data_5B6Q
# 
_entry.id   5B6Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5B6Q         
WWPDB D_1300000636 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5B6Q 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-01 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Masanari, M.'  1  
'Fujii, S.'     2  
'Kawahara, K.'  3  
'Oki, H.'       4  
'Tsujino, H.'   5  
'Maruno, T.'    6  
'Kobayashi, Y.' 7  
'Ohkubo, T.'    8  
'Nishiyama, M.' 9  
'Harada, Y.'    10 
'Wakai, S.'     11 
'Sambongi, Y.'  12 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   JA 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biosci.Biotechnol.Biochem. 
_citation.journal_id_ASTM           BBBIEJ 
_citation.journal_id_CSD            2094 
_citation.journal_id_ISSN           0916-8451 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Comparative study on stabilization mechanism of monomeric cytochrome c5 from deep-sea piezophilic Shewanella violacea' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1080/09168451.2016.1232155 
_citation.pdbx_database_id_PubMed   27648635 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Masanari, M.'  1  ? 
primary 'Fujii, S.'     2  ? 
primary 'Kawahara, K.'  3  ? 
primary 'Oki, H.'       4  ? 
primary 'Tsujino, H.'   5  ? 
primary 'Maruno, T.'    6  ? 
primary 'Kobayashi, Y.' 7  ? 
primary 'Ohkubo, T.'    8  ? 
primary 'Wakai, S.'     9  ? 
primary 'Sambongi, Y.'  10 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5B6Q 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     26.588 
_cell.length_a_esd                 ? 
_cell.length_b                     50.075 
_cell.length_b_esd                 ? 
_cell.length_c                     97.609 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5B6Q 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Soluble cytochrome cA' 8013.103 2   ? ? ? ? 
2 non-polymer syn 'HEME C'                618.503  2   ? ? ? ? 
3 non-polymer syn IMIDAZOLE               69.085   1   ? ? ? ? 
4 water       nat water                   18.015   162 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'cytochrome c5' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       QEGKAVYDKACHICHSMGVAGAPKAHDAAAWEPRIAQGLDTLVSTVKTGKGAMPPGGMCTDCTDEDYKSAIEYMSK 
_entity_poly.pdbx_seq_one_letter_code_can   QEGKAVYDKACHICHSMGVAGAPKAHDAAAWEPRIAQGLDTLVSTVKTGKGAMPPGGMCTDCTDEDYKSAIEYMSK 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLN n 
1 2  GLU n 
1 3  GLY n 
1 4  LYS n 
1 5  ALA n 
1 6  VAL n 
1 7  TYR n 
1 8  ASP n 
1 9  LYS n 
1 10 ALA n 
1 11 CYS n 
1 12 HIS n 
1 13 ILE n 
1 14 CYS n 
1 15 HIS n 
1 16 SER n 
1 17 MET n 
1 18 GLY n 
1 19 VAL n 
1 20 ALA n 
1 21 GLY n 
1 22 ALA n 
1 23 PRO n 
1 24 LYS n 
1 25 ALA n 
1 26 HIS n 
1 27 ASP n 
1 28 ALA n 
1 29 ALA n 
1 30 ALA n 
1 31 TRP n 
1 32 GLU n 
1 33 PRO n 
1 34 ARG n 
1 35 ILE n 
1 36 ALA n 
1 37 GLN n 
1 38 GLY n 
1 39 LEU n 
1 40 ASP n 
1 41 THR n 
1 42 LEU n 
1 43 VAL n 
1 44 SER n 
1 45 THR n 
1 46 VAL n 
1 47 LYS n 
1 48 THR n 
1 49 GLY n 
1 50 LYS n 
1 51 GLY n 
1 52 ALA n 
1 53 MET n 
1 54 PRO n 
1 55 PRO n 
1 56 GLY n 
1 57 GLY n 
1 58 MET n 
1 59 CYS n 
1 60 THR n 
1 61 ASP n 
1 62 CYS n 
1 63 THR n 
1 64 ASP n 
1 65 GLU n 
1 66 ASP n 
1 67 TYR n 
1 68 LYS n 
1 69 SER n 
1 70 ALA n 
1 71 ILE n 
1 72 GLU n 
1 73 TYR n 
1 74 MET n 
1 75 SER n 
1 76 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   76 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 cytcA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Shewanella violacea' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     60217 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Jcb387 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9RHJ6_SHEVI 
_struct_ref.pdbx_db_accession          Q9RHJ6 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   QEGKAVYDKACHICHSMGVAGAPKAHDAAAWEPRIAQGLDTLVSTVKTGKGAMPPGGMCTDCTDEDYKSAIEYMSK 
_struct_ref.pdbx_align_begin           22 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5B6Q A 1 ? 76 ? Q9RHJ6 22 ? 97 ? 1 76 
2 1 5B6Q B 1 ? 76 ? Q9RHJ6 22 ? 97 ? 1 76 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1'   175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'       75.067  
HEC non-polymer         . 'HEME C'        ? 'C34 H34 Fe N4 O4' 618.503 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER           ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'      131.173 
IMD non-polymer         . IMIDAZOLE       ? 'C3 H5 N2 1'       69.085  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'    149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5B6Q 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.03 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         39.33 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M imidazole, 0.2 M NaCl, 0.4 M NaH2PO4, 1.8 M K2HPO4' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV++' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-03-02 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5B6Q 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.780 
_reflns.d_resolution_low                 34.951 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       12711 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.12 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                47.170 
_refine.B_iso_mean                               26.7906 
_refine.B_iso_min                                15.280 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5B6Q 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.7800 
_refine.ls_d_res_low                             34.9510 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12662 
_refine.ls_number_reflns_R_free                  1268 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.5500 
_refine.ls_percent_reflns_R_free                 10.0100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2164 
_refine.ls_R_factor_R_free                       0.2375 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2140 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.6900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2100 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.7800 
_refine_hist.d_res_low                        34.9510 
_refine_hist.pdbx_number_atoms_ligand         91 
_refine_hist.number_atoms_solvent             162 
_refine_hist.number_atoms_total               1361 
_refine_hist.pdbx_number_residues_total       152 
_refine_hist.pdbx_B_iso_mean_ligand           23.72 
_refine_hist.pdbx_B_iso_mean_solvent          31.15 
_refine_hist.pdbx_number_atoms_protein        1108 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 1245 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.693  ? 1693 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.044  ? 168  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 211  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 12.338 ? 456  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.7801 1.8514  1276 . 127 1149 91.0000 . . . 0.3015 . 0.3102 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 1.8514 1.9356  1364 . 138 1226 96.0000 . . . 0.3709 . 0.3253 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 1.9356 2.0377  1402 . 140 1262 97.0000 . . . 0.2376 . 0.2226 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.0377 2.1653  1378 . 136 1242 97.0000 . . . 0.2668 . 0.2189 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.1653 2.3325  1381 . 140 1241 96.0000 . . . 0.3178 . 0.2724 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.3325 2.5671  1393 . 139 1254 96.0000 . . . 0.2565 . 0.2257 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.5671 2.9384  1446 . 145 1301 98.0000 . . . 0.2436 . 0.2163 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.9384 3.7015  1464 . 147 1317 99.0000 . . . 0.2013 . 0.1981 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.7015 34.9572 1558 . 156 1402 99.0000 . . . 0.1976 . 0.1720 . . . . . . 9 . . . 
# 
_struct.entry_id                     5B6Q 
_struct.title                        'Crystal structure of monomeric cytochrome c5 from Shewanella violacea' 
_struct.pdbx_descriptor              'Soluble cytochrome cA' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5B6Q 
_struct_keywords.text            'Cytochrome c5, Protein stability, Shewanella, ELECTRON TRANSPORT' 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 2  ? ALA A 10 ? GLU A 2  ALA A 10 1 ? 9  
HELX_P HELX_P2  AA2 CYS A 11 ? SER A 16 ? CYS A 11 SER A 16 1 ? 6  
HELX_P HELX_P3  AA3 GLY A 18 ? ALA A 22 ? GLY A 18 ALA A 22 5 ? 5  
HELX_P HELX_P4  AA4 ASP A 27 ? ALA A 36 ? ASP A 27 ALA A 36 1 ? 10 
HELX_P HELX_P5  AA5 GLY A 38 ? GLY A 49 ? GLY A 38 GLY A 49 1 ? 12 
HELX_P HELX_P6  AA6 THR A 63 ? SER A 75 ? THR A 63 SER A 75 1 ? 13 
HELX_P HELX_P7  AA7 GLU B 2  ? ALA B 10 ? GLU B 2  ALA B 10 1 ? 9  
HELX_P HELX_P8  AA8 CYS B 11 ? SER B 16 ? CYS B 11 SER B 16 1 ? 6  
HELX_P HELX_P9  AA9 GLY B 18 ? ALA B 22 ? GLY B 18 ALA B 22 5 ? 5  
HELX_P HELX_P10 AB1 ASP B 27 ? GLN B 37 ? ASP B 27 GLN B 37 1 ? 11 
HELX_P HELX_P11 AB2 GLY B 38 ? THR B 48 ? GLY B 38 THR B 48 1 ? 11 
HELX_P HELX_P12 AB3 THR B 63 ? SER B 75 ? THR B 63 SER B 75 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?    ? A CYS 59 SG  ? ? ? 1_555 A CYS 62 SG  ? ? A CYS 59  A CYS 62  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf2 disulf ?    ? B CYS 59 SG  ? ? ? 1_555 B CYS 62 SG  ? ? B CYS 59  B CYS 62  1_555 ? ? ? ? ? ? ? 2.020 ? 
covale1 covale none ? A CYS 11 SG  ? ? ? 1_555 C HEC .  CAB ? ? A CYS 11  A HEC 101 1_555 ? ? ? ? ? ? ? 1.778 ? 
covale2 covale none ? A CYS 14 SG  ? ? ? 1_555 C HEC .  CAC ? ? A CYS 14  A HEC 101 1_555 ? ? ? ? ? ? ? 1.777 ? 
metalc1 metalc ?    ? A HIS 15 NE2 ? ? ? 1_555 C HEC .  FE  ? ? A HIS 15  A HEC 101 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc2 metalc ?    ? A MET 53 SD  ? ? ? 1_555 C HEC .  FE  ? ? A MET 53  A HEC 101 1_555 ? ? ? ? ? ? ? 2.303 ? 
covale3 covale none ? B CYS 11 SG  ? ? ? 1_555 D HEC .  CAB ? ? B CYS 11  B HEC 101 1_555 ? ? ? ? ? ? ? 1.773 ? 
covale4 covale none ? B CYS 14 SG  ? ? ? 1_555 D HEC .  CAC ? ? B CYS 14  B HEC 101 1_555 ? ? ? ? ? ? ? 1.774 ? 
metalc3 metalc ?    ? B HIS 15 NE2 ? ? ? 1_555 D HEC .  FE  ? ? B HIS 15  B HEC 101 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc4 metalc ?    ? D HEC .  FE  ? ? ? 1_555 E IMD .  N1  ? ? B HEC 101 B IMD 102 1_555 ? ? ? ? ? ? ? 2.185 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A HEC 101 ? 22 'binding site for residue HEC A 101'                 
AC2 Software B IMD 102 ? 4  'binding site for residue IMD B 102'                 
AC3 Software B HEC 101 ? 20 'binding site for Di-peptide HEM B 101 and CYS B 14' 
AC4 Software B HEC 101 ? 20 'binding site for Di-peptide HEM B 101 and CYS B 11' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 CYS A 11 ? CYS A 11  . ? 1_555 ? 
2  AC1 22 CYS A 14 ? CYS A 14  . ? 1_555 ? 
3  AC1 22 HIS A 15 ? HIS A 15  . ? 1_555 ? 
4  AC1 22 ALA A 20 ? ALA A 20  . ? 1_555 ? 
5  AC1 22 ALA A 22 ? ALA A 22  . ? 1_555 ? 
6  AC1 22 PRO A 23 ? PRO A 23  . ? 1_555 ? 
7  AC1 22 TRP A 31 ? TRP A 31  . ? 1_555 ? 
8  AC1 22 ARG A 34 ? ARG A 34  . ? 1_555 ? 
9  AC1 22 GLN A 37 ? GLN A 37  . ? 1_555 ? 
10 AC1 22 VAL A 46 ? VAL A 46  . ? 1_555 ? 
11 AC1 22 LYS A 50 ? LYS A 50  . ? 1_555 ? 
12 AC1 22 MET A 53 ? MET A 53  . ? 1_555 ? 
13 AC1 22 PRO A 54 ? PRO A 54  . ? 1_555 ? 
14 AC1 22 GLY A 57 ? GLY A 57  . ? 1_555 ? 
15 AC1 22 MET A 74 ? MET A 74  . ? 1_555 ? 
16 AC1 22 HOH F .  ? HOH A 204 . ? 1_555 ? 
17 AC1 22 HOH F .  ? HOH A 205 . ? 1_555 ? 
18 AC1 22 HOH F .  ? HOH A 210 . ? 1_555 ? 
19 AC1 22 HOH F .  ? HOH A 213 . ? 1_555 ? 
20 AC1 22 HOH F .  ? HOH A 225 . ? 1_555 ? 
21 AC1 22 HOH F .  ? HOH A 253 . ? 1_555 ? 
22 AC1 22 PRO B 54 ? PRO B 54  . ? 1_555 ? 
23 AC2 4  THR B 45 ? THR B 45  . ? 1_555 ? 
24 AC2 4  MET B 53 ? MET B 53  . ? 1_555 ? 
25 AC2 4  HEC D .  ? HEC B 101 . ? 1_555 ? 
26 AC2 4  HOH G .  ? HOH B 203 . ? 1_555 ? 
27 AC3 20 MET A 58 ? MET A 58  . ? 1_555 ? 
28 AC3 20 CYS B 11 ? CYS B 11  . ? 1_555 ? 
29 AC3 20 HIS B 12 ? HIS B 12  . ? 1_555 ? 
30 AC3 20 ILE B 13 ? ILE B 13  . ? 1_555 ? 
31 AC3 20 HIS B 15 ? HIS B 15  . ? 1_555 ? 
32 AC3 20 SER B 16 ? SER B 16  . ? 1_555 ? 
33 AC3 20 GLY B 18 ? GLY B 18  . ? 1_555 ? 
34 AC3 20 VAL B 19 ? VAL B 19  . ? 1_555 ? 
35 AC3 20 ALA B 20 ? ALA B 20  . ? 1_555 ? 
36 AC3 20 ALA B 22 ? ALA B 22  . ? 1_555 ? 
37 AC3 20 PRO B 23 ? PRO B 23  . ? 1_555 ? 
38 AC3 20 ARG B 34 ? ARG B 34  . ? 1_555 ? 
39 AC3 20 VAL B 46 ? VAL B 46  . ? 1_555 ? 
40 AC3 20 GLY B 57 ? GLY B 57  . ? 1_555 ? 
41 AC3 20 ILE B 71 ? ILE B 71  . ? 1_555 ? 
42 AC3 20 MET B 74 ? MET B 74  . ? 1_555 ? 
43 AC3 20 IMD E .  ? IMD B 102 . ? 1_555 ? 
44 AC3 20 HOH G .  ? HOH B 206 . ? 1_555 ? 
45 AC3 20 HOH G .  ? HOH B 207 . ? 1_555 ? 
46 AC3 20 HOH G .  ? HOH B 216 . ? 1_555 ? 
47 AC4 20 MET A 58 ? MET A 58  . ? 1_555 ? 
48 AC4 20 VAL B 6  ? VAL B 6   . ? 1_555 ? 
49 AC4 20 TYR B 7  ? TYR B 7   . ? 1_555 ? 
50 AC4 20 ALA B 10 ? ALA B 10  . ? 1_555 ? 
51 AC4 20 HIS B 12 ? HIS B 12  . ? 1_555 ? 
52 AC4 20 ILE B 13 ? ILE B 13  . ? 1_555 ? 
53 AC4 20 CYS B 14 ? CYS B 14  . ? 1_555 ? 
54 AC4 20 HIS B 15 ? HIS B 15  . ? 1_555 ? 
55 AC4 20 ALA B 20 ? ALA B 20  . ? 1_555 ? 
56 AC4 20 ALA B 22 ? ALA B 22  . ? 1_555 ? 
57 AC4 20 PRO B 23 ? PRO B 23  . ? 1_555 ? 
58 AC4 20 ARG B 34 ? ARG B 34  . ? 1_555 ? 
59 AC4 20 VAL B 46 ? VAL B 46  . ? 1_555 ? 
60 AC4 20 GLY B 57 ? GLY B 57  . ? 1_555 ? 
61 AC4 20 ILE B 71 ? ILE B 71  . ? 1_555 ? 
62 AC4 20 MET B 74 ? MET B 74  . ? 1_555 ? 
63 AC4 20 IMD E .  ? IMD B 102 . ? 1_555 ? 
64 AC4 20 HOH G .  ? HOH B 206 . ? 1_555 ? 
65 AC4 20 HOH G .  ? HOH B 207 . ? 1_555 ? 
66 AC4 20 HOH G .  ? HOH B 216 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5B6Q 
_atom_sites.fract_transf_matrix[1][1]   0.037611 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019970 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010245 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 1  ? -3.848  13.353  -8.112  1.00 25.66 ?  1   GLN A N   1 
ATOM   2    C  CA  . GLN A 1 1  ? -2.557  12.799  -7.719  1.00 24.69 ?  1   GLN A CA  1 
ATOM   3    C  C   . GLN A 1 1  ? -2.197  11.592  -8.572  1.00 24.26 ?  1   GLN A C   1 
ATOM   4    O  O   . GLN A 1 1  ? -3.078  10.870  -9.035  1.00 24.52 ?  1   GLN A O   1 
ATOM   5    C  CB  . GLN A 1 1  ? -2.565  12.400  -6.241  1.00 21.63 ?  1   GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 1  ? -3.084  13.472  -5.297  1.00 26.56 ?  1   GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 1  ? -2.818  13.145  -3.834  1.00 24.06 ?  1   GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 1  ? -1.667  13.049  -3.416  1.00 23.63 ?  1   GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 1  ? -3.886  12.976  -3.050  1.00 20.86 ?  1   GLN A NE2 1 
ATOM   10   N  N   . GLU A 1 2  ? -0.915  11.365  -8.749  1.00 24.49 ?  2   GLU A N   1 
ATOM   11   C  CA  . GLU A 1 2  ? -0.445  10.170  -9.433  1.00 25.09 ?  2   GLU A CA  1 
ATOM   12   C  C   . GLU A 1 2  ? -0.522  8.965   -8.493  1.00 22.67 ?  2   GLU A C   1 
ATOM   13   O  O   . GLU A 1 2  ? -0.237  9.101   -7.347  1.00 20.86 ?  2   GLU A O   1 
ATOM   14   C  CB  . GLU A 1 2  ? 0.998   10.320  -9.932  1.00 25.34 ?  2   GLU A CB  1 
ATOM   15   C  CG  . GLU A 1 2  ? 1.201   11.392  -10.974 1.00 27.54 ?  2   GLU A CG  1 
ATOM   16   C  CD  . GLU A 1 2  ? 0.203   11.322  -12.063 1.00 32.21 ?  2   GLU A CD  1 
ATOM   17   O  OE1 . GLU A 1 2  ? 0.247   10.368  -12.842 1.00 34.73 ?  2   GLU A OE1 1 
ATOM   18   O  OE2 . GLU A 1 2  ? -0.646  12.239  -12.147 1.00 34.70 ?  2   GLU A OE2 1 
ATOM   19   N  N   . GLY A 1 3  ? -0.868  7.803   -9.028  1.00 19.85 ?  3   GLY A N   1 
ATOM   20   C  CA  . GLY A 1 3  ? -0.976  6.604   -8.217  1.00 20.93 ?  3   GLY A CA  1 
ATOM   21   C  C   . GLY A 1 3  ? 0.287   6.315   -7.426  1.00 20.44 ?  3   GLY A C   1 
ATOM   22   O  O   . GLY A 1 3  ? 0.225   5.962   -6.247  1.00 19.60 ?  3   GLY A O   1 
ATOM   23   N  N   . LYS A 1 4  ? 1.439   6.475   -8.072  1.00 20.85 ?  4   LYS A N   1 
ATOM   24   C  CA  . LYS A 1 4  ? 2.714   6.210   -7.411  1.00 19.78 ?  4   LYS A CA  1 
ATOM   25   C  C   . LYS A 1 4  ? 2.944   7.185   -6.254  1.00 19.56 ?  4   LYS A C   1 
ATOM   26   O  O   . LYS A 1 4  ? 3.479   6.806   -5.212  1.00 18.60 ?  4   LYS A O   1 
ATOM   27   C  CB  . LYS A 1 4  ? 3.868   6.291   -8.410  1.00 20.74 ?  4   LYS A CB  1 
ATOM   28   C  CG  . LYS A 1 4  ? 5.233   5.974   -7.804  1.00 22.60 ?  4   LYS A CG  1 
ATOM   29   C  CD  . LYS A 1 4  ? 6.326   5.936   -8.871  1.00 19.92 ?  4   LYS A CD  1 
ATOM   30   C  CE  . LYS A 1 4  ? 7.642   5.406   -8.300  1.00 25.67 ?  4   LYS A CE  1 
ATOM   31   N  NZ  . LYS A 1 4  ? 8.105   6.188   -7.126  1.00 24.09 ?  4   LYS A NZ  1 
ATOM   32   N  N   . ALA A 1 5  ? 2.528   8.435   -6.439  1.00 18.30 ?  5   ALA A N   1 
ATOM   33   C  CA  . ALA A 1 5  ? 2.686   9.449   -5.397  1.00 18.99 ?  5   ALA A CA  1 
ATOM   34   C  C   . ALA A 1 5  ? 1.854   9.107   -4.161  1.00 17.47 ?  5   ALA A C   1 
ATOM   35   O  O   . ALA A 1 5  ? 2.329   9.228   -3.036  1.00 18.87 ?  5   ALA A O   1 
ATOM   36   C  CB  . ALA A 1 5  ? 2.313   10.816  -5.922  1.00 19.03 ?  5   ALA A CB  1 
ATOM   37   N  N   . VAL A 1 6  ? 0.615   8.670   -4.369  1.00 18.76 ?  6   VAL A N   1 
ATOM   38   C  CA  . VAL A 1 6  ? -0.225  8.262   -3.250  1.00 16.63 ?  6   VAL A CA  1 
ATOM   39   C  C   . VAL A 1 6  ? 0.403   7.083   -2.526  1.00 16.35 ?  6   VAL A C   1 
ATOM   40   O  O   . VAL A 1 6  ? 0.485   7.068   -1.294  1.00 18.82 ?  6   VAL A O   1 
ATOM   41   C  CB  . VAL A 1 6  ? -1.649  7.884   -3.708  1.00 16.54 ?  6   VAL A CB  1 
ATOM   42   C  CG1 . VAL A 1 6  ? -2.460  7.350   -2.531  1.00 17.18 ?  6   VAL A CG1 1 
ATOM   43   C  CG2 . VAL A 1 6  ? -2.342  9.088   -4.316  1.00 19.08 ?  6   VAL A CG2 1 
ATOM   44   N  N   . TYR A 1 7  ? 0.859   6.103   -3.303  1.00 17.80 ?  7   TYR A N   1 
ATOM   45   C  CA  . TYR A 1 7  ? 1.522   4.926   -2.756  1.00 17.95 ?  7   TYR A CA  1 
ATOM   46   C  C   . TYR A 1 7  ? 2.745   5.299   -1.918  1.00 16.69 ?  7   TYR A C   1 
ATOM   47   O  O   . TYR A 1 7  ? 2.933   4.778   -0.824  1.00 16.71 ?  7   TYR A O   1 
ATOM   48   C  CB  . TYR A 1 7  ? 1.937   3.972   -3.883  1.00 16.73 ?  7   TYR A CB  1 
ATOM   49   C  CG  . TYR A 1 7  ? 2.725   2.773   -3.397  1.00 19.55 ?  7   TYR A CG  1 
ATOM   50   C  CD1 . TYR A 1 7  ? 2.078   1.645   -2.903  1.00 17.57 ?  7   TYR A CD1 1 
ATOM   51   C  CD2 . TYR A 1 7  ? 4.117   2.773   -3.419  1.00 18.91 ?  7   TYR A CD2 1 
ATOM   52   C  CE1 . TYR A 1 7  ? 2.791   0.554   -2.450  1.00 17.79 ?  7   TYR A CE1 1 
ATOM   53   C  CE2 . TYR A 1 7  ? 4.839   1.678   -2.967  1.00 19.31 ?  7   TYR A CE2 1 
ATOM   54   C  CZ  . TYR A 1 7  ? 4.170   0.574   -2.483  1.00 19.33 ?  7   TYR A CZ  1 
ATOM   55   O  OH  . TYR A 1 7  ? 4.884   -0.518  -2.032  1.00 18.70 ?  7   TYR A OH  1 
ATOM   56   N  N   . ASP A 1 8  ? 3.566   6.210   -2.428  1.00 17.88 ?  8   ASP A N   1 
ATOM   57   C  CA  . ASP A 1 8  ? 4.832   6.537   -1.767  1.00 18.80 ?  8   ASP A CA  1 
ATOM   58   C  C   . ASP A 1 8  ? 4.647   7.339   -0.474  1.00 17.10 ?  8   ASP A C   1 
ATOM   59   O  O   . ASP A 1 8  ? 5.531   7.342   0.386   1.00 17.39 ?  8   ASP A O   1 
ATOM   60   C  CB  . ASP A 1 8  ? 5.757   7.310   -2.718  1.00 19.05 ?  8   ASP A CB  1 
ATOM   61   C  CG  . ASP A 1 8  ? 6.346   6.436   -3.817  1.00 18.80 ?  8   ASP A CG  1 
ATOM   62   O  OD1 . ASP A 1 8  ? 6.417   5.195   -3.655  1.00 18.58 ?  8   ASP A OD1 1 
ATOM   63   O  OD2 . ASP A 1 8  ? 6.756   7.002   -4.848  1.00 19.14 ?  8   ASP A OD2 1 
ATOM   64   N  N   . LYS A 1 9  ? 3.509   8.012   -0.316  1.00 18.56 ?  9   LYS A N   1 
ATOM   65   C  CA  . LYS A 1 9  ? 3.283   8.750   0.926   1.00 18.91 ?  9   LYS A CA  1 
ATOM   66   C  C   . LYS A 1 9  ? 2.345   8.029   1.890   1.00 18.00 ?  9   LYS A C   1 
ATOM   67   O  O   . LYS A 1 9  ? 2.246   8.420   3.051   1.00 18.28 ?  9   LYS A O   1 
ATOM   68   C  CB  . LYS A 1 9  ? 2.737   10.157  0.643   1.00 19.99 ?  9   LYS A CB  1 
ATOM   69   C  CG  . LYS A 1 9  ? 1.255   10.220  0.256   1.00 18.72 ?  9   LYS A CG  1 
ATOM   70   C  CD  . LYS A 1 9  ? 0.813   11.674  0.082   1.00 20.76 ?  9   LYS A CD  1 
ATOM   71   C  CE  . LYS A 1 9  ? -0.662  11.783  -0.265  1.00 24.35 ?  9   LYS A CE  1 
ATOM   72   N  NZ  . LYS A 1 9  ? -1.123  13.198  -0.253  1.00 23.42 ?  9   LYS A NZ  1 
ATOM   73   N  N   . ALA A 1 10 ? 1.658   6.987   1.426   1.00 17.92 ?  10  ALA A N   1 
ATOM   74   C  CA  . ALA A 1 10 ? 0.637   6.341   2.254   1.00 15.95 ?  10  ALA A CA  1 
ATOM   75   C  C   . ALA A 1 10 ? 0.601   4.815   2.147   1.00 18.41 ?  10  ALA A C   1 
ATOM   76   O  O   . ALA A 1 10 ? 0.969   4.110   3.088   1.00 17.80 ?  10  ALA A O   1 
ATOM   77   C  CB  . ALA A 1 10 ? -0.738  6.913   1.914   1.00 20.93 ?  10  ALA A CB  1 
ATOM   78   N  N   . CYS A 1 11 ? 0.135   4.307   1.009   1.00 16.14 ?  11  CYS A N   1 
ATOM   79   C  CA  . CYS A 1 11 ? -0.149  2.876   0.864   1.00 17.23 ?  11  CYS A CA  1 
ATOM   80   C  C   . CYS A 1 11 ? 1.056   1.971   1.119   1.00 17.48 ?  11  CYS A C   1 
ATOM   81   O  O   . CYS A 1 11 ? 0.916   0.875   1.671   1.00 18.52 ?  11  CYS A O   1 
ATOM   82   C  CB  . CYS A 1 11 ? -0.695  2.602   -0.530  1.00 15.75 ?  11  CYS A CB  1 
ATOM   83   S  SG  . CYS A 1 11 ? -1.938  3.784   -1.020  1.00 15.43 ?  11  CYS A SG  1 
ATOM   84   N  N   . HIS A 1 12 ? 2.237   2.439   0.728   1.00 16.77 ?  12  HIS A N   1 
ATOM   85   C  CA  . HIS A 1 12 ? 3.458   1.637   0.834   1.00 18.07 ?  12  HIS A CA  1 
ATOM   86   C  C   . HIS A 1 12 ? 3.713   1.128   2.252   1.00 18.06 ?  12  HIS A C   1 
ATOM   87   O  O   . HIS A 1 12 ? 4.322   0.080   2.435   1.00 18.44 ?  12  HIS A O   1 
ATOM   88   C  CB  . HIS A 1 12 ? 4.673   2.453   0.378   1.00 18.08 ?  12  HIS A CB  1 
ATOM   89   C  CG  . HIS A 1 12 ? 5.173   3.396   1.424   1.00 19.37 ?  12  HIS A CG  1 
ATOM   90   N  ND1 . HIS A 1 12 ? 6.171   3.057   2.311   1.00 20.72 ?  12  HIS A ND1 1 
ATOM   91   C  CD2 . HIS A 1 12 ? 4.783   4.650   1.756   1.00 19.90 ?  12  HIS A CD2 1 
ATOM   92   C  CE1 . HIS A 1 12 ? 6.393   4.070   3.129   1.00 22.99 ?  12  HIS A CE1 1 
ATOM   93   N  NE2 . HIS A 1 12 ? 5.562   5.049   2.816   1.00 22.01 ?  12  HIS A NE2 1 
ATOM   94   N  N   . ILE A 1 13 ? 3.260   1.886   3.248   1.00 18.82 ?  13  ILE A N   1 
ATOM   95   C  CA  . ILE A 1 13 ? 3.533   1.577   4.651   1.00 18.61 ?  13  ILE A CA  1 
ATOM   96   C  C   . ILE A 1 13 ? 3.205   0.123   4.980   1.00 20.03 ?  13  ILE A C   1 
ATOM   97   O  O   . ILE A 1 13 ? 3.989   -0.560  5.641   1.00 20.44 ?  13  ILE A O   1 
ATOM   98   C  CB  . ILE A 1 13 ? 2.742   2.511   5.588   1.00 18.87 ?  13  ILE A CB  1 
ATOM   99   C  CG1 . ILE A 1 13 ? 3.259   3.944   5.454   1.00 19.73 ?  13  ILE A CG1 1 
ATOM   100  C  CG2 . ILE A 1 13 ? 2.839   2.038   7.039   1.00 19.65 ?  13  ILE A CG2 1 
ATOM   101  C  CD1 . ILE A 1 13 ? 2.311   4.983   6.002   1.00 22.02 ?  13  ILE A CD1 1 
ATOM   102  N  N   . CYS A 1 14 ? 2.068   -0.355  4.482   1.00 18.52 ?  14  CYS A N   1 
ATOM   103  C  CA  . CYS A 1 14 ? 1.633   -1.718  4.765   1.00 19.38 ?  14  CYS A CA  1 
ATOM   104  C  C   . CYS A 1 14 ? 1.705   -2.627  3.541   1.00 18.71 ?  14  CYS A C   1 
ATOM   105  O  O   . CYS A 1 14 ? 1.835   -3.842  3.676   1.00 18.42 ?  14  CYS A O   1 
ATOM   106  C  CB  . CYS A 1 14 ? 0.202   -1.714  5.315   1.00 21.65 ?  14  CYS A CB  1 
ATOM   107  S  SG  . CYS A 1 14 ? -0.053  -0.614  6.728   1.00 22.12 ?  14  CYS A SG  1 
ATOM   108  N  N   . HIS A 1 15 ? 1.613   -2.043  2.349   1.00 18.17 ?  15  HIS A N   1 
ATOM   109  C  CA  . HIS A 1 15 ? 1.537   -2.842  1.129   1.00 19.86 ?  15  HIS A CA  1 
ATOM   110  C  C   . HIS A 1 15 ? 2.894   -3.145  0.484   1.00 20.06 ?  15  HIS A C   1 
ATOM   111  O  O   . HIS A 1 15 ? 2.983   -4.031  -0.363  1.00 22.01 ?  15  HIS A O   1 
ATOM   112  C  CB  . HIS A 1 15 ? 0.640   -2.154  0.101   1.00 17.73 ?  15  HIS A CB  1 
ATOM   113  C  CG  . HIS A 1 15 ? -0.820  -2.268  0.399   1.00 18.28 ?  15  HIS A CG  1 
ATOM   114  N  ND1 . HIS A 1 15 ? -1.584  -3.336  -0.023  1.00 21.67 ?  15  HIS A ND1 1 
ATOM   115  C  CD2 . HIS A 1 15 ? -1.662  -1.443  1.068   1.00 17.85 ?  15  HIS A CD2 1 
ATOM   116  C  CE1 . HIS A 1 15 ? -2.831  -3.166  0.377   1.00 21.89 ?  15  HIS A CE1 1 
ATOM   117  N  NE2 . HIS A 1 15 ? -2.905  -2.024  1.040   1.00 19.10 ?  15  HIS A NE2 1 
ATOM   118  N  N   . SER A 1 16 ? 3.941   -2.413  0.858   1.00 19.56 ?  16  SER A N   1 
ATOM   119  C  CA  . SER A 1 16 ? 5.255   -2.680  0.272   1.00 18.27 ?  16  SER A CA  1 
ATOM   120  C  C   . SER A 1 16 ? 5.722   -4.094  0.620   1.00 20.68 ?  16  SER A C   1 
ATOM   121  O  O   . SER A 1 16 ? 6.299   -4.784  -0.220  1.00 18.74 ?  16  SER A O   1 
ATOM   122  C  CB  . SER A 1 16 ? 6.294   -1.659  0.735   1.00 20.42 ?  16  SER A CB  1 
ATOM   123  O  OG  . SER A 1 16 ? 6.615   -1.849  2.094   1.00 18.58 ?  16  SER A OG  1 
ATOM   124  N  N   . MET A 1 17 ? 5.465   -4.519  1.854   1.00 19.40 ?  17  MET A N   1 
ATOM   125  C  CA  . MET A 1 17 ? 5.869   -5.850  2.304   1.00 21.85 ?  17  MET A CA  1 
ATOM   126  C  C   . MET A 1 17 ? 4.669   -6.773  2.488   1.00 23.80 ?  17  MET A C   1 
ATOM   127  O  O   . MET A 1 17 ? 4.831   -7.970  2.724   1.00 23.35 ?  17  MET A O   1 
ATOM   128  C  CB  . MET A 1 17 ? 6.659   -5.759  3.613   1.00 23.44 ?  17  MET A CB  1 
ATOM   129  C  CG  . MET A 1 17 ? 7.999   -5.050  3.479   1.00 26.14 ?  17  MET A CG  1 
ATOM   130  S  SD  . MET A 1 17 ? 8.826   -4.745  5.061   1.00 36.27 ?  17  MET A SD  1 
ATOM   131  C  CE  . MET A 1 17 ? 7.784   -3.467  5.782   1.00 21.14 ?  17  MET A CE  1 
ATOM   132  N  N   . GLY A 1 18 ? 3.468   -6.213  2.381   1.00 22.51 ?  18  GLY A N   1 
ATOM   133  C  CA  . GLY A 1 18 ? 2.251   -6.982  2.565   1.00 23.04 ?  18  GLY A CA  1 
ATOM   134  C  C   . GLY A 1 18 ? 2.042   -7.351  4.018   1.00 21.22 ?  18  GLY A C   1 
ATOM   135  O  O   . GLY A 1 18 ? 1.871   -8.520  4.358   1.00 23.58 ?  18  GLY A O   1 
ATOM   136  N  N   . VAL A 1 19 ? 2.063   -6.346  4.883   1.00 20.59 ?  19  VAL A N   1 
ATOM   137  C  CA  . VAL A 1 19 ? 1.952   -6.570  6.316   1.00 21.15 ?  19  VAL A CA  1 
ATOM   138  C  C   . VAL A 1 19 ? 0.512   -6.935  6.674   1.00 22.32 ?  19  VAL A C   1 
ATOM   139  O  O   . VAL A 1 19 ? -0.431  -6.446  6.048   1.00 20.87 ?  19  VAL A O   1 
ATOM   140  C  CB  . VAL A 1 19 ? 2.417   -5.329  7.112   1.00 22.52 ?  19  VAL A CB  1 
ATOM   141  C  CG1 . VAL A 1 19 ? 2.417   -5.607  8.605   1.00 22.66 ?  19  VAL A CG1 1 
ATOM   142  C  CG2 . VAL A 1 19 ? 3.810   -4.910  6.665   1.00 24.18 ?  19  VAL A CG2 1 
ATOM   143  N  N   . ALA A 1 20 ? 0.366   -7.819  7.661   1.00 22.04 ?  20  ALA A N   1 
ATOM   144  C  CA  . ALA A 1 20 ? -0.927  -8.291  8.157   1.00 22.54 ?  20  ALA A CA  1 
ATOM   145  C  C   . ALA A 1 20 ? -1.842  -8.773  7.036   1.00 22.87 ?  20  ALA A C   1 
ATOM   146  O  O   . ALA A 1 20 ? -3.054  -8.575  7.087   1.00 25.24 ?  20  ALA A O   1 
ATOM   147  C  CB  . ALA A 1 20 ? -1.612  -7.202  8.963   1.00 27.94 ?  20  ALA A CB  1 
ATOM   148  N  N   . GLY A 1 21 ? -1.253  -9.391  6.020   1.00 22.36 ?  21  GLY A N   1 
ATOM   149  C  CA  . GLY A 1 21 ? -2.025  -9.942  4.922   1.00 26.59 ?  21  GLY A CA  1 
ATOM   150  C  C   . GLY A 1 21 ? -2.389  -8.962  3.822   1.00 25.46 ?  21  GLY A C   1 
ATOM   151  O  O   . GLY A 1 21 ? -3.140  -9.312  2.913   1.00 25.28 ?  21  GLY A O   1 
ATOM   152  N  N   . ALA A 1 22 ? -1.871  -7.736  3.891   1.00 21.53 ?  22  ALA A N   1 
ATOM   153  C  CA  . ALA A 1 22 ? -2.117  -6.769  2.825   1.00 21.82 ?  22  ALA A CA  1 
ATOM   154  C  C   . ALA A 1 22 ? -1.579  -7.329  1.509   1.00 23.95 ?  22  ALA A C   1 
ATOM   155  O  O   . ALA A 1 22 ? -0.503  -7.926  1.480   1.00 24.88 ?  22  ALA A O   1 
ATOM   156  C  CB  . ALA A 1 22 ? -1.474  -5.417  3.149   1.00 21.15 ?  22  ALA A CB  1 
ATOM   157  N  N   . PRO A 1 23 ? -2.350  -7.191  0.421   1.00 22.36 ?  23  PRO A N   1 
ATOM   158  C  CA  . PRO A 1 23 ? -1.822  -7.637  -0.871  1.00 22.11 ?  23  PRO A CA  1 
ATOM   159  C  C   . PRO A 1 23 ? -0.590  -6.827  -1.254  1.00 23.62 ?  23  PRO A C   1 
ATOM   160  O  O   . PRO A 1 23 ? -0.656  -5.601  -1.349  1.00 21.93 ?  23  PRO A O   1 
ATOM   161  C  CB  . PRO A 1 23 ? -2.987  -7.393  -1.838  1.00 22.37 ?  23  PRO A CB  1 
ATOM   162  C  CG  . PRO A 1 23 ? -3.900  -6.441  -1.114  1.00 22.29 ?  23  PRO A CG  1 
ATOM   163  C  CD  . PRO A 1 23 ? -3.754  -6.762  0.328   1.00 22.02 ?  23  PRO A CD  1 
ATOM   164  N  N   . LYS A 1 24 ? 0.525   -7.517  -1.453  1.00 19.96 ?  24  LYS A N   1 
ATOM   165  C  CA  . LYS A 1 24 ? 1.808   -6.863  -1.676  1.00 22.82 ?  24  LYS A CA  1 
ATOM   166  C  C   . LYS A 1 24 ? 1.808   -6.079  -2.981  1.00 22.50 ?  24  LYS A C   1 
ATOM   167  O  O   . LYS A 1 24 ? 1.277   -6.537  -3.989  1.00 23.32 ?  24  LYS A O   1 
ATOM   168  C  CB  . LYS A 1 24 ? 2.935   -7.899  -1.673  1.00 21.25 ?  24  LYS A CB  1 
ATOM   169  C  CG  . LYS A 1 24 ? 4.334   -7.322  -1.837  1.00 25.86 ?  24  LYS A CG  1 
ATOM   170  C  CD  . LYS A 1 24 ? 5.395   -8.420  -1.725  1.00 27.96 ?  24  LYS A CD  1 
ATOM   171  C  CE  . LYS A 1 24 ? 6.801   -7.852  -1.861  1.00 26.72 ?  24  LYS A CE  1 
ATOM   172  N  NZ  . LYS A 1 24 ? 7.843   -8.914  -1.800  1.00 35.98 ?  24  LYS A NZ  1 
ATOM   173  N  N   . ALA A 1 25 ? 2.394   -4.888  -2.952  1.00 22.12 ?  25  ALA A N   1 
ATOM   174  C  CA  . ALA A 1 25 ? 2.450   -4.050  -4.138  1.00 21.96 ?  25  ALA A CA  1 
ATOM   175  C  C   . ALA A 1 25 ? 3.274   -4.728  -5.224  1.00 21.27 ?  25  ALA A C   1 
ATOM   176  O  O   . ALA A 1 25 ? 4.292   -5.358  -4.933  1.00 21.33 ?  25  ALA A O   1 
ATOM   177  C  CB  . ALA A 1 25 ? 3.028   -2.685  -3.802  1.00 20.94 ?  25  ALA A CB  1 
ATOM   178  N  N   . HIS A 1 26 ? 2.804   -4.595  -6.462  1.00 21.76 ?  26  HIS A N   1 
ATOM   179  C  CA  . HIS A 1 26 ? 3.435   -5.150  -7.662  1.00 21.54 ?  26  HIS A CA  1 
ATOM   180  C  C   . HIS A 1 26 ? 3.355   -6.684  -7.709  1.00 23.62 ?  26  HIS A C   1 
ATOM   181  O  O   . HIS A 1 26 ? 3.964   -7.327  -8.570  1.00 25.50 ?  26  HIS A O   1 
ATOM   182  C  CB  . HIS A 1 26 ? 4.888   -4.673  -7.772  1.00 23.40 ?  26  HIS A CB  1 
ATOM   183  C  CG  . HIS A 1 26 ? 5.051   -3.197  -7.571  1.00 22.93 ?  26  HIS A CG  1 
ATOM   184  N  ND1 . HIS A 1 26 ? 4.400   -2.262  -8.349  1.00 22.73 ?  26  HIS A ND1 1 
ATOM   185  C  CD2 . HIS A 1 26 ? 5.786   -2.496  -6.677  1.00 23.43 ?  26  HIS A CD2 1 
ATOM   186  C  CE1 . HIS A 1 26 ? 4.730   -1.050  -7.943  1.00 23.09 ?  26  HIS A CE1 1 
ATOM   187  N  NE2 . HIS A 1 26 ? 5.571   -1.163  -6.931  1.00 21.51 ?  26  HIS A NE2 1 
ATOM   188  N  N   . ASP A 1 27 ? 2.585   -7.259  -6.790  1.00 21.93 ?  27  ASP A N   1 
ATOM   189  C  CA  . ASP A 1 27 ? 2.283   -8.686  -6.808  1.00 23.04 ?  27  ASP A CA  1 
ATOM   190  C  C   . ASP A 1 27 ? 0.973   -8.888  -7.562  1.00 25.20 ?  27  ASP A C   1 
ATOM   191  O  O   . ASP A 1 27 ? -0.106  -8.834  -6.965  1.00 23.19 ?  27  ASP A O   1 
ATOM   192  C  CB  . ASP A 1 27 ? 2.188   -9.241  -5.383  1.00 21.48 ?  27  ASP A CB  1 
ATOM   193  C  CG  . ASP A 1 27 ? 2.014   -10.750 -5.345  1.00 25.42 ?  27  ASP A CG  1 
ATOM   194  O  OD1 . ASP A 1 27 ? 1.640   -11.345 -6.378  1.00 26.10 ?  27  ASP A OD1 1 
ATOM   195  O  OD2 . ASP A 1 27 ? 2.242   -11.344 -4.268  1.00 25.18 ?  27  ASP A OD2 1 
ATOM   196  N  N   . ALA A 1 28 ? 1.074   -9.125  -8.868  1.00 25.30 ?  28  ALA A N   1 
ATOM   197  C  CA  . ALA A 1 28 ? -0.105  -9.183  -9.732  1.00 27.86 ?  28  ALA A CA  1 
ATOM   198  C  C   . ALA A 1 28 ? -1.035  -10.328 -9.349  1.00 28.13 ?  28  ALA A C   1 
ATOM   199  O  O   . ALA A 1 28 ? -2.257  -10.194 -9.424  1.00 28.56 ?  28  ALA A O   1 
ATOM   200  C  CB  . ALA A 1 28 ? 0.312   -9.307  -11.187 1.00 26.52 ?  28  ALA A CB  1 
ATOM   201  N  N   . ALA A 1 29 ? -0.457  -11.450 -8.930  1.00 25.91 ?  29  ALA A N   1 
ATOM   202  C  CA  . ALA A 1 29 ? -1.249  -12.619 -8.559  1.00 26.75 ?  29  ALA A CA  1 
ATOM   203  C  C   . ALA A 1 29 ? -2.077  -12.350 -7.308  1.00 24.17 ?  29  ALA A C   1 
ATOM   204  O  O   . ALA A 1 29 ? -3.225  -12.786 -7.208  1.00 24.46 ?  29  ALA A O   1 
ATOM   205  C  CB  . ALA A 1 29 ? -0.349  -13.826 -8.348  1.00 26.19 ?  29  ALA A CB  1 
ATOM   206  N  N   . ALA A 1 30 ? -1.498  -11.624 -6.357  1.00 21.73 ?  30  ALA A N   1 
ATOM   207  C  CA  . ALA A 1 30 ? -2.188  -11.326 -5.108  1.00 24.40 ?  30  ALA A CA  1 
ATOM   208  C  C   . ALA A 1 30 ? -3.318  -10.322 -5.328  1.00 25.09 ?  30  ALA A C   1 
ATOM   209  O  O   . ALA A 1 30 ? -4.351  -10.381 -4.656  1.00 28.17 ?  30  ALA A O   1 
ATOM   210  C  CB  . ALA A 1 30 ? -1.208  -10.802 -4.066  1.00 23.11 ?  30  ALA A CB  1 
ATOM   211  N  N   . TRP A 1 31 ? -3.123  -9.411  -6.278  1.00 24.69 ?  31  TRP A N   1 
ATOM   212  C  CA  . TRP A 1 31 ? -4.102  -8.359  -6.524  1.00 24.05 ?  31  TRP A CA  1 
ATOM   213  C  C   . TRP A 1 31 ? -5.216  -8.779  -7.476  1.00 22.96 ?  31  TRP A C   1 
ATOM   214  O  O   . TRP A 1 31 ? -6.297  -8.198  -7.447  1.00 24.33 ?  31  TRP A O   1 
ATOM   215  C  CB  . TRP A 1 31 ? -3.409  -7.104  -7.061  1.00 23.35 ?  31  TRP A CB  1 
ATOM   216  C  CG  . TRP A 1 31 ? -2.808  -6.258  -5.972  1.00 21.91 ?  31  TRP A CG  1 
ATOM   217  C  CD1 . TRP A 1 31 ? -1.509  -6.261  -5.551  1.00 20.56 ?  31  TRP A CD1 1 
ATOM   218  C  CD2 . TRP A 1 31 ? -3.492  -5.294  -5.160  1.00 20.62 ?  31  TRP A CD2 1 
ATOM   219  N  NE1 . TRP A 1 31 ? -1.340  -5.350  -4.528  1.00 19.07 ?  31  TRP A NE1 1 
ATOM   220  C  CE2 . TRP A 1 31 ? -2.543  -4.743  -4.271  1.00 21.07 ?  31  TRP A CE2 1 
ATOM   221  C  CE3 . TRP A 1 31 ? -4.816  -4.838  -5.101  1.00 20.58 ?  31  TRP A CE3 1 
ATOM   222  C  CZ2 . TRP A 1 31 ? -2.874  -3.763  -3.336  1.00 21.43 ?  31  TRP A CZ2 1 
ATOM   223  C  CZ3 . TRP A 1 31 ? -5.144  -3.872  -4.171  1.00 20.66 ?  31  TRP A CZ3 1 
ATOM   224  C  CH2 . TRP A 1 31 ? -4.177  -3.343  -3.299  1.00 20.04 ?  31  TRP A CH2 1 
ATOM   225  N  N   . GLU A 1 32 ? -4.961  -9.787  -8.306  1.00 24.82 ?  32  GLU A N   1 
ATOM   226  C  CA  . GLU A 1 32 ? -5.936  -10.215 -9.312  1.00 24.54 ?  32  GLU A CA  1 
ATOM   227  C  C   . GLU A 1 32 ? -7.336  -10.490 -8.733  1.00 24.51 ?  32  GLU A C   1 
ATOM   228  O  O   . GLU A 1 32 ? -8.317  -9.954  -9.248  1.00 25.62 ?  32  GLU A O   1 
ATOM   229  C  CB  . GLU A 1 32 ? -5.422  -11.448 -10.070 1.00 25.06 ?  32  GLU A CB  1 
ATOM   230  C  CG  . GLU A 1 32 ? -6.167  -11.739 -11.382 1.00 26.64 ?  32  GLU A CG  1 
ATOM   231  C  CD  . GLU A 1 32 ? -7.561  -12.305 -11.166 1.00 26.07 ?  32  GLU A CD  1 
ATOM   232  O  OE1 . GLU A 1 32 ? -7.716  -13.193 -10.300 1.00 26.63 ?  32  GLU A OE1 1 
ATOM   233  O  OE2 . GLU A 1 32 ? -8.504  -11.842 -11.843 1.00 26.70 ?  32  GLU A OE2 1 
ATOM   234  N  N   . PRO A 1 33 ? -7.443  -11.309 -7.665  1.00 25.63 ?  33  PRO A N   1 
ATOM   235  C  CA  . PRO A 1 33 ? -8.796  -11.550 -7.147  1.00 25.64 ?  33  PRO A CA  1 
ATOM   236  C  C   . PRO A 1 33 ? -9.442  -10.295 -6.567  1.00 25.87 ?  33  PRO A C   1 
ATOM   237  O  O   . PRO A 1 33 ? -10.663 -10.167 -6.561  1.00 28.30 ?  33  PRO A O   1 
ATOM   238  C  CB  . PRO A 1 33 ? -8.575  -12.589 -6.042  1.00 25.55 ?  33  PRO A CB  1 
ATOM   239  C  CG  . PRO A 1 33 ? -7.215  -13.152 -6.284  1.00 28.86 ?  33  PRO A CG  1 
ATOM   240  C  CD  . PRO A 1 33 ? -6.428  -12.036 -6.880  1.00 24.26 ?  33  PRO A CD  1 
ATOM   241  N  N   . ARG A 1 34 ? -8.626  -9.372  -6.081  1.00 25.58 ?  34  ARG A N   1 
ATOM   242  C  CA  . ARG A 1 34 ? -9.156  -8.150  -5.498  1.00 26.72 ?  34  ARG A CA  1 
ATOM   243  C  C   . ARG A 1 34 ? -9.592  -7.168  -6.583  1.00 24.17 ?  34  ARG A C   1 
ATOM   244  O  O   . ARG A 1 34 ? -10.677 -6.597  -6.499  1.00 21.33 ?  34  ARG A O   1 
ATOM   245  C  CB  . ARG A 1 34 ? -8.122  -7.541  -4.559  1.00 24.38 ?  34  ARG A CB  1 
ATOM   246  C  CG  . ARG A 1 34 ? -7.825  -8.486  -3.396  1.00 26.84 ?  34  ARG A CG  1 
ATOM   247  C  CD  . ARG A 1 34 ? -6.716  -7.985  -2.516  1.00 30.02 ?  34  ARG A CD  1 
ATOM   248  N  NE  . ARG A 1 34 ? -6.688  -8.667  -1.225  1.00 28.33 ?  34  ARG A NE  1 
ATOM   249  C  CZ  . ARG A 1 34 ? -5.924  -9.716  -0.948  1.00 32.39 ?  34  ARG A CZ  1 
ATOM   250  N  NH1 . ARG A 1 34 ? -5.120  -10.222 -1.878  1.00 37.25 ?  34  ARG A NH1 1 
ATOM   251  N  NH2 . ARG A 1 34 ? -5.965  -10.263 0.259   1.00 33.61 ?  34  ARG A NH2 1 
ATOM   252  N  N   . ILE A 1 35 ? -8.762  -6.995  -7.608  1.00 21.59 ?  35  ILE A N   1 
ATOM   253  C  CA  . ILE A 1 35 ? -9.140  -6.202  -8.776  1.00 21.50 ?  35  ILE A CA  1 
ATOM   254  C  C   . ILE A 1 35 ? -10.441 -6.720  -9.398  1.00 25.36 ?  35  ILE A C   1 
ATOM   255  O  O   . ILE A 1 35 ? -11.272 -5.934  -9.860  1.00 27.06 ?  35  ILE A O   1 
ATOM   256  C  CB  . ILE A 1 35 ? -8.025  -6.204  -9.850  1.00 24.77 ?  35  ILE A CB  1 
ATOM   257  C  CG1 . ILE A 1 35 ? -6.759  -5.529  -9.317  1.00 24.54 ?  35  ILE A CG1 1 
ATOM   258  C  CG2 . ILE A 1 35 ? -8.492  -5.522  -11.131 1.00 23.72 ?  35  ILE A CG2 1 
ATOM   259  C  CD1 . ILE A 1 35 ? -6.967  -4.079  -8.920  1.00 25.86 ?  35  ILE A CD1 1 
ATOM   260  N  N   . ALA A 1 36 ? -10.619 -8.043  -9.392  1.00 22.73 ?  36  ALA A N   1 
ATOM   261  C  CA  . ALA A 1 36 ? -11.795 -8.673  -9.994  1.00 24.36 ?  36  ALA A CA  1 
ATOM   262  C  C   . ALA A 1 36 ? -13.115 -8.235  -9.351  1.00 24.78 ?  36  ALA A C   1 
ATOM   263  O  O   . ALA A 1 36 ? -14.175 -8.335  -9.968  1.00 25.85 ?  36  ALA A O   1 
ATOM   264  C  CB  . ALA A 1 36 ? -11.665 -10.187 -9.927  1.00 23.35 ?  36  ALA A CB  1 
ATOM   265  N  N   . GLN A 1 37 ? -13.055 -7.730  -8.136  1.00 25.94 ?  37  GLN A N   1 
ATOM   266  C  CA  . GLN A 1 37 ? -14.200 -7.273  -7.409  1.00 25.55 ?  37  GLN A CA  1 
ATOM   267  C  C   . GLN A 1 37 ? -14.756 -5.994  -8.028  1.00 27.73 ?  37  GLN A C   1 
ATOM   268  O  O   . GLN A 1 37 ? -15.874 -5.652  -7.804  1.00 29.45 ?  37  GLN A O   1 
ATOM   269  C  CB  . GLN A 1 37 ? -13.900 -7.055  -5.912  1.00 26.98 ?  37  GLN A CB  1 
ATOM   270  C  CG  . GLN A 1 37 ? -13.324 -8.210  -5.155  1.00 28.53 ?  37  GLN A CG  1 
ATOM   271  C  CD  . GLN A 1 37 ? -13.253 -7.962  -3.639  1.00 34.79 ?  37  GLN A CD  1 
ATOM   272  O  OE1 . GLN A 1 37 ? -14.258 -7.694  -3.020  1.00 40.36 ?  37  GLN A OE1 1 
ATOM   273  N  NE2 . GLN A 1 37 ? -12.080 -8.082  -3.049  1.00 33.39 ?  37  GLN A NE2 1 
ATOM   274  N  N   . GLY A 1 38 ? -13.947 -5.334  -8.813  1.00 24.90 ?  38  GLY A N   1 
ATOM   275  C  CA  . GLY A 1 38 ? -14.320 -4.073  -9.425  1.00 25.96 ?  38  GLY A CA  1 
ATOM   276  C  C   . GLY A 1 38 ? -13.747 -2.905  -8.648  1.00 22.46 ?  38  GLY A C   1 
ATOM   277  O  O   . GLY A 1 38 ? -13.800 -2.885  -7.416  1.00 23.16 ?  38  GLY A O   1 
ATOM   278  N  N   . LEU A 1 39 ? -13.201 -1.931  -9.372  1.00 22.88 ?  39  LEU A N   1 
ATOM   279  C  CA  . LEU A 1 39 ? -12.543 -0.782  -8.757  1.00 23.55 ?  39  LEU A CA  1 
ATOM   280  C  C   . LEU A 1 39 ? -13.482 0.048   -7.889  1.00 22.80 ?  39  LEU A C   1 
ATOM   281  O  O   . LEU A 1 39 ? -13.074 0.518   -6.828  1.00 23.38 ?  39  LEU A O   1 
ATOM   282  C  CB  . LEU A 1 39 ? -11.908 0.108   -9.831  1.00 26.19 ?  39  LEU A CB  1 
ATOM   283  C  CG  . LEU A 1 39 ? -10.411 -0.096  -10.075 1.00 24.08 ?  39  LEU A CG  1 
ATOM   284  C  CD1 . LEU A 1 39 ? -10.059 -1.567  -10.114 1.00 26.99 ?  39  LEU A CD1 1 
ATOM   285  C  CD2 . LEU A 1 39 ? -9.991  0.572   -11.369 1.00 31.96 ?  39  LEU A CD2 1 
ATOM   286  N  N   . ASP A 1 40 ? -14.724 0.237   -8.336  1.00 22.84 ?  40  ASP A N   1 
ATOM   287  C  CA  . ASP A 1 40 ? -15.724 0.944   -7.532  1.00 24.15 ?  40  ASP A CA  1 
ATOM   288  C  C   . ASP A 1 40 ? -15.813 0.339   -6.134  1.00 24.46 ?  40  ASP A C   1 
ATOM   289  O  O   . ASP A 1 40 ? -15.827 1.056   -5.129  1.00 23.31 ?  40  ASP A O   1 
ATOM   290  C  CB  . ASP A 1 40 ? -17.103 0.903   -8.203  1.00 28.03 ?  40  ASP A CB  1 
ATOM   291  C  CG  . ASP A 1 40 ? -17.320 2.050   -9.177  1.00 28.96 ?  40  ASP A CG  1 
ATOM   292  O  OD1 . ASP A 1 40 ? -16.335 2.737   -9.517  1.00 29.32 ?  40  ASP A OD1 1 
ATOM   293  O  OD2 . ASP A 1 40 ? -18.480 2.258   -9.602  1.00 32.06 ?  40  ASP A OD2 1 
ATOM   294  N  N   . THR A 1 41 ? -15.853 -0.990  -6.082  1.00 21.42 ?  41  THR A N   1 
ATOM   295  C  CA  . THR A 1 41 ? -15.938 -1.719  -4.821  1.00 23.43 ?  41  THR A CA  1 
ATOM   296  C  C   . THR A 1 41 ? -14.682 -1.526  -3.975  1.00 20.07 ?  41  THR A C   1 
ATOM   297  O  O   . THR A 1 41 ? -14.761 -1.299  -2.764  1.00 19.72 ?  41  THR A O   1 
ATOM   298  C  CB  . THR A 1 41 ? -16.159 -3.225  -5.063  1.00 24.83 ?  41  THR A CB  1 
ATOM   299  O  OG1 . THR A 1 41 ? -17.440 -3.432  -5.669  1.00 27.19 ?  41  THR A OG1 1 
ATOM   300  C  CG2 . THR A 1 41 ? -16.093 -3.995  -3.752  1.00 25.17 ?  41  THR A CG2 1 
ATOM   301  N  N   . LEU A 1 42 ? -13.524 -1.605  -4.619  1.00 20.89 ?  42  LEU A N   1 
ATOM   302  C  CA  . LEU A 1 42 ? -12.249 -1.454  -3.920  1.00 21.67 ?  42  LEU A CA  1 
ATOM   303  C  C   . LEU A 1 42 ? -12.078 -0.053  -3.335  1.00 19.73 ?  42  LEU A C   1 
ATOM   304  O  O   . LEU A 1 42 ? -11.632 0.097   -2.202  1.00 21.19 ?  42  LEU A O   1 
ATOM   305  C  CB  . LEU A 1 42 ? -11.084 -1.774  -4.856  1.00 18.45 ?  42  LEU A CB  1 
ATOM   306  C  CG  . LEU A 1 42 ? -10.993 -3.236  -5.293  1.00 20.32 ?  42  LEU A CG  1 
ATOM   307  C  CD1 . LEU A 1 42 ? -9.716  -3.470  -6.087  1.00 19.15 ?  42  LEU A CD1 1 
ATOM   308  C  CD2 . LEU A 1 42 ? -11.079 -4.169  -4.087  1.00 20.95 ?  42  LEU A CD2 1 
ATOM   309  N  N   . VAL A 1 43 ? -12.431 0.970   -4.105  1.00 23.28 ?  43  VAL A N   1 
ATOM   310  C  CA  . VAL A 1 43 ? -12.322 2.342   -3.613  1.00 21.83 ?  43  VAL A CA  1 
ATOM   311  C  C   . VAL A 1 43 ? -13.226 2.523   -2.396  1.00 22.89 ?  43  VAL A C   1 
ATOM   312  O  O   . VAL A 1 43 ? -12.815 3.100   -1.393  1.00 22.44 ?  43  VAL A O   1 
ATOM   313  C  CB  . VAL A 1 43 ? -12.678 3.376   -4.702  1.00 22.67 ?  43  VAL A CB  1 
ATOM   314  C  CG1 . VAL A 1 43 ? -12.768 4.773   -4.119  1.00 19.73 ?  43  VAL A CG1 1 
ATOM   315  C  CG2 . VAL A 1 43 ? -11.649 3.340   -5.817  1.00 21.91 ?  43  VAL A CG2 1 
ATOM   316  N  N   . SER A 1 44 ? -14.447 2.000   -2.471  1.00 22.96 ?  44  SER A N   1 
ATOM   317  C  CA  . SER A 1 44 ? -15.374 2.075   -1.344  1.00 22.33 ?  44  SER A CA  1 
ATOM   318  C  C   . SER A 1 44 ? -14.793 1.396   -0.104  1.00 25.27 ?  44  SER A C   1 
ATOM   319  O  O   . SER A 1 44 ? -14.856 1.932   1.001   1.00 24.30 ?  44  SER A O   1 
ATOM   320  C  CB  . SER A 1 44 ? -16.717 1.444   -1.710  1.00 24.93 ?  44  SER A CB  1 
ATOM   321  O  OG  . SER A 1 44 ? -17.632 1.545   -0.636  1.00 26.95 ?  44  SER A OG  1 
ATOM   322  N  N   . THR A 1 45 ? -14.216 0.217   -0.297  1.00 23.08 ?  45  THR A N   1 
ATOM   323  C  CA  . THR A 1 45 ? -13.606 -0.526  0.802   1.00 24.73 ?  45  THR A CA  1 
ATOM   324  C  C   . THR A 1 45 ? -12.450 0.243   1.465   1.00 26.14 ?  45  THR A C   1 
ATOM   325  O  O   . THR A 1 45 ? -12.347 0.280   2.692   1.00 29.08 ?  45  THR A O   1 
ATOM   326  C  CB  . THR A 1 45 ? -13.110 -1.899  0.315   1.00 21.97 ?  45  THR A CB  1 
ATOM   327  O  OG1 . THR A 1 45 ? -14.244 -2.725  0.020   1.00 24.42 ?  45  THR A OG1 1 
ATOM   328  C  CG2 . THR A 1 45 ? -12.248 -2.574  1.375   1.00 23.91 ?  45  THR A CG2 1 
ATOM   329  N  N   . VAL A 1 46 ? -11.597 0.868   0.660   1.00 23.44 ?  46  VAL A N   1 
ATOM   330  C  CA  . VAL A 1 46 ? -10.462 1.619   1.196   1.00 22.22 ?  46  VAL A CA  1 
ATOM   331  C  C   . VAL A 1 46 ? -10.925 2.784   2.062   1.00 23.99 ?  46  VAL A C   1 
ATOM   332  O  O   . VAL A 1 46 ? -10.348 3.058   3.117   1.00 24.58 ?  46  VAL A O   1 
ATOM   333  C  CB  . VAL A 1 46 ? -9.559  2.158   0.069   1.00 21.46 ?  46  VAL A CB  1 
ATOM   334  C  CG1 . VAL A 1 46 ? -8.471  3.047   0.634   1.00 21.44 ?  46  VAL A CG1 1 
ATOM   335  C  CG2 . VAL A 1 46 ? -8.947  1.012   -0.703  1.00 22.61 ?  46  VAL A CG2 1 
ATOM   336  N  N   . LYS A 1 47 ? -11.973 3.465   1.613   1.00 24.05 ?  47  LYS A N   1 
ATOM   337  C  CA  . LYS A 1 47 ? -12.486 4.633   2.320   1.00 25.98 ?  47  LYS A CA  1 
ATOM   338  C  C   . LYS A 1 47 ? -13.154 4.282   3.656   1.00 27.06 ?  47  LYS A C   1 
ATOM   339  O  O   . LYS A 1 47 ? -13.122 5.077   4.596   1.00 29.71 ?  47  LYS A O   1 
ATOM   340  C  CB  . LYS A 1 47 ? -13.458 5.387   1.420   1.00 24.70 ?  47  LYS A CB  1 
ATOM   341  C  CG  . LYS A 1 47 ? -12.783 5.927   0.173   1.00 25.08 ?  47  LYS A CG  1 
ATOM   342  C  CD  . LYS A 1 47 ? -13.760 6.115   -0.973  1.00 26.08 ?  47  LYS A CD  1 
ATOM   343  C  CE  . LYS A 1 47 ? -14.638 7.312   -0.757  1.00 24.67 ?  47  LYS A CE  1 
ATOM   344  N  NZ  . LYS A 1 47 ? -15.661 7.456   -1.832  1.00 19.62 ?  47  LYS A NZ  1 
ATOM   345  N  N   . THR A 1 48 ? -13.739 3.093   3.747   1.00 26.12 ?  48  THR A N   1 
ATOM   346  C  CA  . THR A 1 48 ? -14.395 2.669   4.981   1.00 28.04 ?  48  THR A CA  1 
ATOM   347  C  C   . THR A 1 48 ? -13.467 1.826   5.842   1.00 34.27 ?  48  THR A C   1 
ATOM   348  O  O   . THR A 1 48 ? -13.674 1.689   7.048   1.00 34.46 ?  48  THR A O   1 
ATOM   349  C  CB  . THR A 1 48 ? -15.675 1.866   4.699   1.00 30.34 ?  48  THR A CB  1 
ATOM   350  O  OG1 . THR A 1 48 ? -15.342 0.656   4.005   1.00 34.84 ?  48  THR A OG1 1 
ATOM   351  C  CG2 . THR A 1 48 ? -16.648 2.690   3.865   1.00 27.88 ?  48  THR A CG2 1 
ATOM   352  N  N   . GLY A 1 49 ? -12.437 1.267   5.217   1.00 30.47 ?  49  GLY A N   1 
ATOM   353  C  CA  . GLY A 1 49 ? -11.504 0.410   5.918   1.00 33.40 ?  49  GLY A CA  1 
ATOM   354  C  C   . GLY A 1 49 ? -11.923 -1.042  5.820   1.00 35.56 ?  49  GLY A C   1 
ATOM   355  O  O   . GLY A 1 49 ? -13.075 -1.359  5.511   1.00 33.91 ?  49  GLY A O   1 
ATOM   356  N  N   . LYS A 1 50 ? -10.974 -1.933  6.068   1.00 36.45 ?  50  LYS A N   1 
ATOM   357  C  CA  . LYS A 1 50 ? -11.250 -3.361  6.037   1.00 35.32 ?  50  LYS A CA  1 
ATOM   358  C  C   . LYS A 1 50 ? -10.277 -4.080  6.957   1.00 35.64 ?  50  LYS A C   1 
ATOM   359  O  O   . LYS A 1 50 ? -9.082  -4.168  6.663   1.00 36.35 ?  50  LYS A O   1 
ATOM   360  C  CB  . LYS A 1 50 ? -11.154 -3.904  4.606   1.00 35.54 ?  50  LYS A CB  1 
ATOM   361  C  CG  . LYS A 1 50 ? -11.357 -5.411  4.498   1.00 35.26 ?  50  LYS A CG  1 
ATOM   362  C  CD  . LYS A 1 50 ? -11.590 -5.848  3.057   1.00 32.69 ?  50  LYS A CD  1 
ATOM   363  C  CE  . LYS A 1 50 ? -11.797 -7.358  2.982   1.00 34.76 ?  50  LYS A CE  1 
ATOM   364  N  NZ  . LYS A 1 50 ? -12.393 -7.794  1.685   1.00 35.24 ?  50  LYS A NZ  1 
ATOM   365  N  N   . GLY A 1 51 ? -10.797 -4.575  8.077   1.00 37.15 ?  51  GLY A N   1 
ATOM   366  C  CA  . GLY A 1 51 ? -9.992  -5.261  9.072   1.00 36.59 ?  51  GLY A CA  1 
ATOM   367  C  C   . GLY A 1 51 ? -8.830  -4.427  9.578   1.00 37.63 ?  51  GLY A C   1 
ATOM   368  O  O   . GLY A 1 51 ? -9.018  -3.394  10.226  1.00 36.50 ?  51  GLY A O   1 
ATOM   369  N  N   . ALA A 1 52 ? -7.619  -4.878  9.260   1.00 37.82 ?  52  ALA A N   1 
ATOM   370  C  CA  . ALA A 1 52 ? -6.402  -4.218  9.719   1.00 35.10 ?  52  ALA A CA  1 
ATOM   371  C  C   . ALA A 1 52 ? -6.136  -2.898  8.994   1.00 34.78 ?  52  ALA A C   1 
ATOM   372  O  O   . ALA A 1 52 ? -5.414  -2.047  9.507   1.00 36.34 ?  52  ALA A O   1 
ATOM   373  C  CB  . ALA A 1 52 ? -5.212  -5.152  9.562   1.00 35.82 ?  52  ALA A CB  1 
ATOM   374  N  N   . MET A 1 53 ? -6.708  -2.720  7.806   1.00 33.35 ?  53  MET A N   1 
ATOM   375  C  CA  . MET A 1 53 ? -6.545  -1.449  7.111   1.00 32.46 ?  53  MET A CA  1 
ATOM   376  C  C   . MET A 1 53 ? -7.511  -0.408  7.652   1.00 33.63 ?  53  MET A C   1 
ATOM   377  O  O   . MET A 1 53 ? -8.719  -0.633  7.700   1.00 36.16 ?  53  MET A O   1 
ATOM   378  C  CB  . MET A 1 53 ? -6.745  -1.596  5.604   1.00 29.52 ?  53  MET A CB  1 
ATOM   379  C  CG  . MET A 1 53 ? -6.449  -0.296  4.847   1.00 28.69 ?  53  MET A CG  1 
ATOM   380  S  SD  . MET A 1 53 ? -6.555  -0.483  3.065   1.00 25.49 ?  53  MET A SD  1 
ATOM   381  C  CE  . MET A 1 53 ? -8.275  -0.943  2.901   1.00 25.07 ?  53  MET A CE  1 
ATOM   382  N  N   . PRO A 1 54 ? -6.973  0.743   8.068   1.00 35.53 ?  54  PRO A N   1 
ATOM   383  C  CA  . PRO A 1 54 ? -7.774  1.865   8.561   1.00 32.53 ?  54  PRO A CA  1 
ATOM   384  C  C   . PRO A 1 54 ? -8.460  2.628   7.428   1.00 30.87 ?  54  PRO A C   1 
ATOM   385  O  O   . PRO A 1 54 ? -7.909  2.713   6.329   1.00 29.21 ?  54  PRO A O   1 
ATOM   386  C  CB  . PRO A 1 54 ? -6.736  2.739   9.262   1.00 36.84 ?  54  PRO A CB  1 
ATOM   387  C  CG  . PRO A 1 54 ? -5.472  2.469   8.518   1.00 33.89 ?  54  PRO A CG  1 
ATOM   388  C  CD  . PRO A 1 54 ? -5.527  1.015   8.155   1.00 31.95 ?  54  PRO A CD  1 
ATOM   389  N  N   . PRO A 1 55 ? -9.653  3.183   7.693   1.00 32.27 ?  55  PRO A N   1 
ATOM   390  C  CA  . PRO A 1 55 ? -10.410 3.927   6.679   1.00 31.13 ?  55  PRO A CA  1 
ATOM   391  C  C   . PRO A 1 55 ? -9.581  5.045   6.050   1.00 27.64 ?  55  PRO A C   1 
ATOM   392  O  O   . PRO A 1 55 ? -9.081  5.915   6.768   1.00 28.70 ?  55  PRO A O   1 
ATOM   393  C  CB  . PRO A 1 55 ? -11.593 4.498   7.470   1.00 30.03 ?  55  PRO A CB  1 
ATOM   394  C  CG  . PRO A 1 55 ? -11.733 3.596   8.649   1.00 33.03 ?  55  PRO A CG  1 
ATOM   395  C  CD  . PRO A 1 55 ? -10.348 3.148   8.993   1.00 31.72 ?  55  PRO A CD  1 
ATOM   396  N  N   . GLY A 1 56 ? -9.422  5.006   4.729   1.00 24.16 ?  56  GLY A N   1 
ATOM   397  C  CA  . GLY A 1 56 ? -8.661  6.023   4.027   1.00 23.22 ?  56  GLY A CA  1 
ATOM   398  C  C   . GLY A 1 56 ? -7.267  5.584   3.600   1.00 25.34 ?  56  GLY A C   1 
ATOM   399  O  O   . GLY A 1 56 ? -6.625  6.254   2.781   1.00 21.20 ?  56  GLY A O   1 
ATOM   400  N  N   . GLY A 1 57 ? -6.800  4.464   4.152   1.00 24.61 ?  57  GLY A N   1 
ATOM   401  C  CA  . GLY A 1 57 ? -5.478  3.943   3.848   1.00 21.05 ?  57  GLY A CA  1 
ATOM   402  C  C   . GLY A 1 57 ? -4.375  4.952   4.123   1.00 23.71 ?  57  GLY A C   1 
ATOM   403  O  O   . GLY A 1 57 ? -3.379  5.006   3.395   1.00 20.91 ?  57  GLY A O   1 
ATOM   404  N  N   . MET A 1 58 ? -4.581  5.765   5.161   1.00 22.36 ?  58  MET A N   1 
ATOM   405  C  CA  . MET A 1 58 ? -3.638  6.802   5.591   1.00 21.00 ?  58  MET A CA  1 
ATOM   406  C  C   . MET A 1 58 ? -3.292  7.846   4.529   1.00 20.88 ?  58  MET A C   1 
ATOM   407  O  O   . MET A 1 58 ? -2.254  8.503   4.606   1.00 20.36 ?  58  MET A O   1 
ATOM   408  C  CB  . MET A 1 58 ? -2.353  6.162   6.097   1.00 21.10 ?  58  MET A CB  1 
ATOM   409  C  CG  . MET A 1 58 ? -2.557  5.344   7.354   1.00 24.24 ?  58  MET A CG  1 
ATOM   410  S  SD  . MET A 1 58 ? -1.005  4.718   7.952   1.00 27.78 ?  58  MET A SD  1 
ATOM   411  C  CE  . MET A 1 58 ? -0.245  6.234   8.547   1.00 21.37 ?  58  MET A CE  1 
ATOM   412  N  N   . CYS A 1 59 ? -4.154  7.990   3.536   1.00 21.68 ?  59  CYS A N   1 
ATOM   413  C  CA  . CYS A 1 59 ? -4.080  9.131   2.646   1.00 20.70 ?  59  CYS A CA  1 
ATOM   414  C  C   . CYS A 1 59 ? -5.089  10.169  3.129   1.00 22.82 ?  59  CYS A C   1 
ATOM   415  O  O   . CYS A 1 59 ? -6.272  9.867   3.273   1.00 19.27 ?  59  CYS A O   1 
ATOM   416  C  CB  . CYS A 1 59 ? -4.363  8.730   1.205   1.00 21.92 ?  59  CYS A CB  1 
ATOM   417  S  SG  . CYS A 1 59 ? -4.379  10.141  0.095   1.00 21.29 ?  59  CYS A SG  1 
ATOM   418  N  N   . THR A 1 60 ? -4.622  11.386  3.386   1.00 21.86 ?  60  THR A N   1 
ATOM   419  C  CA  . THR A 1 60 ? -5.455  12.383  4.043   1.00 20.86 ?  60  THR A CA  1 
ATOM   420  C  C   . THR A 1 60 ? -6.161  13.306  3.059   1.00 21.50 ?  60  THR A C   1 
ATOM   421  O  O   . THR A 1 60 ? -7.027  14.085  3.456   1.00 22.16 ?  60  THR A O   1 
ATOM   422  C  CB  . THR A 1 60 ? -4.625  13.244  5.016   1.00 22.82 ?  60  THR A CB  1 
ATOM   423  O  OG1 . THR A 1 60 ? -3.615  13.950  4.286   1.00 19.73 ?  60  THR A OG1 1 
ATOM   424  C  CG2 . THR A 1 60 ? -3.956  12.367  6.067   1.00 24.54 ?  60  THR A CG2 1 
ATOM   425  N  N   . ASP A 1 61 ? -5.809  13.212  1.780   1.00 19.78 ?  61  ASP A N   1 
ATOM   426  C  CA  . ASP A 1 61 ? -6.349  14.130  0.783   1.00 20.56 ?  61  ASP A CA  1 
ATOM   427  C  C   . ASP A 1 61 ? -6.749  13.434  -0.519  1.00 20.17 ?  61  ASP A C   1 
ATOM   428  O  O   . ASP A 1 61 ? -6.743  14.054  -1.585  1.00 19.93 ?  61  ASP A O   1 
ATOM   429  C  CB  . ASP A 1 61 ? -5.325  15.225  0.482   1.00 17.70 ?  61  ASP A CB  1 
ATOM   430  C  CG  . ASP A 1 61 ? -4.021  14.674  -0.066  1.00 21.47 ?  61  ASP A CG  1 
ATOM   431  O  OD1 . ASP A 1 61 ? -3.892  13.440  -0.238  1.00 21.64 ?  61  ASP A OD1 1 
ATOM   432  O  OD2 . ASP A 1 61 ? -3.121  15.486  -0.340  1.00 21.40 ?  61  ASP A OD2 1 
ATOM   433  N  N   . CYS A 1 62 ? -7.082  12.151  -0.432  1.00 19.33 ?  62  CYS A N   1 
ATOM   434  C  CA  . CYS A 1 62 ? -7.328  11.346  -1.628  1.00 20.71 ?  62  CYS A CA  1 
ATOM   435  C  C   . CYS A 1 62 ? -8.759  11.415  -2.155  1.00 20.27 ?  62  CYS A C   1 
ATOM   436  O  O   . CYS A 1 62 ? -9.719  11.137  -1.438  1.00 21.98 ?  62  CYS A O   1 
ATOM   437  C  CB  . CYS A 1 62 ? -6.973  9.884   -1.357  1.00 21.65 ?  62  CYS A CB  1 
ATOM   438  S  SG  . CYS A 1 62 ? -5.233  9.464   -1.611  1.00 20.71 ?  62  CYS A SG  1 
ATOM   439  N  N   . THR A 1 63 ? -8.887  11.772  -3.426  1.00 22.00 ?  63  THR A N   1 
ATOM   440  C  CA  . THR A 1 63 ? -10.144 11.636  -4.148  1.00 19.25 ?  63  THR A CA  1 
ATOM   441  C  C   . THR A 1 63 ? -10.351 10.169  -4.514  1.00 21.99 ?  63  THR A C   1 
ATOM   442  O  O   . THR A 1 63 ? -9.441  9.355   -4.347  1.00 19.35 ?  63  THR A O   1 
ATOM   443  C  CB  . THR A 1 63 ? -10.149 12.477  -5.429  1.00 22.38 ?  63  THR A CB  1 
ATOM   444  O  OG1 . THR A 1 63 ? -9.117  12.006  -6.302  1.00 20.27 ?  63  THR A OG1 1 
ATOM   445  C  CG2 . THR A 1 63 ? -9.892  13.953  -5.113  1.00 23.17 ?  63  THR A CG2 1 
ATOM   446  N  N   . ASP A 1 64 ? -11.535 9.832   -5.020  1.00 21.42 ?  64  ASP A N   1 
ATOM   447  C  CA  . ASP A 1 64 ? -11.780 8.487   -5.539  1.00 23.39 ?  64  ASP A CA  1 
ATOM   448  C  C   . ASP A 1 64 ? -10.811 8.166   -6.671  1.00 22.18 ?  64  ASP A C   1 
ATOM   449  O  O   . ASP A 1 64 ? -10.324 7.040   -6.772  1.00 21.32 ?  64  ASP A O   1 
ATOM   450  C  CB  . ASP A 1 64 ? -13.223 8.342   -6.027  1.00 22.92 ?  64  ASP A CB  1 
ATOM   451  C  CG  . ASP A 1 64 ? -14.215 8.212   -4.888  1.00 23.64 ?  64  ASP A CG  1 
ATOM   452  O  OD1 . ASP A 1 64 ? -13.814 8.407   -3.719  1.00 21.35 ?  64  ASP A OD1 1 
ATOM   453  O  OD2 . ASP A 1 64 ? -15.398 7.917   -5.165  1.00 21.42 ?  64  ASP A OD2 1 
ATOM   454  N  N   . GLU A 1 65 ? -10.530 9.152   -7.507  1.00 20.63 ?  65  GLU A N   1 
ATOM   455  C  CA  . GLU A 1 65 ? -9.573  9.005   -8.586  1.00 22.02 ?  65  GLU A CA  1 
ATOM   456  C  C   . GLU A 1 65 ? -8.181  8.682   -8.069  1.00 22.59 ?  65  GLU A C   1 
ATOM   457  O  O   . GLU A 1 65 ? -7.512  7.871   -8.618  1.00 20.07 ?  65  GLU A O   1 
ATOM   458  C  CB  . GLU A 1 65 ? -9.526  10.238  -9.443  1.00 25.17 ?  65  GLU A CB  1 
ATOM   459  C  CG  . GLU A 1 65 ? -10.718 10.391  -10.364 1.00 26.74 ?  65  GLU A CG  1 
ATOM   460  C  CD  . GLU A 1 65 ? -11.978 10.867  -9.651  1.00 28.67 ?  65  GLU A CD  1 
ATOM   461  O  OE1 . GLU A 1 65 ? -13.025 10.662  -10.242 1.00 33.39 ?  65  GLU A OE1 1 
ATOM   462  O  OE2 . GLU A 1 65 ? -11.933 11.416  -8.541  1.00 27.43 ?  65  GLU A OE2 1 
ATOM   463  N  N   . ASP A 1 66 ? -7.802  9.353   -6.996  1.00 19.71 ?  66  ASP A N   1 
ATOM   464  C  CA  . ASP A 1 66 ? -6.521  9.115   -6.345  1.00 19.69 ?  66  ASP A CA  1 
ATOM   465  C  C   . ASP A 1 66 ? -6.429  7.682   -5.844  1.00 19.58 ?  66  ASP A C   1 
ATOM   466  O  O   . ASP A 1 66 ? -5.432  7.006   -6.083  1.00 20.42 ?  66  ASP A O   1 
ATOM   467  C  CB  . ASP A 1 66 ? -6.312  10.079  -5.178  1.00 18.87 ?  66  ASP A CB  1 
ATOM   468  C  CG  . ASP A 1 66 ? -6.179  11.519  -5.624  1.00 21.34 ?  66  ASP A CG  1 
ATOM   469  O  OD1 . ASP A 1 66 ? -5.856  11.757  -6.812  1.00 22.58 ?  66  ASP A OD1 1 
ATOM   470  O  OD2 . ASP A 1 66 ? -6.394  12.414  -4.777  1.00 20.51 ?  66  ASP A OD2 1 
ATOM   471  N  N   . TYR A 1 67 ? -7.474  7.228   -5.156  1.00 18.55 ?  67  TYR A N   1 
ATOM   472  C  CA  . TYR A 1 67 ? -7.529  5.860   -4.635  1.00 17.70 ?  67  TYR A CA  1 
ATOM   473  C  C   . TYR A 1 67 ? -7.431  4.831   -5.750  1.00 17.30 ?  67  TYR A C   1 
ATOM   474  O  O   . TYR A 1 67 ? -6.687  3.857   -5.654  1.00 16.54 ?  67  TYR A O   1 
ATOM   475  C  CB  . TYR A 1 67 ? -8.814  5.639   -3.838  1.00 19.53 ?  67  TYR A CB  1 
ATOM   476  C  CG  . TYR A 1 67 ? -8.771  6.210   -2.442  1.00 18.57 ?  67  TYR A CG  1 
ATOM   477  C  CD1 . TYR A 1 67 ? -7.693  5.960   -1.601  1.00 20.09 ?  67  TYR A CD1 1 
ATOM   478  C  CD2 . TYR A 1 67 ? -9.800  7.013   -1.971  1.00 20.72 ?  67  TYR A CD2 1 
ATOM   479  C  CE1 . TYR A 1 67 ? -7.649  6.484   -0.327  1.00 23.24 ?  67  TYR A CE1 1 
ATOM   480  C  CE2 . TYR A 1 67 ? -9.762  7.544   -0.698  1.00 19.94 ?  67  TYR A CE2 1 
ATOM   481  C  CZ  . TYR A 1 67 ? -8.689  7.279   0.119   1.00 21.79 ?  67  TYR A CZ  1 
ATOM   482  O  OH  . TYR A 1 67 ? -8.657  7.813   1.388   1.00 23.93 ?  67  TYR A OH  1 
ATOM   483  N  N   . LYS A 1 68 ? -8.194  5.058   -6.810  1.00 18.97 ?  68  LYS A N   1 
ATOM   484  C  CA  . LYS A 1 68 ? -8.168  4.182   -7.974  1.00 21.17 ?  68  LYS A CA  1 
ATOM   485  C  C   . LYS A 1 68 ? -6.774  4.138   -8.613  1.00 18.23 ?  68  LYS A C   1 
ATOM   486  O  O   . LYS A 1 68 ? -6.266  3.061   -8.929  1.00 19.57 ?  68  LYS A O   1 
ATOM   487  C  CB  . LYS A 1 68 ? -9.219  4.644   -8.982  1.00 21.99 ?  68  LYS A CB  1 
ATOM   488  C  CG  . LYS A 1 68 ? -9.242  3.898   -10.291 1.00 25.80 ?  68  LYS A CG  1 
ATOM   489  C  CD  . LYS A 1 68 ? -10.337 4.478   -11.180 1.00 30.02 ?  68  LYS A CD  1 
ATOM   490  C  CE  . LYS A 1 68 ? -10.262 3.932   -12.593 1.00 34.20 ?  68  LYS A CE  1 
ATOM   491  N  NZ  . LYS A 1 68 ? -11.321 4.519   -13.466 1.00 36.53 ?  68  LYS A NZ  1 
ATOM   492  N  N   . SER A 1 69 ? -6.151  5.302   -8.784  1.00 19.41 ?  69  SER A N   1 
ATOM   493  C  CA  . SER A 1 69 ? -4.800  5.369   -9.347  1.00 19.23 ?  69  SER A CA  1 
ATOM   494  C  C   . SER A 1 69 ? -3.799  4.576   -8.512  1.00 18.60 ?  69  SER A C   1 
ATOM   495  O  O   . SER A 1 69 ? -2.951  3.849   -9.053  1.00 22.00 ?  69  SER A O   1 
ATOM   496  C  CB  . SER A 1 69 ? -4.325  6.823   -9.462  1.00 22.41 ?  69  SER A CB  1 
ATOM   497  O  OG  . SER A 1 69 ? -5.099  7.556   -10.392 1.00 25.75 ?  69  SER A OG  1 
ATOM   498  N  N   . ALA A 1 70 ? -3.908  4.720   -7.193  1.00 18.74 ?  70  ALA A N   1 
ATOM   499  C  CA  . ALA A 1 70 ? -3.015  4.049   -6.257  1.00 16.86 ?  70  ALA A CA  1 
ATOM   500  C  C   . ALA A 1 70 ? -3.142  2.534   -6.367  1.00 18.89 ?  70  ALA A C   1 
ATOM   501  O  O   . ALA A 1 70 ? -2.137  1.817   -6.387  1.00 18.43 ?  70  ALA A O   1 
ATOM   502  C  CB  . ALA A 1 70 ? -3.304  4.503   -4.833  1.00 16.99 ?  70  ALA A CB  1 
ATOM   503  N  N   . ILE A 1 71 ? -4.381  2.057   -6.428  1.00 15.65 ?  71  ILE A N   1 
ATOM   504  C  CA  . ILE A 1 71 ? -4.658  0.631   -6.584  1.00 18.34 ?  71  ILE A CA  1 
ATOM   505  C  C   . ILE A 1 71 ? -4.078  0.101   -7.899  1.00 18.70 ?  71  ILE A C   1 
ATOM   506  O  O   . ILE A 1 71 ? -3.427  -0.952  -7.928  1.00 20.81 ?  71  ILE A O   1 
ATOM   507  C  CB  . ILE A 1 71 ? -6.183  0.350   -6.517  1.00 18.16 ?  71  ILE A CB  1 
ATOM   508  C  CG1 . ILE A 1 71 ? -6.723  0.691   -5.126  1.00 16.18 ?  71  ILE A CG1 1 
ATOM   509  C  CG2 . ILE A 1 71 ? -6.482  -1.106  -6.845  1.00 17.44 ?  71  ILE A CG2 1 
ATOM   510  C  CD1 . ILE A 1 71 ? -8.233  0.540   -4.983  1.00 21.32 ?  71  ILE A CD1 1 
ATOM   511  N  N   . GLU A 1 72 ? -4.295  0.839   -8.982  1.00 19.01 ?  72  GLU A N   1 
ATOM   512  C  CA  . GLU A 1 72 ? -3.749  0.459   -10.281 1.00 19.60 ?  72  GLU A CA  1 
ATOM   513  C  C   . GLU A 1 72 ? -2.221  0.345   -10.241 1.00 21.93 ?  72  GLU A C   1 
ATOM   514  O  O   . GLU A 1 72 ? -1.647  -0.573  -10.828 1.00 22.05 ?  72  GLU A O   1 
ATOM   515  C  CB  . GLU A 1 72 ? -4.196  1.455   -11.354 1.00 23.45 ?  72  GLU A CB  1 
ATOM   516  C  CG  . GLU A 1 72 ? -5.649  1.244   -11.780 1.00 21.80 ?  72  GLU A CG  1 
ATOM   517  C  CD  . GLU A 1 72 ? -6.187  2.341   -12.677 1.00 28.55 ?  72  GLU A CD  1 
ATOM   518  O  OE1 . GLU A 1 72 ? -5.586  3.438   -12.732 1.00 29.04 ?  72  GLU A OE1 1 
ATOM   519  O  OE2 . GLU A 1 72 ? -7.228  2.102   -13.322 1.00 32.62 ?  72  GLU A OE2 1 
ATOM   520  N  N   . TYR A 1 73 ? -1.567  1.264   -9.533  1.00 22.18 ?  73  TYR A N   1 
ATOM   521  C  CA  . TYR A 1 73 ? -0.112  1.213   -9.374  1.00 20.71 ?  73  TYR A CA  1 
ATOM   522  C  C   . TYR A 1 73 ? 0.336   -0.027  -8.604  1.00 20.50 ?  73  TYR A C   1 
ATOM   523  O  O   . TYR A 1 73 ? 1.358   -0.636  -8.933  1.00 20.18 ?  73  TYR A O   1 
ATOM   524  C  CB  . TYR A 1 73 ? 0.406   2.473   -8.664  1.00 18.77 ?  73  TYR A CB  1 
ATOM   525  C  CG  . TYR A 1 73 ? 1.892   2.427   -8.370  1.00 19.55 ?  73  TYR A CG  1 
ATOM   526  C  CD1 . TYR A 1 73 ? 2.825   2.681   -9.368  1.00 21.62 ?  73  TYR A CD1 1 
ATOM   527  C  CD2 . TYR A 1 73 ? 2.364   2.123   -7.097  1.00 19.45 ?  73  TYR A CD2 1 
ATOM   528  C  CE1 . TYR A 1 73 ? 4.186   2.632   -9.111  1.00 19.65 ?  73  TYR A CE1 1 
ATOM   529  C  CE2 . TYR A 1 73 ? 3.729   2.068   -6.831  1.00 20.84 ?  73  TYR A CE2 1 
ATOM   530  C  CZ  . TYR A 1 73 ? 4.630   2.328   -7.844  1.00 20.18 ?  73  TYR A CZ  1 
ATOM   531  O  OH  . TYR A 1 73 ? 5.978   2.275   -7.594  1.00 22.28 ?  73  TYR A OH  1 
ATOM   532  N  N   . MET A 1 74 ? -0.416  -0.398  -7.569  1.00 18.93 ?  74  MET A N   1 
ATOM   533  C  CA  . MET A 1 74 ? -0.029  -1.540  -6.742  1.00 20.35 ?  74  MET A CA  1 
ATOM   534  C  C   . MET A 1 74 ? -0.315  -2.858  -7.448  1.00 21.85 ?  74  MET A C   1 
ATOM   535  O  O   . MET A 1 74 ? 0.369   -3.855  -7.224  1.00 22.30 ?  74  MET A O   1 
ATOM   536  C  CB  . MET A 1 74 ? -0.752  -1.509  -5.388  1.00 18.76 ?  74  MET A CB  1 
ATOM   537  C  CG  . MET A 1 74 ? -0.274  -0.393  -4.468  1.00 17.81 ?  74  MET A CG  1 
ATOM   538  S  SD  . MET A 1 74 ? -0.779  -0.565  -2.749  1.00 17.01 ?  74  MET A SD  1 
ATOM   539  C  CE  . MET A 1 74 ? -2.534  -0.194  -2.858  1.00 19.08 ?  74  MET A CE  1 
ATOM   540  N  N   . SER A 1 75 ? -1.319  -2.850  -8.314  1.00 18.94 ?  75  SER A N   1 
ATOM   541  C  CA  . SER A 1 75 ? -1.845  -4.082  -8.887  1.00 23.29 ?  75  SER A CA  1 
ATOM   542  C  C   . SER A 1 75 ? -0.932  -4.681  -9.951  1.00 24.06 ?  75  SER A C   1 
ATOM   543  O  O   . SER A 1 75 ? -1.143  -5.807  -10.380 1.00 28.11 ?  75  SER A O   1 
ATOM   544  C  CB  . SER A 1 75 ? -3.235  -3.833  -9.481  1.00 25.32 ?  75  SER A CB  1 
ATOM   545  O  OG  . SER A 1 75 ? -3.144  -3.022  -10.642 1.00 26.42 ?  75  SER A OG  1 
ATOM   546  N  N   . LYS A 1 76 ? 0.066   -3.950  -10.403 1.00 25.12 ?  76  LYS A N   1 
ATOM   547  C  CA  . LYS A 1 76 ? 1.074   -4.484  -11.290 1.00 25.06 ?  76  LYS A CA  1 
ATOM   548  C  C   . LYS A 1 76 ? 2.458   -4.248  -10.743 1.00 25.25 ?  76  LYS A C   1 
ATOM   549  O  O   . LYS A 1 76 ? 2.759   -3.198  -10.304 1.00 24.27 ?  76  LYS A O   1 
ATOM   550  C  CB  . LYS A 1 76 ? 1.047   -3.825  -12.667 1.00 30.77 ?  76  LYS A CB  1 
ATOM   551  C  CG  . LYS A 1 76 ? -0.248  -3.801  -13.399 1.00 33.30 ?  76  LYS A CG  1 
ATOM   552  C  CD  . LYS A 1 76 ? -0.065  -3.342  -14.835 1.00 35.88 ?  76  LYS A CD  1 
ATOM   553  C  CE  . LYS A 1 76 ? -0.524  -1.913  -15.010 1.00 39.58 ?  76  LYS A CE  1 
ATOM   554  N  NZ  . LYS A 1 76 ? 0.023   -1.027  -13.951 1.00 38.53 ?  76  LYS A NZ  1 
ATOM   555  N  N   . GLN B 1 1  ? 4.749   -13.402 23.027  1.00 33.89 ?  1   GLN B N   1 
ATOM   556  C  CA  . GLN B 1 1  ? 5.779   -12.958 22.094  1.00 32.50 ?  1   GLN B CA  1 
ATOM   557  C  C   . GLN B 1 1  ? 6.688   -11.926 22.747  1.00 30.24 ?  1   GLN B C   1 
ATOM   558  O  O   . GLN B 1 1  ? 6.282   -11.237 23.685  1.00 31.33 ?  1   GLN B O   1 
ATOM   559  C  CB  . GLN B 1 1  ? 5.147   -12.370 20.829  1.00 31.05 ?  1   GLN B CB  1 
ATOM   560  C  CG  . GLN B 1 1  ? 3.904   -13.102 20.347  1.00 29.65 ?  1   GLN B CG  1 
ATOM   561  C  CD  . GLN B 1 1  ? 3.333   -12.503 19.073  1.00 28.95 ?  1   GLN B CD  1 
ATOM   562  O  OE1 . GLN B 1 1  ? 4.047   -12.317 18.092  1.00 30.64 ?  1   GLN B OE1 1 
ATOM   563  N  NE2 . GLN B 1 1  ? 2.041   -12.194 19.087  1.00 29.68 ?  1   GLN B NE2 1 
ATOM   564  N  N   . GLU B 1 2  ? 7.892   -11.798 22.250  1.00 25.69 ?  2   GLU B N   1 
ATOM   565  C  CA  . GLU B 1 2  ? 8.800   -10.794 22.720  1.00 29.59 ?  2   GLU B CA  1 
ATOM   566  C  C   . GLU B 1 2  ? 8.360   -9.421  22.222  1.00 29.83 ?  2   GLU B C   1 
ATOM   567  O  O   . GLU B 1 2  ? 7.850   -9.317  21.150  1.00 29.16 ?  2   GLU B O   1 
ATOM   568  C  CB  . GLU B 1 2  ? 10.162  -11.002 22.113  1.00 30.96 ?  2   GLU B CB  1 
ATOM   569  C  CG  . GLU B 1 2  ? 11.045  -12.050 22.729  1.00 30.61 ?  2   GLU B CG  1 
ATOM   570  C  CD  . GLU B 1 2  ? 11.089  -12.000 24.214  1.00 33.24 ?  2   GLU B CD  1 
ATOM   571  O  OE1 . GLU B 1 2  ? 11.639  -11.085 24.852  1.00 37.64 ?  2   GLU B OE1 1 
ATOM   572  O  OE2 . GLU B 1 2  ? 10.547  -12.926 24.733  1.00 38.38 ?  2   GLU B OE2 1 
ATOM   573  N  N   . GLY B 1 3  ? 8.660   -8.372  22.955  1.00 29.24 ?  3   GLY B N   1 
ATOM   574  C  CA  . GLY B 1 3  ? 8.291   -7.027  22.553  1.00 30.15 ?  3   GLY B CA  1 
ATOM   575  C  C   . GLY B 1 3  ? 8.964   -6.598  21.263  1.00 27.63 ?  3   GLY B C   1 
ATOM   576  O  O   . GLY B 1 3  ? 8.321   -6.030  20.380  1.00 27.58 ?  3   GLY B O   1 
ATOM   577  N  N   . LYS B 1 4  ? 10.261  -6.878  21.157  1.00 28.90 ?  4   LYS B N   1 
ATOM   578  C  CA  . LYS B 1 4  ? 11.039  -6.510  19.979  1.00 25.71 ?  4   LYS B CA  1 
ATOM   579  C  C   . LYS B 1 4  ? 10.537  -7.240  18.744  1.00 26.33 ?  4   LYS B C   1 
ATOM   580  O  O   . LYS B 1 4  ? 10.560  -6.700  17.641  1.00 26.49 ?  4   LYS B O   1 
ATOM   581  C  CB  . LYS B 1 4  ? 12.521  -6.816  20.193  1.00 28.13 ?  4   LYS B CB  1 
ATOM   582  C  CG  . LYS B 1 4  ? 13.406  -6.379  19.041  1.00 26.90 ?  4   LYS B CG  1 
ATOM   583  C  CD  . LYS B 1 4  ? 14.876  -6.587  19.352  1.00 29.86 ?  4   LYS B CD  1 
ATOM   584  C  CE  . LYS B 1 4  ? 15.741  -6.089  18.205  1.00 31.74 ?  4   LYS B CE  1 
ATOM   585  N  NZ  . LYS B 1 4  ? 15.457  -6.813  16.936  1.00 30.21 ?  4   LYS B NZ  1 
ATOM   586  N  N   . ALA B 1 5  ? 10.083  -8.473  18.938  1.00 27.36 ?  5   ALA B N   1 
ATOM   587  C  CA  . ALA B 1 5  ? 9.572   -9.262  17.831  1.00 26.98 ?  5   ALA B CA  1 
ATOM   588  C  C   . ALA B 1 5  ? 8.298   -8.623  17.288  1.00 27.15 ?  5   ALA B C   1 
ATOM   589  O  O   . ALA B 1 5  ? 8.135   -8.483  16.075  1.00 24.24 ?  5   ALA B O   1 
ATOM   590  C  CB  . ALA B 1 5  ? 9.316   -10.687 18.265  1.00 25.57 ?  5   ALA B CB  1 
ATOM   591  N  N   . VAL B 1 6  ? 7.403   -8.229  18.192  1.00 24.80 ?  6   VAL B N   1 
ATOM   592  C  CA  . VAL B 1 6  ? 6.171   -7.566  17.790  1.00 23.07 ?  6   VAL B CA  1 
ATOM   593  C  C   . VAL B 1 6  ? 6.503   -6.291  17.015  1.00 24.13 ?  6   VAL B C   1 
ATOM   594  O  O   . VAL B 1 6  ? 5.939   -6.033  15.950  1.00 23.19 ?  6   VAL B O   1 
ATOM   595  C  CB  . VAL B 1 6  ? 5.280   -7.230  19.007  1.00 25.06 ?  6   VAL B CB  1 
ATOM   596  C  CG1 . VAL B 1 6  ? 4.074   -6.404  18.579  1.00 24.29 ?  6   VAL B CG1 1 
ATOM   597  C  CG2 . VAL B 1 6  ? 4.837   -8.506  19.706  1.00 28.15 ?  6   VAL B CG2 1 
ATOM   598  N  N   . TYR B 1 7  ? 7.445   -5.517  17.546  1.00 22.52 ?  7   TYR B N   1 
ATOM   599  C  CA  . TYR B 1 7  ? 7.882   -4.279  16.915  1.00 24.45 ?  7   TYR B CA  1 
ATOM   600  C  C   . TYR B 1 7  ? 8.443   -4.488  15.506  1.00 23.74 ?  7   TYR B C   1 
ATOM   601  O  O   . TYR B 1 7  ? 8.167   -3.704  14.594  1.00 23.38 ?  7   TYR B O   1 
ATOM   602  C  CB  . TYR B 1 7  ? 8.936   -3.590  17.783  1.00 22.08 ?  7   TYR B CB  1 
ATOM   603  C  CG  . TYR B 1 7  ? 9.453   -2.308  17.178  1.00 24.65 ?  7   TYR B CG  1 
ATOM   604  C  CD1 . TYR B 1 7  ? 8.711   -1.133  17.263  1.00 23.18 ?  7   TYR B CD1 1 
ATOM   605  C  CD2 . TYR B 1 7  ? 10.675  -2.269  16.514  1.00 23.40 ?  7   TYR B CD2 1 
ATOM   606  C  CE1 . TYR B 1 7  ? 9.170   0.042   16.712  1.00 25.51 ?  7   TYR B CE1 1 
ATOM   607  C  CE2 . TYR B 1 7  ? 11.145  -1.094  15.956  1.00 26.22 ?  7   TYR B CE2 1 
ATOM   608  C  CZ  . TYR B 1 7  ? 10.387  0.060   16.061  1.00 25.98 ?  7   TYR B CZ  1 
ATOM   609  O  OH  . TYR B 1 7  ? 10.833  1.235   15.509  1.00 25.50 ?  7   TYR B OH  1 
ATOM   610  N  N   . ASP B 1 8  ? 9.240   -5.538  15.338  1.00 25.78 ?  8   ASP B N   1 
ATOM   611  C  CA  . ASP B 1 8  ? 9.926   -5.788  14.072  1.00 25.43 ?  8   ASP B CA  1 
ATOM   612  C  C   . ASP B 1 8  ? 8.981   -6.287  12.986  1.00 23.49 ?  8   ASP B C   1 
ATOM   613  O  O   . ASP B 1 8  ? 9.267   -6.144  11.799  1.00 27.80 ?  8   ASP B O   1 
ATOM   614  C  CB  . ASP B 1 8  ? 11.062  -6.801  14.265  1.00 25.31 ?  8   ASP B CB  1 
ATOM   615  C  CG  . ASP B 1 8  ? 12.270  -6.205  14.966  1.00 25.90 ?  8   ASP B CG  1 
ATOM   616  O  OD1 . ASP B 1 8  ? 12.427  -4.968  14.941  1.00 29.87 ?  8   ASP B OD1 1 
ATOM   617  O  OD2 . ASP B 1 8  ? 13.069  -6.973  15.539  1.00 26.21 ?  8   ASP B OD2 1 
ATOM   618  N  N   . LYS B 1 9  ? 7.860   -6.878  13.385  1.00 24.53 ?  9   LYS B N   1 
ATOM   619  C  CA  . LYS B 1 9  ? 6.932   -7.437  12.404  1.00 25.39 ?  9   LYS B CA  1 
ATOM   620  C  C   . LYS B 1 9  ? 5.720   -6.546  12.163  1.00 24.97 ?  9   LYS B C   1 
ATOM   621  O  O   . LYS B 1 9  ? 4.945   -6.793  11.239  1.00 26.54 ?  9   LYS B O   1 
ATOM   622  C  CB  . LYS B 1 9  ? 6.464   -8.829  12.838  1.00 26.45 ?  9   LYS B CB  1 
ATOM   623  C  CG  . LYS B 1 9  ? 5.389   -8.835  13.915  1.00 24.94 ?  9   LYS B CG  1 
ATOM   624  C  CD  . LYS B 1 9  ? 5.007   -10.266 14.278  1.00 27.12 ?  9   LYS B CD  1 
ATOM   625  C  CE  . LYS B 1 9  ? 3.744   -10.310 15.122  1.00 26.09 ?  9   LYS B CE  1 
ATOM   626  N  NZ  . LYS B 1 9  ? 3.413   -11.704 15.524  1.00 28.68 ?  9   LYS B NZ  1 
ATOM   627  N  N   . ALA B 1 10 ? 5.552   -5.509  12.981  1.00 22.22 ?  10  ALA B N   1 
ATOM   628  C  CA  . ALA B 1 10 ? 4.345   -4.686  12.882  1.00 22.86 ?  10  ALA B CA  1 
ATOM   629  C  C   . ALA B 1 10 ? 4.558   -3.196  13.172  1.00 21.86 ?  10  ALA B C   1 
ATOM   630  O  O   . ALA B 1 10 ? 4.424   -2.359  12.273  1.00 23.48 ?  10  ALA B O   1 
ATOM   631  C  CB  . ALA B 1 10 ? 3.267   -5.245  13.816  1.00 23.60 ?  10  ALA B CB  1 
ATOM   632  N  N   . CYS B 1 11 ? 4.878   -2.866  14.420  1.00 21.78 ?  11  CYS B N   1 
ATOM   633  C  CA  . CYS B 1 11 ? 4.877   -1.469  14.865  1.00 20.07 ?  11  CYS B CA  1 
ATOM   634  C  C   . CYS B 1 11 ? 5.886   -0.579  14.139  1.00 21.35 ?  11  CYS B C   1 
ATOM   635  O  O   . CYS B 1 11 ? 5.652   0.625   13.977  1.00 20.26 ?  11  CYS B O   1 
ATOM   636  C  CB  . CYS B 1 11 ? 5.146   -1.386  16.368  1.00 20.50 ?  11  CYS B CB  1 
ATOM   637  S  SG  . CYS B 1 11 ? 4.261   -2.590  17.387  1.00 21.42 ?  11  CYS B SG  1 
ATOM   638  N  N   . HIS B 1 12 ? 7.005   -1.161  13.710  1.00 22.69 ?  12  HIS B N   1 
ATOM   639  C  CA  . HIS B 1 12 ? 8.113   -0.375  13.167  1.00 20.77 ?  12  HIS B CA  1 
ATOM   640  C  C   . HIS B 1 12 ? 7.733   0.413   11.919  1.00 22.26 ?  12  HIS B C   1 
ATOM   641  O  O   . HIS B 1 12 ? 8.298   1.473   11.659  1.00 21.61 ?  12  HIS B O   1 
ATOM   642  C  CB  . HIS B 1 12 ? 9.308   -1.278  12.846  1.00 23.78 ?  12  HIS B CB  1 
ATOM   643  C  CG  . HIS B 1 12 ? 9.113   -2.127  11.627  1.00 24.78 ?  12  HIS B CG  1 
ATOM   644  N  ND1 . HIS B 1 12 ? 9.678   -1.819  10.409  1.00 23.64 ?  12  HIS B ND1 1 
ATOM   645  C  CD2 . HIS B 1 12 ? 8.405   -3.265  11.436  1.00 24.26 ?  12  HIS B CD2 1 
ATOM   646  C  CE1 . HIS B 1 12 ? 9.334   -2.735  9.522   1.00 25.58 ?  12  HIS B CE1 1 
ATOM   647  N  NE2 . HIS B 1 12 ? 8.562   -3.624  10.120  1.00 25.69 ?  12  HIS B NE2 1 
ATOM   648  N  N   . ILE B 1 13 ? 6.774   -0.096  11.152  1.00 20.48 ?  13  ILE B N   1 
ATOM   649  C  CA  . ILE B 1 13 ? 6.446   0.511   9.861   1.00 23.28 ?  13  ILE B CA  1 
ATOM   650  C  C   . ILE B 1 13 ? 5.876   1.926   10.003  1.00 21.16 ?  13  ILE B C   1 
ATOM   651  O  O   . ILE B 1 13 ? 5.802   2.669   9.025   1.00 23.47 ?  13  ILE B O   1 
ATOM   652  C  CB  . ILE B 1 13 ? 5.449   -0.359  9.063   1.00 23.00 ?  13  ILE B CB  1 
ATOM   653  C  CG1 . ILE B 1 13 ? 4.088   -0.401  9.756   1.00 22.48 ?  13  ILE B CG1 1 
ATOM   654  C  CG2 . ILE B 1 13 ? 6.016   -1.763  8.868   1.00 20.40 ?  13  ILE B CG2 1 
ATOM   655  C  CD1 . ILE B 1 13 ? 3.064   -1.288  9.061   1.00 21.05 ?  13  ILE B CD1 1 
ATOM   656  N  N   . CYS B 1 14 ? 5.467   2.292   11.213  1.00 19.91 ?  14  CYS B N   1 
ATOM   657  C  CA  . CYS B 1 14 ? 5.056   3.668   11.479  1.00 21.85 ?  14  CYS B CA  1 
ATOM   658  C  C   . CYS B 1 14 ? 5.929   4.312   12.551  1.00 22.90 ?  14  CYS B C   1 
ATOM   659  O  O   . CYS B 1 14 ? 6.260   5.500   12.473  1.00 22.82 ?  14  CYS B O   1 
ATOM   660  C  CB  . CYS B 1 14 ? 3.587   3.723   11.906  1.00 22.43 ?  14  CYS B CB  1 
ATOM   661  S  SG  . CYS B 1 14 ? 2.408   3.302   10.609  1.00 21.82 ?  14  CYS B SG  1 
ATOM   662  N  N   . HIS B 1 15 ? 6.305   3.524   13.551  1.00 20.52 ?  15  HIS B N   1 
ATOM   663  C  CA  . HIS B 1 15 ? 6.940   4.086   14.733  1.00 22.04 ?  15  HIS B CA  1 
ATOM   664  C  C   . HIS B 1 15 ? 8.453   4.224   14.631  1.00 22.06 ?  15  HIS B C   1 
ATOM   665  O  O   . HIS B 1 15 ? 9.055   4.931   15.435  1.00 21.18 ?  15  HIS B O   1 
ATOM   666  C  CB  . HIS B 1 15 ? 6.579   3.255   15.958  1.00 22.12 ?  15  HIS B CB  1 
ATOM   667  C  CG  . HIS B 1 15 ? 5.218   3.553   16.493  1.00 21.72 ?  15  HIS B CG  1 
ATOM   668  N  ND1 . HIS B 1 15 ? 4.959   4.648   17.291  1.00 21.92 ?  15  HIS B ND1 1 
ATOM   669  C  CD2 . HIS B 1 15 ? 4.033   2.923   16.323  1.00 19.82 ?  15  HIS B CD2 1 
ATOM   670  C  CE1 . HIS B 1 15 ? 3.678   4.670   17.602  1.00 20.88 ?  15  HIS B CE1 1 
ATOM   671  N  NE2 . HIS B 1 15 ? 3.092   3.635   17.026  1.00 22.99 ?  15  HIS B NE2 1 
ATOM   672  N  N   . SER B 1 16 ? 9.071   3.564   13.653  1.00 22.31 ?  16  SER B N   1 
ATOM   673  C  CA  . SER B 1 16 ? 10.508  3.748   13.443  1.00 23.03 ?  16  SER B CA  1 
ATOM   674  C  C   . SER B 1 16 ? 10.845  5.185   13.040  1.00 23.09 ?  16  SER B C   1 
ATOM   675  O  O   . SER B 1 16 ? 11.687  5.832   13.666  1.00 26.74 ?  16  SER B O   1 
ATOM   676  C  CB  . SER B 1 16 ? 11.041  2.788   12.379  1.00 23.83 ?  16  SER B CB  1 
ATOM   677  O  OG  . SER B 1 16 ? 12.439  2.961   12.216  1.00 26.79 ?  16  SER B OG  1 
ATOM   678  N  N   . MET B 1 17 ? 10.192  5.682   11.994  1.00 21.91 ?  17  MET B N   1 
ATOM   679  C  CA  . MET B 1 17 ? 10.499  7.014   11.477  1.00 23.59 ?  17  MET B CA  1 
ATOM   680  C  C   . MET B 1 17 ? 9.479   8.046   11.954  1.00 23.46 ?  17  MET B C   1 
ATOM   681  O  O   . MET B 1 17 ? 9.580   9.222   11.619  1.00 25.15 ?  17  MET B O   1 
ATOM   682  C  CB  . MET B 1 17 ? 10.557  7.010   9.939   1.00 24.80 ?  17  MET B CB  1 
ATOM   683  C  CG  . MET B 1 17 ? 11.716  6.211   9.329   1.00 27.55 ?  17  MET B CG  1 
ATOM   684  S  SD  . MET B 1 17 ? 13.373  6.717   9.880   1.00 38.09 ?  17  MET B SD  1 
ATOM   685  C  CE  . MET B 1 17 ? 13.576  8.281   9.028   1.00 31.89 ?  17  MET B CE  1 
ATOM   686  N  N   . GLY B 1 18 ? 8.492   7.603   12.728  1.00 22.92 ?  18  GLY B N   1 
ATOM   687  C  CA  . GLY B 1 18 ? 7.474   8.502   13.242  1.00 22.85 ?  18  GLY B CA  1 
ATOM   688  C  C   . GLY B 1 18 ? 6.528   8.985   12.162  1.00 25.73 ?  18  GLY B C   1 
ATOM   689  O  O   . GLY B 1 18 ? 6.259   10.179  12.046  1.00 23.92 ?  18  GLY B O   1 
ATOM   690  N  N   . VAL B 1 19 ? 6.027   8.045   11.368  1.00 23.84 ?  19  VAL B N   1 
ATOM   691  C  CA  . VAL B 1 19 ? 5.142   8.345   10.246  1.00 22.94 ?  19  VAL B CA  1 
ATOM   692  C  C   . VAL B 1 19 ? 3.809   8.920   10.730  1.00 24.31 ?  19  VAL B C   1 
ATOM   693  O  O   . VAL B 1 19 ? 3.241   8.433   11.706  1.00 24.41 ?  19  VAL B O   1 
ATOM   694  C  CB  . VAL B 1 19 ? 4.869   7.076   9.394   1.00 23.54 ?  19  VAL B CB  1 
ATOM   695  C  CG1 . VAL B 1 19 ? 4.019   7.418   8.175   1.00 27.01 ?  19  VAL B CG1 1 
ATOM   696  C  CG2 . VAL B 1 19 ? 6.178   6.403   8.975   1.00 24.02 ?  19  VAL B CG2 1 
ATOM   697  N  N   . ALA B 1 20 ? 3.336   9.969   10.058  1.00 24.33 ?  20  ALA B N   1 
ATOM   698  C  CA  . ALA B 1 20 ? 1.995   10.530  10.282  1.00 26.21 ?  20  ALA B CA  1 
ATOM   699  C  C   . ALA B 1 20 ? 1.718   10.914  11.739  1.00 26.13 ?  20  ALA B C   1 
ATOM   700  O  O   . ALA B 1 20 ? 0.606   10.730  12.240  1.00 27.84 ?  20  ALA B O   1 
ATOM   701  C  CB  . ALA B 1 20 ? 0.933   9.547   9.794   1.00 25.34 ?  20  ALA B CB  1 
ATOM   702  N  N   . GLY B 1 21 ? 2.733   11.450  12.411  1.00 28.10 ?  21  GLY B N   1 
ATOM   703  C  CA  . GLY B 1 21 ? 2.593   11.890  13.787  1.00 28.22 ?  21  GLY B CA  1 
ATOM   704  C  C   . GLY B 1 21 ? 2.837   10.823  14.840  1.00 28.76 ?  21  GLY B C   1 
ATOM   705  O  O   . GLY B 1 21 ? 2.697   11.086  16.033  1.00 28.14 ?  21  GLY B O   1 
ATOM   706  N  N   . ALA B 1 22 ? 3.195   9.618   14.409  1.00 24.21 ?  22  ALA B N   1 
ATOM   707  C  CA  . ALA B 1 22 ? 3.466   8.530   15.346  1.00 24.84 ?  22  ALA B CA  1 
ATOM   708  C  C   . ALA B 1 22 ? 4.669   8.857   16.225  1.00 22.13 ?  22  ALA B C   1 
ATOM   709  O  O   . ALA B 1 22 ? 5.697   9.309   15.720  1.00 22.95 ?  22  ALA B O   1 
ATOM   710  C  CB  . ALA B 1 22 ? 3.704   7.223   14.592  1.00 23.25 ?  22  ALA B CB  1 
ATOM   711  N  N   . PRO B 1 23 ? 4.546   8.635   17.546  1.00 23.19 ?  23  PRO B N   1 
ATOM   712  C  CA  . PRO B 1 23 ? 5.707   8.819   18.425  1.00 23.66 ?  23  PRO B CA  1 
ATOM   713  C  C   . PRO B 1 23 ? 6.821   7.850   18.064  1.00 23.56 ?  23  PRO B C   1 
ATOM   714  O  O   . PRO B 1 23 ? 6.600   6.638   18.064  1.00 23.44 ?  23  PRO B O   1 
ATOM   715  C  CB  . PRO B 1 23 ? 5.150   8.525   19.824  1.00 25.61 ?  23  PRO B CB  1 
ATOM   716  C  CG  . PRO B 1 23 ? 3.914   7.703   19.580  1.00 24.93 ?  23  PRO B CG  1 
ATOM   717  C  CD  . PRO B 1 23 ? 3.347   8.216   18.292  1.00 23.20 ?  23  PRO B CD  1 
ATOM   718  N  N   . LYS B 1 24 ? 7.997   8.385   17.751  1.00 23.98 ?  24  LYS B N   1 
ATOM   719  C  CA  . LYS B 1 24 ? 9.133   7.571   17.326  1.00 25.52 ?  24  LYS B CA  1 
ATOM   720  C  C   . LYS B 1 24 ? 9.569   6.608   18.418  1.00 23.97 ?  24  LYS B C   1 
ATOM   721  O  O   . LYS B 1 24 ? 9.691   6.983   19.584  1.00 23.15 ?  24  LYS B O   1 
ATOM   722  C  CB  . LYS B 1 24 ? 10.306  8.465   16.909  1.00 26.30 ?  24  LYS B CB  1 
ATOM   723  C  CG  . LYS B 1 24 ? 9.993   9.324   15.695  1.00 28.40 ?  24  LYS B CG  1 
ATOM   724  C  CD  . LYS B 1 24 ? 11.000  10.446  15.506  1.00 34.06 ?  24  LYS B CD  1 
ATOM   725  C  CE  . LYS B 1 24 ? 12.362  9.920   15.091  1.00 35.25 ?  24  LYS B CE  1 
ATOM   726  N  NZ  . LYS B 1 24 ? 13.339  11.033  14.913  1.00 39.20 ?  24  LYS B NZ  1 
ATOM   727  N  N   . ALA B 1 25 ? 9.793   5.357   18.035  1.00 22.43 ?  25  ALA B N   1 
ATOM   728  C  CA  . ALA B 1 25 ? 10.300  4.378   18.978  1.00 24.33 ?  25  ALA B CA  1 
ATOM   729  C  C   . ALA B 1 25 ? 11.618  4.884   19.568  1.00 27.01 ?  25  ALA B C   1 
ATOM   730  O  O   . ALA B 1 25 ? 12.427  5.501   18.868  1.00 24.77 ?  25  ALA B O   1 
ATOM   731  C  CB  . ALA B 1 25 ? 10.481  3.025   18.305  1.00 25.52 ?  25  ALA B CB  1 
ATOM   732  N  N   . HIS B 1 26 ? 11.785  4.664   20.868  1.00 24.90 ?  26  HIS B N   1 
ATOM   733  C  CA  . HIS B 1 26 ? 13.022  4.957   21.587  1.00 27.39 ?  26  HIS B CA  1 
ATOM   734  C  C   . HIS B 1 26 ? 13.279  6.459   21.754  1.00 29.87 ?  26  HIS B C   1 
ATOM   735  O  O   . HIS B 1 26 ? 14.368  6.864   22.159  1.00 33.28 ?  26  HIS B O   1 
ATOM   736  C  CB  . HIS B 1 26 ? 14.204  4.267   20.891  1.00 29.67 ?  26  HIS B CB  1 
ATOM   737  C  CG  . HIS B 1 26 ? 13.890  2.874   20.433  1.00 27.11 ?  26  HIS B CG  1 
ATOM   738  N  ND1 . HIS B 1 26 ? 13.459  1.887   21.295  1.00 26.87 ?  26  HIS B ND1 1 
ATOM   739  C  CD2 . HIS B 1 26 ? 13.910  2.314   19.200  1.00 27.05 ?  26  HIS B CD2 1 
ATOM   740  C  CE1 . HIS B 1 26 ? 13.238  0.777   20.613  1.00 25.51 ?  26  HIS B CE1 1 
ATOM   741  N  NE2 . HIS B 1 26 ? 13.503  1.009   19.340  1.00 26.06 ?  26  HIS B NE2 1 
ATOM   742  N  N   . ASP B 1 27 ? 12.268  7.274   21.458  1.00 26.76 ?  27  ASP B N   1 
ATOM   743  C  CA  . ASP B 1 27 ? 12.307  8.706   21.760  1.00 29.37 ?  27  ASP B CA  1 
ATOM   744  C  C   . ASP B 1 27 ? 11.839  8.911   23.197  1.00 29.77 ?  27  ASP B C   1 
ATOM   745  O  O   . ASP B 1 27 ? 10.640  8.932   23.466  1.00 25.26 ?  27  ASP B O   1 
ATOM   746  C  CB  . ASP B 1 27 ? 11.427  9.501   20.788  1.00 27.57 ?  27  ASP B CB  1 
ATOM   747  C  CG  . ASP B 1 27 ? 11.488  11.013  21.026  1.00 31.83 ?  27  ASP B CG  1 
ATOM   748  O  OD1 . ASP B 1 27 ? 12.062  11.454  22.045  1.00 28.92 ?  27  ASP B OD1 1 
ATOM   749  O  OD2 . ASP B 1 27 ? 10.946  11.767  20.189  1.00 28.50 ?  27  ASP B OD2 1 
ATOM   750  N  N   . ALA B 1 28 ? 12.794  9.065   24.110  1.00 32.66 ?  28  ALA B N   1 
ATOM   751  C  CA  . ALA B 1 28 ? 12.491  9.175   25.534  1.00 33.64 ?  28  ALA B CA  1 
ATOM   752  C  C   . ALA B 1 28 ? 11.499  10.294  25.822  1.00 30.58 ?  28  ALA B C   1 
ATOM   753  O  O   . ALA B 1 28 ? 10.584  10.127  26.626  1.00 30.59 ?  28  ALA B O   1 
ATOM   754  C  CB  . ALA B 1 28 ? 13.772  9.391   26.330  1.00 35.33 ?  28  ALA B CB  1 
ATOM   755  N  N   . ALA B 1 29 ? 11.679  11.426  25.149  1.00 32.26 ?  29  ALA B N   1 
ATOM   756  C  CA  . ALA B 1 29 ? 10.854  12.610  25.382  1.00 30.63 ?  29  ALA B CA  1 
ATOM   757  C  C   . ALA B 1 29 ? 9.386   12.388  25.018  1.00 30.72 ?  29  ALA B C   1 
ATOM   758  O  O   . ALA B 1 29 ? 8.492   12.988  25.612  1.00 32.46 ?  29  ALA B O   1 
ATOM   759  C  CB  . ALA B 1 29 ? 11.407  13.796  24.603  1.00 32.43 ?  29  ALA B CB  1 
ATOM   760  N  N   . ALA B 1 30 ? 9.139   11.534  24.035  1.00 29.85 ?  30  ALA B N   1 
ATOM   761  C  CA  . ALA B 1 30 ? 7.774   11.249  23.621  1.00 28.76 ?  30  ALA B CA  1 
ATOM   762  C  C   . ALA B 1 30 ? 7.161   10.128  24.457  1.00 30.76 ?  30  ALA B C   1 
ATOM   763  O  O   . ALA B 1 30 ? 5.951   10.108  24.697  1.00 29.33 ?  30  ALA B O   1 
ATOM   764  C  CB  . ALA B 1 30 ? 7.734   10.896  22.139  1.00 28.92 ?  30  ALA B CB  1 
ATOM   765  N  N   . TRP B 1 31 ? 7.990   9.196   24.911  1.00 29.40 ?  31  TRP B N   1 
ATOM   766  C  CA  . TRP B 1 31 ? 7.453   8.019   25.583  1.00 30.11 ?  31  TRP B CA  1 
ATOM   767  C  C   . TRP B 1 31 ? 7.363   8.158   27.100  1.00 29.68 ?  31  TRP B C   1 
ATOM   768  O  O   . TRP B 1 31 ? 6.517   7.515   27.721  1.00 29.63 ?  31  TRP B O   1 
ATOM   769  C  CB  . TRP B 1 31 ? 8.274   6.782   25.208  1.00 29.83 ?  31  TRP B CB  1 
ATOM   770  C  CG  . TRP B 1 31 ? 7.929   6.329   23.830  1.00 26.98 ?  31  TRP B CG  1 
ATOM   771  C  CD1 . TRP B 1 31 ? 8.636   6.566   22.687  1.00 25.92 ?  31  TRP B CD1 1 
ATOM   772  C  CD2 . TRP B 1 31 ? 6.752   5.615   23.437  1.00 26.32 ?  31  TRP B CD2 1 
ATOM   773  N  NE1 . TRP B 1 31 ? 7.981   6.022   21.610  1.00 26.48 ?  31  TRP B NE1 1 
ATOM   774  C  CE2 . TRP B 1 31 ? 6.823   5.434   22.042  1.00 23.04 ?  31  TRP B CE2 1 
ATOM   775  C  CE3 . TRP B 1 31 ? 5.651   5.099   24.133  1.00 26.41 ?  31  TRP B CE3 1 
ATOM   776  C  CZ2 . TRP B 1 31 ? 5.835   4.759   21.328  1.00 22.39 ?  31  TRP B CZ2 1 
ATOM   777  C  CZ3 . TRP B 1 31 ? 4.671   4.428   23.422  1.00 23.15 ?  31  TRP B CZ3 1 
ATOM   778  C  CH2 . TRP B 1 31 ? 4.770   4.262   22.031  1.00 23.18 ?  31  TRP B CH2 1 
ATOM   779  N  N   . GLU B 1 32 ? 8.209   8.999   27.692  1.00 30.07 ?  32  GLU B N   1 
ATOM   780  C  CA  . GLU B 1 32 ? 8.180   9.185   29.146  1.00 32.67 ?  32  GLU B CA  1 
ATOM   781  C  C   . GLU B 1 32 ? 6.802   9.614   29.672  1.00 30.39 ?  32  GLU B C   1 
ATOM   782  O  O   . GLU B 1 32 ? 6.308   9.026   30.633  1.00 30.53 ?  32  GLU B O   1 
ATOM   783  C  CB  . GLU B 1 32 ? 9.233   10.199  29.603  1.00 34.42 ?  32  GLU B CB  1 
ATOM   784  C  CG  . GLU B 1 32 ? 9.220   10.407  31.116  1.00 38.54 ?  32  GLU B CG  1 
ATOM   785  C  CD  . GLU B 1 32 ? 9.610   11.813  31.536  1.00 44.12 ?  32  GLU B CD  1 
ATOM   786  O  OE1 . GLU B 1 32 ? 10.193  12.545  30.706  1.00 40.41 ?  32  GLU B OE1 1 
ATOM   787  O  OE2 . GLU B 1 32 ? 9.328   12.183  32.701  1.00 47.17 ?  32  GLU B OE2 1 
ATOM   788  N  N   . PRO B 1 33 ? 6.170   10.632  29.055  1.00 31.83 ?  33  PRO B N   1 
ATOM   789  C  CA  . PRO B 1 33 ? 4.837   10.932  29.585  1.00 28.33 ?  33  PRO B CA  1 
ATOM   790  C  C   . PRO B 1 33 ? 3.823   9.836   29.270  1.00 29.35 ?  33  PRO B C   1 
ATOM   791  O  O   . PRO B 1 33 ? 2.882   9.630   30.039  1.00 29.06 ?  33  PRO B O   1 
ATOM   792  C  CB  . PRO B 1 33 ? 4.463   12.242  28.883  1.00 29.70 ?  33  PRO B CB  1 
ATOM   793  C  CG  . PRO B 1 33 ? 5.274   12.255  27.643  1.00 27.98 ?  33  PRO B CG  1 
ATOM   794  C  CD  . PRO B 1 33 ? 6.565   11.588  28.003  1.00 31.32 ?  33  PRO B CD  1 
ATOM   795  N  N   . ARG B 1 34 ? 4.014   9.137   28.156  1.00 30.51 ?  34  ARG B N   1 
ATOM   796  C  CA  . ARG B 1 34 ? 3.087   8.082   27.759  1.00 27.77 ?  34  ARG B CA  1 
ATOM   797  C  C   . ARG B 1 34 ? 3.112   6.931   28.758  1.00 27.95 ?  34  ARG B C   1 
ATOM   798  O  O   . ARG B 1 34 ? 2.060   6.418   29.154  1.00 27.62 ?  34  ARG B O   1 
ATOM   799  C  CB  . ARG B 1 34 ? 3.413   7.588   26.346  1.00 27.85 ?  34  ARG B CB  1 
ATOM   800  C  CG  . ARG B 1 34 ? 2.905   8.536   25.271  1.00 29.84 ?  34  ARG B CG  1 
ATOM   801  C  CD  . ARG B 1 34 ? 3.247   8.089   23.867  1.00 25.26 ?  34  ARG B CD  1 
ATOM   802  N  NE  . ARG B 1 34 ? 2.563   8.909   22.871  1.00 27.24 ?  34  ARG B NE  1 
ATOM   803  C  CZ  . ARG B 1 34 ? 3.061   10.024  22.343  1.00 26.94 ?  34  ARG B CZ  1 
ATOM   804  N  NH1 . ARG B 1 34 ? 2.359   10.699  21.445  1.00 29.55 ?  34  ARG B NH1 1 
ATOM   805  N  NH2 . ARG B 1 34 ? 4.260   10.462  22.709  1.00 27.38 ?  34  ARG B NH2 1 
ATOM   806  N  N   . ILE B 1 35 ? 4.313   6.547   29.177  1.00 26.52 ?  35  ILE B N   1 
ATOM   807  C  CA  . ILE B 1 35 ? 4.482   5.524   30.203  1.00 29.22 ?  35  ILE B CA  1 
ATOM   808  C  C   . ILE B 1 35 ? 3.840   5.965   31.520  1.00 30.39 ?  35  ILE B C   1 
ATOM   809  O  O   . ILE B 1 35 ? 3.287   5.147   32.259  1.00 31.27 ?  35  ILE B O   1 
ATOM   810  C  CB  . ILE B 1 35 ? 5.977   5.201   30.427  1.00 27.76 ?  35  ILE B CB  1 
ATOM   811  C  CG1 . ILE B 1 35 ? 6.561   4.536   29.179  1.00 29.41 ?  35  ILE B CG1 1 
ATOM   812  C  CG2 . ILE B 1 35 ? 6.172   4.289   31.630  1.00 28.89 ?  35  ILE B CG2 1 
ATOM   813  C  CD1 . ILE B 1 35 ? 5.812   3.273   28.750  1.00 30.54 ?  35  ILE B CD1 1 
ATOM   814  N  N   . ALA B 1 36 ? 3.897   7.266   31.793  1.00 33.74 ?  36  ALA B N   1 
ATOM   815  C  CA  . ALA B 1 36 ? 3.340   7.833   33.023  1.00 30.50 ?  36  ALA B CA  1 
ATOM   816  C  C   . ALA B 1 36 ? 1.827   7.656   33.102  1.00 31.24 ?  36  ALA B C   1 
ATOM   817  O  O   . ALA B 1 36 ? 1.248   7.695   34.188  1.00 30.28 ?  36  ALA B O   1 
ATOM   818  C  CB  . ALA B 1 36 ? 3.701   9.305   33.132  1.00 31.20 ?  36  ALA B CB  1 
ATOM   819  N  N   . GLN B 1 37 ? 1.194   7.452   31.952  1.00 30.25 ?  37  GLN B N   1 
ATOM   820  C  CA  . GLN B 1 37 ? -0.258  7.317   31.885  1.00 31.57 ?  37  GLN B CA  1 
ATOM   821  C  C   . GLN B 1 37 ? -0.711  5.898   32.211  1.00 33.34 ?  37  GLN B C   1 
ATOM   822  O  O   . GLN B 1 37 ? -1.906  5.637   32.374  1.00 33.79 ?  37  GLN B O   1 
ATOM   823  C  CB  . GLN B 1 37 ? -0.764  7.720   30.499  1.00 30.84 ?  37  GLN B CB  1 
ATOM   824  C  CG  . GLN B 1 37 ? -0.356  9.123   30.075  1.00 27.75 ?  37  GLN B CG  1 
ATOM   825  C  CD  . GLN B 1 37 ? -0.715  9.432   28.629  1.00 30.93 ?  37  GLN B CD  1 
ATOM   826  O  OE1 . GLN B 1 37 ? -1.523  8.736   28.012  1.00 29.36 ?  37  GLN B OE1 1 
ATOM   827  N  NE2 . GLN B 1 37 ? -0.109  10.485  28.082  1.00 30.06 ?  37  GLN B NE2 1 
ATOM   828  N  N   . GLY B 1 38 ? 0.246   4.981   32.298  1.00 34.00 ?  38  GLY B N   1 
ATOM   829  C  CA  . GLY B 1 38 ? -0.058  3.593   32.593  1.00 32.39 ?  38  GLY B CA  1 
ATOM   830  C  C   . GLY B 1 38 ? -0.037  2.736   31.345  1.00 32.67 ?  38  GLY B C   1 
ATOM   831  O  O   . GLY B 1 38 ? -0.639  3.089   30.331  1.00 32.20 ?  38  GLY B O   1 
ATOM   832  N  N   . LEU B 1 39 ? 0.654   1.603   31.416  1.00 31.46 ?  39  LEU B N   1 
ATOM   833  C  CA  . LEU B 1 39 ? 0.790   0.726   30.258  1.00 30.07 ?  39  LEU B CA  1 
ATOM   834  C  C   . LEU B 1 39 ? -0.553  0.197   29.756  1.00 30.66 ?  39  LEU B C   1 
ATOM   835  O  O   . LEU B 1 39 ? -0.772  0.102   28.547  1.00 31.91 ?  39  LEU B O   1 
ATOM   836  C  CB  . LEU B 1 39 ? 1.720   -0.447  30.588  1.00 33.21 ?  39  LEU B CB  1 
ATOM   837  C  CG  . LEU B 1 39 ? 3.220   -0.137  30.612  1.00 32.17 ?  39  LEU B CG  1 
ATOM   838  C  CD1 . LEU B 1 39 ? 4.010   -1.313  31.170  1.00 32.92 ?  39  LEU B CD1 1 
ATOM   839  C  CD2 . LEU B 1 39 ? 3.718   0.221   29.218  1.00 30.93 ?  39  LEU B CD2 1 
ATOM   840  N  N   . ASP B 1 40 ? -1.451  -0.140  30.678  1.00 30.83 ?  40  ASP B N   1 
ATOM   841  C  CA  . ASP B 1 40 ? -2.708  -0.784  30.305  1.00 32.56 ?  40  ASP B CA  1 
ATOM   842  C  C   . ASP B 1 40 ? -3.610  0.146   29.509  1.00 32.09 ?  40  ASP B C   1 
ATOM   843  O  O   . ASP B 1 40 ? -4.400  -0.308  28.675  1.00 30.56 ?  40  ASP B O   1 
ATOM   844  C  CB  . ASP B 1 40 ? -3.452  -1.284  31.544  1.00 35.88 ?  40  ASP B CB  1 
ATOM   845  C  CG  . ASP B 1 40 ? -2.734  -2.424  32.233  1.00 37.94 ?  40  ASP B CG  1 
ATOM   846  O  OD1 . ASP B 1 40 ? -1.903  -3.095  31.584  1.00 41.11 ?  40  ASP B OD1 1 
ATOM   847  O  OD2 . ASP B 1 40 ? -3.008  -2.651  33.427  1.00 40.77 ?  40  ASP B OD2 1 
ATOM   848  N  N   . THR B 1 41 ? -3.497  1.444   29.773  1.00 30.59 ?  41  THR B N   1 
ATOM   849  C  CA  . THR B 1 41 ? -4.254  2.428   29.017  1.00 29.19 ?  41  THR B CA  1 
ATOM   850  C  C   . THR B 1 41 ? -3.716  2.494   27.595  1.00 29.66 ?  41  THR B C   1 
ATOM   851  O  O   . THR B 1 41 ? -4.478  2.591   26.637  1.00 29.13 ?  41  THR B O   1 
ATOM   852  C  CB  . THR B 1 41 ? -4.189  3.827   29.659  1.00 31.74 ?  41  THR B CB  1 
ATOM   853  O  OG1 . THR B 1 41 ? -2.856  4.342   29.555  1.00 31.09 ?  41  THR B OG1 1 
ATOM   854  C  CG2 . THR B 1 41 ? -4.605  3.767   31.127  1.00 29.70 ?  41  THR B CG2 1 
ATOM   855  N  N   . LEU B 1 42 ? -2.394  2.430   27.468  1.00 28.27 ?  42  LEU B N   1 
ATOM   856  C  CA  . LEU B 1 42 ? -1.749  2.453   26.163  1.00 28.52 ?  42  LEU B CA  1 
ATOM   857  C  C   . LEU B 1 42 ? -2.119  1.206   25.368  1.00 25.91 ?  42  LEU B C   1 
ATOM   858  O  O   . LEU B 1 42 ? -2.357  1.279   24.161  1.00 24.29 ?  42  LEU B O   1 
ATOM   859  C  CB  . LEU B 1 42 ? -0.228  2.558   26.311  1.00 27.15 ?  42  LEU B CB  1 
ATOM   860  C  CG  . LEU B 1 42 ? 0.323   3.822   26.975  1.00 28.81 ?  42  LEU B CG  1 
ATOM   861  C  CD1 . LEU B 1 42 ? 1.813   3.683   27.246  1.00 25.15 ?  42  LEU B CD1 1 
ATOM   862  C  CD2 . LEU B 1 42 ? 0.046   5.051   26.116  1.00 26.39 ?  42  LEU B CD2 1 
ATOM   863  N  N   . VAL B 1 43 ? -2.165  0.068   26.056  1.00 26.36 ?  43  VAL B N   1 
ATOM   864  C  CA  . VAL B 1 43 ? -2.539  -1.200  25.435  1.00 26.51 ?  43  VAL B CA  1 
ATOM   865  C  C   . VAL B 1 43 ? -3.951  -1.139  24.851  1.00 28.98 ?  43  VAL B C   1 
ATOM   866  O  O   . VAL B 1 43 ? -4.187  -1.599  23.729  1.00 29.49 ?  43  VAL B O   1 
ATOM   867  C  CB  . VAL B 1 43 ? -2.443  -2.364  26.438  1.00 26.91 ?  43  VAL B CB  1 
ATOM   868  C  CG1 . VAL B 1 43 ? -3.084  -3.625  25.868  1.00 30.36 ?  43  VAL B CG1 1 
ATOM   869  C  CG2 . VAL B 1 43 ? -0.994  -2.620  26.803  1.00 29.69 ?  43  VAL B CG2 1 
ATOM   870  N  N   . SER B 1 44 ? -4.882  -0.557  25.604  1.00 27.75 ?  44  SER B N   1 
ATOM   871  C  CA  . SER B 1 44 ? -6.258  -0.403  25.129  1.00 27.73 ?  44  SER B CA  1 
ATOM   872  C  C   . SER B 1 44 ? -6.311  0.388   23.819  1.00 28.30 ?  44  SER B C   1 
ATOM   873  O  O   . SER B 1 44 ? -6.928  -0.048  22.848  1.00 30.87 ?  44  SER B O   1 
ATOM   874  C  CB  . SER B 1 44 ? -7.120  0.276   26.198  1.00 30.37 ?  44  SER B CB  1 
ATOM   875  O  OG  . SER B 1 44 ? -8.461  0.434   25.761  1.00 29.83 ?  44  SER B OG  1 
ATOM   876  N  N   . THR B 1 45 ? -5.636  1.535   23.795  1.00 29.02 ?  45  THR B N   1 
ATOM   877  C  CA  . THR B 1 45 ? -5.602  2.412   22.621  1.00 30.31 ?  45  THR B CA  1 
ATOM   878  C  C   . THR B 1 45 ? -5.103  1.706   21.354  1.00 31.24 ?  45  THR B C   1 
ATOM   879  O  O   . THR B 1 45 ? -5.612  1.954   20.253  1.00 29.52 ?  45  THR B O   1 
ATOM   880  C  CB  . THR B 1 45 ? -4.716  3.649   22.890  1.00 30.89 ?  45  THR B CB  1 
ATOM   881  O  OG1 . THR B 1 45 ? -5.232  4.368   24.018  1.00 30.70 ?  45  THR B OG1 1 
ATOM   882  C  CG2 . THR B 1 45 ? -4.682  4.573   21.678  1.00 32.07 ?  45  THR B CG2 1 
ATOM   883  N  N   . VAL B 1 46 ? -4.118  0.824   21.509  1.00 27.42 ?  46  VAL B N   1 
ATOM   884  C  CA  . VAL B 1 46 ? -3.606  0.053   20.375  1.00 26.77 ?  46  VAL B CA  1 
ATOM   885  C  C   . VAL B 1 46 ? -4.635  -0.954  19.883  1.00 27.08 ?  46  VAL B C   1 
ATOM   886  O  O   . VAL B 1 46 ? -4.876  -1.072  18.685  1.00 29.39 ?  46  VAL B O   1 
ATOM   887  C  CB  . VAL B 1 46 ? -2.313  -0.703  20.732  1.00 27.24 ?  46  VAL B CB  1 
ATOM   888  C  CG1 . VAL B 1 46 ? -1.785  -1.464  19.519  1.00 27.86 ?  46  VAL B CG1 1 
ATOM   889  C  CG2 . VAL B 1 46 ? -1.274  0.262   21.233  1.00 26.79 ?  46  VAL B CG2 1 
ATOM   890  N  N   . LYS B 1 47 ? -5.234  -1.683  20.818  1.00 28.06 ?  47  LYS B N   1 
ATOM   891  C  CA  . LYS B 1 47 ? -6.220  -2.707  20.478  1.00 30.36 ?  47  LYS B CA  1 
ATOM   892  C  C   . LYS B 1 47 ? -7.400  -2.127  19.707  1.00 30.99 ?  47  LYS B C   1 
ATOM   893  O  O   . LYS B 1 47 ? -7.844  -2.703  18.712  1.00 34.13 ?  47  LYS B O   1 
ATOM   894  C  CB  . LYS B 1 47 ? -6.717  -3.409  21.740  1.00 30.76 ?  47  LYS B CB  1 
ATOM   895  C  CG  . LYS B 1 47 ? -5.674  -4.300  22.376  1.00 33.72 ?  47  LYS B CG  1 
ATOM   896  C  CD  . LYS B 1 47 ? -6.107  -4.758  23.751  1.00 35.51 ?  47  LYS B CD  1 
ATOM   897  C  CE  . LYS B 1 47 ? -7.387  -5.561  23.689  1.00 35.43 ?  47  LYS B CE  1 
ATOM   898  N  NZ  . LYS B 1 47 ? -7.719  -6.106  25.034  1.00 37.21 ?  47  LYS B NZ  1 
ATOM   899  N  N   . THR B 1 48 ? -7.868  -0.984  20.140  1.00 30.95 ?  48  THR B N   1 
ATOM   900  C  CA  . THR B 1 48 ? -8.960  -0.314  19.496  1.00 31.46 ?  48  THR B CA  1 
ATOM   901  C  C   . THR B 1 48 ? -8.518  0.521   18.344  1.00 35.01 ?  48  THR B C   1 
ATOM   902  O  O   . THR B 1 48 ? -7.393  0.886   18.235  1.00 34.28 ?  48  THR B O   1 
ATOM   903  C  CB  . THR B 1 48 ? -9.722  0.642   20.435  1.00 31.64 ?  48  THR B CB  1 
ATOM   904  O  OG1 . THR B 1 48 ? -8.848  1.628   20.885  1.00 33.47 ?  48  THR B OG1 1 
ATOM   905  C  CG2 . THR B 1 48 ? -10.314 -0.064  21.608  1.00 29.71 ?  48  THR B CG2 1 
ATOM   906  N  N   . GLY B 1 49 ? -9.448  0.844   17.474  1.00 36.54 ?  49  GLY B N   1 
ATOM   907  C  CA  . GLY B 1 49 ? -9.121  1.648   16.306  1.00 39.10 ?  49  GLY B CA  1 
ATOM   908  C  C   . GLY B 1 49 ? -9.049  3.138   16.579  1.00 40.55 ?  49  GLY B C   1 
ATOM   909  O  O   . GLY B 1 49 ? -9.269  3.902   15.706  1.00 42.69 ?  49  GLY B O   1 
ATOM   910  N  N   . LYS B 1 50 ? -8.711  3.469   17.800  1.00 38.67 ?  50  LYS B N   1 
ATOM   911  C  CA  . LYS B 1 50 ? -8.805  4.799   18.337  1.00 41.71 ?  50  LYS B CA  1 
ATOM   912  C  C   . LYS B 1 50 ? -8.032  5.796   17.484  1.00 42.02 ?  50  LYS B C   1 
ATOM   913  O  O   . LYS B 1 50 ? -6.832  5.774   17.440  1.00 40.80 ?  50  LYS B O   1 
ATOM   914  C  CB  . LYS B 1 50 ? -8.319  4.770   19.787  1.00 39.38 ?  50  LYS B CB  1 
ATOM   915  C  CG  . LYS B 1 50 ? -7.954  6.086   20.368  1.00 40.16 ?  50  LYS B CG  1 
ATOM   916  C  CD  . LYS B 1 50 ? -9.147  6.916   20.713  1.00 41.11 ?  50  LYS B CD  1 
ATOM   917  C  CE  . LYS B 1 50 ? -8.973  7.693   21.994  1.00 39.72 ?  50  LYS B CE  1 
ATOM   918  N  NZ  . LYS B 1 50 ? -9.317  6.838   23.137  1.00 38.70 ?  50  LYS B NZ  1 
ATOM   919  N  N   . GLY B 1 51 ? -8.777  6.641   16.786  1.00 44.60 ?  51  GLY B N   1 
ATOM   920  C  CA  . GLY B 1 51 ? -8.244  7.659   15.905  1.00 42.44 ?  51  GLY B CA  1 
ATOM   921  C  C   . GLY B 1 51 ? -7.860  7.235   14.498  1.00 45.20 ?  51  GLY B C   1 
ATOM   922  O  O   . GLY B 1 51 ? -6.752  7.539   14.055  1.00 44.13 ?  51  GLY B O   1 
ATOM   923  N  N   . ALA B 1 52 ? -8.796  6.613   13.786  1.00 44.75 ?  52  ALA B N   1 
ATOM   924  C  CA  . ALA B 1 52 ? -8.592  6.250   12.389  1.00 45.05 ?  52  ALA B CA  1 
ATOM   925  C  C   . ALA B 1 52 ? -7.354  5.384   12.253  1.00 44.52 ?  52  ALA B C   1 
ATOM   926  O  O   . ALA B 1 52 ? -6.725  5.331   11.195  1.00 45.94 ?  52  ALA B O   1 
ATOM   927  C  CB  . ALA B 1 52 ? -8.468  7.498   11.528  1.00 47.07 ?  52  ALA B CB  1 
ATOM   928  N  N   . MET B 1 53 ? -7.011  4.708   13.341  1.00 42.33 ?  53  MET B N   1 
ATOM   929  C  CA  . MET B 1 53 ? -5.835  3.860   13.379  1.00 41.44 ?  53  MET B CA  1 
ATOM   930  C  C   . MET B 1 53 ? -6.121  2.388   13.185  1.00 39.37 ?  53  MET B C   1 
ATOM   931  O  O   . MET B 1 53 ? -7.220  1.949   13.354  1.00 40.74 ?  53  MET B O   1 
ATOM   932  C  CB  . MET B 1 53 ? -5.101  4.047   14.689  1.00 38.12 ?  53  MET B CB  1 
ATOM   933  C  CG  . MET B 1 53 ? -4.428  5.377   14.794  1.00 41.19 ?  53  MET B CG  1 
ATOM   934  S  SD  . MET B 1 53 ? -3.192  5.427   13.535  1.00 45.54 ?  53  MET B SD  1 
ATOM   935  C  CE  . MET B 1 53 ? -3.936  6.495   12.325  1.00 42.37 ?  53  MET B CE  1 
ATOM   936  N  N   . PRO B 1 54 ? -5.121  1.606   12.802  1.00 38.88 ?  54  PRO B N   1 
ATOM   937  C  CA  . PRO B 1 54 ? -5.368  0.178   12.567  1.00 36.02 ?  54  PRO B CA  1 
ATOM   938  C  C   . PRO B 1 54 ? -5.573  -0.590  13.873  1.00 37.22 ?  54  PRO B C   1 
ATOM   939  O  O   . PRO B 1 54 ? -4.589  -0.829  14.572  1.00 37.67 ?  54  PRO B O   1 
ATOM   940  C  CB  . PRO B 1 54 ? -4.082  -0.286  11.881  1.00 37.06 ?  54  PRO B CB  1 
ATOM   941  C  CG  . PRO B 1 54 ? -3.565  0.934   11.198  1.00 37.77 ?  54  PRO B CG  1 
ATOM   942  C  CD  . PRO B 1 54 ? -3.922  2.087   12.093  1.00 39.52 ?  54  PRO B CD  1 
ATOM   943  N  N   . PRO B 1 55 ? -6.807  -0.973  14.205  1.00 36.84 ?  55  PRO B N   1 
ATOM   944  C  CA  . PRO B 1 55 ? -7.007  -1.718  15.449  1.00 33.48 ?  55  PRO B CA  1 
ATOM   945  C  C   . PRO B 1 55 ? -6.002  -2.855  15.539  1.00 32.33 ?  55  PRO B C   1 
ATOM   946  O  O   . PRO B 1 55 ? -5.923  -3.680  14.633  1.00 32.99 ?  55  PRO B O   1 
ATOM   947  C  CB  . PRO B 1 55 ? -8.441  -2.249  15.325  1.00 36.76 ?  55  PRO B CB  1 
ATOM   948  C  CG  . PRO B 1 55 ? -9.093  -1.361  14.320  1.00 36.31 ?  55  PRO B CG  1 
ATOM   949  C  CD  . PRO B 1 55 ? -8.012  -0.973  13.359  1.00 37.00 ?  55  PRO B CD  1 
ATOM   950  N  N   . GLY B 1 56 ? -5.219  -2.877  16.608  1.00 31.34 ?  56  GLY B N   1 
ATOM   951  C  CA  . GLY B 1 56 ? -4.213  -3.905  16.770  1.00 29.22 ?  56  GLY B CA  1 
ATOM   952  C  C   . GLY B 1 56 ? -2.826  -3.494  16.318  1.00 26.73 ?  56  GLY B C   1 
ATOM   953  O  O   . GLY B 1 56 ? -1.866  -4.243  16.499  1.00 27.29 ?  56  GLY B O   1 
ATOM   954  N  N   . GLY B 1 57 ? -2.721  -2.307  15.726  1.00 28.30 ?  57  GLY B N   1 
ATOM   955  C  CA  . GLY B 1 57 ? -1.444  -1.781  15.272  1.00 25.88 ?  57  GLY B CA  1 
ATOM   956  C  C   . GLY B 1 57 ? -0.709  -2.691  14.302  1.00 24.84 ?  57  GLY B C   1 
ATOM   957  O  O   . GLY B 1 57 ? 0.502   -2.856  14.402  1.00 21.72 ?  57  GLY B O   1 
ATOM   958  N  N   . MET B 1 58 ? -1.459  -3.279  13.374  1.00 23.78 ?  58  MET B N   1 
ATOM   959  C  CA  . MET B 1 58 ? -0.944  -4.204  12.355  1.00 25.48 ?  58  MET B CA  1 
ATOM   960  C  C   . MET B 1 58 ? -0.348  -5.487  12.930  1.00 24.79 ?  58  MET B C   1 
ATOM   961  O  O   . MET B 1 58 ? 0.411   -6.177  12.256  1.00 19.78 ?  58  MET B O   1 
ATOM   962  C  CB  . MET B 1 58 ? 0.090   -3.512  11.454  1.00 24.31 ?  58  MET B CB  1 
ATOM   963  C  CG  . MET B 1 58 ? -0.510  -2.438  10.553  1.00 24.79 ?  58  MET B CG  1 
ATOM   964  S  SD  . MET B 1 58 ? -1.828  -3.057  9.476   1.00 28.89 ?  58  MET B SD  1 
ATOM   965  C  CE  . MET B 1 58 ? -0.878  -3.829  8.167   1.00 22.46 ?  58  MET B CE  1 
ATOM   966  N  N   . CYS B 1 59 ? -0.701  -5.821  14.167  1.00 25.83 ?  59  CYS B N   1 
ATOM   967  C  CA  . CYS B 1 59 ? -0.374  -7.141  14.693  1.00 26.14 ?  59  CYS B CA  1 
ATOM   968  C  C   . CYS B 1 59 ? -1.630  -8.014  14.706  1.00 24.88 ?  59  CYS B C   1 
ATOM   969  O  O   . CYS B 1 59 ? -2.655  -7.629  15.267  1.00 27.33 ?  59  CYS B O   1 
ATOM   970  C  CB  . CYS B 1 59 ? 0.225   -7.047  16.095  1.00 26.52 ?  59  CYS B CB  1 
ATOM   971  S  SG  . CYS B 1 59 ? 0.654   -8.664  16.774  1.00 24.79 ?  59  CYS B SG  1 
ATOM   972  N  N   . THR B 1 60 ? -1.544  -9.187  14.082  1.00 25.84 ?  60  THR B N   1 
ATOM   973  C  CA  . THR B 1 60 ? -2.713  -10.043 13.895  1.00 28.26 ?  60  THR B CA  1 
ATOM   974  C  C   . THR B 1 60 ? -2.847  -11.139 14.955  1.00 28.54 ?  60  THR B C   1 
ATOM   975  O  O   . THR B 1 60 ? -3.835  -11.868 14.970  1.00 27.48 ?  60  THR B O   1 
ATOM   976  C  CB  . THR B 1 60 ? -2.701  -10.719 12.499  1.00 26.69 ?  60  THR B CB  1 
ATOM   977  O  OG1 . THR B 1 60 ? -1.561  -11.583 12.380  1.00 28.94 ?  60  THR B OG1 1 
ATOM   978  C  CG2 . THR B 1 60 ? -2.652  -9.678  11.398  1.00 26.11 ?  60  THR B CG2 1 
ATOM   979  N  N   . ASP B 1 61 ? -1.864  -11.252 15.842  1.00 28.72 ?  61  ASP B N   1 
ATOM   980  C  CA  . ASP B 1 61 ? -1.879  -12.323 16.837  1.00 31.37 ?  61  ASP B CA  1 
ATOM   981  C  C   . ASP B 1 61 ? -1.458  -11.850 18.228  1.00 30.69 ?  61  ASP B C   1 
ATOM   982  O  O   . ASP B 1 61 ? -1.018  -12.648 19.054  1.00 28.54 ?  61  ASP B O   1 
ATOM   983  C  CB  . ASP B 1 61 ? -0.970  -13.466 16.381  1.00 27.18 ?  61  ASP B CB  1 
ATOM   984  C  CG  . ASP B 1 61 ? 0.473   -13.026 16.194  1.00 30.30 ?  61  ASP B CG  1 
ATOM   985  O  OD1 . ASP B 1 61 ? 0.727   -11.804 16.189  1.00 30.33 ?  61  ASP B OD1 1 
ATOM   986  O  OD2 . ASP B 1 61 ? 1.352   -13.901 16.044  1.00 28.35 ?  61  ASP B OD2 1 
ATOM   987  N  N   . CYS B 1 62 ? -1.607  -10.553 18.484  1.00 29.86 ?  62  CYS B N   1 
ATOM   988  C  CA  . CYS B 1 62 ? -1.103  -9.951  19.714  1.00 29.01 ?  62  CYS B CA  1 
ATOM   989  C  C   . CYS B 1 62 ? -2.112  -9.966  20.859  1.00 30.04 ?  62  CYS B C   1 
ATOM   990  O  O   . CYS B 1 62 ? -3.237  -9.469  20.737  1.00 27.65 ?  62  CYS B O   1 
ATOM   991  C  CB  . CYS B 1 62 ? -0.653  -8.511  19.453  1.00 29.03 ?  62  CYS B CB  1 
ATOM   992  S  SG  . CYS B 1 62 ? 1.001   -8.343  18.738  1.00 25.58 ?  62  CYS B SG  1 
ATOM   993  N  N   . THR B 1 63 ? -1.680  -10.543 21.975  1.00 30.70 ?  63  THR B N   1 
ATOM   994  C  CA  . THR B 1 63 ? -2.435  -10.525 23.219  1.00 32.02 ?  63  THR B CA  1 
ATOM   995  C  C   . THR B 1 63 ? -2.209  -9.207  23.946  1.00 31.43 ?  63  THR B C   1 
ATOM   996  O  O   . THR B 1 63 ? -1.382  -8.397  23.523  1.00 30.04 ?  63  THR B O   1 
ATOM   997  C  CB  . THR B 1 63 ? -2.023  -11.678 24.136  1.00 31.17 ?  63  THR B CB  1 
ATOM   998  O  OG1 . THR B 1 63 ? -0.625  -11.564 24.440  1.00 28.23 ?  63  THR B OG1 1 
ATOM   999  C  CG2 . THR B 1 63 ? -2.278  -13.008 23.447  1.00 31.06 ?  63  THR B CG2 1 
ATOM   1000 N  N   . ASP B 1 64 ? -2.936  -9.001  25.040  1.00 31.62 ?  64  ASP B N   1 
ATOM   1001 C  CA  . ASP B 1 64 ? -2.734  -7.820  25.879  1.00 31.18 ?  64  ASP B CA  1 
ATOM   1002 C  C   . ASP B 1 64 ? -1.294  -7.751  26.361  1.00 30.79 ?  64  ASP B C   1 
ATOM   1003 O  O   . ASP B 1 64 ? -0.689  -6.681  26.412  1.00 31.09 ?  64  ASP B O   1 
ATOM   1004 C  CB  . ASP B 1 64 ? -3.691  -7.833  27.072  1.00 33.47 ?  64  ASP B CB  1 
ATOM   1005 C  CG  . ASP B 1 64 ? -5.071  -7.317  26.716  1.00 35.29 ?  64  ASP B CG  1 
ATOM   1006 O  OD1 . ASP B 1 64 ? -5.365  -7.197  25.508  1.00 35.80 ?  64  ASP B OD1 1 
ATOM   1007 O  OD2 . ASP B 1 64 ? -5.863  -7.035  27.640  1.00 36.60 ?  64  ASP B OD2 1 
ATOM   1008 N  N   . GLU B 1 65 ? -0.744  -8.907  26.703  1.00 31.57 ?  65  GLU B N   1 
ATOM   1009 C  CA  . GLU B 1 65 ? 0.628   -8.988  27.179  1.00 32.71 ?  65  GLU B CA  1 
ATOM   1010 C  C   . GLU B 1 65 ? 1.625   -8.671  26.061  1.00 30.47 ?  65  GLU B C   1 
ATOM   1011 O  O   . GLU B 1 65 ? 2.645   -8.031  26.297  1.00 29.63 ?  65  GLU B O   1 
ATOM   1012 C  CB  . GLU B 1 65 ? 0.911   -10.377 27.769  1.00 32.64 ?  65  GLU B CB  1 
ATOM   1013 C  CG  . GLU B 1 65 ? 0.101   -10.713 29.030  1.00 33.52 ?  65  GLU B CG  1 
ATOM   1014 C  CD  . GLU B 1 65 ? -1.357  -11.071 28.742  1.00 35.56 ?  65  GLU B CD  1 
ATOM   1015 O  OE1 . GLU B 1 65 ? -1.704  -11.296 27.565  1.00 35.34 ?  65  GLU B OE1 1 
ATOM   1016 O  OE2 . GLU B 1 65 ? -2.163  -11.126 29.696  1.00 38.34 ?  65  GLU B OE2 1 
ATOM   1017 N  N   . ASP B 1 66 ? 1.328   -9.118  24.844  1.00 29.86 ?  66  ASP B N   1 
ATOM   1018 C  CA  . ASP B 1 66 ? 2.205   -8.853  23.704  1.00 30.65 ?  66  ASP B CA  1 
ATOM   1019 C  C   . ASP B 1 66 ? 2.287   -7.359  23.376  1.00 27.88 ?  66  ASP B C   1 
ATOM   1020 O  O   . ASP B 1 66 ? 3.368   -6.838  23.108  1.00 25.78 ?  66  ASP B O   1 
ATOM   1021 C  CB  . ASP B 1 66 ? 1.735   -9.633  22.473  1.00 26.93 ?  66  ASP B CB  1 
ATOM   1022 C  CG  . ASP B 1 66 ? 1.863   -11.132 22.650  1.00 30.18 ?  66  ASP B CG  1 
ATOM   1023 O  OD1 . ASP B 1 66 ? 2.742   -11.563 23.423  1.00 32.48 ?  66  ASP B OD1 1 
ATOM   1024 O  OD2 . ASP B 1 66 ? 1.087   -11.877 22.019  1.00 30.05 ?  66  ASP B OD2 1 
ATOM   1025 N  N   . TYR B 1 67 ? 1.142   -6.682  23.391  1.00 28.20 ?  67  TYR B N   1 
ATOM   1026 C  CA  . TYR B 1 67 ? 1.103   -5.235  23.170  1.00 26.70 ?  67  TYR B CA  1 
ATOM   1027 C  C   . TYR B 1 67 ? 1.928   -4.507  24.219  1.00 27.42 ?  67  TYR B C   1 
ATOM   1028 O  O   . TYR B 1 67 ? 2.762   -3.660  23.890  1.00 26.76 ?  67  TYR B O   1 
ATOM   1029 C  CB  . TYR B 1 67 ? -0.333  -4.714  23.195  1.00 25.41 ?  67  TYR B CB  1 
ATOM   1030 C  CG  . TYR B 1 67 ? -1.124  -5.067  21.963  1.00 27.88 ?  67  TYR B CG  1 
ATOM   1031 C  CD1 . TYR B 1 67 ? -0.635  -4.779  20.691  1.00 26.91 ?  67  TYR B CD1 1 
ATOM   1032 C  CD2 . TYR B 1 67 ? -2.354  -5.697  22.067  1.00 29.52 ?  67  TYR B CD2 1 
ATOM   1033 C  CE1 . TYR B 1 67 ? -1.355  -5.106  19.562  1.00 27.18 ?  67  TYR B CE1 1 
ATOM   1034 C  CE2 . TYR B 1 67 ? -3.083  -6.027  20.942  1.00 30.12 ?  67  TYR B CE2 1 
ATOM   1035 C  CZ  . TYR B 1 67 ? -2.580  -5.729  19.696  1.00 28.79 ?  67  TYR B CZ  1 
ATOM   1036 O  OH  . TYR B 1 67 ? -3.310  -6.065  18.585  1.00 30.24 ?  67  TYR B OH  1 
ATOM   1037 N  N   . LYS B 1 68 ? 1.675   -4.843  25.480  1.00 28.29 ?  68  LYS B N   1 
ATOM   1038 C  CA  . LYS B 1 68 ? 2.405   -4.279  26.611  1.00 27.39 ?  68  LYS B CA  1 
ATOM   1039 C  C   . LYS B 1 68 ? 3.914   -4.411  26.415  1.00 28.31 ?  68  LYS B C   1 
ATOM   1040 O  O   . LYS B 1 68 ? 4.654   -3.443  26.573  1.00 26.88 ?  68  LYS B O   1 
ATOM   1041 C  CB  . LYS B 1 68 ? 1.959   -4.970  27.903  1.00 29.35 ?  68  LYS B CB  1 
ATOM   1042 C  CG  . LYS B 1 68 ? 2.617   -4.472  29.173  1.00 32.44 ?  68  LYS B CG  1 
ATOM   1043 C  CD  . LYS B 1 68 ? 1.981   -5.142  30.390  1.00 33.81 ?  68  LYS B CD  1 
ATOM   1044 C  CE  . LYS B 1 68 ? 2.409   -4.497  31.700  1.00 33.49 ?  68  LYS B CE  1 
ATOM   1045 N  NZ  . LYS B 1 68 ? 3.880   -4.580  31.931  1.00 41.35 ?  68  LYS B NZ  1 
ATOM   1046 N  N   . SER B 1 69 ? 4.363   -5.608  26.049  1.00 29.13 ?  69  SER B N   1 
ATOM   1047 C  CA  . SER B 1 69 ? 5.786   -5.854  25.820  1.00 28.51 ?  69  SER B CA  1 
ATOM   1048 C  C   . SER B 1 69 ? 6.336   -4.965  24.708  1.00 26.93 ?  69  SER B C   1 
ATOM   1049 O  O   . SER B 1 69 ? 7.447   -4.448  24.810  1.00 26.49 ?  69  SER B O   1 
ATOM   1050 C  CB  . SER B 1 69 ? 6.032   -7.329  25.477  1.00 29.03 ?  69  SER B CB  1 
ATOM   1051 O  OG  . SER B 1 69 ? 5.380   -8.185  26.399  1.00 32.09 ?  69  SER B OG  1 
ATOM   1052 N  N   . ALA B 1 70 ? 5.548   -4.792  23.650  1.00 27.19 ?  70  ALA B N   1 
ATOM   1053 C  CA  . ALA B 1 70 ? 5.950   -3.983  22.505  1.00 24.71 ?  70  ALA B CA  1 
ATOM   1054 C  C   . ALA B 1 70 ? 6.044   -2.504  22.869  1.00 26.04 ?  70  ALA B C   1 
ATOM   1055 O  O   . ALA B 1 70 ? 6.931   -1.798  22.381  1.00 24.04 ?  70  ALA B O   1 
ATOM   1056 C  CB  . ALA B 1 70 ? 4.974   -4.182  21.347  1.00 23.82 ?  70  ALA B CB  1 
ATOM   1057 N  N   . ILE B 1 71 ? 5.118   -2.037  23.707  1.00 26.40 ?  71  ILE B N   1 
ATOM   1058 C  CA  . ILE B 1 71 ? 5.155   -0.661  24.201  1.00 25.31 ?  71  ILE B CA  1 
ATOM   1059 C  C   . ILE B 1 71 ? 6.435   -0.412  24.990  1.00 26.57 ?  71  ILE B C   1 
ATOM   1060 O  O   . ILE B 1 71 ? 7.135   0.572   24.763  1.00 26.10 ?  71  ILE B O   1 
ATOM   1061 C  CB  . ILE B 1 71 ? 3.957   -0.328  25.118  1.00 26.46 ?  71  ILE B CB  1 
ATOM   1062 C  CG1 . ILE B 1 71 ? 2.626   -0.694  24.465  1.00 29.30 ?  71  ILE B CG1 1 
ATOM   1063 C  CG2 . ILE B 1 71 ? 3.969   1.136   25.486  1.00 25.13 ?  71  ILE B CG2 1 
ATOM   1064 C  CD1 . ILE B 1 71 ? 2.322   0.086   23.264  1.00 25.33 ?  71  ILE B CD1 1 
ATOM   1065 N  N   . GLU B 1 72 ? 6.725   -1.309  25.928  1.00 28.68 ?  72  GLU B N   1 
ATOM   1066 C  CA  . GLU B 1 72 ? 7.920   -1.188  26.752  1.00 27.03 ?  72  GLU B CA  1 
ATOM   1067 C  C   . GLU B 1 72 ? 9.168   -1.092  25.885  1.00 27.75 ?  72  GLU B C   1 
ATOM   1068 O  O   . GLU B 1 72 ? 10.037  -0.253  26.123  1.00 29.39 ?  72  GLU B O   1 
ATOM   1069 C  CB  . GLU B 1 72 ? 8.032   -2.371  27.714  1.00 29.34 ?  72  GLU B CB  1 
ATOM   1070 C  CG  . GLU B 1 72 ? 6.975   -2.391  28.806  1.00 31.97 ?  72  GLU B CG  1 
ATOM   1071 C  CD  . GLU B 1 72 ? 7.021   -3.661  29.637  1.00 35.05 ?  72  GLU B CD  1 
ATOM   1072 O  OE1 . GLU B 1 72 ? 7.799   -4.577  29.288  1.00 37.33 ?  72  GLU B OE1 1 
ATOM   1073 O  OE2 . GLU B 1 72 ? 6.279   -3.744  30.638  1.00 36.41 ?  72  GLU B OE2 1 
ATOM   1074 N  N   . TYR B 1 73 ? 9.238   -1.935  24.860  1.00 29.92 ?  73  TYR B N   1 
ATOM   1075 C  CA  . TYR B 1 73 ? 10.380  -1.924  23.956  1.00 25.78 ?  73  TYR B CA  1 
ATOM   1076 C  C   . TYR B 1 73 ? 10.536  -0.581  23.233  1.00 28.22 ?  73  TYR B C   1 
ATOM   1077 O  O   . TYR B 1 73 ? 11.642  -0.060  23.118  1.00 27.99 ?  73  TYR B O   1 
ATOM   1078 C  CB  . TYR B 1 73 ? 10.269  -3.055  22.929  1.00 29.53 ?  73  TYR B CB  1 
ATOM   1079 C  CG  . TYR B 1 73 ? 11.408  -3.032  21.941  1.00 28.47 ?  73  TYR B CG  1 
ATOM   1080 C  CD1 . TYR B 1 73 ? 12.658  -3.542  22.281  1.00 29.30 ?  73  TYR B CD1 1 
ATOM   1081 C  CD2 . TYR B 1 73 ? 11.248  -2.472  20.679  1.00 27.42 ?  73  TYR B CD2 1 
ATOM   1082 C  CE1 . TYR B 1 73 ? 13.713  -3.508  21.387  1.00 30.24 ?  73  TYR B CE1 1 
ATOM   1083 C  CE2 . TYR B 1 73 ? 12.293  -2.432  19.779  1.00 25.89 ?  73  TYR B CE2 1 
ATOM   1084 C  CZ  . TYR B 1 73 ? 13.524  -2.950  20.138  1.00 30.30 ?  73  TYR B CZ  1 
ATOM   1085 O  OH  . TYR B 1 73 ? 14.567  -2.910  19.246  1.00 32.46 ?  73  TYR B OH  1 
ATOM   1086 N  N   . MET B 1 74 ? 9.431   -0.022  22.748  1.00 26.87 ?  74  MET B N   1 
ATOM   1087 C  CA  . MET B 1 74 ? 9.476   1.260   22.043  1.00 27.69 ?  74  MET B CA  1 
ATOM   1088 C  C   . MET B 1 74 ? 9.812   2.426   22.970  1.00 25.69 ?  74  MET B C   1 
ATOM   1089 O  O   . MET B 1 74 ? 10.282  3.466   22.517  1.00 24.56 ?  74  MET B O   1 
ATOM   1090 C  CB  . MET B 1 74 ? 8.147   1.537   21.338  1.00 24.59 ?  74  MET B CB  1 
ATOM   1091 C  CG  . MET B 1 74 ? 7.935   0.697   20.090  1.00 26.31 ?  74  MET B CG  1 
ATOM   1092 S  SD  . MET B 1 74 ? 6.678   1.354   18.969  1.00 22.25 ?  74  MET B SD  1 
ATOM   1093 C  CE  . MET B 1 74 ? 5.192   1.121   19.948  1.00 24.36 ?  74  MET B CE  1 
ATOM   1094 N  N   . SER B 1 75 ? 9.573   2.253   24.265  1.00 28.54 ?  75  SER B N   1 
ATOM   1095 C  CA  . SER B 1 75 ? 9.833   3.319   25.226  1.00 28.19 ?  75  SER B CA  1 
ATOM   1096 C  C   . SER B 1 75 ? 11.221  3.202   25.853  1.00 33.15 ?  75  SER B C   1 
ATOM   1097 O  O   . SER B 1 75 ? 11.569  3.981   26.739  1.00 36.75 ?  75  SER B O   1 
ATOM   1098 C  CB  . SER B 1 75 ? 8.770   3.312   26.324  1.00 30.43 ?  75  SER B CB  1 
ATOM   1099 O  OG  . SER B 1 75 ? 8.920   2.183   27.173  1.00 34.73 ?  75  SER B OG  1 
ATOM   1100 N  N   . LYS B 1 76 ? 11.998  2.227   25.385  1.00 33.77 ?  76  LYS B N   1 
ATOM   1101 C  CA  . LYS B 1 76 ? 13.311  1.892   25.950  1.00 36.59 ?  76  LYS B CA  1 
ATOM   1102 C  C   . LYS B 1 76 ? 13.206  1.472   27.411  1.00 37.58 ?  76  LYS B C   1 
ATOM   1103 O  O   . LYS B 1 76 ? 13.336  0.291   27.738  1.00 43.28 ?  76  LYS B O   1 
ATOM   1104 C  CB  . LYS B 1 76 ? 14.285  3.064   25.821  1.00 37.34 ?  76  LYS B CB  1 
ATOM   1105 C  CG  . LYS B 1 76 ? 14.508  3.529   24.402  1.00 35.22 ?  76  LYS B CG  1 
ATOM   1106 C  CD  . LYS B 1 76 ? 15.434  4.735   24.367  1.00 37.88 ?  76  LYS B CD  1 
ATOM   1107 C  CE  . LYS B 1 76 ? 14.940  5.834   25.302  1.00 38.30 ?  76  LYS B CE  1 
ATOM   1108 N  NZ  . LYS B 1 76 ? 15.872  6.997   25.359  1.00 40.81 ?  76  LYS B NZ  1 
HETATM 1109 FE FE  . HEC C 2 .  ? -4.661  -1.381  2.110   1.00 18.99 ?  101 HEC A FE  1 
HETATM 1110 C  CHA . HEC C 2 .  ? -6.131  -4.398  1.539   1.00 22.43 ?  101 HEC A CHA 1 
HETATM 1111 C  CHB . HEC C 2 .  ? -5.807  -0.332  -1.064  1.00 19.95 ?  101 HEC A CHB 1 
HETATM 1112 C  CHC . HEC C 2 .  ? -3.089  1.704   2.456   1.00 18.84 ?  101 HEC A CHC 1 
HETATM 1113 C  CHD . HEC C 2 .  ? -3.402  -2.411  5.025   1.00 22.50 ?  101 HEC A CHD 1 
HETATM 1114 N  NA  . HEC C 2 .  ? -5.667  -2.170  0.567   1.00 19.03 ?  101 HEC A NA  1 
HETATM 1115 C  C1A . HEC C 2 .  ? -6.269  -3.416  0.604   1.00 19.92 ?  101 HEC A C1A 1 
HETATM 1116 C  C2A . HEC C 2 .  ? -7.105  -3.595  -0.512  1.00 22.59 ?  101 HEC A C2A 1 
HETATM 1117 C  C3A . HEC C 2 .  ? -7.029  -2.467  -1.252  1.00 22.51 ?  101 HEC A C3A 1 
HETATM 1118 C  C4A . HEC C 2 .  ? -6.136  -1.586  -0.596  1.00 20.39 ?  101 HEC A C4A 1 
HETATM 1119 C  CMA . HEC C 2 .  ? -7.775  -2.228  -2.542  1.00 19.68 ?  101 HEC A CMA 1 
HETATM 1120 C  CAA . HEC C 2 .  ? -7.931  -4.823  -0.825  1.00 22.40 ?  101 HEC A CAA 1 
HETATM 1121 C  CBA . HEC C 2 .  ? -9.293  -4.768  -0.124  1.00 22.46 ?  101 HEC A CBA 1 
HETATM 1122 C  CGA . HEC C 2 .  ? -10.116 -5.975  -0.496  1.00 27.00 ?  101 HEC A CGA 1 
HETATM 1123 O  O1A . HEC C 2 .  ? -11.323 -5.848  -0.796  1.00 27.27 ?  101 HEC A O1A 1 
HETATM 1124 O  O2A . HEC C 2 .  ? -9.602  -7.114  -0.494  1.00 28.24 -1 101 HEC A O2A 1 
HETATM 1125 N  NB  . HEC C 2 .  ? -4.472  0.331   0.884   1.00 18.98 ?  101 HEC A NB  1 
HETATM 1126 C  C1B . HEC C 2 .  ? -5.018  0.546   -0.321  1.00 17.03 ?  101 HEC A C1B 1 
HETATM 1127 C  C2B . HEC C 2 .  ? -4.669  1.850   -0.790  1.00 17.22 ?  101 HEC A C2B 1 
HETATM 1128 C  C3B . HEC C 2 .  ? -3.908  2.447   0.175   1.00 15.28 ?  101 HEC A C3B 1 
HETATM 1129 C  C4B . HEC C 2 .  ? -3.798  1.445   1.268   1.00 16.97 ?  101 HEC A C4B 1 
HETATM 1130 C  CMB . HEC C 2 .  ? -5.066  2.449   -2.115  1.00 16.01 ?  101 HEC A CMB 1 
HETATM 1131 C  CAB . HEC C 2 .  ? -3.296  3.801   0.127   1.00 16.27 ?  101 HEC A CAB 1 
HETATM 1132 C  CBB . HEC C 2 .  ? -4.049  4.898   -0.035  1.00 18.58 ?  101 HEC A CBB 1 
HETATM 1133 N  NC  . HEC C 2 .  ? -3.408  -0.491  3.502   1.00 20.10 ?  101 HEC A NC  1 
HETATM 1134 C  C1C . HEC C 2 .  ? -2.945  0.792   3.509   1.00 19.50 ?  101 HEC A C1C 1 
HETATM 1135 C  C2C . HEC C 2 .  ? -2.285  1.002   4.736   1.00 19.31 ?  101 HEC A C2C 1 
HETATM 1136 C  C3C . HEC C 2 .  ? -2.377  -0.179  5.474   1.00 19.52 ?  101 HEC A C3C 1 
HETATM 1137 C  C4C . HEC C 2 .  ? -3.099  -1.112  4.678   1.00 21.05 ?  101 HEC A C4C 1 
HETATM 1138 C  CMC . HEC C 2 .  ? -1.607  2.287   5.153   1.00 20.72 ?  101 HEC A CMC 1 
HETATM 1139 C  CAC . HEC C 2 .  ? -1.819  -0.439  6.821   1.00 22.06 ?  101 HEC A CAC 1 
HETATM 1140 C  CBC . HEC C 2 .  ? -2.083  0.348   7.865   1.00 24.29 ?  101 HEC A CBC 1 
HETATM 1141 N  ND  . HEC C 2 .  ? -4.735  -3.031  3.008   1.00 20.45 ?  101 HEC A ND  1 
HETATM 1142 C  C1D . HEC C 2 .  ? -4.173  -3.262  4.216   1.00 21.17 ?  101 HEC A C1D 1 
HETATM 1143 C  C2D . HEC C 2 .  ? -4.464  -4.633  4.654   1.00 23.75 ?  101 HEC A C2D 1 
HETATM 1144 C  C3D . HEC C 2 .  ? -5.210  -5.185  3.686   1.00 22.75 ?  101 HEC A C3D 1 
HETATM 1145 C  C4D . HEC C 2 .  ? -5.395  -4.148  2.670   1.00 22.13 ?  101 HEC A C4D 1 
HETATM 1146 C  CMD . HEC C 2 .  ? -4.002  -5.299  5.925   1.00 25.17 ?  101 HEC A CMD 1 
HETATM 1147 C  CAD . HEC C 2 .  ? -5.780  -6.577  3.669   1.00 26.01 ?  101 HEC A CAD 1 
HETATM 1148 C  CBD . HEC C 2 .  ? -7.106  -6.471  4.429   1.00 29.97 ?  101 HEC A CBD 1 
HETATM 1149 C  CGD . HEC C 2 .  ? -7.877  -7.761  4.371   1.00 31.55 ?  101 HEC A CGD 1 
HETATM 1150 O  O1D . HEC C 2 .  ? -7.887  -8.437  3.319   1.00 33.55 ?  101 HEC A O1D 1 
HETATM 1151 O  O2D . HEC C 2 .  ? -8.512  -8.144  5.380   1.00 33.26 -1 101 HEC A O2D 1 
HETATM 1152 FE FE  . HEC D 2 .  ? 0.955   3.208   17.009  1.00 21.82 ?  101 HEC B FE  1 
HETATM 1153 C  CHA . HEC D 2 .  ? 0.526   6.133   18.687  1.00 21.95 ?  101 HEC B CHA 1 
HETATM 1154 C  CHB . HEC D 2 .  ? 1.541   1.608   20.097  1.00 22.18 ?  101 HEC B CHB 1 
HETATM 1155 C  CHC . HEC D 2 .  ? 1.772   0.202   15.425  1.00 21.78 ?  101 HEC B CHC 1 
HETATM 1156 C  CHD . HEC D 2 .  ? 0.646   4.706   14.042  1.00 24.00 ?  101 HEC B CHD 1 
HETATM 1157 N  NA  . HEC D 2 .  ? 1.060   3.729   18.944  1.00 19.23 ?  101 HEC B NA  1 
HETATM 1158 C  C1A . HEC D 2 .  ? 0.764   4.998   19.418  1.00 22.49 ?  101 HEC B C1A 1 
HETATM 1159 C  C2A . HEC D 2 .  ? 0.768   4.993   20.831  1.00 23.29 ?  101 HEC B C2A 1 
HETATM 1160 C  C3A . HEC D 2 .  ? 1.056   3.735   21.226  1.00 24.18 ?  101 HEC B C3A 1 
HETATM 1161 C  C4A . HEC D 2 .  ? 1.227   2.947   20.069  1.00 22.04 ?  101 HEC B C4A 1 
HETATM 1162 C  CMA . HEC D 2 .  ? 1.154   3.293   22.663  1.00 22.96 ?  101 HEC B CMA 1 
HETATM 1163 C  CAA . HEC D 2 .  ? 0.521   6.149   21.779  1.00 24.09 ?  101 HEC B CAA 1 
HETATM 1164 C  CBA . HEC D 2 .  ? -0.966  6.482   21.933  1.00 24.82 ?  101 HEC B CBA 1 
HETATM 1165 C  CGA . HEC D 2 .  ? -1.139  7.620   22.916  1.00 29.55 ?  101 HEC B CGA 1 
HETATM 1166 O  O1A . HEC D 2 .  ? -2.160  7.661   23.644  1.00 27.16 ?  101 HEC B O1A 1 
HETATM 1167 O  O2A . HEC D 2 .  ? -0.275  8.528   23.003  1.00 26.25 -1 101 HEC B O2A 1 
HETATM 1168 N  NB  . HEC D 2 .  ? 1.573   1.295   17.663  1.00 22.63 ?  101 HEC B NB  1 
HETATM 1169 C  C1B . HEC D 2 .  ? 1.710   0.867   18.926  1.00 23.51 ?  101 HEC B C1B 1 
HETATM 1170 C  C2B . HEC D 2 .  ? 2.093   -0.504  18.934  1.00 24.28 ?  101 HEC B C2B 1 
HETATM 1171 C  C3B . HEC D 2 .  ? 2.164   -0.925  17.638  1.00 20.97 ?  101 HEC B C3B 1 
HETATM 1172 C  C4B . HEC D 2 .  ? 1.809   0.256   16.821  1.00 21.63 ?  101 HEC B C4B 1 
HETATM 1173 C  CMB . HEC D 2 .  ? 2.372   -1.352  20.146  1.00 24.80 ?  101 HEC B CMB 1 
HETATM 1174 C  CAB . HEC D 2 .  ? 2.531   -2.278  17.160  1.00 22.84 ?  101 HEC B CAB 1 
HETATM 1175 C  CBB . HEC D 2 .  ? 1.766   -3.336  17.453  1.00 23.94 ?  101 HEC B CBB 1 
HETATM 1176 N  NC  . HEC D 2 .  ? 1.205   2.548   15.056  1.00 22.19 ?  101 HEC B NC  1 
HETATM 1177 C  C1C . HEC D 2 .  ? 1.454   1.283   14.613  1.00 23.70 ?  101 HEC B C1C 1 
HETATM 1178 C  C2C . HEC D 2 .  ? 1.370   1.277   13.213  1.00 23.78 ?  101 HEC B C2C 1 
HETATM 1179 C  C3C . HEC D 2 .  ? 1.048   2.571   12.813  1.00 22.73 ?  101 HEC B C3C 1 
HETATM 1180 C  C4C . HEC D 2 .  ? 0.937   3.362   13.994  1.00 22.84 ?  101 HEC B C4C 1 
HETATM 1181 C  CMC . HEC D 2 .  ? 1.586   0.070   12.333  1.00 20.99 ?  101 HEC B CMC 1 
HETATM 1182 C  CAC . HEC D 2 .  ? 0.855   3.043   11.426  1.00 24.45 ?  101 HEC B CAC 1 
HETATM 1183 C  CBC . HEC D 2 .  ? -0.091  2.507   10.654  1.00 24.62 ?  101 HEC B CBC 1 
HETATM 1184 N  ND  . HEC D 2 .  ? 0.697   4.998   16.520  1.00 22.54 ?  101 HEC B ND  1 
HETATM 1185 C  C1D . HEC D 2 .  ? 0.556   5.420   15.245  1.00 22.34 ?  101 HEC B C1D 1 
HETATM 1186 C  C2D . HEC D 2 .  ? 0.300   6.863   15.208  1.00 25.09 ?  101 HEC B C2D 1 
HETATM 1187 C  C3D . HEC D 2 .  ? 0.276   7.267   16.489  1.00 25.24 ?  101 HEC B C3D 1 
HETATM 1188 C  C4D . HEC D 2 .  ? 0.504   6.067   17.308  1.00 24.49 ?  101 HEC B C4D 1 
HETATM 1189 C  CMD . HEC D 2 .  ? 0.116   7.709   13.972  1.00 23.63 ?  101 HEC B CMD 1 
HETATM 1190 C  CAD . HEC D 2 .  ? 0.026   8.669   16.982  1.00 28.60 ?  101 HEC B CAD 1 
HETATM 1191 C  CBD . HEC D 2 .  ? -1.491  8.861   17.056  1.00 28.97 ?  101 HEC B CBD 1 
HETATM 1192 C  CGD . HEC D 2 .  ? -1.799  10.228  17.611  1.00 40.38 ?  101 HEC B CGD 1 
HETATM 1193 O  O1D . HEC D 2 .  ? -2.217  10.346  18.784  1.00 40.52 ?  101 HEC B O1D 1 
HETATM 1194 O  O2D . HEC D 2 .  ? -1.638  11.244  16.899  1.00 41.99 -1 101 HEC B O2D 1 
HETATM 1195 N  N1  . IMD E 3 .  ? -1.148  2.642   17.184  1.00 23.44 ?  102 IMD B N1  1 
HETATM 1196 C  C2  . IMD E 3 .  ? -2.053  3.352   17.900  1.00 27.71 ?  102 IMD B C2  1 
HETATM 1197 N  N3  . IMD E 3 .  ? -3.279  2.820   17.673  1.00 30.98 1  102 IMD B N3  1 
HETATM 1198 C  C4  . IMD E 3 .  ? -3.134  1.795   16.828  1.00 31.11 ?  102 IMD B C4  1 
HETATM 1199 C  C5  . IMD E 3 .  ? -1.804  1.684   16.523  1.00 27.05 ?  102 IMD B C5  1 
HETATM 1200 O  O   . HOH F 4 .  ? -13.284 10.190  -12.187 1.00 34.17 ?  201 HOH A O   1 
HETATM 1201 O  O   . HOH F 4 .  ? -14.455 9.236   -9.855  1.00 35.00 ?  202 HOH A O   1 
HETATM 1202 O  O   . HOH F 4 .  ? -13.635 12.319  -7.629  1.00 30.66 ?  203 HOH A O   1 
HETATM 1203 O  O   . HOH F 4 .  ? -6.400  -10.138 3.317   1.00 34.02 ?  204 HOH A O   1 
HETATM 1204 O  O   . HOH F 4 .  ? -7.530  -7.816  1.110   1.00 33.85 ?  205 HOH A O   1 
HETATM 1205 O  O   . HOH F 4 .  ? -10.719 -0.831  8.971   1.00 33.29 ?  206 HOH A O   1 
HETATM 1206 O  O   . HOH F 4 .  ? -15.716 -3.572  1.738   1.00 32.40 ?  207 HOH A O   1 
HETATM 1207 O  O   . HOH F 4 .  ? -17.046 -0.066  1.149   1.00 28.99 ?  208 HOH A O   1 
HETATM 1208 O  O   . HOH F 4 .  ? -6.156  -15.013 -9.640  1.00 29.06 ?  209 HOH A O   1 
HETATM 1209 O  O   . HOH F 4 .  ? -13.399 -4.670  -1.583  1.00 25.11 ?  210 HOH A O   1 
HETATM 1210 O  O   . HOH F 4 .  ? -4.697  -3.204  -12.626 1.00 34.13 ?  211 HOH A O   1 
HETATM 1211 O  O   . HOH F 4 .  ? -2.028  -6.331  -12.692 1.00 34.76 ?  212 HOH A O   1 
HETATM 1212 O  O   . HOH F 4 .  ? -10.668 -9.120  6.372   1.00 33.51 ?  213 HOH A O   1 
HETATM 1213 O  O   . HOH F 4 .  ? -4.293  16.371  3.747   1.00 20.83 ?  214 HOH A O   1 
HETATM 1214 O  O   . HOH F 4 .  ? 5.168   -2.710  4.042   1.00 18.22 ?  215 HOH A O   1 
HETATM 1215 O  O   . HOH F 4 .  ? -16.793 -7.622  -3.553  1.00 33.50 ?  216 HOH A O   1 
HETATM 1216 O  O   . HOH F 4 .  ? -8.346  13.749  -8.070  1.00 22.00 ?  217 HOH A O   1 
HETATM 1217 O  O   . HOH F 4 .  ? 6.091   9.350   -5.747  1.00 20.96 ?  218 HOH A O   1 
HETATM 1218 O  O   . HOH F 4 .  ? -16.617 3.540   -5.173  1.00 21.71 ?  219 HOH A O   1 
HETATM 1219 O  O   . HOH F 4 .  ? -6.378  15.985  -3.332  1.00 22.49 ?  220 HOH A O   1 
HETATM 1220 O  O   . HOH F 4 .  ? -8.358  -9.207  -12.034 1.00 28.42 ?  221 HOH A O   1 
HETATM 1221 O  O   . HOH F 4 .  ? 0.646   13.463  -4.635  1.00 26.83 ?  222 HOH A O   1 
HETATM 1222 O  O   . HOH F 4 .  ? 7.332   -0.936  -2.949  1.00 23.24 ?  223 HOH A O   1 
HETATM 1223 O  O   . HOH F 4 .  ? 7.928   6.211   0.269   1.00 25.17 ?  224 HOH A O   1 
HETATM 1224 O  O   . HOH F 4 .  ? -7.541  -7.450  7.767   1.00 34.59 ?  225 HOH A O   1 
HETATM 1225 O  O   . HOH F 4 .  ? -11.004 -12.444 -12.572 1.00 24.11 ?  226 HOH A O   1 
HETATM 1226 O  O   . HOH F 4 .  ? -18.946 3.755   -1.368  1.00 25.22 ?  227 HOH A O   1 
HETATM 1227 O  O   . HOH F 4 .  ? -18.756 -5.637  -4.910  1.00 33.41 ?  228 HOH A O   1 
HETATM 1228 O  O   . HOH F 4 .  ? 3.752   11.413  -2.405  1.00 23.17 ?  229 HOH A O   1 
HETATM 1229 O  O   . HOH F 4 .  ? -16.858 5.146   -2.569  1.00 24.50 ?  230 HOH A O   1 
HETATM 1230 O  O   . HOH F 4 .  ? -6.409  5.817   7.219   1.00 29.65 ?  231 HOH A O   1 
HETATM 1231 O  O   . HOH F 4 .  ? -17.175 -2.770  -8.296  1.00 27.50 ?  232 HOH A O   1 
HETATM 1232 O  O   . HOH F 4 .  ? 7.330   3.155   -5.230  1.00 22.82 ?  233 HOH A O   1 
HETATM 1233 O  O   . HOH F 4 .  ? -15.631 5.698   -6.748  1.00 21.80 ?  234 HOH A O   1 
HETATM 1234 O  O   . HOH F 4 .  ? 0.560   -10.369 2.111   1.00 33.80 ?  235 HOH A O   1 
HETATM 1235 O  O   . HOH F 4 .  ? -7.999  7.685   -11.310 1.00 25.14 ?  236 HOH A O   1 
HETATM 1236 O  O   . HOH F 4 .  ? -17.120 -2.114  -1.628  1.00 24.82 ?  237 HOH A O   1 
HETATM 1237 O  O   . HOH F 4 .  ? 0.794   -10.246 -1.240  1.00 26.66 ?  238 HOH A O   1 
HETATM 1238 O  O   . HOH F 4 .  ? -16.060 9.319   -7.445  1.00 27.52 ?  239 HOH A O   1 
HETATM 1239 O  O   . HOH F 4 .  ? -4.186  -15.338 -7.684  1.00 28.07 ?  240 HOH A O   1 
HETATM 1240 O  O   . HOH F 4 .  ? -6.389  14.838  -6.130  1.00 24.34 ?  241 HOH A O   1 
HETATM 1241 O  O   . HOH F 4 .  ? 7.491   0.699   2.966   1.00 23.09 ?  242 HOH A O   1 
HETATM 1242 O  O   . HOH F 4 .  ? -1.588  4.644   -11.349 1.00 29.13 ?  243 HOH A O   1 
HETATM 1243 O  O   . HOH F 4 .  ? 2.955   -13.443 -7.699  1.00 36.61 ?  244 HOH A O   1 
HETATM 1244 O  O   . HOH F 4 .  ? -10.169 -14.128 -9.280  1.00 32.15 ?  245 HOH A O   1 
HETATM 1245 O  O   . HOH F 4 .  ? -12.384 10.239  -1.673  1.00 21.34 ?  246 HOH A O   1 
HETATM 1246 O  O   . HOH F 4 .  ? -4.502  16.033  -7.431  1.00 25.82 ?  247 HOH A O   1 
HETATM 1247 O  O   . HOH F 4 .  ? -13.812 11.536  -4.981  1.00 19.88 ?  248 HOH A O   1 
HETATM 1248 O  O   . HOH F 4 .  ? 7.343   0.378   -5.309  1.00 21.98 ?  249 HOH A O   1 
HETATM 1249 O  O   . HOH F 4 .  ? -1.124  13.941  2.504   1.00 28.18 ?  250 HOH A O   1 
HETATM 1250 O  O   . HOH F 4 .  ? 6.761   0.105   5.427   1.00 20.76 ?  251 HOH A O   1 
HETATM 1251 O  O   . HOH F 4 .  ? 5.792   -7.725  -5.519  1.00 27.92 ?  252 HOH A O   1 
HETATM 1252 O  O   . HOH F 4 .  ? -10.138 -10.155 2.791   1.00 35.81 ?  253 HOH A O   1 
HETATM 1253 O  O   . HOH F 4 .  ? -18.145 -6.945  -6.590  1.00 30.87 ?  254 HOH A O   1 
HETATM 1254 O  O   . HOH F 4 .  ? 6.702   -7.794  -9.362  1.00 30.81 ?  255 HOH A O   1 
HETATM 1255 O  O   . HOH F 4 .  ? 4.964   7.453   4.303   1.00 25.78 ?  256 HOH A O   1 
HETATM 1256 O  O   . HOH F 4 .  ? 0.319   10.006  4.530   1.00 28.26 ?  257 HOH A O   1 
HETATM 1257 O  O   . HOH F 4 .  ? 2.499   -0.416  -11.595 1.00 27.98 ?  258 HOH A O   1 
HETATM 1258 O  O   . HOH F 4 .  ? -9.458  10.821  1.440   1.00 27.39 ?  259 HOH A O   1 
HETATM 1259 O  O   . HOH F 4 .  ? 6.576   -11.529 -1.909  1.00 38.71 ?  260 HOH A O   1 
HETATM 1260 O  O   . HOH F 4 .  ? 6.309   -4.185  -3.195  1.00 27.97 ?  261 HOH A O   1 
HETATM 1261 O  O   . HOH F 4 .  ? -16.008 -0.396  -10.876 1.00 31.49 ?  262 HOH A O   1 
HETATM 1262 O  O   . HOH F 4 .  ? -3.403  -9.203  -11.924 1.00 34.37 ?  263 HOH A O   1 
HETATM 1263 O  O   . HOH F 4 .  ? -15.670 -5.934  -1.157  1.00 33.12 ?  264 HOH A O   1 
HETATM 1264 O  O   . HOH F 4 .  ? -5.890  10.406  -9.736  1.00 26.59 ?  265 HOH A O   1 
HETATM 1265 O  O   . HOH F 4 .  ? -1.301  14.529  -10.420 1.00 28.00 ?  266 HOH A O   1 
HETATM 1266 O  O   . HOH F 4 .  ? -13.076 -2.156  -12.314 1.00 29.63 ?  267 HOH A O   1 
HETATM 1267 O  O   . HOH F 4 .  ? 3.567   -10.021 -10.180 1.00 33.79 ?  268 HOH A O   1 
HETATM 1268 O  O   . HOH F 4 .  ? 1.785   6.729   -11.005 1.00 27.01 ?  269 HOH A O   1 
HETATM 1269 O  O   . HOH F 4 .  ? 1.398   -14.242 -4.455  1.00 27.86 ?  270 HOH A O   1 
HETATM 1270 O  O   . HOH F 4 .  ? -1.227  7.792   -12.145 1.00 32.69 ?  271 HOH A O   1 
HETATM 1271 O  O   . HOH F 4 .  ? -18.487 -5.896  -9.384  1.00 37.09 ?  272 HOH A O   1 
HETATM 1272 O  O   . HOH F 4 .  ? -13.857 -4.178  8.150   1.00 35.43 ?  273 HOH A O   1 
HETATM 1273 O  O   . HOH F 4 .  ? 0.924   13.542  -7.529  1.00 23.22 ?  274 HOH A O   1 
HETATM 1274 O  O   . HOH F 4 .  ? -1.510  11.261  3.338   1.00 23.93 ?  275 HOH A O   1 
HETATM 1275 O  O   . HOH F 4 .  ? -3.626  11.054  -12.202 1.00 32.58 ?  276 HOH A O   1 
HETATM 1276 O  O   . HOH F 4 .  ? 9.726   -1.979  2.909   1.00 30.96 ?  277 HOH A O   1 
HETATM 1277 O  O   . HOH F 4 .  ? -3.884  6.341   -13.216 1.00 37.05 ?  278 HOH A O   1 
HETATM 1278 O  O   . HOH F 4 .  ? 2.374   -12.608 -10.350 1.00 36.79 ?  279 HOH A O   1 
HETATM 1279 O  O   . HOH F 4 .  ? -0.422  10.381  6.764   1.00 32.95 ?  280 HOH A O   1 
HETATM 1280 O  O   . HOH F 4 .  ? 7.308   -10.205 3.472   1.00 34.25 ?  281 HOH A O   1 
HETATM 1281 O  O   . HOH F 4 .  ? 7.913   9.467   -8.552  1.00 32.48 ?  282 HOH A O   1 
HETATM 1282 O  O   . HOH F 4 .  ? -3.700  17.583  -3.220  1.00 36.48 ?  283 HOH A O   1 
HETATM 1283 O  O   . HOH F 4 .  ? 7.456   -1.907  -10.340 1.00 35.33 ?  284 HOH A O   1 
HETATM 1284 O  O   . HOH F 4 .  ? 4.474   10.490  -8.908  1.00 30.16 ?  285 HOH A O   1 
HETATM 1285 O  O   . HOH F 4 .  ? -7.116  9.816   -12.690 1.00 33.37 ?  286 HOH A O   1 
HETATM 1286 O  O   . HOH F 4 .  ? -14.352 -10.176 3.911   1.00 31.62 ?  287 HOH A O   1 
HETATM 1287 O  O   . HOH F 4 .  ? 0.158   2.919   -12.576 1.00 32.89 ?  288 HOH A O   1 
HETATM 1288 O  O   . HOH F 4 .  ? -13.404 4.982   -8.242  1.00 31.14 ?  289 HOH A O   1 
HETATM 1289 O  O   . HOH F 4 .  ? 5.492   -11.836 -7.482  1.00 39.88 ?  290 HOH A O   1 
HETATM 1290 O  O   . HOH F 4 .  ? -4.632  -16.434 -5.251  1.00 34.35 ?  291 HOH A O   1 
HETATM 1291 O  O   . HOH F 4 .  ? -0.273  -12.710 2.684   1.00 34.75 ?  292 HOH A O   1 
HETATM 1292 O  O   . HOH F 4 .  ? -5.965  -7.871  -13.015 1.00 33.39 ?  293 HOH A O   1 
HETATM 1293 O  O   . HOH G 4 .  ? -2.463  -13.752 12.437  1.00 30.94 ?  201 HOH B O   1 
HETATM 1294 O  O   . HOH G 4 .  ? -4.498  -3.860  12.762  1.00 33.31 ?  202 HOH B O   1 
HETATM 1295 O  O   . HOH G 4 .  ? -5.611  3.804   17.941  1.00 38.74 ?  203 HOH B O   1 
HETATM 1296 O  O   . HOH G 4 .  ? -3.569  -8.735  17.220  1.00 30.72 ?  204 HOH B O   1 
HETATM 1297 O  O   . HOH G 4 .  ? 15.689  10.636  15.472  1.00 44.73 ?  205 HOH B O   1 
HETATM 1298 O  O   . HOH G 4 .  ? -3.478  6.113   25.023  1.00 32.03 ?  206 HOH B O   1 
HETATM 1299 O  O   . HOH G 4 .  ? -2.435  9.490   25.261  1.00 33.04 ?  207 HOH B O   1 
HETATM 1300 O  O   . HOH G 4 .  ? -3.032  6.694   28.010  1.00 34.24 ?  208 HOH B O   1 
HETATM 1301 O  O   . HOH G 4 .  ? -2.808  -4.463  29.600  1.00 38.04 ?  209 HOH B O   1 
HETATM 1302 O  O   . HOH G 4 .  ? 6.208   -10.959 26.246  1.00 34.06 ?  210 HOH B O   1 
HETATM 1303 O  O   . HOH G 4 .  ? -9.664  -7.826  24.527  1.00 36.70 ?  211 HOH B O   1 
HETATM 1304 O  O   . HOH G 4 .  ? 9.059   -10.380 14.443  1.00 28.21 ?  212 HOH B O   1 
HETATM 1305 O  O   . HOH G 4 .  ? 12.030  10.689  30.117  1.00 38.22 ?  213 HOH B O   1 
HETATM 1306 O  O   . HOH G 4 .  ? 4.934   12.757  21.500  1.00 34.98 ?  214 HOH B O   1 
HETATM 1307 O  O   . HOH G 4 .  ? 1.101   -14.943 13.579  1.00 32.26 ?  215 HOH B O   1 
HETATM 1308 O  O   . HOH G 4 .  ? 0.007   9.855   20.214  1.00 32.24 ?  216 HOH B O   1 
HETATM 1309 O  O   . HOH G 4 .  ? -6.661  4.187   26.734  1.00 36.61 ?  217 HOH B O   1 
HETATM 1310 O  O   . HOH G 4 .  ? 2.606   -8.141  11.502  1.00 24.62 ?  218 HOH B O   1 
HETATM 1311 O  O   . HOH G 4 .  ? 11.887  12.938  17.930  1.00 36.70 ?  219 HOH B O   1 
HETATM 1312 O  O   . HOH G 4 .  ? -0.033  -11.452 10.142  1.00 26.20 ?  220 HOH B O   1 
HETATM 1313 O  O   . HOH G 4 .  ? 7.146   2.655   6.650   1.00 26.24 ?  221 HOH B O   1 
HETATM 1314 O  O   . HOH G 4 .  ? 12.969  5.488   16.186  1.00 30.94 ?  222 HOH B O   1 
HETATM 1315 O  O   . HOH G 4 .  ? 5.023   12.921  12.827  1.00 33.02 ?  223 HOH B O   1 
HETATM 1316 O  O   . HOH G 4 .  ? -9.353  2.460   23.461  1.00 35.27 ?  224 HOH B O   1 
HETATM 1317 O  O   . HOH G 4 .  ? 6.629   11.744  14.807  1.00 29.81 ?  225 HOH B O   1 
HETATM 1318 O  O   . HOH G 4 .  ? 6.124   -7.937  9.013   1.00 32.57 ?  226 HOH B O   1 
HETATM 1319 O  O   . HOH G 4 .  ? 8.850   10.951  18.388  1.00 24.69 ?  227 HOH B O   1 
HETATM 1320 O  O   . HOH G 4 .  ? 9.790   -5.707  25.639  1.00 35.46 ?  228 HOH B O   1 
HETATM 1321 O  O   . HOH G 4 .  ? 14.554  -0.469  17.219  1.00 29.04 ?  229 HOH B O   1 
HETATM 1322 O  O   . HOH G 4 .  ? 8.829   11.829  10.934  1.00 26.96 ?  230 HOH B O   1 
HETATM 1323 O  O   . HOH G 4 .  ? 8.464   4.026   10.512  1.00 23.91 ?  231 HOH B O   1 
HETATM 1324 O  O   . HOH G 4 .  ? 4.386   12.043  18.066  1.00 29.33 ?  232 HOH B O   1 
HETATM 1325 O  O   . HOH G 4 .  ? 9.563   -8.393  25.647  1.00 34.59 ?  233 HOH B O   1 
HETATM 1326 O  O   . HOH G 4 .  ? 8.063   -6.010  8.611   1.00 29.98 ?  234 HOH B O   1 
HETATM 1327 O  O   . HOH G 4 .  ? -5.215  -10.723 25.285  1.00 31.24 ?  235 HOH B O   1 
HETATM 1328 O  O   . HOH G 4 .  ? 7.526   7.808   32.955  1.00 35.47 ?  236 HOH B O   1 
HETATM 1329 O  O   . HOH G 4 .  ? 3.587   -8.302  29.023  1.00 33.87 ?  237 HOH B O   1 
HETATM 1330 O  O   . HOH G 4 .  ? 13.532  1.071   14.443  1.00 32.11 ?  238 HOH B O   1 
HETATM 1331 O  O   . HOH G 4 .  ? -5.631  -2.969  28.704  1.00 30.99 ?  239 HOH B O   1 
HETATM 1332 O  O   . HOH G 4 .  ? 3.040   -6.946  33.458  1.00 41.09 ?  240 HOH B O   1 
HETATM 1333 O  O   . HOH G 4 .  ? -5.411  -8.349  22.399  1.00 34.17 ?  241 HOH B O   1 
HETATM 1334 O  O   . HOH G 4 .  ? 6.310   12.490  10.139  1.00 27.91 ?  242 HOH B O   1 
HETATM 1335 O  O   . HOH G 4 .  ? 11.424  0.608   10.155  1.00 32.63 ?  243 HOH B O   1 
HETATM 1336 O  O   . HOH G 4 .  ? 10.399  -7.755  9.533   1.00 35.28 ?  244 HOH B O   1 
HETATM 1337 O  O   . HOH G 4 .  ? 1.189   -10.022 13.129  1.00 23.25 ?  245 HOH B O   1 
HETATM 1338 O  O   . HOH G 4 .  ? 2.515   1.115   33.773  1.00 39.50 ?  246 HOH B O   1 
HETATM 1339 O  O   . HOH G 4 .  ? 15.023  6.962   18.243  1.00 38.52 ?  247 HOH B O   1 
HETATM 1340 O  O   . HOH G 4 .  ? -4.216  7.598   31.799  1.00 31.23 ?  248 HOH B O   1 
HETATM 1341 O  O   . HOH G 4 .  ? 6.321   -13.831 25.649  1.00 33.95 ?  249 HOH B O   1 
HETATM 1342 O  O   . HOH G 4 .  ? -7.212  -5.762  18.606  1.00 34.35 ?  250 HOH B O   1 
HETATM 1343 O  O   . HOH G 4 .  ? 9.780   3.268   29.987  1.00 34.66 ?  251 HOH B O   1 
HETATM 1344 O  O   . HOH G 4 .  ? 12.416  -2.895  12.557  1.00 32.65 ?  252 HOH B O   1 
HETATM 1345 O  O   . HOH G 4 .  ? 12.529  -10.389 19.841  1.00 34.85 ?  253 HOH B O   1 
HETATM 1346 O  O   . HOH G 4 .  ? 14.934  12.384  20.843  1.00 41.23 ?  254 HOH B O   1 
HETATM 1347 O  O   . HOH G 4 .  ? -1.875  7.926   35.121  1.00 34.78 ?  255 HOH B O   1 
HETATM 1348 O  O   . HOH G 4 .  ? -1.383  5.287   35.613  1.00 33.49 ?  256 HOH B O   1 
HETATM 1349 O  O   . HOH G 4 .  ? 9.135   -0.247  7.434   1.00 25.80 ?  257 HOH B O   1 
HETATM 1350 O  O   . HOH G 4 .  ? 14.695  7.996   15.935  1.00 38.07 ?  258 HOH B O   1 
HETATM 1351 O  O   . HOH G 4 .  ? -3.009  1.057   33.721  1.00 36.73 ?  259 HOH B O   1 
HETATM 1352 O  O   . HOH G 4 .  ? 5.650   -10.854 29.083  1.00 38.92 ?  260 HOH B O   1 
HETATM 1353 O  O   . HOH G 4 .  ? 6.228   6.703   34.909  1.00 38.84 ?  261 HOH B O   1 
HETATM 1354 O  O   . HOH G 4 .  ? 9.137   4.303   7.636   1.00 26.87 ?  262 HOH B O   1 
HETATM 1355 O  O   . HOH G 4 .  ? -8.845  10.674  16.983  1.00 44.20 ?  263 HOH B O   1 
HETATM 1356 O  O   . HOH G 4 .  ? 9.524   -10.471 11.697  1.00 33.53 ?  264 HOH B O   1 
HETATM 1357 O  O   . HOH G 4 .  ? 12.638  8.123   29.956  1.00 41.53 ?  265 HOH B O   1 
HETATM 1358 O  O   . HOH G 4 .  ? 2.678   -9.165  30.616  1.00 35.34 ?  266 HOH B O   1 
HETATM 1359 O  O   . HOH G 4 .  ? 6.600   12.735  19.362  1.00 28.29 ?  267 HOH B O   1 
HETATM 1360 O  O   . HOH G 4 .  ? 8.918   12.587  15.640  1.00 39.64 ?  268 HOH B O   1 
HETATM 1361 O  O   . HOH G 4 .  ? 14.517  12.011  28.970  1.00 38.52 ?  269 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLN 1  1  1  GLN GLN A . n 
A 1 2  GLU 2  2  2  GLU GLU A . n 
A 1 3  GLY 3  3  3  GLY GLY A . n 
A 1 4  LYS 4  4  4  LYS LYS A . n 
A 1 5  ALA 5  5  5  ALA ALA A . n 
A 1 6  VAL 6  6  6  VAL VAL A . n 
A 1 7  TYR 7  7  7  TYR TYR A . n 
A 1 8  ASP 8  8  8  ASP ASP A . n 
A 1 9  LYS 9  9  9  LYS LYS A . n 
A 1 10 ALA 10 10 10 ALA ALA A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 HIS 12 12 12 HIS HIS A . n 
A 1 13 ILE 13 13 13 ILE ILE A . n 
A 1 14 CYS 14 14 14 CYS CYS A . n 
A 1 15 HIS 15 15 15 HIS HIS A . n 
A 1 16 SER 16 16 16 SER SER A . n 
A 1 17 MET 17 17 17 MET MET A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 VAL 19 19 19 VAL VAL A . n 
A 1 20 ALA 20 20 20 ALA ALA A . n 
A 1 21 GLY 21 21 21 GLY GLY A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 PRO 23 23 23 PRO PRO A . n 
A 1 24 LYS 24 24 24 LYS LYS A . n 
A 1 25 ALA 25 25 25 ALA ALA A . n 
A 1 26 HIS 26 26 26 HIS HIS A . n 
A 1 27 ASP 27 27 27 ASP ASP A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 ALA 29 29 29 ALA ALA A . n 
A 1 30 ALA 30 30 30 ALA ALA A . n 
A 1 31 TRP 31 31 31 TRP TRP A . n 
A 1 32 GLU 32 32 32 GLU GLU A . n 
A 1 33 PRO 33 33 33 PRO PRO A . n 
A 1 34 ARG 34 34 34 ARG ARG A . n 
A 1 35 ILE 35 35 35 ILE ILE A . n 
A 1 36 ALA 36 36 36 ALA ALA A . n 
A 1 37 GLN 37 37 37 GLN GLN A . n 
A 1 38 GLY 38 38 38 GLY GLY A . n 
A 1 39 LEU 39 39 39 LEU LEU A . n 
A 1 40 ASP 40 40 40 ASP ASP A . n 
A 1 41 THR 41 41 41 THR THR A . n 
A 1 42 LEU 42 42 42 LEU LEU A . n 
A 1 43 VAL 43 43 43 VAL VAL A . n 
A 1 44 SER 44 44 44 SER SER A . n 
A 1 45 THR 45 45 45 THR THR A . n 
A 1 46 VAL 46 46 46 VAL VAL A . n 
A 1 47 LYS 47 47 47 LYS LYS A . n 
A 1 48 THR 48 48 48 THR THR A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 LYS 50 50 50 LYS LYS A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 ALA 52 52 52 ALA ALA A . n 
A 1 53 MET 53 53 53 MET MET A . n 
A 1 54 PRO 54 54 54 PRO PRO A . n 
A 1 55 PRO 55 55 55 PRO PRO A . n 
A 1 56 GLY 56 56 56 GLY GLY A . n 
A 1 57 GLY 57 57 57 GLY GLY A . n 
A 1 58 MET 58 58 58 MET MET A . n 
A 1 59 CYS 59 59 59 CYS CYS A . n 
A 1 60 THR 60 60 60 THR THR A . n 
A 1 61 ASP 61 61 61 ASP ASP A . n 
A 1 62 CYS 62 62 62 CYS CYS A . n 
A 1 63 THR 63 63 63 THR THR A . n 
A 1 64 ASP 64 64 64 ASP ASP A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 ASP 66 66 66 ASP ASP A . n 
A 1 67 TYR 67 67 67 TYR TYR A . n 
A 1 68 LYS 68 68 68 LYS LYS A . n 
A 1 69 SER 69 69 69 SER SER A . n 
A 1 70 ALA 70 70 70 ALA ALA A . n 
A 1 71 ILE 71 71 71 ILE ILE A . n 
A 1 72 GLU 72 72 72 GLU GLU A . n 
A 1 73 TYR 73 73 73 TYR TYR A . n 
A 1 74 MET 74 74 74 MET MET A . n 
A 1 75 SER 75 75 75 SER SER A . n 
A 1 76 LYS 76 76 76 LYS LYS A . n 
B 1 1  GLN 1  1  1  GLN GLN B . n 
B 1 2  GLU 2  2  2  GLU GLU B . n 
B 1 3  GLY 3  3  3  GLY GLY B . n 
B 1 4  LYS 4  4  4  LYS LYS B . n 
B 1 5  ALA 5  5  5  ALA ALA B . n 
B 1 6  VAL 6  6  6  VAL VAL B . n 
B 1 7  TYR 7  7  7  TYR TYR B . n 
B 1 8  ASP 8  8  8  ASP ASP B . n 
B 1 9  LYS 9  9  9  LYS LYS B . n 
B 1 10 ALA 10 10 10 ALA ALA B . n 
B 1 11 CYS 11 11 11 CYS CYS B . n 
B 1 12 HIS 12 12 12 HIS HIS B . n 
B 1 13 ILE 13 13 13 ILE ILE B . n 
B 1 14 CYS 14 14 14 CYS CYS B . n 
B 1 15 HIS 15 15 15 HIS HIS B . n 
B 1 16 SER 16 16 16 SER SER B . n 
B 1 17 MET 17 17 17 MET MET B . n 
B 1 18 GLY 18 18 18 GLY GLY B . n 
B 1 19 VAL 19 19 19 VAL VAL B . n 
B 1 20 ALA 20 20 20 ALA ALA B . n 
B 1 21 GLY 21 21 21 GLY GLY B . n 
B 1 22 ALA 22 22 22 ALA ALA B . n 
B 1 23 PRO 23 23 23 PRO PRO B . n 
B 1 24 LYS 24 24 24 LYS LYS B . n 
B 1 25 ALA 25 25 25 ALA ALA B . n 
B 1 26 HIS 26 26 26 HIS HIS B . n 
B 1 27 ASP 27 27 27 ASP ASP B . n 
B 1 28 ALA 28 28 28 ALA ALA B . n 
B 1 29 ALA 29 29 29 ALA ALA B . n 
B 1 30 ALA 30 30 30 ALA ALA B . n 
B 1 31 TRP 31 31 31 TRP TRP B . n 
B 1 32 GLU 32 32 32 GLU GLU B . n 
B 1 33 PRO 33 33 33 PRO PRO B . n 
B 1 34 ARG 34 34 34 ARG ARG B . n 
B 1 35 ILE 35 35 35 ILE ILE B . n 
B 1 36 ALA 36 36 36 ALA ALA B . n 
B 1 37 GLN 37 37 37 GLN GLN B . n 
B 1 38 GLY 38 38 38 GLY GLY B . n 
B 1 39 LEU 39 39 39 LEU LEU B . n 
B 1 40 ASP 40 40 40 ASP ASP B . n 
B 1 41 THR 41 41 41 THR THR B . n 
B 1 42 LEU 42 42 42 LEU LEU B . n 
B 1 43 VAL 43 43 43 VAL VAL B . n 
B 1 44 SER 44 44 44 SER SER B . n 
B 1 45 THR 45 45 45 THR THR B . n 
B 1 46 VAL 46 46 46 VAL VAL B . n 
B 1 47 LYS 47 47 47 LYS LYS B . n 
B 1 48 THR 48 48 48 THR THR B . n 
B 1 49 GLY 49 49 49 GLY GLY B . n 
B 1 50 LYS 50 50 50 LYS LYS B . n 
B 1 51 GLY 51 51 51 GLY GLY B . n 
B 1 52 ALA 52 52 52 ALA ALA B . n 
B 1 53 MET 53 53 53 MET MET B . n 
B 1 54 PRO 54 54 54 PRO PRO B . n 
B 1 55 PRO 55 55 55 PRO PRO B . n 
B 1 56 GLY 56 56 56 GLY GLY B . n 
B 1 57 GLY 57 57 57 GLY GLY B . n 
B 1 58 MET 58 58 58 MET MET B . n 
B 1 59 CYS 59 59 59 CYS CYS B . n 
B 1 60 THR 60 60 60 THR THR B . n 
B 1 61 ASP 61 61 61 ASP ASP B . n 
B 1 62 CYS 62 62 62 CYS CYS B . n 
B 1 63 THR 63 63 63 THR THR B . n 
B 1 64 ASP 64 64 64 ASP ASP B . n 
B 1 65 GLU 65 65 65 GLU GLU B . n 
B 1 66 ASP 66 66 66 ASP ASP B . n 
B 1 67 TYR 67 67 67 TYR TYR B . n 
B 1 68 LYS 68 68 68 LYS LYS B . n 
B 1 69 SER 69 69 69 SER SER B . n 
B 1 70 ALA 70 70 70 ALA ALA B . n 
B 1 71 ILE 71 71 71 ILE ILE B . n 
B 1 72 GLU 72 72 72 GLU GLU B . n 
B 1 73 TYR 73 73 73 TYR TYR B . n 
B 1 74 MET 74 74 74 MET MET B . n 
B 1 75 SER 75 75 75 SER SER B . n 
B 1 76 LYS 76 76 76 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HEC 1  101 80  HEC HEM A . 
D 2 HEC 1  101 80  HEC HEM B . 
E 3 IMD 1  102 85  IMD IMD B . 
F 4 HOH 1  201 156 HOH HOH A . 
F 4 HOH 2  202 153 HOH HOH A . 
F 4 HOH 3  203 180 HOH HOH A . 
F 4 HOH 4  204 136 HOH HOH A . 
F 4 HOH 5  205 171 HOH HOH A . 
F 4 HOH 6  206 157 HOH HOH A . 
F 4 HOH 7  207 184 HOH HOH A . 
F 4 HOH 8  208 160 HOH HOH A . 
F 4 HOH 9  209 126 HOH HOH A . 
F 4 HOH 10 210 106 HOH HOH A . 
F 4 HOH 11 211 141 HOH HOH A . 
F 4 HOH 12 212 163 HOH HOH A . 
F 4 HOH 13 213 149 HOH HOH A . 
F 4 HOH 14 214 143 HOH HOH A . 
F 4 HOH 15 215 107 HOH HOH A . 
F 4 HOH 16 216 123 HOH HOH A . 
F 4 HOH 17 217 144 HOH HOH A . 
F 4 HOH 18 218 118 HOH HOH A . 
F 4 HOH 19 219 104 HOH HOH A . 
F 4 HOH 20 220 105 HOH HOH A . 
F 4 HOH 21 221 151 HOH HOH A . 
F 4 HOH 22 222 142 HOH HOH A . 
F 4 HOH 23 223 117 HOH HOH A . 
F 4 HOH 24 224 119 HOH HOH A . 
F 4 HOH 25 225 110 HOH HOH A . 
F 4 HOH 26 226 127 HOH HOH A . 
F 4 HOH 27 227 131 HOH HOH A . 
F 4 HOH 28 228 167 HOH HOH A . 
F 4 HOH 29 229 120 HOH HOH A . 
F 4 HOH 30 230 145 HOH HOH A . 
F 4 HOH 31 231 152 HOH HOH A . 
F 4 HOH 32 232 108 HOH HOH A . 
F 4 HOH 33 233 116 HOH HOH A . 
F 4 HOH 34 234 101 HOH HOH A . 
F 4 HOH 35 235 154 HOH HOH A . 
F 4 HOH 36 236 137 HOH HOH A . 
F 4 HOH 37 237 148 HOH HOH A . 
F 4 HOH 38 238 174 HOH HOH A . 
F 4 HOH 39 239 168 HOH HOH A . 
F 4 HOH 40 240 162 HOH HOH A . 
F 4 HOH 41 241 113 HOH HOH A . 
F 4 HOH 42 242 109 HOH HOH A . 
F 4 HOH 43 243 155 HOH HOH A . 
F 4 HOH 44 244 124 HOH HOH A . 
F 4 HOH 45 245 190 HOH HOH A . 
F 4 HOH 46 246 111 HOH HOH A . 
F 4 HOH 47 247 134 HOH HOH A . 
F 4 HOH 48 248 102 HOH HOH A . 
F 4 HOH 49 249 146 HOH HOH A . 
F 4 HOH 50 250 140 HOH HOH A . 
F 4 HOH 51 251 100 HOH HOH A . 
F 4 HOH 52 252 138 HOH HOH A . 
F 4 HOH 53 253 150 HOH HOH A . 
F 4 HOH 54 254 128 HOH HOH A . 
F 4 HOH 55 255 147 HOH HOH A . 
F 4 HOH 56 256 103 HOH HOH A . 
F 4 HOH 57 257 130 HOH HOH A . 
F 4 HOH 58 258 115 HOH HOH A . 
F 4 HOH 59 259 133 HOH HOH A . 
F 4 HOH 60 260 173 HOH HOH A . 
F 4 HOH 61 261 165 HOH HOH A . 
F 4 HOH 62 262 161 HOH HOH A . 
F 4 HOH 63 263 186 HOH HOH A . 
F 4 HOH 64 264 170 HOH HOH A . 
F 4 HOH 65 265 112 HOH HOH A . 
F 4 HOH 66 266 188 HOH HOH A . 
F 4 HOH 67 267 139 HOH HOH A . 
F 4 HOH 68 268 122 HOH HOH A . 
F 4 HOH 69 269 114 HOH HOH A . 
F 4 HOH 70 270 125 HOH HOH A . 
F 4 HOH 71 271 182 HOH HOH A . 
F 4 HOH 72 272 159 HOH HOH A . 
F 4 HOH 73 273 183 HOH HOH A . 
F 4 HOH 74 274 132 HOH HOH A . 
F 4 HOH 75 275 121 HOH HOH A . 
F 4 HOH 76 276 192 HOH HOH A . 
F 4 HOH 77 277 185 HOH HOH A . 
F 4 HOH 78 278 179 HOH HOH A . 
F 4 HOH 79 279 135 HOH HOH A . 
F 4 HOH 80 280 129 HOH HOH A . 
F 4 HOH 81 281 177 HOH HOH A . 
F 4 HOH 82 282 178 HOH HOH A . 
F 4 HOH 83 283 175 HOH HOH A . 
F 4 HOH 84 284 164 HOH HOH A . 
F 4 HOH 85 285 189 HOH HOH A . 
F 4 HOH 86 286 191 HOH HOH A . 
F 4 HOH 87 287 169 HOH HOH A . 
F 4 HOH 88 288 181 HOH HOH A . 
F 4 HOH 89 289 187 HOH HOH A . 
F 4 HOH 90 290 176 HOH HOH A . 
F 4 HOH 91 291 166 HOH HOH A . 
F 4 HOH 92 292 172 HOH HOH A . 
F 4 HOH 93 293 158 HOH HOH A . 
G 4 HOH 1  201 126 HOH HOH B . 
G 4 HOH 2  202 112 HOH HOH B . 
G 4 HOH 3  203 110 HOH HOH B . 
G 4 HOH 4  204 120 HOH HOH B . 
G 4 HOH 5  205 139 HOH HOH B . 
G 4 HOH 6  206 135 HOH HOH B . 
G 4 HOH 7  207 100 HOH HOH B . 
G 4 HOH 8  208 148 HOH HOH B . 
G 4 HOH 9  209 137 HOH HOH B . 
G 4 HOH 10 210 160 HOH HOH B . 
G 4 HOH 11 211 117 HOH HOH B . 
G 4 HOH 12 212 114 HOH HOH B . 
G 4 HOH 13 213 144 HOH HOH B . 
G 4 HOH 14 214 166 HOH HOH B . 
G 4 HOH 15 215 125 HOH HOH B . 
G 4 HOH 16 216 147 HOH HOH B . 
G 4 HOH 17 217 146 HOH HOH B . 
G 4 HOH 18 218 102 HOH HOH B . 
G 4 HOH 19 219 129 HOH HOH B . 
G 4 HOH 20 220 164 HOH HOH B . 
G 4 HOH 21 221 107 HOH HOH B . 
G 4 HOH 22 222 127 HOH HOH B . 
G 4 HOH 23 223 156 HOH HOH B . 
G 4 HOH 24 224 140 HOH HOH B . 
G 4 HOH 25 225 118 HOH HOH B . 
G 4 HOH 26 226 106 HOH HOH B . 
G 4 HOH 27 227 108 HOH HOH B . 
G 4 HOH 28 228 138 HOH HOH B . 
G 4 HOH 29 229 124 HOH HOH B . 
G 4 HOH 30 230 104 HOH HOH B . 
G 4 HOH 31 231 105 HOH HOH B . 
G 4 HOH 32 232 103 HOH HOH B . 
G 4 HOH 33 233 142 HOH HOH B . 
G 4 HOH 34 234 101 HOH HOH B . 
G 4 HOH 35 235 111 HOH HOH B . 
G 4 HOH 36 236 109 HOH HOH B . 
G 4 HOH 37 237 119 HOH HOH B . 
G 4 HOH 38 238 133 HOH HOH B . 
G 4 HOH 39 239 143 HOH HOH B . 
G 4 HOH 40 240 150 HOH HOH B . 
G 4 HOH 41 241 116 HOH HOH B . 
G 4 HOH 42 242 115 HOH HOH B . 
G 4 HOH 43 243 121 HOH HOH B . 
G 4 HOH 44 244 134 HOH HOH B . 
G 4 HOH 45 245 136 HOH HOH B . 
G 4 HOH 46 246 159 HOH HOH B . 
G 4 HOH 47 247 132 HOH HOH B . 
G 4 HOH 48 248 149 HOH HOH B . 
G 4 HOH 49 249 155 HOH HOH B . 
G 4 HOH 50 250 162 HOH HOH B . 
G 4 HOH 51 251 153 HOH HOH B . 
G 4 HOH 52 252 130 HOH HOH B . 
G 4 HOH 53 253 158 HOH HOH B . 
G 4 HOH 54 254 161 HOH HOH B . 
G 4 HOH 55 255 152 HOH HOH B . 
G 4 HOH 56 256 163 HOH HOH B . 
G 4 HOH 57 257 168 HOH HOH B . 
G 4 HOH 58 258 151 HOH HOH B . 
G 4 HOH 59 259 165 HOH HOH B . 
G 4 HOH 60 260 131 HOH HOH B . 
G 4 HOH 61 261 167 HOH HOH B . 
G 4 HOH 62 262 113 HOH HOH B . 
G 4 HOH 63 263 141 HOH HOH B . 
G 4 HOH 64 264 128 HOH HOH B . 
G 4 HOH 65 265 145 HOH HOH B . 
G 4 HOH 66 266 122 HOH HOH B . 
G 4 HOH 67 267 123 HOH HOH B . 
G 4 HOH 68 268 154 HOH HOH B . 
G 4 HOH 69 269 157 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F   
2 1 B,D,E,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1100 ? 
1 MORE         -21  ? 
1 'SSA (A^2)'  4170 ? 
2 'ABSA (A^2)' 1340 ? 
2 MORE         -16  ? 
2 'SSA (A^2)'  4310 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 15 ? A HIS 15  ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 NA ? C HEC .  ? A HEC 101 ? 1_555 84.8  ? 
2  NE2 ? A HIS 15 ? A HIS 15  ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 NB ? C HEC .  ? A HEC 101 ? 1_555 83.2  ? 
3  NA  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 NB ? C HEC .  ? A HEC 101 ? 1_555 85.2  ? 
4  NE2 ? A HIS 15 ? A HIS 15  ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 NC ? C HEC .  ? A HEC 101 ? 1_555 88.2  ? 
5  NA  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 NC ? C HEC .  ? A HEC 101 ? 1_555 171.6 ? 
6  NB  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 NC ? C HEC .  ? A HEC 101 ? 1_555 89.3  ? 
7  NE2 ? A HIS 15 ? A HIS 15  ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 ND ? C HEC .  ? A HEC 101 ? 1_555 90.4  ? 
8  NA  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 ND ? C HEC .  ? A HEC 101 ? 1_555 90.1  ? 
9  NB  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 ND ? C HEC .  ? A HEC 101 ? 1_555 172.4 ? 
10 NC  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 ND ? C HEC .  ? A HEC 101 ? 1_555 94.6  ? 
11 NE2 ? A HIS 15 ? A HIS 15  ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 SD ? A MET 53 ? A MET 53  ? 1_555 172.9 ? 
12 NA  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 SD ? A MET 53 ? A MET 53  ? 1_555 93.4  ? 
13 NB  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 SD ? A MET 53 ? A MET 53  ? 1_555 89.9  ? 
14 NC  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 SD ? A MET 53 ? A MET 53  ? 1_555 92.9  ? 
15 ND  ? C HEC .  ? A HEC 101 ? 1_555 FE ? C HEC . ? A HEC 101 ? 1_555 SD ? A MET 53 ? A MET 53  ? 1_555 96.4  ? 
16 NE2 ? B HIS 15 ? B HIS 15  ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 NA ? D HEC .  ? B HEC 101 ? 1_555 83.7  ? 
17 NE2 ? B HIS 15 ? B HIS 15  ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 NB ? D HEC .  ? B HEC 101 ? 1_555 83.6  ? 
18 NA  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 NB ? D HEC .  ? B HEC 101 ? 1_555 85.5  ? 
19 NE2 ? B HIS 15 ? B HIS 15  ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 NC ? D HEC .  ? B HEC 101 ? 1_555 87.2  ? 
20 NA  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 NC ? D HEC .  ? B HEC 101 ? 1_555 169.5 ? 
21 NB  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 NC ? D HEC .  ? B HEC 101 ? 1_555 88.2  ? 
22 NE2 ? B HIS 15 ? B HIS 15  ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 ND ? D HEC .  ? B HEC 101 ? 1_555 87.1  ? 
23 NA  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 ND ? D HEC .  ? B HEC 101 ? 1_555 90.6  ? 
24 NB  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 ND ? D HEC .  ? B HEC 101 ? 1_555 170.3 ? 
25 NC  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 ND ? D HEC .  ? B HEC 101 ? 1_555 94.3  ? 
26 NE2 ? B HIS 15 ? B HIS 15  ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 N1 ? E IMD .  ? B IMD 102 ? 1_555 173.7 ? 
27 NA  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 N1 ? E IMD .  ? B IMD 102 ? 1_555 92.3  ? 
28 NB  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 N1 ? E IMD .  ? B IMD 102 ? 1_555 91.3  ? 
29 NC  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 N1 ? E IMD .  ? B IMD 102 ? 1_555 96.3  ? 
30 ND  ? D HEC .  ? B HEC 101 ? 1_555 FE ? D HEC . ? B HEC 101 ? 1_555 N1 ? E IMD .  ? B IMD 102 ? 1_555 97.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-10-19 
2 'Structure model' 2 0 2019-10-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Atomic model'            
2 2 'Structure model' 'Data collection'         
3 2 'Structure model' 'Derived calculations'    
4 2 'Structure model' 'Non-polymer description' 
5 2 'Structure model' 'Structure summary'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' atom_site              
2  2 'Structure model' chem_comp              
3  2 'Structure model' entity                 
4  2 'Structure model' pdbx_entity_nonpoly    
5  2 'Structure model' pdbx_nonpoly_scheme    
6  2 'Structure model' pdbx_struct_conn_angle 
7  2 'Structure model' pdbx_struct_oper_list  
8  2 'Structure model' struct_conn            
9  2 'Structure model' struct_site            
10 2 'Structure model' struct_site_gen        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  2 'Structure model' '_atom_site.Cartn_x'                          
3  2 'Structure model' '_atom_site.Cartn_y'                          
4  2 'Structure model' '_atom_site.Cartn_z'                          
5  2 'Structure model' '_atom_site.auth_atom_id'                     
6  2 'Structure model' '_atom_site.auth_comp_id'                     
7  2 'Structure model' '_atom_site.label_atom_id'                    
8  2 'Structure model' '_atom_site.label_comp_id'                    
9  2 'Structure model' '_atom_site.pdbx_formal_charge'               
10 2 'Structure model' '_atom_site.type_symbol'                      
11 2 'Structure model' '_chem_comp.formula'                          
12 2 'Structure model' '_chem_comp.formula_weight'                   
13 2 'Structure model' '_chem_comp.id'                               
14 2 'Structure model' '_chem_comp.name'                             
15 2 'Structure model' '_chem_comp.pdbx_synonyms'                    
16 2 'Structure model' '_entity.formula_weight'                      
17 2 'Structure model' '_entity.pdbx_description'                    
18 2 'Structure model' '_pdbx_entity_nonpoly.comp_id'                
19 2 'Structure model' '_pdbx_entity_nonpoly.name'                   
20 2 'Structure model' '_pdbx_nonpoly_scheme.mon_id'                 
21 2 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id'             
22 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
23 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
24 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id'  
25 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 
26 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
27 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
28 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
29 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
30 2 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
31 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
32 2 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
33 2 'Structure model' '_struct_site.details'                        
34 2 'Structure model' '_struct_site.pdbx_auth_comp_id'              
35 2 'Structure model' '_struct_site_gen.auth_comp_id'               
36 2 'Structure model' '_struct_site_gen.label_comp_id'              
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? d*TREK       ? ? ? .        1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX       ? ? ? 1.9_1692 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT  ? ? ? 3.20     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? CrystalClear ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER       ? ? ? .        5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 65  ? ? O A HOH 201 ? ? 2.02 
2 1 O   B HOH 237 ? ? O B HOH 266 ? ? 2.03 
3 1 OE1 A GLU 65  ? ? O A HOH 202 ? ? 2.06 
4 1 OE2 A GLU 65  ? ? O A HOH 203 ? ? 2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 10 ? ? -140.62 -71.48 
2 1 ALA B 10 ? ? -145.28 -67.36 
3 1 LYS B 50 ? ? -55.87  109.04 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'HEME C'  HEC 
3 IMIDAZOLE IMD 
4 water     HOH 
#