU A C   
135  O O   . LEU A 16  ? 0.1991 0.2516 0.2136 -0.0133 0.0358  0.0174  16  LEU A O   
136  C CB  . LEU A 16  ? 0.1494 0.2176 0.1682 -0.0226 0.0273  0.0260  16  LEU A CB  
137  C CG  . LEU A 16  ? 0.1743 0.2404 0.1991 -0.0280 0.0233  0.0302  16  LEU A CG  
138  C CD1 . LEU A 16  ? 0.1715 0.2417 0.2075 -0.0269 0.0192  0.0254  16  LEU A CD1 
139  C CD2 . LEU A 16  ? 0.2011 0.2722 0.2258 -0.0337 0.0266  0.0378  16  LEU A CD2 
140  N N   . HIS A 17  ? 0.1478 0.2224 0.1575 -0.0146 0.0362  0.0129  17  HIS A N   
141  C CA  . HIS A 17  ? 0.1543 0.2237 0.1651 -0.0066 0.0401  0.0063  17  HIS A CA  
142  C C   . HIS A 17  ? 0.1307 0.2005 0.1442 0.0011  0.0407  0.0107  17  HIS A C   
143  O O   . HIS A 17  ? 0.1541 0.2418 0.1719 0.0015  0.0392  0.0115  17  HIS A O   
144  C CB  . HIS A 17  ? 0.1708 0.2553 0.1773 -0.0030 0.0426  -0.0010 17  HIS A CB  
145  C CG  . HIS A 17  ? 0.1682 0.2457 0.1770 0.0072  0.0462  -0.0095 17  HIS A CG  
146  N ND1 . HIS A 17  ? 0.2340 0.2996 0.2441 0.0095  0.0467  -0.0226 17  HIS A ND1 
147  C CD2 . HIS A 17  ? 0.1765 0.2570 0.1885 0.0173  0.0488  -0.0082 17  HIS A CD2 
148  C CE1 . HIS A 17  ? 0.2614 0.3179 0.2751 0.0202  0.0508  -0.0274 17  HIS A CE1 
149  N NE2 . HIS A 17  ? 0.2172 0.2837 0.2302 0.0264  0.0521  -0.0177 17  HIS A NE2 
150  N N   . GLN A 18  ? 0.1355 0.1874 0.1477 0.0079  0.0434  0.0138  18  GLN A N   
151  C CA  . GLN A 18  ? 0.1426 0.1962 0.1510 0.0208  0.0428  0.0187  18  GLN A CA  
152  C C   . GLN A 18  ? 0.1491 0.2189 0.1593 0.0179  0.0350  0.0191  18  GLN A C   
153  O O   . GLN A 18  ? 0.1726 0.2576 0.1844 0.0273  0.0300  0.0165  18  GLN A O   
154  C CB  . GLN A 18  ? 0.1970 0.2596 0.2065 0.0326  0.0442  0.0143  18  GLN A CB  
155  C CG  . GLN A 18  ? 0.1940 0.2339 0.2033 0.0382  0.0519  0.0121  18  GLN A CG  
156  C CD  . GLN A 18  ? 0.2382 0.2865 0.2488 0.0517  0.0532  0.0060  18  GLN A CD  
157  O OE1 . GLN A 18  ? 0.2457 0.3227 0.2605 0.0519  0.0495  0.0008  18  GLN A OE1 
158  N NE2 . GLN A 18  ? 0.2237 0.2463 0.2339 0.0632  0.0600  0.0070  18  GLN A NE2 
159  N N   . GLY A 19  ? 0.1328 0.1996 0.1451 0.0063  0.0328  0.0205  19  GLY A N   
160  C CA  . GLY A 19  ? 0.1572 0.2332 0.1742 0.0033  0.0255  0.0189  19  GLY A CA  
161  C C   . GLY A 19  ? 0.1518 0.2472 0.1841 -0.0038 0.0223  0.0143  19  GLY A C   
162  O O   . GLY A 19  ? 0.1323 0.2362 0.1762 -0.0064 0.0156  0.0094  19  GLY A O   
163  N N   . ASP A 20  ? 0.1190 0.2222 0.1541 -0.0069 0.0279  0.0148  20  ASP A N   
164  C CA  . ASP A 20  ? 0.1311 0.2549 0.1837 -0.0146 0.0297  0.0137  20  ASP A CA  
165  C C   . ASP A 20  ? 0.1362 0.2539 0.1924 -0.0278 0.0325  0.0216  20  ASP A C   
166  O O   . ASP A 20  ? 0.1540 0.2636 0.1959 -0.0290 0.0364  0.0274  20  ASP A O   
167  C CB  . ASP A 20  ? 0.1452 0.2820 0.1962 -0.0097 0.0370  0.0122  20  ASP A CB  
168  C CG  . ASP A 20  ? 0.1794 0.3433 0.2522 -0.0163 0.0423  0.0120  20  ASP A CG  
169  O OD1 . ASP A 20  ? 0.1746 0.3422 0.2648 -0.0287 0.0432  0.0161  20  ASP A OD1 
170  O OD2 . ASP A 20  ? 0.2021 0.3833 0.2776 -0.0087 0.0472  0.0079  20  ASP A OD2 
171  N N   . TYR A 21  ? 0.1489 0.2701 0.2252 -0.0361 0.0296  0.0209  21  TYR A N   
172  C CA  . TYR A 21  ? 0.1613 0.2708 0.2422 -0.0467 0.0334  0.0312  21  TYR A CA  
173  C C   . TYR A 21  ? 0.1935 0.3119 0.2733 -0.0516 0.0463  0.0439  21  TYR A C   
174  O O   . TYR A 21  ? 0.1877 0.2945 0.2617 -0.0557 0.0513  0.0571  21  TYR A O   
175  C CB  . TYR A 21  ? 0.1753 0.2836 0.2846 -0.0552 0.0284  0.0254  21  TYR A CB  
176  C CG  . TYR A 21  ? 0.1795 0.2749 0.2839 -0.0492 0.0162  0.0153  21  TYR A CG  
177  C CD1 . TYR A 21  ? 0.1635 0.2698 0.2639 -0.0375 0.0070  0.0015  21  TYR A CD1 
178  C CD2 . TYR A 21  ? 0.1518 0.2260 0.2546 -0.0523 0.0143  0.0200  21  TYR A CD2 
179  C CE1 . TYR A 21  ? 0.1765 0.2744 0.2684 -0.0289 -0.0025 -0.0072 21  TYR A CE1 
180  C CE2 . TYR A 21  ? 0.1636 0.2290 0.2616 -0.0448 0.0041  0.0093  21  TYR A CE2 
181  C CZ  . TYR A 21  ? 0.1744 0.2528 0.2660 -0.0331 -0.0037 -0.0042 21  TYR A CZ  
182  O OH  . TYR A 21  ? 0.1804 0.2535 0.2630 -0.0226 -0.0122 -0.0141 21  TYR A OH  
183  N N   . ALA A 22  ? 0.1426 0.2824 0.2258 -0.0484 0.0525  0.0408  22  ALA A N   
184  C CA  . ALA A 22  ? 0.1695 0.3186 0.2459 -0.0483 0.0656  0.0508  22  ALA A CA  
185  C C   . ALA A 22  ? 0.2035 0.3509 0.2470 -0.0373 0.0655  0.0503  22  ALA A C   
186  O O   . ALA A 22  ? 0.2254 0.3799 0.2550 -0.0319 0.0733  0.0543  22  ALA A O   
187  C CB  . ALA A 22  ? 0.1711 0.3446 0.2692 -0.0484 0.0722  0.0446  22  ALA A CB  
188  N N   . ARG A 23  ? 0.1767 0.3110 0.2086 -0.0325 0.0554  0.0420  23  ARG A N   
189  C CA  . ARG A 23  ? 0.1756 0.3070 0.1852 -0.0235 0.0533  0.0350  23  ARG A CA  
190  C C   . ARG A 23  ? 0.1822 0.2959 0.1813 -0.0240 0.0450  0.0350  23  ARG A C   
191  O O   . ARG A 23  ? 0.1931 0.2953 0.1918 -0.0216 0.0390  0.0255  23  ARG A O   
192  C CB  . ARG A 23  ? 0.1653 0.2969 0.1778 -0.0158 0.0510  0.0216  23  ARG A CB  
193  C CG  . ARG A 23  ? 0.1728 0.3275 0.1973 -0.0127 0.0583  0.0200  23  ARG A CG  
194  C CD  . ARG A 23  ? 0.1894 0.3436 0.2142 -0.0008 0.0564  0.0080  23  ARG A CD  
195  N NE  . ARG A 23  ? 0.1838 0.3321 0.1926 0.0071  0.0576  -0.0012 23  ARG A NE  
196  C CZ  . ARG A 23  ? 0.1843 0.3292 0.1929 0.0189  0.0582  -0.0124 23  ARG A CZ  
197  N NH1 . ARG A 23  ? 0.2034 0.3525 0.2235 0.0262  0.0580  -0.0128 23  ARG A NH1 
198  N NH2 . ARG A 23  ? 0.2126 0.3506 0.2106 0.0250  0.0580  -0.0249 23  ARG A NH2 
199  N N   . GLN A 24  ? 0.2313 0.4100 0.2464 -0.0514 0.0321  0.0610  24  GLN A N   
200  C CA  . GLN A 24  ? 0.2298 0.3793 0.2373 -0.0553 0.0217  0.0656  24  GLN A CA  
201  C C   . GLN A 24  ? 0.2405 0.3904 0.2280 -0.0649 0.0285  0.0635  24  GLN A C   
202  O O   . GLN A 24  ? 0.2511 0.4268 0.2306 -0.0745 0.0364  0.0645  24  GLN A O   
203  C CB  . GLN A 24  ? 0.2528 0.3988 0.2714 -0.0689 0.0029  0.0821  24  GLN A CB  
204  C CG  . GLN A 24  ? 0.3222 0.4706 0.3626 -0.0640 -0.0076 0.0844  24  GLN A CG  
205  C CD  . GLN A 24  ? 0.3476 0.4851 0.3968 -0.0784 -0.0276 0.1000  24  GLN A CD  
206  O OE1 . GLN A 24  ? 0.3429 0.4667 0.3794 -0.0875 -0.0339 0.1091  24  GLN A OE1 
207  N NE2 . GLN A 24  ? 0.3428 0.4868 0.4138 -0.0807 -0.0382 0.1029  24  GLN A NE2 
208  N N   . ARG A 25  ? 0.2386 0.3628 0.2189 -0.0612 0.0250  0.0602  25  ARG A N   
209  C CA  . ARG A 25  ? 0.2598 0.3837 0.2250 -0.0733 0.0241  0.0608  25  ARG A CA  
210  C C   . ARG A 25  ? 0.2420 0.3480 0.2100 -0.0760 0.0078  0.0716  25  ARG A C   
211  O O   . ARG A 25  ? 0.2600 0.3455 0.2364 -0.0629 0.0025  0.0711  25  ARG A O   
212  C CB  . ARG A 25  ? 0.3177 0.4308 0.2716 -0.0666 0.0366  0.0436  25  ARG A CB  
213  C CG  . ARG A 25  ? 0.4744 0.5890 0.4144 -0.0789 0.0341  0.0409  25  ARG A CG  
214  C CD  . ARG A 25  ? 0.5914 0.7293 0.5158 -0.0849 0.0432  0.0327  25  ARG A CD  
215  N NE  . ARG A 25  ? 0.5778 0.7148 0.4979 -0.0727 0.0582  0.0172  25  ARG A NE  
216  C CZ  . ARG A 25  ? 0.5341 0.6584 0.4422 -0.0686 0.0666  -0.0011 25  ARG A CZ  
217  N NH1 . ARG A 25  ? 0.5864 0.7002 0.4886 -0.0774 0.0613  -0.0073 25  ARG A NH1 
218  N NH2 . ARG A 25  ? 0.4740 0.5954 0.3762 -0.0551 0.0795  -0.0139 25  ARG A NH2 
219  N N   . ASP A 26  ? 0.2493 0.3618 0.2089 -0.0896 -0.0008 0.0817  26  ASP A N   
220  C CA  . ASP A 26  ? 0.3304 0.4308 0.2877 -0.0933 -0.0170 0.0940  26  ASP A CA  
221  C C   . ASP A 26  ? 0.2514 0.3462 0.1983 -0.0934 -0.0177 0.0879  26  ASP A C   
222  O O   . ASP A 26  ? 0.2953 0.4020 0.2323 -0.0993 -0.0084 0.0776  26  ASP A O   
223  C CB  . ASP A 26  ? 0.4489 0.5644 0.4016 -0.1086 -0.0239 0.1105  26  ASP A CB  
224  C CG  . ASP A 26  ? 0.6834 0.7845 0.6306 -0.1112 -0.0412 0.1243  26  ASP A CG  
225  O OD1 . ASP A 26  ? 0.8636 0.9439 0.8199 -0.1028 -0.0534 0.1290  26  ASP A OD1 
226  O OD2 . ASP A 26  ? 0.7435 0.8546 0.6751 -0.1198 -0.0433 0.1302  26  ASP A OD2 
227  N N   . TYR A 27  ? 0.2442 0.3215 0.1956 -0.0852 -0.0296 0.0940  27  TYR A N   
228  C CA  . TYR A 27  ? 0.2535 0.3278 0.1995 -0.0843 -0.0320 0.0902  27  TYR A CA  
229  C C   . TYR A 27  ? 0.2606 0.3302 0.2010 -0.0832 -0.0496 0.1039  27  TYR A C   
230  O O   . TYR A 27  ? 0.2694 0.3331 0.2113 -0.0751 -0.0545 0.1037  27  TYR A O   
231  C CB  . TYR A 27  ? 0.2431 0.3029 0.1999 -0.0706 -0.0240 0.0805  27  TYR A CB  
232  C CG  . TYR A 27  ? 0.2489 0.3107 0.2063 -0.0720 -0.0064 0.0654  27  TYR A CG  
233  C CD1 . TYR A 27  ? 0.3207 0.3880 0.2723 -0.0813 0.0003  0.0539  27  TYR A CD1 
234  C CD2 . TYR A 27  ? 0.2443 0.3030 0.2070 -0.0638 0.0024  0.0614  27  TYR A CD2 
235  C CE1 . TYR A 27  ? 0.3934 0.4580 0.3428 -0.0816 0.0147  0.0390  27  TYR A CE1 
236  C CE2 . TYR A 27  ? 0.3782 0.4372 0.3379 -0.0626 0.0184  0.0470  27  TYR A CE2 
237  C CZ  . TYR A 27  ? 0.3989 0.4585 0.3510 -0.0715 0.0242  0.0359  27  TYR A CZ  
238  O OH  . TYR A 27  ? 0.5536 0.6087 0.5003 -0.0698 0.0384  0.0203  27  TYR A OH  
239  N N   . GLY A 28  ? 0.2146 0.4006 0.2512 -0.0158 -0.0371 0.0552  28  GLY A N   
240  C CA  . GLY A 28  ? 0.2772 0.4470 0.3115 -0.0172 -0.0444 0.0751  28  GLY A CA  
241  C C   . GLY A 28  ? 0.2770 0.4180 0.3290 -0.0164 -0.0483 0.0806  28  GLY A C   
242  O O   . GLY A 28  ? 0.2696 0.4016 0.3349 -0.0140 -0.0463 0.0681  28  GLY A O   
243  N N   . ASN A 29  ? 0.2668 0.3912 0.3173 -0.0170 -0.0559 0.0989  29  ASN A N   
244  C CA  A ASN A 29  ? 0.2714 0.3648 0.3365 -0.0144 -0.0621 0.1028  29  ASN A CA  
245  C CA  B ASN A 29  ? 0.2803 0.3736 0.3451 -0.0145 -0.0622 0.1034  29  ASN A CA  
246  C C   . ASN A 29  ? 0.2724 0.3501 0.3421 0.0002  -0.0711 0.1000  29  ASN A C   
247  O O   . ASN A 29  ? 0.2505 0.3025 0.3264 0.0054  -0.0798 0.1077  29  ASN A O   
248  C CB  A ASN A 29  ? 0.3383 0.4189 0.4021 -0.0264 -0.0657 0.1254  29  ASN A CB  
249  C CB  B ASN A 29  ? 0.3447 0.4249 0.4074 -0.0261 -0.0664 0.1267  29  ASN A CB  
250  C CG  A ASN A 29  ? 0.3902 0.4693 0.4385 -0.0263 -0.0736 0.1452  29  ASN A CG  
251  C CG  B ASN A 29  ? 0.3710 0.4717 0.4342 -0.0426 -0.0558 0.1319  29  ASN A CG  
252  O OD1 A ASN A 29  ? 0.4600 0.5621 0.4937 -0.0234 -0.0721 0.1436  29  ASN A OD1 
253  O OD1 B ASN A 29  ? 0.4312 0.5526 0.5000 -0.0427 -0.0463 0.1151  29  ASN A OD1 
254  N ND2 A ASN A 29  ? 0.4860 0.5353 0.5367 -0.0290 -0.0847 0.1638  29  ASN A ND2 
255  N ND2 B ASN A 29  ? 0.4684 0.5647 0.5274 -0.0569 -0.0577 0.1562  29  ASN A ND2 
256  N N   . ASP A 30  ? 0.2303 0.3243 0.2985 0.0071  -0.0697 0.0881  30  ASP A N   
257  C CA  . ASP A 30  ? 0.2128 0.3022 0.2896 0.0203  -0.0760 0.0849  30  ASP A CA  
258  C C   . ASP A 30  ? 0.2410 0.3345 0.3263 0.0254  -0.0705 0.0672  30  ASP A C   
259  O O   . ASP A 30  ? 0.2062 0.3165 0.2938 0.0277  -0.0709 0.0619  30  ASP A O   
260  C CB  . ASP A 30  ? 0.2382 0.3457 0.3082 0.0224  -0.0827 0.0923  30  ASP A CB  
261  C CG  . ASP A 30  ? 0.2681 0.4000 0.3276 0.0155  -0.0786 0.0834  30  ASP A CG  
262  O OD1 . ASP A 30  ? 0.3045 0.4405 0.3579 0.0081  -0.0704 0.0762  30  ASP A OD1 
263  O OD2 . ASP A 30  ? 0.3174 0.4646 0.3757 0.0183  -0.0853 0.0828  30  ASP A OD2 
264  N N   . PRO A 31  ? 0.1808 0.2584 0.2706 0.0261  -0.0668 0.0593  31  PRO A N   
265  C CA  . PRO A 31  ? 0.1554 0.2352 0.2490 0.0302  -0.0621 0.0452  31  PRO A CA  
266  C C   . PRO A 31  ? 0.1690 0.2543 0.2705 0.0414  -0.0629 0.0433  31  PRO A C   
267  O O   . PRO A 31  ? 0.1692 0.2666 0.2725 0.0403  -0.0589 0.0366  31  PRO A O   
268  C CB  . PRO A 31  ? 0.1554 0.2143 0.2501 0.0304  -0.0611 0.0392  31  PRO A CB  
269  C CG  . PRO A 31  ? 0.2171 0.2589 0.3138 0.0293  -0.0672 0.0502  31  PRO A CG  
270  C CD  . PRO A 31  ? 0.2159 0.2728 0.3072 0.0218  -0.0682 0.0635  31  PRO A CD  
271  N N   . LEU A 32  ? 0.1985 0.2764 0.3059 0.0519  -0.0682 0.0492  32  LEU A N   
272  C CA  . LEU A 32  ? 0.1858 0.2748 0.3037 0.0650  -0.0668 0.0447  32  LEU A CA  
273  C C   . LEU A 32  ? 0.1790 0.2994 0.3050 0.0616  -0.0663 0.0470  32  LEU A C   
274  O O   . LEU A 32  ? 0.1693 0.3053 0.3016 0.0615  -0.0599 0.0412  32  LEU A O   
275  C CB  . LEU A 32  ? 0.2412 0.3161 0.3658 0.0807  -0.0746 0.0482  32  LEU A CB  
276  C CG  . LEU A 32  ? 0.2308 0.3235 0.3689 0.0980  -0.0718 0.0414  32  LEU A CG  
277  C CD1 . LEU A 32  ? 0.1942 0.2926 0.3288 0.0999  -0.0600 0.0291  32  LEU A CD1 
278  C CD2 . LEU A 32  ? 0.3077 0.3805 0.4478 0.1145  -0.0789 0.0417  32  LEU A CD2 
279  N N   . PRO A 33  ? 0.1595 0.2893 0.2846 0.0575  -0.0737 0.0558  33  PRO A N   
280  C CA  . PRO A 33  ? 0.1772 0.3359 0.3111 0.0533  -0.0760 0.0561  33  PRO A CA  
281  C C   . PRO A 33  ? 0.1628 0.3263 0.2915 0.0402  -0.0707 0.0482  33  PRO A C   
282  O O   . PRO A 33  ? 0.1777 0.3599 0.3171 0.0361  -0.0703 0.0460  33  PRO A O   
283  C CB  . PRO A 33  ? 0.2178 0.3772 0.3418 0.0502  -0.0855 0.0644  33  PRO A CB  
284  C CG  . PRO A 33  ? 0.2362 0.3731 0.3498 0.0513  -0.0883 0.0736  33  PRO A CG  
285  C CD  . PRO A 33  ? 0.2204 0.3363 0.3379 0.0578  -0.0823 0.0674  33  PRO A CD  
286  N N   . ARG A 34  ? 0.1684 0.3141 0.2821 0.0336  -0.0677 0.0443  34  ARG A N   
287  C CA  . ARG A 34  ? 0.1473 0.2921 0.2553 0.0239  -0.0650 0.0354  34  ARG A CA  
288  C C   . ARG A 34  ? 0.1746 0.3184 0.2898 0.0248  -0.0589 0.0313  34  ARG A C   
289  O O   . ARG A 34  ? 0.1592 0.3108 0.2780 0.0167  -0.0598 0.0289  34  ARG A O   
290  C CB  . ARG A 34  ? 0.2203 0.3493 0.3150 0.0202  -0.0626 0.0310  34  ARG A CB  
291  C CG  . ARG A 34  ? 0.2590 0.3943 0.3441 0.0125  -0.0654 0.0239  34  ARG A CG  
292  C CD  . ARG A 34  ? 0.2210 0.3480 0.2976 0.0109  -0.0612 0.0185  34  ARG A CD  
293  N NE  . ARG A 34  ? 0.2018 0.3417 0.2673 0.0079  -0.0616 0.0212  34  ARG A NE  
294  C CZ  . ARG A 34  ? 0.1698 0.3223 0.2255 0.0056  -0.0655 0.0137  34  ARG A CZ  
295  N NH1 . ARG A 34  ? 0.1689 0.3187 0.2274 0.0045  -0.0713 0.0033  34  ARG A NH1 
296  N NH2 . ARG A 34  ? 0.1762 0.3431 0.2177 0.0038  -0.0644 0.0166  34  ARG A NH2 
297  N N   . LEU A 35  ? 0.1406 0.2735 0.2560 0.0342  -0.0537 0.0309  35  LEU A N   
298  C CA  . LEU A 35  ? 0.1979 0.3315 0.3148 0.0366  -0.0467 0.0276  35  LEU A CA  
299  C C   . LEU A 35  ? 0.1659 0.3281 0.2993 0.0385  -0.0438 0.0322  35  LEU A C   
300  O O   . LEU A 35  ? 0.1577 0.3301 0.2940 0.0327  -0.0385 0.0329  35  LEU A O   
301  C CB  . LEU A 35  ? 0.1913 0.3077 0.3025 0.0489  -0.0434 0.0239  35  LEU A CB  
302  C CG  . LEU A 35  ? 0.2276 0.3180 0.3263 0.0465  -0.0455 0.0188  35  LEU A CG  
303  C CD1 . LEU A 35  ? 0.2457 0.3194 0.3408 0.0590  -0.0453 0.0144  35  LEU A CD1 
304  C CD2 . LEU A 35  ? 0.1667 0.2509 0.2565 0.0390  -0.0436 0.0139  35  LEU A CD2 
305  N N   . GLN A 36  ? 0.1313 0.3070 0.2765 0.0471  -0.0479 0.0363  36  GLN A N   
306  C CA  . GLN A 36  ? 0.1212 0.3308 0.2879 0.0508  -0.0456 0.0399  36  GLN A CA  
307  C C   . GLN A 36  ? 0.1435 0.3720 0.3195 0.0336  -0.0500 0.0435  36  GLN A C   
308  O O   . GLN A 36  ? 0.1480 0.4037 0.3409 0.0284  -0.0451 0.0467  36  GLN A O   
309  C CB  . GLN A 36  ? 0.1458 0.3607 0.3224 0.0650  -0.0521 0.0422  36  GLN A CB  
310  C CG  . GLN A 36  ? 0.1538 0.3514 0.3263 0.0840  -0.0495 0.0378  36  GLN A CG  
311  C CD  . GLN A 36  ? 0.2686 0.4548 0.4453 0.0957  -0.0597 0.0395  36  GLN A CD  
312  O OE1 . GLN A 36  ? 0.2223 0.4087 0.3980 0.0895  -0.0693 0.0456  36  GLN A OE1 
313  N NE2 . GLN A 36  ? 0.1901 0.3645 0.3696 0.1131  -0.0585 0.0340  36  GLN A NE2 
314  N N   . ASP A 37  ? 0.1150 0.3302 0.2802 0.0243  -0.0594 0.0424  37  ASP A N   
315  C CA  . ASP A 37  ? 0.1640 0.3888 0.3344 0.0084  -0.0662 0.0421  37  ASP A CA  
316  C C   . ASP A 37  ? 0.1169 0.3311 0.2827 -0.0033 -0.0617 0.0406  37  ASP A C   
317  O O   . ASP A 37  ? 0.1411 0.3697 0.3201 -0.0163 -0.0641 0.0443  37  ASP A O   
318  C CB  . ASP A 37  ? 0.1697 0.3807 0.3241 0.0042  -0.0768 0.0375  37  ASP A CB  
319  C CG  . ASP A 37  ? 0.1905 0.4110 0.3471 0.0100  -0.0834 0.0397  37  ASP A CG  
320  O OD1 . ASP A 37  ? 0.2417 0.4802 0.4164 0.0153  -0.0817 0.0430  37  ASP A OD1 
321  O OD2 . ASP A 37  ? 0.2094 0.4217 0.3498 0.0097  -0.0905 0.0384  37  ASP A OD2 
322  N N   . TYR A 38  ? 0.1234 0.3102 0.2703 0.0006  -0.0564 0.0359  38  TYR A N   
323  C CA  . TYR A 38  ? 0.1227 0.2952 0.2619 -0.0084 -0.0532 0.0356  38  TYR A CA  
324  C C   . TYR A 38  ? 0.1436 0.3386 0.2947 -0.0102 -0.0428 0.0440  38  TYR A C   
325  O O   . TYR A 38  ? 0.1502 0.3485 0.3053 -0.0250 -0.0432 0.0501  38  TYR A O   
326  C CB  . TYR A 38  ? 0.1230 0.2660 0.2419 -0.0010 -0.0501 0.0290  38  TYR A CB  
327  C CG  . TYR A 38  ? 0.1287 0.2525 0.2363 -0.0019 -0.0581 0.0204  38  TYR A CG  
328  C CD1 . TYR A 38  ? 0.1267 0.2531 0.2360 -0.0100 -0.0680 0.0168  38  TYR A CD1 
329  C CD2 . TYR A 38  ? 0.1395 0.2450 0.2355 0.0056  -0.0559 0.0147  38  TYR A CD2 
330  C CE1 . TYR A 38  ? 0.1631 0.2769 0.2608 -0.0085 -0.0734 0.0068  38  TYR A CE1 
331  C CE2 . TYR A 38  ? 0.1467 0.2423 0.2355 0.0052  -0.0609 0.0067  38  TYR A CE2 
332  C CZ  . TYR A 38  ? 0.1488 0.2500 0.2376 -0.0008 -0.0686 0.0024  38  TYR A CZ  
333  O OH  . TYR A 38  ? 0.1730 0.2694 0.2536 0.0011  -0.0717 -0.0075 38  TYR A OH  
334  N N   . ALA A 39  ? 0.1272 0.3373 0.2831 0.0051  -0.0337 0.0443  39  ALA A N   
335  C CA  . ALA A 39  ? 0.1518 0.3890 0.3171 0.0074  -0.0207 0.0501  39  ALA A CA  
336  C C   . ALA A 39  ? 0.1575 0.4346 0.3520 -0.0039 -0.0216 0.0587  39  ALA A C   
337  O O   . ALA A 39  ? 0.1538 0.4538 0.3575 -0.0147 -0.0129 0.0675  39  ALA A O   
338  C CB  . ALA A 39  ? 0.1443 0.3876 0.3085 0.0303  -0.0130 0.0443  39  ALA A CB  
339  N N   . ALA A 40  ? 0.1704 0.4571 0.3794 -0.0031 -0.0329 0.0573  40  ALA A N   
340  C CA  . ALA A 40  ? 0.1789 0.4985 0.4144 -0.0133 -0.0364 0.0627  40  ALA A CA  
341  C C   . ALA A 40  ? 0.1557 0.4672 0.3931 -0.0387 -0.0450 0.0676  40  ALA A C   
342  O O   . ALA A 40  ? 0.1791 0.5118 0.4347 -0.0517 -0.0445 0.0734  40  ALA A O   
343  C CB  . ALA A 40  ? 0.1278 0.4437 0.3655 -0.0035 -0.0468 0.0563  40  ALA A CB  
344  N N   . GLN A 41  ? 0.1776 0.4300 0.4162 0.0179  -0.0448 0.0535  41  GLN A N   
345  C CA  . GLN A 41  ? 0.1397 0.3891 0.3641 0.0041  -0.0456 0.0540  41  GLN A CA  
346  C C   . GLN A 41  ? 0.1966 0.4535 0.4252 -0.0023 -0.0323 0.0526  41  GLN A C   
347  O O   . GLN A 41  ? 0.1964 0.4511 0.4189 -0.0142 -0.0339 0.0553  41  GLN A O   
348  C CB  . GLN A 41  ? 0.1895 0.4147 0.3821 -0.0013 -0.0506 0.0534  41  GLN A CB  
349  C CG  . GLN A 41  ? 0.3256 0.5501 0.5093 -0.0036 -0.0641 0.0567  41  GLN A CG  
350  C CD  . GLN A 41  ? 0.3885 0.6183 0.5679 -0.0167 -0.0720 0.0521  41  GLN A CD  
351  O OE1 . GLN A 41  ? 0.3605 0.5836 0.5378 -0.0229 -0.0677 0.0439  41  GLN A OE1 
352  N NE2 . GLN A 41  ? 0.4689 0.7117 0.6497 -0.0219 -0.0853 0.0572  41  GLN A NE2 
353  N N   . GLY A 42  ? 0.1360 0.4031 0.3758 0.0040  -0.0194 0.0487  42  GLY A N   
354  C CA  . GLY A 42  ? 0.1152 0.3977 0.3578 -0.0060 -0.0049 0.0493  42  GLY A CA  
355  C C   . GLY A 42  ? 0.1382 0.4082 0.3549 -0.0087 0.0024  0.0519  42  GLY A C   
356  O O   . GLY A 42  ? 0.1660 0.4496 0.3762 -0.0218 0.0123  0.0565  42  GLY A O   
357  N N   . ALA A 43  ? 0.1222 0.3683 0.3221 0.0008  -0.0032 0.0504  43  ALA A N   
358  C CA  . ALA A 43  ? 0.1125 0.3482 0.2901 -0.0015 0.0016  0.0526  43  ALA A CA  
359  C C   . ALA A 43  ? 0.1212 0.3821 0.3064 -0.0034 0.0212  0.0456  43  ALA A C   
360  O O   . ALA A 43  ? 0.1631 0.4360 0.3745 0.0077  0.0314  0.0321  43  ALA A O   
361  C CB  . ALA A 43  ? 0.1119 0.3209 0.2759 0.0096  -0.0055 0.0492  43  ALA A CB  
362  N N   . GLY A 44  ? 0.1521 0.4209 0.3153 -0.0201 0.0264  0.0531  44  GLY A N   
363  C CA  . GLY A 44  ? 0.1760 0.4684 0.3321 -0.0293 0.0481  0.0431  44  GLY A CA  
364  C C   . GLY A 44  ? 0.1754 0.4604 0.3122 -0.0250 0.0557  0.0337  44  GLY A C   
365  O O   . GLY A 44  ? 0.1938 0.4929 0.3281 -0.0270 0.0766  0.0154  44  GLY A O   
366  N N   . VAL A 45  ? 0.1510 0.4126 0.2748 -0.0202 0.0397  0.0437  45  VAL A N   
367  C CA  . VAL A 45  ? 0.1117 0.3646 0.2191 -0.0156 0.0440  0.0361  45  VAL A CA  
368  C C   . VAL A 45  ? 0.1159 0.3381 0.2311 0.0013  0.0260  0.0412  45  VAL A C   
369  O O   . VAL A 45  ? 0.1399 0.3496 0.2589 -0.0005 0.0103  0.0522  45  VAL A O   
370  C CB  . VAL A 45  ? 0.1781 0.4222 0.2420 -0.0396 0.0391  0.0458  45  VAL A CB  
371  C CG1 . VAL A 45  ? 0.2243 0.4411 0.2668 -0.0334 0.0361  0.0367  45  VAL A CG1 
372  C CG2 . VAL A 45  ? 0.2660 0.5376 0.3096 -0.0616 0.0570  0.0391  45  VAL A CG2 
373  N N   . LEU A 46  ? 0.0902 0.2947 0.2044 0.0152  0.0292  0.0295  46  LEU A N   
374  C CA  . LEU A 46  ? 0.0884 0.2658 0.2032 0.0260  0.0148  0.0341  46  LEU A CA  
375  C C   . LEU A 46  ? 0.1304 0.2829 0.2191 0.0232  0.0135  0.0288  46  LEU A C   
376  O O   . LEU A 46  ? 0.1333 0.2874 0.2086 0.0194  0.0254  0.0169  46  LEU A O   
377  C CB  . LEU A 46  ? 0.1016 0.2710 0.2396 0.0416  0.0139  0.0288  46  LEU A CB  
378  C CG  . LEU A 46  ? 0.0996 0.2786 0.2562 0.0412  0.0097  0.0305  46  LEU A CG  
379  C CD1 . LEU A 46  ? 0.1553 0.3309 0.3388 0.0552  0.0067  0.0245  46  LEU A CD1 
380  C CD2 . LEU A 46  ? 0.1668 0.3322 0.3071 0.0326  -0.0050 0.0399  46  LEU A CD2 
381  N N   . HIS A 47  ? 0.0981 0.2309 0.1811 0.0234  0.0003  0.0347  47  HIS A N   
382  C CA  . HIS A 47  ? 0.0877 0.1998 0.1523 0.0195  -0.0033 0.0308  47  HIS A CA  
383  C C   . HIS A 47  ? 0.1237 0.2187 0.1929 0.0289  -0.0056 0.0276  47  HIS A C   
384  O O   . HIS A 47  ? 0.1283 0.2249 0.2066 0.0306  -0.0120 0.0330  47  HIS A O   
385  C CB  . HIS A 47  ? 0.0971 0.2043 0.1588 0.0078  -0.0175 0.0399  47  HIS A CB  
386  C CG  . HIS A 47  ? 0.1286 0.2183 0.1803 0.0034  -0.0247 0.0373  47  HIS A CG  
387  N ND1 . HIS A 47  ? 0.1679 0.2547 0.1970 -0.0046 -0.0222 0.0343  47  HIS A ND1 
388  C CD2 . HIS A 47  ? 0.1044 0.1822 0.1684 0.0041  -0.0342 0.0353  47  HIS A CD2 
389  C CE1 . HIS A 47  ? 0.2110 0.2830 0.2395 -0.0077 -0.0328 0.0336  47  HIS A CE1 
390  N NE2 . HIS A 47  ? 0.1347 0.2019 0.1876 -0.0017 -0.0393 0.0337  47  HIS A NE2 
391  N N   . LEU A 48  ? 0.1107 0.1907 0.1717 0.0316  -0.0006 0.0188  48  LEU A N   
392  C CA  . LEU A 48  ? 0.1193 0.1813 0.1833 0.0364  -0.0037 0.0189  48  LEU A CA  
393  C C   . LEU A 48  ? 0.1608 0.2071 0.2109 0.0289  -0.0065 0.0133  48  LEU A C   
394  O O   . LEU A 48  ? 0.1643 0.2074 0.2023 0.0245  -0.0032 0.0053  48  LEU A O   
395  C CB  . LEU A 48  ? 0.1396 0.1935 0.2187 0.0477  0.0025  0.0143  48  LEU A CB  
396  C CG  . LEU A 48  ? 0.1548 0.2241 0.2604 0.0578  0.0029  0.0197  48  LEU A CG  
397  C CD1 . LEU A 48  ? 0.1628 0.2188 0.2959 0.0704  0.0061  0.0131  48  LEU A CD1 
398  C CD2 . LEU A 48  ? 0.1728 0.2476 0.2796 0.0548  -0.0101 0.0370  48  LEU A CD2 
399  N N   . VAL A 49  ? 0.1280 0.1681 0.1798 0.0251  -0.0119 0.0160  49  VAL A N   
400  C CA  . VAL A 49  ? 0.1261 0.1534 0.1729 0.0186  -0.0140 0.0098  49  VAL A CA  
401  C C   . VAL A 49  ? 0.1476 0.1609 0.1946 0.0184  -0.0118 0.0114  49  VAL A C   
402  O O   . VAL A 49  ? 0.1668 0.1850 0.2155 0.0160  -0.0129 0.0193  49  VAL A O   
403  C CB  . VAL A 49  ? 0.1070 0.1427 0.1646 0.0111  -0.0211 0.0081  49  VAL A CB  
404  C CG1 . VAL A 49  ? 0.1404 0.1669 0.2012 0.0046  -0.0235 0.0010  49  VAL A CG1 
405  C CG2 . VAL A 49  ? 0.1460 0.1906 0.2078 0.0090  -0.0288 0.0122  49  VAL A CG2 
406  N N   . ASP A 50  ? 0.1542 0.1500 0.1973 0.0178  -0.0099 0.0046  50  ASP A N   
407  C CA  . ASP A 50  ? 0.1455 0.1233 0.1908 0.0144  -0.0100 0.0078  50  ASP A CA  
408  C C   . ASP A 50  ? 0.1969 0.1785 0.2410 0.0017  -0.0115 0.0040  50  ASP A C   
409  O O   . ASP A 50  ? 0.1996 0.1752 0.2433 -0.0026 -0.0133 -0.0056 50  ASP A O   
410  C CB  . ASP A 50  ? 0.1944 0.1513 0.2430 0.0197  -0.0068 -0.0023 50  ASP A CB  
411  C CG  . ASP A 50  ? 0.2275 0.1596 0.2836 0.0154  -0.0095 0.0024  50  ASP A CG  
412  O OD1 . ASP A 50  ? 0.2390 0.1724 0.2916 0.0047  -0.0131 0.0152  50  ASP A OD1 
413  O OD2 . ASP A 50  ? 0.2741 0.1860 0.3404 0.0203  -0.0071 -0.0088 50  ASP A OD2 
414  N N   . LEU A 51  ? 0.1710 0.1669 0.2166 -0.0061 -0.0105 0.0088  51  LEU A N   
415  C CA  . LEU A 51  ? 0.1690 0.1761 0.2233 -0.0184 -0.0083 -0.0005 51  LEU A CA  
416  C C   . LEU A 51  ? 0.1781 0.1707 0.2298 -0.0293 -0.0063 0.0007  51  LEU A C   
417  O O   . LEU A 51  ? 0.1840 0.1812 0.2478 -0.0370 -0.0057 -0.0097 51  LEU A O   
418  C CB  . LEU A 51  ? 0.1414 0.1729 0.1990 -0.0267 -0.0032 -0.0029 51  LEU A CB  
419  C CG  . LEU A 51  ? 0.1189 0.1669 0.1917 -0.0198 -0.0058 -0.0107 51  LEU A CG  
420  C CD1 . LEU A 51  ? 0.1182 0.1893 0.1916 -0.0302 0.0014  -0.0172 51  LEU A CD1 
421  C CD2 . LEU A 51  ? 0.1537 0.2053 0.2538 -0.0186 -0.0111 -0.0229 51  LEU A CD2 
422  N N   . THR A 52  ? 0.1915 0.1660 0.2329 -0.0307 -0.0075 0.0150  52  THR A N   
423  C CA  . THR A 52  ? 0.1981 0.1530 0.2393 -0.0422 -0.0080 0.0194  52  THR A CA  
424  C C   . THR A 52  ? 0.2375 0.1758 0.2864 -0.0361 -0.0103 0.0050  52  THR A C   
425  O O   . THR A 52  ? 0.2261 0.1633 0.2811 -0.0474 -0.0099 -0.0026 52  THR A O   
426  C CB  . THR A 52  ? 0.2475 0.1801 0.2845 -0.0430 -0.0148 0.0415  52  THR A CB  
427  O OG1 . THR A 52  ? 0.2670 0.2193 0.2894 -0.0565 -0.0149 0.0568  52  THR A OG1 
428  C CG2 . THR A 52  ? 0.2665 0.1718 0.3087 -0.0544 -0.0181 0.0474  52  THR A CG2 
429  N N   . GLY A 53  ? 0.2179 0.1476 0.2658 -0.0208 -0.0121 -0.0005 53  GLY A N   
430  C CA  . GLY A 53  ? 0.2499 0.1687 0.2968 -0.0190 -0.0134 -0.0168 53  GLY A CA  
431  C C   . GLY A 53  ? 0.2273 0.1653 0.2737 -0.0251 -0.0180 -0.0257 53  GLY A C   
432  O O   . GLY A 53  ? 0.2505 0.1818 0.2966 -0.0329 -0.0225 -0.0356 53  GLY A O   
433  N N   . ALA A 54  ? 0.1788 0.1398 0.2296 -0.0222 -0.0195 -0.0217 54  ALA A N   
434  C CA  . ALA A 54  ? 0.1785 0.1558 0.2411 -0.0271 -0.0289 -0.0267 54  ALA A CA  
435  C C   . ALA A 54  ? 0.2153 0.1986 0.2993 -0.0387 -0.0298 -0.0323 54  ALA A C   
436  O O   . ALA A 54  ? 0.2379 0.2271 0.3360 -0.0444 -0.0409 -0.0376 54  ALA A O   
437  C CB  . ALA A 54  ? 0.1565 0.1535 0.2303 -0.0214 -0.0311 -0.0221 54  ALA A CB  
438  N N   . LYS A 55  ? 0.1647 0.2163 0.2480 -0.0301 -0.0041 -0.0094 55  LYS A N   
439  C CA  . LYS A 55  ? 0.1636 0.2374 0.2761 -0.0417 0.0032  -0.0091 55  LYS A CA  
440  C C   . LYS A 55  ? 0.1814 0.2452 0.2961 -0.0558 -0.0067 -0.0043 55  LYS A C   
441  O O   . LYS A 55  ? 0.2197 0.3036 0.3659 -0.0648 -0.0098 -0.0042 55  LYS A O   
442  C CB  . LYS A 55  ? 0.1895 0.2748 0.2957 -0.0474 0.0231  -0.0088 55  LYS A CB  
443  C CG  . LYS A 55  ? 0.2498 0.3705 0.3905 -0.0577 0.0365  -0.0113 55  LYS A CG  
444  C CD  . LYS A 55  ? 0.2712 0.4082 0.3981 -0.0636 0.0582  -0.0135 55  LYS A CD  
445  C CE  . LYS A 55  ? 0.4255 0.6070 0.5897 -0.0716 0.0759  -0.0202 55  LYS A CE  
446  N NZ  . LYS A 55  ? 0.5277 0.7299 0.6717 -0.0790 0.0990  -0.0247 55  LYS A NZ  
447  N N   . ASP A 56  ? 0.2164 0.2491 0.3016 -0.0577 -0.0126 -0.0011 56  ASP A N   
448  C CA  . ASP A 56  ? 0.2197 0.2327 0.3053 -0.0698 -0.0251 0.0004  56  ASP A CA  
449  C C   . ASP A 56  ? 0.2531 0.2339 0.3108 -0.0597 -0.0369 -0.0061 56  ASP A C   
450  O O   . ASP A 56  ? 0.2825 0.2415 0.3203 -0.0558 -0.0341 -0.0021 56  ASP A O   
451  C CB  . ASP A 56  ? 0.2597 0.2661 0.3463 -0.0875 -0.0176 0.0127  56  ASP A CB  
452  C CG  . ASP A 56  ? 0.2977 0.2823 0.3934 -0.1032 -0.0323 0.0145  56  ASP A CG  
453  O OD1 . ASP A 56  ? 0.3375 0.3080 0.4311 -0.0980 -0.0481 0.0024  56  ASP A OD1 
454  O OD2 . ASP A 56  ? 0.3573 0.3390 0.4610 -0.1224 -0.0285 0.0279  56  ASP A OD2 
455  N N   . PRO A 57  ? 0.2610 0.2421 0.3179 -0.0556 -0.0503 -0.0164 57  PRO A N   
456  C CA  . PRO A 57  ? 0.2513 0.2093 0.2815 -0.0452 -0.0586 -0.0272 57  PRO A CA  
457  C C   . PRO A 57  ? 0.3731 0.2946 0.3960 -0.0497 -0.0641 -0.0305 57  PRO A C   
458  O O   . PRO A 57  ? 0.4420 0.3439 0.4464 -0.0373 -0.0668 -0.0402 57  PRO A O   
459  C CB  . PRO A 57  ? 0.2582 0.2296 0.2899 -0.0468 -0.0725 -0.0369 57  PRO A CB  
460  C CG  . PRO A 57  ? 0.2891 0.2928 0.3465 -0.0491 -0.0699 -0.0275 57  PRO A CG  
461  C CD  . PRO A 57  ? 0.2594 0.2674 0.3394 -0.0591 -0.0582 -0.0186 57  PRO A CD  
462  N N   . ALA A 58  ? 0.3154 0.2287 0.3562 -0.0672 -0.0660 -0.0221 58  ALA A N   
463  C CA  . ALA A 58  ? 0.4046 0.2781 0.4435 -0.0737 -0.0732 -0.0202 58  ALA A CA  
464  C C   . ALA A 58  ? 0.4103 0.2691 0.4361 -0.0653 -0.0651 -0.0071 58  ALA A C   
465  O O   . ALA A 58  ? 0.5101 0.3323 0.5326 -0.0628 -0.0734 -0.0062 58  ALA A O   
466  C CB  . ALA A 58  ? 0.4066 0.2786 0.4701 -0.0989 -0.0772 -0.0092 58  ALA A CB  
467  N N   . LYS A 59  ? 0.3549 0.2418 0.3754 -0.0608 -0.0508 0.0026  59  LYS A N   
468  C CA  . LYS A 59  ? 0.3737 0.2531 0.3813 -0.0578 -0.0443 0.0177  59  LYS A CA  
469  C C   . LYS A 59  ? 0.3438 0.2331 0.3352 -0.0373 -0.0396 0.0113  59  LYS A C   
470  O O   . LYS A 59  ? 0.3723 0.2711 0.3536 -0.0357 -0.0318 0.0223  59  LYS A O   
471  C CB  . LYS A 59  ? 0.3805 0.2856 0.3931 -0.0744 -0.0308 0.0343  59  LYS A CB  
472  C CG  . LYS A 59  ? 0.4031 0.2990 0.4316 -0.0985 -0.0345 0.0471  59  LYS A CG  
473  C CD  . LYS A 59  ? 0.4636 0.3942 0.4962 -0.1160 -0.0173 0.0622  59  LYS A CD  
474  C CE  . LYS A 59  ? 0.5750 0.4995 0.6252 -0.1434 -0.0207 0.0785  59  LYS A CE  
475  N NZ  . LYS A 59  ? 0.5818 0.5523 0.6413 -0.1621 -0.0005 0.0893  59  LYS A NZ  
476  N N   . ARG A 60  ? 0.3384 0.2279 0.3265 -0.0239 -0.0445 -0.0060 60  ARG A N   
477  C CA  . ARG A 60  ? 0.3040 0.2051 0.2796 -0.0066 -0.0402 -0.0109 60  ARG A CA  
478  C C   . ARG A 60  ? 0.3241 0.2070 0.2936 0.0021  -0.0425 -0.0030 60  ARG A C   
479  O O   . ARG A 60  ? 0.3627 0.2149 0.3374 0.0007  -0.0517 0.0000  60  ARG A O   
480  C CB  . ARG A 60  ? 0.2971 0.2025 0.2675 0.0037  -0.0449 -0.0297 60  ARG A CB  
481  C CG  . ARG A 60  ? 0.3341 0.2624 0.3090 -0.0036 -0.0458 -0.0336 60  ARG A CG  
482  C CD  . ARG A 60  ? 0.3407 0.2747 0.3034 0.0029  -0.0522 -0.0504 60  ARG A CD  
483  N NE  . ARG A 60  ? 0.3633 0.3085 0.3125 0.0173  -0.0460 -0.0539 60  ARG A NE  
484  C CZ  . ARG A 60  ? 0.3912 0.3373 0.3272 0.0265  -0.0474 -0.0710 60  ARG A CZ  
485  N NH1 . ARG A 60  ? 0.3603 0.2923 0.2918 0.0232  -0.0562 -0.0887 60  ARG A NH1 
486  N NH2 . ARG A 60  ? 0.4313 0.3944 0.3596 0.0383  -0.0395 -0.0724 60  ARG A NH2 
487  N N   . GLN A 61  ? 0.3081 0.2093 0.2698 0.0105  -0.0363 0.0011  61  GLN A N   
488  C CA  . GLN A 61  ? 0.2977 0.1899 0.2557 0.0189  -0.0398 0.0106  61  GLN A CA  
489  C C   . GLN A 61  ? 0.3704 0.2628 0.3321 0.0385  -0.0430 -0.0034 61  GLN A C   
490  O O   . GLN A 61  ? 0.3215 0.2334 0.2813 0.0475  -0.0397 -0.0019 61  GLN A O   
491  C CB  . GLN A 61  ? 0.2826 0.1980 0.2307 0.0146  -0.0323 0.0216  61  GLN A CB  
492  C CG  . GLN A 61  ? 0.2966 0.2201 0.2408 -0.0038 -0.0249 0.0307  61  GLN A CG  
493  C CD  . GLN A 61  ? 0.2845 0.2318 0.2175 -0.0070 -0.0165 0.0339  61  GLN A CD  
494  O OE1 . GLN A 61  ? 0.3243 0.2711 0.2442 -0.0093 -0.0196 0.0459  61  GLN A OE1 
495  N NE2 . GLN A 61  ? 0.2791 0.2463 0.2180 -0.0074 -0.0079 0.0229  61  GLN A NE2 
496  N N   . ILE A 62  ? 0.3645 0.2374 0.3328 0.0441  -0.0489 -0.0187 62  ILE A N   
497  C CA  . ILE A 62  ? 0.3757 0.2533 0.3479 0.0631  -0.0489 -0.0382 62  ILE A CA  
498  C C   . ILE A 62  ? 0.3624 0.2379 0.3464 0.0795  -0.0525 -0.0328 62  ILE A C   
499  O O   . ILE A 62  ? 0.3732 0.2772 0.3592 0.0918  -0.0459 -0.0403 62  ILE A O   
500  C CB  . ILE A 62  ? 0.4840 0.3358 0.4606 0.0654  -0.0558 -0.0596 62  ILE A CB  
501  C CG1 . ILE A 62  ? 0.4737 0.3367 0.4396 0.0499  -0.0541 -0.0656 62  ILE A CG1 
502  C CG2 . ILE A 62  ? 0.5551 0.4135 0.5363 0.0868  -0.0536 -0.0841 62  ILE A CG2 
503  C CD1 . ILE A 62  ? 0.5708 0.4092 0.5385 0.0469  -0.0634 -0.0866 62  ILE A CD1 
504  N N   . PRO A 63  ? 0.4115 0.2564 0.4056 0.0788  -0.0639 -0.0172 63  PRO A N   
505  C CA  . PRO A 63  ? 0.3820 0.2276 0.3912 0.0951  -0.0707 -0.0091 63  PRO A CA  
506  C C   . PRO A 63  ? 0.3685 0.2511 0.3692 0.0930  -0.0649 0.0044  63  PRO A C   
507  O O   . PRO A 63  ? 0.4012 0.3050 0.4155 0.1088  -0.0647 0.0001  63  PRO A O   
508  C CB  . PRO A 63  ? 0.4639 0.2693 0.4804 0.0876  -0.0865 0.0133  63  PRO A CB  
509  C CG  . PRO A 63  ? 0.4722 0.2504 0.4856 0.0734  -0.0880 0.0070  63  PRO A CG  
510  C CD  . PRO A 63  ? 0.4613 0.2712 0.4563 0.0625  -0.0729 -0.0040 63  PRO A CD  
511  N N   . LEU A 64  ? 0.3323 0.2240 0.3136 0.0734  -0.0603 0.0188  64  LEU A N   
512  C CA  . LEU A 64  ? 0.2896 0.2119 0.2617 0.0692  -0.0562 0.0286  64  LEU A CA  
513  C C   . LEU A 64  ? 0.2757 0.2300 0.2505 0.0763  -0.0458 0.0129  64  LEU A C   
514  O O   . LEU A 64  ? 0.3233 0.3015 0.3055 0.0832  -0.0462 0.0152  64  LEU A O   
515  C CB  . LEU A 64  ? 0.3264 0.2520 0.2780 0.0479  -0.0511 0.0403  64  LEU A CB  
516  C CG  . LEU A 64  ? 0.3564 0.3110 0.2968 0.0419  -0.0465 0.0443  64  LEU A CG  
517  C CD1 . LEU A 64  ? 0.3507 0.3110 0.2935 0.0476  -0.0587 0.0584  64  LEU A CD1 
518  C CD2 . LEU A 64  ? 0.3359 0.2940 0.2582 0.0229  -0.0388 0.0489  64  LEU A CD2 
519  N N   . ILE A 65  ? 0.3141 0.2708 0.2834 0.0724  -0.0377 -0.0006 65  ILE A N   
520  C CA  . ILE A 65  ? 0.3191 0.3058 0.2879 0.0758  -0.0288 -0.0114 65  ILE A CA  
521  C C   . ILE A 65  ? 0.3307 0.3340 0.3149 0.0941  -0.0277 -0.0221 65  ILE A C   
522  O O   . ILE A 65  ? 0.2946 0.3304 0.2837 0.0962  -0.0223 -0.0211 65  ILE A O   
523  C CB  . ILE A 65  ? 0.3546 0.3391 0.3145 0.0692  -0.0244 -0.0224 65  ILE A CB  
524  C CG1 . ILE A 65  ? 0.3466 0.3265 0.2994 0.0528  -0.0232 -0.0127 65  ILE A CG1 
525  C CG2 . ILE A 65  ? 0.3073 0.3228 0.2642 0.0723  -0.0170 -0.0308 65  ILE A CG2 
526  C CD1 . ILE A 65  ? 0.4335 0.4090 0.3832 0.0460  -0.0232 -0.0206 65  ILE A CD1 
527  N N   . LYS A 66  ? 0.3200 0.3017 0.3154 0.1072  -0.0329 -0.0330 66  LYS A N   
528  C CA  . LYS A 66  ? 0.3350 0.3335 0.3510 0.1281  -0.0305 -0.0478 66  LYS A CA  
529  C C   . LYS A 66  ? 0.3363 0.3547 0.3713 0.1356  -0.0355 -0.0334 66  LYS A C   
530  O O   . LYS A 66  ? 0.3382 0.3946 0.3880 0.1452  -0.0281 -0.0402 66  LYS A O   
531  C CB  . LYS A 66  ? 0.3889 0.3521 0.4186 0.1421  -0.0379 -0.0637 66  LYS A CB  
532  C CG  . LYS A 66  ? 0.4726 0.4247 0.4869 0.1381  -0.0331 -0.0861 66  LYS A CG  
533  C CD  . LYS A 66  ? 0.5381 0.4496 0.5695 0.1516  -0.0428 -0.1039 66  LYS A CD  
534  C CE  . LYS A 66  ? 0.5588 0.4607 0.5735 0.1446  -0.0397 -0.1282 66  LYS A CE  
535  N NZ  . LYS A 66  ? 0.6453 0.5101 0.6772 0.1487  -0.0479 -0.1406 66  LYS A NZ  
536  N N   . THR A 67  ? 0.3402 0.3372 0.3740 0.1290  -0.0481 -0.0124 67  THR A N   
537  C CA  A THR A 67  ? 0.3160 0.3302 0.3652 0.1337  -0.0574 0.0037  67  THR A CA  
538  C CA  B THR A 67  ? 0.3041 0.3192 0.3542 0.1343  -0.0572 0.0032  67  THR A CA  
539  C C   . THR A 67  ? 0.2637 0.3172 0.3054 0.1221  -0.0500 0.0088  67  THR A C   
540  O O   . THR A 67  ? 0.3186 0.4040 0.3808 0.1294  -0.0521 0.0118  67  THR A O   
541  C CB  A THR A 67  ? 0.3787 0.3623 0.4186 0.1239  -0.0733 0.0276  67  THR A CB  
542  C CB  B THR A 67  ? 0.3744 0.3595 0.4174 0.1260  -0.0740 0.0273  67  THR A CB  
543  O OG1 A THR A 67  ? 0.4533 0.3973 0.5065 0.1342  -0.0835 0.0266  67  THR A OG1 
544  O OG1 B THR A 67  ? 0.3916 0.3705 0.4026 0.1025  -0.0694 0.0363  67  THR A OG1 
545  C CG2 A THR A 67  ? 0.4017 0.4062 0.4526 0.1258  -0.0858 0.0457  67  THR A CG2 
546  C CG2 B THR A 67  ? 0.4417 0.3837 0.4976 0.1360  -0.0844 0.0261  67  THR A CG2 
547  N N   . LEU A 68  ? 0.2553 0.3057 0.2714 0.1037  -0.0427 0.0100  68  LEU A N   
548  C CA  . LEU A 68  ? 0.2185 0.2968 0.2284 0.0907  -0.0378 0.0147  68  LEU A CA  
549  C C   . LEU A 68  ? 0.2396 0.3531 0.2619 0.0958  -0.0267 0.0045  68  LEU A C   
550  O O   . LEU A 68  ? 0.2628 0.4080 0.2978 0.0928  -0.0266 0.0099  68  LEU A O   
551  C CB  . LEU A 68  ? 0.2238 0.2863 0.2095 0.0727  -0.0335 0.0167  68  LEU A CB  
552  C CG  . LEU A 68  ? 0.2462 0.2841 0.2165 0.0635  -0.0408 0.0274  68  LEU A CG  
553  C CD1 . LEU A 68  ? 0.2186 0.2474 0.1717 0.0483  -0.0335 0.0250  68  LEU A CD1 
554  C CD2 . LEU A 68  ? 0.2745 0.3254 0.2448 0.0600  -0.0511 0.0396  68  LEU A CD2 
555  N N   . VAL A 69  ? 0.2168 0.3271 0.2339 0.1009  -0.0177 -0.0098 69  VAL A N   
556  C CA  . VAL A 69  ? 0.2010 0.3485 0.2235 0.1034  -0.0054 -0.0192 69  VAL A CA  
557  C C   . VAL A 69  ? 0.2632 0.4427 0.3162 0.1211  -0.0033 -0.0253 69  VAL A C   
558  O O   . VAL A 69  ? 0.2563 0.4790 0.3218 0.1182  0.0044  -0.0230 69  VAL A O   
559  C CB  . VAL A 69  ? 0.2255 0.3628 0.2312 0.1050  0.0019  -0.0353 69  VAL A CB  
560  C CG1 . VAL A 69  ? 0.2604 0.4404 0.2681 0.1091  0.0156  -0.0470 69  VAL A CG1 
561  C CG2 . VAL A 69  ? 0.2505 0.3681 0.2335 0.0870  -0.0002 -0.0270 69  VAL A CG2 
562  N N   . ALA A 70  ? 0.2375 0.3965 0.3068 0.1391  -0.0113 -0.0315 70  ALA A N   
563  C CA  . ALA A 70  ? 0.2633 0.4495 0.3685 0.1582  -0.0104 -0.0389 70  ALA A CA  
564  C C   . ALA A 70  ? 0.2612 0.4674 0.3857 0.1532  -0.0209 -0.0191 70  ALA A C   
565  O O   . ALA A 70  ? 0.2717 0.5072 0.4258 0.1596  -0.0183 -0.0211 70  ALA A O   
566  C CB  . ALA A 70  ? 0.2887 0.4362 0.4073 0.1746  -0.0179 -0.0497 70  ALA A CB  
567  N N   . GLY A 71  ? 0.2210 0.4099 0.3269 0.1386  -0.0326 -0.0010 71  GLY A N   
568  C CA  . GLY A 71  ? 0.2004 0.4028 0.3183 0.1318  -0.0464 0.0167  71  GLY A CA  
569  C C   . GLY A 71  ? 0.1898 0.4297 0.3092 0.1143  -0.0413 0.0227  71  GLY A C   
570  O O   . GLY A 71  ? 0.2276 0.4777 0.3550 0.1046  -0.0528 0.0345  71  GLY A O   
571  N N   . VAL A 72  ? 0.1900 0.4463 0.2997 0.1070  -0.0256 0.0154  72  VAL A N   
572  C CA  . VAL A 72  ? 0.1751 0.4668 0.2909 0.0891  -0.0213 0.0234  72  VAL A CA  
573  C C   . VAL A 72  ? 0.2114 0.5389 0.3385 0.0918  -0.0031 0.0143  72  VAL A C   
574  O O   . VAL A 72  ? 0.2760 0.5984 0.3978 0.1056  0.0072  -0.0011 72  VAL A O   
575  C CB  . VAL A 72  ? 0.1914 0.4563 0.2766 0.0666  -0.0217 0.0295  72  VAL A CB  
576  C CG1 . VAL A 72  ? 0.2425 0.4746 0.3123 0.0594  -0.0368 0.0358  72  VAL A CG1 
577  C CG2 . VAL A 72  ? 0.1949 0.4364 0.2559 0.0676  -0.0110 0.0207  72  VAL A CG2 
578  N N   . ASN A 73  ? 0.1682 0.5193 0.5007 0.0788  -0.0321 0.0198  73  ASN A N   
579  C CA  . ASN A 73  ? 0.1909 0.5605 0.5536 0.0825  -0.0031 0.0054  73  ASN A CA  
580  C C   . ASN A 73  ? 0.2316 0.6012 0.5584 0.0630  0.0213  0.0018  73  ASN A C   
581  O O   . ASN A 73  ? 0.2680 0.6572 0.6131 0.0551  0.0434  -0.0070 73  ASN A O   
582  C CB  . ASN A 73  ? 0.3477 0.7545 0.7750 0.0851  -0.0067 0.0008  73  ASN A CB  
583  C CG  . ASN A 73  ? 0.5474 0.9558 0.9902 0.1055  -0.0376 -0.0030 73  ASN A CG  
584  O OD1 . ASN A 73  ? 0.6394 1.0719 1.0896 0.1032  -0.0623 0.0026  73  ASN A OD1 
585  N ND2 . ASN A 73  ? 0.5955 1.0025 1.0137 0.1325  -0.0312 -0.0007 73  ASN A ND2 
586  N N   . VAL A 74  ? 0.1465 0.4911 0.4226 0.0545  0.0173  0.0096  74  VAL A N   
587  C CA  . VAL A 74  ? 0.1658 0.5012 0.4057 0.0387  0.0380  0.0071  74  VAL A CA  
588  C C   . VAL A 74  ? 0.1656 0.4700 0.3672 0.0483  0.0416  0.0085  74  VAL A C   
589  O O   . VAL A 74  ? 0.1427 0.4314 0.3425 0.0627  0.0256  0.0130  74  VAL A O   
590  C CB  . VAL A 74  ? 0.1884 0.5241 0.4102 0.0158  0.0310  0.0145  74  VAL A CB  
591  C CG1 . VAL A 74  ? 0.2106 0.5771 0.4689 0.0053  0.0267  0.0115  74  VAL A CG1 
592  C CG2 . VAL A 74  ? 0.1876 0.5051 0.3870 0.0155  0.0093  0.0250  74  VAL A CG2 
593  N N   . PRO A 75  ? 0.1353 0.4221 0.3021 0.0388  0.0608  0.0051  75  PRO A N   
594  C CA  . PRO A 75  ? 0.1452 0.3901 0.2684 0.0441  0.0604  0.0056  75  PRO A CA  
595  C C   . PRO A 75  ? 0.1341 0.3527 0.2362 0.0417  0.0399  0.0156  75  PRO A C   
596  O O   . PRO A 75  ? 0.1377 0.3590 0.2381 0.0275  0.0343  0.0219  75  PRO A O   
597  C CB  . PRO A 75  ? 0.2082 0.4405 0.2973 0.0288  0.0795  0.0049  75  PRO A CB  
598  C CG  . PRO A 75  ? 0.2346 0.5038 0.3537 0.0202  0.0984  -0.0021 75  PRO A CG  
599  C CD  . PRO A 75  ? 0.1639 0.4621 0.3282 0.0217  0.0828  0.0003  75  PRO A CD  
600  N N   . VAL A 76  ? 0.1355 0.3289 0.2227 0.0535  0.0313  0.0147  76  VAL A N   
601  C CA  . VAL A 76  ? 0.1247 0.2930 0.1921 0.0498  0.0158  0.0212  76  VAL A CA  
602  C C   . VAL A 76  ? 0.1801 0.3179 0.2144 0.0510  0.0179  0.0186  76  VAL A C   
603  O O   . VAL A 76  ? 0.1799 0.3098 0.2065 0.0606  0.0234  0.0111  76  VAL A O   
604  C CB  . VAL A 76  ? 0.1453 0.3107 0.2265 0.0596  -0.0005 0.0244  76  VAL A CB  
605  C CG1 . VAL A 76  ? 0.1683 0.3083 0.2262 0.0511  -0.0117 0.0288  76  VAL A CG1 
606  C CG2 . VAL A 76  ? 0.1349 0.3324 0.2496 0.0588  -0.0089 0.0297  76  VAL A CG2 
607  N N   . GLN A 77  ? 0.1631 0.2849 0.1807 0.0410  0.0132  0.0234  77  GLN A N   
608  C CA  . GLN A 77  ? 0.1599 0.2567 0.1536 0.0433  0.0092  0.0219  77  GLN A CA  
609  C C   . GLN A 77  ? 0.1557 0.2394 0.1518 0.0436  -0.0031 0.0210  77  GLN A C   
610  O O   . GLN A 77  ? 0.1792 0.2678 0.1861 0.0366  -0.0071 0.0237  77  GLN A O   
611  C CB  . GLN A 77  ? 0.3011 0.3875 0.2786 0.0344  0.0119  0.0280  77  GLN A CB  
612  C CG  . GLN A 77  ? 0.3446 0.4336 0.3345 0.0232  0.0127  0.0333  77  GLN A CG  
613  C CD  . GLN A 77  ? 0.2207 0.2925 0.1972 0.0170  0.0143  0.0412  77  GLN A CD  
614  O OE1 . GLN A 77  ? 0.2965 0.3651 0.2543 0.0144  0.0216  0.0461  77  GLN A OE1 
615  N NE2 . GLN A 77  ? 0.2201 0.2786 0.2063 0.0140  0.0080  0.0424  77  GLN A NE2 
616  N N   . VAL A 78  ? 0.1615 0.2287 0.1451 0.0493  -0.0079 0.0159  78  VAL A N   
617  C CA  . VAL A 78  ? 0.1776 0.2321 0.1634 0.0484  -0.0166 0.0131  78  VAL A CA  
618  C C   . VAL A 78  ? 0.2034 0.2436 0.1792 0.0462  -0.0222 0.0087  78  VAL A C   
619  O O   . VAL A 78  ? 0.2060 0.2409 0.1669 0.0504  -0.0229 0.0053  78  VAL A O   
620  C CB  . VAL A 78  ? 0.1762 0.2245 0.1643 0.0580  -0.0180 0.0095  78  VAL A CB  
621  C CG1 . VAL A 78  ? 0.2082 0.2374 0.1920 0.0537  -0.0256 0.0073  78  VAL A CG1 
622  C CG2 . VAL A 78  ? 0.1974 0.2631 0.2047 0.0620  -0.0177 0.0155  78  VAL A CG2 
623  N N   . GLY A 79  ? 0.1813 0.2174 0.1665 0.0381  -0.0260 0.0074  79  GLY A N   
624  C CA  . GLY A 79  ? 0.1934 0.2215 0.1802 0.0364  -0.0326 0.0016  79  GLY A CA  
625  C C   . GLY A 79  ? 0.1718 0.1931 0.1666 0.0283  -0.0330 -0.0055 79  GLY A C   
626  O O   . GLY A 79  ? 0.1795 0.2001 0.1742 0.0218  -0.0288 -0.0033 79  GLY A O   
627  N N   . GLY A 80  ? 0.1882 0.2051 0.1882 0.0265  -0.0386 -0.0136 80  GLY A N   
628  C CA  . GLY A 80  ? 0.1957 0.2078 0.2064 0.0151  -0.0362 -0.0227 80  GLY A CA  
629  C C   . GLY A 80  ? 0.2343 0.2333 0.2336 0.0145  -0.0398 -0.0299 80  GLY A C   
630  O O   . GLY A 80  ? 0.2451 0.2299 0.2283 0.0156  -0.0373 -0.0270 80  GLY A O   
631  N N   . GLY A 81  ? 0.2003 0.2035 0.2102 0.0129  -0.0471 -0.0389 81  GLY A N   
632  C CA  . GLY A 81  ? 0.2518 0.2428 0.2530 0.0081  -0.0497 -0.0491 81  GLY A CA  
633  C C   . GLY A 81  ? 0.2749 0.2583 0.2531 0.0166  -0.0559 -0.0509 81  GLY A C   
634  O O   . GLY A 81  ? 0.3021 0.2712 0.2703 0.0117  -0.0564 -0.0611 81  GLY A O   
635  N N   . VAL A 82  ? 0.2521 0.2428 0.2193 0.0267  -0.0584 -0.0427 82  VAL A N   
636  C CA  . VAL A 82  ? 0.2588 0.2432 0.1997 0.0311  -0.0613 -0.0471 82  VAL A CA  
637  C C   . VAL A 82  ? 0.3089 0.2995 0.2495 0.0240  -0.0766 -0.0555 82  VAL A C   
638  O O   . VAL A 82  ? 0.2829 0.2898 0.2432 0.0233  -0.0880 -0.0503 82  VAL A O   
639  C CB  . VAL A 82  ? 0.2817 0.2733 0.2083 0.0392  -0.0583 -0.0365 82  VAL A CB  
640  C CG1 . VAL A 82  ? 0.3725 0.3584 0.2663 0.0390  -0.0597 -0.0432 82  VAL A CG1 
641  C CG2 . VAL A 82  ? 0.2662 0.2569 0.1982 0.0458  -0.0448 -0.0300 82  VAL A CG2 
642  N N   . ARG A 83  ? 0.3140 0.2921 0.2356 0.0187  -0.0778 -0.0691 83  ARG A N   
643  C CA  . ARG A 83  ? 0.3412 0.3281 0.2629 0.0090  -0.0949 -0.0786 83  ARG A CA  
644  C C   . ARG A 83  ? 0.3762 0.3538 0.2571 0.0048  -0.0990 -0.0879 83  ARG A C   
645  O O   . ARG A 83  ? 0.3867 0.3757 0.2590 -0.0032 -0.1180 -0.0905 83  ARG A O   
646  C CB  . ARG A 83  ? 0.3009 0.2843 0.2454 -0.0027 -0.0934 -0.0921 83  ARG A CB  
647  C CG  . ARG A 83  ? 0.2855 0.2827 0.2700 -0.0049 -0.0905 -0.0878 83  ARG A CG  
648  C CD  . ARG A 83  ? 0.3000 0.3253 0.3125 -0.0013 -0.1073 -0.0814 83  ARG A CD  
649  N NE  . ARG A 83  ? 0.2499 0.2894 0.3067 -0.0052 -0.1012 -0.0835 83  ARG A NE  
650  C CZ  . ARG A 83  ? 0.2440 0.2848 0.3123 0.0006  -0.0906 -0.0738 83  ARG A CZ  
651  N NH1 . ARG A 83  ? 0.2238 0.2546 0.2653 0.0107  -0.0866 -0.0601 83  ARG A NH1 
652  N NH2 . ARG A 83  ? 0.2211 0.2742 0.3284 -0.0058 -0.0821 -0.0801 83  ARG A NH2 
653  N N   . THR A 84  ? 0.3585 0.3163 0.2159 0.0093  -0.0812 -0.0935 84  THR A N   
654  C CA  . THR A 84  ? 0.3932 0.3387 0.2104 0.0029  -0.0786 -0.1078 84  THR A CA  
655  C C   . THR A 84  ? 0.4016 0.3432 0.1940 0.0109  -0.0630 -0.1040 84  THR A C   
656  O O   . THR A 84  ? 0.3848 0.3300 0.1952 0.0229  -0.0516 -0.0925 84  THR A O   
657  C CB  . THR A 84  ? 0.4687 0.3887 0.2829 -0.0029 -0.0670 -0.1286 84  THR A CB  
658  O OG1 . THR A 84  ? 0.4891 0.3917 0.3153 0.0103  -0.0468 -0.1262 84  THR A OG1 
659  C CG2 . THR A 84  ? 0.4981 0.4212 0.3394 -0.0140 -0.0773 -0.1333 84  THR A CG2 
660  N N   . GLU A 85  ? 0.4792 0.4146 0.2291 0.0014  -0.0617 -0.1156 85  GLU A N   
661  C CA  . GLU A 85  ? 0.4740 0.4048 0.1972 0.0046  -0.0416 -0.1185 85  GLU A CA  
662  C C   . GLU A 85  ? 0.4801 0.3968 0.2270 0.0180  -0.0158 -0.1287 85  GLU A C   
663  O O   . GLU A 85  ? 0.4866 0.4095 0.2397 0.0276  0.0009  -0.1243 85  GLU A O   
664  C CB  . GLU A 85  ? 0.5751 0.5080 0.2600 -0.0141 -0.0402 -0.1311 85  GLU A CB  
665  C CG  . GLU A 85  ? 0.6309 0.5599 0.2912 -0.0113 -0.0166 -0.1406 85  GLU A CG  
666  C CD  . GLU A 85  ? 0.7124 0.6348 0.3360 -0.0237 -0.0188 -0.1530 85  GLU A CD  
667  O OE1 . GLU A 85  ? 0.7185 0.6455 0.3369 -0.0333 -0.0418 -0.1528 85  GLU A OE1 
668  O OE2 . GLU A 85  ? 0.7334 0.6478 0.3362 -0.0256 0.0034  -0.1636 85  GLU A OE2 
669  N N   . GLU A 86  ? 0.4801 0.4767 0.3317 0.0699  -0.1420 -0.1541 86  GLU A N   
670  C CA  . GLU A 86  ? 0.4959 0.4229 0.3549 0.0777  -0.1349 -0.1781 86  GLU A CA  
671  C C   . GLU A 86  ? 0.4618 0.3816 0.3500 0.0846  -0.1006 -0.1361 86  GLU A C   
672  O O   . GLU A 86  ? 0.4328 0.3261 0.3118 0.1039  -0.0836 -0.1454 86  GLU A O   
673  C CB  . GLU A 86  ? 0.6069 0.4804 0.5077 0.0505  -0.1702 -0.2017 86  GLU A CB  
674  C CG  . GLU A 86  ? 0.7675 0.6409 0.6364 0.0380  -0.2042 -0.2497 86  GLU A CG  
675  C CD  . GLU A 86  ? 0.8760 0.8157 0.7483 0.0147  -0.2392 -0.2368 86  GLU A CD  
676  O OE1 . GLU A 86  ? 0.7087 0.6734 0.6478 -0.0063 -0.2429 -0.1872 86  GLU A OE1 
677  O OE2 . GLU A 86  ? 1.0788 1.0532 0.8974 0.0166  -0.2450 -0.2542 86  GLU A OE2 
678  N N   . ASP A 87  ? 0.3811 0.3266 0.3025 0.0699  -0.0905 -0.0900 87  ASP A N   
679  C CA  . ASP A 87  ? 0.3940 0.3349 0.3253 0.0765  -0.0575 -0.0557 87  ASP A CA  
680  C C   . ASP A 87  ? 0.3462 0.3108 0.2429 0.0991  -0.0310 -0.0614 87  ASP A C   
681  O O   . ASP A 87  ? 0.3763 0.3225 0.2694 0.1089  -0.0178 -0.0623 87  ASP A O   
682  C CB  . ASP A 87  ? 0.3001 0.2652 0.2620 0.0625  -0.0425 -0.0082 87  ASP A CB  
683  C CG  . ASP A 87  ? 0.3654 0.3080 0.3797 0.0415  -0.0601 0.0124  87  ASP A CG  
684  O OD1 . ASP A 87  ? 0.3667 0.2650 0.3968 0.0384  -0.0772 -0.0055 87  ASP A OD1 
685  O OD2 . ASP A 87  ? 0.3419 0.3126 0.3915 0.0299  -0.0527 0.0523  87  ASP A OD2 
686  N N   . VAL A 88  ? 0.3436 0.3554 0.2224 0.1068  -0.0241 -0.0599 88  VAL A N   
687  C CA  . VAL A 88  ? 0.3274 0.3674 0.1884 0.1287  0.0052  -0.0581 88  VAL A CA  
688  C C   . VAL A 88  ? 0.3760 0.3947 0.2387 0.1316  -0.0017 -0.0770 88  VAL A C   
689  O O   . VAL A 88  ? 0.3472 0.3621 0.2303 0.1264  0.0113  -0.0642 88  VAL A O   
690  C CB  . VAL A 88  ? 0.3285 0.4257 0.1854 0.1341  0.0127  -0.0408 88  VAL A CB  
691  C CG1 . VAL A 88  ? 0.3148 0.4190 0.1979 0.1325  0.0319  -0.0214 88  VAL A CG1 
692  C CG2 . VAL A 88  ? 0.2790 0.4053 0.1608 0.1216  0.0220  -0.0013 88  VAL A CG2 
693  N N   . ALA A 89  ? 0.3842 0.3896 0.2245 0.1377  -0.0220 -0.1080 89  ALA A N   
694  C CA  . ALA A 89  ? 0.4320 0.4187 0.2709 0.1454  -0.0186 -0.1217 89  ALA A CA  
695  C C   . ALA A 89  ? 0.4331 0.3876 0.2983 0.1417  -0.0152 -0.1164 89  ALA A C   
696  O O   . ALA A 89  ? 0.3970 0.3569 0.2744 0.1478  -0.0013 -0.1082 89  ALA A O   
697  C CB  . ALA A 89  ? 0.4606 0.4247 0.2693 0.1477  -0.0389 -0.1597 89  ALA A CB  
698  N N   . ALA A 90  ? 0.4103 0.3334 0.2863 0.1339  -0.0291 -0.1189 90  ALA A N   
699  C CA  . ALA A 90  ? 0.4416 0.3367 0.3419 0.1343  -0.0281 -0.1098 90  ALA A CA  
700  C C   . ALA A 90  ? 0.4390 0.3608 0.3481 0.1324  -0.0134 -0.0836 90  ALA A C   
701  O O   . ALA A 90  ? 0.4126 0.3329 0.3362 0.1392  -0.0109 -0.0777 90  ALA A O   
702  C CB  . ALA A 90  ? 0.4567 0.3079 0.3741 0.1272  -0.0458 -0.1101 90  ALA A CB  
703  N N   . LEU A 91  ? 0.3547 0.2996 0.2570 0.1236  -0.0042 -0.0695 91  LEU A N   
704  C CA  . LEU A 91  ? 0.3312 0.2939 0.2413 0.1168  0.0082  -0.0528 91  LEU A CA  
705  C C   . LEU A 91  ? 0.3653 0.3531 0.2906 0.1196  0.0166  -0.0531 91  LEU A C   
706  O O   . LEU A 91  ? 0.3711 0.3645 0.3093 0.1241  0.0168  -0.0507 91  LEU A O   
707  C CB  . LEU A 91  ? 0.3082 0.2819 0.2152 0.1042  0.0224  -0.0378 91  LEU A CB  
708  C CG  . LEU A 91  ? 0.3119 0.2569 0.2028 0.1053  0.0244  -0.0277 91  LEU A CG  
709  C CD1 . LEU A 91  ? 0.3194 0.2788 0.2141 0.0947  0.0460  -0.0075 91  LEU A CD1 
710  C CD2 . LEU A 91  ? 0.3894 0.3123 0.2661 0.1081  0.0225  -0.0228 91  LEU A CD2 
711  N N   . LEU A 92  ? 0.3275 0.3309 0.2500 0.1221  0.0229  -0.0553 92  LEU A N   
712  C CA  . LEU A 92  ? 0.3148 0.3372 0.2517 0.1285  0.0348  -0.0517 92  LEU A CA  
713  C C   . LEU A 92  ? 0.3597 0.3714 0.3044 0.1440  0.0327  -0.0606 92  LEU A C   
714  O O   . LEU A 92  ? 0.3607 0.3872 0.3327 0.1494  0.0414  -0.0531 92  LEU A O   
715  C CB  . LEU A 92  ? 0.3217 0.3603 0.2427 0.1359  0.0408  -0.0512 92  LEU A CB  
716  C CG  . LEU A 92  ? 0.3204 0.3762 0.2423 0.1269  0.0461  -0.0351 92  LEU A CG  
717  C CD1 . LEU A 92  ? 0.3272 0.4054 0.2269 0.1421  0.0469  -0.0341 92  LEU A CD1 
718  C CD2 . LEU A 92  ? 0.3150 0.3805 0.2635 0.1196  0.0603  -0.0184 92  LEU A CD2 
719  N N   . LYS A 93  ? 0.3384 0.3225 0.2677 0.1517  0.0223  -0.0763 93  LYS A N   
720  C CA  . LYS A 93  ? 0.4092 0.3751 0.3532 0.1675  0.0246  -0.0833 93  LYS A CA  
721  C C   . LYS A 93  ? 0.4390 0.4091 0.4127 0.1700  0.0191  -0.0683 93  LYS A C   
722  O O   . LYS A 93  ? 0.4687 0.4458 0.4736 0.1848  0.0254  -0.0609 93  LYS A O   
723  C CB  . LYS A 93  ? 0.4789 0.4038 0.4075 0.1716  0.0156  -0.1057 93  LYS A CB  
724  C CG  . LYS A 93  ? 0.5781 0.4756 0.5298 0.1888  0.0251  -0.1121 93  LYS A CG  
725  C CD  . LYS A 93  ? 0.6524 0.4988 0.5932 0.1891  0.0196  -0.1390 93  LYS A CD  
726  C CE  . LYS A 93  ? 0.7723 0.5864 0.7439 0.2080  0.0382  -0.1442 93  LYS A CE  
727  N NZ  . LYS A 93  ? 0.7732 0.6127 0.7484 0.2257  0.0603  -0.1432 93  LYS A NZ  
728  N N   . ALA A 94  ? 0.3774 0.3464 0.3425 0.1591  0.0071  -0.0618 94  ALA A N   
729  C CA  . ALA A 94  ? 0.3794 0.3546 0.3611 0.1668  -0.0046 -0.0482 94  ALA A CA  
730  C C   . ALA A 94  ? 0.4418 0.4568 0.4404 0.1659  -0.0020 -0.0414 94  ALA A C   
731  O O   . ALA A 94  ? 0.4667 0.4998 0.4751 0.1731  -0.0198 -0.0329 94  ALA A O   
732  C CB  . ALA A 94  ? 0.4004 0.3507 0.3593 0.1616  -0.0180 -0.0437 94  ALA A CB  
733  N N   . GLY A 95  ? 0.3587 0.4595 0.4167 0.1777  -0.0220 -0.0181 95  GLY A N   
734  C CA  . GLY A 95  ? 0.3146 0.4584 0.4060 0.1698  -0.0207 -0.0080 95  GLY A CA  
735  C C   . GLY A 95  ? 0.2472 0.3993 0.3353 0.1500  -0.0221 -0.0030 95  GLY A C   
736  O O   . GLY A 95  ? 0.2541 0.4389 0.3734 0.1413  -0.0224 0.0052  95  GLY A O   
737  N N   . VAL A 96  ? 0.2187 0.3376 0.2720 0.1387  -0.0234 -0.0078 96  VAL A N   
738  C CA  . VAL A 96  ? 0.2011 0.3212 0.2495 0.1186  -0.0235 -0.0048 96  VAL A CA  
739  C C   . VAL A 96  ? 0.2412 0.3906 0.3054 0.1163  -0.0080 0.0003  96  VAL A C   
740  O O   . VAL A 96  ? 0.2362 0.3912 0.2903 0.1278  0.0057  -0.0036 96  VAL A O   
741  C CB  . VAL A 96  ? 0.2153 0.2999 0.2274 0.1100  -0.0249 -0.0113 96  VAL A CB  
742  C CG1 . VAL A 96  ? 0.2334 0.3213 0.2433 0.0937  -0.0227 -0.0095 96  VAL A CG1 
743  C CG2 . VAL A 96  ? 0.2770 0.3362 0.2739 0.1083  -0.0384 -0.0107 96  VAL A CG2 
744  N N   . ALA A 97  ? 0.1785 0.3460 0.2670 0.1018  -0.0108 0.0091  97  ALA A N   
745  C CA  . ALA A 97  ? 0.2459 0.4419 0.3545 0.0971  0.0036  0.0202  97  ALA A CA  
746  C C   . ALA A 97  ? 0.2612 0.4407 0.3410 0.0908  0.0106  0.0202  97  ALA A C   
747  O O   . ALA A 97  ? 0.2283 0.4237 0.3012 0.0966  0.0260  0.0258  97  ALA A O   
748  C CB  . ALA A 97  ? 0.1722 0.3882 0.3223 0.0818  -0.0045 0.0305  97  ALA A CB  
749  N N   . ARG A 98  ? 0.1860 0.3369 0.2488 0.0803  -0.0006 0.0142  98  ARG A N   
750  C CA  . ARG A 98  ? 0.1938 0.3301 0.2345 0.0747  0.0027  0.0140  98  ARG A CA  
751  C C   . ARG A 98  ? 0.2119 0.3173 0.2259 0.0725  -0.0065 0.0011  98  ARG A C   
752  O O   . ARG A 98  ? 0.1975 0.2925 0.2139 0.0685  -0.0169 -0.0034 98  ARG A O   
753  C CB  . ARG A 98  ? 0.1904 0.3318 0.2537 0.0606  0.0007  0.0253  98  ARG A CB  
754  C CG  . ARG A 98  ? 0.2750 0.4476 0.3671 0.0591  0.0121  0.0436  98  ARG A CG  
755  C CD  . ARG A 98  ? 0.3628 0.5324 0.4757 0.0447  0.0097  0.0571  98  ARG A CD  
756  N NE  . ARG A 98  ? 0.3984 0.5558 0.5370 0.0328  -0.0065 0.0510  98  ARG A NE  
757  C CZ  . ARG A 98  ? 0.3969 0.5674 0.5788 0.0207  -0.0102 0.0624  98  ARG A CZ  
758  N NH1 . ARG A 98  ? 0.3856 0.5852 0.5919 0.0185  0.0041  0.0842  98  ARG A NH1 
759  N NH2 . ARG A 98  ? 0.3221 0.4781 0.5230 0.0106  -0.0280 0.0517  98  ARG A NH2 
760  N N   . VAL A 99  ? 0.1881 0.2817 0.1770 0.0746  -0.0030 -0.0042 99  VAL A N   
761  C CA  . VAL A 99  ? 0.2314 0.3003 0.2011 0.0702  -0.0100 -0.0141 99  VAL A CA  
762  C C   . VAL A 99  ? 0.2249 0.2913 0.1962 0.0608  -0.0119 -0.0122 99  VAL A C   
763  O O   . VAL A 99  ? 0.2050 0.2808 0.1763 0.0614  -0.0078 -0.0060 99  VAL A O   
764  C CB  . VAL A 99  ? 0.2346 0.2907 0.1812 0.0780  -0.0080 -0.0239 99  VAL A CB  
765  C CG1 . VAL A 99  ? 0.2626 0.2966 0.1967 0.0698  -0.0144 -0.0309 99  VAL A CG1 
766  C CG2 . VAL A 99  ? 0.2493 0.3038 0.1973 0.0904  -0.0068 -0.0273 99  VAL A CG2 
767  N N   . VAL A 100 ? 0.1757 0.2308 0.1479 0.0538  -0.0182 -0.0170 100 VAL A N   
768  C CA  . VAL A 100 ? 0.1695 0.2223 0.1483 0.0474  -0.0204 -0.0177 100 VAL A CA  
769  C C   . VAL A 100 ? 0.1988 0.2434 0.1627 0.0459  -0.0201 -0.0247 100 VAL A C   
770  O O   . VAL A 100 ? 0.2241 0.2594 0.1766 0.0441  -0.0206 -0.0299 100 VAL A O   
771  C CB  . VAL A 100 ? 0.1515 0.2002 0.1404 0.0425  -0.0266 -0.0224 100 VAL A CB  
772  C CG1 . VAL A 100 ? 0.1774 0.2223 0.1760 0.0393  -0.0283 -0.0257 100 VAL A CG1 
773  C CG2 . VAL A 100 ? 0.1758 0.2341 0.1845 0.0419  -0.0304 -0.0169 100 VAL A CG2 
774  N N   . ILE A 101 ? 0.1793 0.2289 0.1458 0.0460  -0.0200 -0.0225 101 ILE A N   
775  C CA  A ILE A 101 ? 0.2013 0.2491 0.1598 0.0441  -0.0215 -0.0286 101 ILE A CA  
776  C CA  B ILE A 101 ? 0.1863 0.2339 0.1450 0.0439  -0.0215 -0.0288 101 ILE A CA  
777  C C   . ILE A 101 ? 0.2138 0.2674 0.1871 0.0427  -0.0238 -0.0284 101 ILE A C   
778  O O   . ILE A 101 ? 0.2065 0.2644 0.1911 0.0457  -0.0254 -0.0203 101 ILE A O   
779  C CB  A ILE A 101 ? 0.2295 0.2811 0.1739 0.0489  -0.0224 -0.0286 101 ILE A CB  
780  C CB  B ILE A 101 ? 0.2266 0.2772 0.1709 0.0483  -0.0226 -0.0295 101 ILE A CB  
781  C CG1 A ILE A 101 ? 0.2599 0.3056 0.1927 0.0541  -0.0192 -0.0310 101 ILE A CG1 
782  C CG1 B ILE A 101 ? 0.2479 0.3116 0.1938 0.0537  -0.0218 -0.0185 101 ILE A CG1 
783  C CG2 A ILE A 101 ? 0.2303 0.2806 0.1704 0.0450  -0.0278 -0.0368 101 ILE A CG2 
784  C CG2 B ILE A 101 ? 0.2444 0.2865 0.1762 0.0525  -0.0202 -0.0334 101 ILE A CG2 
785  C CD1 A ILE A 101 ? 0.2903 0.3444 0.2083 0.0631  -0.0170 -0.0312 101 ILE A CD1 
786  C CD1 B ILE A 101 ? 0.3277 0.3980 0.2526 0.0598  -0.0236 -0.0207 101 ILE A CD1 
787  N N   . ALA A 102 ? 0.1901 0.2447 0.1664 0.0386  -0.0235 -0.0358 102 ALA A N   
788  C CA  . ALA A 102 ? 0.1888 0.2527 0.1829 0.0402  -0.0252 -0.0372 102 ALA A CA  
789  C C   . ALA A 102 ? 0.1951 0.2697 0.1930 0.0370  -0.0281 -0.0408 102 ALA A C   
790  O O   . ALA A 102 ? 0.1890 0.2728 0.1923 0.0406  -0.0354 -0.0373 102 ALA A O   
791  C CB  . ALA A 102 ? 0.2029 0.2656 0.2055 0.0401  -0.0206 -0.0446 102 ALA A CB  
792  N N   . SER A 103 ? 0.1846 0.2589 0.1807 0.0293  -0.0235 -0.0462 103 SER A N   
793  C CA  . SER A 103 ? 0.1521 0.2396 0.1615 0.0227  -0.0258 -0.0497 103 SER A CA  
794  C C   . SER A 103 ? 0.1895 0.2786 0.1943 0.0223  -0.0377 -0.0508 103 SER A C   
795  O O   . SER A 103 ? 0.2182 0.3245 0.2389 0.0237  -0.0457 -0.0515 103 SER A O   
796  C CB  . SER A 103 ? 0.1859 0.2684 0.1917 0.0119  -0.0182 -0.0506 103 SER A CB  
797  O OG  . SER A 103 ? 0.1840 0.2729 0.1924 0.0129  -0.0070 -0.0509 103 SER A OG  
798  N N   . THR A 104 ? 0.1845 0.2569 0.1672 0.0220  -0.0398 -0.0524 104 THR A N   
799  C CA  . THR A 104 ? 0.2092 0.2817 0.1815 0.0225  -0.0515 -0.0584 104 THR A CA  
800  C C   . THR A 104 ? 0.2702 0.3548 0.2350 0.0337  -0.0576 -0.0526 104 THR A C   
801  O O   . THR A 104 ? 0.2504 0.3447 0.2098 0.0353  -0.0698 -0.0567 104 THR A O   
802  C CB  . THR A 104 ? 0.2618 0.3118 0.2117 0.0230  -0.0511 -0.0642 104 THR A CB  
803  O OG1 . THR A 104 ? 0.2666 0.3025 0.2237 0.0128  -0.0458 -0.0646 104 THR A OG1 
804  C CG2 . THR A 104 ? 0.2630 0.3110 0.2003 0.0237  -0.0644 -0.0765 104 THR A CG2 
805  N N   . ALA A 105 ? 0.2044 0.2882 0.1686 0.0406  -0.0503 -0.0420 105 ALA A N   
806  C CA  . ALA A 105 ? 0.2219 0.3158 0.1819 0.0498  -0.0545 -0.0306 105 ALA A CA  
807  C C   . ALA A 105 ? 0.2543 0.3640 0.2365 0.0517  -0.0636 -0.0273 105 ALA A C   
808  O O   . ALA A 105 ? 0.2496 0.3702 0.2254 0.0587  -0.0732 -0.0191 105 ALA A O   
809  C CB  . ALA A 105 ? 0.2332 0.3207 0.1961 0.0535  -0.0453 -0.0189 105 ALA A CB  
810  N N   . MET A 106 ? 0.1970 0.3106 0.2049 0.0469  -0.0604 -0.0330 106 MET A N   
811  C CA  . MET A 106 ? 0.1754 0.3084 0.2106 0.0502  -0.0685 -0.0322 106 MET A CA  
812  C C   . MET A 106 ? 0.1972 0.3455 0.2368 0.0432  -0.0804 -0.0414 106 MET A C   
813  O O   . MET A 106 ? 0.2316 0.3977 0.2795 0.0483  -0.0951 -0.0387 106 MET A O   
814  C CB  . MET A 106 ? 0.1849 0.3211 0.2474 0.0500  -0.0581 -0.0365 106 MET A CB  
815  C CG  . MET A 106 ? 0.2074 0.3673 0.3049 0.0562  -0.0643 -0.0372 106 MET A CG  
816  S SD  . MET A 106 ? 0.2141 0.3994 0.3335 0.0433  -0.0647 -0.0480 106 MET A SD  
817  C CE  . MET A 106 ? 0.2541 0.4714 0.4096 0.0539  -0.0819 -0.0444 106 MET A CE  
818  N N   . LYS A 107 ? 0.2183 0.2955 0.2473 0.0147  -0.0299 -0.0747 107 LYS A N   
819  C CA  . LYS A 107 ? 0.2359 0.3049 0.2744 0.0058  -0.0323 -0.0964 107 LYS A CA  
820  C C   . LYS A 107 ? 0.2935 0.3862 0.3184 0.0160  -0.0477 -0.1074 107 LYS A C   
821  O O   . LYS A 107 ? 0.3170 0.4273 0.3627 0.0106  -0.0562 -0.1257 107 LYS A O   
822  C CB  . LYS A 107 ? 0.3050 0.3235 0.3255 -0.0039 -0.0156 -0.1074 107 LYS A CB  
823  C CG  . LYS A 107 ? 0.3384 0.3313 0.3726 -0.0187 0.0018  -0.1037 107 LYS A CG  
824  C CD  . LYS A 107 ? 0.4443 0.4475 0.5264 -0.0346 0.0050  -0.1171 107 LYS A CD  
825  C CE  . LYS A 107 ? 0.4152 0.3967 0.5145 -0.0504 0.0246  -0.1138 107 LYS A CE  
826  N NZ  . LYS A 107 ? 0.4859 0.4123 0.5569 -0.0610 0.0467  -0.1209 107 LYS A NZ  
827  N N   . SER A 108 ? 0.2727 0.3686 0.2649 0.0299  -0.0510 -0.0997 108 SER A N   
828  C CA  . SER A 108 ? 0.2883 0.4018 0.2618 0.0381  -0.0618 -0.1133 108 SER A CA  
829  C C   . SER A 108 ? 0.3001 0.4405 0.2519 0.0546  -0.0683 -0.0966 108 SER A C   
830  O O   . SER A 108 ? 0.3002 0.4299 0.2260 0.0627  -0.0644 -0.0983 108 SER A O   
831  C CB  . SER A 108 ? 0.3360 0.4112 0.2899 0.0358  -0.0515 -0.1306 108 SER A CB  
832  O OG  . SER A 108 ? 0.3960 0.4380 0.3676 0.0202  -0.0389 -0.1436 108 SER A OG  
833  N N   . PRO A 109 ? 0.3006 0.4742 0.2645 0.0604  -0.0761 -0.0799 109 PRO A N   
834  C CA  . PRO A 109 ? 0.3307 0.5259 0.2754 0.0755  -0.0766 -0.0605 109 PRO A CA  
835  C C   . PRO A 109 ? 0.3140 0.5221 0.2235 0.0848  -0.0828 -0.0725 109 PRO A C   
836  O O   . PRO A 109 ? 0.3378 0.5440 0.2274 0.0936  -0.0747 -0.0642 109 PRO A O   
837  C CB  . PRO A 109 ? 0.3575 0.5833 0.3229 0.0803  -0.0844 -0.0429 109 PRO A CB  
838  C CG  . PRO A 109 ? 0.3387 0.5540 0.3425 0.0664  -0.0832 -0.0490 109 PRO A CG  
839  C CD  . PRO A 109 ? 0.3077 0.4987 0.3073 0.0541  -0.0825 -0.0777 109 PRO A CD  
840  N N   . ASP A 110 ? 0.3214 0.5437 0.2272 0.0816  -0.0951 -0.0946 110 ASP A N   
841  C CA  . ASP A 110 ? 0.3914 0.6172 0.2730 0.0851  -0.0935 -0.1051 110 ASP A CA  
842  C C   . ASP A 110 ? 0.3985 0.5935 0.2677 0.0841  -0.0813 -0.1173 110 ASP A C   
843  O O   . ASP A 110 ? 0.4395 0.6346 0.2908 0.0906  -0.0746 -0.1151 110 ASP A O   
844  C CB  . ASP A 110 ? 0.4011 0.6456 0.2906 0.0784  -0.1056 -0.1291 110 ASP A CB  
845  C CG  . ASP A 110 ? 0.5700 0.8482 0.4668 0.0843  -0.1192 -0.1151 110 ASP A CG  
846  O OD1 . ASP A 110 ? 0.6044 0.8907 0.4871 0.0958  -0.1165 -0.0866 110 ASP A OD1 
847  O OD2 . ASP A 110 ? 0.6121 0.9073 0.5313 0.0778  -0.1313 -0.1332 110 ASP A OD2 
848  N N   . VAL A 111 ? 0.3699 0.5363 0.2490 0.0767  -0.0774 -0.1303 111 VAL A N   
849  C CA  . VAL A 111 ? 0.3766 0.5078 0.2445 0.0792  -0.0650 -0.1377 111 VAL A CA  
850  C C   . VAL A 111 ? 0.4255 0.5540 0.2855 0.0905  -0.0583 -0.1153 111 VAL A C   
851  O O   . VAL A 111 ? 0.4464 0.5695 0.2958 0.0982  -0.0520 -0.1172 111 VAL A O   
852  C CB  . VAL A 111 ? 0.4424 0.5318 0.3262 0.0682  -0.0556 -0.1450 111 VAL A CB  
853  C CG1 . VAL A 111 ? 0.4525 0.5036 0.3228 0.0761  -0.0434 -0.1428 111 VAL A CG1 
854  C CG2 . VAL A 111 ? 0.4099 0.4988 0.3077 0.0554  -0.0569 -0.1743 111 VAL A CG2 
855  N N   . VAL A 112 ? 0.3252 0.4580 0.2004 0.0890  -0.0573 -0.0944 112 VAL A N   
856  C CA  . VAL A 112 ? 0.3260 0.4583 0.2022 0.0971  -0.0495 -0.0786 112 VAL A CA  
857  C C   . VAL A 112 ? 0.3209 0.4824 0.1862 0.1071  -0.0472 -0.0704 112 VAL A C   
858  O O   . VAL A 112 ? 0.3498 0.5115 0.2130 0.1151  -0.0389 -0.0683 112 VAL A O   
859  C CB  . VAL A 112 ? 0.2690 0.3974 0.1686 0.0899  -0.0459 -0.0635 112 VAL A CB  
860  C CG1 . VAL A 112 ? 0.2794 0.4163 0.1866 0.0965  -0.0376 -0.0520 112 VAL A CG1 
861  C CG2 . VAL A 112 ? 0.2868 0.3803 0.1883 0.0814  -0.0437 -0.0713 112 VAL A CG2 
862  N N   . LYS A 113 ? 0.2990 0.4831 0.1599 0.1065  -0.0527 -0.0657 113 LYS A N   
863  C CA  . LYS A 113 ? 0.3194 0.5215 0.1662 0.1145  -0.0463 -0.0569 113 LYS A CA  
864  C C   . LYS A 113 ? 0.3576 0.5502 0.1909 0.1168  -0.0414 -0.0739 113 LYS A C   
865  O O   . LYS A 113 ? 0.3602 0.5591 0.1861 0.1238  -0.0308 -0.0697 113 LYS A O   
866  C CB  . LYS A 113 ? 0.3902 0.6141 0.2295 0.1148  -0.0550 -0.0498 113 LYS A CB  
867  C CG  . LYS A 113 ? 0.3735 0.6110 0.2273 0.1178  -0.0557 -0.0255 113 LYS A CG  
868  C CD  . LYS A 113 ? 0.3918 0.6499 0.2393 0.1208  -0.0670 -0.0185 113 LYS A CD  
869  C CE  . LYS A 113 ? 0.4489 0.7182 0.3146 0.1269  -0.0651 0.0100  113 LYS A CE  
870  N NZ  . LYS A 113 ? 0.5089 0.7978 0.3666 0.1336  -0.0770 0.0195  113 LYS A NZ  
871  N N   . GLY A 114 ? 0.4199 0.5969 0.2523 0.1107  -0.0470 -0.0943 114 GLY A N   
872  C CA  . GLY A 114 ? 0.4296 0.5949 0.2535 0.1127  -0.0410 -0.1115 114 GLY A CA  
873  C C   . GLY A 114 ? 0.3839 0.5329 0.2154 0.1214  -0.0328 -0.1095 114 GLY A C   
874  O O   . GLY A 114 ? 0.4174 0.5666 0.2456 0.1275  -0.0249 -0.1163 114 GLY A O   
875  N N   . TRP A 115 ? 0.3505 0.4875 0.1931 0.1222  -0.0349 -0.1014 115 TRP A N   
876  C CA  . TRP A 115 ? 0.3384 0.4656 0.1893 0.1324  -0.0303 -0.0993 115 TRP A CA  
877  C C   . TRP A 115 ? 0.3282 0.4810 0.1867 0.1386  -0.0219 -0.0907 115 TRP A C   
878  O O   . TRP A 115 ? 0.3167 0.4708 0.1833 0.1476  -0.0162 -0.0968 115 TRP A O   
879  C CB  . TRP A 115 ? 0.3160 0.4281 0.1738 0.1306  -0.0345 -0.0919 115 TRP A CB  
880  C CG  . TRP A 115 ? 0.3726 0.4527 0.2246 0.1241  -0.0375 -0.0991 115 TRP A CG  
881  C CD1 . TRP A 115 ? 0.4384 0.5043 0.2809 0.1210  -0.0365 -0.1164 115 TRP A CD1 
882  C CD2 . TRP A 115 ? 0.3628 0.4194 0.2195 0.1182  -0.0381 -0.0914 115 TRP A CD2 
883  N NE1 . TRP A 115 ? 0.4516 0.4842 0.2958 0.1134  -0.0344 -0.1193 115 TRP A NE1 
884  C CE2 . TRP A 115 ? 0.3714 0.3965 0.2211 0.1119  -0.0353 -0.1027 115 TRP A CE2 
885  C CE3 . TRP A 115 ? 0.3174 0.3768 0.1839 0.1163  -0.0384 -0.0782 115 TRP A CE3 
886  C CZ2 . TRP A 115 ? 0.3564 0.3494 0.2055 0.1045  -0.0311 -0.0984 115 TRP A CZ2 
887  C CZ3 . TRP A 115 ? 0.3738 0.4040 0.2365 0.1090  -0.0367 -0.0749 115 TRP A CZ3 
888  C CH2 . TRP A 115 ? 0.4111 0.4066 0.2636 0.1035  -0.0322 -0.0835 115 TRP A CH2 
889  N N   . PHE A 116 ? 0.3605 0.5330 0.2190 0.1346  -0.0194 -0.0769 116 PHE A N   
890  C CA  . PHE A 116 ? 0.3703 0.5640 0.2353 0.1398  -0.0052 -0.0682 116 PHE A CA  
891  C C   . PHE A 116 ? 0.3829 0.5801 0.2354 0.1429  0.0026  -0.0762 116 PHE A C   
892  O O   . PHE A 116 ? 0.3803 0.5838 0.2456 0.1474  0.0155  -0.0790 116 PHE A O   
893  C CB  . PHE A 116 ? 0.2903 0.4987 0.1565 0.1359  -0.0011 -0.0476 116 PHE A CB  
894  C CG  . PHE A 116 ? 0.3039 0.5101 0.2028 0.1295  0.0012  -0.0371 116 PHE A CG  
895  C CD1 . PHE A 116 ? 0.3295 0.5461 0.2563 0.1304  0.0176  -0.0336 116 PHE A CD1 
896  C CD2 . PHE A 116 ? 0.2751 0.4703 0.1803 0.1210  -0.0106 -0.0343 116 PHE A CD2 
897  C CE1 . PHE A 116 ? 0.2551 0.4729 0.2140 0.1228  0.0211  -0.0288 116 PHE A CE1 
898  C CE2 . PHE A 116 ? 0.3172 0.5109 0.2519 0.1136  -0.0062 -0.0273 116 PHE A CE2 
899  C CZ  . PHE A 116 ? 0.2524 0.4583 0.2132 0.1144  0.0091  -0.0251 116 PHE A CZ  
900  N N   . GLU A 117 ? 0.3470 0.5405 0.1787 0.1384  -0.0044 -0.0826 117 GLU A N   
901  C CA  . GLU A 117 ? 0.3776 0.5739 0.1939 0.1391  0.0037  -0.0932 117 GLU A CA  
902  C C   . GLU A 117 ? 0.4359 0.6185 0.2653 0.1436  0.0081  -0.1112 117 GLU A C   
903  O O   . GLU A 117 ? 0.4526 0.6397 0.2837 0.1465  0.0216  -0.1174 117 GLU A O   
904  C CB  . GLU A 117 ? 0.4034 0.6019 0.1980 0.1319  -0.0060 -0.1004 117 GLU A CB  
905  C CG  . GLU A 117 ? 0.5775 0.7773 0.3537 0.1302  0.0019  -0.1165 117 GLU A CG  
906  C CD  . GLU A 117 ? 0.6776 0.8906 0.4356 0.1339  0.0169  -0.1050 117 GLU A CD  
907  O OE1 . GLU A 117 ? 0.6948 0.9187 0.4463 0.1370  0.0177  -0.0829 117 GLU A OE1 
908  O OE2 . GLU A 117 ? 0.6900 0.9000 0.4405 0.1338  0.0304  -0.1177 117 GLU A OE2 
909  N N   . ARG A 118 ? 0.3732 0.5368 0.2121 0.1448  -0.0016 -0.1190 118 ARG A N   
910  C CA  . ARG A 118 ? 0.3869 0.5353 0.2382 0.1527  0.0018  -0.1334 118 ARG A CA  
911  C C   . ARG A 118 ? 0.3645 0.5202 0.2414 0.1629  0.0051  -0.1289 118 ARG A C   
912  O O   . ARG A 118 ? 0.3917 0.5515 0.2827 0.1682  0.0140  -0.1379 118 ARG A O   
913  C CB  . ARG A 118 ? 0.3895 0.5097 0.2398 0.1534  -0.0065 -0.1412 118 ARG A CB  
914  C CG  . ARG A 118 ? 0.4744 0.5758 0.3394 0.1669  -0.0032 -0.1503 118 ARG A CG  
915  C CD  . ARG A 118 ? 0.4658 0.5315 0.3262 0.1689  -0.0054 -0.1572 118 ARG A CD  
916  N NE  . ARG A 118 ? 0.5324 0.5781 0.4072 0.1868  -0.0032 -0.1593 118 ARG A NE  
917  C CZ  . ARG A 118 ? 0.5238 0.5310 0.3965 0.1944  -0.0013 -0.1612 118 ARG A CZ  
918  N NH1 . ARG A 118 ? 0.5509 0.5351 0.4105 0.1827  0.0009  -0.1651 118 ARG A NH1 
919  N NH2 . ARG A 118 ? 0.5015 0.4924 0.3879 0.2138  -0.0006 -0.1583 118 ARG A NH2 
920  N N   . PHE A 119 ? 0.3399 0.4991 0.2264 0.1641  -0.0019 -0.1172 119 PHE A N   
921  C CA  . PHE A 119 ? 0.3494 0.5169 0.2636 0.1723  -0.0032 -0.1163 119 PHE A CA  
922  C C   . PHE A 119 ? 0.3084 0.5007 0.2429 0.1666  0.0090  -0.1104 119 PHE A C   
923  O O   . PHE A 119 ? 0.3623 0.5652 0.3260 0.1692  0.0112  -0.1153 119 PHE A O   
924  C CB  . PHE A 119 ? 0.3214 0.4777 0.2356 0.1758  -0.0163 -0.1100 119 PHE A CB  
925  C CG  . PHE A 119 ? 0.3439 0.4671 0.2387 0.1814  -0.0238 -0.1143 119 PHE A CG  
926  C CD1 . PHE A 119 ? 0.3541 0.4617 0.2541 0.1956  -0.0256 -0.1219 119 PHE A CD1 
927  C CD2 . PHE A 119 ? 0.3711 0.4765 0.2461 0.1715  -0.0270 -0.1104 119 PHE A CD2 
928  C CE1 . PHE A 119 ? 0.3806 0.4511 0.2643 0.2013  -0.0275 -0.1244 119 PHE A CE1 
929  C CE2 . PHE A 119 ? 0.3577 0.4274 0.2180 0.1740  -0.0290 -0.1158 119 PHE A CE2 
930  C CZ  . PHE A 119 ? 0.3829 0.4327 0.2464 0.1897  -0.0276 -0.1222 119 PHE A CZ  
931  N N   . GLY A 120 ? 0.3510 0.5043 0.2078 0.1439  0.0191  -0.0048 120 GLY A N   
932  C CA  . GLY A 120 ? 0.3235 0.4539 0.1686 0.1466  0.0496  0.0115  120 GLY A CA  
933  C C   . GLY A 120 ? 0.3343 0.4667 0.2079 0.1301  0.0524  0.0147  120 GLY A C   
934  O O   . GLY A 120 ? 0.3284 0.4822 0.2351 0.1151  0.0340  0.0054  120 GLY A O   
935  N N   . ALA A 121 ? 0.3518 0.4529 0.2043 0.1378  0.0811  0.0295  121 ALA A N   
936  C CA  . ALA A 121 ? 0.3568 0.4556 0.2309 0.1250  0.0851  0.0328  121 ALA A CA  
937  C C   . ALA A 121 ? 0.2874 0.4099 0.2298 0.0954  0.0975  0.0162  121 ALA A C   
938  O O   . ALA A 121 ? 0.2700 0.4024 0.2394 0.0837  0.0923  0.0121  121 ALA A O   
939  C CB  . ALA A 121 ? 0.4267 0.4733 0.2490 0.1479  0.1202  0.0541  121 ALA A CB  
940  N N   . GLN A 122 ? 0.3371 0.4755 0.3106 0.0875  0.1114  0.0001  122 GLN A N   
941  C CA  . GLN A 122 ? 0.2827 0.4618 0.3297 0.0685  0.1160  -0.0320 122 GLN A CA  
942  C C   . GLN A 122 ? 0.2385 0.4565 0.2933 0.0756  0.0693  -0.0444 122 GLN A C   
943  O O   . GLN A 122 ? 0.2880 0.5427 0.3880 0.0735  0.0599  -0.0715 122 GLN A O   
944  C CB  . GLN A 122 ? 0.3085 0.5019 0.3949 0.0618  0.1451  -0.0557 122 GLN A CB  
945  C CG  . GLN A 122 ? 0.4528 0.6103 0.5685 0.0441  0.2035  -0.0601 122 GLN A CG  
946  C CD  . GLN A 122 ? 0.5757 0.7563 0.7578 0.0227  0.2005  -0.0880 122 GLN A CD  
947  O OE1 . GLN A 122 ? 0.6428 0.7780 0.8248 0.0100  0.2322  -0.0789 122 GLN A OE1 
948  N NE2 . GLN A 122 ? 0.6348 0.8765 0.8626 0.0232  0.1589  -0.1229 122 GLN A NE2 
949  N N   . ALA A 123 ? 0.2429 0.4485 0.2514 0.0888  0.0447  -0.0280 123 ALA A N   
950  C CA  . ALA A 123 ? 0.2065 0.4245 0.2066 0.1017  0.0174  -0.0346 123 ALA A CA  
951  C C   . ALA A 123 ? 0.2412 0.4411 0.2257 0.1011  0.0064  -0.0217 123 ALA A C   
952  O O   . ALA A 123 ? 0.2560 0.4488 0.2252 0.1152  -0.0041 -0.0232 123 ALA A O   
953  C CB  . ALA A 123 ? 0.2997 0.5054 0.2683 0.1129  0.0110  -0.0299 123 ALA A CB  
954  N N   . LEU A 124 ? 0.2075 0.3932 0.1890 0.0903  0.0135  -0.0087 124 LEU A N   
955  C CA  . LEU A 124 ? 0.1950 0.3676 0.1681 0.0882  0.0039  -0.0003 124 LEU A CA  
956  C C   . LEU A 124 ? 0.2046 0.3790 0.1948 0.0798  0.0101  0.0030  124 LEU A C   
957  O O   . LEU A 124 ? 0.2165 0.3834 0.2097 0.0752  0.0295  0.0075  124 LEU A O   
958  C CB  . LEU A 124 ? 0.2168 0.3785 0.1697 0.0912  -0.0010 0.0033  124 LEU A CB  
959  C CG  . LEU A 124 ? 0.2789 0.4402 0.2219 0.0971  -0.0044 -0.0058 124 LEU A CG  
960  C CD1 . LEU A 124 ? 0.2820 0.4499 0.2157 0.1060  -0.0147 -0.0170 124 LEU A CD1 
961  C CD2 . LEU A 124 ? 0.3198 0.4665 0.2678 0.0958  -0.0013 -0.0115 124 LEU A CD2 
962  N N   . VAL A 125 ? 0.1663 0.3408 0.1620 0.0805  0.0005  0.0021  125 VAL A N   
963  C CA  . VAL A 125 ? 0.1584 0.3336 0.1695 0.0726  0.0040  0.0047  125 VAL A CA  
964  C C   . VAL A 125 ? 0.1544 0.3126 0.1505 0.0716  -0.0032 0.0158  125 VAL A C   
965  O O   . VAL A 125 ? 0.1888 0.3362 0.1786 0.0755  -0.0074 0.0143  125 VAL A O   
966  C CB  . VAL A 125 ? 0.1468 0.3446 0.1812 0.0794  -0.0035 -0.0135 125 VAL A CB  
967  C CG1 . VAL A 125 ? 0.1475 0.3459 0.2019 0.0689  0.0013  -0.0130 125 VAL A CG1 
968  C CG2 . VAL A 125 ? 0.1472 0.3804 0.2157 0.0824  0.0004  -0.0418 125 VAL A CG2 
969  N N   . LEU A 126 ? 0.1619 0.3132 0.1510 0.0700  0.0010  0.0243  126 LEU A N   
970  C CA  . LEU A 126 ? 0.1601 0.3083 0.1459 0.0716  -0.0090 0.0249  126 LEU A CA  
971  C C   . LEU A 126 ? 0.2025 0.3474 0.2026 0.0642  -0.0079 0.0292  126 LEU A C   
972  O O   . LEU A 126 ? 0.1759 0.3180 0.1803 0.0611  0.0020  0.0347  126 LEU A O   
973  C CB  . LEU A 126 ? 0.1878 0.3328 0.1460 0.0886  -0.0101 0.0286  126 LEU A CB  
974  C CG  . LEU A 126 ? 0.2622 0.4183 0.2197 0.0995  -0.0255 0.0189  126 LEU A CG  
975  C CD1 . LEU A 126 ? 0.2694 0.4474 0.2624 0.0910  -0.0375 -0.0087 126 LEU A CD1 
976  C CD2 . LEU A 126 ? 0.2865 0.4376 0.1940 0.1365  -0.0288 0.0208  126 LEU A CD2 
977  N N   . ALA A 127 ? 0.1432 0.2815 0.1504 0.0623  -0.0110 0.0255  127 ALA A N   
978  C CA  . ALA A 127 ? 0.1410 0.2729 0.1542 0.0605  -0.0103 0.0302  127 ALA A CA  
979  C C   . ALA A 127 ? 0.1920 0.3244 0.2129 0.0561  -0.0133 0.0303  127 ALA A C   
980  O O   . ALA A 127 ? 0.1965 0.3300 0.2310 0.0535  -0.0126 0.0171  127 ALA A O   
981  C CB  . ALA A 127 ? 0.1665 0.2772 0.1678 0.0709  -0.0039 0.0296  127 ALA A CB  
982  N N   . LEU A 128 ? 0.1289 0.2625 0.1475 0.0560  -0.0134 0.0388  128 LEU A N   
983  C CA  . LEU A 128 ? 0.1377 0.2738 0.1565 0.0596  -0.0187 0.0387  128 LEU A CA  
984  C C   . LEU A 128 ? 0.1903 0.3173 0.2187 0.0526  -0.0151 0.0457  128 LEU A C   
985  O O   . LEU A 128 ? 0.1981 0.3196 0.2229 0.0519  -0.0092 0.0541  128 LEU A O   
986  C CB  . LEU A 128 ? 0.1950 0.3262 0.1830 0.0768  -0.0161 0.0469  128 LEU A CB  
987  C CG  . LEU A 128 ? 0.1938 0.3323 0.1614 0.0927  -0.0210 0.0393  128 LEU A CG  
988  C CD1 . LEU A 128 ? 0.2352 0.3486 0.1483 0.1229  -0.0081 0.0542  128 LEU A CD1 
989  C CD2 . LEU A 128 ? 0.2379 0.4081 0.2277 0.0985  -0.0418 0.0100  128 LEU A CD2 
990  N N   . ASP A 129 ? 0.1537 0.2719 0.1928 0.0489  -0.0120 0.0410  129 ASP A N   
991  C CA  . ASP A 129 ? 0.1460 0.2505 0.1843 0.0496  -0.0079 0.0477  129 ASP A CA  
992  C C   . ASP A 129 ? 0.1968 0.3034 0.2499 0.0447  -0.0084 0.0452  129 ASP A C   
993  O O   . ASP A 129 ? 0.1634 0.2765 0.2385 0.0404  -0.0048 0.0288  129 ASP A O   
994  C CB  . ASP A 129 ? 0.1443 0.2210 0.1661 0.0605  0.0049  0.0483  129 ASP A CB  
995  C CG  . ASP A 129 ? 0.1673 0.2503 0.1714 0.0745  -0.0006 0.0453  129 ASP A CG  
996  O OD1 . ASP A 129 ? 0.1688 0.2806 0.1853 0.0722  -0.0123 0.0390  129 ASP A OD1 
997  O OD2 . ASP A 129 ? 0.1995 0.2559 0.1796 0.0889  0.0120  0.0459  129 ASP A OD2 
998  N N   . VAL A 130 ? 0.1239 0.2304 0.1737 0.0454  -0.0118 0.0542  130 VAL A N   
999  C CA  . VAL A 130 ? 0.1300 0.2458 0.1883 0.0469  -0.0170 0.0507  130 VAL A CA  
1000 C C   . VAL A 130 ? 0.1608 0.2640 0.2261 0.0434  -0.0118 0.0559  130 VAL A C   
1001 O O   . VAL A 130 ? 0.1552 0.2449 0.2101 0.0446  -0.0085 0.0653  130 VAL A O   
1002 C CB  . VAL A 130 ? 0.1725 0.2904 0.2060 0.0596  -0.0208 0.0596  130 VAL A CB  
1003 C CG1 . VAL A 130 ? 0.1840 0.3107 0.2006 0.0721  -0.0250 0.0539  130 VAL A CG1 
1004 C CG2 . VAL A 130 ? 0.1717 0.2714 0.1997 0.0527  -0.0069 0.0727  130 VAL A CG2 
1005 N N   . ARG A 131 ? 0.1365 0.2506 0.2247 0.0421  -0.0122 0.0422  131 ARG A N   
1006 C CA  . ARG A 131 ? 0.1345 0.2415 0.2293 0.0409  -0.0090 0.0463  131 ARG A CA  
1007 C C   . ARG A 131 ? 0.1726 0.2998 0.2570 0.0551  -0.0252 0.0453  131 ARG A C   
1008 O O   . ARG A 131 ? 0.1633 0.3220 0.2593 0.0687  -0.0386 0.0219  131 ARG A O   
1009 C CB  . ARG A 131 ? 0.1266 0.2280 0.2599 0.0307  0.0104  0.0266  131 ARG A CB  
1010 C CG  . ARG A 131 ? 0.1844 0.2398 0.3044 0.0281  0.0400  0.0355  131 ARG A CG  
1011 C CD  . ARG A 131 ? 0.2192 0.2429 0.3708 0.0183  0.0801  0.0215  131 ARG A CD  
1012 N NE  . ARG A 131 ? 0.2529 0.2082 0.3585 0.0318  0.1164  0.0420  131 ARG A NE  
1013 C CZ  . ARG A 131 ? 0.2926 0.2122 0.3975 0.0307  0.1503  0.0355  131 ARG A CZ  
1014 N NH1 . ARG A 131 ? 0.3187 0.2741 0.4824 0.0093  0.1506  0.0027  131 ARG A NH1 
1015 N NH2 . ARG A 131 ? 0.3442 0.1901 0.3836 0.0580  0.1847  0.0594  131 ARG A NH2 
1016 N N   . ILE A 132 ? 0.1704 0.2746 0.2279 0.0559  -0.0215 0.0632  132 ILE A N   
1017 C CA  . ILE A 132 ? 0.1673 0.2628 0.1947 0.0713  -0.0238 0.0647  132 ILE A CA  
1018 C C   . ILE A 132 ? 0.2187 0.3209 0.2576 0.0750  -0.0296 0.0577  132 ILE A C   
1019 O O   . ILE A 132 ? 0.2086 0.2981 0.2575 0.0624  -0.0217 0.0665  132 ILE A O   
1020 C CB  . ILE A 132 ? 0.2229 0.2885 0.2269 0.0694  -0.0046 0.0843  132 ILE A CB  
1021 C CG1 . ILE A 132 ? 0.2762 0.3436 0.2828 0.0653  0.0021  0.0895  132 ILE A CG1 
1022 C CG2 . ILE A 132 ? 0.3237 0.3652 0.2856 0.0924  0.0062  0.0904  132 ILE A CG2 
1023 C CD1 . ILE A 132 ? 0.3280 0.3725 0.3385 0.0565  0.0286  0.0989  132 ILE A CD1 
1024 N N   . ASP A 133 ? 0.2861 0.3574 0.2584 0.1123  -0.0184 0.0108  133 ASP A N   
1025 C CA  . ASP A 133 ? 0.3159 0.4077 0.2896 0.1398  0.0056  0.0023  133 ASP A CA  
1026 C C   . ASP A 133 ? 0.3574 0.4126 0.3120 0.1699  -0.0071 -0.0053 133 ASP A C   
1027 O O   . ASP A 133 ? 0.3797 0.3902 0.3179 0.1662  -0.0368 -0.0017 133 ASP A O   
1028 C CB  . ASP A 133 ? 0.2733 0.4446 0.3149 0.1372  0.0207  0.0079  133 ASP A CB  
1029 C CG  . ASP A 133 ? 0.2822 0.4765 0.3633 0.1399  -0.0023 0.0125  133 ASP A CG  
1030 O OD1 . ASP A 133 ? 0.2620 0.4188 0.3226 0.1487  -0.0229 0.0122  133 ASP A OD1 
1031 O OD2 . ASP A 133 ? 0.2432 0.4901 0.3756 0.1327  -0.0025 0.0181  133 ASP A OD2 
1032 N N   . GLU A 134 ? 0.3949 0.4687 0.3566 0.2002  0.0161  -0.0140 134 GLU A N   
1033 C CA  . GLU A 134 ? 0.4590 0.4929 0.3981 0.2342  0.0057  -0.0246 134 GLU A CA  
1034 C C   . GLU A 134 ? 0.4563 0.5001 0.4337 0.2331  -0.0263 -0.0175 134 GLU A C   
1035 O O   . GLU A 134 ? 0.5082 0.5012 0.4603 0.2493  -0.0512 -0.0214 134 GLU A O   
1036 C CB  . GLU A 134 ? 0.5878 0.6522 0.5421 0.2693  0.0442  -0.0341 134 GLU A CB  
1037 C CG  . GLU A 134 ? 0.7960 0.8990 0.7565 0.2617  0.0879  -0.0298 134 GLU A CG  
1038 C CD  . GLU A 134 ? 1.0498 1.1554 0.9972 0.3009  0.1338  -0.0388 134 GLU A CD  
1039 O OE1 . GLU A 134 ? 1.1259 1.2295 1.0955 0.3229  0.1288  -0.0459 134 GLU A OE1 
1040 O OE2 . GLU A 134 ? 1.1332 1.2350 1.0487 0.2945  0.1689  -0.0355 134 GLU A OE2 
1041 N N   . HIS A 135 ? 0.3525 0.4547 0.3850 0.2141  -0.0282 -0.0062 135 HIS A N   
1042 C CA  . HIS A 135 ? 0.3594 0.4675 0.4179 0.2123  -0.0569 0.0025  135 HIS A CA  
1043 C C   . HIS A 135 ? 0.3771 0.4485 0.4102 0.1872  -0.0790 0.0153  135 HIS A C   
1044 O O   . HIS A 135 ? 0.4498 0.5083 0.4880 0.1775  -0.0965 0.0254  135 HIS A O   
1045 C CB  . HIS A 135 ? 0.3064 0.4791 0.4238 0.2041  -0.0540 0.0087  135 HIS A CB  
1046 C CG  . HIS A 135 ? 0.3827 0.5986 0.5471 0.2215  -0.0295 0.0023  135 HIS A CG  
1047 N ND1 . HIS A 135 ? 0.4156 0.6257 0.6013 0.2440  -0.0313 -0.0035 135 HIS A ND1 
1048 C CD2 . HIS A 135 ? 0.3728 0.6362 0.5720 0.2165  -0.0003 0.0039  135 HIS A CD2 
1049 C CE1 . HIS A 135 ? 0.4628 0.7170 0.6995 0.2538  -0.0023 -0.0054 135 HIS A CE1 
1050 N NE2 . HIS A 135 ? 0.3962 0.6821 0.6412 0.2356  0.0172  0.0001  135 HIS A NE2 
1051 N N   . GLY A 136 ? 0.3327 0.3846 0.3414 0.1676  -0.0720 0.0168  136 GLY A N   
1052 C CA  . GLY A 136 ? 0.3187 0.3397 0.3177 0.1450  -0.0885 0.0312  136 GLY A CA  
1053 C C   . GLY A 136 ? 0.3150 0.3726 0.3345 0.1201  -0.0791 0.0403  136 GLY A C   
1054 O O   . GLY A 136 ? 0.3341 0.3735 0.3533 0.1030  -0.0849 0.0536  136 GLY A O   
1055 N N   . THR A 137 ? 0.2385 0.3459 0.2798 0.1192  -0.0650 0.0342  137 THR A N   
1056 C CA  . THR A 137 ? 0.2034 0.3376 0.2573 0.0980  -0.0608 0.0397  137 THR A CA  
1057 C C   . THR A 137 ? 0.2301 0.3499 0.2739 0.0780  -0.0529 0.0398  137 THR A C   
1058 O O   . THR A 137 ? 0.2057 0.3219 0.2401 0.0785  -0.0434 0.0319  137 THR A O   
1059 C CB  . THR A 137 ? 0.1872 0.3728 0.2733 0.0996  -0.0558 0.0346  137 THR A CB  
1060 O OG1 . THR A 137 ? 0.2178 0.4136 0.3201 0.1180  -0.0696 0.0352  137 THR A OG1 
1061 C CG2 . THR A 137 ? 0.1803 0.3804 0.2699 0.0791  -0.0590 0.0384  137 THR A CG2 
1062 N N   . LYS A 138 ? 0.1784 0.2871 0.2224 0.0621  -0.0557 0.0498  138 LYS A N   
1063 C CA  . LYS A 138 ? 0.1667 0.2609 0.2115 0.0427  -0.0527 0.0514  138 LYS A CA  
1064 C C   . LYS A 138 ? 0.1789 0.3083 0.2356 0.0296  -0.0448 0.0460  138 LYS A C   
1065 O O   . LYS A 138 ? 0.1857 0.3207 0.2472 0.0221  -0.0437 0.0504  138 LYS A O   
1066 C CB  . LYS A 138 ? 0.2235 0.2906 0.2770 0.0346  -0.0569 0.0675  138 LYS A CB  
1067 C CG  . LYS A 138 ? 0.2369 0.2681 0.2875 0.0449  -0.0705 0.0782  138 LYS A CG  
1068 C CD  . LYS A 138 ? 0.2517 0.2675 0.3266 0.0352  -0.0684 0.1011  138 LYS A CD  
1069 C CE  . LYS A 138 ? 0.2788 0.2630 0.3498 0.0398  -0.0760 0.1066  138 LYS A CE  
1070 N NZ  . LYS A 138 ? 0.2817 0.2757 0.3332 0.0564  -0.0762 0.1086  138 LYS A NZ  
1071 N N   . GLN A 139 ? 0.1570 0.3076 0.2170 0.0284  -0.0384 0.0376  139 GLN A N   
1072 C CA  . GLN A 139 ? 0.1427 0.3279 0.2215 0.0150  -0.0360 0.0351  139 GLN A CA  
1073 C C   . GLN A 139 ? 0.1679 0.3371 0.2444 -0.0063 -0.0377 0.0358  139 GLN A C   
1074 O O   . GLN A 139 ? 0.1716 0.3153 0.2338 -0.0131 -0.0368 0.0353  139 GLN A O   
1075 C CB  . GLN A 139 ? 0.1455 0.3646 0.2415 0.0196  -0.0252 0.0320  139 GLN A CB  
1076 C CG  . GLN A 139 ? 0.3178 0.5773 0.4481 0.0074  -0.0311 0.0337  139 GLN A CG  
1077 C CD  . GLN A 139 ? 0.3019 0.5988 0.4635 0.0057  -0.0160 0.0373  139 GLN A CD  
1078 O OE1 . GLN A 139 ? 0.3165 0.6164 0.4991 -0.0066 -0.0215 0.0380  139 GLN A OE1 
1079 N NE2 . GLN A 139 ? 0.2570 0.5465 0.4032 0.0200  0.0059  0.0363  139 GLN A NE2 
1080 N N   . VAL A 140 ? 0.1738 0.2867 0.2057 0.0638  -0.0266 0.0259  140 VAL A N   
1081 C CA  . VAL A 140 ? 0.1462 0.2510 0.1813 0.0481  -0.0267 0.0209  140 VAL A CA  
1082 C C   . VAL A 140 ? 0.1633 0.2825 0.2133 0.0385  -0.0266 0.0160  140 VAL A C   
1083 O O   . VAL A 140 ? 0.1638 0.3102 0.2259 0.0365  -0.0310 0.0148  140 VAL A O   
1084 C CB  . VAL A 140 ? 0.1762 0.2848 0.2067 0.0449  -0.0321 0.0189  140 VAL A CB  
1085 C CG1 . VAL A 140 ? 0.1970 0.2985 0.2276 0.0335  -0.0327 0.0130  140 VAL A CG1 
1086 C CG2 . VAL A 140 ? 0.1920 0.2855 0.2070 0.0511  -0.0302 0.0257  140 VAL A CG2 
1087 N N   . ALA A 141 ? 0.1287 0.2306 0.1770 0.0310  -0.0221 0.0143  141 ALA A N   
1088 C CA  . ALA A 141 ? 0.1488 0.2581 0.2068 0.0202  -0.0215 0.0107  141 ALA A CA  
1089 C C   . ALA A 141 ? 0.1739 0.2728 0.2266 0.0092  -0.0262 0.0053  141 ALA A C   
1090 O O   . ALA A 141 ? 0.1725 0.2572 0.2145 0.0117  -0.0268 0.0047  141 ALA A O   
1091 C CB  . ALA A 141 ? 0.1944 0.2887 0.2494 0.0209  -0.0140 0.0120  141 ALA A CB  
1092 N N   . VAL A 142 ? 0.1340 0.2399 0.1917 -0.0028 -0.0297 0.0022  142 VAL A N   
1093 C CA  . VAL A 142 ? 0.1483 0.2354 0.1931 -0.0119 -0.0352 -0.0037 142 VAL A CA  
1094 C C   . VAL A 142 ? 0.1963 0.2746 0.2412 -0.0254 -0.0339 -0.0047 142 VAL A C   
1095 O O   . VAL A 142 ? 0.1678 0.2599 0.2251 -0.0273 -0.0279 -0.0004 142 VAL A O   
1096 C CB  . VAL A 142 ? 0.1774 0.2728 0.2175 -0.0158 -0.0457 -0.0075 142 VAL A CB  
1097 C CG1 . VAL A 142 ? 0.2413 0.3419 0.2769 -0.0015 -0.0465 -0.0060 142 VAL A CG1 
1098 C CG2 . VAL A 142 ? 0.1793 0.3053 0.2361 -0.0267 -0.0502 -0.0052 142 VAL A CG2 
1099 N N   . SER A 143 ? 0.1831 0.2361 0.2102 -0.0333 -0.0391 -0.0099 143 SER A N   
1100 C CA  . SER A 143 ? 0.1772 0.2135 0.1977 -0.0471 -0.0386 -0.0102 143 SER A CA  
1101 C C   . SER A 143 ? 0.1879 0.2200 0.2128 -0.0420 -0.0285 -0.0065 143 SER A C   
1102 O O   . SER A 143 ? 0.1969 0.2419 0.2329 -0.0495 -0.0236 -0.0020 143 SER A O   
1103 C CB  . SER A 143 ? 0.1844 0.2439 0.2178 -0.0658 -0.0428 -0.0072 143 SER A CB  
1104 O OG  . SER A 143 ? 0.2664 0.3276 0.2928 -0.0739 -0.0547 -0.0113 143 SER A OG  
1105 N N   . GLY A 144 ? 0.1759 0.1929 0.1918 -0.0293 -0.0255 -0.0076 144 GLY A N   
1106 C CA  . GLY A 144 ? 0.1856 0.1978 0.2033 -0.0248 -0.0180 -0.0045 144 GLY A CA  
1107 C C   . GLY A 144 ? 0.1666 0.1997 0.2002 -0.0208 -0.0122 0.0001  144 GLY A C   
1108 O O   . GLY A 144 ? 0.1755 0.2057 0.2096 -0.0207 -0.0062 0.0025  144 GLY A O   
1109 N N   . TRP A 145 ? 0.1536 0.2045 0.1958 -0.0152 -0.0140 0.0012  145 TRP A N   
1110 C CA  . TRP A 145 ? 0.1803 0.2482 0.2323 -0.0068 -0.0095 0.0054  145 TRP A CA  
1111 C C   . TRP A 145 ? 0.1926 0.2841 0.2570 -0.0111 -0.0060 0.0086  145 TRP A C   
1112 O O   . TRP A 145 ? 0.1802 0.2858 0.2495 -0.0002 -0.0007 0.0123  145 TRP A O   
1113 C CB  . TRP A 145 ? 0.1241 0.1746 0.1673 0.0009  -0.0044 0.0071  145 TRP A CB  
1114 C CG  . TRP A 145 ? 0.1233 0.1588 0.1571 0.0028  -0.0074 0.0068  145 TRP A CG  
1115 C CD1 . TRP A 145 ? 0.1514 0.1898 0.1839 0.0025  -0.0121 0.0057  145 TRP A CD1 
1116 C CD2 . TRP A 145 ? 0.1328 0.1516 0.1569 0.0043  -0.0059 0.0087  145 TRP A CD2 
1117 N NE1 . TRP A 145 ? 0.1661 0.1967 0.1918 0.0040  -0.0123 0.0081  145 TRP A NE1 
1118 C CE2 . TRP A 145 ? 0.1563 0.1748 0.1773 0.0030  -0.0095 0.0101  145 TRP A CE2 
1119 C CE3 . TRP A 145 ? 0.1529 0.1573 0.1684 0.0062  -0.0025 0.0096  145 TRP A CE3 
1120 C CZ2 . TRP A 145 ? 0.1661 0.1747 0.1793 -0.0001 -0.0105 0.0134  145 TRP A CZ2 
1121 C CZ3 . TRP A 145 ? 0.1732 0.1606 0.1770 0.0034  -0.0047 0.0112  145 TRP A CZ3 
1122 C CH2 . TRP A 145 ? 0.1652 0.1569 0.1696 -0.0014 -0.0091 0.0137  145 TRP A CH2 
1123 N N   . GLN A 146 ? 0.1559 0.2516 0.2229 -0.0265 -0.0090 0.0078  146 GLN A N   
1124 C CA  . GLN A 146 ? 0.1435 0.2689 0.2247 -0.0346 -0.0054 0.0131  146 GLN A CA  
1125 C C   . GLN A 146 ? 0.1838 0.3490 0.2821 -0.0347 -0.0100 0.0159  146 GLN A C   
1126 O O   . GLN A 146 ? 0.2179 0.4210 0.3325 -0.0370 -0.0061 0.0223  146 GLN A O   
1127 C CB  . GLN A 146 ? 0.1839 0.2968 0.2590 -0.0557 -0.0079 0.0130  146 GLN A CB  
1128 C CG  . GLN A 146 ? 0.2011 0.2763 0.2578 -0.0551 -0.0042 0.0109  146 GLN A CG  
1129 C CD  . GLN A 146 ? 0.2644 0.3183 0.3078 -0.0750 -0.0088 0.0105  146 GLN A CD  
1130 O OE1 . GLN A 146 ? 0.2951 0.3511 0.3383 -0.0858 -0.0035 0.0158  146 GLN A OE1 
1131 N NE2 . GLN A 146 ? 0.3066 0.3373 0.3352 -0.0798 -0.0188 0.0045  146 GLN A NE2 
1132 N N   . GLU A 147 ? 0.1630 0.3234 0.2574 -0.0319 -0.0183 0.0119  147 GLU A N   
1133 C CA  A GLU A 147 ? 0.1478 0.3444 0.2557 -0.0307 -0.0247 0.0140  147 GLU A CA  
1134 C CA  B GLU A 147 ? 0.1420 0.3390 0.2501 -0.0307 -0.0246 0.0141  147 GLU A CA  
1135 C C   . GLU A 147 ? 0.1686 0.3653 0.2733 -0.0085 -0.0237 0.0144  147 GLU A C   
1136 O O   . GLU A 147 ? 0.1785 0.3437 0.2681 -0.0025 -0.0244 0.0108  147 GLU A O   
1137 C CB  A GLU A 147 ? 0.1945 0.3838 0.2956 -0.0484 -0.0376 0.0089  147 GLU A CB  
1138 C CB  B GLU A 147 ? 0.1951 0.3861 0.2971 -0.0490 -0.0375 0.0092  147 GLU A CB  
1139 C CG  A GLU A 147 ? 0.2593 0.4523 0.3620 -0.0747 -0.0420 0.0101  147 GLU A CG  
1140 C CG  B GLU A 147 ? 0.2477 0.4763 0.3618 -0.0491 -0.0466 0.0108  147 GLU A CG  
1141 C CD  A GLU A 147 ? 0.3663 0.5422 0.4538 -0.0912 -0.0570 0.0038  147 GLU A CD  
1142 C CD  B GLU A 147 ? 0.3669 0.5830 0.4689 -0.0690 -0.0612 0.0048  147 GLU A CD  
1143 O OE1 A GLU A 147 ? 0.4412 0.6334 0.5312 -0.0851 -0.0647 0.0019  147 GLU A OE1 
1144 O OE1 B GLU A 147 ? 0.4369 0.6181 0.5221 -0.0847 -0.0637 0.0008  147 GLU A OE1 
1145 O OE2 A GLU A 147 ? 0.3761 0.5179 0.4448 -0.1088 -0.0614 0.0006  147 GLU A OE2 
1146 O OE2 B GLU A 147 ? 0.2953 0.5329 0.4005 -0.0678 -0.0708 0.0040  147 GLU A OE2 
1147 N N   . ASN A 148 ? 0.1805 0.4138 0.2981 0.0042  -0.0220 0.0199  148 ASN A N   
1148 C CA  . ASN A 148 ? 0.1226 0.3534 0.2331 0.0249  -0.0228 0.0211  148 ASN A CA  
1149 C C   . ASN A 148 ? 0.1248 0.3750 0.2395 0.0195  -0.0346 0.0195  148 ASN A C   
1150 O O   . ASN A 148 ? 0.1703 0.4618 0.3021 0.0107  -0.0402 0.0220  148 ASN A O   
1151 C CB  . ASN A 148 ? 0.1540 0.4079 0.2688 0.0471  -0.0149 0.0277  148 ASN A CB  
1152 C CG  . ASN A 148 ? 0.2401 0.4641 0.3417 0.0554  -0.0043 0.0280  148 ASN A CG  
1153 O OD1 . ASN A 148 ? 0.2693 0.4494 0.3526 0.0547  -0.0038 0.0245  148 ASN A OD1 
1154 N ND2 . ASN A 148 ? 0.3055 0.5557 0.4157 0.0623  0.0037  0.0325  148 ASN A ND2 
1155 N N   . SER A 149 ? 0.1506 0.3735 0.2494 0.0234  -0.0388 0.0159  149 SER A N   
1156 C CA  . SER A 149 ? 0.1677 0.3998 0.2642 0.0160  -0.0508 0.0123  149 SER A CA  
1157 C C   . SER A 149 ? 0.1681 0.4350 0.2715 0.0294  -0.0562 0.0166  149 SER A C   
1158 O O   . SER A 149 ? 0.1930 0.4763 0.2972 0.0211  -0.0678 0.0140  149 SER A O   
1159 C CB  . SER A 149 ? 0.1565 0.3508 0.2319 0.0176  -0.0523 0.0077  149 SER A CB  
1160 O OG  . SER A 149 ? 0.1606 0.3468 0.2269 0.0358  -0.0486 0.0122  149 SER A OG  
1161 N N   . GLY A 150 ? 0.1711 0.4448 0.2746 0.0512  -0.0489 0.0229  150 GLY A N   
1162 C CA  . GLY A 150 ? 0.1899 0.4818 0.2912 0.0667  -0.0514 0.0268  150 GLY A CA  
1163 C C   . GLY A 150 ? 0.2106 0.4782 0.2917 0.0767  -0.0555 0.0264  150 GLY A C   
1164 O O   . GLY A 150 ? 0.2680 0.5440 0.3430 0.0882  -0.0577 0.0291  150 GLY A O   
1165 N N   . VAL A 151 ? 0.1904 0.4247 0.2588 0.0711  -0.0546 0.0234  151 VAL A N   
1166 C CA  . VAL A 151 ? 0.1872 0.3978 0.2352 0.0781  -0.0564 0.0244  151 VAL A CA  
1167 C C   . VAL A 151 ? 0.2177 0.3894 0.2491 0.0847  -0.0466 0.0290  151 VAL A C   
1168 O O   . VAL A 151 ? 0.2188 0.3733 0.2522 0.0762  -0.0405 0.0273  151 VAL A O   
1169 C CB  . VAL A 151 ? 0.2490 0.4500 0.2906 0.0629  -0.0629 0.0169  151 VAL A CB  
1170 C CG1 . VAL A 151 ? 0.3316 0.5121 0.3520 0.0711  -0.0624 0.0193  151 VAL A CG1 
1171 C CG2 . VAL A 151 ? 0.2928 0.5246 0.3439 0.0529  -0.0755 0.0121  151 VAL A CG2 
1172 N N   . SER A 152 ? 0.2234 0.3802 0.2364 0.0981  -0.0460 0.0354  152 SER A N   
1173 C CA  . SER A 152 ? 0.2188 0.3364 0.2128 0.1005  -0.0386 0.0412  152 SER A CA  
1174 C C   . SER A 152 ? 0.1977 0.2974 0.1845 0.0864  -0.0367 0.0411  152 SER A C   
1175 O O   . SER A 152 ? 0.2061 0.3191 0.1951 0.0817  -0.0408 0.0374  152 SER A O   
1176 C CB  . SER A 152 ? 0.2602 0.3635 0.2324 0.1194  -0.0388 0.0499  152 SER A CB  
1177 O OG  . SER A 152 ? 0.2597 0.3643 0.2212 0.1201  -0.0428 0.0528  152 SER A OG  
1178 N N   . LEU A 153 ? 0.2045 0.2754 0.1811 0.0804  -0.0308 0.0453  153 LEU A N   
1179 C CA  . LEU A 153 ? 0.2070 0.2674 0.1775 0.0680  -0.0283 0.0484  153 LEU A CA  
1180 C C   . LEU A 153 ? 0.2503 0.3156 0.2084 0.0729  -0.0300 0.0542  153 LEU A C   
1181 O O   . LEU A 153 ? 0.2189 0.2978 0.1793 0.0685  -0.0301 0.0523  153 LEU A O   
1182 C CB  . LEU A 153 ? 0.2532 0.2820 0.2106 0.0601  -0.0239 0.0549  153 LEU A CB  
1183 C CG  . LEU A 153 ? 0.2528 0.2773 0.2051 0.0452  -0.0214 0.0615  153 LEU A CG  
1184 C CD1 . LEU A 153 ? 0.2748 0.2800 0.2255 0.0320  -0.0196 0.0624  153 LEU A CD1 
1185 C CD2 . LEU A 153 ? 0.3098 0.3201 0.2406 0.0458  -0.0210 0.0736  153 LEU A CD2 
1186 N N   . GLU A 154 ? 0.2429 0.2958 0.1844 0.0847  -0.0311 0.0613  154 GLU A N   
1187 C CA  . GLU A 154 ? 0.2817 0.3346 0.2067 0.0900  -0.0321 0.0690  154 GLU A CA  
1188 C C   . GLU A 154 ? 0.2827 0.3662 0.2156 0.0969  -0.0380 0.0620  154 GLU A C   
1189 O O   . GLU A 154 ? 0.2623 0.3524 0.1863 0.0964  -0.0375 0.0647  154 GLU A O   
1190 C CB  . GLU A 154 ? 0.3156 0.3429 0.2166 0.1035  -0.0327 0.0781  154 GLU A CB  
1191 C CG  . GLU A 154 ? 0.3422 0.3264 0.2229 0.0951  -0.0286 0.0864  154 GLU A CG  
1192 C CD  . GLU A 154 ? 0.3785 0.3476 0.2617 0.1000  -0.0281 0.0807  154 GLU A CD  
1193 O OE1 . GLU A 154 ? 0.3042 0.3022 0.2116 0.1051  -0.0292 0.0708  154 GLU A OE1 
1194 O OE2 . GLU A 154 ? 0.4429 0.3685 0.3002 0.0985  -0.0269 0.0867  154 GLU A OE2 
1195 N N   . GLN A 155 ? 0.2384 0.3415 0.1862 0.1023  -0.0439 0.0535  155 GLN A N   
1196 C CA  . GLN A 155 ? 0.2297 0.3585 0.1822 0.1045  -0.0521 0.0460  155 GLN A CA  
1197 C C   . GLN A 155 ? 0.2186 0.3482 0.1728 0.0930  -0.0512 0.0393  155 GLN A C   
1198 O O   . GLN A 155 ? 0.2517 0.3870 0.1938 0.0966  -0.0547 0.0372  155 GLN A O   
1199 C CB  . GLN A 155 ? 0.2203 0.3743 0.1915 0.1060  -0.0593 0.0389  155 GLN A CB  
1200 C CG  . GLN A 155 ? 0.2358 0.4083 0.2086 0.1012  -0.0688 0.0302  155 GLN A CG  
1201 C CD  . GLN A 155 ? 0.2562 0.4553 0.2493 0.0949  -0.0758 0.0243  155 GLN A CD  
1202 O OE1 . GLN A 155 ? 0.2436 0.4539 0.2478 0.1010  -0.0727 0.0281  155 GLN A OE1 
1203 N NE2 . GLN A 155 ? 0.3321 0.5404 0.3276 0.0821  -0.0853 0.0153  155 GLN A NE2 
1204 N N   . LEU A 156 ? 0.2047 0.3267 0.1701 0.0820  -0.0463 0.0361  156 LEU A N   
1205 C CA  . LEU A 156 ? 0.1969 0.3185 0.1612 0.0751  -0.0455 0.0297  156 LEU A CA  
1206 C C   . LEU A 156 ? 0.2187 0.3365 0.1696 0.0770  -0.0383 0.0379  156 LEU A C   
1207 O O   . LEU A 156 ? 0.2377 0.3609 0.1783 0.0811  -0.0388 0.0343  156 LEU A O   
1208 C CB  . LEU A 156 ? 0.2132 0.3290 0.1921 0.0643  -0.0429 0.0245  156 LEU A CB  
1209 C CG  . LEU A 156 ? 0.2516 0.3767 0.2410 0.0593  -0.0509 0.0149  156 LEU A CG  
1210 C CD1 . LEU A 156 ? 0.2133 0.3319 0.2159 0.0489  -0.0474 0.0116  156 LEU A CD1 
1211 C CD2 . LEU A 156 ? 0.3719 0.4972 0.3480 0.0588  -0.0591 0.0063  156 LEU A CD2 
1212 N N   . VAL A 157 ? 0.2091 0.3176 0.1575 0.0741  -0.0319 0.0494  157 VAL A N   
1213 C CA  . VAL A 157 ? 0.2201 0.3316 0.1566 0.0732  -0.0253 0.0604  157 VAL A CA  
1214 C C   . VAL A 157 ? 0.2372 0.3578 0.1567 0.0856  -0.0278 0.0623  157 VAL A C   
1215 O O   . VAL A 157 ? 0.2489 0.3822 0.1596 0.0901  -0.0244 0.0634  157 VAL A O   
1216 C CB  . VAL A 157 ? 0.2324 0.3263 0.1633 0.0644  -0.0205 0.0740  157 VAL A CB  
1217 C CG1 . VAL A 157 ? 0.2484 0.3501 0.1663 0.0607  -0.0143 0.0881  157 VAL A CG1 
1218 C CG2 . VAL A 157 ? 0.2388 0.3232 0.1823 0.0512  -0.0183 0.0724  157 VAL A CG2 
1219 N N   . GLU A 158 ? 0.2489 0.3648 0.1622 0.0938  -0.0337 0.0627  158 GLU A N   
1220 C CA  . GLU A 158 ? 0.2674 0.3907 0.1628 0.1058  -0.0368 0.0646  158 GLU A CA  
1221 C C   . GLU A 158 ? 0.2978 0.4311 0.1919 0.1096  -0.0429 0.0499  158 GLU A C   
1222 O O   . GLU A 158 ? 0.2867 0.4226 0.1656 0.1166  -0.0424 0.0487  158 GLU A O   
1223 C CB  . GLU A 158 ? 0.2818 0.3969 0.1731 0.1130  -0.0416 0.0665  158 GLU A CB  
1224 C CG  . GLU A 158 ? 0.2974 0.3900 0.1788 0.1119  -0.0365 0.0808  158 GLU A CG  
1225 C CD  . GLU A 158 ? 0.3771 0.4604 0.2393 0.1077  -0.0287 0.0950  158 GLU A CD  
1226 O OE1 . GLU A 158 ? 0.3319 0.4308 0.1896 0.1095  -0.0261 0.0940  158 GLU A OE1 
1227 O OE2 . GLU A 158 ? 0.3504 0.4085 0.1999 0.1019  -0.0251 0.1074  158 GLU A OE2 
1228 N N   . THR A 159 ? 0.2506 0.3858 0.1571 0.1045  -0.0490 0.0391  159 THR A N   
1229 C CA  . THR A 159 ? 0.2578 0.3930 0.1566 0.1056  -0.0566 0.0253  159 THR A CA  
1230 C C   . THR A 159 ? 0.2668 0.3996 0.1503 0.1111  -0.0495 0.0248  159 THR A C   
1231 O O   . THR A 159 ? 0.2992 0.4268 0.1638 0.1187  -0.0527 0.0172  159 THR A O   
1232 C CB  . THR A 159 ? 0.2737 0.4066 0.1889 0.0945  -0.0633 0.0150  159 THR A CB  
1233 O OG1 . THR A 159 ? 0.2528 0.3965 0.1825 0.0921  -0.0696 0.0158  159 THR A OG1 
1234 C CG2 . THR A 159 ? 0.2866 0.4102 0.1860 0.0932  -0.0727 0.0013  159 THR A CG2 
1235 N N   . TYR A 160 ? 0.2601 0.3972 0.1519 0.1077  -0.0393 0.0330  160 TYR A N   
1236 C CA  . TYR A 160 ? 0.2599 0.4023 0.1413 0.1147  -0.0318 0.0329  160 TYR A CA  
1237 C C   . TYR A 160 ? 0.2922 0.4512 0.1706 0.1180  -0.0193 0.0475  160 TYR A C   
1238 O O   . TYR A 160 ? 0.2888 0.4590 0.1603 0.1267  -0.0118 0.0479  160 TYR A O   
1239 C CB  . TYR A 160 ? 0.2507 0.3899 0.1475 0.1064  -0.0287 0.0297  160 TYR A CB  
1240 C CG  . TYR A 160 ? 0.2494 0.3694 0.1460 0.1020  -0.0391 0.0144  160 TYR A CG  
1241 C CD1 . TYR A 160 ? 0.2689 0.3744 0.1405 0.1118  -0.0452 0.0025  160 TYR A CD1 
1242 C CD2 . TYR A 160 ? 0.2360 0.3504 0.1537 0.0880  -0.0430 0.0122  160 TYR A CD2 
1243 C CE1 . TYR A 160 ? 0.3297 0.4133 0.1975 0.1033  -0.0560 -0.0105 160 TYR A CE1 
1244 C CE2 . TYR A 160 ? 0.2504 0.3512 0.1686 0.0808  -0.0521 0.0002  160 TYR A CE2 
1245 C CZ  . TYR A 160 ? 0.3036 0.3879 0.1968 0.0864  -0.0591 -0.0107 160 TYR A CZ  
1246 O OH  . TYR A 160 ? 0.3491 0.4155 0.2394 0.0749  -0.0693 -0.0214 160 TYR A OH  
1247 N N   . LEU A 161 ? 0.2813 0.4418 0.1637 0.1115  -0.0169 0.0601  161 LEU A N   
1248 C CA  . LEU A 161 ? 0.2790 0.4541 0.1565 0.1113  -0.0062 0.0750  161 LEU A CA  
1249 C C   . LEU A 161 ? 0.3035 0.4865 0.1641 0.1270  -0.0032 0.0710  161 LEU A C   
1250 O O   . LEU A 161 ? 0.3075 0.5118 0.1684 0.1306  0.0071  0.0792  161 LEU A O   
1251 C CB  . LEU A 161 ? 0.3016 0.4654 0.1769 0.1029  -0.0063 0.0879  161 LEU A CB  
1252 C CG  . LEU A 161 ? 0.3253 0.4831 0.2105 0.0855  -0.0033 0.1005  161 LEU A CG  
1253 C CD1 . LEU A 161 ? 0.3622 0.4965 0.2356 0.0803  -0.0046 0.1116  161 LEU A CD1 
1254 C CD2 . LEU A 161 ? 0.2778 0.4597 0.1714 0.0754  0.0068  0.1113  161 LEU A CD2 
1255 N N   . PRO A 162 ? 0.3152 0.4835 0.1620 0.1362  -0.0125 0.0588  162 PRO A N   
1256 C CA  . PRO A 162 ? 0.3412 0.5140 0.1687 0.1517  -0.0097 0.0554  162 PRO A CA  
1257 C C   . PRO A 162 ? 0.3519 0.5285 0.1718 0.1642  -0.0062 0.0466  162 PRO A C   
1258 O O   . PRO A 162 ? 0.3839 0.5680 0.1889 0.1795  -0.0010 0.0469  162 PRO A O   
1259 C CB  . PRO A 162 ? 0.3961 0.5504 0.2106 0.1555  -0.0231 0.0439  162 PRO A CB  
1260 C CG  . PRO A 162 ? 0.3392 0.4880 0.1686 0.1434  -0.0289 0.0479  162 PRO A CG  
1261 C CD  . PRO A 162 ? 0.3485 0.5003 0.1965 0.1328  -0.0252 0.0507  162 PRO A CD  
1262 N N   . VAL A 163 ? 0.3449 0.5148 0.1725 0.1602  -0.0090 0.0392  163 VAL A N   
1263 C CA  . VAL A 163 ? 0.3458 0.5160 0.1636 0.1748  -0.0052 0.0320  163 VAL A CA  
1264 C C   . VAL A 163 ? 0.3771 0.5778 0.2154 0.1724  0.0070  0.0445  163 VAL A C   
1265 O O   . VAL A 163 ? 0.3737 0.5781 0.2096 0.1839  0.0102  0.0400  163 VAL A O   
1266 C CB  . VAL A 163 ? 0.3525 0.4901 0.1584 0.1744  -0.0176 0.0143  163 VAL A CB  
1267 C CG1 . VAL A 163 ? 0.3908 0.5027 0.1767 0.1743  -0.0315 0.0026  163 VAL A CG1 
1268 C CG2 . VAL A 163 ? 0.3329 0.4688 0.1602 0.1567  -0.0212 0.0153  163 VAL A CG2 
1269 N N   . GLY A 164 ? 0.3097 0.5306 0.1666 0.1570  0.0127  0.0607  164 GLY A N   
1270 C CA  . GLY A 164 ? 0.2970 0.5528 0.1740 0.1510  0.0232  0.0756  164 GLY A CA  
1271 C C   . GLY A 164 ? 0.2720 0.5299 0.1685 0.1337  0.0220  0.0790  164 GLY A C   
1272 O O   . GLY A 164 ? 0.2784 0.5665 0.1910 0.1306  0.0287  0.0881  164 GLY A O   
1273 N N   . LEU A 165 ? 0.2613 0.4906 0.1577 0.1230  0.0126  0.0722  165 LEU A N   
1274 C CA  . LEU A 165 ? 0.2580 0.4852 0.1710 0.1070  0.0104  0.0753  165 LEU A CA  
1275 C C   . LEU A 165 ? 0.2304 0.4847 0.1602 0.0901  0.0184  0.0943  165 LEU A C   
1276 O O   . LEU A 165 ? 0.2637 0.5212 0.1922 0.0811  0.0213  0.1063  165 LEU A O   
1277 C CB  . LEU A 165 ? 0.2298 0.4263 0.1449 0.0968  0.0003  0.0696  165 LEU A CB  
1278 C CG  . LEU A 165 ? 0.2105 0.3958 0.1468 0.0780  -0.0011 0.0703  165 LEU A CG  
1279 C CD1 . LEU A 165 ? 0.2014 0.3834 0.1443 0.0808  -0.0029 0.0588  165 LEU A CD1 
1280 C CD2 . LEU A 165 ? 0.2237 0.3823 0.1621 0.0710  -0.0082 0.0668  165 LEU A CD2 
1281 N N   . LYS A 166 ? 0.2179 0.4902 0.1623 0.0844  0.0209  0.0969  166 LYS A N   
1282 C CA  . LYS A 166 ? 0.2138 0.5151 0.1763 0.0653  0.0263  0.1139  166 LYS A CA  
1283 C C   . LYS A 166 ? 0.2231 0.5184 0.1986 0.0458  0.0226  0.1163  166 LYS A C   
1284 O O   . LYS A 166 ? 0.2790 0.5771 0.2638 0.0217  0.0223  0.1288  166 LYS A O   
1285 C CB  . LYS A 166 ? 0.3240 0.6701 0.2957 0.0787  0.0331  0.1186  166 LYS A CB  
1286 C CG  . LYS A 166 ? 0.3758 0.7579 0.3701 0.0590  0.0342  0.1338  166 LYS A CG  
1287 C CD  . LYS A 166 ? 0.5192 0.9496 0.5210 0.0728  0.0386  0.1424  166 LYS A CD  
1288 C CE  . LYS A 166 ? 0.5226 0.9878 0.5447 0.0482  0.0362  0.1586  166 LYS A CE  
1289 N NZ  . LYS A 166 ? 0.6315 1.1476 0.6613 0.0650  0.0370  0.1653  166 LYS A NZ  
1290 N N   . HIS A 167 ? 0.2098 0.4761 0.1779 0.0854  0.0455  0.0577  167 HIS A N   
1291 C CA  . HIS A 167 ? 0.1999 0.4498 0.1784 0.0832  0.0456  0.0597  167 HIS A CA  
1292 C C   . HIS A 167 ? 0.1851 0.4033 0.1617 0.0777  0.0427  0.0546  167 HIS A C   
1293 O O   . HIS A 167 ? 0.2050 0.4044 0.1671 0.0822  0.0422  0.0407  167 HIS A O   
1294 C CB  . HIS A 167 ? 0.1828 0.4260 0.1562 0.0978  0.0474  0.0489  167 HIS A CB  
1295 C CG  . HIS A 167 ? 0.2084 0.4830 0.1852 0.1036  0.0475  0.0523  167 HIS A CG  
1296 N ND1 . HIS A 167 ? 0.1818 0.4799 0.1744 0.0941  0.0459  0.0650  167 HIS A ND1 
1297 C CD2 . HIS A 167 ? 0.2179 0.5061 0.1834 0.1175  0.0488  0.0439  167 HIS A CD2 
1298 C CE1 . HIS A 167 ? 0.1943 0.5228 0.1856 0.1013  0.0463  0.0646  167 HIS A CE1 
1299 N NE2 . HIS A 167 ? 0.2593 0.5828 0.2349 0.1168  0.0482  0.0521  167 HIS A NE2 
1300 N N   . VAL A 168 ? 0.1549 0.3630 0.1459 0.0661  0.0382  0.0642  168 VAL A N   
1301 C CA  . VAL A 168 ? 0.1497 0.3279 0.1429 0.0603  0.0331  0.0584  168 VAL A CA  
1302 C C   . VAL A 168 ? 0.1695 0.3328 0.1749 0.0557  0.0314  0.0608  168 VAL A C   
1303 O O   . VAL A 168 ? 0.1659 0.3397 0.1822 0.0499  0.0307  0.0723  168 VAL A O   
1304 C CB  . VAL A 168 ? 0.1488 0.3294 0.1450 0.0532  0.0279  0.0662  168 VAL A CB  
1305 C CG1 . VAL A 168 ? 0.1897 0.3474 0.1921 0.0487  0.0228  0.0606  168 VAL A CG1 
1306 C CG2 . VAL A 168 ? 0.2151 0.4108 0.1972 0.0574  0.0285  0.0619  168 VAL A CG2 
1307 N N   . LEU A 169 ? 0.1395 0.2782 0.1410 0.0566  0.0306  0.0497  169 LEU A N   
1308 C CA  . LEU A 169 ? 0.1581 0.2818 0.1689 0.0518  0.0285  0.0506  169 LEU A CA  
1309 C C   . LEU A 169 ? 0.1921 0.3030 0.2074 0.0442  0.0242  0.0480  169 LEU A C   
1310 O O   . LEU A 169 ? 0.1876 0.2921 0.1947 0.0436  0.0240  0.0388  169 LEU A O   
1311 C CB  . LEU A 169 ? 0.1984 0.3049 0.1988 0.0586  0.0309  0.0413  169 LEU A CB  
1312 C CG  . LEU A 169 ? 0.2177 0.3098 0.2230 0.0559  0.0294  0.0412  169 LEU A CG  
1313 C CD1 . LEU A 169 ? 0.2366 0.3138 0.2259 0.0671  0.0318  0.0348  169 LEU A CD1 
1314 C CD2 . LEU A 169 ? 0.1824 0.2564 0.1894 0.0459  0.0268  0.0362  169 LEU A CD2 
1315 N N   . CYS A 170 ? 0.1269 0.2357 0.1542 0.0387  0.0206  0.0553  170 CYS A N   
1316 C CA  . CYS A 170 ? 0.1493 0.2492 0.1811 0.0357  0.0162  0.0523  170 CYS A CA  
1317 C C   . CYS A 170 ? 0.2097 0.2954 0.2487 0.0319  0.0147  0.0496  170 CYS A C   
1318 O O   . CYS A 170 ? 0.1570 0.2396 0.2025 0.0287  0.0126  0.0570  170 CYS A O   
1319 C CB  . CYS A 170 ? 0.2086 0.3151 0.2435 0.0360  0.0120  0.0632  170 CYS A CB  
1320 S SG  . CYS A 170 ? 0.2513 0.3482 0.2918 0.0385  0.0054  0.0602  170 CYS A SG  
1321 N N   . THR A 171 ? 0.1488 0.2268 0.1848 0.0305  0.0158  0.0386  171 THR A N   
1322 C CA  . THR A 171 ? 0.1385 0.2062 0.1795 0.0270  0.0148  0.0345  171 THR A CA  
1323 C C   . THR A 171 ? 0.1558 0.2260 0.2033 0.0281  0.0112  0.0304  171 THR A C   
1324 O O   . THR A 171 ? 0.1474 0.2281 0.1932 0.0291  0.0112  0.0249  171 THR A O   
1325 C CB  . THR A 171 ? 0.1602 0.2189 0.1918 0.0236  0.0186  0.0261  171 THR A CB  
1326 O OG1 . THR A 171 ? 0.1455 0.2005 0.1679 0.0274  0.0214  0.0289  171 THR A OG1 
1327 C CG2 . THR A 171 ? 0.1705 0.2218 0.2058 0.0198  0.0179  0.0233  171 THR A CG2 
1328 N N   . ASP A 172 ? 0.1151 0.1769 0.1691 0.0288  0.0079  0.0319  172 ASP A N   
1329 C CA  . ASP A 172 ? 0.1270 0.1908 0.1858 0.0330  0.0052  0.0241  172 ASP A CA  
1330 C C   . ASP A 172 ? 0.1234 0.1885 0.1807 0.0274  0.0091  0.0139  172 ASP A C   
1331 O O   . ASP A 172 ? 0.1417 0.1964 0.1985 0.0241  0.0095  0.0134  172 ASP A O   
1332 C CB  . ASP A 172 ? 0.1581 0.2064 0.2203 0.0377  -0.0006 0.0284  172 ASP A CB  
1333 C CG  . ASP A 172 ? 0.2355 0.2865 0.3015 0.0475  -0.0037 0.0188  172 ASP A CG  
1334 O OD1 . ASP A 172 ? 0.2006 0.2704 0.2691 0.0473  -0.0004 0.0081  172 ASP A OD1 
1335 O OD2 . ASP A 172 ? 0.2326 0.2666 0.2977 0.0554  -0.0097 0.0219  172 ASP A OD2 
1336 N N   . ILE A 173 ? 0.1126 0.1922 0.1678 0.0246  0.0119  0.0061  173 ILE A N   
1337 C CA  . ILE A 173 ? 0.1091 0.1901 0.1587 0.0154  0.0166  -0.0018 173 ILE A CA  
1338 C C   . ILE A 173 ? 0.1188 0.2014 0.1736 0.0170  0.0161  -0.0080 173 ILE A C   
1339 O O   . ILE A 173 ? 0.1303 0.2073 0.1790 0.0099  0.0193  -0.0106 173 ILE A O   
1340 C CB  . ILE A 173 ? 0.1175 0.2164 0.1635 0.0085  0.0191  -0.0091 173 ILE A CB  
1341 C CG1 . ILE A 173 ? 0.1138 0.2030 0.1487 0.0052  0.0203  -0.0050 173 ILE A CG1 
1342 C CG2 . ILE A 173 ? 0.1334 0.2371 0.1734 -0.0037 0.0238  -0.0170 173 ILE A CG2 
1343 C CD1 . ILE A 173 ? 0.1217 0.2262 0.1507 -0.0035 0.0215  -0.0123 173 ILE A CD1 
1344 N N   . SER A 174 ? 0.1199 0.2082 0.1838 0.0280  0.0116  -0.0103 174 SER A N   
1345 C CA  . SER A 174 ? 0.1262 0.2145 0.1932 0.0324  0.0108  -0.0183 174 SER A CA  
1346 C C   . SER A 174 ? 0.1439 0.2085 0.2069 0.0292  0.0094  -0.0144 174 SER A C   
1347 O O   . SER A 174 ? 0.1600 0.2238 0.2216 0.0289  0.0100  -0.0221 174 SER A O   
1348 C CB  . SER A 174 ? 0.1905 0.2839 0.2647 0.0488  0.0051  -0.0220 174 SER A CB  
1349 O OG  . SER A 174 ? 0.1933 0.2597 0.2658 0.0549  -0.0009 -0.0124 174 SER A OG  
1350 N N   . ARG A 175 ? 0.1499 0.1999 0.2110 0.0265  0.0075  -0.0031 175 ARG A N   
1351 C CA  . ARG A 175 ? 0.1514 0.1856 0.2099 0.0216  0.0056  0.0012  175 ARG A CA  
1352 C C   . ARG A 175 ? 0.1539 0.1903 0.2060 0.0137  0.0096  0.0043  175 ARG A C   
1353 O O   . ARG A 175 ? 0.1514 0.1825 0.2010 0.0095  0.0084  0.0052  175 ARG A O   
1354 C CB  . ARG A 175 ? 0.1342 0.1560 0.1947 0.0220  0.0010  0.0125  175 ARG A CB  
1355 C CG  . ARG A 175 ? 0.2107 0.2229 0.2730 0.0313  -0.0042 0.0135  175 ARG A CG  
1356 C CD  . ARG A 175 ? 0.2728 0.2714 0.3336 0.0374  -0.0079 0.0034  175 ARG A CD  
1357 N NE  . ARG A 175 ? 0.3381 0.3207 0.3970 0.0494  -0.0141 0.0056  175 ARG A NE  
1358 C CZ  . ARG A 175 ? 0.3778 0.3301 0.4299 0.0469  -0.0202 0.0136  175 ARG A CZ  
1359 N NH1 . ARG A 175 ? 0.3398 0.2819 0.3895 0.0313  -0.0205 0.0190  175 ARG A NH1 
1360 N NH2 . ARG A 175 ? 0.3789 0.3113 0.4252 0.0596  -0.0265 0.0166  175 ARG A NH2 
1361 N N   . ALA A 176 ? 0.1423 0.1848 0.1897 0.0122  0.0136  0.0059  176 ALA A N   
1362 C CA  . ALA A 176 ? 0.1336 0.1713 0.1708 0.0083  0.0166  0.0099  176 ALA A CA  
1363 C C   . ALA A 176 ? 0.1521 0.1870 0.1818 0.0033  0.0180  0.0057  176 ALA A C   
1364 O O   . ALA A 176 ? 0.1481 0.1886 0.1752 -0.0008 0.0206  -0.0021 176 ALA A O   
1365 C CB  . ALA A 176 ? 0.1350 0.1729 0.1636 0.0067  0.0204  0.0091  176 ALA A CB  
1366 N N   . GLY A 177 ? 0.1455 0.1762 0.1718 0.0035  0.0162  0.0110  177 GLY A N   
1367 C CA  . GLY A 177 ? 0.1700 0.1982 0.1860 -0.0005 0.0169  0.0089  177 GLY A CA  
1368 C C   . GLY A 177 ? 0.1780 0.2114 0.1986 -0.0034 0.0150  0.0007  177 GLY A C   
1369 O O   . GLY A 177 ? 0.2325 0.2672 0.2434 -0.0076 0.0165  -0.0026 177 GLY A O   
1370 N N   . THR A 178 ? 0.1518 0.1855 0.1840 -0.0006 0.0115  -0.0026 178 THR A N   
1371 C CA  . THR A 178 ? 0.1394 0.1736 0.1731 -0.0006 0.0097  -0.0133 178 THR A CA  
1372 C C   . THR A 178 ? 0.1710 0.1973 0.2064 -0.0032 0.0034  -0.0136 178 THR A C   
1373 O O   . THR A 178 ? 0.2153 0.2390 0.2478 -0.0036 0.0016  -0.0240 178 THR A O   
1374 C CB  . THR A 178 ? 0.1796 0.2148 0.2213 0.0068  0.0092  -0.0202 178 THR A CB  
1375 O OG1 . THR A 178 ? 0.2109 0.2343 0.2591 0.0101  0.0044  -0.0132 178 THR A OG1 
1376 C CG2 . THR A 178 ? 0.2021 0.2516 0.2437 0.0071  0.0147  -0.0218 178 THR A CG2 
1377 N N   . LEU A 179 ? 0.1766 0.2009 0.2162 -0.0058 0.0003  -0.0032 179 LEU A N   
1378 C CA  . LEU A 179 ? 0.1839 0.2029 0.2258 -0.0128 -0.0061 -0.0018 179 LEU A CA  
1379 C C   . LEU A 179 ? 0.2046 0.2032 0.2484 -0.0122 -0.0104 -0.0072 179 LEU A C   
1380 O O   . LEU A 179 ? 0.2771 0.2642 0.3186 -0.0203 -0.0161 -0.0094 179 LEU A O   
1381 C CB  . LEU A 179 ? 0.2004 0.2259 0.2352 -0.0184 -0.0082 -0.0076 179 LEU A CB  
1382 C CG  . LEU A 179 ? 0.2144 0.2555 0.2427 -0.0173 -0.0056 -0.0015 179 LEU A CG  
1383 C CD1 . LEU A 179 ? 0.2606 0.3079 0.2799 -0.0220 -0.0083 -0.0083 179 LEU A CD1 
1384 C CD2 . LEU A 179 ? 0.1986 0.2520 0.2325 -0.0173 -0.0074 0.0108  179 LEU A CD2 
1385 N N   . ALA A 180 ? 0.2094 0.2024 0.2555 -0.0025 -0.0084 -0.0094 180 ALA A N   
1386 C CA  . ALA A 180 ? 0.2374 0.2076 0.2819 0.0034  -0.0131 -0.0154 180 ALA A CA  
1387 C C   . ALA A 180 ? 0.2791 0.2313 0.3244 -0.0012 -0.0180 -0.0036 180 ALA A C   
1388 O O   . ALA A 180 ? 0.3416 0.2662 0.3812 0.0030  -0.0233 -0.0062 180 ALA A O   
1389 C CB  . ALA A 180 ? 0.2646 0.2424 0.3116 0.0176  -0.0097 -0.0224 180 ALA A CB  
1390 N N   . GLY A 181 ? 0.2256 0.1926 0.2757 -0.0091 -0.0162 0.0094  181 GLY A N   
1391 C CA  . GLY A 181 ? 0.2303 0.1884 0.2812 -0.0149 -0.0190 0.0226  181 GLY A CA  
1392 C C   . GLY A 181 ? 0.2635 0.2342 0.3186 -0.0057 -0.0150 0.0300  181 GLY A C   
1393 O O   . GLY A 181 ? 0.2198 0.1967 0.2761 0.0060  -0.0120 0.0232  181 GLY A O   
1394 N N   . SER A 182 ? 0.2519 0.2304 0.3088 -0.0122 -0.0146 0.0435  182 SER A N   
1395 C CA  . SER A 182 ? 0.2271 0.2172 0.2858 -0.0038 -0.0113 0.0500  182 SER A CA  
1396 C C   . SER A 182 ? 0.2427 0.2099 0.2960 0.0028  -0.0161 0.0534  182 SER A C   
1397 O O   . SER A 182 ? 0.2983 0.2366 0.3446 -0.0012 -0.0220 0.0540  182 SER A O   
1398 C CB  . SER A 182 ? 0.2435 0.2560 0.3052 -0.0112 -0.0082 0.0621  182 SER A CB  
1399 O OG  . SER A 182 ? 0.2254 0.2599 0.2903 -0.0097 -0.0037 0.0584  182 SER A OG  
1400 N N   . ASN A 183 ? 0.2114 0.1894 0.2656 0.0136  -0.0142 0.0552  183 ASN A N   
1401 C CA  . ASN A 183 ? 0.2120 0.1719 0.2602 0.0237  -0.0195 0.0588  183 ASN A CA  
1402 C C   . ASN A 183 ? 0.2588 0.2085 0.2997 0.0153  -0.0223 0.0765  183 ASN A C   
1403 O O   . ASN A 183 ? 0.2935 0.2612 0.3343 0.0177  -0.0200 0.0848  183 ASN A O   
1404 C CB  . ASN A 183 ? 0.2326 0.2138 0.2847 0.0377  -0.0172 0.0529  183 ASN A CB  
1405 C CG  . ASN A 183 ? 0.2474 0.2147 0.2944 0.0532  -0.0238 0.0538  183 ASN A CG  
1406 O OD1 . ASN A 183 ? 0.2937 0.2307 0.3307 0.0533  -0.0301 0.0633  183 ASN A OD1 
1407 N ND2 . ASN A 183 ? 0.2747 0.2642 0.3270 0.0660  -0.0229 0.0444  183 ASN A ND2 
1408 N N   . VAL A 184 ? 0.2646 0.1851 0.2977 0.0038  -0.0272 0.0820  184 VAL A N   
1409 C CA  . VAL A 184 ? 0.2746 0.1849 0.2988 -0.0103 -0.0294 0.1002  184 VAL A CA  
1410 C C   . VAL A 184 ? 0.3398 0.2408 0.3545 0.0012  -0.0327 0.1109  184 VAL A C   
1411 O O   . VAL A 184 ? 0.3500 0.2692 0.3627 -0.0053 -0.0300 0.1245  184 VAL A O   
1412 C CB  . VAL A 184 ? 0.3496 0.2206 0.3626 -0.0263 -0.0358 0.1030  184 VAL A CB  
1413 C CG1 . VAL A 184 ? 0.4079 0.2681 0.4094 -0.0452 -0.0378 0.1236  184 VAL A CG1 
1414 C CG2 . VAL A 184 ? 0.3726 0.2591 0.3948 -0.0390 -0.0332 0.0933  184 VAL A CG2 
1415 N N   . SER A 185 ? 0.3866 0.1905 0.5418 0.0108  0.0156  0.1101  185 SER A N   
1416 C CA  . SER A 185 ? 0.4080 0.2315 0.5712 0.0331  0.0247  0.1319  185 SER A CA  
1417 C C   . SER A 185 ? 0.3595 0.2411 0.5270 0.0449  0.0257  0.1445  185 SER A C   
1418 O O   . SER A 185 ? 0.3519 0.2629 0.5244 0.0526  0.0294  0.1662  185 SER A O   
1419 C CB  . SER A 185 ? 0.5012 0.2966 0.6537 0.0523  0.0321  0.1225  185 SER A CB  
1420 O OG  . SER A 185 ? 0.6493 0.3868 0.7898 0.0426  0.0314  0.1095  185 SER A OG  
1421 N N   . LEU A 186 ? 0.2899 0.1934 0.4470 0.0441  0.0212  0.1240  186 LEU A N   
1422 C CA  . LEU A 186 ? 0.2512 0.2106 0.4032 0.0511  0.0195  0.1266  186 LEU A CA  
1423 C C   . LEU A 186 ? 0.2791 0.2636 0.4365 0.0403  0.0202  0.1440  186 LEU A C   
1424 O O   . LEU A 186 ? 0.2712 0.2886 0.4243 0.0510  0.0233  0.1613  186 LEU A O   
1425 C CB  . LEU A 186 ? 0.2189 0.1945 0.3607 0.0474  0.0139  0.0985  186 LEU A CB  
1426 C CG  . LEU A 186 ? 0.2156 0.2423 0.3519 0.0479  0.0105  0.0955  186 LEU A CG  
1427 C CD1 . LEU A 186 ? 0.2375 0.2928 0.3687 0.0675  0.0104  0.1076  186 LEU A CD1 
1428 C CD2 . LEU A 186 ? 0.1843 0.2200 0.3172 0.0409  0.0055  0.0692  186 LEU A CD2 
1429 N N   . TYR A 187 ? 0.2471 0.2171 0.4134 0.0193  0.0175  0.1412  187 TYR A N   
1430 C CA  . TYR A 187 ? 0.2627 0.2591 0.4377 0.0102  0.0209  0.1592  187 TYR A CA  
1431 C C   . TYR A 187 ? 0.2588 0.2517 0.4437 0.0137  0.0267  0.1845  187 TYR A C   
1432 O O   . TYR A 187 ? 0.2889 0.3154 0.4719 0.0191  0.0332  0.1993  187 TYR A O   
1433 C CB  . TYR A 187 ? 0.2184 0.2071 0.4049 -0.0139 0.0153  0.1500  187 TYR A CB  
1434 C CG  . TYR A 187 ? 0.1886 0.1899 0.3629 -0.0156 0.0099  0.1206  187 TYR A CG  
1435 C CD1 . TYR A 187 ? 0.1766 0.2187 0.3406 -0.0056 0.0132  0.1139  187 TYR A CD1 
1436 C CD2 . TYR A 187 ? 0.2272 0.1977 0.3979 -0.0264 0.0016  0.0993  187 TYR A CD2 
1437 C CE1 . TYR A 187 ? 0.1433 0.1979 0.3005 -0.0067 0.0083  0.0891  187 TYR A CE1 
1438 C CE2 . TYR A 187 ? 0.1695 0.1545 0.3304 -0.0263 -0.0023 0.0750  187 TYR A CE2 
1439 C CZ  . TYR A 187 ? 0.1981 0.2262 0.3557 -0.0164 0.0011  0.0712  187 TYR A CZ  
1440 O OH  . TYR A 187 ? 0.1642 0.2067 0.3168 -0.0165 -0.0028 0.0494  187 TYR A OH  
1441 N N   . GLU A 188 ? 0.2933 0.2473 0.4844 0.0115  0.0250  0.1841  188 GLU A N   
1442 C CA  . GLU A 188 ? 0.3234 0.2764 0.5244 0.0165  0.0303  0.2049  188 GLU A CA  
1443 C C   . GLU A 188 ? 0.3494 0.3367 0.5420 0.0374  0.0376  0.2204  188 GLU A C   
1444 O O   . GLU A 188 ? 0.3393 0.3529 0.5361 0.0409  0.0435  0.2391  188 GLU A O   
1445 C CB  . GLU A 188 ? 0.4300 0.3324 0.6347 0.0143  0.0283  0.2000  188 GLU A CB  
1446 C CG  . GLU A 188 ? 0.5799 0.4463 0.7869 -0.0087 0.0193  0.1866  188 GLU A CG  
1447 C CD  . GLU A 188 ? 0.7115 0.5213 0.9121 -0.0097 0.0182  0.1779  188 GLU A CD  
1448 O OE1 . GLU A 188 ? 0.7430 0.5395 0.9367 0.0087  0.0247  0.1759  188 GLU A OE1 
1449 O OE2 . GLU A 188 ? 0.7326 0.5117 0.9334 -0.0281 0.0114  0.1732  188 GLU A OE2 
1450 N N   . GLU A 189 ? 0.3154 0.3047 0.4952 0.0513  0.0363  0.2116  189 GLU A N   
1451 C CA  . GLU A 189 ? 0.3113 0.3341 0.4801 0.0688  0.0393  0.2234  189 GLU A CA  
1452 C C   . GLU A 189 ? 0.2880 0.3553 0.4396 0.0700  0.0398  0.2257  189 GLU A C   
1453 O O   . GLU A 189 ? 0.3845 0.4771 0.5305 0.0754  0.0449  0.2419  189 GLU A O   
1454 C CB  . GLU A 189 ? 0.3264 0.3450 0.4877 0.0820  0.0360  0.2113  189 GLU A CB  
1455 C CG  . GLU A 189 ? 0.3305 0.3901 0.4786 0.0951  0.0349  0.2205  189 GLU A CG  
1456 C CD  . GLU A 189 ? 0.4147 0.4753 0.5600 0.1060  0.0311  0.2099  189 GLU A CD  
1457 O OE1 . GLU A 189 ? 0.4916 0.5186 0.6447 0.1070  0.0324  0.1965  189 GLU A OE1 
1458 O OE2 . GLU A 189 ? 0.5812 0.6755 0.7156 0.1127  0.0270  0.2147  189 GLU A OE2 
1459 N N   . VAL A 190 ? 0.2571 0.3452 0.3336 0.0445  -0.0153 0.1731  190 VAL A N   
1460 C CA  . VAL A 190 ? 0.2570 0.3688 0.3143 0.0410  -0.0088 0.1710  190 VAL A CA  
1461 C C   . VAL A 190 ? 0.2834 0.3934 0.3386 0.0332  -0.0006 0.1785  190 VAL A C   
1462 O O   . VAL A 190 ? 0.2477 0.3729 0.2888 0.0347  0.0037  0.1807  190 VAL A O   
1463 C CB  . VAL A 190 ? 0.1993 0.3193 0.2469 0.0354  -0.0063 0.1502  190 VAL A CB  
1464 C CG1 . VAL A 190 ? 0.2404 0.3690 0.2917 0.0404  -0.0127 0.1349  190 VAL A CG1 
1465 C CG2 . VAL A 190 ? 0.2173 0.3203 0.2729 0.0269  -0.0021 0.1430  190 VAL A CG2 
1466 N N   . CYS A 191 ? 0.2253 0.3196 0.2957 0.0257  0.0006  0.1816  191 CYS A N   
1467 C CA  . CYS A 191 ? 0.2294 0.3306 0.3013 0.0194  0.0075  0.1883  191 CYS A CA  
1468 C C   . CYS A 191 ? 0.3151 0.4184 0.3874 0.0219  0.0075  0.2030  191 CYS A C   
1469 O O   . CYS A 191 ? 0.3110 0.4304 0.3763 0.0221  0.0135  0.2079  191 CYS A O   
1470 C CB  . CYS A 191 ? 0.2259 0.3152 0.3158 0.0096  0.0070  0.1892  191 CYS A CB  
1471 S SG  . CYS A 191 ? 0.2808 0.3724 0.3669 0.0068  0.0100  0.1733  191 CYS A SG  
1472 N N   . ALA A 192 ? 0.2811 0.3667 0.3599 0.0254  0.0006  0.2097  192 ALA A N   
1473 C CA  . ALA A 192 ? 0.3195 0.4021 0.3965 0.0285  0.0002  0.2249  192 ALA A CA  
1474 C C   . ALA A 192 ? 0.3421 0.4463 0.4011 0.0386  0.0017  0.2252  192 ALA A C   
1475 O O   . ALA A 192 ? 0.3189 0.4326 0.3719 0.0400  0.0054  0.2362  192 ALA A O   
1476 C CB  . ALA A 192 ? 0.3423 0.3939 0.4268 0.0316  -0.0080 0.2301  192 ALA A CB  
1477 N N   . ARG A 193 ? 0.3049 0.4169 0.3566 0.0450  -0.0020 0.2134  193 ARG A N   
1478 C CA  A ARG A 193 ? 0.2914 0.4276 0.3248 0.0531  -0.0022 0.2115  193 ARG A CA  
1479 C CA  B ARG A 193 ? 0.2898 0.4255 0.3236 0.0522  -0.0017 0.2110  193 ARG A CA  
1480 C C   . ARG A 193 ? 0.3606 0.5162 0.3776 0.0496  0.0058  0.2067  193 ARG A C   
1481 O O   . ARG A 193 ? 0.4163 0.5887 0.4166 0.0543  0.0071  0.2070  193 ARG A O   
1482 C CB  A ARG A 193 ? 0.3656 0.5110 0.3958 0.0593  -0.0091 0.1997  193 ARG A CB  
1483 C CB  B ARG A 193 ? 0.3579 0.5034 0.3879 0.0586  -0.0086 0.1995  193 ARG A CB  
1484 C CG  A ARG A 193 ? 0.4265 0.5602 0.4666 0.0698  -0.0173 0.2039  193 ARG A CG  
1485 C CG  B ARG A 193 ? 0.4087 0.5417 0.4492 0.0688  -0.0169 0.2034  193 ARG A CG  
1486 C CD  A ARG A 193 ? 0.4489 0.6091 0.4801 0.0801  -0.0232 0.1987  193 ARG A CD  
1487 C CD  B ARG A 193 ? 0.4203 0.5775 0.4557 0.0779  -0.0236 0.1934  193 ARG A CD  
1488 N NE  A ARG A 193 ? 0.4647 0.6184 0.4963 0.0922  -0.0275 0.2104  193 ARG A NE  
1489 N NE  B ARG A 193 ? 0.4381 0.6125 0.4630 0.0865  -0.0258 0.2007  193 ARG A NE  
1490 C CZ  A ARG A 193 ? 0.4009 0.5787 0.4222 0.1010  -0.0308 0.2127  193 ARG A CZ  
1491 C CZ  B ARG A 193 ? 0.4100 0.6161 0.4214 0.0871  -0.0275 0.1939  193 ARG A CZ  
1492 N NH1 A ARG A 193 ? 0.4047 0.6149 0.4144 0.0973  -0.0308 0.2029  193 ARG A NH1 
1493 N NH1 B ARG A 193 ? 0.2816 0.5048 0.2861 0.0785  -0.0273 0.1791  193 ARG A NH1 
1494 N NH2 A ARG A 193 ? 0.5029 0.6706 0.5239 0.1131  -0.0346 0.2246  193 ARG A NH2 
1495 N NH2 B ARG A 193 ? 0.4211 0.6408 0.4245 0.0956  -0.0299 0.2020  193 ARG A NH2 
1496 N N   . TYR A 194 ? 0.2673 0.4176 0.2880 0.0422  0.0102  0.1985  194 TYR A N   
1497 C CA  . TYR A 194 ? 0.3157 0.4773 0.3198 0.0415  0.0168  0.1908  194 TYR A CA  
1498 C C   . TYR A 194 ? 0.2813 0.4403 0.2959 0.0367  0.0233  0.1946  194 TYR A C   
1499 O O   . TYR A 194 ? 0.2581 0.4135 0.2712 0.0336  0.0262  0.1841  194 TYR A O   
1500 C CB  . TYR A 194 ? 0.2935 0.4558 0.2818 0.0400  0.0157  0.1728  194 TYR A CB  
1501 C CG  . TYR A 194 ? 0.2925 0.4661 0.2709 0.0436  0.0084  0.1689  194 TYR A CG  
1502 C CD1 . TYR A 194 ? 0.3603 0.5486 0.3215 0.0480  0.0072  0.1696  194 TYR A CD1 
1503 C CD2 . TYR A 194 ? 0.3141 0.4874 0.3013 0.0433  0.0018  0.1648  194 TYR A CD2 
1504 C CE1 . TYR A 194 ? 0.3591 0.5635 0.3128 0.0506  -0.0006 0.1656  194 TYR A CE1 
1505 C CE2 . TYR A 194 ? 0.2801 0.4721 0.2607 0.0472  -0.0059 0.1608  194 TYR A CE2 
1506 C CZ  . TYR A 194 ? 0.3604 0.5688 0.3248 0.0501  -0.0071 0.1611  194 TYR A CZ  
1507 O OH  . TYR A 194 ? 0.4192 0.6509 0.3788 0.0529  -0.0154 0.1563  194 TYR A OH  
1508 N N   . PRO A 195 ? 0.2944 0.4573 0.3189 0.0362  0.0255  0.2103  195 PRO A N   
1509 C CA  . PRO A 195 ? 0.2763 0.4435 0.3141 0.0310  0.0306  0.2164  195 PRO A CA  
1510 C C   . PRO A 195 ? 0.3078 0.4890 0.3310 0.0358  0.0376  0.2085  195 PRO A C   
1511 O O   . PRO A 195 ? 0.3011 0.4895 0.3346 0.0334  0.0415  0.2112  195 PRO A O   
1512 C CB  . PRO A 195 ? 0.3568 0.5269 0.4041 0.0296  0.0309  0.2364  195 PRO A CB  
1513 C CG  . PRO A 195 ? 0.4022 0.5632 0.4429 0.0347  0.0252  0.2402  195 PRO A CG  
1514 C CD  . PRO A 195 ? 0.3549 0.5208 0.3776 0.0409  0.0232  0.2240  195 PRO A CD  
1515 N N   . GLN A 196 ? 0.2993 0.4835 0.2982 0.0428  0.0384  0.1989  196 GLN A N   
1516 C CA  . GLN A 196 ? 0.3317 0.5220 0.3120 0.0489  0.0445  0.1904  196 GLN A CA  
1517 C C   . GLN A 196 ? 0.2988 0.4747 0.2676 0.0477  0.0446  0.1720  196 GLN A C   
1518 O O   . GLN A 196 ? 0.3414 0.5155 0.2927 0.0530  0.0493  0.1632  196 GLN A O   
1519 C CB  . GLN A 196 ? 0.3279 0.5245 0.2839 0.0561  0.0450  0.1890  196 GLN A CB  
1520 C CG  . GLN A 196 ? 0.4151 0.6023 0.3512 0.0555  0.0387  0.1759  196 GLN A CG  
1521 C CD  . GLN A 196 ? 0.5010 0.6914 0.4490 0.0537  0.0317  0.1844  196 GLN A CD  
1522 O OE1 . GLN A 196 ? 0.4878 0.6744 0.4594 0.0500  0.0301  0.1943  196 GLN A OE1 
1523 N NE2 . GLN A 196 ? 0.4647 0.6613 0.3952 0.0568  0.0268  0.1807  196 GLN A NE2 
1524 N N   . ILE A 197 ? 0.2536 0.4180 0.2309 0.0415  0.0394  0.1667  197 ILE A N   
1525 C CA  A ILE A 197 ? 0.2690 0.4190 0.2361 0.0393  0.0396  0.1505  197 ILE A CA  
1526 C CA  B ILE A 197 ? 0.2670 0.4169 0.2345 0.0391  0.0394  0.1506  197 ILE A CA  
1527 C C   . ILE A 197 ? 0.2649 0.4131 0.2542 0.0350  0.0403  0.1530  197 ILE A C   
1528 O O   . ILE A 197 ? 0.2204 0.3708 0.2334 0.0297  0.0369  0.1642  197 ILE A O   
1529 C CB  A ILE A 197 ? 0.2618 0.4034 0.2198 0.0356  0.0335  0.1416  197 ILE A CB  
1530 C CB  B ILE A 197 ? 0.2565 0.3984 0.2171 0.0352  0.0331  0.1426  197 ILE A CB  
1531 C CG1 A ILE A 197 ? 0.3075 0.4521 0.2395 0.0385  0.0321  0.1363  197 ILE A CG1 
1532 C CG1 B ILE A 197 ? 0.2925 0.4403 0.2319 0.0381  0.0305  0.1403  197 ILE A CG1 
1533 C CG2 A ILE A 197 ? 0.2354 0.3617 0.1861 0.0314  0.0341  0.1268  197 ILE A CG2 
1534 C CG2 B ILE A 197 ? 0.2427 0.3690 0.1919 0.0314  0.0339  0.1265  197 ILE A CG2 
1535 C CD1 A ILE A 197 ? 0.2519 0.3969 0.1760 0.0343  0.0253  0.1289  197 ILE A CD1 
1536 C CD1 B ILE A 197 ? 0.2985 0.4380 0.2079 0.0407  0.0345  0.1284  197 ILE A CD1 
1537 N N   . ALA A 198 ? 0.2222 0.3644 0.2018 0.0373  0.0444  0.1427  198 ALA A N   
1538 C CA  . ALA A 198 ? 0.2078 0.3497 0.2049 0.0339  0.0446  0.1431  198 ALA A CA  
1539 C C   . ALA A 198 ? 0.1992 0.3236 0.1912 0.0290  0.0412  0.1310  198 ALA A C   
1540 O O   . ALA A 198 ? 0.2509 0.3617 0.2201 0.0309  0.0434  0.1166  198 ALA A O   
1541 C CB  . ALA A 198 ? 0.2124 0.3602 0.2023 0.0413  0.0507  0.1401  198 ALA A CB  
1542 N N   . PHE A 199 ? 0.1862 0.3092 0.1986 0.0224  0.0359  0.1373  199 PHE A N   
1543 C CA  . PHE A 199 ? 0.1755 0.2858 0.1862 0.0183  0.0327  0.1283  199 PHE A CA  
1544 C C   . PHE A 199 ? 0.1834 0.2891 0.2031 0.0157  0.0341  0.1241  199 PHE A C   
1545 O O   . PHE A 199 ? 0.1725 0.2861 0.2120 0.0131  0.0335  0.1333  199 PHE A O   
1546 C CB  . PHE A 199 ? 0.1795 0.2883 0.2077 0.0148  0.0257  0.1375  199 PHE A CB  
1547 C CG  . PHE A 199 ? 0.2014 0.3162 0.2175 0.0185  0.0231  0.1391  199 PHE A CG  
1548 C CD1 . PHE A 199 ? 0.2372 0.3522 0.2367 0.0183  0.0212  0.1289  199 PHE A CD1 
1549 C CD2 . PHE A 199 ? 0.2113 0.3345 0.2321 0.0214  0.0224  0.1511  199 PHE A CD2 
1550 C CE1 . PHE A 199 ? 0.2217 0.3483 0.2105 0.0212  0.0173  0.1305  199 PHE A CE1 
1551 C CE2 . PHE A 199 ? 0.2104 0.3417 0.2198 0.0257  0.0194  0.1529  199 PHE A CE2 
1552 C CZ  . PHE A 199 ? 0.2316 0.3658 0.2256 0.0258  0.0162  0.1424  199 PHE A CZ  
1553 N N   . GLN A 200 ? 0.1616 0.2558 0.1657 0.0154  0.0357  0.1106  200 GLN A N   
1554 C CA  . GLN A 200 ? 0.1504 0.2396 0.1613 0.0132  0.0367  0.1059  200 GLN A CA  
1555 C C   . GLN A 200 ? 0.1701 0.2494 0.1928 0.0076  0.0298  0.0976  200 GLN A C   
1556 O O   . GLN A 200 ? 0.1707 0.2445 0.1792 0.0071  0.0289  0.0864  200 GLN A O   
1557 C CB  . GLN A 200 ? 0.1735 0.2516 0.1571 0.0185  0.0424  0.0912  200 GLN A CB  
1558 C CG  . GLN A 200 ? 0.2102 0.2930 0.1834 0.0266  0.0463  0.0925  200 GLN A CG  
1559 C CD  . GLN A 200 ? 0.1920 0.2554 0.1352 0.0315  0.0503  0.0779  200 GLN A CD  
1560 O OE1 . GLN A 200 ? 0.2325 0.2810 0.1661 0.0288  0.0506  0.0677  200 GLN A OE1 
1561 N NE2 . GLN A 200 ? 0.2461 0.3084 0.1746 0.0384  0.0533  0.0776  200 GLN A NE2 
1562 N N   . SER A 201 ? 0.1376 0.2140 0.1861 0.0032  0.0234  0.0995  201 SER A N   
1563 C CA  . SER A 201 ? 0.1466 0.2106 0.2050 0.0010  0.0158  0.0862  201 SER A CA  
1564 C C   . SER A 201 ? 0.1577 0.2154 0.2025 0.0014  0.0189  0.0693  201 SER A C   
1565 O O   . SER A 201 ? 0.1661 0.2260 0.2015 0.0031  0.0245  0.0696  201 SER A O   
1566 C CB  . SER A 201 ? 0.1683 0.2249 0.2535 -0.0036 0.0076  0.0915  201 SER A CB  
1567 O OG  . SER A 201 ? 0.1803 0.2401 0.2733 -0.0079 0.0081  0.0920  201 SER A OG  
1568 N N   . SER A 202 ? 0.1465 0.1982 0.1895 0.0010  0.0157  0.0556  202 SER A N   
1569 C CA  . SER A 202 ? 0.1285 0.1740 0.1555 0.0004  0.0195  0.0409  202 SER A CA  
1570 C C   . SER A 202 ? 0.1626 0.2055 0.1971 0.0001  0.0146  0.0277  202 SER A C   
1571 O O   . SER A 202 ? 0.1598 0.2094 0.1986 0.0010  0.0115  0.0264  202 SER A O   
1572 C CB  . SER A 202 ? 0.1605 0.2052 0.1586 -0.0003 0.0271  0.0389  202 SER A CB  
1573 O OG  . SER A 202 ? 0.1725 0.2079 0.1529 -0.0030 0.0308  0.0254  202 SER A OG  
1574 N N   . GLY A 203 ? 0.1532 0.1896 0.1885 0.0004  0.0141  0.0181  203 GLY A N   
1575 C CA  . GLY A 203 ? 0.1273 0.1631 0.1650 0.0016  0.0115  0.0044  203 GLY A CA  
1576 C C   . GLY A 203 ? 0.1620 0.1915 0.2208 0.0054  0.0025  0.0016  203 GLY A C   
1577 O O   . GLY A 203 ? 0.1791 0.2061 0.2525 0.0072  -0.0032 0.0095  203 GLY A O   
1578 N N   . GLY A 204 ? 0.1349 0.1589 0.1924 0.0067  0.0011  -0.0095 204 GLY A N   
1579 C CA  . GLY A 204 ? 0.1475 0.1619 0.2190 0.0110  -0.0077 -0.0170 204 GLY A CA  
1580 C C   . GLY A 204 ? 0.1470 0.1505 0.2292 0.0074  -0.0149 -0.0154 204 GLY A C   
1581 O O   . GLY A 204 ? 0.1997 0.1908 0.2882 0.0102  -0.0227 -0.0250 204 GLY A O   
1582 N N   . ILE A 205 ? 0.1495 0.1584 0.2334 0.0013  -0.0128 -0.0036 205 ILE A N   
1583 C CA  . ILE A 205 ? 0.1617 0.1667 0.2587 -0.0047 -0.0205 -0.0013 205 ILE A CA  
1584 C C   . ILE A 205 ? 0.1949 0.1961 0.2859 -0.0024 -0.0243 -0.0176 205 ILE A C   
1585 O O   . ILE A 205 ? 0.2140 0.2228 0.2882 0.0021  -0.0173 -0.0239 205 ILE A O   
1586 C CB  . ILE A 205 ? 0.1501 0.1711 0.2488 -0.0096 -0.0158 0.0133  205 ILE A CB  
1587 C CG1 . ILE A 205 ? 0.1947 0.2197 0.3000 -0.0120 -0.0130 0.0304  205 ILE A CG1 
1588 C CG2 . ILE A 205 ? 0.1891 0.2144 0.3016 -0.0172 -0.0239 0.0144  205 ILE A CG2 
1589 C CD1 . ILE A 205 ? 0.2060 0.2177 0.3306 -0.0183 -0.0224 0.0375  205 ILE A CD1 
1590 N N   . GLY A 206 ? 0.1843 0.1707 0.2860 -0.0051 -0.0356 -0.0247 206 GLY A N   
1591 C CA  . GLY A 206 ? 0.2037 0.1856 0.2982 -0.0020 -0.0406 -0.0415 206 GLY A CA  
1592 C C   . GLY A 206 ? 0.2582 0.2390 0.3632 -0.0120 -0.0514 -0.0423 206 GLY A C   
1593 O O   . GLY A 206 ? 0.2830 0.2674 0.3800 -0.0101 -0.0550 -0.0544 206 GLY A O   
1594 N N   . ASP A 207 ? 0.2145 0.1919 0.3372 -0.0237 -0.0571 -0.0292 207 ASP A N   
1595 C CA  . ASP A 207 ? 0.2243 0.2067 0.3601 -0.0376 -0.0677 -0.0274 207 ASP A CA  
1596 C C   . ASP A 207 ? 0.2476 0.2389 0.4022 -0.0509 -0.0679 -0.0059 207 ASP A C   
1597 O O   . ASP A 207 ? 0.2376 0.2283 0.3932 -0.0476 -0.0602 0.0064  207 ASP A O   
1598 C CB  . ASP A 207 ? 0.3242 0.2773 0.4601 -0.0416 -0.0822 -0.0439 207 ASP A CB  
1599 C CG  . ASP A 207 ? 0.3960 0.3146 0.5343 -0.0400 -0.0862 -0.0436 207 ASP A CG  
1600 O OD1 . ASP A 207 ? 0.3698 0.2880 0.5178 -0.0438 -0.0821 -0.0261 207 ASP A OD1 
1601 O OD2 . ASP A 207 ? 0.5204 0.4112 0.6489 -0.0332 -0.0936 -0.0609 207 ASP A OD2 
1602 N N   . ILE A 208 ? 0.2610 0.2634 0.4309 -0.0666 -0.0770 -0.0011 208 ILE A N   
1603 C CA  . ILE A 208 ? 0.2134 0.2317 0.4029 -0.0810 -0.0762 0.0213  208 ILE A CA  
1604 C C   . ILE A 208 ? 0.2442 0.2309 0.4402 -0.0871 -0.0793 0.0300  208 ILE A C   
1605 O O   . ILE A 208 ? 0.2827 0.2802 0.4864 -0.0899 -0.0722 0.0498  208 ILE A O   
1606 C CB  . ILE A 208 ? 0.2424 0.2816 0.4493 -0.0998 -0.0871 0.0241  208 ILE A CB  
1607 C CG1 . ILE A 208 ? 0.2767 0.3589 0.4798 -0.0911 -0.0807 0.0247  208 ILE A CG1 
1608 C CG2 . ILE A 208 ? 0.2899 0.3396 0.5192 -0.1189 -0.0886 0.0469  208 ILE A CG2 
1609 C CD1 . ILE A 208 ? 0.2541 0.3661 0.4571 -0.0820 -0.0652 0.0438  208 ILE A CD1 
1610 N N   . ASP A 209 ? 0.2837 0.2302 0.4740 -0.0871 -0.0894 0.0154  209 ASP A N   
1611 C CA  . ASP A 209 ? 0.3229 0.2333 0.5155 -0.0895 -0.0929 0.0228  209 ASP A CA  
1612 C C   . ASP A 209 ? 0.2675 0.1817 0.4522 -0.0726 -0.0804 0.0313  209 ASP A C   
1613 O O   . ASP A 209 ? 0.3179 0.2203 0.5082 -0.0758 -0.0793 0.0477  209 ASP A O   
1614 C CB  . ASP A 209 ? 0.3702 0.2344 0.5521 -0.0864 -0.1052 0.0024  209 ASP A CB  
1615 C CG  . ASP A 209 ? 0.5420 0.4006 0.7228 -0.1025 -0.1154 -0.0045 209 ASP A CG  
1616 O OD1 . ASP A 209 ? 0.5083 0.3891 0.7027 -0.1206 -0.1156 0.0108  209 ASP A OD1 
1617 O OD2 . ASP A 209 ? 0.6524 0.4864 0.8176 -0.0966 -0.1225 -0.0252 209 ASP A OD2 
1618 N N   . ASP A 210 ? 0.2413 0.1720 0.4120 -0.0559 -0.0715 0.0206  210 ASP A N   
1619 C CA  . ASP A 210 ? 0.2234 0.1620 0.3854 -0.0418 -0.0604 0.0265  210 ASP A CA  
1620 C C   . ASP A 210 ? 0.2416 0.2068 0.4099 -0.0469 -0.0515 0.0484  210 ASP A C   
1621 O O   . ASP A 210 ? 0.2265 0.1914 0.3927 -0.0416 -0.0462 0.0598  210 ASP A O   
1622 C CB  . ASP A 210 ? 0.2387 0.1907 0.3841 -0.0276 -0.0531 0.0106  210 ASP A CB  
1623 C CG  . ASP A 210 ? 0.2810 0.2101 0.4175 -0.0171 -0.0587 -0.0092 210 ASP A CG  
1624 O OD1 . ASP A 210 ? 0.3318 0.2321 0.4716 -0.0153 -0.0664 -0.0101 210 ASP A OD1 
1625 O OD2 . ASP A 210 ? 0.2578 0.1973 0.3820 -0.0090 -0.0546 -0.0234 210 ASP A OD2 
1626 N N   . ILE A 211 ? 0.2380 0.2290 0.4130 -0.0557 -0.0497 0.0542  211 ILE A N   
1627 C CA  . ILE A 211 ? 0.2077 0.2266 0.3886 -0.0594 -0.0411 0.0750  211 ILE A CA  
1628 C C   . ILE A 211 ? 0.2357 0.2442 0.4335 -0.0737 -0.0463 0.0937  211 ILE A C   
1629 O O   . ILE A 211 ? 0.2426 0.2563 0.4400 -0.0713 -0.0398 0.1102  211 ILE A O   
1630 C CB  . ILE A 211 ? 0.1714 0.2234 0.3559 -0.0627 -0.0383 0.0768  211 ILE A CB  
1631 C CG1 . ILE A 211 ? 0.1868 0.2454 0.3501 -0.0471 -0.0312 0.0616  211 ILE A CG1 
1632 C CG2 . ILE A 211 ? 0.2270 0.3102 0.4200 -0.0664 -0.0299 0.0998  211 ILE A CG2 
1633 C CD1 . ILE A 211 ? 0.2102 0.2984 0.3734 -0.0460 -0.0287 0.0622  211 ILE A CD1 
1634 N N   . ALA A 212 ? 0.2399 0.2318 0.4507 -0.0894 -0.0586 0.0910  212 ALA A N   
1635 C CA  . ALA A 212 ? 0.2723 0.2488 0.4936 -0.1042 -0.0639 0.1067  212 ALA A CA  
1636 C C   . ALA A 212 ? 0.3366 0.2814 0.5498 -0.0949 -0.0633 0.1118  212 ALA A C   
1637 O O   . ALA A 212 ? 0.2907 0.2364 0.5042 -0.0979 -0.0601 0.1289  212 ALA A O   
1638 C CB  . ALA A 212 ? 0.2919 0.2474 0.5160 -0.1183 -0.0771 0.0950  212 ALA A CB  
1639 N N   . ALA A 213 ? 0.3149 0.2363 0.5167 -0.0799 -0.0653 0.0952  213 ALA A N   
1640 C CA  . ALA A 213 ? 0.3398 0.2339 0.5330 -0.0671 -0.0654 0.0981  213 ALA A CA  
1641 C C   . ALA A 213 ? 0.2981 0.2172 0.4874 -0.0586 -0.0539 0.1153  213 ALA A C   
1642 O O   . ALA A 213 ? 0.3257 0.2279 0.5110 -0.0511 -0.0543 0.1249  213 ALA A O   
1643 C CB  . ALA A 213 ? 0.2923 0.1702 0.4714 -0.0491 -0.0678 0.0741  213 ALA A CB  
1644 N N   . LEU A 214 ? 0.3357 0.2055 0.4366 -0.0622 -0.0321 0.1017  214 LEU A N   
1645 C CA  . LEU A 214 ? 0.2982 0.1943 0.3978 -0.0538 -0.0218 0.1160  214 LEU A CA  
1646 C C   . LEU A 214 ? 0.3108 0.2114 0.4028 -0.0725 -0.0153 0.1372  214 LEU A C   
1647 O O   . LEU A 214 ? 0.3635 0.2785 0.4445 -0.0650 -0.0070 0.1469  214 LEU A O   
1648 C CB  . LEU A 214 ? 0.2584 0.2077 0.3705 -0.0460 -0.0102 0.1073  214 LEU A CB  
1649 C CG  . LEU A 214 ? 0.2308 0.1888 0.3443 -0.0259 -0.0132 0.0864  214 LEU A CG  
1650 C CD1 . LEU A 214 ? 0.2191 0.2188 0.3390 -0.0256 -0.0041 0.0801  214 LEU A CD1 
1651 C CD2 . LEU A 214 ? 0.2942 0.2423 0.3972 -0.0064 -0.0181 0.0888  214 LEU A CD2 
1652 N N   . ARG A 215 ? 0.3815 0.2769 0.4751 -0.0946 -0.0181 0.1389  215 ARG A N   
1653 C CA  . ARG A 215 ? 0.4095 0.3233 0.4996 -0.1119 -0.0097 0.1545  215 ARG A CA  
1654 C C   . ARG A 215 ? 0.3998 0.2889 0.4654 -0.1095 -0.0072 0.1692  215 ARG A C   
1655 O O   . ARG A 215 ? 0.5209 0.4377 0.5845 -0.1156 0.0049  0.1815  215 ARG A O   
1656 C CB  . ARG A 215 ? 0.4479 0.3511 0.5427 -0.1379 -0.0185 0.1546  215 ARG A CB  
1657 C CG  . ARG A 215 ? 0.6453 0.4758 0.7120 -0.1442 -0.0335 0.1558  215 ARG A CG  
1658 C CD  . ARG A 215 ? 0.7631 0.5722 0.8257 -0.1734 -0.0448 0.1582  215 ARG A CD  
1659 N NE  . ARG A 215 ? 0.7561 0.5556 0.8233 -0.1760 -0.0562 0.1394  215 ARG A NE  
1660 C CZ  . ARG A 215 ? 0.7903 0.5704 0.8514 -0.2002 -0.0695 0.1376  215 ARG A CZ  
1661 N NH1 . ARG A 215 ? 0.7979 0.5700 0.8522 -0.2250 -0.0725 0.1556  215 ARG A NH1 
1662 N NH2 . ARG A 215 ? 0.6830 0.4540 0.7435 -0.2016 -0.0801 0.1194  215 ARG A NH2 
1663 N N   . GLY A 216 ? 0.4262 0.2623 0.4714 -0.0979 -0.0190 0.1673  216 GLY A N   
1664 C CA  . GLY A 216 ? 0.5249 0.3302 0.5422 -0.0939 -0.0192 0.1810  216 GLY A CA  
1665 C C   . GLY A 216 ? 0.5139 0.3262 0.5201 -0.0685 -0.0174 0.1815  216 GLY A C   
1666 O O   . GLY A 216 ? 0.5620 0.3501 0.5426 -0.0623 -0.0187 0.1923  216 GLY A O   
1667 N N   . THR A 217 ? 0.3975 0.2435 0.4216 -0.0547 -0.0151 0.1705  217 THR A N   
1668 C CA  . THR A 217 ? 0.4230 0.2769 0.4377 -0.0324 -0.0175 0.1693  217 THR A CA  
1669 C C   . THR A 217 ? 0.4469 0.3242 0.4429 -0.0341 -0.0053 0.1778  217 THR A C   
1670 O O   . THR A 217 ? 0.4620 0.3302 0.4358 -0.0214 -0.0101 0.1810  217 THR A O   
1671 C CB  . THR A 217 ? 0.3638 0.2463 0.4021 -0.0197 -0.0190 0.1557  217 THR A CB  
1672 O OG1 . THR A 217 ? 0.3351 0.2560 0.3876 -0.0313 -0.0054 0.1525  217 THR A OG1 
1673 C CG2 . THR A 217 ? 0.3958 0.2533 0.4490 -0.0113 -0.0309 0.1441  217 THR A CG2 
1674 N N   . GLY A 218 ? 0.3660 0.2744 0.3698 -0.0474 0.0097  0.1800  218 GLY A N   
1675 C CA  . GLY A 218 ? 0.3873 0.3162 0.3705 -0.0447 0.0231  0.1853  218 GLY A CA  
1676 C C   . GLY A 218 ? 0.3297 0.2892 0.3156 -0.0326 0.0296  0.1736  218 GLY A C   
1677 O O   . GLY A 218 ? 0.3702 0.3376 0.3308 -0.0264 0.0391  0.1748  218 GLY A O   
1678 N N   . VAL A 219 ? 0.2998 0.2701 0.3098 -0.0290 0.0243  0.1620  219 VAL A N   
1679 C CA  . VAL A 219 ? 0.2627 0.2554 0.2698 -0.0191 0.0301  0.1513  219 VAL A CA  
1680 C C   . VAL A 219 ? 0.2593 0.2812 0.2701 -0.0203 0.0467  0.1528  219 VAL A C   
1681 O O   . VAL A 219 ? 0.3189 0.3559 0.3517 -0.0325 0.0509  0.1593  219 VAL A O   
1682 C CB  . VAL A 219 ? 0.3284 0.3286 0.3603 -0.0170 0.0225  0.1402  219 VAL A CB  
1683 C CG1 . VAL A 219 ? 0.3120 0.2940 0.3439 -0.0098 0.0062  0.1391  219 VAL A CG1 
1684 C CG2 . VAL A 219 ? 0.3090 0.3192 0.3734 -0.0289 0.0236  0.1385  219 VAL A CG2 
1685 N N   . ARG A 220 ? 0.2852 0.3133 0.2719 -0.0071 0.0544  0.1469  220 ARG A N   
1686 C CA  . ARG A 220 ? 0.2949 0.3520 0.2834 -0.0002 0.0706  0.1487  220 ARG A CA  
1687 C C   . ARG A 220 ? 0.2324 0.3095 0.2388 0.0069  0.0720  0.1385  220 ARG A C   
1688 O O   . ARG A 220 ? 0.3002 0.4076 0.3186 0.0140  0.0825  0.1407  220 ARG A O   
1689 C CB  . ARG A 220 ? 0.3366 0.3811 0.2800 0.0142  0.0790  0.1485  220 ARG A CB  
1690 C CG  . ARG A 220 ? 0.3705 0.3974 0.2919 0.0068  0.0789  0.1602  220 ARG A CG  
1691 C CD  . ARG A 220 ? 0.4229 0.4775 0.3665 -0.0039 0.0908  0.1755  220 ARG A CD  
1692 N NE  . ARG A 220 ? 0.6070 0.6401 0.5219 -0.0111 0.0917  0.1875  220 ARG A NE  
1693 C CZ  . ARG A 220 ? 0.7126 0.7644 0.6298 -0.0200 0.1045  0.2027  220 ARG A CZ  
1694 N NH1 . ARG A 220 ? 0.6551 0.7529 0.6063 -0.0229 0.1165  0.2081  220 ARG A NH1 
1695 N NH2 . ARG A 220 ? 0.7558 0.7816 0.6405 -0.0268 0.1042  0.2136  220 ARG A NH2 
1696 N N   . GLY A 221 ? 0.2109 0.2731 0.2191 0.0056  0.0607  0.1286  221 GLY A N   
1697 C CA  . GLY A 221 ? 0.2066 0.2835 0.2289 0.0096  0.0606  0.1196  221 GLY A CA  
1698 C C   . GLY A 221 ? 0.1990 0.2702 0.2441 -0.0022 0.0480  0.1138  221 GLY A C   
1699 O O   . GLY A 221 ? 0.2050 0.2560 0.2449 -0.0060 0.0380  0.1135  221 GLY A O   
1700 N N   . VAL A 222 ? 0.1455 0.2353 0.2155 -0.0059 0.0467  0.1066  222 VAL A N   
1701 C CA  . VAL A 222 ? 0.1549 0.2375 0.2427 -0.0142 0.0334  0.0930  222 VAL A CA  
1702 C C   . VAL A 222 ? 0.1199 0.2072 0.1999 -0.0086 0.0314  0.0797  222 VAL A C   
1703 O O   . VAL A 222 ? 0.1329 0.2400 0.2246 -0.0071 0.0350  0.0794  222 VAL A O   
1704 C CB  . VAL A 222 ? 0.1228 0.2141 0.2428 -0.0290 0.0295  0.0957  222 VAL A CB  
1705 C CG1 . VAL A 222 ? 0.1309 0.2101 0.2595 -0.0322 0.0177  0.0788  222 VAL A CG1 
1706 C CG2 . VAL A 222 ? 0.1520 0.2278 0.2724 -0.0373 0.0287  0.1093  222 VAL A CG2 
1707 N N   . ILE A 223 ? 0.1214 0.1925 0.1810 -0.0067 0.0244  0.0707  223 ILE A N   
1708 C CA  . ILE A 223 ? 0.1071 0.1765 0.1534 -0.0055 0.0212  0.0603  223 ILE A CA  
1709 C C   . ILE A 223 ? 0.1322 0.2139 0.2033 -0.0132 0.0156  0.0501  223 ILE A C   
1710 O O   . ILE A 223 ? 0.1374 0.2196 0.2235 -0.0172 0.0110  0.0464  223 ILE A O   
1711 C CB  . ILE A 223 ? 0.1425 0.1912 0.1554 -0.0076 0.0141  0.0572  223 ILE A CB  
1712 C CG1 . ILE A 223 ? 0.2538 0.2804 0.2301 0.0016  0.0186  0.0652  223 ILE A CG1 
1713 C CG2 . ILE A 223 ? 0.1618 0.2039 0.1580 -0.0120 0.0090  0.0486  223 ILE A CG2 
1714 C CD1 . ILE A 223 ? 0.3230 0.3205 0.2569 -0.0037 0.0085  0.0627  223 ILE A CD1 
1715 N N   . VAL A 224 ? 0.1308 0.2206 0.2024 -0.0122 0.0158  0.0457  224 VAL A N   
1716 C CA  . VAL A 224 ? 0.0919 0.1900 0.1777 -0.0192 0.0101  0.0351  224 VAL A CA  
1717 C C   . VAL A 224 ? 0.1060 0.1990 0.1685 -0.0185 0.0075  0.0294  224 VAL A C   
1718 O O   . VAL A 224 ? 0.1197 0.2100 0.1686 -0.0102 0.0092  0.0337  224 VAL A O   
1719 C CB  . VAL A 224 ? 0.1132 0.2268 0.2245 -0.0237 0.0089  0.0373  224 VAL A CB  
1720 C CG1 . VAL A 224 ? 0.1661 0.2797 0.2828 -0.0311 0.0009  0.0242  224 VAL A CG1 
1721 C CG2 . VAL A 224 ? 0.1082 0.2214 0.2374 -0.0288 0.0108  0.0470  224 VAL A CG2 
1722 N N   . GLY A 225 ? 0.1085 0.2006 0.1643 -0.0259 0.0037  0.0214  225 GLY A N   
1723 C CA  . GLY A 225 ? 0.1187 0.2030 0.1486 -0.0302 0.0004  0.0183  225 GLY A CA  
1724 C C   . GLY A 225 ? 0.1080 0.2044 0.1454 -0.0350 -0.0019 0.0090  225 GLY A C   
1725 O O   . GLY A 225 ? 0.1331 0.2306 0.1706 -0.0320 -0.0050 0.0083  225 GLY A O   
1726 N N   . ARG A 226 ? 0.1209 0.2293 0.1636 -0.0407 -0.0004 0.0024  226 ARG A N   
1727 C CA  . ARG A 226 ? 0.1022 0.2198 0.1420 -0.0440 -0.0006 -0.0075 226 ARG A CA  
1728 C C   . ARG A 226 ? 0.1185 0.2330 0.1705 -0.0405 -0.0047 -0.0145 226 ARG A C   
1729 O O   . ARG A 226 ? 0.1574 0.2706 0.1962 -0.0437 -0.0091 -0.0191 226 ARG A O   
1730 C CB  . ARG A 226 ? 0.0995 0.2379 0.1478 -0.0436 0.0053  -0.0131 226 ARG A CB  
1731 C CG  . ARG A 226 ? 0.1310 0.2792 0.1698 -0.0437 0.0083  -0.0244 226 ARG A CG  
1732 C CD  . ARG A 226 ? 0.1438 0.3205 0.1927 -0.0360 0.0176  -0.0301 226 ARG A CD  
1733 N NE  . ARG A 226 ? 0.2090 0.3923 0.2407 -0.0337 0.0226  -0.0415 226 ARG A NE  
1734 C CZ  . ARG A 226 ? 0.2059 0.4182 0.2382 -0.0236 0.0340  -0.0483 226 ARG A CZ  
1735 N NH1 . ARG A 226 ? 0.2243 0.4680 0.2795 -0.0142 0.0404  -0.0438 226 ARG A NH1 
1736 N NH2 . ARG A 226 ? 0.2819 0.4950 0.2904 -0.0210 0.0391  -0.0590 226 ARG A NH2 
1737 N N   . ALA A 227 ? 0.1016 0.2126 0.1752 -0.0369 -0.0055 -0.0139 227 ALA A N   
1738 C CA  . ALA A 227 ? 0.1128 0.2173 0.1948 -0.0404 -0.0130 -0.0199 227 ALA A CA  
1739 C C   . ALA A 227 ? 0.1317 0.2447 0.2143 -0.0444 -0.0197 -0.0130 227 ALA A C   
1740 O O   . ALA A 227 ? 0.1574 0.2703 0.2368 -0.0506 -0.0290 -0.0188 227 ALA A O   
1741 C CB  . ALA A 227 ? 0.1153 0.2089 0.2161 -0.0407 -0.0144 -0.0166 227 ALA A CB  
1742 N N   . LEU A 228 ? 0.1193 0.2394 0.2032 -0.0387 -0.0159 -0.0006 228 LEU A N   
1743 C CA  . LEU A 228 ? 0.1270 0.2604 0.2121 -0.0351 -0.0212 0.0071  228 LEU A CA  
1744 C C   . LEU A 228 ? 0.1527 0.2784 0.2086 -0.0337 -0.0262 0.0028  228 LEU A C   
1745 O O   . LEU A 228 ? 0.1587 0.2952 0.2155 -0.0337 -0.0359 0.0041  228 LEU A O   
1746 C CB  . LEU A 228 ? 0.1028 0.2425 0.1910 -0.0226 -0.0136 0.0206  228 LEU A CB  
1747 C CG  . LEU A 228 ? 0.1126 0.2691 0.2310 -0.0249 -0.0090 0.0302  228 LEU A CG  
1748 C CD1 . LEU A 228 ? 0.1335 0.2918 0.2438 -0.0090 0.0021  0.0416  228 LEU A CD1 
1749 C CD2 . LEU A 228 ? 0.1045 0.2818 0.2455 -0.0326 -0.0166 0.0337  228 LEU A CD2 
1750 N N   . LEU A 229 ? 0.1668 0.2759 0.1967 -0.0349 -0.0212 -0.0004 229 LEU A N   
1751 C CA  . LEU A 229 ? 0.1554 0.2532 0.1524 -0.0380 -0.0258 -0.0024 229 LEU A CA  
1752 C C   . LEU A 229 ? 0.1954 0.2998 0.1906 -0.0458 -0.0314 -0.0134 229 LEU A C   
1753 O O   . LEU A 229 ? 0.2306 0.3307 0.2043 -0.0470 -0.0396 -0.0133 229 LEU A O   
1754 C CB  . LEU A 229 ? 0.1720 0.2559 0.1437 -0.0454 -0.0198 -0.0014 229 LEU A CB  
1755 C CG  . LEU A 229 ? 0.2034 0.2680 0.1614 -0.0412 -0.0176 0.0081  229 LEU A CG  
1756 C CD1 . LEU A 229 ? 0.2442 0.3018 0.1823 -0.0567 -0.0153 0.0096  229 LEU A CD1 
1757 C CD2 . LEU A 229 ? 0.2610 0.3013 0.1910 -0.0285 -0.0239 0.0156  229 LEU A CD2 
1758 N N   . GLU A 230 ? 0.1589 0.2716 0.1939 -0.0207 -0.0445 0.0029  230 GLU A N   
1759 C CA  . GLU A 230 ? 0.1668 0.2947 0.1866 -0.0346 -0.0274 -0.0219 230 GLU A CA  
1760 C C   . GLU A 230 ? 0.1848 0.3049 0.1981 -0.0376 -0.0336 -0.0369 230 GLU A C   
1761 O O   . GLU A 230 ? 0.2612 0.3876 0.2543 -0.0483 -0.0261 -0.0588 230 GLU A O   
1762 C CB  . GLU A 230 ? 0.1693 0.3042 0.2242 -0.0276 -0.0042 -0.0442 230 GLU A CB  
1763 C CG  . GLU A 230 ? 0.2195 0.3729 0.2894 -0.0290 0.0053  -0.0346 230 GLU A CG  
1764 C CD  . GLU A 230 ? 0.3626 0.5419 0.4666 -0.0272 0.0332  -0.0672 230 GLU A CD  
1765 O OE1 . GLU A 230 ? 0.4898 0.6650 0.6056 -0.0208 0.0410  -0.0990 230 GLU A OE1 
1766 O OE2 . GLU A 230 ? 0.4231 0.6290 0.5482 -0.0319 0.0459  -0.0630 230 GLU A OE2 
1767 N N   . GLY A 231 ? 0.1725 0.2809 0.2033 -0.0295 -0.0467 -0.0267 231 GLY A N   
1768 C CA  . GLY A 231 ? 0.1963 0.3029 0.2314 -0.0357 -0.0538 -0.0383 231 GLY A CA  
1769 C C   . GLY A 231 ? 0.1953 0.2889 0.2522 -0.0362 -0.0427 -0.0592 231 GLY A C   
1770 O O   . GLY A 231 ? 0.2305 0.3222 0.2839 -0.0454 -0.0488 -0.0756 231 GLY A O   
1771 N N   . LYS A 232 ? 0.1973 0.2764 0.2785 -0.0261 -0.0332 -0.0594 232 LYS A N   
1772 C CA  . LYS A 232 ? 0.1972 0.2535 0.3046 -0.0253 -0.0327 -0.0774 232 LYS A CA  
1773 C C   . LYS A 232 ? 0.1891 0.2324 0.3088 -0.0352 -0.0431 -0.0674 232 LYS A C   
1774 O O   . LYS A 232 ? 0.2587 0.2846 0.3934 -0.0425 -0.0503 -0.0821 232 LYS A O   
1775 C CB  . LYS A 232 ? 0.1828 0.2183 0.3171 -0.0120 -0.0305 -0.0757 232 LYS A CB  
1776 C CG  . LYS A 232 ? 0.1828 0.2395 0.3222 -0.0037 -0.0173 -0.0886 232 LYS A CG  
1777 C CD  . LYS A 232 ? 0.2657 0.3422 0.4008 -0.0070 -0.0048 -0.1260 232 LYS A CD  
1778 C CE  . LYS A 232 ? 0.2899 0.4000 0.4328 -0.0033 0.0163  -0.1396 232 LYS A CE  
1779 N NZ  . LYS A 232 ? 0.3837 0.5148 0.5279 -0.0030 0.0333  -0.1852 232 LYS A NZ  
1780 N N   . PHE A 233 ? 0.1897 0.2436 0.3060 -0.0361 -0.0439 -0.0437 233 PHE A N   
1781 C CA  . PHE A 233 ? 0.1988 0.2567 0.3301 -0.0484 -0.0465 -0.0335 233 PHE A CA  
1782 C C   . PHE A 233 ? 0.1847 0.2712 0.3103 -0.0426 -0.0455 -0.0193 233 PHE A C   
1783 O O   . PHE A 233 ? 0.1850 0.2757 0.2928 -0.0293 -0.0477 -0.0135 233 PHE A O   
1784 C CB  . PHE A 233 ? 0.1956 0.2201 0.3385 -0.0554 -0.0452 -0.0210 233 PHE A CB  
1785 C CG  . PHE A 233 ? 0.1786 0.1797 0.3086 -0.0422 -0.0431 -0.0063 233 PHE A CG  
1786 C CD1 . PHE A 233 ? 0.1917 0.2022 0.3053 -0.0374 -0.0371 0.0133  233 PHE A CD1 
1787 C CD2 . PHE A 233 ? 0.2099 0.1795 0.3483 -0.0326 -0.0503 -0.0161 233 PHE A CD2 
1788 C CE1 . PHE A 233 ? 0.2087 0.1906 0.3066 -0.0245 -0.0409 0.0263  233 PHE A CE1 
1789 C CE2 . PHE A 233 ? 0.2215 0.1659 0.3544 -0.0200 -0.0547 -0.0031 233 PHE A CE2 
1790 C CZ  . PHE A 233 ? 0.2062 0.1533 0.3149 -0.0168 -0.0513 0.0200  233 PHE A CZ  
1791 N N   . THR A 234 ? 0.1833 0.2918 0.3296 -0.0527 -0.0441 -0.0160 234 THR A N   
1792 C CA  . THR A 234 ? 0.1665 0.3075 0.3187 -0.0438 -0.0443 -0.0109 234 THR A CA  
1793 C C   . THR A 234 ? 0.1609 0.2983 0.3075 -0.0419 -0.0277 0.0045  234 THR A C   
1794 O O   . THR A 234 ? 0.1733 0.2848 0.3155 -0.0555 -0.0183 0.0143  234 THR A O   
1795 C CB  . THR A 234 ? 0.2168 0.3951 0.4056 -0.0538 -0.0514 -0.0225 234 THR A CB  
1796 O OG1 . THR A 234 ? 0.2242 0.4083 0.4403 -0.0748 -0.0371 -0.0184 234 THR A OG1 
1797 C CG2 . THR A 234 ? 0.2139 0.3847 0.3959 -0.0580 -0.0728 -0.0369 234 THR A CG2 
1798 N N   . VAL A 235 ? 0.1454 0.3036 0.2877 -0.0255 -0.0282 0.0060  235 VAL A N   
1799 C CA  . VAL A 235 ? 0.1608 0.3191 0.2890 -0.0233 -0.0111 0.0165  235 VAL A CA  
1800 C C   . VAL A 235 ? 0.1602 0.3443 0.3109 -0.0488 0.0112  0.0177  235 VAL A C   
1801 O O   . VAL A 235 ? 0.2025 0.3635 0.3283 -0.0640 0.0267  0.0340  235 VAL A O   
1802 C CB  . VAL A 235 ? 0.1674 0.3501 0.2933 0.0017  -0.0183 0.0092  235 VAL A CB  
1803 C CG1 . VAL A 235 ? 0.2334 0.4343 0.3491 0.0013  0.0057  0.0102  235 VAL A CG1 
1804 C CG2 . VAL A 235 ? 0.1744 0.3204 0.2701 0.0214  -0.0386 0.0177  235 VAL A CG2 
1805 N N   . LYS A 236 ? 0.1494 0.3981 0.3558 -0.0818 -0.0529 0.0752  236 LYS A N   
1806 C CA  . LYS A 236 ? 0.1592 0.4227 0.4152 -0.0848 -0.0494 0.0844  236 LYS A CA  
1807 C C   . LYS A 236 ? 0.1907 0.4345 0.4431 -0.0994 -0.0488 0.0804  236 LYS A C   
1808 O O   . LYS A 236 ? 0.1911 0.4420 0.4668 -0.1001 -0.0326 0.0929  236 LYS A O   
1809 C CB  . LYS A 236 ? 0.1817 0.4570 0.4702 -0.0911 -0.0764 0.0871  236 LYS A CB  
1810 C CG  . LYS A 236 ? 0.2338 0.5372 0.5791 -0.0952 -0.0712 0.0972  236 LYS A CG  
1811 C CD  . LYS A 236 ? 0.3136 0.6396 0.6952 -0.0951 -0.0965 0.0985  236 LYS A CD  
1812 C CE  . LYS A 236 ? 0.4992 0.8207 0.9006 -0.1172 -0.1179 0.0950  236 LYS A CE  
1813 N NZ  . LYS A 236 ? 0.5370 0.8870 0.9772 -0.1165 -0.1430 0.0959  236 LYS A NZ  
1814 N N   . GLU A 237 ? 0.1798 0.3981 0.4004 -0.1109 -0.0675 0.0621  237 GLU A N   
1815 C CA  . GLU A 237 ? 0.2260 0.4223 0.4483 -0.1229 -0.0729 0.0531  237 GLU A CA  
1816 C C   . GLU A 237 ? 0.2567 0.4514 0.4683 -0.1154 -0.0499 0.0593  237 GLU A C   
1817 O O   . GLU A 237 ? 0.2359 0.4202 0.4718 -0.1221 -0.0472 0.0717  237 GLU A O   
1818 C CB  . GLU A 237 ? 0.2265 0.3991 0.4110 -0.1307 -0.0965 0.0219  237 GLU A CB  
1819 C CG  . GLU A 237 ? 0.2610 0.4336 0.4587 -0.1398 -0.1209 0.0155  237 GLU A CG  
1820 C CD  . GLU A 237 ? 0.3569 0.5159 0.5054 -0.1403 -0.1379 -0.0152 237 GLU A CD  
1821 O OE1 . GLU A 237 ? 0.3058 0.4554 0.4063 -0.1318 -0.1292 -0.0287 237 GLU A OE1 
1822 O OE2 . GLU A 237 ? 0.3790 0.5395 0.5358 -0.1487 -0.1586 -0.0252 237 GLU A OE2 
1823 N N   . ALA A 238 ? 0.1674 0.3711 0.3410 -0.1022 -0.0347 0.0528  238 ALA A N   
1824 C CA  . ALA A 238 ? 0.1584 0.3664 0.3146 -0.0908 -0.0115 0.0553  238 ALA A CA  
1825 C C   . ALA A 238 ? 0.1921 0.4078 0.3709 -0.0791 0.0106  0.0805  238 ALA A C   
1826 O O   . ALA A 238 ? 0.1928 0.4028 0.3745 -0.0787 0.0196  0.0931  238 ALA A O   
1827 C CB  . ALA A 238 ? 0.1331 0.3471 0.2392 -0.0772 0.0015  0.0389  238 ALA A CB  
1828 N N   . ILE A 239 ? 0.1396 0.3707 0.3320 -0.0708 0.0165  0.0867  239 ILE A N   
1829 C CA  . ILE A 239 ? 0.1722 0.4189 0.3791 -0.0616 0.0357  0.1019  239 ILE A CA  
1830 C C   . ILE A 239 ? 0.2103 0.4592 0.4550 -0.0808 0.0311  0.1235  239 ILE A C   
1831 O O   . ILE A 239 ? 0.2184 0.4704 0.4612 -0.0802 0.0458  0.1404  239 ILE A O   
1832 C CB  . ILE A 239 ? 0.1486 0.4205 0.3738 -0.0509 0.0392  0.0995  239 ILE A CB  
1833 C CG1 . ILE A 239 ? 0.1538 0.4172 0.3427 -0.0324 0.0451  0.0828  239 ILE A CG1 
1834 C CG2 . ILE A 239 ? 0.1690 0.4694 0.4187 -0.0476 0.0573  0.1120  239 ILE A CG2 
1835 C CD1 . ILE A 239 ? 0.1902 0.4776 0.4051 -0.0214 0.0430  0.0810  239 ILE A CD1 
1836 N N   . GLN A 240 ? 0.2034 0.4470 0.4792 -0.0996 0.0079  0.1228  240 GLN A N   
1837 C CA  . GLN A 240 ? 0.2251 0.4621 0.5391 -0.1216 -0.0018 0.1408  240 GLN A CA  
1838 C C   . GLN A 240 ? 0.2428 0.4464 0.5467 -0.1292 -0.0037 0.1515  240 GLN A C   
1839 O O   . GLN A 240 ? 0.2938 0.4948 0.6137 -0.1389 0.0033  0.1774  240 GLN A O   
1840 C CB  . GLN A 240 ? 0.2932 0.5202 0.6323 -0.1386 -0.0324 0.1284  240 GLN A CB  
1841 C CG  . GLN A 240 ? 0.4976 0.7263 0.8845 -0.1618 -0.0432 0.1444  240 GLN A CG  
1842 C CD  . GLN A 240 ? 0.5952 0.8629 1.0085 -0.1630 -0.0173 0.1706  240 GLN A CD  
1843 O OE1 . GLN A 240 ? 0.7012 0.9612 1.1342 -0.1810 -0.0146 0.1929  240 GLN A OE1 
1844 N NE2 . GLN A 240 ? 0.5982 0.9073 1.0116 -0.1448 0.0006  0.1665  240 GLN A NE2 
1845 N N   . CYS A 241 ? 0.2261 0.4062 0.5046 -0.1257 -0.0143 0.1322  241 CYS A N   
1846 C CA  . CYS A 241 ? 0.2441 0.3890 0.5201 -0.1316 -0.0221 0.1390  241 CYS A CA  
1847 C C   . CYS A 241 ? 0.2478 0.4041 0.5030 -0.1174 0.0062  0.1658  241 CYS A C   
1848 O O   . CYS A 241 ? 0.3357 0.4622 0.5998 -0.1263 0.0015  0.1918  241 CYS A O   
1849 C CB  . CYS A 241 ? 0.4037 0.5268 0.6385 -0.1186 -0.0362 0.0962  241 CYS A CB  
1850 S SG  . CYS A 241 ? 0.3728 0.4382 0.5771 -0.1009 -0.0484 0.0782  241 CYS A SG  
1851 N N   . TRP A 242 ? 0.4711 0.3761 0.4676 -0.1199 -0.1027 0.1461  242 TRP A N   
1852 C CA  . TRP A 242 ? 0.4284 0.3156 0.4439 -0.1082 -0.0525 0.1155  242 TRP A CA  
1853 C C   . TRP A 242 ? 0.4737 0.4037 0.5724 -0.1085 -0.0382 0.1134  242 TRP A C   
1854 O O   . TRP A 242 ? 0.4890 0.4035 0.5760 -0.1082 -0.0062 0.0827  242 TRP A O   
1855 C CB  . TRP A 242 ? 0.4302 0.2989 0.4774 -0.0796 -0.0261 0.1225  242 TRP A CB  
1856 C CG  . TRP A 242 ? 0.4888 0.3214 0.5266 -0.0699 0.0163  0.0861  242 TRP A CG  
1857 C CD1 . TRP A 242 ? 0.5710 0.4005 0.6699 -0.0461 0.0460  0.0758  242 TRP A CD1 
1858 C CD2 . TRP A 242 ? 0.4768 0.2692 0.4325 -0.0799 0.0323  0.0560  242 TRP A CD2 
1859 N NE1 . TRP A 242 ? 0.5405 0.3266 0.5978 -0.0434 0.0751  0.0379  242 TRP A NE1 
1860 C CE2 . TRP A 242 ? 0.4795 0.2483 0.4550 -0.0656 0.0676  0.0271  242 TRP A CE2 
1861 C CE3 . TRP A 242 ? 0.4572 0.2298 0.3188 -0.0947 0.0210  0.0527  242 TRP A CE3 
1862 C CZ2 . TRP A 242 ? 0.4386 0.2179 0.3647 -0.0586 0.0754  -0.0039 242 TRP A CZ2 
1863 C CZ3 . TRP A 242 ? 0.4825 0.2521 0.3017 -0.0854 0.0420  0.0202  242 TRP A CZ3 
1864 C CH2 . TRP A 242 ? 0.4365 0.2184 0.2929 -0.0684 0.0663  -0.0048 242 TRP A CH2 
1865 N N   . GLN A 243 ? 0.4547 0.4435 0.6391 -0.1057 -0.0601 0.1509  243 GLN A N   
1866 C CA  . GLN A 243 ? 0.4577 0.5043 0.7332 -0.1041 -0.0485 0.1638  243 GLN A CA  
1867 C C   . GLN A 243 ? 0.5086 0.5557 0.7526 -0.1405 -0.0600 0.1461  243 GLN A C   
1868 O O   . GLN A 243 ? 0.4554 0.5055 0.7182 -0.1341 -0.0227 0.1280  243 GLN A O   
1869 C CB  . GLN A 243 ? 0.4503 0.5709 0.8194 -0.1015 -0.0810 0.2167  243 GLN A CB  
1870 C CG  . GLN A 243 ? 0.5830 0.7131 1.0076 -0.0576 -0.0607 0.2410  243 GLN A CG  
1871 C CD  . GLN A 243 ? 0.6783 0.8946 1.2247 -0.0372 -0.0583 0.2891  243 GLN A CD  
1872 O OE1 . GLN A 243 ? 0.6983 0.9774 1.2981 -0.0612 -0.0764 0.3095  243 GLN A OE1 
1873 N NE2 . GLN A 243 ? 0.7326 0.9531 1.3256 0.0078  -0.0364 0.3118  243 GLN A NE2 
1874 N N   . ASN A 244 ? 0.6440 0.6730 0.8223 -0.1738 -0.1110 0.1488  244 ASN A N   
1875 C CA  . ASN A 244 ? 0.7365 0.7457 0.8608 -0.2137 -0.1396 0.1345  244 ASN A CA  
1876 C C   . ASN A 244 ? 0.8412 0.7822 0.8657 -0.2153 -0.1061 0.0867  244 ASN A C   
1877 O O   . ASN A 244 ? 0.8235 0.7656 0.8529 -0.2342 -0.0976 0.0746  244 ASN A O   
1878 C CB  . ASN A 244 ? 0.7865 0.7743 0.8435 -0.2388 -0.2067 0.1479  244 ASN A CB  
1879 C CG  . ASN A 244 ? 0.8005 0.8635 0.9571 -0.2498 -0.2537 0.1975  244 ASN A CG  
1880 O OD1 . ASN A 244 ? 0.7576 0.8957 1.0386 -0.2427 -0.2374 0.2264  244 ASN A OD1 
1881 N ND2 . ASN A 244 ? 0.8592 0.9025 0.9554 -0.2636 -0.3122 0.2098  244 ASN A ND2 
1882 N N   . VAL A 245 ? 0.8692 0.7558 0.8075 -0.1959 -0.0870 0.0644  245 VAL A N   
1883 C CA  . VAL A 245 ? 0.9112 0.7415 0.7563 -0.1963 -0.0564 0.0242  245 VAL A CA  
1884 C C   . VAL A 245 ? 1.0052 0.8558 0.9088 -0.1752 -0.0029 0.0056  245 VAL A C   
1885 O O   . VAL A 245 ? 1.0258 0.8656 0.8817 -0.1557 0.0214  -0.0218 245 VAL A O   
1886 C CB  . VAL A 245 ? 0.8924 0.6749 0.6395 -0.1768 -0.0467 0.0127  245 VAL A CB  
1887 C CG1 . VAL A 245 ? 0.9231 0.6844 0.6061 -0.1863 -0.0967 0.0345  245 VAL A CG1 
1888 C CG2 . VAL A 245 ? 0.8968 0.6868 0.6940 -0.1501 -0.0117 0.0151  245 VAL A CG2 
1889 N N   . LYS A 246 ? 1.0481 0.9423 1.0550 -0.1554 0.0155  0.0247  246 LYS A N   
1890 C CA  . LYS A 246 ? 1.0346 0.9377 1.0859 -0.1288 0.0672  0.0077  246 LYS A CA  
1891 C C   . LYS A 246 ? 0.9917 0.9447 1.1107 -0.1405 0.0706  0.0233  246 LYS A C   
1892 O O   . LYS A 246 ? 0.9757 0.9892 1.1855 -0.1427 0.0513  0.0633  246 LYS A O   
1893 C CB  . LYS A 246 ? 1.0343 0.9491 1.1511 -0.0892 0.0889  0.0197  246 LYS A CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   ILE 3   3   3   ILE ILE A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  GLN 18  18  18  GLN GLN A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  GLN 24  24  24  GLN GLN A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLN 36  36  36  GLN GLN A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  HIS 47  47  47  HIS HIS A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  GLN 61  61  61  GLN GLN A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 MET 106 106 106 MET MET A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 TRP 115 115 115 TRP TRP A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 HIS 135 135 135 HIS HIS A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 TRP 145 145 145 TRP TRP A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 ASN 148 148 148 ASN ASN A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 GLN 155 155 155 GLN GLN A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 GLU 158 158 158 GLU GLU A . n 
A 1 159 THR 159 159 159 THR THR A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 CYS 170 170 170 CYS CYS A . n 
A 1 171 THR 171 171 171 THR THR A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 SER 185 185 185 SER SER A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 TYR 187 187 187 TYR TYR A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 CYS 191 191 191 CYS CYS A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 TYR 194 194 194 TYR TYR A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 GLN 196 196 196 GLN GLN A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 PHE 199 199 199 PHE PHE A . n 
A 1 200 GLN 200 200 200 GLN GLN A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 ILE 205 205 205 ILE ILE A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 ASP 207 207 207 ASP ASP A . n 
A 1 208 ILE 208 208 208 ILE ILE A . n 
A 1 209 ASP 209 209 209 ASP ASP A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 ARG 215 215 215 ARG ARG A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 ARG 226 226 226 ARG ARG A . n 
A 1 227 ALA 227 227 227 ALA ALA A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 LYS 236 236 236 LYS LYS A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 ILE 239 239 239 ILE ILE A . n 
A 1 240 GLN 240 240 240 GLN GLN A . n 
A 1 241 CYS 241 241 241 CYS CYS A . n 
A 1 242 TRP 242 242 242 TRP TRP A . n 
A 1 243 GLN 243 243 243 GLN GLN A . n 
A 1 244 ASN 244 244 244 ASN ASN A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LYS 246 246 246 LYS LYS A . n 
A 1 247 GLY 247 247 ?   ?   ?   A . n 
A 1 248 HIS 248 248 ?   ?   ?   A . n 
A 1 249 HIS 249 249 ?   ?   ?   A . n 
A 1 250 HIS 250 250 ?   ?   ?   A . n 
A 1 251 HIS 251 251 ?   ?   ?   A . n 
A 1 252 HIS 252 252 ?   ?   ?   A . n 
A 1 253 HIS 253 253 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GUO 1   1247 1247 GUO GUO A . 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
C 3 HOH 104 2104 2104 HOH HOH A . 
C 3 HOH 105 2105 2105 HOH HOH A . 
C 3 HOH 106 2106 2106 HOH HOH A . 
C 3 HOH 107 2107 2107 HOH HOH A . 
C 3 HOH 108 2108 2108 HOH HOH A . 
C 3 HOH 109 2109 2109 HOH HOH A . 
C 3 HOH 110 2110 2110 HOH HOH A . 
C 3 HOH 111 2111 2111 HOH HOH A . 
C 3 HOH 112 2112 2112 HOH HOH A . 
C 3 HOH 113 2113 2113 HOH HOH A . 
C 3 HOH 114 2114 2114 HOH HOH A . 
C 3 HOH 115 2115 2115 HOH HOH A . 
C 3 HOH 116 2116 2116 HOH HOH A . 
C 3 HOH 117 2117 2117 HOH HOH A . 
C 3 HOH 118 2118 2118 HOH HOH A . 
C 3 HOH 119 2119 2119 HOH HOH A . 
C 3 HOH 120 2120 2120 HOH HOH A . 
C 3 HOH 121 2121 2121 HOH HOH A . 
C 3 HOH 122 2122 2122 HOH HOH A . 
C 3 HOH 123 2123 2123 HOH HOH A . 
C 3 HOH 124 2124 2124 HOH HOH A . 
C 3 HOH 125 2125 2125 HOH HOH A . 
C 3 HOH 126 2126 2126 HOH HOH A . 
C 3 HOH 127 2127 2127 HOH HOH A . 
C 3 HOH 128 2128 2128 HOH HOH A . 
C 3 HOH 129 2129 2129 HOH HOH A . 
C 3 HOH 130 2130 2130 HOH HOH A . 
C 3 HOH 131 2131 2131 HOH HOH A . 
C 3 HOH 132 2132 2132 HOH HOH A . 
C 3 HOH 133 2133 2133 HOH HOH A . 
C 3 HOH 134 2134 2134 HOH HOH A . 
C 3 HOH 135 2135 2135 HOH HOH A . 
C 3 HOH 136 2136 2136 HOH HOH A . 
C 3 HOH 137 2137 2137 HOH HOH A . 
C 3 HOH 138 2138 2138 HOH HOH A . 
C 3 HOH 139 2139 2139 HOH HOH A . 
C 3 HOH 140 2140 2140 HOH HOH A . 
C 3 HOH 141 2141 2141 HOH HOH A . 
C 3 HOH 142 2142 2142 HOH HOH A . 
C 3 HOH 143 2143 2143 HOH HOH A . 
C 3 HOH 144 2144 2144 HOH HOH A . 
C 3 HOH 145 2145 2145 HOH HOH A . 
C 3 HOH 146 2146 2146 HOH HOH A . 
C 3 HOH 147 2147 2147 HOH HOH A . 
C 3 HOH 148 2148 2148 HOH HOH A . 
C 3 HOH 149 2149 2149 HOH HOH A . 
C 3 HOH 150 2150 2150 HOH HOH A . 
C 3 HOH 151 2151 2151 HOH HOH A . 
C 3 HOH 152 2152 2152 HOH HOH A . 
C 3 HOH 153 2153 2153 HOH HOH A . 
C 3 HOH 154 2154 2154 HOH HOH A . 
C 3 HOH 155 2155 2155 HOH HOH A . 
C 3 HOH 156 2156 2156 HOH HOH A . 
C 3 HOH 157 2157 2157 HOH HOH A . 
C 3 HOH 158 2158 2158 HOH HOH A . 
C 3 HOH 159 2159 2159 HOH HOH A . 
C 3 HOH 160 2160 2160 HOH HOH A . 
C 3 HOH 161 2161 2161 HOH HOH A . 
C 3 HOH 162 2162 2162 HOH HOH A . 
C 3 HOH 163 2163 2163 HOH HOH A . 
C 3 HOH 164 2164 2164 HOH HOH A . 
C 3 HOH 165 2165 2165 HOH HOH A . 
C 3 HOH 166 2166 2166 HOH HOH A . 
C 3 HOH 167 2167 2167 HOH HOH A . 
C 3 HOH 168 2168 2168 HOH HOH A . 
C 3 HOH 169 2169 2169 HOH HOH A . 
C 3 HOH 170 2170 2170 HOH HOH A . 
C 3 HOH 171 2171 2171 HOH HOH A . 
C 3 HOH 172 2172 2172 HOH HOH A . 
C 3 HOH 173 2173 2173 HOH HOH A . 
C 3 HOH 174 2174 2174 HOH HOH A . 
C 3 HOH 175 2175 2175 HOH HOH A . 
C 3 HOH 176 2176 2176 HOH HOH A . 
C 3 HOH 177 2177 2177 HOH HOH A . 
C 3 HOH 178 2178 2178 HOH HOH A . 
C 3 HOH 179 2179 2179 HOH HOH A . 
C 3 HOH 180 2180 2180 HOH HOH A . 
C 3 HOH 181 2181 2181 HOH HOH A . 
C 3 HOH 182 2182 2182 HOH HOH A . 
C 3 HOH 183 2183 2183 HOH HOH A . 
C 3 HOH 184 2184 2184 HOH HOH A . 
C 3 HOH 185 2185 2185 HOH HOH A . 
C 3 HOH 186 2186 2186 HOH HOH A . 
C 3 HOH 187 2187 2187 HOH HOH A . 
C 3 HOH 188 2188 2188 HOH HOH A . 
C 3 HOH 189 2189 2189 HOH HOH A . 
C 3 HOH 190 2190 2190 HOH HOH A . 
C 3 HOH 191 2191 2191 HOH HOH A . 
C 3 HOH 192 2192 2192 HOH HOH A . 
C 3 HOH 193 2193 2193 HOH HOH A . 
C 3 HOH 194 2194 2194 HOH HOH A . 
C 3 HOH 195 2195 2195 HOH HOH A . 
C 3 HOH 196 2196 2196 HOH HOH A . 
C 3 HOH 197 2197 2197 HOH HOH A . 
C 3 HOH 198 2198 2198 HOH HOH A . 
C 3 HOH 199 2199 2199 HOH HOH A . 
C 3 HOH 200 2200 2200 HOH HOH A . 
C 3 HOH 201 2201 2201 HOH HOH A . 
C 3 HOH 202 2202 2202 HOH HOH A . 
C 3 HOH 203 2203 2203 HOH HOH A . 
C 3 HOH 204 2204 2204 HOH HOH A . 
C 3 HOH 205 2205 2205 HOH HOH A . 
C 3 HOH 206 2206 2206 HOH HOH A . 
C 3 HOH 207 2207 2207 HOH HOH A . 
C 3 HOH 208 2208 2208 HOH HOH A . 
C 3 HOH 209 2209 2209 HOH HOH A . 
C 3 HOH 210 2210 2210 HOH HOH A . 
C 3 HOH 211 2211 2211 HOH HOH A . 
C 3 HOH 212 2212 2212 HOH HOH A . 
C 3 HOH 213 2213 2213 HOH HOH A . 
C 3 HOH 214 2214 2214 HOH HOH A . 
C 3 HOH 215 2215 2215 HOH HOH A . 
C 3 HOH 216 2216 2216 HOH HOH A . 
C 3 HOH 217 2217 2217 HOH HOH A . 
C 3 HOH 218 2218 2218 HOH HOH A . 
C 3 HOH 219 2219 2219 HOH HOH A . 
C 3 HOH 220 2220 2220 HOH HOH A . 
C 3 HOH 221 2221 2221 HOH HOH A . 
C 3 HOH 222 2222 2222 HOH HOH A . 
C 3 HOH 223 2223 2223 HOH HOH A . 
C 3 HOH 224 2224 2224 HOH HOH A . 
C 3 HOH 225 2225 2225 HOH HOH A . 
C 3 HOH 226 2226 2226 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2016-09-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined -12.5980 17.2877 -19.4843 0.1349 0.1909 0.1942 0.0078  0.0216  0.0732  6.7964 6.8170 8.3308 
5.8222  -4.7045 -7.0504 0.0182  -0.0751 -0.2074 0.3524  0.2954  0.4080  -0.2545 -0.3699 -0.2939 
'X-RAY DIFFRACTION' 2  ? refined 0.7406   23.6191 -28.5125 0.1152 0.1758 0.1333 -0.0323 0.0222  0.0401  4.9881 3.0710 2.9663 
-2.3007 -0.5761 0.8974  -0.0326 0.2946  0.2336  -0.1662 0.0036  -0.1222 -0.1184 0.1372  0.0084  
'X-RAY DIFFRACTION' 3  ? refined -2.7802  22.4904 -34.1580 0.2449 0.3473 0.2063 -0.0796 0.0060  0.0712  2.4363 1.1637 2.9910 
-1.6838 0.3543  -0.1009 -0.4070 0.6751  0.0487  -0.2621 0.2046  -0.1286 0.0453  0.2929  0.2058  
'X-RAY DIFFRACTION' 4  ? refined -15.7091 25.8382 -28.3038 0.1275 0.2611 0.2374 0.0331  -0.0631 0.0396  3.3850 2.6910 3.3422 
-0.3154 1.6718  0.1195  -0.0876 0.2685  0.2188  -0.0991 0.1160  0.2587  -0.1855 -0.3755 -0.0025 
'X-RAY DIFFRACTION' 5  ? refined -9.0031  23.9985 -20.2387 0.0752 0.1575 0.1486 0.0351  -0.0080 0.0279  6.6587 4.3813 2.2517 
3.2661  1.2380  0.7213  0.0979  -0.1715 0.2859  0.1580  0.0144  0.2716  -0.2537 -0.3242 0.1481  
'X-RAY DIFFRACTION' 6  ? refined -6.6057  34.2317 -20.0583 0.2328 0.1657 0.1896 0.0491  -0.0337 -0.0090 5.5107 3.2973 3.1832 
1.2022  1.2564  -0.0663 -0.2070 -0.0914 0.7134  -0.0328 0.0796  0.0727  -0.5827 -0.1942 0.0810  
'X-RAY DIFFRACTION' 7  ? refined -7.3740  28.7372 -12.6313 0.1756 0.2096 0.1293 0.0637  -0.0114 -0.0046 3.6982 4.6762 3.0509 
2.2094  -0.4381 0.9192  -0.0104 -0.3619 0.2428  0.4221  0.0345  0.2104  -0.2346 -0.2832 0.0453  
'X-RAY DIFFRACTION' 8  ? refined -7.9706  35.2111 -8.5883  0.3355 0.2738 0.1962 0.1548  -0.0125 -0.1156 9.7491 7.7233 4.1882 
-1.9936 -2.6579 -4.0257 -0.4728 -0.9386 0.9614  0.5733  0.0847  -0.0209 -0.9091 -0.0187 -0.1678 
'X-RAY DIFFRACTION' 9  ? refined -2.6342  25.7323 -9.3872  0.1576 0.2083 0.1080 0.0521  -0.0173 -0.0228 4.9542 3.6336 3.1436 
-0.7241 0.8317  -0.2710 -0.0707 -0.3224 -0.1455 0.1404  0.1446  0.0792  -0.1794 -0.0953 -0.0389 
'X-RAY DIFFRACTION' 10 ? refined 0.3587   28.4600 -0.3770  0.3064 0.4493 0.1571 0.1116  -0.0453 -0.0893 4.6048 4.0290 2.1007 
-0.3851 -2.3811 1.8390  -0.0629 -0.8318 0.2097  0.3338  0.0813  -0.0865 -0.4298 0.0006  -0.0538 
'X-RAY DIFFRACTION' 11 ? refined -0.7675  18.7605 -9.7071  0.1406 0.2814 0.1469 0.0607  -0.0078 0.0345  5.5560 8.2564 6.2720 
-6.5907 -5.4613 6.4740  -0.1799 -0.3334 -0.0703 0.3251  0.0732  0.0739  0.0744  -0.0659 0.1044  
'X-RAY DIFFRACTION' 12 ? refined 12.7353  7.9842  -13.1685 0.2378 0.3766 0.2826 0.1215  -0.0323 0.0193  2.7453 9.5802 2.5669 
-1.1740 2.6115  -1.9555 0.2313  0.1212  -0.3320 -0.5614 -0.0108 -0.6312 0.6713  0.9182  -0.0573 
'X-RAY DIFFRACTION' 13 ? refined 5.4616   18.5499 -7.3168  0.1589 0.2660 0.1590 0.0484  -0.0400 0.0162  1.1369 1.5939 5.2597 
-0.6236 0.5395  -0.8995 -0.1600 -0.3724 -0.0250 0.2324  0.1422  -0.1700 0.0175  0.2134  0.0454  
'X-RAY DIFFRACTION' 14 ? refined -0.6020  11.2540 -19.1553 0.1152 0.1593 0.1727 0.0204  0.0059  0.0392  2.1719 0.9695 4.7611 
0.0741  0.4064  0.2692  0.0288  -0.1590 -0.2869 0.0144  0.1529  0.0005  0.1995  -0.0192 -0.0641 
'X-RAY DIFFRACTION' 15 ? refined -0.7039  4.2498  -12.0063 0.2746 0.2298 0.4466 0.0366  0.0241  0.1657  3.1164 3.1449 2.0860 
-0.0810 -0.4377 -2.4151 -0.2005 -0.6361 -1.0674 -0.0438 0.2556  0.2218  0.8118  0.0820  -0.1301 
'X-RAY DIFFRACTION' 16 ? refined -5.5934  7.9576  -12.8596 0.1661 0.2286 0.2658 -0.0020 0.0037  0.1345  1.8735 1.2143 4.0837 
-0.5349 0.1069  -0.4825 0.0642  -0.3983 -0.6771 0.1467  0.1866  0.1627  0.2883  -0.1231 -0.1527 
'X-RAY DIFFRACTION' 17 ? refined -9.4489  10.2079 -19.1585 0.1061 0.1802 0.2322 -0.0299 0.0146  0.0724  2.1804 3.4522 7.2336 
-0.1467 1.2656  -1.4824 0.0318  -0.1328 -0.5778 0.2239  0.1733  0.2417  0.3223  -0.3462 0.0954  
'X-RAY DIFFRACTION' 18 ? refined -13.1786 12.1541 -30.3439 0.1336 0.2017 0.2317 -0.0222 -0.0431 -0.0221 5.0333 7.4790 3.9657 
1.4452  4.4651  1.5985  -0.1364 0.4997  -0.7228 -0.1908 0.1010  0.0604  0.3810  -0.2916 -0.1575 
'X-RAY DIFFRACTION' 19 ? refined -19.8782 8.4837  -23.4364 0.1491 0.4152 0.4633 -0.1317 -0.0311 0.1154  7.2851 4.5238 6.0519 
0.4652  2.6201  1.2548  0.0227  -0.2127 -0.9585 -0.2241 0.4426  1.3549  0.5703  -0.7756 -0.1948 
'X-RAY DIFFRACTION' 20 ? refined -18.3369 4.7013  -16.2410 0.3945 0.3298 0.4766 -0.1332 -0.0361 0.0919  3.3543 5.6869 6.6307 
-3.4168 0.8546  -4.6094 0.0055  0.7086  0.8919  -0.7599 0.6352  1.9283  0.2287  -1.3043 -0.4924 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1:6)'     
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 7:23)'    
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 24:27)'   
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 28:40)'   
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 41:54)'   
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 55:72)'   
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 73:85)'   
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 86:94)'   
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 95:106)'  
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 107:119)' 
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 120:132)' 
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 133:139)' 
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 140:166)' 
'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 167:184)' 
'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 185:189)' 
'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 190:213)' 
'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 214:229)' 
'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 230:235)' 
'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 236:241)' 
'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 242:246)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
XDS    'data reduction' .                 ? 2 
XDS    'data scaling'   .                 ? 3 
PHASER phasing          .                 ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
DETERMINATION METHOD: DSSP
THE SHEETS PRESENTED AS "AA" IN EACH CHAIN ON SHEET RECORDS
BELOW IS ACTUALLY AN  8-STRANDED BARREL THIS IS REPRESENTED BY
A  9-STRANDED SHEET IN WHICH THE FIRST AND LAST STRANDS
ARE IDENTICAL.
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A ARG 193 ? B C A ARG 193 ? ? O A ARG 193 ? ? 134.16 120.10 14.06  2.10 N 
2 1 CA A ARG 193 ? B C A ARG 193 ? ? N A TYR 194 ? ? 103.90 117.20 -13.30 2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 61  ? ? -94.97  58.96  
2 1 ALA A 102 ? ? -126.63 -66.78 
3 1 LYS A 166 ? ? -132.39 -31.05 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 246 ? CG ? A LYS 246 CG 
2 1 Y 1 A LYS 246 ? CD ? A LYS 246 CD 
3 1 Y 1 A LYS 246 ? CE ? A LYS 246 CE 
4 1 Y 1 A LYS 246 ? NZ ? A LYS 246 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 247 ? A GLY 247 
2 1 Y 1 A HIS 248 ? A HIS 248 
3 1 Y 1 A HIS 249 ? A HIS 249 
4 1 Y 1 A HIS 250 ? A HIS 250 
5 1 Y 1 A HIS 251 ? A HIS 251 
6 1 Y 1 A HIS 252 ? A HIS 252 
7 1 Y 1 A HIS 253 ? A HIS 253 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;[(2R,3S,4R,5R)-5-[4-aminocarbonyl-5-[(E)-[[(2R,3R,4S,5R)-3,4-bis(oxidanyl)-5-(phosphonooxymethyl)oxolan-2-yl]amino]methylideneamino]imidazol-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methyl dihydrogen phosphate
;
GUO 
3 water HOH 
#