data_5BNG
# 
_entry.id   5BNG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5BNG         
WWPDB D_1000210210 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5BNG 
_pdbx_database_status.recvd_initial_deposition_date   2015-05-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Morgunova, E.' 1  
'Jolma, A.'     2  
'Yin, Y.'       3  
'Nitta, K.'     4  
'Dave, K.'      5  
'Popov, A.'     6  
'Taipale, M.'   7  
'Enge, M.'      8  
'Kivioja, T.'   9  
'Taipale, J.'   10 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            527 
_citation.language                  ? 
_citation.page_first                384 
_citation.page_last                 388 
_citation.title                     'DNA-dependent formation of transcription factor pairs alters their binding specificity.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature15518 
_citation.pdbx_database_id_PubMed   26550823 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jolma, A.'     1  
primary 'Yin, Y.'       2  
primary 'Nitta, K.R.'   3  
primary 'Dave, K.'      4  
primary 'Popov, A.'     5  
primary 'Taipale, M.'   6  
primary 'Enge, M.'      7  
primary 'Kivioja, T.'   8  
primary 'Morgunova, E.' 9  
primary 'Taipale, J.'   10 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5BNG 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     45.900 
_cell.length_a_esd                 ? 
_cell.length_b                     59.940 
_cell.length_b_esd                 ? 
_cell.length_c                     107.940 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5BNG 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Homeobox protein Meis2'                              7129.208 2  ? ? 'residues 283-342' ? 
2 polymer syn 
;DNA (5'-D(P*TP*TP*AP*GP*CP*TP*GP*TP*CP*A)-3')
;
3035.003 1  ? ? ?                  ? 
3 polymer syn 
;DNA (5'-D(P*TP*GP*AP*CP*AP*GP*CP*TP*AP*A-3')
;
3671.418 1  ? ? ?                  ? 
4 polymer syn 
;DNA (5'-D(P*AP*AP*TP*TP*AP*GP*CP*TP*GP*TP*CP*A)-3')
;
3677.415 1  ? ? ?                  ? 
5 polymer syn 
;DNA (5'-D(P*TP*GP*AP*CP*AP*GP*CP*TP*AP*A)-3')
;
3053.031 1  ? ? ?                  ? 
6 water   nat water                                                 18.015   33 ? ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Meis1-related protein 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS 
FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS B,A ? 
2 polydeoxyribonucleotide no no '(DT)(DT)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)'                   TTAGCTGTCA L   ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DA)(DA)(DC)(DG)'           TGACAGCTAACG M   ? 
4 polydeoxyribonucleotide no no '(DG)(DA)(DT)(DT)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)'           GATTAGCTGTCA C   ? 
5 polydeoxyribonucleotide no no '(DT)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DA)(DA)'                   TGACAGCTAA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PHE n 
1 2  PRO n 
1 3  LYS n 
1 4  VAL n 
1 5  ALA n 
1 6  THR n 
1 7  ASN n 
1 8  ILE n 
1 9  MET n 
1 10 ARG n 
1 11 ALA n 
1 12 TRP n 
1 13 LEU n 
1 14 PHE n 
1 15 GLN n 
1 16 HIS n 
1 17 LEU n 
1 18 THR n 
1 19 HIS n 
1 20 PRO n 
1 21 TYR n 
1 22 PRO n 
1 23 SER n 
1 24 GLU n 
1 25 GLU n 
1 26 GLN n 
1 27 LYS n 
1 28 LYS n 
1 29 GLN n 
1 30 LEU n 
1 31 ALA n 
1 32 GLN n 
1 33 ASP n 
1 34 THR n 
1 35 GLY n 
1 36 LEU n 
1 37 THR n 
1 38 ILE n 
1 39 LEU n 
1 40 GLN n 
1 41 VAL n 
1 42 ASN n 
1 43 ASN n 
1 44 TRP n 
1 45 PHE n 
1 46 ILE n 
1 47 ASN n 
1 48 ALA n 
1 49 ARG n 
1 50 ARG n 
1 51 ARG n 
1 52 ILE n 
1 53 VAL n 
1 54 GLN n 
1 55 PRO n 
1 56 MET n 
1 57 ILE n 
1 58 ASP n 
1 59 GLN n 
1 60 SER n 
2 1  DT  n 
2 2  DT  n 
2 3  DA  n 
2 4  DG  n 
2 5  DC  n 
2 6  DT  n 
2 7  DG  n 
2 8  DT  n 
2 9  DC  n 
2 10 DA  n 
3 1  DT  n 
3 2  DG  n 
3 3  DA  n 
3 4  DC  n 
3 5  DA  n 
3 6  DG  n 
3 7  DC  n 
3 8  DT  n 
3 9  DA  n 
3 10 DA  n 
3 11 DC  n 
3 12 DG  n 
4 1  DG  n 
4 2  DA  n 
4 3  DT  n 
4 4  DT  n 
4 5  DA  n 
4 6  DG  n 
4 7  DC  n 
4 8  DT  n 
4 9  DG  n 
4 10 DT  n 
4 11 DC  n 
4 12 DA  n 
5 1  DT  n 
5 2  DG  n 
5 3  DA  n 
5 4  DC  n 
5 5  DA  n 
5 6  DG  n 
5 7  DC  n 
5 8  DT  n 
5 9  DA  n 
5 10 DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   60 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MEIS2, MRG1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              pLysS 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PETG20A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 10 'Homo sapiens' ? 9606 ? 
3 1 sample 1 12 'Homo sapiens' ? 9606 ? 
4 1 sample 1 12 'Homo sapiens' ? 9606 ? 
5 1 sample 1 10 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MEIS2_HUMAN O14770 O14770-4 1 FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS 283 
2 PDB 5BNG        5BNG   ?        2 ?                                                            1   
3 PDB 5BNG        5BNG   ?        3 ?                                                            1   
4 PDB 5BNG        5BNG   ?        4 ?                                                            1   
5 PDB 5BNG        5BNG   ?        5 ?                                                            1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5BNG B 1 ? 60 ? O14770 283 ? 342 ? 5  64 
2 2 5BNG L 1 ? 10 ? 5BNG   26  ? 35  ? 26 35 
3 3 5BNG M 1 ? 12 ? 5BNG   4   ? 16  ? 4  16 
4 1 5BNG A 1 ? 60 ? O14770 283 ? 342 ? 5  64 
5 4 5BNG C 1 ? 12 ? 5BNG   24  ? 35  ? 24 35 
6 5 5BNG D 1 ? 10 ? 5BNG   4   ? 13  ? 4  13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5BNG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.75 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.23 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.09 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 4000, magnesium chloride, PEG 400, HEPES' 
_exptl_crystal_grow.pdbx_pH_range   7-7.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-03-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.006370 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.006370 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            56 
_reflns.entry_id                         5BNG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.23 
_reflns.d_resolution_low                 42 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       10268 
_reflns.number_obs                       9233 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.1 
_reflns.pdbx_Rmerge_I_obs                0.34 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.23 
_reflns_shell.d_res_low                   3.35 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         1006 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           930 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             9.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                312.520 
_refine.B_iso_mean                               88.2163 
_refine.B_iso_min                                0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5BNG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.5000 
_refine.ls_d_res_low                             19.9190 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     7190 
_refine.ls_number_reflns_R_free                  302 
_refine.ls_number_reflns_R_work                  6888 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7400 
_refine.ls_percent_reflns_R_free                 4.2000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.3451 
_refine.ls_R_factor_R_free                       0.3881 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.3433 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.410 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 44.9100 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.6500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.5000 
_refine_hist.d_res_low                        19.9190 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             34 
_refine_hist.number_atoms_total               1931 
_refine_hist.pdbx_number_residues_total       163 
_refine_hist.pdbx_B_iso_mean_solvent          19.69 
_refine_hist.pdbx_number_atoms_protein        993 
_refine_hist.pdbx_number_atoms_nucleic_acid   904 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 2026 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.727  ? 2922 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.036  ? 327  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 221  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 24.063 ? 807  ? f_dihedral_angle_d ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.5002 
_refine_ls_shell.d_res_low                        4.4021 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             155 
_refine_ls_shell.number_reflns_R_work             3453 
_refine_ls_shell.percent_reflns_obs               100.0000 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.4032 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.3462 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5BNG 
_struct.title                        'monomer of TALE type homeobox transcription factor MEIS1 complexes with specific DNA' 
_struct.pdbx_descriptor              'Homeobox protein Meis2/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5BNG 
_struct_keywords.text            'Protein-DNA complex, transcription factor, TALE type homeobox protein' 
_struct_keywords.pdbx_keywords   PROTEIN/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 2  ? GLN A 15 ? PRO B 6  GLN B 19 1 ? 14 
HELX_P HELX_P2 AA2 SER A 23 ? GLY A 35 ? SER B 27 GLY B 39 1 ? 13 
HELX_P HELX_P3 AA3 THR A 37 ? ILE A 52 ? THR B 41 ILE B 56 1 ? 16 
HELX_P HELX_P4 AA4 ILE A 52 ? SER A 60 ? ILE B 56 SER B 64 1 ? 9  
HELX_P HELX_P5 AA5 VAL D 4  ? PHE D 14 ? VAL A 8  PHE A 18 1 ? 11 
HELX_P HELX_P6 AA6 GLN D 15 ? LEU D 17 ? GLN A 19 LEU A 21 5 ? 3  
HELX_P HELX_P7 AA7 GLU D 24 ? LEU D 30 ? GLU A 28 LEU A 34 1 ? 7  
HELX_P HELX_P8 AA8 THR D 37 ? VAL D 53 ? THR A 41 VAL A 57 1 ? 17 
HELX_P HELX_P9 AA9 VAL D 53 ? GLN D 59 ? VAL A 57 GLN A 63 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? E DT 3  N3 ? ? ? 1_555 F DA 10 N1 ? ? C DT 26 D DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2  hydrog ? ? E DT 3  O4 ? ? ? 1_555 F DA 10 N6 ? ? C DT 26 D DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3  hydrog ? ? E DT 4  N3 ? ? ? 1_555 F DA 9  N1 ? ? C DT 27 D DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4  hydrog ? ? E DT 4  O4 ? ? ? 1_555 F DA 9  N6 ? ? C DT 27 D DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5  hydrog ? ? E DG 6  N1 ? ? ? 1_555 F DC 7  N3 ? ? C DG 29 D DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6  hydrog ? ? E DG 6  N2 ? ? ? 1_555 F DC 7  O2 ? ? C DG 29 D DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7  hydrog ? ? E DG 6  O6 ? ? ? 1_555 F DC 7  N4 ? ? C DG 29 D DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8  hydrog ? ? E DC 7  N3 ? ? ? 1_555 F DG 6  N1 ? ? C DC 30 D DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9  hydrog ? ? E DC 7  N4 ? ? ? 1_555 F DG 6  O6 ? ? C DC 30 D DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10 hydrog ? ? E DC 7  O2 ? ? ? 1_555 F DG 6  N2 ? ? C DC 30 D DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11 hydrog ? ? E DT 8  O4 ? ? ? 1_555 F DC 4  N4 ? ? C DT 31 D DC 7  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog12 hydrog ? ? E DT 8  N3 ? ? ? 1_555 F DA 5  N1 ? ? C DT 31 D DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13 hydrog ? ? E DT 8  O4 ? ? ? 1_555 F DA 5  N6 ? ? C DT 31 D DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14 hydrog ? ? E DG 9  N1 ? ? ? 1_555 F DC 4  N3 ? ? C DG 32 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15 hydrog ? ? E DG 9  N2 ? ? ? 1_555 F DC 4  O2 ? ? C DG 32 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16 hydrog ? ? E DG 9  O6 ? ? ? 1_555 F DC 4  N4 ? ? C DG 32 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17 hydrog ? ? E DC 11 N3 ? ? ? 1_555 F DG 2  N1 ? ? C DC 34 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18 hydrog ? ? E DC 11 N4 ? ? ? 1_555 F DG 2  O6 ? ? C DC 34 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19 hydrog ? ? E DC 11 O2 ? ? ? 1_555 F DG 2  N2 ? ? C DC 34 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20 hydrog ? ? E DA 12 N1 ? ? ? 1_555 F DT 1  N3 ? ? C DA 35 D DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog21 hydrog ? ? B DT 1  O4 ? ? ? 1_555 C DA 9  N6 ? ? L DT 26 M DA 12 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog22 hydrog ? ? B DT 2  N3 ? ? ? 1_555 C DA 9  N1 ? ? L DT 27 M DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23 hydrog ? ? B DT 2  O4 ? ? ? 1_555 C DA 9  N6 ? ? L DT 27 M DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24 hydrog ? ? B DA 3  N1 ? ? ? 1_555 C DT 8  N3 ? ? L DA 28 M DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25 hydrog ? ? B DA 3  N6 ? ? ? 1_555 C DT 8  O4 ? ? L DA 28 M DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26 hydrog ? ? B DG 4  N2 ? ? ? 1_555 C DC 7  O2 ? ? L DG 29 M DC 10 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog27 hydrog ? ? B DC 5  N3 ? ? ? 1_555 C DG 6  N1 ? ? L DC 30 M DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28 hydrog ? ? B DC 5  N4 ? ? ? 1_555 C DG 6  O6 ? ? L DC 30 M DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29 hydrog ? ? B DC 5  O2 ? ? ? 1_555 C DG 6  N2 ? ? L DC 30 M DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30 hydrog ? ? B DT 6  N3 ? ? ? 1_555 C DA 5  N1 ? ? L DT 31 M DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31 hydrog ? ? B DT 6  O4 ? ? ? 1_555 C DA 5  N6 ? ? L DT 31 M DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32 hydrog ? ? B DG 7  N1 ? ? ? 1_555 C DA 3  N1 ? ? L DG 32 M DA 6  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog33 hydrog ? ? B DG 7  O6 ? ? ? 1_555 C DA 3  N6 ? ? L DG 32 M DA 6  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog34 hydrog ? ? B DG 7  N2 ? ? ? 1_555 C DC 4  O2 ? ? L DG 32 M DC 7  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog35 hydrog ? ? B DT 8  N3 ? ? ? 1_555 C DA 3  N1 ? ? L DT 33 M DA 6  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog36 hydrog ? ? B DC 9  N3 ? ? ? 1_555 C DG 2  N1 ? ? L DC 34 M DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37 hydrog ? ? B DC 9  N4 ? ? ? 1_555 C DG 2  O6 ? ? L DC 34 M DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38 hydrog ? ? B DC 9  O2 ? ? ? 1_555 C DG 2  N2 ? ? L DC 34 M DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39 hydrog ? ? B DA 10 N1 ? ? ? 1_555 C DT 1  N3 ? ? L DA 35 M DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 31 D . ? ALA 35 A GLN 32 D ? GLN 36 A 1 5.16  
2 LEU 36 D . ? LEU 40 A THR 37 D ? THR 41 A 1 16.89 
# 
_atom_sites.entry_id                    5BNG 
_atom_sites.fract_transf_matrix[1][1]   0.021786 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016683 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009264 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . PHE A 1 1  ? 6.386   7.089  4.832   1.00 76.59  ? 5   PHE B N     1 
ATOM   2    C CA    . PHE A 1 1  ? 7.369   6.815  3.788   1.00 73.06  ? 5   PHE B CA    1 
ATOM   3    C C     . PHE A 1 1  ? 6.998   5.620  2.909   1.00 77.01  ? 5   PHE B C     1 
ATOM   4    O O     . PHE A 1 1  ? 7.209   5.666  1.696   1.00 80.24  ? 5   PHE B O     1 
ATOM   5    C CB    . PHE A 1 1  ? 8.750   6.585  4.406   1.00 69.75  ? 5   PHE B CB    1 
ATOM   6    C CG    . PHE A 1 1  ? 9.633   7.798  4.373   1.00 64.69  ? 5   PHE B CG    1 
ATOM   7    C CD1   . PHE A 1 1  ? 10.100  8.295  3.167   1.00 60.91  ? 5   PHE B CD1   1 
ATOM   8    C CD2   . PHE A 1 1  ? 10.000  8.441  5.544   1.00 61.53  ? 5   PHE B CD2   1 
ATOM   9    C CE1   . PHE A 1 1  ? 10.911  9.412  3.128   1.00 59.97  ? 5   PHE B CE1   1 
ATOM   10   C CE2   . PHE A 1 1  ? 10.814  9.558  5.511   1.00 60.51  ? 5   PHE B CE2   1 
ATOM   11   C CZ    . PHE A 1 1  ? 11.269  10.043 4.300   1.00 59.58  ? 5   PHE B CZ    1 
ATOM   12   N N     . PRO A 1 2  ? 6.465   4.540  3.511   1.00 68.63  ? 6   PRO B N     1 
ATOM   13   C CA    . PRO A 1 2  ? 6.040   3.401  2.689   1.00 67.53  ? 6   PRO B CA    1 
ATOM   14   C C     . PRO A 1 2  ? 5.062   3.809  1.590   1.00 73.36  ? 6   PRO B C     1 
ATOM   15   O O     . PRO A 1 2  ? 4.124   4.565  1.845   1.00 73.43  ? 6   PRO B O     1 
ATOM   16   C CB    . PRO A 1 2  ? 5.371   2.467  3.701   1.00 64.88  ? 6   PRO B CB    1 
ATOM   17   C CG    . PRO A 1 2  ? 6.032   2.782  4.991   1.00 63.86  ? 6   PRO B CG    1 
ATOM   18   C CD    . PRO A 1 2  ? 6.333   4.253  4.952   1.00 64.39  ? 6   PRO B CD    1 
ATOM   19   N N     . LYS A 1 3  ? 5.294   3.313  0.379   1.00 73.82  ? 7   LYS B N     1 
ATOM   20   C CA    . LYS A 1 3  ? 4.487   3.687  -0.777  1.00 76.00  ? 7   LYS B CA    1 
ATOM   21   C C     . LYS A 1 3  ? 3.038   3.257  -0.583  1.00 77.11  ? 7   LYS B C     1 
ATOM   22   O O     . LYS A 1 3  ? 2.114   3.924  -1.048  1.00 77.51  ? 7   LYS B O     1 
ATOM   23   C CB    . LYS A 1 3  ? 5.066   3.065  -2.050  1.00 73.95  ? 7   LYS B CB    1 
ATOM   24   C CG    . LYS A 1 3  ? 6.540   3.391  -2.271  1.00 73.33  ? 7   LYS B CG    1 
ATOM   25   C CD    . LYS A 1 3  ? 7.106   2.693  -3.497  1.00 72.94  ? 7   LYS B CD    1 
ATOM   26   C CE    . LYS A 1 3  ? 6.579   3.302  -4.786  1.00 72.06  ? 7   LYS B CE    1 
ATOM   27   N NZ    . LYS A 1 3  ? 7.226   2.705  -5.986  1.00 72.18  ? 7   LYS B NZ    1 
ATOM   28   N N     . VAL A 1 4  ? 2.848   2.142  0.114   1.00 66.12  ? 8   VAL B N     1 
ATOM   29   C CA    . VAL A 1 4  ? 1.509   1.667  0.447   1.00 64.36  ? 8   VAL B CA    1 
ATOM   30   C C     . VAL A 1 4  ? 0.862   2.560  1.497   1.00 58.22  ? 8   VAL B C     1 
ATOM   31   O O     . VAL A 1 4  ? -0.331  2.852  1.420   1.00 51.53  ? 8   VAL B O     1 
ATOM   32   C CB    . VAL A 1 4  ? 1.520   0.209  0.973   1.00 80.47  ? 8   VAL B CB    1 
ATOM   33   C CG1   . VAL A 1 4  ? 1.765   -0.763 -0.163  1.00 82.11  ? 8   VAL B CG1   1 
ATOM   34   C CG2   . VAL A 1 4  ? 2.554   0.022  2.091   1.00 82.37  ? 8   VAL B CG2   1 
ATOM   35   N N     . ALA A 1 5  ? 1.654   2.992  2.474   1.00 50.88  ? 9   ALA B N     1 
ATOM   36   C CA    . ALA A 1 5  ? 1.146   3.808  3.570   1.00 53.24  ? 9   ALA B CA    1 
ATOM   37   C C     . ALA A 1 5  ? 0.538   5.104  3.051   1.00 55.95  ? 9   ALA B C     1 
ATOM   38   O O     . ALA A 1 5  ? -0.405  5.630  3.635   1.00 65.68  ? 9   ALA B O     1 
ATOM   39   C CB    . ALA A 1 5  ? 2.254   4.109  4.567   1.00 51.49  ? 9   ALA B CB    1 
ATOM   40   N N     . THR A 1 6  ? 1.077   5.614  1.950   1.00 69.26  ? 10  THR B N     1 
ATOM   41   C CA    . THR A 1 6  ? 0.575   6.851  1.368   1.00 69.06  ? 10  THR B CA    1 
ATOM   42   C C     . THR A 1 6  ? -0.815  6.637  0.774   1.00 74.46  ? 10  THR B C     1 
ATOM   43   O O     . THR A 1 6  ? -1.727  7.427  1.015   1.00 76.61  ? 10  THR B O     1 
ATOM   44   C CB    . THR A 1 6  ? 1.516   7.386  0.274   1.00 70.09  ? 10  THR B CB    1 
ATOM   45   O OG1   . THR A 1 6  ? 2.878   7.127  0.640   1.00 75.02  ? 10  THR B OG1   1 
ATOM   46   C CG2   . THR A 1 6  ? 1.315   8.882  0.085   1.00 73.44  ? 10  THR B CG2   1 
ATOM   47   N N     . ASN A 1 7  ? -0.970  5.559  0.011   1.00 64.77  ? 11  ASN B N     1 
ATOM   48   C CA    . ASN A 1 7  ? -2.230  5.257  -0.663  1.00 63.41  ? 11  ASN B CA    1 
ATOM   49   C C     . ASN A 1 7  ? -3.415  5.153  0.293   1.00 62.64  ? 11  ASN B C     1 
ATOM   50   O O     . ASN A 1 7  ? -4.475  5.728  0.045   1.00 58.01  ? 11  ASN B O     1 
ATOM   51   C CB    . ASN A 1 7  ? -2.102  3.952  -1.450  1.00 66.63  ? 11  ASN B CB    1 
ATOM   52   C CG    . ASN A 1 7  ? -1.054  4.029  -2.540  1.00 68.56  ? 11  ASN B CG    1 
ATOM   53   O OD1   . ASN A 1 7  ? -0.191  4.907  -2.527  1.00 69.43  ? 11  ASN B OD1   1 
ATOM   54   N ND2   . ASN A 1 7  ? -1.123  3.107  -3.493  1.00 70.37  ? 11  ASN B ND2   1 
ATOM   55   N N     . ILE A 1 8  ? -3.231  4.416  1.384   1.00 52.01  ? 12  ILE B N     1 
ATOM   56   C CA    . ILE A 1 8  ? -4.306  4.187  2.344   1.00 60.19  ? 12  ILE B CA    1 
ATOM   57   C C     . ILE A 1 8  ? -4.694  5.490  3.041   1.00 62.38  ? 12  ILE B C     1 
ATOM   58   O O     . ILE A 1 8  ? -5.855  5.690  3.398   1.00 69.43  ? 12  ILE B O     1 
ATOM   59   C CB    . ILE A 1 8  ? -3.901  3.139  3.407   1.00 64.18  ? 12  ILE B CB    1 
ATOM   60   C CG1   . ILE A 1 8  ? -3.376  1.861  2.741   1.00 69.91  ? 12  ILE B CG1   1 
ATOM   61   C CG2   . ILE A 1 8  ? -5.076  2.814  4.325   1.00 66.65  ? 12  ILE B CG2   1 
ATOM   62   C CD1   . ILE A 1 8  ? -4.355  1.193  1.786   1.00 71.37  ? 12  ILE B CD1   1 
ATOM   63   N N     . MET A 1 9  ? -3.717  6.372  3.229   1.00 108.00 ? 13  MET B N     1 
ATOM   64   C CA    . MET A 1 9  ? -3.958  7.657  3.877   1.00 103.71 ? 13  MET B CA    1 
ATOM   65   C C     . MET A 1 9  ? -4.569  8.654  2.894   1.00 100.15 ? 13  MET B C     1 
ATOM   66   O O     . MET A 1 9  ? -5.328  9.540  3.289   1.00 100.75 ? 13  MET B O     1 
ATOM   67   C CB    . MET A 1 9  ? -2.655  8.216  4.456   1.00 103.52 ? 13  MET B CB    1 
ATOM   68   C CG    . MET A 1 9  ? -2.001  7.314  5.501   1.00 105.21 ? 13  MET B CG    1 
ATOM   69   S SD    . MET A 1 9  ? -2.757  7.398  7.134   1.00 32.91  ? 13  MET B SD    1 
ATOM   70   C CE    . MET A 1 9  ? -2.238  9.029  7.661   1.00 28.17  ? 13  MET B CE    1 
ATOM   71   N N     . ARG A 1 10 ? -4.238  8.505  1.614   1.00 87.99  ? 14  ARG B N     1 
ATOM   72   C CA    . ARG A 1 10 ? -4.760  9.397  0.581   1.00 81.21  ? 14  ARG B CA    1 
ATOM   73   C C     . ARG A 1 10 ? -6.252  9.176  0.350   1.00 74.10  ? 14  ARG B C     1 
ATOM   74   O O     . ARG A 1 10 ? -6.996  10.126 0.106   1.00 74.40  ? 14  ARG B O     1 
ATOM   75   C CB    . ARG A 1 10 ? -4.005  9.204  -0.739  1.00 82.54  ? 14  ARG B CB    1 
ATOM   76   C CG    . ARG A 1 10 ? -2.660  9.918  -0.814  1.00 83.69  ? 14  ARG B CG    1 
ATOM   77   C CD    . ARG A 1 10 ? -2.222  10.120 -2.259  1.00 84.28  ? 14  ARG B CD    1 
ATOM   78   N NE    . ARG A 1 10 ? -2.363  8.902  -3.057  1.00 84.89  ? 14  ARG B NE    1 
ATOM   79   C CZ    . ARG A 1 10 ? -1.417  7.977  -3.208  1.00 84.80  ? 14  ARG B CZ    1 
ATOM   80   N NH1   . ARG A 1 10 ? -0.237  8.109  -2.616  1.00 84.89  ? 14  ARG B NH1   1 
ATOM   81   N NH2   . ARG A 1 10 ? -1.656  6.910  -3.959  1.00 85.36  ? 14  ARG B NH2   1 
ATOM   82   N N     . ALA A 1 11 ? -6.683  7.921  0.426   1.00 76.51  ? 15  ALA B N     1 
ATOM   83   C CA    . ALA A 1 11 ? -8.072  7.570  0.148   1.00 69.46  ? 15  ALA B CA    1 
ATOM   84   C C     . ALA A 1 11 ? -9.023  8.218  1.147   1.00 63.94  ? 15  ALA B C     1 
ATOM   85   O O     . ALA A 1 11 ? -9.930  8.954  0.760   1.00 64.38  ? 15  ALA B O     1 
ATOM   86   C CB    . ALA A 1 11 ? -8.246  6.061  0.160   1.00 69.64  ? 15  ALA B CB    1 
ATOM   87   N N     . TRP A 1 12 ? -8.809  7.940  2.431   1.00 61.79  ? 16  TRP B N     1 
ATOM   88   C CA    . TRP A 1 12 ? -9.667  8.467  3.488   1.00 56.55  ? 16  TRP B CA    1 
ATOM   89   C C     . TRP A 1 12 ? -9.750  9.987  3.416   1.00 55.99  ? 16  TRP B C     1 
ATOM   90   O O     . TRP A 1 12 ? -10.801 10.573 3.678   1.00 56.54  ? 16  TRP B O     1 
ATOM   91   C CB    . TRP A 1 12 ? -9.155  8.036  4.865   1.00 51.50  ? 16  TRP B CB    1 
ATOM   92   C CG    . TRP A 1 12 ? -10.146 8.279  5.970   1.00 47.28  ? 16  TRP B CG    1 
ATOM   93   C CD1   . TRP A 1 12 ? -11.004 7.369  6.517   1.00 46.99  ? 16  TRP B CD1   1 
ATOM   94   C CD2   . TRP A 1 12 ? -10.383 9.515  6.656   1.00 44.37  ? 16  TRP B CD2   1 
ATOM   95   N NE1   . TRP A 1 12 ? -11.759 7.960  7.501   1.00 46.40  ? 16  TRP B NE1   1 
ATOM   96   C CE2   . TRP A 1 12 ? -11.397 9.277  7.606   1.00 44.32  ? 16  TRP B CE2   1 
ATOM   97   C CE3   . TRP A 1 12 ? -9.837  10.798 6.561   1.00 41.85  ? 16  TRP B CE3   1 
ATOM   98   C CZ2   . TRP A 1 12 ? -11.875 10.275 8.453   1.00 44.00  ? 16  TRP B CZ2   1 
ATOM   99   C CZ3   . TRP A 1 12 ? -10.313 11.787 7.402   1.00 41.49  ? 16  TRP B CZ3   1 
ATOM   100  C CH2   . TRP A 1 12 ? -11.321 11.520 8.336   1.00 42.57  ? 16  TRP B CH2   1 
ATOM   101  N N     . LEU A 1 13 ? -8.639  10.619 3.050   1.00 51.22  ? 17  LEU B N     1 
ATOM   102  C CA    . LEU A 1 13 ? -8.586  12.070 2.923   1.00 50.70  ? 17  LEU B CA    1 
ATOM   103  C C     . LEU A 1 13 ? -9.590  12.559 1.887   1.00 53.78  ? 17  LEU B C     1 
ATOM   104  O O     . LEU A 1 13 ? -10.494 13.333 2.202   1.00 56.74  ? 17  LEU B O     1 
ATOM   105  C CB    . LEU A 1 13 ? -7.176  12.525 2.540   1.00 49.14  ? 17  LEU B CB    1 
ATOM   106  C CG    . LEU A 1 13 ? -6.952  14.038 2.492   1.00 47.57  ? 17  LEU B CG    1 
ATOM   107  C CD1   . LEU A 1 13 ? -6.918  14.620 3.895   1.00 47.43  ? 17  LEU B CD1   1 
ATOM   108  C CD2   . LEU A 1 13 ? -5.674  14.366 1.741   1.00 46.50  ? 17  LEU B CD2   1 
ATOM   109  N N     . PHE A 1 14 ? -9.431  12.099 0.651   1.00 63.14  ? 18  PHE B N     1 
ATOM   110  C CA    . PHE A 1 14 ? -10.303 12.527 -0.436  1.00 62.35  ? 18  PHE B CA    1 
ATOM   111  C C     . PHE A 1 14 ? -11.706 11.950 -0.285  1.00 62.91  ? 18  PHE B C     1 
ATOM   112  O O     . PHE A 1 14 ? -12.651 12.430 -0.911  1.00 62.88  ? 18  PHE B O     1 
ATOM   113  C CB    . PHE A 1 14 ? -9.703  12.132 -1.786  1.00 61.67  ? 18  PHE B CB    1 
ATOM   114  C CG    . PHE A 1 14 ? -8.658  13.093 -2.282  1.00 61.31  ? 18  PHE B CG    1 
ATOM   115  C CD1   . PHE A 1 14 ? -7.323  12.928 -1.947  1.00 61.50  ? 18  PHE B CD1   1 
ATOM   116  C CD2   . PHE A 1 14 ? -9.014  14.172 -3.075  1.00 60.97  ? 18  PHE B CD2   1 
ATOM   117  C CE1   . PHE A 1 14 ? -6.364  13.817 -2.401  1.00 61.67  ? 18  PHE B CE1   1 
ATOM   118  C CE2   . PHE A 1 14 ? -8.060  15.063 -3.531  1.00 61.10  ? 18  PHE B CE2   1 
ATOM   119  C CZ    . PHE A 1 14 ? -6.734  14.886 -3.193  1.00 61.41  ? 18  PHE B CZ    1 
ATOM   120  N N     . GLN A 1 15 ? -11.840 10.926 0.552   1.00 64.30  ? 19  GLN B N     1 
ATOM   121  C CA    . GLN A 1 15 ? -13.151 10.386 0.889   1.00 66.20  ? 19  GLN B CA    1 
ATOM   122  C C     . GLN A 1 15 ? -13.822 11.239 1.963   1.00 65.56  ? 19  GLN B C     1 
ATOM   123  O O     . GLN A 1 15 ? -15.001 11.051 2.270   1.00 66.13  ? 19  GLN B O     1 
ATOM   124  C CB    . GLN A 1 15 ? -13.032 8.935  1.361   1.00 66.39  ? 19  GLN B CB    1 
ATOM   125  C CG    . GLN A 1 15 ? -12.821 7.933  0.237   1.00 66.45  ? 19  GLN B CG    1 
ATOM   126  C CD    . GLN A 1 15 ? -12.604 6.524  0.751   1.00 67.20  ? 19  GLN B CD    1 
ATOM   127  O OE1   . GLN A 1 15 ? -12.706 6.267  1.951   1.00 67.57  ? 19  GLN B OE1   1 
ATOM   128  N NE2   . GLN A 1 15 ? -12.301 5.603  -0.156  1.00 67.39  ? 19  GLN B NE2   1 
ATOM   129  N N     . HIS A 1 16 ? -13.065 12.177 2.531   1.00 48.58  ? 20  HIS B N     1 
ATOM   130  C CA    . HIS A 1 16 ? -13.578 13.072 3.566   1.00 49.27  ? 20  HIS B CA    1 
ATOM   131  C C     . HIS A 1 16 ? -12.961 14.466 3.449   1.00 47.01  ? 20  HIS B C     1 
ATOM   132  O O     . HIS A 1 16 ? -12.372 14.973 4.403   1.00 47.53  ? 20  HIS B O     1 
ATOM   133  C CB    . HIS A 1 16 ? -13.296 12.502 4.959   1.00 52.46  ? 20  HIS B CB    1 
ATOM   134  C CG    . HIS A 1 16 ? -13.855 11.132 5.181   1.00 55.62  ? 20  HIS B CG    1 
ATOM   135  N ND1   . HIS A 1 16 ? -13.250 9.992  4.699   1.00 56.99  ? 20  HIS B ND1   1 
ATOM   136  C CD2   . HIS A 1 16 ? -14.964 10.718 5.841   1.00 57.75  ? 20  HIS B CD2   1 
ATOM   137  C CE1   . HIS A 1 16 ? -13.961 8.935  5.048   1.00 58.44  ? 20  HIS B CE1   1 
ATOM   138  N NE2   . HIS A 1 16 ? -15.007 9.349  5.741   1.00 58.94  ? 20  HIS B NE2   1 
ATOM   139  N N     . LEU A 1 17 ? -13.100 15.083 2.279   1.00 61.68  ? 21  LEU B N     1 
ATOM   140  C CA    . LEU A 1 17 ? -12.539 16.410 2.043   1.00 60.79  ? 21  LEU B CA    1 
ATOM   141  C C     . LEU A 1 17 ? -13.260 17.481 2.856   1.00 59.96  ? 21  LEU B C     1 
ATOM   142  O O     . LEU A 1 17 ? -12.707 18.551 3.114   1.00 61.36  ? 21  LEU B O     1 
ATOM   143  C CB    . LEU A 1 17 ? -12.602 16.762 0.554   1.00 60.88  ? 21  LEU B CB    1 
ATOM   144  C CG    . LEU A 1 17 ? -11.714 15.932 -0.374  1.00 61.46  ? 21  LEU B CG    1 
ATOM   145  C CD1   . LEU A 1 17 ? -11.996 16.264 -1.831  1.00 62.11  ? 21  LEU B CD1   1 
ATOM   146  C CD2   . LEU A 1 17 ? -10.238 16.150 -0.057  1.00 61.39  ? 21  LEU B CD2   1 
ATOM   147  N N     . THR A 1 18 ? -14.495 17.191 3.253   1.00 58.62  ? 22  THR B N     1 
ATOM   148  C CA    . THR A 1 18 ? -15.291 18.131 4.036   1.00 56.80  ? 22  THR B CA    1 
ATOM   149  C C     . THR A 1 18 ? -15.075 17.926 5.533   1.00 55.50  ? 22  THR B C     1 
ATOM   150  O O     . THR A 1 18 ? -15.196 18.866 6.319   1.00 57.23  ? 22  THR B O     1 
ATOM   151  C CB    . THR A 1 18 ? -16.790 17.996 3.717   1.00 56.96  ? 22  THR B CB    1 
ATOM   152  O OG1   . THR A 1 18 ? -17.209 16.641 3.921   1.00 56.76  ? 22  THR B OG1   1 
ATOM   153  C CG2   . THR A 1 18 ? -17.061 18.398 2.276   1.00 56.59  ? 22  THR B CG2   1 
ATOM   154  N N     . HIS A 1 19 ? -14.758 16.692 5.918   1.00 52.75  ? 23  HIS B N     1 
ATOM   155  C CA    . HIS A 1 19 ? -14.435 16.369 7.306   1.00 50.51  ? 23  HIS B CA    1 
ATOM   156  C C     . HIS A 1 19 ? -13.144 15.558 7.362   1.00 49.22  ? 23  HIS B C     1 
ATOM   157  O O     . HIS A 1 19 ? -13.166 14.366 7.664   1.00 49.65  ? 23  HIS B O     1 
ATOM   158  C CB    . HIS A 1 19 ? -15.580 15.596 7.970   1.00 50.86  ? 23  HIS B CB    1 
ATOM   159  C CG    . HIS A 1 19 ? -15.375 15.354 9.435   1.00 51.12  ? 23  HIS B CG    1 
ATOM   160  N ND1   . HIS A 1 19 ? -16.049 14.374 10.131  1.00 51.07  ? 23  HIS B ND1   1 
ATOM   161  C CD2   . HIS A 1 19 ? -14.567 15.966 10.333  1.00 50.65  ? 23  HIS B CD2   1 
ATOM   162  C CE1   . HIS A 1 19 ? -15.666 14.394 11.396  1.00 51.73  ? 23  HIS B CE1   1 
ATOM   163  N NE2   . HIS A 1 19 ? -14.768 15.350 11.544  1.00 51.69  ? 23  HIS B NE2   1 
ATOM   164  N N     . PRO A 1 20 ? -12.007 16.208 7.071   1.00 48.12  ? 24  PRO B N     1 
ATOM   165  C CA    . PRO A 1 20 ? -10.700 15.542 7.060   1.00 48.37  ? 24  PRO B CA    1 
ATOM   166  C C     . PRO A 1 20 ? -10.131 15.304 8.462   1.00 54.12  ? 24  PRO B C     1 
ATOM   167  O O     . PRO A 1 20 ? -8.924  15.097 8.609   1.00 54.81  ? 24  PRO B O     1 
ATOM   168  C CB    . PRO A 1 20 ? -9.826  16.521 6.272   1.00 45.24  ? 24  PRO B CB    1 
ATOM   169  C CG    . PRO A 1 20 ? -10.425 17.851 6.545   1.00 44.10  ? 24  PRO B CG    1 
ATOM   170  C CD    . PRO A 1 20 ? -11.906 17.624 6.673   1.00 45.86  ? 24  PRO B CD    1 
ATOM   171  N N     . TYR A 1 21 ? -11.000 15.324 9.469   1.00 56.37  ? 25  TYR B N     1 
ATOM   172  C CA    . TYR A 1 21 ? -10.598 15.144 10.859  1.00 58.73  ? 25  TYR B CA    1 
ATOM   173  C C     . TYR A 1 21 ? -11.106 13.810 11.398  1.00 67.37  ? 25  TYR B C     1 
ATOM   174  O O     . TYR A 1 21 ? -12.222 13.735 11.914  1.00 70.09  ? 25  TYR B O     1 
ATOM   175  C CB    . TYR A 1 21 ? -11.129 16.294 11.714  1.00 51.78  ? 25  TYR B CB    1 
ATOM   176  C CG    . TYR A 1 21 ? -10.604 17.647 11.293  1.00 43.93  ? 25  TYR B CG    1 
ATOM   177  C CD1   . TYR A 1 21 ? -11.069 18.266 10.141  1.00 39.11  ? 25  TYR B CD1   1 
ATOM   178  C CD2   . TYR A 1 21 ? -9.646  18.305 12.048  1.00 39.91  ? 25  TYR B CD2   1 
ATOM   179  C CE1   . TYR A 1 21 ? -10.591 19.500 9.751   1.00 36.52  ? 25  TYR B CE1   1 
ATOM   180  C CE2   . TYR A 1 21 ? -9.163  19.540 11.667  1.00 37.10  ? 25  TYR B CE2   1 
ATOM   181  C CZ    . TYR A 1 21 ? -9.640  20.134 10.518  1.00 35.19  ? 25  TYR B CZ    1 
ATOM   182  O OH    . TYR A 1 21 ? -9.165  21.366 10.128  1.00 34.95  ? 25  TYR B OH    1 
ATOM   183  N N     . PRO A 1 22 ? -10.293 12.748 11.274  1.00 55.79  ? 26  PRO B N     1 
ATOM   184  C CA    . PRO A 1 22 ? -10.736 11.424 11.726  1.00 58.66  ? 26  PRO B CA    1 
ATOM   185  C C     . PRO A 1 22 ? -10.870 11.322 13.242  1.00 67.44  ? 26  PRO B C     1 
ATOM   186  O O     . PRO A 1 22 ? -10.388 12.193 13.966  1.00 64.30  ? 26  PRO B O     1 
ATOM   187  C CB    . PRO A 1 22 ? -9.632  10.493 11.215  1.00 56.64  ? 26  PRO B CB    1 
ATOM   188  C CG    . PRO A 1 22 ? -8.431  11.353 11.117  1.00 55.05  ? 26  PRO B CG    1 
ATOM   189  C CD    . PRO A 1 22 ? -8.928  12.709 10.720  1.00 53.37  ? 26  PRO B CD    1 
ATOM   190  N N     . SER A 1 23 ? -11.527 10.263 13.704  1.00 65.44  ? 27  SER B N     1 
ATOM   191  C CA    . SER A 1 23 ? -11.704 10.020 15.131  1.00 77.97  ? 27  SER B CA    1 
ATOM   192  C C     . SER A 1 23 ? -10.615 9.090  15.650  1.00 87.24  ? 27  SER B C     1 
ATOM   193  O O     . SER A 1 23 ? -9.861  8.510  14.868  1.00 86.60  ? 27  SER B O     1 
ATOM   194  C CB    . SER A 1 23 ? -13.085 9.421  15.404  1.00 82.06  ? 27  SER B CB    1 
ATOM   195  O OG    . SER A 1 23 ? -13.251 8.194  14.715  1.00 83.12  ? 27  SER B OG    1 
ATOM   196  N N     . GLU A 1 24 ? -10.538 8.948  16.970  1.00 94.36  ? 28  GLU B N     1 
ATOM   197  C CA    . GLU A 1 24 ? -9.555  8.069  17.593  1.00 101.70 ? 28  GLU B CA    1 
ATOM   198  C C     . GLU A 1 24 ? -9.732  6.630  17.119  1.00 110.68 ? 28  GLU B C     1 
ATOM   199  O O     . GLU A 1 24 ? -8.781  5.850  17.109  1.00 112.80 ? 28  GLU B O     1 
ATOM   200  C CB    . GLU A 1 24 ? -9.664  8.136  19.118  1.00 103.15 ? 28  GLU B CB    1 
ATOM   201  C CG    . GLU A 1 24 ? -9.253  9.476  19.713  1.00 102.31 ? 28  GLU B CG    1 
ATOM   202  C CD    . GLU A 1 24 ? -7.784  9.793  19.495  1.00 100.67 ? 28  GLU B CD    1 
ATOM   203  O OE1   . GLU A 1 24 ? -7.006  8.862  19.197  1.00 100.35 ? 28  GLU B OE1   1 
ATOM   204  O OE2   . GLU A 1 24 ? -7.408  10.978 19.620  1.00 99.83  ? 28  GLU B OE2   1 
ATOM   205  N N     . GLU A 1 25 ? -10.955 6.285  16.728  1.00 126.04 ? 29  GLU B N     1 
ATOM   206  C CA    . GLU A 1 25 ? -11.245 4.961  16.193  1.00 127.68 ? 29  GLU B CA    1 
ATOM   207  C C     . GLU A 1 25 ? -10.617 4.789  14.815  1.00 126.17 ? 29  GLU B C     1 
ATOM   208  O O     . GLU A 1 25 ? -10.044 3.744  14.509  1.00 127.38 ? 29  GLU B O     1 
ATOM   209  C CB    . GLU A 1 25 ? -12.759 4.736  16.118  1.00 129.51 ? 29  GLU B CB    1 
ATOM   210  C CG    . GLU A 1 25 ? -13.178 3.438  15.435  1.00 131.25 ? 29  GLU B CG    1 
ATOM   211  C CD    . GLU A 1 25 ? -12.627 2.203  16.123  1.00 133.71 ? 29  GLU B CD    1 
ATOM   212  O OE1   . GLU A 1 25 ? -12.293 2.285  17.324  1.00 135.53 ? 29  GLU B OE1   1 
ATOM   213  O OE2   . GLU A 1 25 ? -12.530 1.148  15.462  1.00 134.58 ? 29  GLU B OE2   1 
ATOM   214  N N     . GLN A 1 26 ? -10.724 5.824  13.989  1.00 79.13  ? 30  GLN B N     1 
ATOM   215  C CA    . GLN A 1 26 ? -10.207 5.780  12.626  1.00 78.94  ? 30  GLN B CA    1 
ATOM   216  C C     . GLN A 1 26 ? -8.694  5.980  12.591  1.00 73.74  ? 30  GLN B C     1 
ATOM   217  O O     . GLN A 1 26 ? -8.010  5.437  11.723  1.00 70.78  ? 30  GLN B O     1 
ATOM   218  C CB    . GLN A 1 26 ? -10.894 6.843  11.767  1.00 81.38  ? 30  GLN B CB    1 
ATOM   219  C CG    . GLN A 1 26 ? -12.385 6.604  11.570  1.00 84.59  ? 30  GLN B CG    1 
ATOM   220  C CD    . GLN A 1 26 ? -13.091 7.784  10.930  1.00 83.39  ? 30  GLN B CD    1 
ATOM   221  O OE1   . GLN A 1 26 ? -12.733 8.938  11.164  1.00 82.16  ? 30  GLN B OE1   1 
ATOM   222  N NE2   . GLN A 1 26 ? -14.101 7.500  10.116  1.00 82.74  ? 30  GLN B NE2   1 
ATOM   223  N N     . LYS A 1 27 ? -8.180  6.761  13.536  1.00 79.92  ? 31  LYS B N     1 
ATOM   224  C CA    . LYS A 1 27 ? -6.747  7.027  13.617  1.00 77.46  ? 31  LYS B CA    1 
ATOM   225  C C     . LYS A 1 27 ? -5.959  5.742  13.845  1.00 79.85  ? 31  LYS B C     1 
ATOM   226  O O     . LYS A 1 27 ? -4.950  5.498  13.182  1.00 78.53  ? 31  LYS B O     1 
ATOM   227  C CB    . LYS A 1 27 ? -6.449  8.027  14.737  1.00 75.49  ? 31  LYS B CB    1 
ATOM   228  C CG    . LYS A 1 27 ? -6.792  9.469  14.394  1.00 71.50  ? 31  LYS B CG    1 
ATOM   229  C CD    . LYS A 1 27 ? -6.592  10.386 15.589  1.00 70.40  ? 31  LYS B CD    1 
ATOM   230  C CE    . LYS A 1 27 ? -6.945  11.825 15.253  1.00 68.83  ? 31  LYS B CE    1 
ATOM   231  N NZ    . LYS A 1 27 ? -6.774  12.730 16.423  1.00 70.16  ? 31  LYS B NZ    1 
ATOM   232  N N     . LYS A 1 28 ? -6.423  4.922  14.782  1.00 79.13  ? 32  LYS B N     1 
ATOM   233  C CA    . LYS A 1 28 ? -5.761  3.658  15.082  1.00 81.95  ? 32  LYS B CA    1 
ATOM   234  C C     . LYS A 1 28 ? -6.015  2.643  13.972  1.00 81.19  ? 32  LYS B C     1 
ATOM   235  O O     . LYS A 1 28 ? -5.149  1.826  13.656  1.00 83.42  ? 32  LYS B O     1 
ATOM   236  C CB    . LYS A 1 28 ? -6.240  3.103  16.426  1.00 86.52  ? 32  LYS B CB    1 
ATOM   237  C CG    . LYS A 1 28 ? -7.722  2.747  16.468  1.00 89.68  ? 32  LYS B CG    1 
ATOM   238  C CD    . LYS A 1 28 ? -8.125  2.136  17.803  1.00 93.99  ? 32  LYS B CD    1 
ATOM   239  C CE    . LYS A 1 28 ? -7.998  3.128  18.951  1.00 95.56  ? 32  LYS B CE    1 
ATOM   240  N NZ    . LYS A 1 28 ? -8.451  2.545  20.243  1.00 98.08  ? 32  LYS B NZ    1 
ATOM   241  N N     . GLN A 1 29 ? -7.205  2.701  13.384  1.00 99.54  ? 33  GLN B N     1 
ATOM   242  C CA    . GLN A 1 29 ? -7.576  1.779  12.318  1.00 98.53  ? 33  GLN B CA    1 
ATOM   243  C C     . GLN A 1 29 ? -6.722  2.040  11.082  1.00 97.42  ? 33  GLN B C     1 
ATOM   244  O O     . GLN A 1 29 ? -6.406  1.120  10.328  1.00 99.23  ? 33  GLN B O     1 
ATOM   245  C CB    . GLN A 1 29 ? -9.064  1.911  11.986  1.00 95.95  ? 33  GLN B CB    1 
ATOM   246  C CG    . GLN A 1 29 ? -9.638  0.735  11.214  1.00 94.61  ? 33  GLN B CG    1 
ATOM   247  C CD    . GLN A 1 29 ? -11.150 0.798  11.100  1.00 94.79  ? 33  GLN B CD    1 
ATOM   248  O OE1   . GLN A 1 29 ? -11.755 1.853  11.294  1.00 94.11  ? 33  GLN B OE1   1 
ATOM   249  N NE2   . GLN A 1 29 ? -11.769 -0.336 10.793  1.00 95.89  ? 33  GLN B NE2   1 
ATOM   250  N N     . LEU A 1 30 ? -6.346  3.300  10.883  1.00 70.69  ? 34  LEU B N     1 
ATOM   251  C CA    . LEU A 1 30 ? -5.431  3.665  9.809   1.00 67.75  ? 34  LEU B CA    1 
ATOM   252  C C     . LEU A 1 30 ? -4.017  3.206  10.143  1.00 66.01  ? 34  LEU B C     1 
ATOM   253  O O     . LEU A 1 30 ? -3.284  2.736  9.272   1.00 67.38  ? 34  LEU B O     1 
ATOM   254  C CB    . LEU A 1 30 ? -5.448  5.177  9.571   1.00 61.99  ? 34  LEU B CB    1 
ATOM   255  C CG    . LEU A 1 30 ? -6.615  5.735  8.754   1.00 61.32  ? 34  LEU B CG    1 
ATOM   256  C CD1   . LEU A 1 30 ? -6.612  7.252  8.813   1.00 61.57  ? 34  LEU B CD1   1 
ATOM   257  C CD2   . LEU A 1 30 ? -6.540  5.264  7.310   1.00 61.91  ? 34  LEU B CD2   1 
ATOM   258  N N     . ALA A 1 31 ? -3.642  3.344  11.411  1.00 87.60  ? 35  ALA B N     1 
ATOM   259  C CA    . ALA A 1 31 ? -2.317  2.948  11.870  1.00 76.08  ? 35  ALA B CA    1 
ATOM   260  C C     . ALA A 1 31 ? -2.110  1.446  11.703  1.00 73.84  ? 35  ALA B C     1 
ATOM   261  O O     . ALA A 1 31 ? -1.019  0.996  11.356  1.00 73.51  ? 35  ALA B O     1 
ATOM   262  C CB    . ALA A 1 31 ? -2.118  3.354  13.322  1.00 69.77  ? 35  ALA B CB    1 
ATOM   263  N N     . GLN A 1 32 ? -3.165  0.675  11.950  1.00 91.88  ? 36  GLN B N     1 
ATOM   264  C CA    . GLN A 1 32 ? -3.110  -0.774 11.792  1.00 88.96  ? 36  GLN B CA    1 
ATOM   265  C C     . GLN A 1 32 ? -3.108  -1.160 10.315  1.00 86.47  ? 36  GLN B C     1 
ATOM   266  O O     . GLN A 1 32 ? -2.477  -2.142 9.923   1.00 84.41  ? 36  GLN B O     1 
ATOM   267  C CB    . GLN A 1 32 ? -4.288  -1.436 12.511  1.00 87.97  ? 36  GLN B CB    1 
ATOM   268  C CG    . GLN A 1 32 ? -4.131  -1.511 14.026  1.00 86.03  ? 36  GLN B CG    1 
ATOM   269  C CD    . GLN A 1 32 ? -3.130  -2.567 14.464  1.00 84.85  ? 36  GLN B CD    1 
ATOM   270  O OE1   . GLN A 1 32 ? -2.544  -3.266 13.638  1.00 83.66  ? 36  GLN B OE1   1 
ATOM   271  N NE2   . GLN A 1 32 ? -2.933  -2.689 15.773  1.00 85.21  ? 36  GLN B NE2   1 
ATOM   272  N N     . ASP A 1 33 ? -3.814  -0.382 9.501   1.00 89.45  ? 37  ASP B N     1 
ATOM   273  C CA    . ASP A 1 33 ? -3.874  -0.627 8.063   1.00 90.62  ? 37  ASP B CA    1 
ATOM   274  C C     . ASP A 1 33 ? -2.626  -0.112 7.348   1.00 93.34  ? 37  ASP B C     1 
ATOM   275  O O     . ASP A 1 33 ? -2.475  -0.301 6.140   1.00 98.17  ? 37  ASP B O     1 
ATOM   276  C CB    . ASP A 1 33 ? -5.123  0.025  7.463   1.00 86.51  ? 37  ASP B CB    1 
ATOM   277  C CG    . ASP A 1 33 ? -6.407  -0.667 7.887   1.00 87.04  ? 37  ASP B CG    1 
ATOM   278  O OD1   . ASP A 1 33 ? -6.365  -1.878 8.194   1.00 87.78  ? 37  ASP B OD1   1 
ATOM   279  O OD2   . ASP A 1 33 ? -7.462  0.001  7.909   1.00 85.08  ? 37  ASP B OD2   1 
ATOM   280  N N     . THR A 1 34 ? -1.740  0.539  8.098   1.00 76.63  ? 38  THR B N     1 
ATOM   281  C CA    . THR A 1 34 ? -0.498  1.074  7.545   1.00 74.03  ? 38  THR B CA    1 
ATOM   282  C C     . THR A 1 34 ? 0.720   0.618  8.345   1.00 80.83  ? 38  THR B C     1 
ATOM   283  O O     . THR A 1 34 ? 1.848   0.667  7.854   1.00 84.81  ? 38  THR B O     1 
ATOM   284  C CB    . THR A 1 34 ? -0.518  2.614  7.511   1.00 64.26  ? 38  THR B CB    1 
ATOM   285  O OG1   . THR A 1 34 ? -0.784  3.123  8.824   1.00 62.51  ? 38  THR B OG1   1 
ATOM   286  C CG2   . THR A 1 34 ? -1.585  3.114  6.548   1.00 61.43  ? 38  THR B CG2   1 
ATOM   287  N N     . GLY A 1 35 ? 0.490   0.181  9.580   1.00 75.91  ? 39  GLY B N     1 
ATOM   288  C CA    . GLY A 1 35 ? 1.567   -0.264 10.445  1.00 80.63  ? 39  GLY B CA    1 
ATOM   289  C C     . GLY A 1 35 ? 2.300   0.886  11.113  1.00 81.63  ? 39  GLY B C     1 
ATOM   290  O O     . GLY A 1 35 ? 3.183   0.669  11.944  1.00 82.85  ? 39  GLY B O     1 
ATOM   291  N N     . LEU A 1 36 ? 1.934   2.112  10.752  1.00 69.98  ? 40  LEU B N     1 
ATOM   292  C CA    . LEU A 1 36 ? 2.567   3.299  11.314  1.00 67.67  ? 40  LEU B CA    1 
ATOM   293  C C     . LEU A 1 36 ? 2.140   3.513  12.763  1.00 73.43  ? 40  LEU B C     1 
ATOM   294  O O     . LEU A 1 36 ? 1.293   2.786  13.284  1.00 86.52  ? 40  LEU B O     1 
ATOM   295  C CB    . LEU A 1 36 ? 2.221   4.535  10.480  1.00 59.73  ? 40  LEU B CB    1 
ATOM   296  C CG    . LEU A 1 36 ? 2.590   4.486  8.995   1.00 54.22  ? 40  LEU B CG    1 
ATOM   297  C CD1   . LEU A 1 36 ? 2.126   5.753  8.296   1.00 52.47  ? 40  LEU B CD1   1 
ATOM   298  C CD2   . LEU A 1 36 ? 4.086   4.291  8.802   1.00 54.65  ? 40  LEU B CD2   1 
ATOM   299  N N     . THR A 1 37 ? 2.735   4.513  13.405  1.00 82.20  ? 41  THR B N     1 
ATOM   300  C CA    . THR A 1 37 ? 2.388   4.870  14.776  1.00 79.35  ? 41  THR B CA    1 
ATOM   301  C C     . THR A 1 37 ? 1.303   5.940  14.778  1.00 84.42  ? 41  THR B C     1 
ATOM   302  O O     . THR A 1 37 ? 1.056   6.580  13.758  1.00 85.60  ? 41  THR B O     1 
ATOM   303  C CB    . THR A 1 37 ? 3.610   5.387  15.553  1.00 76.89  ? 41  THR B CB    1 
ATOM   304  O OG1   . THR A 1 37 ? 4.081   6.600  14.954  1.00 75.85  ? 41  THR B OG1   1 
ATOM   305  C CG2   . THR A 1 37 ? 4.725   4.352  15.547  1.00 78.68  ? 41  THR B CG2   1 
ATOM   306  N N     . ILE A 1 38 ? 0.664   6.136  15.927  1.00 98.23  ? 42  ILE B N     1 
ATOM   307  C CA    . ILE A 1 38 ? -0.408  7.118  16.048  1.00 102.07 ? 42  ILE B CA    1 
ATOM   308  C C     . ILE A 1 38 ? 0.109   8.522  15.751  1.00 104.50 ? 42  ILE B C     1 
ATOM   309  O O     . ILE A 1 38 ? -0.547  9.301  15.058  1.00 105.25 ? 42  ILE B O     1 
ATOM   310  C CB    . ILE A 1 38 ? -1.042  7.099  17.458  1.00 99.98  ? 42  ILE B CB    1 
ATOM   311  C CG1   . ILE A 1 38 ? -1.490  5.683  17.835  1.00 103.57 ? 42  ILE B CG1   1 
ATOM   312  C CG2   . ILE A 1 38 ? -2.220  8.071  17.539  1.00 99.24  ? 42  ILE B CG2   1 
ATOM   313  C CD1   . ILE A 1 38 ? -2.497  5.064  16.878  1.00 102.55 ? 42  ILE B CD1   1 
ATOM   314  N N     . LEU A 1 39 ? 1.288   8.840  16.278  1.00 125.81 ? 43  LEU B N     1 
ATOM   315  C CA    . LEU A 1 39 ? 1.894   10.148 16.062  1.00 120.34 ? 43  LEU B CA    1 
ATOM   316  C C     . LEU A 1 39 ? 2.192   10.371 14.582  1.00 114.71 ? 43  LEU B C     1 
ATOM   317  O O     . LEU A 1 39 ? 2.083   11.490 14.080  1.00 115.24 ? 43  LEU B O     1 
ATOM   318  C CB    . LEU A 1 39 ? 3.176   10.287 16.886  1.00 122.77 ? 43  LEU B CB    1 
ATOM   319  C CG    . LEU A 1 39 ? 3.925   11.615 16.756  1.00 122.45 ? 43  LEU B CG    1 
ATOM   320  C CD1   . LEU A 1 39 ? 3.064   12.780 17.225  1.00 123.08 ? 43  LEU B CD1   1 
ATOM   321  C CD2   . LEU A 1 39 ? 5.228   11.567 17.536  1.00 124.10 ? 43  LEU B CD2   1 
ATOM   322  N N     . GLN A 1 40 ? 2.566   9.300  13.889  1.00 78.22  ? 44  GLN B N     1 
ATOM   323  C CA    . GLN A 1 40 ? 2.826   9.368  12.456  1.00 73.12  ? 44  GLN B CA    1 
ATOM   324  C C     . GLN A 1 40 ? 1.534   9.624  11.689  1.00 60.89  ? 44  GLN B C     1 
ATOM   325  O O     . GLN A 1 40 ? 1.527   10.350 10.695  1.00 55.85  ? 44  GLN B O     1 
ATOM   326  C CB    . GLN A 1 40 ? 3.486   8.078  11.964  1.00 81.23  ? 44  GLN B CB    1 
ATOM   327  C CG    . GLN A 1 40 ? 4.974   7.989  12.258  1.00 87.42  ? 44  GLN B CG    1 
ATOM   328  C CD    . GLN A 1 40 ? 5.573   6.657  11.847  1.00 89.97  ? 44  GLN B CD    1 
ATOM   329  O OE1   . GLN A 1 40 ? 5.000   5.599  12.108  1.00 91.02  ? 44  GLN B OE1   1 
ATOM   330  N NE2   . GLN A 1 40 ? 6.730   6.703  11.197  1.00 89.99  ? 44  GLN B NE2   1 
ATOM   331  N N     . VAL A 1 41 ? 0.442   9.028  12.158  1.00 80.17  ? 45  VAL B N     1 
ATOM   332  C CA    . VAL A 1 41 ? -0.861  9.211  11.528  1.00 75.06  ? 45  VAL B CA    1 
ATOM   333  C C     . VAL A 1 41 ? -1.387  10.612 11.814  1.00 71.03  ? 45  VAL B C     1 
ATOM   334  O O     . VAL A 1 41 ? -1.975  11.250 10.942  1.00 70.10  ? 45  VAL B O     1 
ATOM   335  C CB    . VAL A 1 41 ? -1.884  8.156  12.016  1.00 45.65  ? 45  VAL B CB    1 
ATOM   336  C CG1   . VAL A 1 41 ? -3.289  8.462  11.494  1.00 45.18  ? 45  VAL B CG1   1 
ATOM   337  C CG2   . VAL A 1 41 ? -1.455  6.763  11.581  1.00 45.44  ? 45  VAL B CG2   1 
ATOM   338  N N     . ASN A 1 42 ? -1.175  11.087 13.038  1.00 80.10  ? 46  ASN B N     1 
ATOM   339  C CA    . ASN A 1 42 ? -1.628  12.418 13.426  1.00 72.80  ? 46  ASN B CA    1 
ATOM   340  C C     . ASN A 1 42 ? -0.980  13.511 12.585  1.00 64.44  ? 46  ASN B C     1 
ATOM   341  O O     . ASN A 1 42 ? -1.668  14.361 12.023  1.00 62.96  ? 46  ASN B O     1 
ATOM   342  C CB    . ASN A 1 42 ? -1.337  12.672 14.905  1.00 71.10  ? 46  ASN B CB    1 
ATOM   343  C CG    . ASN A 1 42 ? -2.165  11.795 15.822  1.00 68.11  ? 46  ASN B CG    1 
ATOM   344  O OD1   . ASN A 1 42 ? -3.185  11.240 15.415  1.00 68.44  ? 46  ASN B OD1   1 
ATOM   345  N ND2   . ASN A 1 42 ? -1.733  11.672 17.070  1.00 69.59  ? 46  ASN B ND2   1 
ATOM   346  N N     . ASN A 1 43 ? 0.345   13.481 12.501  1.00 66.82  ? 47  ASN B N     1 
ATOM   347  C CA    . ASN A 1 43 ? 1.089   14.507 11.780  1.00 58.99  ? 47  ASN B CA    1 
ATOM   348  C C     . ASN A 1 43 ? 0.805   14.501 10.281  1.00 49.79  ? 47  ASN B C     1 
ATOM   349  O O     . ASN A 1 43 ? 0.785   15.555 9.646   1.00 47.53  ? 47  ASN B O     1 
ATOM   350  C CB    . ASN A 1 43 ? 2.590   14.330 12.014  1.00 59.25  ? 47  ASN B CB    1 
ATOM   351  C CG    . ASN A 1 43 ? 2.981   14.509 13.468  1.00 62.51  ? 47  ASN B CG    1 
ATOM   352  O OD1   . ASN A 1 43 ? 2.306   15.208 14.224  1.00 63.90  ? 47  ASN B OD1   1 
ATOM   353  N ND2   . ASN A 1 43 ? 4.080   13.879 13.866  1.00 63.54  ? 47  ASN B ND2   1 
ATOM   354  N N     . TRP A 1 44 ? 0.587   13.314 9.720   1.00 57.15  ? 48  TRP B N     1 
ATOM   355  C CA    . TRP A 1 44 ? 0.390   13.168 8.279   1.00 53.25  ? 48  TRP B CA    1 
ATOM   356  C C     . TRP A 1 44 ? -0.800  13.983 7.788   1.00 54.26  ? 48  TRP B C     1 
ATOM   357  O O     . TRP A 1 44 ? -0.690  14.728 6.813   1.00 54.14  ? 48  TRP B O     1 
ATOM   358  C CB    . TRP A 1 44 ? 0.190   11.696 7.908   1.00 50.13  ? 48  TRP B CB    1 
ATOM   359  C CG    . TRP A 1 44 ? 0.187   11.449 6.423   1.00 46.62  ? 48  TRP B CG    1 
ATOM   360  C CD1   . TRP A 1 44 ? 1.247   11.065 5.653   1.00 44.32  ? 48  TRP B CD1   1 
ATOM   361  C CD2   . TRP A 1 44 ? -0.931  11.574 5.532   1.00 46.22  ? 48  TRP B CD2   1 
ATOM   362  N NE1   . TRP A 1 44 ? 0.858   10.941 4.340   1.00 43.33  ? 48  TRP B NE1   1 
ATOM   363  C CE2   . TRP A 1 44 ? -0.472  11.248 4.239   1.00 45.00  ? 48  TRP B CE2   1 
ATOM   364  C CE3   . TRP A 1 44 ? -2.272  11.930 5.701   1.00 45.15  ? 48  TRP B CE3   1 
ATOM   365  C CZ2   . TRP A 1 44 ? -1.309  11.266 3.124   1.00 44.13  ? 48  TRP B CZ2   1 
ATOM   366  C CZ3   . TRP A 1 44 ? -3.100  11.947 4.594   1.00 43.73  ? 48  TRP B CZ3   1 
ATOM   367  C CH2   . TRP A 1 44 ? -2.616  11.617 3.322   1.00 43.03  ? 48  TRP B CH2   1 
ATOM   368  N N     . PHE A 1 45 ? -1.934  13.838 8.464   1.00 48.94  ? 49  PHE B N     1 
ATOM   369  C CA    . PHE A 1 45 ? -3.143  14.557 8.084   1.00 46.09  ? 49  PHE B CA    1 
ATOM   370  C C     . PHE A 1 45 ? -2.953  16.061 8.246   1.00 44.37  ? 49  PHE B C     1 
ATOM   371  O O     . PHE A 1 45 ? -3.278  16.830 7.343   1.00 44.07  ? 49  PHE B O     1 
ATOM   372  C CB    . PHE A 1 45 ? -4.336  14.079 8.915   1.00 44.20  ? 49  PHE B CB    1 
ATOM   373  C CG    . PHE A 1 45 ? -4.905  12.767 8.453   1.00 42.13  ? 49  PHE B CG    1 
ATOM   374  C CD1   . PHE A 1 45 ? -5.774  12.718 7.377   1.00 39.79  ? 49  PHE B CD1   1 
ATOM   375  C CD2   . PHE A 1 45 ? -4.573  11.584 9.093   1.00 43.40  ? 49  PHE B CD2   1 
ATOM   376  C CE1   . PHE A 1 45 ? -6.301  11.516 6.945   1.00 39.10  ? 49  PHE B CE1   1 
ATOM   377  C CE2   . PHE A 1 45 ? -5.098  10.377 8.667   1.00 43.02  ? 49  PHE B CE2   1 
ATOM   378  C CZ    . PHE A 1 45 ? -5.963  10.344 7.591   1.00 40.21  ? 49  PHE B CZ    1 
ATOM   379  N N     . ILE A 1 46 ? -2.410  16.469 9.391   1.00 35.70  ? 50  ILE B N     1 
ATOM   380  C CA    . ILE A 1 46 ? -2.202  17.885 9.686   1.00 36.06  ? 50  ILE B CA    1 
ATOM   381  C C     . ILE A 1 46 ? -1.390  18.543 8.576   1.00 35.60  ? 50  ILE B C     1 
ATOM   382  O O     . ILE A 1 46 ? -1.631  19.696 8.222   1.00 35.60  ? 50  ILE B O     1 
ATOM   383  C CB    . ILE A 1 46 ? -1.487  18.086 11.044  1.00 37.22  ? 50  ILE B CB    1 
ATOM   384  C CG1   . ILE A 1 46 ? -2.314  17.482 12.180  1.00 37.91  ? 50  ILE B CG1   1 
ATOM   385  C CG2   . ILE A 1 46 ? -1.263  19.572 11.330  1.00 37.76  ? 50  ILE B CG2   1 
ATOM   386  C CD1   . ILE A 1 46 ? -1.538  17.281 13.465  1.00 39.19  ? 50  ILE B CD1   1 
ATOM   387  N N     . ASN A 1 47 ? -0.437  17.803 8.019   1.00 42.57  ? 51  ASN B N     1 
ATOM   388  C CA    . ASN A 1 47 ? 0.342   18.299 6.893   1.00 41.48  ? 51  ASN B CA    1 
ATOM   389  C C     . ASN A 1 47 ? -0.444  18.190 5.595   1.00 40.85  ? 51  ASN B C     1 
ATOM   390  O O     . ASN A 1 47 ? -0.427  19.102 4.768   1.00 38.25  ? 51  ASN B O     1 
ATOM   391  C CB    . ASN A 1 47 ? 1.660   17.536 6.776   1.00 42.19  ? 51  ASN B CB    1 
ATOM   392  C CG    . ASN A 1 47 ? 2.607   17.842 7.916   1.00 42.92  ? 51  ASN B CG    1 
ATOM   393  O OD1   . ASN A 1 47 ? 3.259   18.885 7.931   1.00 43.93  ? 51  ASN B OD1   1 
ATOM   394  N ND2   . ASN A 1 47 ? 2.684   16.935 8.882   1.00 42.78  ? 51  ASN B ND2   1 
ATOM   395  N N     . ALA A 1 48 ? -1.138  17.068 5.430   1.00 39.68  ? 52  ALA B N     1 
ATOM   396  C CA    . ALA A 1 48 ? -1.909  16.805 4.222   1.00 40.66  ? 52  ALA B CA    1 
ATOM   397  C C     . ALA A 1 48 ? -2.995  17.856 4.012   1.00 42.49  ? 52  ALA B C     1 
ATOM   398  O O     . ALA A 1 48 ? -3.255  18.270 2.882   1.00 41.17  ? 52  ALA B O     1 
ATOM   399  C CB    . ALA A 1 48 ? -2.524  15.414 4.288   1.00 40.00  ? 52  ALA B CB    1 
ATOM   400  N N     . ARG A 1 49 ? -3.621  18.287 5.103   1.00 43.53  ? 53  ARG B N     1 
ATOM   401  C CA    . ARG A 1 49 ? -4.695  19.274 5.034   1.00 47.32  ? 53  ARG B CA    1 
ATOM   402  C C     . ARG A 1 49 ? -4.212  20.587 4.420   1.00 55.45  ? 53  ARG B C     1 
ATOM   403  O O     . ARG A 1 49 ? -4.866  21.149 3.543   1.00 56.24  ? 53  ARG B O     1 
ATOM   404  C CB    . ARG A 1 49 ? -5.274  19.536 6.428   1.00 44.39  ? 53  ARG B CB    1 
ATOM   405  C CG    . ARG A 1 49 ? -6.093  18.384 6.996   1.00 41.31  ? 53  ARG B CG    1 
ATOM   406  C CD    . ARG A 1 49 ? -6.652  18.721 8.367   1.00 40.83  ? 53  ARG B CD    1 
ATOM   407  N NE    . ARG A 1 49 ? -7.097  17.527 9.090   1.00 40.40  ? 53  ARG B NE    1 
ATOM   408  C CZ    . ARG A 1 49 ? -6.496  17.009 10.161  1.00 40.49  ? 53  ARG B CZ    1 
ATOM   409  N NH1   . ARG A 1 49 ? -5.407  17.571 10.677  1.00 41.50  ? 53  ARG B NH1   1 
ATOM   410  N NH2   . ARG A 1 49 ? -6.993  15.919 10.729  1.00 40.21  ? 53  ARG B NH2   1 
ATOM   411  N N     . ARG A 1 50 ? -3.062  21.065 4.880   1.00 48.58  ? 54  ARG B N     1 
ATOM   412  C CA    . ARG A 1 50 ? -2.525  22.343 4.422   1.00 51.53  ? 54  ARG B CA    1 
ATOM   413  C C     . ARG A 1 50 ? -1.695  22.207 3.145   1.00 54.98  ? 54  ARG B C     1 
ATOM   414  O O     . ARG A 1 50 ? -1.163  23.198 2.643   1.00 55.29  ? 54  ARG B O     1 
ATOM   415  C CB    . ARG A 1 50 ? -1.673  22.982 5.523   1.00 52.49  ? 54  ARG B CB    1 
ATOM   416  C CG    . ARG A 1 50 ? -0.516  22.116 5.995   1.00 52.99  ? 54  ARG B CG    1 
ATOM   417  C CD    . ARG A 1 50 ? 0.333   22.831 7.034   1.00 54.47  ? 54  ARG B CD    1 
ATOM   418  N NE    . ARG A 1 50 ? 1.404   21.976 7.541   1.00 53.69  ? 54  ARG B NE    1 
ATOM   419  C CZ    . ARG A 1 50 ? 2.354   22.376 8.380   1.00 53.73  ? 54  ARG B CZ    1 
ATOM   420  N NH1   . ARG A 1 50 ? 2.382   23.629 8.815   1.00 54.74  ? 54  ARG B NH1   1 
ATOM   421  N NH2   . ARG A 1 50 ? 3.282   21.520 8.783   1.00 54.08  ? 54  ARG B NH2   1 
ATOM   422  N N     . ARG A 1 51 ? -1.590  20.986 2.624   1.00 55.74  ? 55  ARG B N     1 
ATOM   423  C CA    . ARG A 1 51 ? -0.785  20.722 1.430   1.00 57.36  ? 55  ARG B CA    1 
ATOM   424  C C     . ARG A 1 51 ? -1.574  20.006 0.334   1.00 63.26  ? 55  ARG B C     1 
ATOM   425  O O     . ARG A 1 51 ? -1.147  19.986 -0.822  1.00 66.42  ? 55  ARG B O     1 
ATOM   426  C CB    . ARG A 1 51 ? 0.448   19.892 1.797   1.00 52.92  ? 55  ARG B CB    1 
ATOM   427  C CG    . ARG A 1 51 ? 1.449   20.626 2.673   1.00 47.42  ? 55  ARG B CG    1 
ATOM   428  C CD    . ARG A 1 51 ? 2.555   19.698 3.145   1.00 43.36  ? 55  ARG B CD    1 
ATOM   429  N NE    . ARG A 1 51 ? 3.438   20.345 4.111   1.00 40.57  ? 55  ARG B NE    1 
ATOM   430  C CZ    . ARG A 1 51 ? 4.346   19.706 4.843   1.00 39.86  ? 55  ARG B CZ    1 
ATOM   431  N NH1   . ARG A 1 51 ? 4.496   18.392 4.731   1.00 38.20  ? 55  ARG B NH1   1 
ATOM   432  N NH2   . ARG A 1 51 ? 5.102   20.383 5.696   1.00 41.45  ? 55  ARG B NH2   1 
ATOM   433  N N     . ILE A 1 52 ? -2.711  19.416 0.696   1.00 52.99  ? 56  ILE B N     1 
ATOM   434  C CA    . ILE A 1 52 ? -3.563  18.729 -0.273  1.00 56.58  ? 56  ILE B CA    1 
ATOM   435  C C     . ILE A 1 52 ? -4.968  19.320 -0.273  1.00 60.31  ? 56  ILE B C     1 
ATOM   436  O O     . ILE A 1 52 ? -5.512  19.635 -1.329  1.00 58.95  ? 56  ILE B O     1 
ATOM   437  C CB    . ILE A 1 52 ? -3.655  17.212 0.011   1.00 55.57  ? 56  ILE B CB    1 
ATOM   438  C CG1   . ILE A 1 52 ? -2.251  16.600 0.073   1.00 56.07  ? 56  ILE B CG1   1 
ATOM   439  C CG2   . ILE A 1 52 ? -4.503  16.519 -1.061  1.00 57.42  ? 56  ILE B CG2   1 
ATOM   440  C CD1   . ILE A 1 52 ? -2.221  15.120 0.423   1.00 55.79  ? 56  ILE B CD1   1 
ATOM   441  N N     . VAL A 1 53 ? -5.552  19.473 0.911   1.00 56.74  ? 57  VAL B N     1 
ATOM   442  C CA    . VAL A 1 53 ? -6.927  19.949 1.023   1.00 64.05  ? 57  VAL B CA    1 
ATOM   443  C C     . VAL A 1 53 ? -7.022  21.452 0.772   1.00 78.08  ? 57  VAL B C     1 
ATOM   444  O O     . VAL A 1 53 ? -7.733  21.891 -0.131  1.00 78.00  ? 57  VAL B O     1 
ATOM   445  C CB    . VAL A 1 53 ? -7.520  19.629 2.413   1.00 61.03  ? 57  VAL B CB    1 
ATOM   446  C CG1   . VAL A 1 53 ? -8.972  20.085 2.503   1.00 60.22  ? 57  VAL B CG1   1 
ATOM   447  C CG2   . VAL A 1 53 ? -7.413  18.140 2.705   1.00 59.53  ? 57  VAL B CG2   1 
ATOM   448  N N     . GLN A 1 54 ? -6.301  22.232 1.572   1.00 83.45  ? 58  GLN B N     1 
ATOM   449  C CA    . GLN A 1 54 ? -6.392  23.690 1.520   1.00 89.08  ? 58  GLN B CA    1 
ATOM   450  C C     . GLN A 1 54 ? -6.069  24.290 0.147   1.00 99.06  ? 58  GLN B C     1 
ATOM   451  O O     . GLN A 1 54 ? -6.748  25.220 -0.289  1.00 103.60 ? 58  GLN B O     1 
ATOM   452  C CB    . GLN A 1 54 ? -5.472  24.307 2.577   1.00 87.88  ? 58  GLN B CB    1 
ATOM   453  C CG    . GLN A 1 54 ? -6.012  24.212 3.995   1.00 83.53  ? 58  GLN B CG    1 
ATOM   454  C CD    . GLN A 1 54 ? -7.283  25.017 4.190   1.00 79.31  ? 58  GLN B CD    1 
ATOM   455  O OE1   . GLN A 1 54 ? -7.546  25.972 3.460   1.00 77.45  ? 58  GLN B OE1   1 
ATOM   456  N NE2   . GLN A 1 54 ? -8.084  24.628 5.175   1.00 77.67  ? 58  GLN B NE2   1 
ATOM   457  N N     . PRO A 1 55 ? -5.028  23.778 -0.534  1.00 88.56  ? 59  PRO B N     1 
ATOM   458  C CA    . PRO A 1 55 ? -4.709  24.305 -1.867  1.00 92.17  ? 59  PRO B CA    1 
ATOM   459  C C     . PRO A 1 55 ? -5.877  24.235 -2.852  1.00 104.70 ? 59  PRO B C     1 
ATOM   460  O O     . PRO A 1 55 ? -6.011  25.120 -3.698  1.00 104.88 ? 59  PRO B O     1 
ATOM   461  C CB    . PRO A 1 55 ? -3.561  23.405 -2.329  1.00 86.86  ? 59  PRO B CB    1 
ATOM   462  C CG    . PRO A 1 55 ? -2.909  22.966 -1.078  1.00 83.60  ? 59  PRO B CG    1 
ATOM   463  C CD    . PRO A 1 55 ? -4.010  22.817 -0.072  1.00 83.91  ? 59  PRO B CD    1 
ATOM   464  N N     . MET A 1 56 ? -6.708  23.203 -2.740  1.00 144.01 ? 60  MET B N     1 
ATOM   465  C CA    . MET A 1 56 ? -7.855  23.050 -3.630  1.00 151.63 ? 60  MET B CA    1 
ATOM   466  C C     . MET A 1 56 ? -8.953  24.046 -3.276  1.00 154.96 ? 60  MET B C     1 
ATOM   467  O O     . MET A 1 56 ? -9.696  24.497 -4.148  1.00 156.12 ? 60  MET B O     1 
ATOM   468  C CB    . MET A 1 56 ? -8.400  21.621 -3.566  1.00 153.28 ? 60  MET B CB    1 
ATOM   469  C CG    . MET A 1 56 ? -7.386  20.559 -3.953  1.00 151.19 ? 60  MET B CG    1 
ATOM   470  S SD    . MET A 1 56 ? -8.093  18.903 -4.037  1.00 26.97  ? 60  MET B SD    1 
ATOM   471  C CE    . MET A 1 56 ? -8.774  18.910 -5.695  1.00 62.65  ? 60  MET B CE    1 
ATOM   472  N N     . ILE A 1 57 ? -9.053  24.385 -1.994  1.00 73.19  ? 61  ILE B N     1 
ATOM   473  C CA    . ILE A 1 57 ? -10.022 25.375 -1.543  1.00 73.69  ? 61  ILE B CA    1 
ATOM   474  C C     . ILE A 1 57 ? -9.703  26.733 -2.159  1.00 74.66  ? 61  ILE B C     1 
ATOM   475  O O     . ILE A 1 57 ? -10.603 27.463 -2.576  1.00 80.01  ? 61  ILE B O     1 
ATOM   476  C CB    . ILE A 1 57 ? -10.039 25.503 -0.006  1.00 81.32  ? 61  ILE B CB    1 
ATOM   477  C CG1   . ILE A 1 57 ? -10.338 24.146 0.638   1.00 79.66  ? 61  ILE B CG1   1 
ATOM   478  C CG2   . ILE A 1 57 ? -11.075 26.540 0.429   1.00 100.94 ? 61  ILE B CG2   1 
ATOM   479  C CD1   . ILE A 1 57 ? -10.257 24.140 2.155   1.00 79.40  ? 61  ILE B CD1   1 
ATOM   480  N N     . ASP A 1 58 ? -8.415  27.062 -2.210  1.00 96.44  ? 62  ASP B N     1 
ATOM   481  C CA    . ASP A 1 58 ? -7.963  28.331 -2.769  1.00 89.14  ? 62  ASP B CA    1 
ATOM   482  C C     . ASP A 1 58 ? -8.384  28.469 -4.228  1.00 86.35  ? 62  ASP B C     1 
ATOM   483  O O     . ASP A 1 58 ? -8.797  29.544 -4.664  1.00 91.11  ? 62  ASP B O     1 
ATOM   484  C CB    . ASP A 1 58 ? -6.444  28.458 -2.648  1.00 94.14  ? 62  ASP B CB    1 
ATOM   485  C CG    . ASP A 1 58 ? -5.978  28.562 -1.209  1.00 105.33 ? 62  ASP B CG    1 
ATOM   486  O OD1   . ASP A 1 58 ? -6.712  28.106 -0.308  1.00 110.63 ? 62  ASP B OD1   1 
ATOM   487  O OD2   . ASP A 1 58 ? -4.874  29.099 -0.979  1.00 112.06 ? 62  ASP B OD2   1 
ATOM   488  N N     . GLN A 1 59 ? -8.272  27.379 -4.979  1.00 90.41  ? 63  GLN B N     1 
ATOM   489  C CA    . GLN A 1 59 ? -8.724  27.358 -6.365  1.00 92.60  ? 63  GLN B CA    1 
ATOM   490  C C     . GLN A 1 59 ? -10.246 27.385 -6.414  1.00 87.85  ? 63  GLN B C     1 
ATOM   491  O O     . GLN A 1 59 ? -10.836 27.993 -7.308  1.00 88.30  ? 63  GLN B O     1 
ATOM   492  C CB    . GLN A 1 59 ? -8.191  26.120 -7.092  1.00 92.25  ? 63  GLN B CB    1 
ATOM   493  C CG    . GLN A 1 59 ? -8.576  26.053 -8.564  1.00 91.18  ? 63  GLN B CG    1 
ATOM   494  C CD    . GLN A 1 59 ? -8.124  24.767 -9.230  1.00 87.38  ? 63  GLN B CD    1 
ATOM   495  O OE1   . GLN A 1 59 ? -7.502  23.912 -8.599  1.00 84.77  ? 63  GLN B OE1   1 
ATOM   496  N NE2   . GLN A 1 59 ? -8.438  24.625 -10.513 1.00 86.45  ? 63  GLN B NE2   1 
ATOM   497  N N     . SER A 1 60 ? -10.871 26.720 -5.446  1.00 93.78  ? 64  SER B N     1 
ATOM   498  C CA    . SER A 1 60 ? -12.326 26.664 -5.347  1.00 86.37  ? 64  SER B CA    1 
ATOM   499  C C     . SER A 1 60 ? -12.941 26.098 -6.623  1.00 84.93  ? 64  SER B C     1 
ATOM   500  O O     . SER A 1 60 ? -12.404 25.166 -7.223  1.00 83.36  ? 64  SER B O     1 
ATOM   501  C CB    . SER A 1 60 ? -12.897 28.054 -5.056  1.00 85.59  ? 64  SER B CB    1 
ATOM   502  O OG    . SER A 1 60 ? -12.328 28.603 -3.881  1.00 84.36  ? 64  SER B OG    1 
ATOM   503  P P     . DT  B 2 1  ? -2.240  20.652 33.628  1.00 91.10  ? 26  DT  L P     1 
ATOM   504  O OP1   . DT  B 2 1  ? -2.247  19.677 34.742  1.00 92.41  ? 26  DT  L OP1   1 
ATOM   505  O OP2   . DT  B 2 1  ? -0.973  21.301 33.224  1.00 90.45  ? 26  DT  L OP2   1 
ATOM   506  O "O5'" . DT  B 2 1  ? -2.880  19.977 32.325  1.00 115.72 ? 26  DT  L "O5'" 1 
ATOM   507  C "C5'" . DT  B 2 1  ? -3.992  19.096 32.448  1.00 115.95 ? 26  DT  L "C5'" 1 
ATOM   508  C "C4'" . DT  B 2 1  ? -4.566  18.749 31.085  1.00 113.60 ? 26  DT  L "C4'" 1 
ATOM   509  O "O4'" . DT  B 2 1  ? -5.105  19.952 30.471  1.00 113.99 ? 26  DT  L "O4'" 1 
ATOM   510  C "C3'" . DT  B 2 1  ? -3.556  18.172 30.083  1.00 111.02 ? 26  DT  L "C3'" 1 
ATOM   511  O "O3'" . DT  B 2 1  ? -4.037  16.948 29.529  1.00 109.57 ? 26  DT  L "O3'" 1 
ATOM   512  C "C2'" . DT  B 2 1  ? -3.411  19.267 29.029  1.00 110.21 ? 26  DT  L "C2'" 1 
ATOM   513  C "C1'" . DT  B 2 1  ? -4.746  19.982 29.112  1.00 111.59 ? 26  DT  L "C1'" 1 
ATOM   514  N N1    . DT  B 2 1  ? -4.713  21.408 28.649  1.00 112.70 ? 26  DT  L N1    1 
ATOM   515  C C2    . DT  B 2 1  ? -5.585  21.820 27.665  1.00 112.73 ? 26  DT  L C2    1 
ATOM   516  O O2    . DT  B 2 1  ? -6.398  21.082 27.136  1.00 111.73 ? 26  DT  L O2    1 
ATOM   517  N N3    . DT  B 2 1  ? -5.474  23.138 27.316  1.00 114.41 ? 26  DT  L N3    1 
ATOM   518  C C4    . DT  B 2 1  ? -4.598  24.070 27.840  1.00 116.28 ? 26  DT  L C4    1 
ATOM   519  O O4    . DT  B 2 1  ? -4.577  25.235 27.457  1.00 118.26 ? 26  DT  L O4    1 
ATOM   520  C C5    . DT  B 2 1  ? -3.710  23.576 28.868  1.00 115.85 ? 26  DT  L C5    1 
ATOM   521  C C7    . DT  B 2 1  ? -2.713  24.494 29.513  1.00 117.59 ? 26  DT  L C7    1 
ATOM   522  C C6    . DT  B 2 1  ? -3.810  22.284 29.220  1.00 114.28 ? 26  DT  L C6    1 
ATOM   523  P P     . DT  B 2 2  ? -3.088  16.046 28.596  1.00 170.51 ? 27  DT  L P     1 
ATOM   524  O OP1   . DT  B 2 2  ? -3.140  14.661 29.116  1.00 170.95 ? 27  DT  L OP1   1 
ATOM   525  O OP2   . DT  B 2 2  ? -1.784  16.734 28.471  1.00 170.38 ? 27  DT  L OP2   1 
ATOM   526  O "O5'" . DT  B 2 2  ? -3.806  16.085 27.166  1.00 85.78  ? 27  DT  L "O5'" 1 
ATOM   527  C "C5'" . DT  B 2 2  ? -5.136  15.596 27.027  1.00 86.10  ? 27  DT  L "C5'" 1 
ATOM   528  C "C4'" . DT  B 2 2  ? -5.766  16.082 25.734  1.00 85.31  ? 27  DT  L "C4'" 1 
ATOM   529  O "O4'" . DT  B 2 2  ? -5.719  17.536 25.691  1.00 86.40  ? 27  DT  L "O4'" 1 
ATOM   530  C "C3'" . DT  B 2 2  ? -5.075  15.593 24.456  1.00 83.53  ? 27  DT  L "C3'" 1 
ATOM   531  O "O3'" . DT  B 2 2  ? -6.031  15.064 23.539  1.00 82.71  ? 27  DT  L "O3'" 1 
ATOM   532  C "C2'" . DT  B 2 2  ? -4.382  16.840 23.917  1.00 83.56  ? 27  DT  L "C2'" 1 
ATOM   533  C "C1'" . DT  B 2 2  ? -5.283  17.953 24.418  1.00 85.47  ? 27  DT  L "C1'" 1 
ATOM   534  N N1    . DT  B 2 2  ? -4.608  19.288 24.546  1.00 87.19  ? 27  DT  L N1    1 
ATOM   535  C C2    . DT  B 2 2  ? -5.181  20.395 23.958  1.00 87.95  ? 27  DT  L C2    1 
ATOM   536  O O2    . DT  B 2 2  ? -6.222  20.357 23.326  1.00 87.32  ? 27  DT  L O2    1 
ATOM   537  N N3    . DT  B 2 2  ? -4.487  21.562 24.135  1.00 89.41  ? 27  DT  L N3    1 
ATOM   538  C C4    . DT  B 2 2  ? -3.303  21.733 24.826  1.00 89.50  ? 27  DT  L C4    1 
ATOM   539  O O4    . DT  B 2 2  ? -2.758  22.828 24.927  1.00 90.72  ? 27  DT  L O4    1 
ATOM   540  C C5    . DT  B 2 2  ? -2.754  20.536 25.420  1.00 88.39  ? 27  DT  L C5    1 
ATOM   541  C C7    . DT  B 2 2  ? -1.470  20.595 26.196  1.00 88.19  ? 27  DT  L C7    1 
ATOM   542  C C6    . DT  B 2 2  ? -3.425  19.385 25.255  1.00 87.87  ? 27  DT  L C6    1 
ATOM   543  P P     . DA  B 2 3  ? -5.547  14.347 22.185  1.00 98.59  ? 28  DA  L P     1 
ATOM   544  O OP1   . DA  B 2 3  ? -6.209  13.026 22.118  1.00 98.83  ? 28  DA  L OP1   1 
ATOM   545  O OP2   . DA  B 2 3  ? -4.071  14.433 22.125  1.00 98.37  ? 28  DA  L OP2   1 
ATOM   546  O "O5'" . DA  B 2 3  ? -6.138  15.278 21.026  1.00 83.31  ? 28  DA  L "O5'" 1 
ATOM   547  C "C5'" . DA  B 2 3  ? -7.544  15.454 20.907  1.00 83.44  ? 28  DA  L "C5'" 1 
ATOM   548  C "C4'" . DA  B 2 3  ? -7.873  16.533 19.890  1.00 83.08  ? 28  DA  L "C4'" 1 
ATOM   549  O "O4'" . DA  B 2 3  ? -7.351  17.810 20.358  1.00 83.29  ? 28  DA  L "O4'" 1 
ATOM   550  C "C3'" . DA  B 2 3  ? -7.273  16.313 18.501  1.00 82.22  ? 28  DA  L "C3'" 1 
ATOM   551  O "O3'" . DA  B 2 3  ? -8.215  16.658 17.484  1.00 82.13  ? 28  DA  L "O3'" 1 
ATOM   552  C "C2'" . DA  B 2 3  ? -6.051  17.222 18.494  1.00 81.98  ? 28  DA  L "C2'" 1 
ATOM   553  C "C1'" . DA  B 2 3  ? -6.487  18.371 19.389  1.00 82.46  ? 28  DA  L "C1'" 1 
ATOM   554  N N9    . DA  B 2 3  ? -5.384  19.042 20.076  1.00 82.12  ? 28  DA  L N9    1 
ATOM   555  C C8    . DA  B 2 3  ? -4.396  18.455 20.816  1.00 81.72  ? 28  DA  L C8    1 
ATOM   556  N N7    . DA  B 2 3  ? -3.536  19.305 21.322  1.00 82.07  ? 28  DA  L N7    1 
ATOM   557  C C5    . DA  B 2 3  ? -3.989  20.538 20.884  1.00 82.59  ? 28  DA  L C5    1 
ATOM   558  C C6    . DA  B 2 3  ? -3.512  21.848 21.081  1.00 83.59  ? 28  DA  L C6    1 
ATOM   559  N N6    . DA  B 2 3  ? -2.422  22.134 21.800  1.00 83.54  ? 28  DA  L N6    1 
ATOM   560  N N1    . DA  B 2 3  ? -4.200  22.856 20.506  1.00 85.05  ? 28  DA  L N1    1 
ATOM   561  C C2    . DA  B 2 3  ? -5.290  22.565 19.787  1.00 85.09  ? 28  DA  L C2    1 
ATOM   562  N N3    . DA  B 2 3  ? -5.835  21.376 19.533  1.00 83.99  ? 28  DA  L N3    1 
ATOM   563  C C4    . DA  B 2 3  ? -5.129  20.395 20.116  1.00 82.78  ? 28  DA  L C4    1 
ATOM   564  P P     . DG  B 2 4  ? -7.875  16.402 15.933  1.00 146.44 ? 29  DG  L P     1 
ATOM   565  O OP1   . DG  B 2 4  ? -9.159  16.181 15.232  1.00 146.85 ? 29  DG  L OP1   1 
ATOM   566  O OP2   . DG  B 2 4  ? -6.809  15.379 15.855  1.00 146.47 ? 29  DG  L OP2   1 
ATOM   567  O "O5'" . DG  B 2 4  ? -7.251  17.791 15.442  1.00 54.36  ? 29  DG  L "O5'" 1 
ATOM   568  C "C5'" . DG  B 2 4  ? -8.038  18.976 15.474  1.00 55.24  ? 29  DG  L "C5'" 1 
ATOM   569  C "C4'" . DG  B 2 4  ? -7.184  20.205 15.217  1.00 56.37  ? 29  DG  L "C4'" 1 
ATOM   570  O "O4'" . DG  B 2 4  ? -6.217  20.353 16.289  1.00 57.74  ? 29  DG  L "O4'" 1 
ATOM   571  C "C3'" . DG  B 2 4  ? -6.372  20.171 13.911  1.00 55.76  ? 29  DG  L "C3'" 1 
ATOM   572  O "O3'" . DG  B 2 4  ? -6.780  21.232 13.034  1.00 55.47  ? 29  DG  L "O3'" 1 
ATOM   573  C "C2'" . DG  B 2 4  ? -4.914  20.313 14.366  1.00 57.11  ? 29  DG  L "C2'" 1 
ATOM   574  C "C1'" . DG  B 2 4  ? -5.040  20.904 15.758  1.00 58.80  ? 29  DG  L "C1'" 1 
ATOM   575  N N9    . DG  B 2 4  ? -3.916  20.593 16.642  1.00 60.07  ? 29  DG  L N9    1 
ATOM   576  C C8    . DG  B 2 4  ? -3.435  19.348 16.971  1.00 60.40  ? 29  DG  L C8    1 
ATOM   577  N N7    . DG  B 2 4  ? -2.413  19.383 17.781  1.00 61.23  ? 29  DG  L N7    1 
ATOM   578  C C5    . DG  B 2 4  ? -2.200  20.737 18.003  1.00 62.66  ? 29  DG  L C5    1 
ATOM   579  C C6    . DG  B 2 4  ? -1.225  21.390 18.798  1.00 65.64  ? 29  DG  L C6    1 
ATOM   580  O O6    . DG  B 2 4  ? -0.329  20.881 19.487  1.00 65.58  ? 29  DG  L O6    1 
ATOM   581  N N1    . DG  B 2 4  ? -1.362  22.775 18.746  1.00 67.43  ? 29  DG  L N1    1 
ATOM   582  C C2    . DG  B 2 4  ? -2.316  23.444 18.016  1.00 67.13  ? 29  DG  L C2    1 
ATOM   583  N N2    . DG  B 2 4  ? -2.291  24.783 18.090  1.00 70.22  ? 29  DG  L N2    1 
ATOM   584  N N3    . DG  B 2 4  ? -3.233  22.845 17.267  1.00 64.67  ? 29  DG  L N3    1 
ATOM   585  C C4    . DG  B 2 4  ? -3.115  21.496 17.308  1.00 62.29  ? 29  DG  L C4    1 
ATOM   586  P P     . DC  B 2 5  ? -5.983  21.520 11.667  1.00 48.23  ? 30  DC  L P     1 
ATOM   587  O OP1   . DC  B 2 5  ? -6.951  21.963 10.640  1.00 50.35  ? 30  DC  L OP1   1 
ATOM   588  O OP2   . DC  B 2 5  ? -5.121  20.349 11.393  1.00 41.03  ? 30  DC  L OP2   1 
ATOM   589  O "O5'" . DC  B 2 5  ? -5.049  22.766 12.032  1.00 57.69  ? 30  DC  L "O5'" 1 
ATOM   590  C "C5'" . DC  B 2 5  ? -5.633  23.966 12.534  1.00 58.01  ? 30  DC  L "C5'" 1 
ATOM   591  C "C4'" . DC  B 2 5  ? -4.626  25.100 12.548  1.00 61.51  ? 30  DC  L "C4'" 1 
ATOM   592  O "O4'" . DC  B 2 5  ? -3.682  24.897 13.637  1.00 59.55  ? 30  DC  L "O4'" 1 
ATOM   593  C "C3'" . DC  B 2 5  ? -3.788  25.221 11.281  1.00 65.30  ? 30  DC  L "C3'" 1 
ATOM   594  O "O3'" . DC  B 2 5  ? -3.558  26.584 10.954  1.00 71.24  ? 30  DC  L "O3'" 1 
ATOM   595  C "C2'" . DC  B 2 5  ? -2.505  24.483 11.637  1.00 64.21  ? 30  DC  L "C2'" 1 
ATOM   596  C "C1'" . DC  B 2 5  ? -2.369  24.742 13.132  1.00 61.79  ? 30  DC  L "C1'" 1 
ATOM   597  N N1    . DC  B 2 5  ? -1.693  23.629 13.891  1.00 59.11  ? 30  DC  L N1    1 
ATOM   598  C C2    . DC  B 2 5  ? -0.644  23.916 14.780  1.00 61.62  ? 30  DC  L C2    1 
ATOM   599  O O2    . DC  B 2 5  ? -0.277  25.088 14.932  1.00 64.99  ? 30  DC  L O2    1 
ATOM   600  N N3    . DC  B 2 5  ? -0.056  22.892 15.451  1.00 60.31  ? 30  DC  L N3    1 
ATOM   601  C C4    . DC  B 2 5  ? -0.475  21.639 15.264  1.00 57.05  ? 30  DC  L C4    1 
ATOM   602  N N4    . DC  B 2 5  ? 0.134   20.663 15.948  1.00 55.76  ? 30  DC  L N4    1 
ATOM   603  C C5    . DC  B 2 5  ? -1.539  21.330 14.368  1.00 55.31  ? 30  DC  L C5    1 
ATOM   604  C C6    . DC  B 2 5  ? -2.114  22.343 13.714  1.00 56.21  ? 30  DC  L C6    1 
ATOM   605  P P     . DT  B 2 6  ? -2.782  26.971 9.602   1.00 89.95  ? 31  DT  L P     1 
ATOM   606  O OP1   . DT  B 2 6  ? -3.547  28.059 8.952   1.00 92.78  ? 31  DT  L OP1   1 
ATOM   607  O OP2   . DT  B 2 6  ? -2.511  25.720 8.857   1.00 88.91  ? 31  DT  L OP2   1 
ATOM   608  O "O5'" . DT  B 2 6  ? -1.384  27.551 10.120  1.00 73.89  ? 31  DT  L "O5'" 1 
ATOM   609  C "C5'" . DT  B 2 6  ? -1.366  28.673 10.994  1.00 74.66  ? 31  DT  L "C5'" 1 
ATOM   610  C "C4'" . DT  B 2 6  ? 0.017   28.893 11.580  1.00 75.80  ? 31  DT  L "C4'" 1 
ATOM   611  O "O4'" . DT  B 2 6  ? 0.415   27.720 12.339  1.00 70.45  ? 31  DT  L "O4'" 1 
ATOM   612  C "C3'" . DT  B 2 6  ? 1.125   29.130 10.547  1.00 81.91  ? 31  DT  L "C3'" 1 
ATOM   613  O "O3'" . DT  B 2 6  ? 1.768   30.378 10.783  1.00 88.60  ? 31  DT  L "O3'" 1 
ATOM   614  C "C2'" . DT  B 2 6  ? 2.077   27.946 10.728  1.00 78.55  ? 31  DT  L "C2'" 1 
ATOM   615  C "C1'" . DT  B 2 6  ? 1.788   27.493 12.147  1.00 71.75  ? 31  DT  L "C1'" 1 
ATOM   616  N N1    . DT  B 2 6  ? 2.086   26.045 12.403  1.00 64.55  ? 31  DT  L N1    1 
ATOM   617  C C2    . DT  B 2 6  ? 3.161   25.705 13.194  1.00 62.76  ? 31  DT  L C2    1 
ATOM   618  O O2    . DT  B 2 6  ? 3.901   26.525 13.709  1.00 65.28  ? 31  DT  L O2    1 
ATOM   619  N N3    . DT  B 2 6  ? 3.344   24.359 13.365  1.00 59.36  ? 31  DT  L N3    1 
ATOM   620  C C4    . DT  B 2 6  ? 2.579   23.337 12.838  1.00 56.47  ? 31  DT  L C4    1 
ATOM   621  O O4    . DT  B 2 6  ? 2.828   22.155 13.052  1.00 54.16  ? 31  DT  L O4    1 
ATOM   622  C C5    . DT  B 2 6  ? 1.466   23.759 12.017  1.00 57.46  ? 31  DT  L C5    1 
ATOM   623  C C7    . DT  B 2 6  ? 0.562   22.737 11.387  1.00 54.80  ? 31  DT  L C7    1 
ATOM   624  C C6    . DT  B 2 6  ? 1.274   25.077 11.841  1.00 61.52  ? 31  DT  L C6    1 
ATOM   625  P P     . DG  B 2 7  ? 2.752   31.009 9.681   1.00 112.48 ? 32  DG  L P     1 
ATOM   626  O OP1   . DG  B 2 7  ? 2.723   32.477 9.864   1.00 116.72 ? 32  DG  L OP1   1 
ATOM   627  O OP2   . DG  B 2 7  ? 2.407   30.426 8.365   1.00 113.03 ? 32  DG  L OP2   1 
ATOM   628  O "O5'" . DG  B 2 7  ? 4.198   30.455 10.090  1.00 90.47  ? 32  DG  L "O5'" 1 
ATOM   629  C "C5'" . DG  B 2 7  ? 4.813   30.892 11.297  1.00 89.34  ? 32  DG  L "C5'" 1 
ATOM   630  C "C4'" . DG  B 2 7  ? 6.065   30.085 11.596  1.00 90.25  ? 32  DG  L "C4'" 1 
ATOM   631  O "O4'" . DG  B 2 7  ? 5.705   28.699 11.838  1.00 82.68  ? 32  DG  L "O4'" 1 
ATOM   632  C "C3'" . DG  B 2 7  ? 7.103   30.068 10.468  1.00 97.52  ? 32  DG  L "C3'" 1 
ATOM   633  O "O3'" . DG  B 2 7  ? 8.370   30.494 10.953  1.00 105.09 ? 32  DG  L "O3'" 1 
ATOM   634  C "C2'" . DG  B 2 7  ? 7.118   28.615 9.994   1.00 92.56  ? 32  DG  L "C2'" 1 
ATOM   635  C "C1'" . DG  B 2 7  ? 6.653   27.862 11.223  1.00 83.35  ? 32  DG  L "C1'" 1 
ATOM   636  N N9    . DG  B 2 7  ? 6.030   26.579 10.932  1.00 74.27  ? 32  DG  L N9    1 
ATOM   637  C C8    . DG  B 2 7  ? 4.942   26.353 10.127  1.00 71.52  ? 32  DG  L C8    1 
ATOM   638  N N7    . DG  B 2 7  ? 4.603   25.097 10.053  1.00 66.47  ? 32  DG  L N7    1 
ATOM   639  C C5    . DG  B 2 7  ? 5.526   24.448 10.862  1.00 64.32  ? 32  DG  L C5    1 
ATOM   640  C C6    . DG  B 2 7  ? 5.659   23.074 11.171  1.00 60.96  ? 32  DG  L C6    1 
ATOM   641  O O6    . DG  B 2 7  ? 4.965   22.128 10.776  1.00 58.24  ? 32  DG  L O6    1 
ATOM   642  N N1    . DG  B 2 7  ? 6.729   22.841 12.032  1.00 61.30  ? 32  DG  L N1    1 
ATOM   643  C C2    . DG  B 2 7  ? 7.563   23.814 12.530  1.00 64.41  ? 32  DG  L C2    1 
ATOM   644  N N2    . DG  B 2 7  ? 8.541   23.395 13.347  1.00 64.38  ? 32  DG  L N2    1 
ATOM   645  N N3    . DG  B 2 7  ? 7.449   25.105 12.248  1.00 67.63  ? 32  DG  L N3    1 
ATOM   646  C C4    . DG  B 2 7  ? 6.411   25.347 11.410  1.00 68.00  ? 32  DG  L C4    1 
ATOM   647  P P     . DT  B 2 8  ? 9.607   30.665 9.944   1.00 88.59  ? 33  DT  L P     1 
ATOM   648  O OP1   . DT  B 2 8  ? 10.570  31.596 10.572  1.00 92.77  ? 33  DT  L OP1   1 
ATOM   649  O OP2   . DT  B 2 8  ? 9.054   30.971 8.606   1.00 91.99  ? 33  DT  L OP2   1 
ATOM   650  O "O5'" . DT  B 2 8  ? 10.265  29.209 9.901   1.00 86.23  ? 33  DT  L "O5'" 1 
ATOM   651  C "C5'" . DT  B 2 8  ? 10.661  28.576 11.114  1.00 82.18  ? 33  DT  L "C5'" 1 
ATOM   652  C "C4'" . DT  B 2 8  ? 11.300  27.225 10.850  1.00 81.29  ? 33  DT  L "C4'" 1 
ATOM   653  O "O4'" . DT  B 2 8  ? 10.264  26.213 10.718  1.00 75.76  ? 33  DT  L "O4'" 1 
ATOM   654  C "C3'" . DT  B 2 8  ? 12.142  27.142 9.566   1.00 87.64  ? 33  DT  L "C3'" 1 
ATOM   655  O "O3'" . DT  B 2 8  ? 13.438  26.632 9.847   1.00 89.99  ? 33  DT  L "O3'" 1 
ATOM   656  C "C2'" . DT  B 2 8  ? 11.339  26.208 8.667   1.00 85.32  ? 33  DT  L "C2'" 1 
ATOM   657  C "C1'" . DT  B 2 8  ? 10.622  25.336 9.680   1.00 77.72  ? 33  DT  L "C1'" 1 
ATOM   658  N N1    . DT  B 2 8  ? 9.392   24.645 9.161   1.00 73.77  ? 33  DT  L N1    1 
ATOM   659  C C2    . DT  B 2 8  ? 9.175   23.325 9.493   1.00 69.20  ? 33  DT  L C2    1 
ATOM   660  O O2    . DT  B 2 8  ? 9.933   22.678 10.195  1.00 68.19  ? 33  DT  L O2    1 
ATOM   661  N N3    . DT  B 2 8  ? 8.033   22.782 8.972   1.00 66.13  ? 33  DT  L N3    1 
ATOM   662  C C4    . DT  B 2 8  ? 7.102   23.408 8.166   1.00 67.10  ? 33  DT  L C4    1 
ATOM   663  O O4    . DT  B 2 8  ? 6.104   22.829 7.749   1.00 64.26  ? 33  DT  L O4    1 
ATOM   664  C C5    . DT  B 2 8  ? 7.384   24.790 7.853   1.00 72.02  ? 33  DT  L C5    1 
ATOM   665  C C7    . DT  B 2 8  ? 6.443   25.576 6.985   1.00 73.89  ? 33  DT  L C7    1 
ATOM   666  C C6    . DT  B 2 8  ? 8.502   25.337 8.359   1.00 75.13  ? 33  DT  L C6    1 
ATOM   667  P P     . DC  B 2 9  ? 14.702  27.102 8.973   1.00 126.00 ? 34  DC  L P     1 
ATOM   668  O OP1   . DC  B 2 9  ? 15.362  28.211 9.698   1.00 128.88 ? 34  DC  L OP1   1 
ATOM   669  O OP2   . DC  B 2 9  ? 14.241  27.298 7.581   1.00 129.69 ? 34  DC  L OP2   1 
ATOM   670  O "O5'" . DC  B 2 9  ? 15.666  25.828 8.988   1.00 108.55 ? 34  DC  L "O5'" 1 
ATOM   671  C "C5'" . DC  B 2 9  ? 16.013  25.215 10.224  1.00 104.31 ? 34  DC  L "C5'" 1 
ATOM   672  C "C4'" . DC  B 2 9  ? 15.989  23.704 10.103  1.00 101.25 ? 34  DC  L "C4'" 1 
ATOM   673  O "O4'" . DC  B 2 9  ? 14.627  23.256 9.879   1.00 96.00  ? 34  DC  L "O4'" 1 
ATOM   674  C "C3'" . DC  B 2 9  ? 16.822  23.145 8.945   1.00 107.09 ? 34  DC  L "C3'" 1 
ATOM   675  O "O3'" . DC  B 2 9  ? 17.800  22.230 9.429   1.00 107.19 ? 34  DC  L "O3'" 1 
ATOM   676  C "C2'" . DC  B 2 9  ? 15.800  22.470 8.029   1.00 105.07 ? 34  DC  L "C2'" 1 
ATOM   677  C "C1'" . DC  B 2 9  ? 14.636  22.191 8.963   1.00 96.95  ? 34  DC  L "C1'" 1 
ATOM   678  N N1    . DC  B 2 9  ? 13.298  22.125 8.279   1.00 94.25  ? 34  DC  L N1    1 
ATOM   679  C C2    . DC  B 2 9  ? 12.516  20.962 8.369   1.00 89.11  ? 34  DC  L C2    1 
ATOM   680  O O2    . DC  B 2 9  ? 12.936  19.993 9.014   1.00 86.96  ? 34  DC  L O2    1 
ATOM   681  N N3    . DC  B 2 9  ? 11.313  20.933 7.743   1.00 86.92  ? 34  DC  L N3    1 
ATOM   682  C C4    . DC  B 2 9  ? 10.890  21.994 7.054   1.00 89.68  ? 34  DC  L C4    1 
ATOM   683  N N4    . DC  B 2 9  ? 9.696   21.917 6.455   1.00 87.54  ? 34  DC  L N4    1 
ATOM   684  C C5    . DC  B 2 9  ? 11.669  23.182 6.952   1.00 95.08  ? 34  DC  L C5    1 
ATOM   685  C C6    . DC  B 2 9  ? 12.853  23.204 7.572   1.00 97.17  ? 34  DC  L C6    1 
ATOM   686  P P     . DA  B 2 10 ? 19.088  21.868 8.538   1.00 197.54 ? 35  DA  L P     1 
ATOM   687  O OP1   . DA  B 2 10 ? 20.261  21.887 9.439   1.00 199.09 ? 35  DA  L OP1   1 
ATOM   688  O OP2   . DA  B 2 10 ? 19.076  22.726 7.333   1.00 203.70 ? 35  DA  L OP2   1 
ATOM   689  O "O5'" . DA  B 2 10 ? 18.816  20.363 8.064   1.00 118.15 ? 35  DA  L "O5'" 1 
ATOM   690  C "C5'" . DA  B 2 10 ? 18.721  19.316 9.027   1.00 113.01 ? 35  DA  L "C5'" 1 
ATOM   691  C "C4'" . DA  B 2 10 ? 18.218  18.032 8.388   1.00 112.35 ? 35  DA  L "C4'" 1 
ATOM   692  O "O4'" . DA  B 2 10 ? 16.877  18.250 7.865   1.00 109.22 ? 35  DA  L "O4'" 1 
ATOM   693  C "C3'" . DA  B 2 10 ? 19.050  17.531 7.210   1.00 119.31 ? 35  DA  L "C3'" 1 
ATOM   694  O "O3'" . DA  B 2 10 ? 19.102  16.107 7.193   1.00 117.90 ? 35  DA  L "O3'" 1 
ATOM   695  C "C2'" . DA  B 2 10 ? 18.316  18.098 6.004   1.00 122.06 ? 35  DA  L "C2'" 1 
ATOM   696  C "C1'" . DA  B 2 10 ? 16.861  18.071 6.460   1.00 114.87 ? 35  DA  L "C1'" 1 
ATOM   697  N N9    . DA  B 2 10 ? 16.021  19.113 5.865   1.00 116.11 ? 35  DA  L N9    1 
ATOM   698  C C8    . DA  B 2 10 ? 16.424  20.322 5.365   1.00 122.70 ? 35  DA  L C8    1 
ATOM   699  N N7    . DA  B 2 10 ? 15.442  21.056 4.898   1.00 121.71 ? 35  DA  L N7    1 
ATOM   700  C C5    . DA  B 2 10 ? 14.316  20.276 5.104   1.00 113.77 ? 35  DA  L C5    1 
ATOM   701  C C6    . DA  B 2 10 ? 12.951  20.486 4.825   1.00 108.74 ? 35  DA  L C6    1 
ATOM   702  N N6    . DA  B 2 10 ? 12.479  21.598 4.251   1.00 111.03 ? 35  DA  L N6    1 
ATOM   703  N N1    . DA  B 2 10 ? 12.087  19.505 5.158   1.00 101.80 ? 35  DA  L N1    1 
ATOM   704  C C2    . DA  B 2 10 ? 12.563  18.394 5.732   1.00 99.77  ? 35  DA  L C2    1 
ATOM   705  N N3    . DA  B 2 10 ? 13.820  18.084 6.044   1.00 103.65 ? 35  DA  L N3    1 
ATOM   706  C C4    . DA  B 2 10 ? 14.655  19.076 5.700   1.00 110.77 ? 35  DA  L C4    1 
ATOM   707  P P     . DT  C 3 1  ? 5.191   16.510 -1.331  1.00 84.76  ? 4   DT  M P     1 
ATOM   708  O OP1   . DT  C 3 1  ? 5.711   15.836 -2.543  1.00 80.87  ? 4   DT  M OP1   1 
ATOM   709  O OP2   . DT  C 3 1  ? 3.742   16.782 -1.199  1.00 85.53  ? 4   DT  M OP2   1 
ATOM   710  O "O5'" . DT  C 3 1  ? 5.654   15.702 -0.030  1.00 71.61  ? 4   DT  M "O5'" 1 
ATOM   711  C "C5'" . DT  C 3 1  ? 6.032   14.335 -0.136  1.00 70.26  ? 4   DT  M "C5'" 1 
ATOM   712  C "C4'" . DT  C 3 1  ? 6.633   13.838 1.165   1.00 71.05  ? 4   DT  M "C4'" 1 
ATOM   713  O "O4'" . DT  C 3 1  ? 7.689   14.751 1.583   1.00 73.00  ? 4   DT  M "O4'" 1 
ATOM   714  C "C3'" . DT  C 3 1  ? 5.657   13.758 2.338   1.00 71.28  ? 4   DT  M "C3'" 1 
ATOM   715  O "O3'" . DT  C 3 1  ? 5.912   12.597 3.125   1.00 70.75  ? 4   DT  M "O3'" 1 
ATOM   716  C "C2'" . DT  C 3 1  ? 5.923   15.047 3.102   1.00 73.44  ? 4   DT  M "C2'" 1 
ATOM   717  C "C1'" . DT  C 3 1  ? 7.413   15.261 2.873   1.00 74.39  ? 4   DT  M "C1'" 1 
ATOM   718  N N1    . DT  C 3 1  ? 7.845   16.703 2.927   1.00 76.30  ? 4   DT  M N1    1 
ATOM   719  C C2    . DT  C 3 1  ? 8.888   17.073 3.751   1.00 78.00  ? 4   DT  M C2    1 
ATOM   720  O O2    . DT  C 3 1  ? 9.497   16.288 4.457   1.00 78.05  ? 4   DT  M O2    1 
ATOM   721  N N3    . DT  C 3 1  ? 9.196   18.408 3.721   1.00 79.68  ? 4   DT  M N3    1 
ATOM   722  C C4    . DT  C 3 1  ? 8.583   19.390 2.967   1.00 79.81  ? 4   DT  M C4    1 
ATOM   723  O O4    . DT  C 3 1  ? 8.935   20.565 3.011   1.00 81.40  ? 4   DT  M O4    1 
ATOM   724  C C5    . DT  C 3 1  ? 7.499   18.936 2.125   1.00 77.97  ? 4   DT  M C5    1 
ATOM   725  C C7    . DT  C 3 1  ? 6.753   19.908 1.257   1.00 77.92  ? 4   DT  M C7    1 
ATOM   726  C C6    . DT  C 3 1  ? 7.188   17.631 2.144   1.00 76.33  ? 4   DT  M C6    1 
ATOM   727  P P     . DG  C 3 2  ? 4.766   11.982 4.071   1.00 70.16  ? 5   DG  M P     1 
ATOM   728  O OP1   . DG  C 3 2  ? 4.361   10.681 3.496   1.00 68.06  ? 5   DG  M OP1   1 
ATOM   729  O OP2   . DG  C 3 2  ? 3.750   13.032 4.307   1.00 70.93  ? 5   DG  M OP2   1 
ATOM   730  O "O5'" . DG  C 3 2  ? 5.518   11.723 5.458   1.00 71.38  ? 5   DG  M "O5'" 1 
ATOM   731  C "C5'" . DG  C 3 2  ? 6.699   10.929 5.493   1.00 71.20  ? 5   DG  M "C5'" 1 
ATOM   732  C "C4'" . DG  C 3 2  ? 7.685   11.476 6.508   1.00 73.17  ? 5   DG  M "C4'" 1 
ATOM   733  O "O4'" . DG  C 3 2  ? 8.003   12.849 6.176   1.00 74.63  ? 5   DG  M "O4'" 1 
ATOM   734  C "C3'" . DG  C 3 2  ? 7.173   11.492 7.953   1.00 74.05  ? 5   DG  M "C3'" 1 
ATOM   735  O "O3'" . DG  C 3 2  ? 7.926   10.583 8.756   1.00 74.11  ? 5   DG  M "O3'" 1 
ATOM   736  C "C2'" . DG  C 3 2  ? 7.326   12.951 8.408   1.00 76.15  ? 5   DG  M "C2'" 1 
ATOM   737  C "C1'" . DG  C 3 2  ? 8.237   13.567 7.360   1.00 76.53  ? 5   DG  M "C1'" 1 
ATOM   738  N N9    . DG  C 3 2  ? 7.974   14.982 7.115   1.00 77.77  ? 5   DG  M N9    1 
ATOM   739  C C8    . DG  C 3 2  ? 6.885   15.521 6.474   1.00 77.22  ? 5   DG  M C8    1 
ATOM   740  N N7    . DG  C 3 2  ? 6.915   16.823 6.404   1.00 78.65  ? 5   DG  M N7    1 
ATOM   741  C C5    . DG  C 3 2  ? 8.099   17.171 7.040   1.00 80.27  ? 5   DG  M C5    1 
ATOM   742  C C6    . DG  C 3 2  ? 8.668   18.445 7.271   1.00 82.27  ? 5   DG  M C6    1 
ATOM   743  O O6    . DG  C 3 2  ? 8.223   19.555 6.948   1.00 83.00  ? 5   DG  M O6    1 
ATOM   744  N N1    . DG  C 3 2  ? 9.879   18.353 7.952   1.00 83.48  ? 5   DG  M N1    1 
ATOM   745  C C2    . DG  C 3 2  ? 10.466  17.178 8.358   1.00 82.82  ? 5   DG  M C2    1 
ATOM   746  N N2    . DG  C 3 2  ? 11.636  17.289 9.002   1.00 84.22  ? 5   DG  M N2    1 
ATOM   747  N N3    . DG  C 3 2  ? 9.943   15.976 8.147   1.00 80.94  ? 5   DG  M N3    1 
ATOM   748  C C4    . DG  C 3 2  ? 8.763   16.049 7.485   1.00 79.76  ? 5   DG  M C4    1 
ATOM   749  P P     . DA  C 3 3  ? 7.693   10.509 10.344  1.00 75.18  ? 6   DA  M P     1 
ATOM   750  O OP1   . DA  C 3 3  ? 8.007   9.130  10.776  1.00 74.16  ? 6   DA  M OP1   1 
ATOM   751  O OP2   . DA  C 3 3  ? 6.369   11.094 10.649  1.00 75.35  ? 6   DA  M OP2   1 
ATOM   752  O "O5'" . DA  C 3 3  ? 8.802   11.497 10.932  1.00 77.43  ? 6   DA  M "O5'" 1 
ATOM   753  C "C5'" . DA  C 3 3  ? 8.682   11.985 12.254  1.00 79.03  ? 6   DA  M "C5'" 1 
ATOM   754  C "C4'" . DA  C 3 3  ? 9.574   13.192 12.467  1.00 81.12  ? 6   DA  M "C4'" 1 
ATOM   755  O "O4'" . DA  C 3 3  ? 9.404   14.119 11.372  1.00 81.16  ? 6   DA  M "O4'" 1 
ATOM   756  C "C3'" . DA  C 3 3  ? 9.270   13.993 13.717  1.00 82.94  ? 6   DA  M "C3'" 1 
ATOM   757  O "O3'" . DA  C 3 3  ? 9.980   13.453 14.832  1.00 83.70  ? 6   DA  M "O3'" 1 
ATOM   758  C "C2'" . DA  C 3 3  ? 9.732   15.404 13.350  1.00 84.54  ? 6   DA  M "C2'" 1 
ATOM   759  C "C1'" . DA  C 3 3  ? 9.657   15.440 11.817  1.00 83.22  ? 6   DA  M "C1'" 1 
ATOM   760  N N9    . DA  C 3 3  ? 8.604   16.312 11.296  1.00 83.15  ? 6   DA  M N9    1 
ATOM   761  C C8    . DA  C 3 3  ? 7.376   15.933 10.833  1.00 81.59  ? 6   DA  M C8    1 
ATOM   762  N N7    . DA  C 3 3  ? 6.632   16.933 10.420  1.00 81.96  ? 6   DA  M N7    1 
ATOM   763  C C5    . DA  C 3 3  ? 7.429   18.047 10.626  1.00 83.89  ? 6   DA  M C5    1 
ATOM   764  C C6    . DA  C 3 3  ? 7.218   19.422 10.392  1.00 85.15  ? 6   DA  M C6    1 
ATOM   765  N N6    . DA  C 3 3  ? 6.088   19.918 9.878   1.00 84.61  ? 6   DA  M N6    1 
ATOM   766  N N1    . DA  C 3 3  ? 8.218   20.269 10.711  1.00 87.01  ? 6   DA  M N1    1 
ATOM   767  C C2    . DA  C 3 3  ? 9.348   19.770 11.226  1.00 87.57  ? 6   DA  M C2    1 
ATOM   768  N N3    . DA  C 3 3  ? 9.661   18.502 11.491  1.00 86.51  ? 6   DA  M N3    1 
ATOM   769  C C4    . DA  C 3 3  ? 8.649   17.683 11.165  1.00 84.66  ? 6   DA  M C4    1 
ATOM   770  P P     . DC  C 3 4  ? 9.290   13.339 16.280  1.00 84.43  ? 7   DC  M P     1 
ATOM   771  O OP1   . DC  C 3 4  ? 10.136  12.434 17.088  1.00 84.58  ? 7   DC  M OP1   1 
ATOM   772  O OP2   . DC  C 3 4  ? 7.856   13.021 16.104  1.00 83.08  ? 7   DC  M OP2   1 
ATOM   773  O "O5'" . DC  C 3 4  ? 9.410   14.817 16.874  1.00 86.77  ? 7   DC  M "O5'" 1 
ATOM   774  C "C5'" . DC  C 3 4  ? 10.668  15.488 16.858  1.00 88.30  ? 7   DC  M "C5'" 1 
ATOM   775  C "C4'" . DC  C 3 4  ? 10.488  16.974 17.091  1.00 90.17  ? 7   DC  M "C4'" 1 
ATOM   776  O "O4'" . DC  C 3 4  ? 9.808   17.564 15.945  1.00 89.42  ? 7   DC  M "O4'" 1 
ATOM   777  C "C3'" . DC  C 3 4  ? 9.643   17.327 18.317  1.00 91.20  ? 7   DC  M "C3'" 1 
ATOM   778  O "O3'" . DC  C 3 4  ? 10.246  18.372 19.065  1.00 93.51  ? 7   DC  M "O3'" 1 
ATOM   779  C "C2'" . DC  C 3 4  ? 8.306   17.740 17.719  1.00 90.35  ? 7   DC  M "C2'" 1 
ATOM   780  C "C1'" . DC  C 3 4  ? 8.728   18.353 16.394  1.00 90.12  ? 7   DC  M "C1'" 1 
ATOM   781  N N1    . DC  C 3 4  ? 7.652   18.375 15.331  1.00 88.54  ? 7   DC  M N1    1 
ATOM   782  C C2    . DC  C 3 4  ? 7.572   19.465 14.450  1.00 88.99  ? 7   DC  M C2    1 
ATOM   783  O O2    . DC  C 3 4  ? 8.387   20.390 14.554  1.00 92.93  ? 7   DC  M O2    1 
ATOM   784  N N3    . DC  C 3 4  ? 6.603   19.474 13.502  1.00 87.58  ? 7   DC  M N3    1 
ATOM   785  C C4    . DC  C 3 4  ? 5.740   18.461 13.416  1.00 85.82  ? 7   DC  M C4    1 
ATOM   786  N N4    . DC  C 3 4  ? 4.803   18.519 12.464  1.00 84.51  ? 7   DC  M N4    1 
ATOM   787  C C5    . DC  C 3 4  ? 5.802   17.344 14.300  1.00 85.34  ? 7   DC  M C5    1 
ATOM   788  C C6    . DC  C 3 4  ? 6.763   17.342 15.231  1.00 86.72  ? 7   DC  M C6    1 
ATOM   789  P P     . DA  C 3 5  ? 10.149  18.371 20.668  1.00 104.76 ? 8   DA  M P     1 
ATOM   790  O OP1   . DA  C 3 5  ? 11.315  17.621 21.188  1.00 103.46 ? 8   DA  M OP1   1 
ATOM   791  O OP2   . DA  C 3 5  ? 8.778   17.946 21.031  1.00 103.42 ? 8   DA  M OP2   1 
ATOM   792  O "O5'" . DA  C 3 5  ? 10.311  19.911 21.059  1.00 132.64 ? 8   DA  M "O5'" 1 
ATOM   793  C "C5'" . DA  C 3 5  ? 11.465  20.627 20.644  1.00 135.36 ? 8   DA  M "C5'" 1 
ATOM   794  C "C4'" . DA  C 3 5  ? 11.135  22.084 20.382  1.00 140.41 ? 8   DA  M "C4'" 1 
ATOM   795  O "O4'" . DA  C 3 5  ? 10.320  22.184 19.177  1.00 138.46 ? 8   DA  M "O4'" 1 
ATOM   796  C "C3'" . DA  C 3 5  ? 10.335  22.769 21.490  1.00 144.65 ? 8   DA  M "C3'" 1 
ATOM   797  O "O3'" . DA  C 3 5  ? 10.794  24.105 21.692  1.00 150.07 ? 8   DA  M "O3'" 1 
ATOM   798  C "C2'" . DA  C 3 5  ? 8.906   22.716 20.967  1.00 142.90 ? 8   DA  M "C2'" 1 
ATOM   799  C "C1'" . DA  C 3 5  ? 9.107   22.852 19.468  1.00 140.88 ? 8   DA  M "C1'" 1 
ATOM   800  N N9    . DA  C 3 5  ? 8.035   22.261 18.670  1.00 136.59 ? 8   DA  M N9    1 
ATOM   801  C C8    . DA  C 3 5  ? 7.533   20.995 18.774  1.00 131.55 ? 8   DA  M C8    1 
ATOM   802  N N7    . DA  C 3 5  ? 6.567   20.736 17.925  1.00 128.60 ? 8   DA  M N7    1 
ATOM   803  C C5    . DA  C 3 5  ? 6.425   21.915 17.213  1.00 131.80 ? 8   DA  M C5    1 
ATOM   804  C C6    . DA  C 3 5  ? 5.565   22.293 16.163  1.00 130.96 ? 8   DA  M C6    1 
ATOM   805  N N6    . DA  C 3 5  ? 4.649   21.476 15.632  1.00 126.21 ? 8   DA  M N6    1 
ATOM   806  N N1    . DA  C 3 5  ? 5.684   23.546 15.678  1.00 135.43 ? 8   DA  M N1    1 
ATOM   807  C C2    . DA  C 3 5  ? 6.602   24.360 16.212  1.00 140.11 ? 8   DA  M C2    1 
ATOM   808  N N3    . DA  C 3 5  ? 7.465   24.119 17.199  1.00 141.19 ? 8   DA  M N3    1 
ATOM   809  C C4    . DA  C 3 5  ? 7.323   22.866 17.659  1.00 136.87 ? 8   DA  M C4    1 
ATOM   810  P P     . DG  C 3 6  ? 10.127  25.030 22.825  1.00 182.21 ? 9   DG  M P     1 
ATOM   811  O OP1   . DG  C 3 6  ? 11.130  26.037 23.234  1.00 187.50 ? 9   DG  M OP1   1 
ATOM   812  O OP2   . DG  C 3 6  ? 9.532   24.134 23.841  1.00 180.32 ? 9   DG  M OP2   1 
ATOM   813  O "O5'" . DG  C 3 6  ? 8.931   25.771 22.062  1.00 127.58 ? 9   DG  M "O5'" 1 
ATOM   814  C "C5'" . DG  C 3 6  ? 9.212   26.659 20.982  1.00 129.18 ? 9   DG  M "C5'" 1 
ATOM   815  C "C4'" . DG  C 3 6  ? 7.957   27.389 20.535  1.00 130.61 ? 9   DG  M "C4'" 1 
ATOM   816  O "O4'" . DG  C 3 6  ? 7.175   26.521 19.665  1.00 125.23 ? 9   DG  M "O4'" 1 
ATOM   817  C "C3'" . DG  C 3 6  ? 7.019   27.815 21.673  1.00 134.01 ? 9   DG  M "C3'" 1 
ATOM   818  O "O3'" . DG  C 3 6  ? 6.627   29.180 21.525  1.00 138.96 ? 9   DG  M "O3'" 1 
ATOM   819  C "C2'" . DG  C 3 6  ? 5.839   26.856 21.545  1.00 129.47 ? 9   DG  M "C2'" 1 
ATOM   820  C "C1'" . DG  C 3 6  ? 5.822   26.558 20.058  1.00 125.57 ? 9   DG  M "C1'" 1 
ATOM   821  N N9    . DG  C 3 6  ? 5.185   25.288 19.707  1.00 119.71 ? 9   DG  M N9    1 
ATOM   822  C C8    . DG  C 3 6  ? 5.489   24.042 20.202  1.00 115.87 ? 9   DG  M C8    1 
ATOM   823  N N7    . DG  C 3 6  ? 4.748   23.091 19.702  1.00 110.99 ? 9   DG  M N7    1 
ATOM   824  C C5    . DG  C 3 6  ? 3.900   23.747 18.819  1.00 111.65 ? 9   DG  M C5    1 
ATOM   825  C C6    . DG  C 3 6  ? 2.877   23.235 17.985  1.00 107.85 ? 9   DG  M C6    1 
ATOM   826  O O6    . DG  C 3 6  ? 2.506   22.060 17.858  1.00 103.00 ? 9   DG  M O6    1 
ATOM   827  N N1    . DG  C 3 6  ? 2.260   24.243 17.247  1.00 110.27 ? 9   DG  M N1    1 
ATOM   828  C C2    . DG  C 3 6  ? 2.591   25.576 17.309  1.00 115.66 ? 9   DG  M C2    1 
ATOM   829  N N2    . DG  C 3 6  ? 1.884   26.401 16.523  1.00 117.28 ? 9   DG  M N2    1 
ATOM   830  N N3    . DG  C 3 6  ? 3.546   26.069 18.086  1.00 119.27 ? 9   DG  M N3    1 
ATOM   831  C C4    . DG  C 3 6  ? 4.157   25.100 18.811  1.00 116.99 ? 9   DG  M C4    1 
ATOM   832  P P     . DC  C 3 7  ? 5.768   29.909 22.672  1.00 131.44 ? 10  DC  M P     1 
ATOM   833  O OP1   . DC  C 3 7  ? 6.398   31.221 22.938  1.00 137.54 ? 10  DC  M OP1   1 
ATOM   834  O OP2   . DC  C 3 7  ? 5.583   28.948 23.782  1.00 129.73 ? 10  DC  M OP2   1 
ATOM   835  O "O5'" . DC  C 3 7  ? 4.340   30.151 21.989  1.00 152.75 ? 10  DC  M "O5'" 1 
ATOM   836  C "C5'" . DC  C 3 7  ? 4.238   30.968 20.826  1.00 153.23 ? 10  DC  M "C5'" 1 
ATOM   837  C "C4'" . DC  C 3 7  ? 2.864   30.847 20.188  1.00 150.58 ? 10  DC  M "C4'" 1 
ATOM   838  O "O4'" . DC  C 3 7  ? 2.630   29.464 19.799  1.00 143.86 ? 10  DC  M "O4'" 1 
ATOM   839  C "C3'" . DC  C 3 7  ? 1.695   31.240 21.098  1.00 152.94 ? 10  DC  M "C3'" 1 
ATOM   840  O "O3'" . DC  C 3 7  ? 0.809   32.129 20.422  1.00 154.81 ? 10  DC  M "O3'" 1 
ATOM   841  C "C2'" . DC  C 3 7  ? 1.032   29.910 21.439  1.00 148.22 ? 10  DC  M "C2'" 1 
ATOM   842  C "C1'" . DC  C 3 7  ? 1.347   29.061 20.222  1.00 142.64 ? 10  DC  M "C1'" 1 
ATOM   843  N N1    . DC  C 3 7  ? 1.366   27.585 20.497  1.00 137.24 ? 10  DC  M N1    1 
ATOM   844  C C2    . DC  C 3 7  ? 0.396   26.747 19.925  1.00 132.75 ? 10  DC  M C2    1 
ATOM   845  O O2    . DC  C 3 7  ? -0.473  27.234 19.190  1.00 133.79 ? 10  DC  M O2    1 
ATOM   846  N N3    . DC  C 3 7  ? 0.438   25.418 20.194  1.00 127.06 ? 10  DC  M N3    1 
ATOM   847  C C4    . DC  C 3 7  ? 1.388   24.925 20.989  1.00 126.12 ? 10  DC  M C4    1 
ATOM   848  N N4    . DC  C 3 7  ? 1.388   23.609 21.225  1.00 120.40 ? 10  DC  M N4    1 
ATOM   849  C C5    . DC  C 3 7  ? 2.380   25.761 21.580  1.00 131.22 ? 10  DC  M C5    1 
ATOM   850  C C6    . DC  C 3 7  ? 2.332   27.069 21.310  1.00 136.39 ? 10  DC  M C6    1 
ATOM   851  P P     . DT  C 3 8  ? -0.416  32.809 21.209  1.00 193.88 ? 11  DT  M P     1 
ATOM   852  O OP1   . DT  C 3 8  ? -0.641  34.141 20.606  1.00 198.10 ? 11  DT  M OP1   1 
ATOM   853  O OP2   . DT  C 3 8  ? -0.149  32.694 22.660  1.00 196.28 ? 11  DT  M OP2   1 
ATOM   854  O "O5'" . DT  C 3 8  ? -1.665  31.868 20.868  1.00 140.43 ? 11  DT  M "O5'" 1 
ATOM   855  C "C5'" . DT  C 3 8  ? -2.128  31.760 19.525  1.00 137.18 ? 11  DT  M "C5'" 1 
ATOM   856  C "C4'" . DT  C 3 8  ? -3.343  30.854 19.437  1.00 133.20 ? 11  DT  M "C4'" 1 
ATOM   857  O "O4'" . DT  C 3 8  ? -2.938  29.478 19.671  1.00 128.14 ? 11  DT  M "O4'" 1 
ATOM   858  C "C3'" . DT  C 3 8  ? -4.449  31.155 20.458  1.00 136.21 ? 11  DT  M "C3'" 1 
ATOM   859  O "O3'" . DT  C 3 8  ? -5.703  31.337 19.805  1.00 135.43 ? 11  DT  M "O3'" 1 
ATOM   860  C "C2'" . DT  C 3 8  ? -4.449  29.936 21.378  1.00 133.06 ? 11  DT  M "C2'" 1 
ATOM   861  C "C1'" . DT  C 3 8  ? -3.901  28.846 20.477  1.00 127.02 ? 11  DT  M "C1'" 1 
ATOM   862  N N1    . DT  C 3 8  ? -3.255  27.708 21.206  1.00 123.94 ? 11  DT  M N1    1 
ATOM   863  C C2    . DT  C 3 8  ? -3.749  26.432 21.040  1.00 118.49 ? 11  DT  M C2    1 
ATOM   864  O O2    . DT  C 3 8  ? -4.698  26.167 20.324  1.00 116.01 ? 11  DT  M O2    1 
ATOM   865  N N3    . DT  C 3 8  ? -3.087  25.466 21.748  1.00 116.09 ? 11  DT  M N3    1 
ATOM   866  C C4    . DT  C 3 8  ? -2.005  25.640 22.589  1.00 118.53 ? 11  DT  M C4    1 
ATOM   867  O O4    . DT  C 3 8  ? -1.480  24.703 23.182  1.00 116.05 ? 11  DT  M O4    1 
ATOM   868  C C5    . DT  C 3 8  ? -1.535  27.000 22.720  1.00 124.28 ? 11  DT  M C5    1 
ATOM   869  C C7    . DT  C 3 8  ? -0.364  27.315 23.606  1.00 127.48 ? 11  DT  M C7    1 
ATOM   870  C C6    . DT  C 3 8  ? -2.174  27.958 22.029  1.00 126.67 ? 11  DT  M C6    1 
ATOM   871  P P     . DA  C 3 9  ? -6.955  31.943 20.609  1.00 137.84 ? 12  DA  M P     1 
ATOM   872  O OP1   . DA  C 3 9  ? -7.495  33.065 19.809  1.00 140.81 ? 12  DA  M OP1   1 
ATOM   873  O OP2   . DA  C 3 9  ? -6.530  32.171 22.007  1.00 141.56 ? 12  DA  M OP2   1 
ATOM   874  O "O5'" . DA  C 3 9  ? -8.023  30.753 20.613  1.00 144.02 ? 12  DA  M "O5'" 1 
ATOM   875  C "C5'" . DA  C 3 9  ? -8.524  30.246 19.382  1.00 138.87 ? 12  DA  M "C5'" 1 
ATOM   876  C "C4'" . DA  C 3 9  ? -9.273  28.942 19.593  1.00 133.28 ? 12  DA  M "C4'" 1 
ATOM   877  O "O4'" . DA  C 3 9  ? -8.370  27.959 20.178  1.00 130.01 ? 12  DA  M "O4'" 1 
ATOM   878  C "C3'" . DA  C 3 9  ? -10.468 29.031 20.541  1.00 134.58 ? 12  DA  M "C3'" 1 
ATOM   879  O "O3'" . DA  C 3 9  ? -11.546 28.220 20.073  1.00 130.04 ? 12  DA  M "O3'" 1 
ATOM   880  C "C2'" . DA  C 3 9  ? -9.898  28.531 21.861  1.00 135.17 ? 12  DA  M "C2'" 1 
ATOM   881  C "C1'" . DA  C 3 9  ? -8.901  27.481 21.400  1.00 129.99 ? 12  DA  M "C1'" 1 
ATOM   882  N N9    . DA  C 3 9  ? -7.800  27.243 22.336  1.00 130.03 ? 12  DA  M N9    1 
ATOM   883  C C8    . DA  C 3 9  ? -7.130  28.174 23.080  1.00 135.78 ? 12  DA  M C8    1 
ATOM   884  N N7    . DA  C 3 9  ? -6.183  27.667 23.835  1.00 134.72 ? 12  DA  M N7    1 
ATOM   885  C C5    . DA  C 3 9  ? -6.234  26.309 23.566  1.00 127.21 ? 12  DA  M C5    1 
ATOM   886  C C6    . DA  C 3 9  ? -5.485  25.216 24.048  1.00 122.17 ? 12  DA  M C6    1 
ATOM   887  N N6    . DA  C 3 9  ? -4.497  25.334 24.942  1.00 124.39 ? 12  DA  M N6    1 
ATOM   888  N N1    . DA  C 3 9  ? -5.793  23.991 23.574  1.00 115.10 ? 12  DA  M N1    1 
ATOM   889  C C2    . DA  C 3 9  ? -6.782  23.874 22.680  1.00 112.87 ? 12  DA  M C2    1 
ATOM   890  N N3    . DA  C 3 9  ? -7.553  24.825 22.155  1.00 116.80 ? 12  DA  M N3    1 
ATOM   891  C C4    . DA  C 3 9  ? -7.225  26.031 22.644  1.00 124.30 ? 12  DA  M C4    1 
ATOM   892  P P     . DA  C 3 10 ? -13.020 28.386 20.691  1.00 133.43 ? 13  DA  M P     1 
ATOM   893  O OP1   . DA  C 3 10 ? -13.909 28.860 19.607  1.00 133.35 ? 13  DA  M OP1   1 
ATOM   894  O OP2   . DA  C 3 10 ? -12.904 29.172 21.939  1.00 139.27 ? 13  DA  M OP2   1 
ATOM   895  O "O5'" . DA  C 3 10 ? -13.440 26.894 21.089  1.00 122.38 ? 13  DA  M "O5'" 1 
ATOM   896  C "C5'" . DA  C 3 10 ? -13.499 25.877 20.091  1.00 116.47 ? 13  DA  M "C5'" 1 
ATOM   897  C "C4'" . DA  C 3 10 ? -13.602 24.500 20.722  1.00 112.22 ? 13  DA  M "C4'" 1 
ATOM   898  O "O4'" . DA  C 3 10 ? -12.402 24.239 21.504  1.00 112.62 ? 13  DA  M "O4'" 1 
ATOM   899  C "C3'" . DA  C 3 10 ? -14.776 24.320 21.682  1.00 113.37 ? 13  DA  M "C3'" 1 
ATOM   900  O "O3'" . DA  C 3 10 ? -15.331 23.013 21.568  1.00 107.98 ? 13  DA  M "O3'" 1 
ATOM   901  C "C2'" . DA  C 3 10 ? -14.149 24.565 23.047  1.00 117.02 ? 13  DA  M "C2'" 1 
ATOM   902  C "C1'" . DA  C 3 10 ? -12.736 24.028 22.863  1.00 114.34 ? 13  DA  M "C1'" 1 
ATOM   903  N N9    . DA  C 3 10 ? -11.735 24.687 23.700  1.00 118.46 ? 13  DA  M N9    1 
ATOM   904  C C8    . DA  C 3 10 ? -11.567 26.032 23.884  1.00 124.18 ? 13  DA  M C8    1 
ATOM   905  N N7    . DA  C 3 10 ? -10.580 26.336 24.693  1.00 126.92 ? 13  DA  M N7    1 
ATOM   906  C C5    . DA  C 3 10 ? -10.063 25.106 25.063  1.00 122.68 ? 13  DA  M C5    1 
ATOM   907  C C6    . DA  C 3 10 ? -8.997  24.739 25.910  1.00 122.84 ? 13  DA  M C6    1 
ATOM   908  N N6    . DA  C 3 10 ? -8.234  25.625 26.559  1.00 127.69 ? 13  DA  M N6    1 
ATOM   909  N N1    . DA  C 3 10 ? -8.745  23.423 26.063  1.00 117.88 ? 13  DA  M N1    1 
ATOM   910  C C2    . DA  C 3 10 ? -9.510  22.539 25.411  1.00 113.10 ? 13  DA  M C2    1 
ATOM   911  N N3    . DA  C 3 10 ? -10.536 22.763 24.592  1.00 112.44 ? 13  DA  M N3    1 
ATOM   912  C C4    . DA  C 3 10 ? -10.763 24.079 24.459  1.00 117.43 ? 13  DA  M C4    1 
ATOM   913  P P     . DC  C 3 11 ? -10.773 29.307 35.331  1.00 173.16 ? 15  DC  M P     1 
ATOM   914  O OP1   . DC  C 3 11 ? -9.339  29.320 34.969  1.00 120.87 ? 15  DC  M OP1   1 
ATOM   915  O OP2   . DC  C 3 11 ? -11.255 30.330 36.289  1.00 116.35 ? 15  DC  M OP2   1 
ATOM   916  O "O5'" . DC  C 3 11 ? -11.126 27.819 35.833  1.00 120.59 ? 15  DC  M "O5'" 1 
ATOM   917  C "C5'" . DC  C 3 11 ? -12.487 27.324 35.835  1.00 77.13  ? 15  DC  M "C5'" 1 
ATOM   918  C "C4'" . DC  C 3 11 ? -12.516 25.802 35.979  1.00 72.72  ? 15  DC  M "C4'" 1 
ATOM   919  O "O4'" . DC  C 3 11 ? -11.902 25.169 34.808  1.00 93.22  ? 15  DC  M "O4'" 1 
ATOM   920  C "C3'" . DC  C 3 11 ? -11.729 25.230 37.182  1.00 103.08 ? 15  DC  M "C3'" 1 
ATOM   921  O "O3'" . DC  C 3 11 ? -12.444 24.137 37.786  1.00 142.52 ? 15  DC  M "O3'" 1 
ATOM   922  C "C2'" . DC  C 3 11 ? -10.462 24.748 36.517  1.00 103.99 ? 15  DC  M "C2'" 1 
ATOM   923  C "C1'" . DC  C 3 11 ? -11.096 24.128 35.300  1.00 114.71 ? 15  DC  M "C1'" 1 
ATOM   924  N N1    . DC  C 3 11 ? -10.155 23.617 34.269  1.00 94.63  ? 15  DC  M N1    1 
ATOM   925  C C2    . DC  C 3 11 ? -10.453 22.414 33.621  1.00 114.18 ? 15  DC  M C2    1 
ATOM   926  O O2    . DC  C 3 11 ? -11.503 21.829 33.898  1.00 82.10  ? 15  DC  M O2    1 
ATOM   927  N N3    . DC  C 3 11 ? -9.594  21.932 32.696  1.00 141.24 ? 15  DC  M N3    1 
ATOM   928  C C4    . DC  C 3 11 ? -8.472  22.593 32.425  1.00 107.34 ? 15  DC  M C4    1 
ATOM   929  N N4    . DC  C 3 11 ? -7.655  22.080 31.501  1.00 73.52  ? 15  DC  M N4    1 
ATOM   930  C C5    . DC  C 3 11 ? -8.141  23.815 33.086  1.00 94.01  ? 15  DC  M C5    1 
ATOM   931  C C6    . DC  C 3 11 ? -9.001  24.280 33.999  1.00 73.27  ? 15  DC  M C6    1 
ATOM   932  P P     . DG  C 3 12 ? -11.994 23.514 39.202  1.00 175.47 ? 16  DG  M P     1 
ATOM   933  O OP1   . DG  C 3 12 ? -13.165 22.772 39.715  1.00 157.91 ? 16  DG  M OP1   1 
ATOM   934  O OP2   . DG  C 3 12 ? -11.404 24.604 40.005  1.00 125.73 ? 16  DG  M OP2   1 
ATOM   935  O "O5'" . DG  C 3 12 ? -10.791 22.486 38.886  1.00 93.36  ? 16  DG  M "O5'" 1 
ATOM   936  C "C5'" . DG  C 3 12 ? -10.779 21.661 37.710  1.00 92.20  ? 16  DG  M "C5'" 1 
ATOM   937  C "C4'" . DG  C 3 12 ? -11.844 20.587 37.760  1.00 142.17 ? 16  DG  M "C4'" 1 
ATOM   938  O "O4'" . DG  C 3 12 ? -12.617 20.627 36.529  1.00 151.26 ? 16  DG  M "O4'" 1 
ATOM   939  C "C3'" . DG  C 3 12 ? -11.312 19.166 37.863  1.00 139.11 ? 16  DG  M "C3'" 1 
ATOM   940  O "O3'" . DG  C 3 12 ? -11.169 18.774 39.223  1.00 157.99 ? 16  DG  M "O3'" 1 
ATOM   941  C "C2'" . DG  C 3 12 ? -12.371 18.353 37.132  1.00 105.19 ? 16  DG  M "C2'" 1 
ATOM   942  C "C1'" . DG  C 3 12 ? -12.854 19.313 36.051  1.00 136.03 ? 16  DG  M "C1'" 1 
ATOM   943  N N9    . DG  C 3 12 ? -12.160 19.147 34.779  1.00 87.20  ? 16  DG  M N9    1 
ATOM   944  C C8    . DG  C 3 12 ? -10.848 18.779 34.600  1.00 98.01  ? 16  DG  M C8    1 
ATOM   945  N N7    . DG  C 3 12 ? -10.494 18.709 33.349  1.00 149.10 ? 16  DG  M N7    1 
ATOM   946  C C5    . DG  C 3 12 ? -11.644 19.054 32.650  1.00 141.04 ? 16  DG  M C5    1 
ATOM   947  C C6    . DG  C 3 12 ? -11.865 19.152 31.258  1.00 100.07 ? 16  DG  M C6    1 
ATOM   948  O O6    . DG  C 3 12 ? -11.063 18.947 30.337  1.00 79.99  ? 16  DG  M O6    1 
ATOM   949  N N1    . DG  C 3 12 ? -13.173 19.532 30.969  1.00 100.62 ? 16  DG  M N1    1 
ATOM   950  C C2    . DG  C 3 12 ? -14.144 19.784 31.909  1.00 112.84 ? 16  DG  M C2    1 
ATOM   951  N N2    . DG  C 3 12 ? -15.347 20.140 31.437  1.00 80.72  ? 16  DG  M N2    1 
ATOM   952  N N3    . DG  C 3 12 ? -13.950 19.696 33.220  1.00 122.96 ? 16  DG  M N3    1 
ATOM   953  C C4    . DG  C 3 12 ? -12.682 19.319 33.516  1.00 122.87 ? 16  DG  M C4    1 
ATOM   954  N N     . PRO D 1 2  ? -14.853 31.901 0.342   1.00 94.15  ? 6   PRO A N     1 
ATOM   955  C CA    . PRO D 1 2  ? -15.733 31.326 -0.681  1.00 99.19  ? 6   PRO A CA    1 
ATOM   956  C C     . PRO D 1 2  ? -15.915 32.249 -1.884  1.00 103.00 ? 6   PRO A C     1 
ATOM   957  O O     . PRO D 1 2  ? -15.410 33.372 -1.879  1.00 98.04  ? 6   PRO A O     1 
ATOM   958  C CB    . PRO D 1 2  ? -17.054 31.132 0.065   1.00 94.70  ? 6   PRO A CB    1 
ATOM   959  C CG    . PRO D 1 2  ? -16.655 30.950 1.487   1.00 89.82  ? 6   PRO A CG    1 
ATOM   960  C CD    . PRO D 1 2  ? -15.443 31.815 1.690   1.00 88.06  ? 6   PRO A CD    1 
ATOM   961  N N     . LYS D 1 3  ? -16.635 31.776 -2.897  1.00 115.23 ? 7   LYS A N     1 
ATOM   962  C CA    . LYS D 1 3  ? -16.803 32.526 -4.136  1.00 117.88 ? 7   LYS A CA    1 
ATOM   963  C C     . LYS D 1 3  ? -17.902 33.580 -4.025  1.00 110.63 ? 7   LYS A C     1 
ATOM   964  O O     . LYS D 1 3  ? -17.619 34.763 -3.827  1.00 107.68 ? 7   LYS A O     1 
ATOM   965  C CB    . LYS D 1 3  ? -17.111 31.572 -5.294  1.00 131.74 ? 7   LYS A CB    1 
ATOM   966  C CG    . LYS D 1 3  ? -17.302 32.263 -6.636  1.00 138.82 ? 7   LYS A CG    1 
ATOM   967  C CD    . LYS D 1 3  ? -17.529 31.258 -7.753  1.00 150.40 ? 7   LYS A CD    1 
ATOM   968  C CE    . LYS D 1 3  ? -17.729 31.951 -9.091  1.00 160.07 ? 7   LYS A CE    1 
ATOM   969  N NZ    . LYS D 1 3  ? -17.872 30.980 -10.209 1.00 176.69 ? 7   LYS A NZ    1 
ATOM   970  N N     . VAL D 1 4  ? -19.152 33.146 -4.151  1.00 120.30 ? 8   VAL A N     1 
ATOM   971  C CA    . VAL D 1 4  ? -20.283 34.068 -4.203  1.00 107.80 ? 8   VAL A CA    1 
ATOM   972  C C     . VAL D 1 4  ? -20.781 34.472 -2.817  1.00 92.13  ? 8   VAL A C     1 
ATOM   973  O O     . VAL D 1 4  ? -21.782 35.178 -2.700  1.00 87.77  ? 8   VAL A O     1 
ATOM   974  C CB    . VAL D 1 4  ? -21.467 33.462 -4.992  1.00 116.78 ? 8   VAL A CB    1 
ATOM   975  C CG1   . VAL D 1 4  ? -21.064 33.204 -6.435  1.00 125.67 ? 8   VAL A CG1   1 
ATOM   976  C CG2   . VAL D 1 4  ? -21.967 32.178 -4.333  1.00 112.54 ? 8   VAL A CG2   1 
ATOM   977  N N     . ALA D 1 5  ? -20.088 34.024 -1.773  1.00 91.54  ? 9   ALA A N     1 
ATOM   978  C CA    . ALA D 1 5  ? -20.450 34.386 -0.405  1.00 81.58  ? 9   ALA A CA    1 
ATOM   979  C C     . ALA D 1 5  ? -20.464 35.896 -0.237  1.00 77.33  ? 9   ALA A C     1 
ATOM   980  O O     . ALA D 1 5  ? -21.279 36.441 0.503   1.00 74.85  ? 9   ALA A O     1 
ATOM   981  C CB    . ALA D 1 5  ? -19.487 33.764 0.586   1.00 76.98  ? 9   ALA A CB    1 
ATOM   982  N N     . THR D 1 6  ? -19.547 36.563 -0.928  1.00 110.68 ? 10  THR A N     1 
ATOM   983  C CA    . THR D 1 6  ? -19.435 38.011 -0.860  1.00 104.38 ? 10  THR A CA    1 
ATOM   984  C C     . THR D 1 6  ? -20.732 38.693 -1.290  1.00 98.46  ? 10  THR A C     1 
ATOM   985  O O     . THR D 1 6  ? -21.224 39.590 -0.607  1.00 91.71  ? 10  THR A O     1 
ATOM   986  C CB    . THR D 1 6  ? -18.285 38.515 -1.743  1.00 106.33 ? 10  THR A CB    1 
ATOM   987  O OG1   . THR D 1 6  ? -17.079 37.819 -1.400  1.00 107.93 ? 10  THR A OG1   1 
ATOM   988  C CG2   . THR D 1 6  ? -18.081 40.003 -1.547  1.00 103.97 ? 10  THR A CG2   1 
ATOM   989  N N     . ASN D 1 7  ? -21.278 38.265 -2.424  1.00 80.31  ? 11  ASN A N     1 
ATOM   990  C CA    . ASN D 1 7  ? -22.524 38.826 -2.934  1.00 75.56  ? 11  ASN A CA    1 
ATOM   991  C C     . ASN D 1 7  ? -23.687 38.612 -1.969  1.00 67.50  ? 11  ASN A C     1 
ATOM   992  O O     . ASN D 1 7  ? -24.582 39.451 -1.871  1.00 66.26  ? 11  ASN A O     1 
ATOM   993  C CB    . ASN D 1 7  ? -22.858 38.219 -4.297  1.00 80.48  ? 11  ASN A CB    1 
ATOM   994  C CG    . ASN D 1 7  ? -21.944 38.721 -5.399  1.00 83.36  ? 11  ASN A CG    1 
ATOM   995  O OD1   . ASN D 1 7  ? -20.959 39.413 -5.139  1.00 81.24  ? 11  ASN A OD1   1 
ATOM   996  N ND2   . ASN D 1 7  ? -22.265 38.371 -6.639  1.00 89.15  ? 11  ASN A ND2   1 
ATOM   997  N N     . ILE D 1 8  ? -23.671 37.488 -1.258  1.00 65.47  ? 12  ILE A N     1 
ATOM   998  C CA    . ILE D 1 8  ? -24.685 37.207 -0.247  1.00 61.37  ? 12  ILE A CA    1 
ATOM   999  C C     . ILE D 1 8  ? -24.590 38.230 0.878   1.00 56.77  ? 12  ILE A C     1 
ATOM   1000 O O     . ILE D 1 8  ? -25.594 38.803 1.301   1.00 55.76  ? 12  ILE A O     1 
ATOM   1001 C CB    . ILE D 1 8  ? -24.533 35.785 0.343   1.00 62.15  ? 12  ILE A CB    1 
ATOM   1002 C CG1   . ILE D 1 8  ? -24.586 34.726 -0.763  1.00 69.02  ? 12  ILE A CG1   1 
ATOM   1003 C CG2   . ILE D 1 8  ? -25.607 35.510 1.396   1.00 58.11  ? 12  ILE A CG2   1 
ATOM   1004 C CD1   . ILE D 1 8  ? -25.887 34.691 -1.546  1.00 71.69  ? 12  ILE A CD1   1 
ATOM   1005 N N     . MET D 1 9  ? -23.371 38.456 1.357   1.00 73.99  ? 13  MET A N     1 
ATOM   1006 C CA    . MET D 1 9  ? -23.135 39.391 2.449   1.00 60.66  ? 13  MET A CA    1 
ATOM   1007 C C     . MET D 1 9  ? -23.476 40.816 2.022   1.00 58.93  ? 13  MET A C     1 
ATOM   1008 O O     . MET D 1 9  ? -24.037 41.589 2.799   1.00 52.77  ? 13  MET A O     1 
ATOM   1009 C CB    . MET D 1 9  ? -21.678 39.310 2.912   1.00 57.96  ? 13  MET A CB    1 
ATOM   1010 C CG    . MET D 1 9  ? -21.247 37.921 3.380   1.00 56.95  ? 13  MET A CG    1 
ATOM   1011 S SD    . MET D 1 9  ? -21.886 37.468 5.002   1.00 52.84  ? 13  MET A SD    1 
ATOM   1012 C CE    . MET D 1 9  ? -20.929 38.558 6.052   1.00 51.44  ? 13  MET A CE    1 
ATOM   1013 N N     . ARG D 1 10 ? -23.139 41.154 0.781   1.00 65.42  ? 14  ARG A N     1 
ATOM   1014 C CA    . ARG D 1 10 ? -23.415 42.485 0.248   1.00 67.79  ? 14  ARG A CA    1 
ATOM   1015 C C     . ARG D 1 10 ? -24.908 42.682 0.014   1.00 66.41  ? 14  ARG A C     1 
ATOM   1016 O O     . ARG D 1 10 ? -25.431 43.783 0.186   1.00 64.24  ? 14  ARG A O     1 
ATOM   1017 C CB    . ARG D 1 10 ? -22.647 42.711 -1.056  1.00 76.82  ? 14  ARG A CB    1 
ATOM   1018 C CG    . ARG D 1 10 ? -21.142 42.849 -0.873  1.00 81.46  ? 14  ARG A CG    1 
ATOM   1019 C CD    . ARG D 1 10 ? -20.435 43.037 -2.206  1.00 93.39  ? 14  ARG A CD    1 
ATOM   1020 N NE    . ARG D 1 10 ? -18.981 43.057 -2.058  1.00 98.74  ? 14  ARG A NE    1 
ATOM   1021 C CZ    . ARG D 1 10 ? -18.261 44.139 -1.775  1.00 106.01 ? 14  ARG A CZ    1 
ATOM   1022 N NH1   . ARG D 1 10 ? -18.847 45.320 -1.611  1.00 114.38 ? 14  ARG A NH1   1 
ATOM   1023 N NH2   . ARG D 1 10 ? -16.942 44.039 -1.664  1.00 107.37 ? 14  ARG A NH2   1 
ATOM   1024 N N     . ALA D 1 11 ? -25.588 41.609 -0.381  1.00 73.42  ? 15  ALA A N     1 
ATOM   1025 C CA    . ALA D 1 11 ? -27.026 41.656 -0.616  1.00 73.46  ? 15  ALA A CA    1 
ATOM   1026 C C     . ALA D 1 11 ? -27.758 42.089 0.646   1.00 67.97  ? 15  ALA A C     1 
ATOM   1027 O O     . ALA D 1 11 ? -28.753 42.809 0.582   1.00 66.86  ? 15  ALA A O     1 
ATOM   1028 C CB    . ALA D 1 11 ? -27.533 40.301 -1.083  1.00 77.89  ? 15  ALA A CB    1 
ATOM   1029 N N     . TRP D 1 12 ? -27.252 41.648 1.793   1.00 78.98  ? 16  TRP A N     1 
ATOM   1030 C CA    . TRP D 1 12 ? -27.834 42.006 3.078   1.00 73.36  ? 16  TRP A CA    1 
ATOM   1031 C C     . TRP D 1 12 ? -27.412 43.417 3.475   1.00 70.84  ? 16  TRP A C     1 
ATOM   1032 O O     . TRP D 1 12 ? -28.172 44.148 4.110   1.00 69.08  ? 16  TRP A O     1 
ATOM   1033 C CB    . TRP D 1 12 ? -27.412 41.003 4.155   1.00 69.79  ? 16  TRP A CB    1 
ATOM   1034 C CG    . TRP D 1 12 ? -28.210 41.096 5.422   1.00 63.63  ? 16  TRP A CG    1 
ATOM   1035 C CD1   . TRP D 1 12 ? -29.265 40.309 5.784   1.00 63.48  ? 16  TRP A CD1   1 
ATOM   1036 C CD2   . TRP D 1 12 ? -28.018 42.027 6.495   1.00 57.43  ? 16  TRP A CD2   1 
ATOM   1037 N NE1   . TRP D 1 12 ? -29.741 40.692 7.014   1.00 58.38  ? 16  TRP A NE1   1 
ATOM   1038 C CE2   . TRP D 1 12 ? -28.993 41.744 7.472   1.00 54.45  ? 16  TRP A CE2   1 
ATOM   1039 C CE3   . TRP D 1 12 ? -27.117 43.071 6.725   1.00 55.17  ? 16  TRP A CE3   1 
ATOM   1040 C CZ2   . TRP D 1 12 ? -29.093 42.468 8.659   1.00 51.47  ? 16  TRP A CZ2   1 
ATOM   1041 C CZ3   . TRP D 1 12 ? -27.218 43.789 7.903   1.00 51.83  ? 16  TRP A CZ3   1 
ATOM   1042 C CH2   . TRP D 1 12 ? -28.198 43.484 8.855   1.00 50.58  ? 16  TRP A CH2   1 
ATOM   1043 N N     . LEU D 1 13 ? -26.197 43.795 3.089   1.00 59.18  ? 17  LEU A N     1 
ATOM   1044 C CA    . LEU D 1 13 ? -25.636 45.087 3.470   1.00 55.27  ? 17  LEU A CA    1 
ATOM   1045 C C     . LEU D 1 13 ? -26.449 46.244 2.896   1.00 55.38  ? 17  LEU A C     1 
ATOM   1046 O O     . LEU D 1 13 ? -27.050 47.019 3.640   1.00 50.25  ? 17  LEU A O     1 
ATOM   1047 C CB    . LEU D 1 13 ? -24.181 45.193 3.008   1.00 60.47  ? 17  LEU A CB    1 
ATOM   1048 C CG    . LEU D 1 13 ? -23.424 46.451 3.438   1.00 60.16  ? 17  LEU A CG    1 
ATOM   1049 C CD1   . LEU D 1 13 ? -23.240 46.487 4.948   1.00 56.28  ? 17  LEU A CD1   1 
ATOM   1050 C CD2   . LEU D 1 13 ? -22.081 46.526 2.732   1.00 64.58  ? 17  LEU A CD2   1 
ATOM   1051 N N     . PHE D 1 14 ? -26.470 46.349 1.570   1.00 52.44  ? 18  PHE A N     1 
ATOM   1052 C CA    . PHE D 1 14 ? -27.188 47.426 0.892   1.00 56.95  ? 18  PHE A CA    1 
ATOM   1053 C C     . PHE D 1 14 ? -28.688 47.375 1.176   1.00 62.18  ? 18  PHE A C     1 
ATOM   1054 O O     . PHE D 1 14 ? -29.411 48.337 0.914   1.00 65.60  ? 18  PHE A O     1 
ATOM   1055 C CB    . PHE D 1 14 ? -26.943 47.360 -0.616  1.00 62.36  ? 18  PHE A CB    1 
ATOM   1056 C CG    . PHE D 1 14 ? -25.521 47.636 -1.011  1.00 63.61  ? 18  PHE A CG    1 
ATOM   1057 C CD1   . PHE D 1 14 ? -25.096 48.930 -1.255  1.00 63.38  ? 18  PHE A CD1   1 
ATOM   1058 C CD2   . PHE D 1 14 ? -24.610 46.601 -1.142  1.00 64.61  ? 18  PHE A CD2   1 
ATOM   1059 C CE1   . PHE D 1 14 ? -23.789 49.188 -1.619  1.00 64.58  ? 18  PHE A CE1   1 
ATOM   1060 C CE2   . PHE D 1 14 ? -23.302 46.853 -1.506  1.00 65.70  ? 18  PHE A CE2   1 
ATOM   1061 C CZ    . PHE D 1 14 ? -22.891 48.148 -1.746  1.00 65.76  ? 18  PHE A CZ    1 
ATOM   1062 N N     . GLN D 1 15 ? -29.149 46.245 1.704   1.00 67.35  ? 19  GLN A N     1 
ATOM   1063 C CA    . GLN D 1 15 ? -30.547 46.081 2.081   1.00 72.14  ? 19  GLN A CA    1 
ATOM   1064 C C     . GLN D 1 15 ? -30.840 46.759 3.419   1.00 73.93  ? 19  GLN A C     1 
ATOM   1065 O O     . GLN D 1 15 ? -31.998 46.999 3.761   1.00 72.90  ? 19  GLN A O     1 
ATOM   1066 C CB    . GLN D 1 15 ? -30.905 44.594 2.147   1.00 73.47  ? 19  GLN A CB    1 
ATOM   1067 C CG    . GLN D 1 15 ? -32.383 44.309 2.349   1.00 74.09  ? 19  GLN A CG    1 
ATOM   1068 C CD    . GLN D 1 15 ? -32.713 42.835 2.216   1.00 76.61  ? 19  GLN A CD    1 
ATOM   1069 O OE1   . GLN D 1 15 ? -32.553 42.061 3.160   1.00 74.89  ? 19  GLN A OE1   1 
ATOM   1070 N NE2   . GLN D 1 15 ? -33.175 42.437 1.037   1.00 82.89  ? 19  GLN A NE2   1 
ATOM   1071 N N     . HIS D 1 16 ? -29.784 47.067 4.168   1.00 68.20  ? 20  HIS A N     1 
ATOM   1072 C CA    . HIS D 1 16 ? -29.910 47.750 5.453   1.00 67.68  ? 20  HIS A CA    1 
ATOM   1073 C C     . HIS D 1 16 ? -28.799 48.782 5.615   1.00 71.68  ? 20  HIS A C     1 
ATOM   1074 O O     . HIS D 1 16 ? -27.912 48.609 6.447   1.00 71.68  ? 20  HIS A O     1 
ATOM   1075 C CB    . HIS D 1 16 ? -29.851 46.747 6.610   1.00 66.02  ? 20  HIS A CB    1 
ATOM   1076 C CG    . HIS D 1 16 ? -30.827 45.619 6.490   1.00 65.25  ? 20  HIS A CG    1 
ATOM   1077 N ND1   . HIS D 1 16 ? -30.699 44.619 5.551   1.00 69.54  ? 20  HIS A ND1   1 
ATOM   1078 C CD2   . HIS D 1 16 ? -31.941 45.323 7.204   1.00 64.03  ? 20  HIS A CD2   1 
ATOM   1079 C CE1   . HIS D 1 16 ? -31.696 43.761 5.684   1.00 69.50  ? 20  HIS A CE1   1 
ATOM   1080 N NE2   . HIS D 1 16 ? -32.462 44.166 6.681   1.00 66.16  ? 20  HIS A NE2   1 
ATOM   1081 N N     . LEU D 1 17 ? -28.846 49.857 4.833   1.00 83.23  ? 21  LEU A N     1 
ATOM   1082 C CA    . LEU D 1 17 ? -27.733 50.806 4.796   1.00 81.26  ? 21  LEU A CA    1 
ATOM   1083 C C     . LEU D 1 17 ? -27.911 51.998 5.735   1.00 76.27  ? 21  LEU A C     1 
ATOM   1084 O O     . LEU D 1 17 ? -26.927 52.567 6.207   1.00 76.36  ? 21  LEU A O     1 
ATOM   1085 C CB    . LEU D 1 17 ? -27.513 51.304 3.368   1.00 81.99  ? 21  LEU A CB    1 
ATOM   1086 C CG    . LEU D 1 17 ? -26.265 50.717 2.703   1.00 82.14  ? 21  LEU A CG    1 
ATOM   1087 C CD1   . LEU D 1 17 ? -26.228 51.066 1.227   1.00 86.69  ? 21  LEU A CD1   1 
ATOM   1088 C CD2   . LEU D 1 17 ? -24.992 51.198 3.393   1.00 80.03  ? 21  LEU A CD2   1 
ATOM   1089 N N     . THR D 1 18 ? -29.155 52.380 6.002   1.00 106.24 ? 22  THR A N     1 
ATOM   1090 C CA    . THR D 1 18 ? -29.429 53.411 6.997   1.00 102.44 ? 22  THR A CA    1 
ATOM   1091 C C     . THR D 1 18 ? -29.464 52.763 8.384   1.00 99.31  ? 22  THR A C     1 
ATOM   1092 O O     . THR D 1 18 ? -29.675 53.433 9.396   1.00 96.49  ? 22  THR A O     1 
ATOM   1093 C CB    . THR D 1 18 ? -30.757 54.142 6.705   1.00 57.99  ? 22  THR A CB    1 
ATOM   1094 O OG1   . THR D 1 18 ? -30.839 54.436 5.306   1.00 61.48  ? 22  THR A OG1   1 
ATOM   1095 C CG2   . THR D 1 18 ? -30.858 55.453 7.490   1.00 56.25  ? 22  THR A CG2   1 
ATOM   1096 N N     . HIS D 1 19 ? -29.241 51.452 8.420   1.00 84.56  ? 23  HIS A N     1 
ATOM   1097 C CA    . HIS D 1 19 ? -29.195 50.710 9.672   1.00 80.55  ? 23  HIS A CA    1 
ATOM   1098 C C     . HIS D 1 19 ? -28.475 49.373 9.478   1.00 81.35  ? 23  HIS A C     1 
ATOM   1099 O O     . HIS D 1 19 ? -29.094 48.311 9.540   1.00 82.69  ? 23  HIS A O     1 
ATOM   1100 C CB    . HIS D 1 19 ? -30.614 50.500 10.212  1.00 78.59  ? 23  HIS A CB    1 
ATOM   1101 C CG    . HIS D 1 19 ? -31.636 50.241 9.148   1.00 79.52  ? 23  HIS A CG    1 
ATOM   1102 N ND1   . HIS D 1 19 ? -32.120 51.234 8.323   1.00 79.88  ? 23  HIS A ND1   1 
ATOM   1103 C CD2   . HIS D 1 19 ? -32.279 49.105 8.784   1.00 79.15  ? 23  HIS A CD2   1 
ATOM   1104 C CE1   . HIS D 1 19 ? -33.008 50.720 7.491   1.00 81.15  ? 23  HIS A CE1   1 
ATOM   1105 N NE2   . HIS D 1 19 ? -33.124 49.430 7.751   1.00 80.71  ? 23  HIS A NE2   1 
ATOM   1106 N N     . PRO D 1 20 ? -27.154 49.428 9.232   1.00 64.51  ? 24  PRO A N     1 
ATOM   1107 C CA    . PRO D 1 20 ? -26.340 48.242 8.953   1.00 65.02  ? 24  PRO A CA    1 
ATOM   1108 C C     . PRO D 1 20 ? -25.780 47.578 10.210  1.00 62.09  ? 24  PRO A C     1 
ATOM   1109 O O     . PRO D 1 20 ? -24.591 47.710 10.505  1.00 59.69  ? 24  PRO A O     1 
ATOM   1110 C CB    . PRO D 1 20 ? -25.217 48.808 8.086   1.00 67.61  ? 24  PRO A CB    1 
ATOM   1111 C CG    . PRO D 1 20 ? -25.001 50.174 8.644   1.00 66.72  ? 24  PRO A CG    1 
ATOM   1112 C CD    . PRO D 1 20 ? -26.362 50.665 9.099   1.00 65.49  ? 24  PRO A CD    1 
ATOM   1113 N N     . TYR D 1 21 ? -26.638 46.871 10.937  1.00 62.80  ? 25  TYR A N     1 
ATOM   1114 C CA    . TYR D 1 21 ? -26.226 46.161 12.143  1.00 65.97  ? 25  TYR A CA    1 
ATOM   1115 C C     . TYR D 1 21 ? -27.069 44.904 12.350  1.00 72.54  ? 25  TYR A C     1 
ATOM   1116 O O     . TYR D 1 21 ? -28.135 44.968 12.964  1.00 74.52  ? 25  TYR A O     1 
ATOM   1117 C CB    . TYR D 1 21 ? -26.337 47.072 13.368  1.00 61.67  ? 25  TYR A CB    1 
ATOM   1118 C CG    . TYR D 1 21 ? -25.238 48.106 13.457  1.00 60.96  ? 25  TYR A CG    1 
ATOM   1119 C CD1   . TYR D 1 21 ? -25.403 49.376 12.919  1.00 61.94  ? 25  TYR A CD1   1 
ATOM   1120 C CD2   . TYR D 1 21 ? -24.031 47.811 14.076  1.00 60.73  ? 25  TYR A CD2   1 
ATOM   1121 C CE1   . TYR D 1 21 ? -24.398 50.321 12.996  1.00 62.72  ? 25  TYR A CE1   1 
ATOM   1122 C CE2   . TYR D 1 21 ? -23.021 48.749 14.160  1.00 61.79  ? 25  TYR A CE2   1 
ATOM   1123 C CZ    . TYR D 1 21 ? -23.211 50.002 13.618  1.00 64.28  ? 25  TYR A CZ    1 
ATOM   1124 O OH    . TYR D 1 21 ? -22.208 50.940 13.698  1.00 66.91  ? 25  TYR A OH    1 
ATOM   1125 N N     . PRO D 1 22 ? -26.597 43.755 11.836  1.00 88.71  ? 26  PRO A N     1 
ATOM   1126 C CA    . PRO D 1 22 ? -27.359 42.514 12.014  1.00 92.30  ? 26  PRO A CA    1 
ATOM   1127 C C     . PRO D 1 22 ? -27.417 42.070 13.472  1.00 93.06  ? 26  PRO A C     1 
ATOM   1128 O O     . PRO D 1 22 ? -26.512 42.382 14.247  1.00 93.05  ? 26  PRO A O     1 
ATOM   1129 C CB    . PRO D 1 22 ? -26.588 41.500 11.162  1.00 94.55  ? 26  PRO A CB    1 
ATOM   1130 C CG    . PRO D 1 22 ? -25.206 42.035 11.096  1.00 94.68  ? 26  PRO A CG    1 
ATOM   1131 C CD    . PRO D 1 22 ? -25.341 43.527 11.098  1.00 91.97  ? 26  PRO A CD    1 
ATOM   1132 N N     . SER D 1 23 ? -28.473 41.348 13.832  1.00 78.15  ? 27  SER A N     1 
ATOM   1133 C CA    . SER D 1 23 ? -28.634 40.839 15.187  1.00 80.25  ? 27  SER A CA    1 
ATOM   1134 C C     . SER D 1 23 ? -27.714 39.640 15.401  1.00 92.64  ? 27  SER A C     1 
ATOM   1135 O O     . SER D 1 23 ? -26.620 39.588 14.841  1.00 94.36  ? 27  SER A O     1 
ATOM   1136 C CB    . SER D 1 23 ? -30.094 40.456 15.438  1.00 76.45  ? 27  SER A CB    1 
ATOM   1137 O OG    . SER D 1 23 ? -30.468 39.345 14.640  1.00 76.48  ? 27  SER A OG    1 
ATOM   1138 N N     . GLU D 1 24 ? -28.153 38.683 16.215  1.00 92.21  ? 28  GLU A N     1 
ATOM   1139 C CA    . GLU D 1 24 ? -27.400 37.452 16.427  1.00 100.83 ? 28  GLU A CA    1 
ATOM   1140 C C     . GLU D 1 24 ? -27.965 36.335 15.557  1.00 107.02 ? 28  GLU A C     1 
ATOM   1141 O O     . GLU D 1 24 ? -27.219 35.518 15.018  1.00 109.90 ? 28  GLU A O     1 
ATOM   1142 C CB    . GLU D 1 24 ? -27.433 37.046 17.901  1.00 100.44 ? 28  GLU A CB    1 
ATOM   1143 C CG    . GLU D 1 24 ? -26.801 38.066 18.836  1.00 99.17  ? 28  GLU A CG    1 
ATOM   1144 C CD    . GLU D 1 24 ? -25.320 38.268 18.573  1.00 99.11  ? 28  GLU A CD    1 
ATOM   1145 O OE1   . GLU D 1 24 ? -24.693 37.376 17.964  1.00 102.10 ? 28  GLU A OE1   1 
ATOM   1146 O OE2   . GLU D 1 24 ? -24.783 39.322 18.974  1.00 98.22  ? 28  GLU A OE2   1 
ATOM   1147 N N     . GLU D 1 25 ? -29.288 36.309 15.423  1.00 118.62 ? 29  GLU A N     1 
ATOM   1148 C CA    . GLU D 1 25 ? -29.955 35.321 14.584  1.00 123.81 ? 29  GLU A CA    1 
ATOM   1149 C C     . GLU D 1 25 ? -29.679 35.606 13.113  1.00 129.13 ? 29  GLU A C     1 
ATOM   1150 O O     . GLU D 1 25 ? -29.405 34.693 12.335  1.00 136.20 ? 29  GLU A O     1 
ATOM   1151 C CB    . GLU D 1 25 ? -31.462 35.317 14.848  1.00 126.11 ? 29  GLU A CB    1 
ATOM   1152 C CG    . GLU D 1 25 ? -32.219 34.202 14.135  1.00 133.23 ? 29  GLU A CG    1 
ATOM   1153 C CD    . GLU D 1 25 ? -31.811 32.818 14.606  1.00 137.77 ? 29  GLU A CD    1 
ATOM   1154 O OE1   . GLU D 1 25 ? -31.302 32.697 15.741  1.00 137.50 ? 29  GLU A OE1   1 
ATOM   1155 O OE2   . GLU D 1 25 ? -31.999 31.849 13.840  1.00 143.81 ? 29  GLU A OE2   1 
ATOM   1156 N N     . GLN D 1 26 ? -29.759 36.878 12.737  1.00 96.96  ? 30  GLN A N     1 
ATOM   1157 C CA    . GLN D 1 26 ? -29.434 37.295 11.379  1.00 91.59  ? 30  GLN A CA    1 
ATOM   1158 C C     . GLN D 1 26 ? -27.960 37.047 11.091  1.00 81.57  ? 30  GLN A C     1 
ATOM   1159 O O     . GLN D 1 26 ? -27.576 36.758 9.957   1.00 85.68  ? 30  GLN A O     1 
ATOM   1160 C CB    . GLN D 1 26 ? -29.765 38.773 11.170  1.00 91.17  ? 30  GLN A CB    1 
ATOM   1161 C CG    . GLN D 1 26 ? -31.249 39.085 11.160  1.00 92.89  ? 30  GLN A CG    1 
ATOM   1162 C CD    . GLN D 1 26 ? -31.527 40.552 10.898  1.00 92.20  ? 30  GLN A CD    1 
ATOM   1163 O OE1   . GLN D 1 26 ? -30.778 41.425 11.336  1.00 89.86  ? 30  GLN A OE1   1 
ATOM   1164 N NE2   . GLN D 1 26 ? -32.603 40.829 10.172  1.00 93.88  ? 30  GLN A NE2   1 
ATOM   1165 N N     . LYS D 1 27 ? -27.138 37.167 12.128  1.00 93.85  ? 31  LYS A N     1 
ATOM   1166 C CA    . LYS D 1 27 ? -25.705 36.937 12.004  1.00 84.11  ? 31  LYS A CA    1 
ATOM   1167 C C     . LYS D 1 27 ? -25.417 35.493 11.618  1.00 76.76  ? 31  LYS A C     1 
ATOM   1168 O O     . LYS D 1 27 ? -24.640 35.233 10.698  1.00 78.64  ? 31  LYS A O     1 
ATOM   1169 C CB    . LYS D 1 27 ? -24.994 37.284 13.312  1.00 81.07  ? 31  LYS A CB    1 
ATOM   1170 C CG    . LYS D 1 27 ? -24.242 38.600 13.271  1.00 78.45  ? 31  LYS A CG    1 
ATOM   1171 C CD    . LYS D 1 27 ? -23.561 38.888 14.599  1.00 72.83  ? 31  LYS A CD    1 
ATOM   1172 C CE    . LYS D 1 27 ? -23.021 40.307 14.653  1.00 69.02  ? 31  LYS A CE    1 
ATOM   1173 N NZ    . LYS D 1 27 ? -22.327 40.586 15.940  1.00 65.66  ? 31  LYS A NZ    1 
ATOM   1174 N N     . LYS D 1 28 ? -26.043 34.554 12.321  1.00 92.56  ? 32  LYS A N     1 
ATOM   1175 C CA    . LYS D 1 28 ? -25.861 33.141 12.015  1.00 88.52  ? 32  LYS A CA    1 
ATOM   1176 C C     . LYS D 1 28 ? -26.601 32.774 10.737  1.00 86.63  ? 32  LYS A C     1 
ATOM   1177 O O     . LYS D 1 28 ? -26.124 31.953 9.959   1.00 91.14  ? 32  LYS A O     1 
ATOM   1178 C CB    . LYS D 1 28 ? -26.333 32.259 13.173  1.00 85.15  ? 32  LYS A CB    1 
ATOM   1179 C CG    . LYS D 1 28 ? -27.775 32.464 13.609  1.00 83.45  ? 32  LYS A CG    1 
ATOM   1180 C CD    . LYS D 1 28 ? -28.171 31.477 14.706  1.00 85.20  ? 32  LYS A CD    1 
ATOM   1181 C CE    . LYS D 1 28 ? -27.329 31.652 15.964  1.00 81.70  ? 32  LYS A CE    1 
ATOM   1182 N NZ    . LYS D 1 28 ? -27.771 30.754 17.065  1.00 82.42  ? 32  LYS A NZ    1 
ATOM   1183 N N     . GLN D 1 29 ? -27.753 33.398 10.513  1.00 80.31  ? 33  GLN A N     1 
ATOM   1184 C CA    . GLN D 1 29 ? -28.517 33.188 9.284   1.00 77.54  ? 33  GLN A CA    1 
ATOM   1185 C C     . GLN D 1 29 ? -27.638 33.365 8.044   1.00 74.77  ? 33  GLN A C     1 
ATOM   1186 O O     . GLN D 1 29 ? -27.938 32.825 6.978   1.00 76.27  ? 33  GLN A O     1 
ATOM   1187 C CB    . GLN D 1 29 ? -29.708 34.152 9.227   1.00 75.50  ? 33  GLN A CB    1 
ATOM   1188 C CG    . GLN D 1 29 ? -30.538 34.067 7.948   1.00 78.66  ? 33  GLN A CG    1 
ATOM   1189 C CD    . GLN D 1 29 ? -31.724 35.016 7.952   1.00 75.27  ? 33  GLN A CD    1 
ATOM   1190 O OE1   . GLN D 1 29 ? -32.123 35.527 8.998   1.00 70.22  ? 33  GLN A OE1   1 
ATOM   1191 N NE2   . GLN D 1 29 ? -32.292 35.259 6.775   1.00 78.03  ? 33  GLN A NE2   1 
ATOM   1192 N N     . LEU D 1 30 ? -26.547 34.110 8.200   1.00 60.67  ? 34  LEU A N     1 
ATOM   1193 C CA    . LEU D 1 30 ? -25.648 34.419 7.096   1.00 62.90  ? 34  LEU A CA    1 
ATOM   1194 C C     . LEU D 1 30 ? -24.393 33.536 7.035   1.00 66.23  ? 34  LEU A C     1 
ATOM   1195 O O     . LEU D 1 30 ? -23.664 33.592 6.045   1.00 69.79  ? 34  LEU A O     1 
ATOM   1196 C CB    . LEU D 1 30 ? -25.221 35.891 7.181   1.00 58.23  ? 34  LEU A CB    1 
ATOM   1197 C CG    . LEU D 1 30 ? -26.258 36.954 6.798   1.00 56.61  ? 34  LEU A CG    1 
ATOM   1198 C CD1   . LEU D 1 30 ? -25.809 38.333 7.260   1.00 52.32  ? 34  LEU A CD1   1 
ATOM   1199 C CD2   . LEU D 1 30 ? -26.502 36.956 5.297   1.00 61.95  ? 34  LEU A CD2   1 
ATOM   1200 N N     . ALA D 1 31 ? -24.133 32.720 8.060   1.00 81.35  ? 35  ALA A N     1 
ATOM   1201 C CA    . ALA D 1 31 ? -22.815 32.072 8.164   1.00 83.53  ? 35  ALA A CA    1 
ATOM   1202 C C     . ALA D 1 31 ? -22.742 30.629 7.587   1.00 217.61 ? 35  ALA A C     1 
ATOM   1203 O O     . ALA D 1 31 ? -22.159 30.487 6.513   1.00 221.93 ? 35  ALA A O     1 
ATOM   1204 C CB    . ALA D 1 31 ? -22.315 32.122 9.625   1.00 86.62  ? 35  ALA A CB    1 
ATOM   1205 N N     . GLN D 1 32 ? -23.290 29.565 8.196   1.00 195.84 ? 36  GLN A N     1 
ATOM   1206 C CA    . GLN D 1 32 ? -24.114 29.560 9.401   1.00 189.32 ? 36  GLN A CA    1 
ATOM   1207 C C     . GLN D 1 32 ? -23.483 28.726 10.540  1.00 185.99 ? 36  GLN A C     1 
ATOM   1208 O O     . GLN D 1 32 ? -23.646 27.504 10.579  1.00 189.56 ? 36  GLN A O     1 
ATOM   1209 C CB    . GLN D 1 32 ? -25.507 28.997 9.069   1.00 192.32 ? 36  GLN A CB    1 
ATOM   1210 C CG    . GLN D 1 32 ? -26.516 29.104 10.214  1.00 187.53 ? 36  GLN A CG    1 
ATOM   1211 C CD    . GLN D 1 32 ? -27.241 27.809 10.541  1.00 189.74 ? 36  GLN A CD    1 
ATOM   1212 O OE1   . GLN D 1 32 ? -26.852 26.723 10.107  1.00 193.37 ? 36  GLN A OE1   1 
ATOM   1213 N NE2   . GLN D 1 32 ? -28.308 27.925 11.327  1.00 186.21 ? 36  GLN A NE2   1 
ATOM   1214 N N     . ASP D 1 33 ? -22.725 29.397 11.411  1.00 162.56 ? 37  ASP A N     1 
ATOM   1215 C CA    . ASP D 1 33 ? -22.423 28.961 12.796  1.00 155.37 ? 37  ASP A CA    1 
ATOM   1216 C C     . ASP D 1 33 ? -21.214 28.043 13.056  1.00 154.36 ? 37  ASP A C     1 
ATOM   1217 O O     . ASP D 1 33 ? -20.067 28.475 12.984  1.00 154.13 ? 37  ASP A O     1 
ATOM   1218 C CB    . ASP D 1 33 ? -23.647 28.264 13.420  1.00 153.84 ? 37  ASP A CB    1 
ATOM   1219 C CG    . ASP D 1 33 ? -24.773 29.224 13.732  1.00 149.71 ? 37  ASP A CG    1 
ATOM   1220 O OD1   . ASP D 1 33 ? -25.941 28.895 13.430  1.00 150.68 ? 37  ASP A OD1   1 
ATOM   1221 O OD2   . ASP D 1 33 ? -24.488 30.298 14.304  1.00 145.67 ? 37  ASP A OD2   1 
ATOM   1222 N N     . THR D 1 34 ? -21.501 26.776 13.355  1.00 145.36 ? 38  THR A N     1 
ATOM   1223 C CA    . THR D 1 34 ? -20.737 25.986 14.335  1.00 142.13 ? 38  THR A CA    1 
ATOM   1224 C C     . THR D 1 34 ? -19.272 25.657 14.058  1.00 138.45 ? 38  THR A C     1 
ATOM   1225 O O     . THR D 1 34 ? -18.921 25.175 12.981  1.00 142.07 ? 38  THR A O     1 
ATOM   1226 C CB    . THR D 1 34 ? -21.434 24.637 14.571  1.00 147.21 ? 38  THR A CB    1 
ATOM   1227 O OG1   . THR D 1 34 ? -21.949 24.140 13.330  1.00 151.65 ? 38  THR A OG1   1 
ATOM   1228 C CG2   . THR D 1 34 ? -22.571 24.797 15.561  1.00 145.30 ? 38  THR A CG2   1 
ATOM   1229 N N     . GLY D 1 35 ? -18.445 25.874 15.084  1.00 125.04 ? 39  GLY A N     1 
ATOM   1230 C CA    . GLY D 1 35 ? -17.036 25.513 15.068  1.00 124.37 ? 39  GLY A CA    1 
ATOM   1231 C C     . GLY D 1 35 ? -16.373 25.998 13.799  1.00 123.93 ? 39  GLY A C     1 
ATOM   1232 O O     . GLY D 1 35 ? -16.132 25.210 12.886  1.00 129.87 ? 39  GLY A O     1 
ATOM   1233 N N     . LEU D 1 36 ? -16.055 27.290 13.775  1.00 157.49 ? 40  LEU A N     1 
ATOM   1234 C CA    . LEU D 1 36 ? -15.863 28.042 12.538  1.00 153.51 ? 40  LEU A CA    1 
ATOM   1235 C C     . LEU D 1 36 ? -17.261 28.138 11.906  1.00 147.42 ? 40  LEU A C     1 
ATOM   1236 O O     . LEU D 1 36 ? -17.816 27.118 11.499  1.00 152.24 ? 40  LEU A O     1 
ATOM   1237 C CB    . LEU D 1 36 ? -14.854 27.390 11.579  1.00 159.41 ? 40  LEU A CB    1 
ATOM   1238 C CG    . LEU D 1 36 ? -13.403 27.129 12.021  1.00 159.46 ? 40  LEU A CG    1 
ATOM   1239 C CD1   . LEU D 1 36 ? -12.461 27.900 11.108  1.00 160.60 ? 40  LEU A CD1   1 
ATOM   1240 C CD2   . LEU D 1 36 ? -13.123 27.481 13.479  1.00 155.31 ? 40  LEU A CD2   1 
ATOM   1241 N N     . THR D 1 37 ? -17.827 29.340 11.790  1.00 115.12 ? 41  THR A N     1 
ATOM   1242 C CA    . THR D 1 37 ? -17.083 30.587 11.891  1.00 109.18 ? 41  THR A CA    1 
ATOM   1243 C C     . THR D 1 37 ? -17.983 31.818 11.886  1.00 102.00 ? 41  THR A C     1 
ATOM   1244 O O     . THR D 1 37 ? -18.089 32.511 10.874  1.00 104.35 ? 41  THR A O     1 
ATOM   1245 C CB    . THR D 1 37 ? -16.095 30.695 10.728  1.00 108.71 ? 41  THR A CB    1 
ATOM   1246 O OG1   . THR D 1 37 ? -15.680 32.055 10.574  1.00 107.45 ? 41  THR A OG1   1 
ATOM   1247 C CG2   . THR D 1 37 ? -16.751 30.207 9.422   1.00 113.80 ? 41  THR A CG2   1 
ATOM   1248 N N     . ILE D 1 38 ? -18.621 32.095 13.019  1.00 118.03 ? 42  ILE A N     1 
ATOM   1249 C CA    . ILE D 1 38 ? -19.430 33.300 13.151  1.00 110.50 ? 42  ILE A CA    1 
ATOM   1250 C C     . ILE D 1 38 ? -18.507 34.511 13.273  1.00 104.42 ? 42  ILE A C     1 
ATOM   1251 O O     . ILE D 1 38 ? -18.906 35.642 12.998  1.00 104.27 ? 42  ILE A O     1 
ATOM   1252 C CB    . ILE D 1 38 ? -20.389 33.219 14.371  1.00 100.36 ? 42  ILE A CB    1 
ATOM   1253 C CG1   . ILE D 1 38 ? -21.801 33.659 13.971  1.00 100.14 ? 42  ILE A CG1   1 
ATOM   1254 C CG2   . ILE D 1 38 ? -19.874 34.042 15.563  1.00 96.16  ? 42  ILE A CG2   1 
ATOM   1255 C CD1   . ILE D 1 38 ? -21.878 35.041 13.365  1.00 99.41  ? 42  ILE A CD1   1 
ATOM   1256 N N     . LEU D 1 39 ? -17.268 34.255 13.685  1.00 95.04  ? 43  LEU A N     1 
ATOM   1257 C CA    . LEU D 1 39 ? -16.258 35.299 13.819  1.00 87.84  ? 43  LEU A CA    1 
ATOM   1258 C C     . LEU D 1 39 ? -16.060 36.056 12.511  1.00 86.68  ? 43  LEU A C     1 
ATOM   1259 O O     . LEU D 1 39 ? -15.854 37.270 12.512  1.00 82.48  ? 43  LEU A O     1 
ATOM   1260 C CB    . LEU D 1 39 ? -14.928 34.690 14.274  1.00 88.91  ? 43  LEU A CB    1 
ATOM   1261 C CG    . LEU D 1 39 ? -13.719 35.625 14.347  1.00 87.30  ? 43  LEU A CG    1 
ATOM   1262 C CD1   . LEU D 1 39 ? -13.934 36.710 15.390  1.00 83.12  ? 43  LEU A CD1   1 
ATOM   1263 C CD2   . LEU D 1 39 ? -12.457 34.832 14.645  1.00 90.21  ? 43  LEU A CD2   1 
ATOM   1264 N N     . GLN D 1 40 ? -16.126 35.335 11.398  1.00 56.82  ? 44  GLN A N     1 
ATOM   1265 C CA    . GLN D 1 40 ? -15.885 35.932 10.091  1.00 62.44  ? 44  GLN A CA    1 
ATOM   1266 C C     . GLN D 1 40 ? -17.005 36.885 9.691   1.00 63.19  ? 44  GLN A C     1 
ATOM   1267 O O     . GLN D 1 40 ? -16.764 37.867 8.993   1.00 65.67  ? 44  GLN A O     1 
ATOM   1268 C CB    . GLN D 1 40 ? -15.717 34.844 9.029   1.00 68.66  ? 44  GLN A CB    1 
ATOM   1269 C CG    . GLN D 1 40 ? -14.323 34.242 9.002   1.00 72.07  ? 44  GLN A CG    1 
ATOM   1270 C CD    . GLN D 1 40 ? -14.166 33.169 7.942   1.00 77.55  ? 44  GLN A CD    1 
ATOM   1271 O OE1   . GLN D 1 40 ? -14.778 32.108 8.024   1.00 78.47  ? 44  GLN A OE1   1 
ATOM   1272 N NE2   . GLN D 1 40 ? -13.340 33.442 6.940   1.00 81.42  ? 44  GLN A NE2   1 
ATOM   1273 N N     . VAL D 1 41 ? -18.224 36.598 10.135  1.00 77.51  ? 45  VAL A N     1 
ATOM   1274 C CA    . VAL D 1 41 ? -19.361 37.466 9.848   1.00 74.52  ? 45  VAL A CA    1 
ATOM   1275 C C     . VAL D 1 41 ? -19.136 38.843 10.462  1.00 67.31  ? 45  VAL A C     1 
ATOM   1276 O O     . VAL D 1 41 ? -19.323 39.865 9.803   1.00 66.17  ? 45  VAL A O     1 
ATOM   1277 C CB    . VAL D 1 41 ? -20.682 36.879 10.389  1.00 74.19  ? 45  VAL A CB    1 
ATOM   1278 C CG1   . VAL D 1 41 ? -21.859 37.806 10.081  1.00 71.95  ? 45  VAL A CG1   1 
ATOM   1279 C CG2   . VAL D 1 41 ? -20.933 35.504 9.801   1.00 80.88  ? 45  VAL A CG2   1 
ATOM   1280 N N     . ASN D 1 42 ? -18.729 38.857 11.728  1.00 75.90  ? 46  ASN A N     1 
ATOM   1281 C CA    . ASN D 1 42 ? -18.500 40.100 12.454  1.00 69.58  ? 46  ASN A CA    1 
ATOM   1282 C C     . ASN D 1 42 ? -17.474 40.996 11.771  1.00 71.46  ? 46  ASN A C     1 
ATOM   1283 O O     . ASN D 1 42 ? -17.774 42.137 11.421  1.00 76.38  ? 46  ASN A O     1 
ATOM   1284 C CB    . ASN D 1 42 ? -18.050 39.799 13.883  1.00 65.35  ? 46  ASN A CB    1 
ATOM   1285 C CG    . ASN D 1 42 ? -19.197 39.367 14.775  1.00 60.14  ? 46  ASN A CG    1 
ATOM   1286 O OD1   . ASN D 1 42 ? -19.810 40.188 15.457  1.00 56.25  ? 46  ASN A OD1   1 
ATOM   1287 N ND2   . ASN D 1 42 ? -19.494 38.073 14.773  1.00 61.57  ? 46  ASN A ND2   1 
ATOM   1288 N N     . ASN D 1 43 ? -16.264 40.474 11.589  1.00 69.58  ? 47  ASN A N     1 
ATOM   1289 C CA    . ASN D 1 43 ? -15.195 41.224 10.940  1.00 67.69  ? 47  ASN A CA    1 
ATOM   1290 C C     . ASN D 1 43 ? -15.607 41.737 9.564   1.00 63.44  ? 47  ASN A C     1 
ATOM   1291 O O     . ASN D 1 43 ? -15.174 42.807 9.139   1.00 64.22  ? 47  ASN A O     1 
ATOM   1292 C CB    . ASN D 1 43 ? -13.937 40.359 10.810  1.00 69.93  ? 47  ASN A CB    1 
ATOM   1293 C CG    . ASN D 1 43 ? -13.244 40.125 12.141  1.00 67.38  ? 47  ASN A CG    1 
ATOM   1294 O OD1   . ASN D 1 43 ? -13.350 40.933 13.063  1.00 63.71  ? 47  ASN A OD1   1 
ATOM   1295 N ND2   . ASN D 1 43 ? -12.520 39.016 12.242  1.00 69.60  ? 47  ASN A ND2   1 
ATOM   1296 N N     . TRP D 1 44 ? -16.452 40.973 8.877   1.00 59.08  ? 48  TRP A N     1 
ATOM   1297 C CA    . TRP D 1 44 ? -16.885 41.330 7.530   1.00 51.24  ? 48  TRP A CA    1 
ATOM   1298 C C     . TRP D 1 44 ? -17.618 42.667 7.521   1.00 49.98  ? 48  TRP A C     1 
ATOM   1299 O O     . TRP D 1 44 ? -17.224 43.594 6.813   1.00 50.52  ? 48  TRP A O     1 
ATOM   1300 C CB    . TRP D 1 44 ? -17.789 40.241 6.950   1.00 51.27  ? 48  TRP A CB    1 
ATOM   1301 C CG    . TRP D 1 44 ? -17.825 40.233 5.457   1.00 52.69  ? 48  TRP A CG    1 
ATOM   1302 C CD1   . TRP D 1 44 ? -17.155 39.381 4.630   1.00 56.93  ? 48  TRP A CD1   1 
ATOM   1303 C CD2   . TRP D 1 44 ? -18.562 41.121 4.609   1.00 52.86  ? 48  TRP A CD2   1 
ATOM   1304 N NE1   . TRP D 1 44 ? -17.431 39.680 3.318   1.00 60.67  ? 48  TRP A NE1   1 
ATOM   1305 C CE2   . TRP D 1 44 ? -18.293 40.745 3.278   1.00 58.22  ? 48  TRP A CE2   1 
ATOM   1306 C CE3   . TRP D 1 44 ? -19.424 42.196 4.845   1.00 51.86  ? 48  TRP A CE3   1 
ATOM   1307 C CZ2   . TRP D 1 44 ? -18.855 41.404 2.188   1.00 60.58  ? 48  TRP A CZ2   1 
ATOM   1308 C CZ3   . TRP D 1 44 ? -19.981 42.849 3.760   1.00 52.56  ? 48  TRP A CZ3   1 
ATOM   1309 C CH2   . TRP D 1 44 ? -19.694 42.451 2.449   1.00 57.37  ? 48  TRP A CH2   1 
ATOM   1310 N N     . PHE D 1 45 ? -18.684 42.761 8.309   1.00 49.26  ? 49  PHE A N     1 
ATOM   1311 C CA    . PHE D 1 45 ? -19.480 43.980 8.375   1.00 48.02  ? 49  PHE A CA    1 
ATOM   1312 C C     . PHE D 1 45 ? -18.690 45.116 9.014   1.00 47.65  ? 49  PHE A C     1 
ATOM   1313 O O     . PHE D 1 45 ? -18.890 46.282 8.682   1.00 47.65  ? 49  PHE A O     1 
ATOM   1314 C CB    . PHE D 1 45 ? -20.772 43.735 9.154   1.00 47.01  ? 49  PHE A CB    1 
ATOM   1315 C CG    . PHE D 1 45 ? -21.768 42.894 8.415   1.00 47.47  ? 49  PHE A CG    1 
ATOM   1316 C CD1   . PHE D 1 45 ? -22.669 43.476 7.542   1.00 47.79  ? 49  PHE A CD1   1 
ATOM   1317 C CD2   . PHE D 1 45 ? -21.803 41.522 8.592   1.00 47.74  ? 49  PHE A CD2   1 
ATOM   1318 C CE1   . PHE D 1 45 ? -23.587 42.707 6.859   1.00 48.40  ? 49  PHE A CE1   1 
ATOM   1319 C CE2   . PHE D 1 45 ? -22.718 40.747 7.911   1.00 48.34  ? 49  PHE A CE2   1 
ATOM   1320 C CZ    . PHE D 1 45 ? -23.612 41.340 7.043   1.00 48.68  ? 49  PHE A CZ    1 
ATOM   1321 N N     . ILE D 1 46 ? -17.794 44.767 9.932   1.00 47.33  ? 50  ILE A N     1 
ATOM   1322 C CA    . ILE D 1 46 ? -16.931 45.749 10.581  1.00 47.21  ? 50  ILE A CA    1 
ATOM   1323 C C     . ILE D 1 46 ? -16.061 46.458 9.548   1.00 48.61  ? 50  ILE A C     1 
ATOM   1324 O O     . ILE D 1 46 ? -15.976 47.686 9.535   1.00 48.25  ? 50  ILE A O     1 
ATOM   1325 C CB    . ILE D 1 46 ? -16.044 45.083 11.659  1.00 47.12  ? 50  ILE A CB    1 
ATOM   1326 C CG1   . ILE D 1 46 ? -16.848 44.906 12.946  1.00 46.03  ? 50  ILE A CG1   1 
ATOM   1327 C CG2   . ILE D 1 46 ? -14.800 45.923 11.968  1.00 47.59  ? 50  ILE A CG2   1 
ATOM   1328 C CD1   . ILE D 1 46 ? -16.328 43.825 13.867  1.00 46.02  ? 50  ILE A CD1   1 
ATOM   1329 N N     . ASN D 1 47 ? -15.420 45.679 8.683   1.00 49.31  ? 51  ASN A N     1 
ATOM   1330 C CA    . ASN D 1 47 ? -14.604 46.241 7.614   1.00 50.53  ? 51  ASN A CA    1 
ATOM   1331 C C     . ASN D 1 47 ? -15.472 46.868 6.529   1.00 53.89  ? 51  ASN A C     1 
ATOM   1332 O O     . ASN D 1 47 ? -15.131 47.915 5.979   1.00 58.43  ? 51  ASN A O     1 
ATOM   1333 C CB    . ASN D 1 47 ? -13.704 45.169 6.991   1.00 54.83  ? 51  ASN A CB    1 
ATOM   1334 C CG    . ASN D 1 47 ? -12.793 44.501 8.005   1.00 54.48  ? 51  ASN A CG    1 
ATOM   1335 O OD1   . ASN D 1 47 ? -12.644 43.279 8.009   1.00 57.36  ? 51  ASN A OD1   1 
ATOM   1336 N ND2   . ASN D 1 47 ? -12.173 45.300 8.866   1.00 52.64  ? 51  ASN A ND2   1 
ATOM   1337 N N     . ALA D 1 48 ? -16.590 46.215 6.223   1.00 50.62  ? 52  ALA A N     1 
ATOM   1338 C CA    . ALA D 1 48 ? -17.496 46.674 5.175   1.00 55.63  ? 52  ALA A CA    1 
ATOM   1339 C C     . ALA D 1 48 ? -18.014 48.079 5.457   1.00 60.16  ? 52  ALA A C     1 
ATOM   1340 O O     . ALA D 1 48 ? -18.246 48.861 4.537   1.00 62.61  ? 52  ALA A O     1 
ATOM   1341 C CB    . ALA D 1 48 ? -18.658 45.711 5.029   1.00 53.60  ? 52  ALA A CB    1 
ATOM   1342 N N     . ARG D 1 49 ? -18.198 48.392 6.734   1.00 75.10  ? 53  ARG A N     1 
ATOM   1343 C CA    . ARG D 1 49 ? -18.677 49.709 7.132   1.00 69.59  ? 53  ARG A CA    1 
ATOM   1344 C C     . ARG D 1 49 ? -17.667 50.792 6.759   1.00 72.29  ? 53  ARG A C     1 
ATOM   1345 O O     . ARG D 1 49 ? -17.981 51.706 5.998   1.00 76.68  ? 53  ARG A O     1 
ATOM   1346 C CB    . ARG D 1 49 ? -18.964 49.739 8.635   1.00 66.60  ? 53  ARG A CB    1 
ATOM   1347 C CG    . ARG D 1 49 ? -20.216 48.967 9.030   1.00 63.04  ? 53  ARG A CG    1 
ATOM   1348 C CD    . ARG D 1 49 ? -20.116 48.390 10.433  1.00 59.32  ? 53  ARG A CD    1 
ATOM   1349 N NE    . ARG D 1 49 ? -21.094 47.328 10.651  1.00 57.49  ? 53  ARG A NE    1 
ATOM   1350 C CZ    . ARG D 1 49 ? -21.107 46.525 11.711  1.00 53.65  ? 53  ARG A CZ    1 
ATOM   1351 N NH1   . ARG D 1 49 ? -20.190 46.655 12.660  1.00 51.98  ? 53  ARG A NH1   1 
ATOM   1352 N NH2   . ARG D 1 49 ? -22.038 45.587 11.820  1.00 53.01  ? 53  ARG A NH2   1 
ATOM   1353 N N     . ARG D 1 50 ? -16.445 50.675 7.268   1.00 61.52  ? 54  ARG A N     1 
ATOM   1354 C CA    . ARG D 1 50 ? -15.421 51.688 7.024   1.00 61.39  ? 54  ARG A CA    1 
ATOM   1355 C C     . ARG D 1 50 ? -14.772 51.556 5.644   1.00 67.01  ? 54  ARG A C     1 
ATOM   1356 O O     . ARG D 1 50 ? -13.668 52.056 5.425   1.00 69.97  ? 54  ARG A O     1 
ATOM   1357 C CB    . ARG D 1 50 ? -14.341 51.620 8.108   1.00 58.32  ? 54  ARG A CB    1 
ATOM   1358 C CG    . ARG D 1 50 ? -13.485 50.358 8.078   1.00 57.20  ? 54  ARG A CG    1 
ATOM   1359 C CD    . ARG D 1 50 ? -12.420 50.392 9.164   1.00 54.01  ? 54  ARG A CD    1 
ATOM   1360 N NE    . ARG D 1 50 ? -11.529 49.236 9.105   1.00 53.77  ? 54  ARG A NE    1 
ATOM   1361 C CZ    . ARG D 1 50 ? -10.553 48.998 9.977   1.00 52.24  ? 54  ARG A CZ    1 
ATOM   1362 N NH1   . ARG D 1 50 ? -10.340 49.833 10.985  1.00 51.29  ? 54  ARG A NH1   1 
ATOM   1363 N NH2   . ARG D 1 50 ? -9.791  47.922 9.843   1.00 54.26  ? 54  ARG A NH2   1 
ATOM   1364 N N     . ARG D 1 51 ? -15.456 50.888 4.718   1.00 52.33  ? 55  ARG A N     1 
ATOM   1365 C CA    . ARG D 1 51 ? -14.932 50.690 3.368   1.00 54.83  ? 55  ARG A CA    1 
ATOM   1366 C C     . ARG D 1 51 ? -16.025 50.790 2.302   1.00 62.85  ? 55  ARG A C     1 
ATOM   1367 O O     . ARG D 1 51 ? -15.742 51.131 1.153   1.00 65.79  ? 55  ARG A O     1 
ATOM   1368 C CB    . ARG D 1 51 ? -14.226 49.335 3.273   1.00 55.07  ? 55  ARG A CB    1 
ATOM   1369 C CG    . ARG D 1 51 ? -12.995 49.237 4.162   1.00 54.32  ? 55  ARG A CG    1 
ATOM   1370 C CD    . ARG D 1 51 ? -12.358 47.858 4.123   1.00 54.86  ? 55  ARG A CD    1 
ATOM   1371 N NE    . ARG D 1 51 ? -11.160 47.803 4.958   1.00 54.94  ? 55  ARG A NE    1 
ATOM   1372 C CZ    . ARG D 1 51 ? -10.426 46.712 5.154   1.00 55.44  ? 55  ARG A CZ    1 
ATOM   1373 N NH1   . ARG D 1 51 ? -10.757 45.565 4.578   1.00 55.91  ? 55  ARG A NH1   1 
ATOM   1374 N NH2   . ARG D 1 51 ? -9.354  46.770 5.933   1.00 55.60  ? 55  ARG A NH2   1 
ATOM   1375 N N     . ILE D 1 52 ? -17.265 50.491 2.684   1.00 58.90  ? 56  ILE A N     1 
ATOM   1376 C CA    . ILE D 1 52 ? -18.402 50.605 1.772   1.00 71.68  ? 56  ILE A CA    1 
ATOM   1377 C C     . ILE D 1 52 ? -19.399 51.647 2.282   1.00 83.96  ? 56  ILE A C     1 
ATOM   1378 O O     . ILE D 1 52 ? -20.027 52.346 1.487   1.00 87.61  ? 56  ILE A O     1 
ATOM   1379 C CB    . ILE D 1 52 ? -19.124 49.248 1.586   1.00 64.39  ? 56  ILE A CB    1 
ATOM   1380 C CG1   . ILE D 1 52 ? -18.127 48.174 1.137   1.00 67.30  ? 56  ILE A CG1   1 
ATOM   1381 C CG2   . ILE D 1 52 ? -20.256 49.379 0.565   1.00 67.13  ? 56  ILE A CG2   1 
ATOM   1382 C CD1   . ILE D 1 52 ? -18.702 46.770 1.086   1.00 66.80  ? 56  ILE A CD1   1 
ATOM   1383 N N     . VAL D 1 53 ? -19.532 51.758 3.602   1.00 102.77 ? 57  VAL A N     1 
ATOM   1384 C CA    . VAL D 1 53 ? -20.497 52.681 4.202   1.00 114.77 ? 57  VAL A CA    1 
ATOM   1385 C C     . VAL D 1 53 ? -19.883 54.047 4.485   1.00 123.29 ? 57  VAL A C     1 
ATOM   1386 O O     . VAL D 1 53 ? -20.271 55.041 3.877   1.00 125.33 ? 57  VAL A O     1 
ATOM   1387 C CB    . VAL D 1 53 ? -21.079 52.116 5.524   1.00 65.60  ? 57  VAL A CB    1 
ATOM   1388 C CG1   . VAL D 1 53 ? -21.966 53.149 6.230   1.00 62.94  ? 57  VAL A CG1   1 
ATOM   1389 C CG2   . VAL D 1 53 ? -21.856 50.842 5.257   1.00 66.12  ? 57  VAL A CG2   1 
ATOM   1390 N N     . GLN D 1 54 ? -18.929 54.092 5.410   1.00 78.25  ? 58  GLN A N     1 
ATOM   1391 C CA    . GLN D 1 54 ? -18.409 55.362 5.916   1.00 87.17  ? 58  GLN A CA    1 
ATOM   1392 C C     . GLN D 1 54 ? -17.959 56.326 4.812   1.00 101.94 ? 58  GLN A C     1 
ATOM   1393 O O     . GLN D 1 54 ? -18.130 57.536 4.951   1.00 101.35 ? 58  GLN A O     1 
ATOM   1394 C CB    . GLN D 1 54 ? -17.253 55.106 6.888   1.00 89.41  ? 58  GLN A CB    1 
ATOM   1395 C CG    . GLN D 1 54 ? -17.642 54.273 8.103   1.00 85.26  ? 58  GLN A CG    1 
ATOM   1396 C CD    . GLN D 1 54 ? -18.840 54.837 8.842   1.00 79.86  ? 58  GLN A CD    1 
ATOM   1397 O OE1   . GLN D 1 54 ? -18.904 56.033 9.124   1.00 77.55  ? 58  GLN A OE1   1 
ATOM   1398 N NE2   . GLN D 1 54 ? -19.805 53.976 9.148   1.00 76.34  ? 58  GLN A NE2   1 
ATOM   1399 N N     . PRO D 1 55 ? -17.383 55.802 3.716   1.00 88.09  ? 59  PRO A N     1 
ATOM   1400 C CA    . PRO D 1 55 ? -17.078 56.708 2.601   1.00 107.21 ? 59  PRO A CA    1 
ATOM   1401 C C     . PRO D 1 55 ? -18.334 57.244 1.912   1.00 126.91 ? 59  PRO A C     1 
ATOM   1402 O O     . PRO D 1 55 ? -18.345 58.392 1.465   1.00 137.48 ? 59  PRO A O     1 
ATOM   1403 C CB    . PRO D 1 55 ? -16.265 55.828 1.643   1.00 101.83 ? 59  PRO A CB    1 
ATOM   1404 C CG    . PRO D 1 55 ? -15.736 54.723 2.486   1.00 94.62  ? 59  PRO A CG    1 
ATOM   1405 C CD    . PRO D 1 55 ? -16.790 54.469 3.513   1.00 89.26  ? 59  PRO A CD    1 
ATOM   1406 N N     . MET D 1 56 ? -19.372 56.416 1.830   1.00 202.18 ? 60  MET A N     1 
ATOM   1407 C CA    . MET D 1 56 ? -20.626 56.803 1.189   1.00 201.12 ? 60  MET A CA    1 
ATOM   1408 C C     . MET D 1 56 ? -21.288 57.969 1.919   1.00 203.16 ? 60  MET A C     1 
ATOM   1409 O O     . MET D 1 56 ? -21.932 58.815 1.299   1.00 203.44 ? 60  MET A O     1 
ATOM   1410 C CB    . MET D 1 56 ? -21.580 55.604 1.138   1.00 201.08 ? 60  MET A CB    1 
ATOM   1411 C CG    . MET D 1 56 ? -22.963 55.880 0.560   1.00 201.14 ? 60  MET A CG    1 
ATOM   1412 S SD    . MET D 1 56 ? -24.186 54.710 1.187   1.00 312.52 ? 60  MET A SD    1 
ATOM   1413 C CE    . MET D 1 56 ? -23.336 53.149 0.948   1.00 120.06 ? 60  MET A CE    1 
ATOM   1414 N N     . ILE D 1 57 ? -21.124 58.011 3.236   1.00 150.51 ? 61  ILE A N     1 
ATOM   1415 C CA    . ILE D 1 57 ? -21.819 58.992 4.061   1.00 138.25 ? 61  ILE A CA    1 
ATOM   1416 C C     . ILE D 1 57 ? -21.200 60.384 3.940   1.00 133.19 ? 61  ILE A C     1 
ATOM   1417 O O     . ILE D 1 57 ? -21.898 61.350 3.635   1.00 132.71 ? 61  ILE A O     1 
ATOM   1418 C CB    . ILE D 1 57 ? -21.829 58.554 5.545   1.00 91.12  ? 61  ILE A CB    1 
ATOM   1419 C CG1   . ILE D 1 57 ? -22.641 57.264 5.696   1.00 84.16  ? 61  ILE A CG1   1 
ATOM   1420 C CG2   . ILE D 1 57 ? -22.417 59.651 6.439   1.00 91.61  ? 61  ILE A CG2   1 
ATOM   1421 C CD1   . ILE D 1 57 ? -22.554 56.619 7.066   1.00 72.43  ? 61  ILE A CD1   1 
ATOM   1422 N N     . ASP D 1 58 ? -19.896 60.486 4.174   1.00 151.19 ? 62  ASP A N     1 
ATOM   1423 C CA    . ASP D 1 58 ? -19.232 61.786 4.178   1.00 156.83 ? 62  ASP A CA    1 
ATOM   1424 C C     . ASP D 1 58 ? -19.134 62.375 2.773   1.00 164.58 ? 62  ASP A C     1 
ATOM   1425 O O     . ASP D 1 58 ? -19.275 63.585 2.593   1.00 172.57 ? 62  ASP A O     1 
ATOM   1426 C CB    . ASP D 1 58 ? -17.833 61.678 4.798   1.00 158.86 ? 62  ASP A CB    1 
ATOM   1427 C CG    . ASP D 1 58 ? -16.859 60.907 3.926   1.00 161.77 ? 62  ASP A CG    1 
ATOM   1428 O OD1   . ASP D 1 58 ? -16.307 61.500 2.974   1.00 166.63 ? 62  ASP A OD1   1 
ATOM   1429 O OD2   . ASP D 1 58 ? -16.632 59.711 4.199   1.00 160.65 ? 62  ASP A OD2   1 
ATOM   1430 N N     . GLN D 1 59 ? -18.904 61.513 1.786   1.00 152.65 ? 63  GLN A N     1 
ATOM   1431 C CA    . GLN D 1 59 ? -18.680 61.944 0.407   1.00 151.14 ? 63  GLN A CA    1 
ATOM   1432 C C     . GLN D 1 59 ? -17.582 63.004 0.345   1.00 149.88 ? 63  GLN A C     1 
ATOM   1433 O O     . GLN D 1 59 ? -16.403 62.675 0.210   1.00 152.72 ? 63  GLN A O     1 
ATOM   1434 C CB    . GLN D 1 59 ? -19.974 62.482 -0.213  1.00 152.32 ? 63  GLN A CB    1 
ATOM   1435 C CG    . GLN D 1 59 ? -21.036 61.425 -0.459  1.00 153.96 ? 63  GLN A CG    1 
ATOM   1436 C CD    . GLN D 1 59 ? -20.604 60.381 -1.472  1.00 160.69 ? 63  GLN A CD    1 
ATOM   1437 O OE1   . GLN D 1 59 ? -19.659 60.590 -2.234  1.00 166.05 ? 63  GLN A OE1   1 
ATOM   1438 N NE2   . GLN D 1 59 ? -21.295 59.248 -1.485  1.00 160.94 ? 63  GLN A NE2   1 
ATOM   1439 N N     . SER D 1 60 ? -17.979 64.270 0.451   1.00 168.99 ? 64  SER A N     1 
ATOM   1440 C CA    . SER D 1 60 ? -17.040 65.389 0.447   1.00 168.80 ? 64  SER A CA    1 
ATOM   1441 C C     . SER D 1 60 ? -16.142 65.370 -0.788  1.00 173.43 ? 64  SER A C     1 
ATOM   1442 O O     . SER D 1 60 ? -14.971 64.999 -0.711  1.00 174.22 ? 64  SER A O     1 
ATOM   1443 C CB    . SER D 1 60 ? -16.186 65.369 1.717   1.00 164.61 ? 64  SER A CB    1 
ATOM   1444 O OG    . SER D 1 60 ? -16.997 65.451 2.876   1.00 160.07 ? 64  SER A OG    1 
ATOM   1445 P P     . DG  E 4 1  ? -18.012 32.975 40.216  1.00 117.50 ? 24  DG  C P     1 
ATOM   1446 O OP1   . DG  E 4 1  ? -16.989 31.904 40.247  1.00 117.50 ? 24  DG  C OP1   1 
ATOM   1447 O OP2   . DG  E 4 1  ? -17.593 34.395 40.208  1.00 117.50 ? 24  DG  C OP2   1 
ATOM   1448 O "O5'" . DG  E 4 1  ? -19.015 32.778 38.983  1.00 117.50 ? 24  DG  C "O5'" 1 
ATOM   1449 C "C5'" . DG  E 4 1  ? -19.107 31.524 38.304  1.00 117.50 ? 24  DG  C "C5'" 1 
ATOM   1450 C "C4'" . DG  E 4 1  ? -19.353 31.735 36.821  1.00 117.50 ? 24  DG  C "C4'" 1 
ATOM   1451 O "O4'" . DG  E 4 1  ? -20.757 32.053 36.609  1.00 117.50 ? 24  DG  C "O4'" 1 
ATOM   1452 C "C3'" . DG  E 4 1  ? -18.560 32.882 36.199  1.00 117.50 ? 24  DG  C "C3'" 1 
ATOM   1453 O "O3'" . DG  E 4 1  ? -17.338 32.401 35.621  1.00 117.50 ? 24  DG  C "O3'" 1 
ATOM   1454 C "C2'" . DG  E 4 1  ? -19.522 33.447 35.162  1.00 117.50 ? 24  DG  C "C2'" 1 
ATOM   1455 C "C1'" . DG  E 4 1  ? -20.888 33.198 35.787  1.00 117.50 ? 24  DG  C "C1'" 1 
ATOM   1456 N N9    . DG  E 4 1  ? -21.375 34.309 36.599  1.00 20.00  ? 24  DG  C N9    1 
ATOM   1457 C C8    . DG  E 4 1  ? -20.673 35.020 37.545  1.00 20.00  ? 24  DG  C C8    1 
ATOM   1458 N N7    . DG  E 4 1  ? -21.372 35.968 38.115  1.00 20.00  ? 24  DG  C N7    1 
ATOM   1459 C C5    . DG  E 4 1  ? -22.625 35.892 37.516  1.00 20.00  ? 24  DG  C C5    1 
ATOM   1460 C C6    . DG  E 4 1  ? -23.802 36.653 37.712  1.00 20.00  ? 24  DG  C C6    1 
ATOM   1461 O O6    . DG  E 4 1  ? -23.985 37.595 38.496  1.00 20.00  ? 24  DG  C O6    1 
ATOM   1462 N N1    . DG  E 4 1  ? -24.840 36.225 36.883  1.00 20.00  ? 24  DG  C N1    1 
ATOM   1463 C C2    . DG  E 4 1  ? -24.755 35.192 35.976  1.00 20.00  ? 24  DG  C C2    1 
ATOM   1464 N N2    . DG  E 4 1  ? -25.859 34.919 35.260  1.00 20.00  ? 24  DG  C N2    1 
ATOM   1465 N N3    . DG  E 4 1  ? -23.657 34.473 35.784  1.00 20.00  ? 24  DG  C N3    1 
ATOM   1466 C C4    . DG  E 4 1  ? -22.636 34.873 36.581  1.00 20.00  ? 24  DG  C C4    1 
ATOM   1467 P P     . DA  E 4 2  ? -15.929 32.642 36.362  1.00 245.65 ? 25  DA  C P     1 
ATOM   1468 O OP1   . DA  E 4 2  ? -15.134 31.408 36.191  1.00 244.44 ? 25  DA  C OP1   1 
ATOM   1469 O OP2   . DA  E 4 2  ? -16.191 33.155 37.725  1.00 236.80 ? 25  DA  C OP2   1 
ATOM   1470 O "O5'" . DA  E 4 2  ? -15.222 33.806 35.516  1.00 148.63 ? 25  DA  C "O5'" 1 
ATOM   1471 C "C5'" . DA  E 4 2  ? -15.401 33.891 34.102  1.00 132.87 ? 25  DA  C "C5'" 1 
ATOM   1472 C "C4'" . DA  E 4 2  ? -16.749 34.504 33.778  1.00 116.81 ? 25  DA  C "C4'" 1 
ATOM   1473 O "O4'" . DA  E 4 2  ? -17.162 35.332 34.908  1.00 116.58 ? 25  DA  C "O4'" 1 
ATOM   1474 C "C3'" . DA  E 4 2  ? -16.786 35.422 32.548  1.00 117.02 ? 25  DA  C "C3'" 1 
ATOM   1475 O "O3'" . DA  E 4 2  ? -18.028 35.213 31.788  1.00 135.85 ? 25  DA  C "O3'" 1 
ATOM   1476 C "C2'" . DA  E 4 2  ? -16.666 36.795 33.182  1.00 116.77 ? 25  DA  C "C2'" 1 
ATOM   1477 C "C1'" . DA  E 4 2  ? -17.477 36.620 34.444  1.00 116.55 ? 25  DA  C "C1'" 1 
ATOM   1478 N N9    . DA  E 4 2  ? -17.190 37.614 35.472  1.00 116.26 ? 25  DA  C N9    1 
ATOM   1479 C C8    . DA  E 4 2  ? -16.157 37.622 36.364  1.00 116.23 ? 25  DA  C C8    1 
ATOM   1480 N N7    . DA  E 4 2  ? -16.165 38.662 37.167  1.00 123.74 ? 25  DA  C N7    1 
ATOM   1481 C C5    . DA  E 4 2  ? -17.280 39.383 36.767  1.00 120.62 ? 25  DA  C C5    1 
ATOM   1482 C C6    . DA  E 4 2  ? -17.849 40.593 37.219  1.00 115.53 ? 25  DA  C C6    1 
ATOM   1483 N N6    . DA  E 4 2  ? -17.344 41.319 38.220  1.00 115.38 ? 25  DA  C N6    1 
ATOM   1484 N N1    . DA  E 4 2  ? -18.964 41.029 36.598  1.00 115.41 ? 25  DA  C N1    1 
ATOM   1485 C C2    . DA  E 4 2  ? -19.471 40.302 35.594  1.00 115.48 ? 25  DA  C C2    1 
ATOM   1486 N N3    . DA  E 4 2  ? -19.027 39.157 35.085  1.00 115.73 ? 25  DA  C N3    1 
ATOM   1487 C C4    . DA  E 4 2  ? -17.918 38.749 35.724  1.00 116.03 ? 25  DA  C C4    1 
ATOM   1488 P P     . DT  E 4 3  ? -18.941 36.423 31.222  1.00 217.16 ? 26  DT  C P     1 
ATOM   1489 O OP1   . DT  E 4 3  ? -19.621 37.099 32.345  1.00 223.59 ? 26  DT  C OP1   1 
ATOM   1490 O OP2   . DT  E 4 3  ? -19.780 35.837 30.157  1.00 212.07 ? 26  DT  C OP2   1 
ATOM   1491 O "O5'" . DT  E 4 3  ? -17.921 37.426 30.497  1.00 162.41 ? 26  DT  C "O5'" 1 
ATOM   1492 C "C5'" . DT  E 4 3  ? -17.967 38.852 30.761  1.00 158.72 ? 26  DT  C "C5'" 1 
ATOM   1493 C "C4'" . DT  E 4 3  ? -19.306 39.458 30.389  1.00 153.28 ? 26  DT  C "C4'" 1 
ATOM   1494 O "O4'" . DT  E 4 3  ? -19.406 40.768 30.996  1.00 152.03 ? 26  DT  C "O4'" 1 
ATOM   1495 C "C3'" . DT  E 4 3  ? -19.516 39.671 28.903  1.00 141.61 ? 26  DT  C "C3'" 1 
ATOM   1496 O "O3'" . DT  E 4 3  ? -20.180 38.541 28.321  1.00 142.56 ? 26  DT  C "O3'" 1 
ATOM   1497 C "C2'" . DT  E 4 3  ? -20.370 40.937 28.831  1.00 136.77 ? 26  DT  C "C2'" 1 
ATOM   1498 C "C1'" . DT  E 4 3  ? -20.159 41.640 30.177  1.00 143.78 ? 26  DT  C "C1'" 1 
ATOM   1499 N N1    . DT  E 4 3  ? -19.428 42.967 30.089  1.00 138.76 ? 26  DT  C N1    1 
ATOM   1500 C C2    . DT  E 4 3  ? -19.848 43.923 29.184  1.00 130.05 ? 26  DT  C C2    1 
ATOM   1501 O O2    . DT  E 4 3  ? -20.781 43.762 28.417  1.00 125.77 ? 26  DT  C O2    1 
ATOM   1502 N N3    . DT  E 4 3  ? -19.123 45.085 29.199  1.00 127.21 ? 26  DT  C N3    1 
ATOM   1503 C C4    . DT  E 4 3  ? -18.050 45.391 30.013  1.00 131.31 ? 26  DT  C C4    1 
ATOM   1504 O O4    . DT  E 4 3  ? -17.466 46.469 29.948  1.00 129.48 ? 26  DT  C O4    1 
ATOM   1505 C C5    . DT  E 4 3  ? -17.664 44.356 30.944  1.00 141.68 ? 26  DT  C C5    1 
ATOM   1506 C C7    . DT  E 4 3  ? -16.512 44.574 31.883  1.00 149.06 ? 26  DT  C C7    1 
ATOM   1507 C C6    . DT  E 4 3  ? -18.365 43.210 30.941  1.00 144.48 ? 26  DT  C C6    1 
ATOM   1508 P P     . DT  E 4 4  ? -19.389 37.509 27.372  1.00 181.97 ? 27  DT  C P     1 
ATOM   1509 O OP1   . DT  E 4 4  ? -20.157 36.246 27.383  1.00 188.51 ? 27  DT  C OP1   1 
ATOM   1510 O OP2   . DT  E 4 4  ? -17.959 37.502 27.752  1.00 182.87 ? 27  DT  C OP2   1 
ATOM   1511 O "O5'" . DT  E 4 4  ? -19.514 38.139 25.906  1.00 139.07 ? 27  DT  C "O5'" 1 
ATOM   1512 C "C5'" . DT  E 4 4  ? -18.735 39.269 25.542  1.00 131.36 ? 27  DT  C "C5'" 1 
ATOM   1513 C "C4'" . DT  E 4 4  ? -19.618 40.478 25.305  1.00 125.77 ? 27  DT  C "C4'" 1 
ATOM   1514 O "O4'" . DT  E 4 4  ? -19.129 41.578 26.079  1.00 126.54 ? 27  DT  C "O4'" 1 
ATOM   1515 C "C3'" . DT  E 4 4  ? -19.643 40.989 23.874  1.00 114.90 ? 27  DT  C "C3'" 1 
ATOM   1516 O "O3'" . DT  E 4 4  ? -20.725 40.394 23.163  1.00 113.03 ? 27  DT  C "O3'" 1 
ATOM   1517 C "C2'" . DT  E 4 4  ? -19.801 42.512 24.022  1.00 111.69 ? 27  DT  C "C2'" 1 
ATOM   1518 C "C1'" . DT  E 4 4  ? -19.598 42.774 25.518  1.00 119.45 ? 27  DT  C "C1'" 1 
ATOM   1519 N N1    . DT  E 4 4  ? -18.609 43.846 25.825  1.00 117.10 ? 27  DT  C N1    1 
ATOM   1520 C C2    . DT  E 4 4  ? -18.924 45.153 25.544  1.00 112.47 ? 27  DT  C C2    1 
ATOM   1521 O O2    . DT  E 4 4  ? -19.979 45.494 25.039  1.00 109.59 ? 27  DT  C O2    1 
ATOM   1522 N N3    . DT  E 4 4  ? -17.950 46.057 25.873  1.00 112.49 ? 27  DT  C N3    1 
ATOM   1523 C C4    . DT  E 4 4  ? -16.720 45.790 26.446  1.00 116.54 ? 27  DT  C C4    1 
ATOM   1524 O O4    . DT  E 4 4  ? -15.911 46.673 26.704  1.00 117.31 ? 27  DT  C O4    1 
ATOM   1525 C C5    . DT  E 4 4  ? -16.454 44.399 26.719  1.00 120.32 ? 27  DT  C C5    1 
ATOM   1526 C C7    . DT  E 4 4  ? -15.152 43.983 27.342  1.00 124.38 ? 27  DT  C C7    1 
ATOM   1527 C C6    . DT  E 4 4  ? -17.400 43.504 26.402  1.00 120.63 ? 27  DT  C C6    1 
ATOM   1528 P P     . DA  E 4 5  ? -20.501 39.710 21.725  1.00 143.23 ? 28  DA  C P     1 
ATOM   1529 O OP1   . DA  E 4 5  ? -21.433 38.564 21.648  1.00 148.31 ? 28  DA  C OP1   1 
ATOM   1530 O OP2   . DA  E 4 5  ? -19.055 39.482 21.502  1.00 141.08 ? 28  DA  C OP2   1 
ATOM   1531 O "O5'" . DA  E 4 5  ? -20.982 40.834 20.697  1.00 107.46 ? 28  DA  C "O5'" 1 
ATOM   1532 C "C5'" . DA  E 4 5  ? -22.247 41.461 20.871  1.00 108.00 ? 28  DA  C "C5'" 1 
ATOM   1533 C "C4'" . DA  E 4 5  ? -22.200 42.904 20.410  1.00 101.12 ? 28  DA  C "C4'" 1 
ATOM   1534 O "O4'" . DA  E 4 5  ? -21.195 43.620 21.182  1.00 101.74 ? 28  DA  C "O4'" 1 
ATOM   1535 C "C3'" . DA  E 4 5  ? -21.819 43.093 18.946  1.00 93.37  ? 28  DA  C "C3'" 1 
ATOM   1536 O "O3'" . DA  E 4 5  ? -22.549 44.172 18.365  1.00 90.04  ? 28  DA  C "O3'" 1 
ATOM   1537 C "C2'" . DA  E 4 5  ? -20.322 43.364 19.007  1.00 90.98  ? 28  DA  C "C2'" 1 
ATOM   1538 C "C1'" . DA  E 4 5  ? -20.168 44.099 20.332  1.00 95.64  ? 28  DA  C "C1'" 1 
ATOM   1539 N N9    . DA  E 4 5  ? -18.877 43.886 20.990  1.00 98.53  ? 28  DA  C N9    1 
ATOM   1540 C C8    . DA  E 4 5  ? -18.157 42.723 21.050  1.00 101.29 ? 28  DA  C C8    1 
ATOM   1541 N N7    . DA  E 4 5  ? -17.031 42.832 21.716  1.00 103.79 ? 28  DA  C N7    1 
ATOM   1542 C C5    . DA  E 4 5  ? -17.010 44.156 22.121  1.00 102.38 ? 28  DA  C C5    1 
ATOM   1543 C C6    . DA  E 4 5  ? -16.080 44.907 22.869  1.00 103.28 ? 28  DA  C C6    1 
ATOM   1544 N N6    . DA  E 4 5  ? -14.942 44.398 23.354  1.00 105.29 ? 28  DA  C N6    1 
ATOM   1545 N N1    . DA  E 4 5  ? -16.363 46.206 23.095  1.00 103.01 ? 28  DA  C N1    1 
ATOM   1546 C C2    . DA  E 4 5  ? -17.501 46.713 22.607  1.00 100.99 ? 28  DA  C C2    1 
ATOM   1547 N N3    . DA  E 4 5  ? -18.450 46.108 21.894  1.00 99.26  ? 28  DA  C N3    1 
ATOM   1548 C C4    . DA  E 4 5  ? -18.141 44.819 21.683  1.00 99.84  ? 28  DA  C C4    1 
ATOM   1549 P P     . DG  E 4 6  ? -22.470 44.445 16.784  1.00 100.89 ? 29  DG  C P     1 
ATOM   1550 O OP1   . DG  E 4 6  ? -23.807 44.894 16.334  1.00 98.27  ? 29  DG  C OP1   1 
ATOM   1551 O OP2   . DG  E 4 6  ? -21.838 43.269 16.145  1.00 100.69 ? 29  DG  C OP2   1 
ATOM   1552 O "O5'" . DG  E 4 6  ? -21.446 45.665 16.661  1.00 66.65  ? 29  DG  C "O5'" 1 
ATOM   1553 C "C5'" . DG  E 4 6  ? -21.757 46.914 17.263  1.00 68.20  ? 29  DG  C "C5'" 1 
ATOM   1554 C "C4'" . DG  E 4 6  ? -20.546 47.828 17.273  1.00 66.62  ? 29  DG  C "C4'" 1 
ATOM   1555 O "O4'" . DG  E 4 6  ? -19.562 47.328 18.216  1.00 70.44  ? 29  DG  C "O4'" 1 
ATOM   1556 C "C3'" . DG  E 4 6  ? -19.825 47.949 15.928  1.00 59.96  ? 29  DG  C "C3'" 1 
ATOM   1557 O "O3'" . DG  E 4 6  ? -19.853 49.294 15.483  1.00 58.14  ? 29  DG  C "O3'" 1 
ATOM   1558 C "C2'" . DG  E 4 6  ? -18.401 47.450 16.206  1.00 60.49  ? 29  DG  C "C2'" 1 
ATOM   1559 C "C1'" . DG  E 4 6  ? -18.277 47.589 17.710  1.00 67.07  ? 29  DG  C "C1'" 1 
ATOM   1560 N N9    . DG  E 4 6  ? -17.325 46.661 18.316  1.00 71.24  ? 29  DG  C N9    1 
ATOM   1561 C C8    . DG  E 4 6  ? -17.341 45.289 18.242  1.00 73.08  ? 29  DG  C C8    1 
ATOM   1562 N N7    . DG  E 4 6  ? -16.357 44.724 18.885  1.00 76.59  ? 29  DG  C N7    1 
ATOM   1563 C C5    . DG  E 4 6  ? -15.643 45.789 19.419  1.00 77.59  ? 29  DG  C C5    1 
ATOM   1564 C C6    . DG  E 4 6  ? -14.471 45.796 20.214  1.00 81.33  ? 29  DG  C C6    1 
ATOM   1565 O O6    . DG  E 4 6  ? -13.812 44.828 20.619  1.00 86.38  ? 29  DG  C O6    1 
ATOM   1566 N N1    . DG  E 4 6  ? -14.079 47.092 20.542  1.00 81.55  ? 29  DG  C N1    1 
ATOM   1567 C C2    . DG  E 4 6  ? -14.735 48.235 20.148  1.00 78.34  ? 29  DG  C C2    1 
ATOM   1568 N N2    . DG  E 4 6  ? -14.208 49.397 20.559  1.00 79.77  ? 29  DG  C N2    1 
ATOM   1569 N N3    . DG  E 4 6  ? -15.831 48.241 19.403  1.00 75.04  ? 29  DG  C N3    1 
ATOM   1570 C C4    . DG  E 4 6  ? -16.227 46.988 19.077  1.00 74.47  ? 29  DG  C C4    1 
ATOM   1571 P P     . DC  E 4 7  ? -19.073 49.729 14.150  1.00 50.82  ? 30  DC  C P     1 
ATOM   1572 O OP1   . DC  E 4 7  ? -19.908 50.743 13.471  1.00 49.75  ? 30  DC  C OP1   1 
ATOM   1573 O OP2   . DC  E 4 7  ? -18.681 48.498 13.429  1.00 47.86  ? 30  DC  C OP2   1 
ATOM   1574 O "O5'" . DC  E 4 7  ? -17.735 50.415 14.698  1.00 60.69  ? 30  DC  C "O5'" 1 
ATOM   1575 C "C5'" . DC  E 4 7  ? -17.812 51.523 15.594  1.00 65.23  ? 30  DC  C "C5'" 1 
ATOM   1576 C "C4'" . DC  E 4 7  ? -16.434 52.109 15.847  1.00 67.41  ? 30  DC  C "C4'" 1 
ATOM   1577 O "O4'" . DC  E 4 7  ? -15.682 51.209 16.709  1.00 70.32  ? 30  DC  C "O4'" 1 
ATOM   1578 C "C3'" . DC  E 4 7  ? -15.580 52.314 14.591  1.00 63.62  ? 30  DC  C "C3'" 1 
ATOM   1579 O "O3'" . DC  E 4 7  ? -14.940 53.589 14.620  1.00 65.46  ? 30  DC  C "O3'" 1 
ATOM   1580 C "C2'" . DC  E 4 7  ? -14.586 51.161 14.640  1.00 63.11  ? 30  DC  C "C2'" 1 
ATOM   1581 C "C1'" . DC  E 4 7  ? -14.425 50.929 16.133  1.00 68.72  ? 30  DC  C "C1'" 1 
ATOM   1582 N N1    . DC  E 4 7  ? -14.030 49.529 16.491  1.00 69.74  ? 30  DC  C N1    1 
ATOM   1583 C C2    . DC  E 4 7  ? -12.913 49.301 17.308  1.00 74.44  ? 30  DC  C C2    1 
ATOM   1584 O O2    . DC  E 4 7  ? -12.261 50.265 17.731  1.00 77.65  ? 30  DC  C O2    1 
ATOM   1585 N N3    . DC  E 4 7  ? -12.577 48.024 17.616  1.00 76.00  ? 30  DC  C N3    1 
ATOM   1586 C C4    . DC  E 4 7  ? -13.302 47.009 17.144  1.00 73.91  ? 30  DC  C C4    1 
ATOM   1587 N N4    . DC  E 4 7  ? -12.930 45.768 17.474  1.00 77.20  ? 30  DC  C N4    1 
ATOM   1588 C C5    . DC  E 4 7  ? -14.439 47.221 16.311  1.00 68.97  ? 30  DC  C C5    1 
ATOM   1589 C C6    . DC  E 4 7  ? -14.764 48.482 16.015  1.00 67.23  ? 30  DC  C C6    1 
ATOM   1590 P P     . DT  E 4 8  ? -13.913 54.020 13.459  1.00 54.95  ? 31  DT  C P     1 
ATOM   1591 O OP1   . DT  E 4 8  ? -13.990 55.492 13.339  1.00 58.40  ? 31  DT  C OP1   1 
ATOM   1592 O OP2   . DT  E 4 8  ? -14.145 53.165 12.273  1.00 49.85  ? 31  DT  C OP2   1 
ATOM   1593 O "O5'" . DT  E 4 8  ? -12.481 53.624 14.046  1.00 66.17  ? 31  DT  C "O5'" 1 
ATOM   1594 C "C5'" . DT  E 4 8  ? -12.118 54.020 15.359  1.00 71.02  ? 31  DT  C "C5'" 1 
ATOM   1595 C "C4'" . DT  E 4 8  ? -10.701 53.589 15.686  1.00 72.64  ? 31  DT  C "C4'" 1 
ATOM   1596 O "O4'" . DT  E 4 8  ? -10.675 52.157 15.911  1.00 70.77  ? 31  DT  C "O4'" 1 
ATOM   1597 C "C3'" . DT  E 4 8  ? -9.665  53.868 14.584  1.00 71.51  ? 31  DT  C "C3'" 1 
ATOM   1598 O "O3'" . DT  E 4 8  ? -8.614  54.688 15.084  1.00 77.35  ? 31  DT  C "O3'" 1 
ATOM   1599 C "C2'" . DT  E 4 8  ? -9.169  52.480 14.174  1.00 67.96  ? 31  DT  C "C2'" 1 
ATOM   1600 C "C1'" . DT  E 4 8  ? -9.475  51.642 15.399  1.00 69.43  ? 31  DT  C "C1'" 1 
ATOM   1601 N N1    . DT  E 4 8  ? -9.645  50.190 15.112  1.00 65.37  ? 31  DT  C N1    1 
ATOM   1602 C C2    . DT  E 4 8  ? -8.676  49.307 15.528  1.00 67.62  ? 31  DT  C C2    1 
ATOM   1603 O O2    . DT  E 4 8  ? -7.673  49.647 16.131  1.00 72.72  ? 31  DT  C O2    1 
ATOM   1604 N N3    . DT  E 4 8  ? -8.921  47.999 15.216  1.00 65.19  ? 31  DT  C N3    1 
ATOM   1605 C C4    . DT  E 4 8  ? -10.015 47.492 14.540  1.00 61.09  ? 31  DT  C C4    1 
ATOM   1606 O O4    . DT  E 4 8  ? -10.142 46.294 14.309  1.00 59.82  ? 31  DT  C O4    1 
ATOM   1607 C C5    . DT  E 4 8  ? -10.996 48.469 14.128  1.00 58.67  ? 31  DT  C C5    1 
ATOM   1608 C C7    . DT  E 4 8  ? -12.228 48.037 13.385  1.00 54.49  ? 31  DT  C C7    1 
ATOM   1609 C C6    . DT  E 4 8  ? -10.767 49.759 14.429  1.00 61.10  ? 31  DT  C C6    1 
ATOM   1610 P P     . DG  E 4 9  ? -7.551  55.358 14.082  1.00 83.89  ? 32  DG  C P     1 
ATOM   1611 O OP1   . DG  E 4 9  ? -7.015  56.550 14.775  1.00 90.94  ? 32  DG  C OP1   1 
ATOM   1612 O OP2   . DG  E 4 9  ? -8.166  55.494 12.744  1.00 79.85  ? 32  DG  C OP2   1 
ATOM   1613 O "O5'" . DG  E 4 9  ? -6.393  54.264 13.958  1.00 70.78  ? 32  DG  C "O5'" 1 
ATOM   1614 C "C5'" . DG  E 4 9  ? -5.580  53.962 15.081  1.00 76.73  ? 32  DG  C "C5'" 1 
ATOM   1615 C "C4'" . DG  E 4 9  ? -4.595  52.855 14.757  1.00 76.29  ? 32  DG  C "C4'" 1 
ATOM   1616 O "O4'" . DG  E 4 9  ? -5.302  51.591 14.640  1.00 72.02  ? 32  DG  C "O4'" 1 
ATOM   1617 C "C3'" . DG  E 4 9  ? -3.830  53.042 13.441  1.00 75.38  ? 32  DG  C "C3'" 1 
ATOM   1618 O "O3'" . DG  E 4 9  ? -2.427  52.998 13.672  1.00 80.49  ? 32  DG  C "O3'" 1 
ATOM   1619 C "C2'" . DG  E 4 9  ? -4.318  51.892 12.556  1.00 69.08  ? 32  DG  C "C2'" 1 
ATOM   1620 C "C1'" . DG  E 4 9  ? -4.756  50.855 13.573  1.00 69.39  ? 32  DG  C "C1'" 1 
ATOM   1621 N N9    . DG  E 4 9  ? -5.761  49.914 13.080  1.00 65.04  ? 32  DG  C N9    1 
ATOM   1622 C C8    . DG  E 4 9  ? -6.848  50.199 12.289  1.00 61.34  ? 32  DG  C C8    1 
ATOM   1623 N N7    . DG  E 4 9  ? -7.574  49.154 12.008  1.00 58.27  ? 32  DG  C N7    1 
ATOM   1624 C C5    . DG  E 4 9  ? -6.932  48.108 12.656  1.00 60.99  ? 32  DG  C C5    1 
ATOM   1625 C C6    . DG  E 4 9  ? -7.262  46.733 12.713  1.00 60.80  ? 32  DG  C C6    1 
ATOM   1626 O O6    . DG  E 4 9  ? -8.218  46.152 12.182  1.00 57.29  ? 32  DG  C O6    1 
ATOM   1627 N N1    . DG  E 4 9  ? -6.348  46.015 13.479  1.00 65.76  ? 32  DG  C N1    1 
ATOM   1628 C C2    . DG  E 4 9  ? -5.254  46.557 14.110  1.00 71.26  ? 32  DG  C C2    1 
ATOM   1629 N N2    . DG  E 4 9  ? -4.486  45.703 14.804  1.00 78.25  ? 32  DG  C N2    1 
ATOM   1630 N N3    . DG  E 4 9  ? -4.933  47.844 14.065  1.00 70.75  ? 32  DG  C N3    1 
ATOM   1631 C C4    . DG  E 4 9  ? -5.814  48.558 13.322  1.00 65.77  ? 32  DG  C C4    1 
ATOM   1632 P P     . DT  E 4 10 ? -1.401  53.035 12.438  1.00 178.88 ? 33  DT  C P     1 
ATOM   1633 O OP1   . DT  E 4 10 ? -0.152  53.668 12.917  1.00 185.60 ? 33  DT  C OP1   1 
ATOM   1634 O OP2   . DT  E 4 10 ? -2.123  53.605 11.279  1.00 175.74 ? 33  DT  C OP2   1 
ATOM   1635 O "O5'" . DT  E 4 10 ? -1.122  51.490 12.128  1.00 76.26  ? 33  DT  C "O5'" 1 
ATOM   1636 C "C5'" . DT  E 4 10 ? -0.625  50.639 13.154  1.00 79.96  ? 33  DT  C "C5'" 1 
ATOM   1637 C "C4'" . DT  E 4 10 ? -0.802  49.175 12.790  1.00 75.07  ? 33  DT  C "C4'" 1 
ATOM   1638 O "O4'" . DT  E 4 10 ? -2.207  48.857 12.723  1.00 70.52  ? 33  DT  C "O4'" 1 
ATOM   1639 C "C3'" . DT  E 4 10 ? -0.266  48.765 11.429  1.00 72.00  ? 33  DT  C "C3'" 1 
ATOM   1640 O "O3'" . DT  E 4 10 ? 1.137   48.497 11.482  1.00 76.56  ? 33  DT  C "O3'" 1 
ATOM   1641 C "C2'" . DT  E 4 10 ? -1.087  47.517 11.112  1.00 67.16  ? 33  DT  C "C2'" 1 
ATOM   1642 C "C1'" . DT  E 4 10 ? -2.379  47.707 11.916  1.00 65.98  ? 33  DT  C "C1'" 1 
ATOM   1643 N N1    . DT  E 4 10 ? -3.584  47.893 11.058  1.00 59.07  ? 33  DT  C N1    1 
ATOM   1644 C C2    . DT  E 4 10 ? -4.399  46.815 10.802  1.00 54.90  ? 33  DT  C C2    1 
ATOM   1645 O O2    . DT  E 4 10 ? -4.197  45.701 11.250  1.00 57.12  ? 33  DT  C O2    1 
ATOM   1646 N N3    . DT  E 4 10 ? -5.473  47.088 9.999   1.00 48.98  ? 33  DT  C N3    1 
ATOM   1647 C C4    . DT  E 4 10 ? -5.806  48.305 9.434   1.00 46.65  ? 33  DT  C C4    1 
ATOM   1648 O O4    . DT  E 4 10 ? -6.796  48.447 8.725   1.00 42.68  ? 33  DT  C O4    1 
ATOM   1649 C C5    . DT  E 4 10 ? -4.906  49.394 9.738   1.00 50.74  ? 33  DT  C C5    1 
ATOM   1650 C C7    . DT  E 4 10 ? -5.161  50.765 9.181   1.00 50.58  ? 33  DT  C C7    1 
ATOM   1651 C C6    . DT  E 4 10 ? -3.849  49.139 10.525  1.00 56.55  ? 33  DT  C C6    1 
ATOM   1652 P P     . DC  E 4 11 ? 1.944   48.121 10.141  1.00 76.76  ? 34  DC  C P     1 
ATOM   1653 O OP1   . DC  E 4 11 ? 3.381   48.351 10.405  1.00 83.82  ? 34  DC  C OP1   1 
ATOM   1654 O OP2   . DC  E 4 11 ? 1.290   48.798 9.000   1.00 73.30  ? 34  DC  C OP2   1 
ATOM   1655 O "O5'" . DC  E 4 11 ? 1.700   46.550 9.967   1.00 73.00  ? 34  DC  C "O5'" 1 
ATOM   1656 C "C5'" . DC  E 4 11 ? 2.066   45.652 11.006  1.00 77.73  ? 34  DC  C "C5'" 1 
ATOM   1657 C "C4'" . DC  E 4 11 ? 1.702   44.223 10.642  1.00 76.08  ? 34  DC  C "C4'" 1 
ATOM   1658 O "O4'" . DC  E 4 11 ? 0.277   44.144 10.358  1.00 71.94  ? 34  DC  C "O4'" 1 
ATOM   1659 C "C3'" . DC  E 4 11 ? 2.415   43.676 9.404   1.00 75.03  ? 34  DC  C "C3'" 1 
ATOM   1660 O "O3'" . DC  E 4 11 ? 2.887   42.356 9.640   1.00 75.84  ? 34  DC  C "O3'" 1 
ATOM   1661 C "C2'" . DC  E 4 11 ? 1.346   43.720 8.319   1.00 69.51  ? 34  DC  C "C2'" 1 
ATOM   1662 C "C1'" . DC  E 4 11 ? 0.066   43.521 9.108   1.00 68.10  ? 34  DC  C "C1'" 1 
ATOM   1663 N N1    . DC  E 4 11 ? -1.142  44.130 8.467   1.00 63.17  ? 34  DC  C N1    1 
ATOM   1664 C C2    . DC  E 4 11 ? -2.152  43.308 7.942   1.00 59.93  ? 34  DC  C C2    1 
ATOM   1665 O O2    . DC  E 4 11 ? -2.034  42.079 8.012   1.00 62.34  ? 34  DC  C O2    1 
ATOM   1666 N N3    . DC  E 4 11 ? -3.235  43.889 7.369   1.00 54.09  ? 34  DC  C N3    1 
ATOM   1667 C C4    . DC  E 4 11 ? -3.331  45.218 7.312   1.00 52.19  ? 34  DC  C C4    1 
ATOM   1668 N N4    . DC  E 4 11 ? -4.418  45.744 6.737   1.00 47.15  ? 34  DC  C N4    1 
ATOM   1669 C C5    . DC  E 4 11 ? -2.315  46.068 7.839   1.00 57.08  ? 34  DC  C C5    1 
ATOM   1670 C C6    . DC  E 4 11 ? -1.251  45.486 8.400   1.00 62.07  ? 34  DC  C C6    1 
ATOM   1671 P P     . DA  E 4 12 ? 3.867   41.643 8.585   1.00 119.71 ? 35  DA  C P     1 
ATOM   1672 O OP1   . DA  E 4 12 ? 4.608   40.598 9.323   1.00 125.41 ? 35  DA  C OP1   1 
ATOM   1673 O OP2   . DA  E 4 12 ? 4.608   42.700 7.860   1.00 120.06 ? 35  DA  C OP2   1 
ATOM   1674 O "O5'" . DA  E 4 12 ? 2.871   40.940 7.547   1.00 77.41  ? 35  DA  C "O5'" 1 
ATOM   1675 C "C5'" . DA  E 4 12 ? 1.965   39.938 7.997   1.00 77.20  ? 35  DA  C "C5'" 1 
ATOM   1676 C "C4'" . DA  E 4 12 ? 1.009   39.526 6.890   1.00 68.59  ? 35  DA  C "C4'" 1 
ATOM   1677 O "O4'" . DA  E 4 12 ? 0.103   40.629 6.601   1.00 62.64  ? 35  DA  C "O4'" 1 
ATOM   1678 C "C3'" . DA  E 4 12 ? 1.680   39.161 5.562   1.00 66.12  ? 35  DA  C "C3'" 1 
ATOM   1679 O "O3'" . DA  E 4 12 ? 1.118   37.968 5.021   1.00 64.98  ? 35  DA  C "O3'" 1 
ATOM   1680 C "C2'" . DA  E 4 12 ? 1.415   40.375 4.679   1.00 61.08  ? 35  DA  C "C2'" 1 
ATOM   1681 C "C1'" . DA  E 4 12 ? 0.088   40.887 5.213   1.00 57.71  ? 35  DA  C "C1'" 1 
ATOM   1682 N N9    . DA  E 4 12 ? -0.133  42.318 4.996   1.00 53.43  ? 35  DA  C N9    1 
ATOM   1683 C C8    . DA  E 4 12 ? 0.785   43.327 5.107   1.00 56.84  ? 35  DA  C C8    1 
ATOM   1684 N N7    . DA  E 4 12 ? 0.297   44.518 4.852   1.00 54.81  ? 35  DA  C N7    1 
ATOM   1685 C C5    . DA  E 4 12 ? -1.034  44.276 4.554   1.00 47.68  ? 35  DA  C C5    1 
ATOM   1686 C C6    . DA  E 4 12 ? -2.100  45.128 4.197   1.00 42.49  ? 35  DA  C C6    1 
ATOM   1687 N N6    . DA  E 4 12 ? -1.978  46.455 4.075   1.00 43.00  ? 35  DA  C N6    1 
ATOM   1688 N N1    . DA  E 4 12 ? -3.302  44.560 3.967   1.00 37.06  ? 35  DA  C N1    1 
ATOM   1689 C C2    . DA  E 4 12 ? -3.422  43.232 4.089   1.00 36.49  ? 35  DA  C C2    1 
ATOM   1690 N N3    . DA  E 4 12 ? -2.497  42.333 4.417   1.00 40.92  ? 35  DA  C N3    1 
ATOM   1691 C C4    . DA  E 4 12 ? -1.315  42.925 4.639   1.00 47.37  ? 35  DA  C C4    1 
ATOM   1692 P P     . DT  F 5 1  ? -13.044 44.728 -1.775  1.00 241.36 ? 4   DT  D P     1 
ATOM   1693 O OP1   . DT  F 5 1  ? -12.824 44.353 -3.190  1.00 239.10 ? 4   DT  D OP1   1 
ATOM   1694 O OP2   . DT  F 5 1  ? -14.414 44.729 -1.216  1.00 243.04 ? 4   DT  D OP2   1 
ATOM   1695 O "O5'" . DT  F 5 1  ? -12.130 43.804 -0.841  1.00 54.75  ? 4   DT  D "O5'" 1 
ATOM   1696 C "C5'" . DT  F 5 1  ? -11.844 42.465 -1.227  1.00 53.62  ? 4   DT  D "C5'" 1 
ATOM   1697 C "C4'" . DT  F 5 1  ? -11.021 41.755 -0.168  1.00 56.00  ? 4   DT  D "C4'" 1 
ATOM   1698 O "O4'" . DT  F 5 1  ? -9.792  42.467 0.056   1.00 55.14  ? 4   DT  D "O4'" 1 
ATOM   1699 C "C3'" . DT  F 5 1  ? -11.673 41.671 1.204   1.00 59.75  ? 4   DT  D "C3'" 1 
ATOM   1700 O "O3'" . DT  F 5 1  ? -12.393 40.455 1.338   1.00 62.21  ? 4   DT  D "O3'" 1 
ATOM   1701 C "C2'" . DT  F 5 1  ? -10.495 41.766 2.189   1.00 61.55  ? 4   DT  D "C2'" 1 
ATOM   1702 C "C1'" . DT  F 5 1  ? -9.284  42.086 1.311   1.00 57.85  ? 4   DT  D "C1'" 1 
ATOM   1703 N N1    . DT  F 5 1  ? -8.423  43.192 1.844   1.00 56.64  ? 4   DT  D N1    1 
ATOM   1704 C C2    . DT  F 5 1  ? -7.272  42.879 2.533   1.00 57.39  ? 4   DT  D C2    1 
ATOM   1705 O O2    . DT  F 5 1  ? -6.904  41.735 2.739   1.00 58.40  ? 4   DT  D O2    1 
ATOM   1706 N N3    . DT  F 5 1  ? -6.558  43.959 2.977   1.00 57.03  ? 4   DT  D N3    1 
ATOM   1707 C C4    . DT  F 5 1  ? -6.870  45.293 2.807   1.00 56.56  ? 4   DT  D C4    1 
ATOM   1708 O O4    . DT  F 5 1  ? -6.159  46.192 3.248   1.00 57.14  ? 4   DT  D O4    1 
ATOM   1709 C C5    . DT  F 5 1  ? -8.089  45.555 2.078   1.00 55.51  ? 4   DT  D C5    1 
ATOM   1710 C C7    . DT  F 5 1  ? -8.533  46.968 1.830   1.00 55.04  ? 4   DT  D C7    1 
ATOM   1711 C C6    . DT  F 5 1  ? -8.799  44.504 1.635   1.00 55.37  ? 4   DT  D C6    1 
ATOM   1712 P P     . DG  F 5 2  ? -13.179 40.126 2.699   1.00 58.03  ? 5   DG  D P     1 
ATOM   1713 O OP1   . DG  F 5 2  ? -14.295 39.216 2.361   1.00 58.24  ? 5   DG  D OP1   1 
ATOM   1714 O OP2   . DG  F 5 2  ? -13.454 41.410 3.382   1.00 58.52  ? 5   DG  D OP2   1 
ATOM   1715 O "O5'" . DG  F 5 2  ? -12.104 39.337 3.582   1.00 59.36  ? 5   DG  D "O5'" 1 
ATOM   1716 C "C5'" . DG  F 5 2  ? -11.469 38.172 3.067   1.00 59.03  ? 5   DG  D "C5'" 1 
ATOM   1717 C "C4'" . DG  F 5 2  ? -10.478 37.613 4.071   1.00 60.51  ? 5   DG  D "C4'" 1 
ATOM   1718 O "O4'" . DG  F 5 2  ? -9.410  38.582 4.285   1.00 60.21  ? 5   DG  D "O4'" 1 
ATOM   1719 C "C3'" . DG  F 5 2  ? -11.063 37.328 5.452   1.00 62.79  ? 5   DG  D "C3'" 1 
ATOM   1720 O "O3'" . DG  F 5 2  ? -10.489 36.149 6.014   1.00 64.12  ? 5   DG  D "O3'" 1 
ATOM   1721 C "C2'" . DG  F 5 2  ? -10.703 38.580 6.238   1.00 63.35  ? 5   DG  D "C2'" 1 
ATOM   1722 C "C1'" . DG  F 5 2  ? -9.348  38.936 5.655   1.00 62.10  ? 5   DG  D "C1'" 1 
ATOM   1723 N N9    . DG  F 5 2  ? -9.003  40.352 5.768   1.00 61.72  ? 5   DG  D N9    1 
ATOM   1724 C C8    . DG  F 5 2  ? -9.744  41.425 5.335   1.00 60.80  ? 5   DG  D C8    1 
ATOM   1725 N N7    . DG  F 5 2  ? -9.178  42.576 5.572   1.00 60.79  ? 5   DG  D N7    1 
ATOM   1726 C C5    . DG  F 5 2  ? -7.985  42.246 6.202   1.00 61.77  ? 5   DG  D C5    1 
ATOM   1727 C C6    . DG  F 5 2  ? -6.952  43.079 6.694   1.00 62.33  ? 5   DG  D C6    1 
ATOM   1728 O O6    . DG  F 5 2  ? -6.888  44.316 6.671   1.00 62.09  ? 5   DG  D O6    1 
ATOM   1729 N N1    . DG  F 5 2  ? -5.919  42.337 7.262   1.00 63.38  ? 5   DG  D N1    1 
ATOM   1730 C C2    . DG  F 5 2  ? -5.888  40.965 7.342   1.00 63.82  ? 5   DG  D C2    1 
ATOM   1731 N N2    . DG  F 5 2  ? -4.807  40.427 7.925   1.00 64.89  ? 5   DG  D N2    1 
ATOM   1732 N N3    . DG  F 5 2  ? -6.849  40.174 6.885   1.00 63.34  ? 5   DG  D N3    1 
ATOM   1733 C C4    . DG  F 5 2  ? -7.863  40.880 6.330   1.00 62.32  ? 5   DG  D C4    1 
ATOM   1734 P P     . DA  F 5 3  ? -10.901 35.689 7.497   1.00 66.75  ? 6   DA  D P     1 
ATOM   1735 O OP1   . DA  F 5 3  ? -10.797 34.215 7.585   1.00 67.71  ? 6   DA  D OP1   1 
ATOM   1736 O OP2   . DA  F 5 3  ? -12.178 36.372 7.792   1.00 67.14  ? 6   DA  D OP2   1 
ATOM   1737 O "O5'" . DA  F 5 3  ? -9.796  36.359 8.439   1.00 67.70  ? 6   DA  D "O5'" 1 
ATOM   1738 C "C5'" . DA  F 5 3  ? -8.421  36.035 8.279   1.00 67.37  ? 6   DA  D "C5'" 1 
ATOM   1739 C "C4'" . DA  F 5 3  ? -7.585  36.690 9.364   1.00 68.75  ? 6   DA  D "C4'" 1 
ATOM   1740 O "O4'" . DA  F 5 3  ? -7.469  38.114 9.087   1.00 67.68  ? 6   DA  D "O4'" 1 
ATOM   1741 C "C3'" . DA  F 5 3  ? -8.165  36.572 10.778  1.00 71.30  ? 6   DA  D "C3'" 1 
ATOM   1742 O "O3'" . DA  F 5 3  ? -7.157  36.173 11.703  1.00 73.00  ? 6   DA  D "O3'" 1 
ATOM   1743 C "C2'" . DA  F 5 3  ? -8.700  37.971 11.069  1.00 71.27  ? 6   DA  D "C2'" 1 
ATOM   1744 C "C1'" . DA  F 5 3  ? -7.778  38.853 10.248  1.00 69.41  ? 6   DA  D "C1'" 1 
ATOM   1745 N N9    . DA  F 5 3  ? -8.369  40.128 9.850   1.00 68.33  ? 6   DA  D N9    1 
ATOM   1746 C C8    . DA  F 5 3  ? -9.568  40.324 9.222   1.00 67.31  ? 6   DA  D C8    1 
ATOM   1747 N N7    . DA  F 5 3  ? -9.840  41.586 8.985   1.00 66.54  ? 6   DA  D N7    1 
ATOM   1748 C C5    . DA  F 5 3  ? -8.741  42.263 9.488   1.00 67.13  ? 6   DA  D C5    1 
ATOM   1749 C C6    . DA  F 5 3  ? -8.412  43.631 9.544   1.00 66.92  ? 6   DA  D C6    1 
ATOM   1750 N N6    . DA  F 5 3  ? -9.202  44.598 9.066   1.00 65.95  ? 6   DA  D N6    1 
ATOM   1751 N N1    . DA  F 5 3  ? -7.237  43.969 10.114  1.00 67.84  ? 6   DA  D N1    1 
ATOM   1752 C C2    . DA  F 5 3  ? -6.450  42.998 10.592  1.00 68.85  ? 6   DA  D C2    1 
ATOM   1753 N N3    . DA  F 5 3  ? -6.651  41.682 10.595  1.00 69.12  ? 6   DA  D N3    1 
ATOM   1754 C C4    . DA  F 5 3  ? -7.826  41.378 10.024  1.00 68.23  ? 6   DA  D C4    1 
ATOM   1755 P P     . DC  F 5 4  ? -7.559  35.576 13.141  1.00 75.93  ? 7   DC  D P     1 
ATOM   1756 O OP1   . DC  F 5 4  ? -6.782  34.332 13.334  1.00 76.81  ? 7   DC  D OP1   1 
ATOM   1757 O OP2   . DC  F 5 4  ? -9.035  35.547 13.245  1.00 76.33  ? 7   DC  D OP2   1 
ATOM   1758 O "O5'" . DC  F 5 4  ? -7.027  36.675 14.170  1.00 79.58  ? 7   DC  D "O5'" 1 
ATOM   1759 C "C5'" . DC  F 5 4  ? -5.641  36.983 14.226  1.00 79.00  ? 7   DC  D "C5'" 1 
ATOM   1760 C "C4'" . DC  F 5 4  ? -5.391  38.204 15.089  1.00 81.63  ? 7   DC  D "C4'" 1 
ATOM   1761 O "O4'" . DC  F 5 4  ? -5.766  39.403 14.355  1.00 77.41  ? 7   DC  D "O4'" 1 
ATOM   1762 C "C3'" . DC  F 5 4  ? -6.189  38.241 16.402  1.00 88.45  ? 7   DC  D "C3'" 1 
ATOM   1763 O "O3'" . DC  F 5 4  ? -5.327  38.499 17.510  1.00 93.86  ? 7   DC  D "O3'" 1 
ATOM   1764 C "C2'" . DC  F 5 4  ? -7.196  39.364 16.175  1.00 86.70  ? 7   DC  D "C2'" 1 
ATOM   1765 C "C1'" . DC  F 5 4  ? -6.438  40.275 15.229  1.00 81.44  ? 7   DC  D "C1'" 1 
ATOM   1766 N N1    . DC  F 5 4  ? -7.301  41.217 14.435  1.00 77.11  ? 7   DC  D N1    1 
ATOM   1767 C C2    . DC  F 5 4  ? -6.905  42.553 14.272  1.00 75.66  ? 7   DC  D C2    1 
ATOM   1768 O O2    . DC  F 5 4  ? -5.844  42.940 14.779  1.00 76.79  ? 7   DC  D O2    1 
ATOM   1769 N N3    . DC  F 5 4  ? -7.697  43.389 13.558  1.00 74.13  ? 7   DC  D N3    1 
ATOM   1770 C C4    . DC  F 5 4  ? -8.833  42.941 13.025  1.00 73.23  ? 7   DC  D C4    1 
ATOM   1771 N N4    . DC  F 5 4  ? -9.580  43.804 12.331  1.00 71.79  ? 7   DC  D N4    1 
ATOM   1772 C C5    . DC  F 5 4  ? -9.255  41.588 13.180  1.00 73.86  ? 7   DC  D C5    1 
ATOM   1773 C C6    . DC  F 5 4  ? -8.467  40.770 13.885  1.00 75.70  ? 7   DC  D C6    1 
ATOM   1774 P P     . DA  F 5 5  ? -5.807  38.182 19.011  1.00 96.19  ? 8   DA  D P     1 
ATOM   1775 O OP1   . DA  F 5 5  ? -5.175  36.912 19.432  1.00 99.80  ? 8   DA  D OP1   1 
ATOM   1776 O OP2   . DA  F 5 5  ? -7.280  38.318 19.055  1.00 97.49  ? 8   DA  D OP2   1 
ATOM   1777 O "O5'" . DA  F 5 5  ? -5.173  39.371 19.871  1.00 98.64  ? 8   DA  D "O5'" 1 
ATOM   1778 C "C5'" . DA  F 5 5  ? -3.763  39.584 19.857  1.00 100.12 ? 8   DA  D "C5'" 1 
ATOM   1779 C "C4'" . DA  F 5 5  ? -3.422  41.011 20.247  1.00 102.70 ? 8   DA  D "C4'" 1 
ATOM   1780 O "O4'" . DA  F 5 5  ? -3.966  41.925 19.253  1.00 97.58  ? 8   DA  D "O4'" 1 
ATOM   1781 C "C3'" . DA  F 5 5  ? -3.995  41.464 21.586  1.00 109.75 ? 8   DA  D "C3'" 1 
ATOM   1782 O "O3'" . DA  F 5 5  ? -3.095  42.344 22.253  1.00 112.62 ? 8   DA  D "O3'" 1 
ATOM   1783 C "C2'" . DA  F 5 5  ? -5.290  42.153 21.189  1.00 107.68 ? 8   DA  D "C2'" 1 
ATOM   1784 C "C1'" . DA  F 5 5  ? -4.937  42.772 19.843  1.00 100.05 ? 8   DA  D "C1'" 1 
ATOM   1785 N N9    . DA  F 5 5  ? -6.073  42.889 18.930  1.00 94.22  ? 8   DA  D N9    1 
ATOM   1786 C C8    . DA  F 5 5  ? -6.959  41.908 18.588  1.00 92.81  ? 8   DA  D C8    1 
ATOM   1787 N N7    . DA  F 5 5  ? -7.882  42.298 17.741  1.00 88.19  ? 8   DA  D N7    1 
ATOM   1788 C C5    . DA  F 5 5  ? -7.578  43.628 17.508  1.00 85.99  ? 8   DA  D C5    1 
ATOM   1789 C C6    . DA  F 5 5  ? -8.181  44.612 16.699  1.00 82.28  ? 8   DA  D C6    1 
ATOM   1790 N N6    . DA  F 5 5  ? -9.262  44.384 15.945  1.00 79.19  ? 8   DA  D N6    1 
ATOM   1791 N N1    . DA  F 5 5  ? -7.627  45.842 16.695  1.00 82.14  ? 8   DA  D N1    1 
ATOM   1792 C C2    . DA  F 5 5  ? -6.545  46.065 17.450  1.00 85.53  ? 8   DA  D C2    1 
ATOM   1793 N N3    . DA  F 5 5  ? -5.892  45.223 18.250  1.00 89.17  ? 8   DA  D N3    1 
ATOM   1794 C C4    . DA  F 5 5  ? -6.465  44.009 18.233  1.00 89.14  ? 8   DA  D C4    1 
ATOM   1795 P P     . DG  F 5 6  ? -3.456  42.922 23.709  1.00 171.24 ? 9   DG  D P     1 
ATOM   1796 O OP1   . DG  F 5 6  ? -2.203  42.968 24.494  1.00 175.56 ? 9   DG  D OP1   1 
ATOM   1797 O OP2   . DG  F 5 6  ? -4.621  42.167 24.222  1.00 174.07 ? 9   DG  D OP2   1 
ATOM   1798 O "O5'" . DG  F 5 6  ? -3.940  44.419 23.417  1.00 115.81 ? 9   DG  D "O5'" 1 
ATOM   1799 C "C5'" . DG  F 5 6  ? -3.041  45.352 22.832  1.00 112.85 ? 9   DG  D "C5'" 1 
ATOM   1800 C "C4'" . DG  F 5 6  ? -3.734  46.672 22.544  1.00 111.42 ? 9   DG  D "C4'" 1 
ATOM   1801 O "O4'" . DG  F 5 6  ? -4.731  46.480 21.501  1.00 105.90 ? 9   DG  D "O4'" 1 
ATOM   1802 C "C3'" . DG  F 5 6  ? -4.474  47.280 23.738  1.00 117.54 ? 9   DG  D "C3'" 1 
ATOM   1803 O "O3'" . DG  F 5 6  ? -4.147  48.658 23.878  1.00 118.61 ? 9   DG  D "O3'" 1 
ATOM   1804 C "C2'" . DG  F 5 6  ? -5.947  47.063 23.409  1.00 115.50 ? 9   DG  D "C2'" 1 
ATOM   1805 C "C1'" . DG  F 5 6  ? -5.952  47.067 21.892  1.00 107.76 ? 9   DG  D "C1'" 1 
ATOM   1806 N N9    . DG  F 5 6  ? -7.049  46.306 21.302  1.00 104.63 ? 9   DG  D N9    1 
ATOM   1807 C C8    . DG  F 5 6  ? -7.267  44.956 21.412  1.00 105.21 ? 9   DG  D C8    1 
ATOM   1808 N N7    . DG  F 5 6  ? -8.328  44.547 20.777  1.00 102.21 ? 9   DG  D N7    1 
ATOM   1809 C C5    . DG  F 5 6  ? -8.849  45.700 20.206  1.00 99.34  ? 9   DG  D C5    1 
ATOM   1810 C C6    . DG  F 5 6  ? -9.996  45.878 19.399  1.00 95.63  ? 9   DG  D C6    1 
ATOM   1811 O O6    . DG  F 5 6  ? -10.807 45.022 19.017  1.00 94.18  ? 9   DG  D O6    1 
ATOM   1812 N N1    . DG  F 5 6  ? -10.165 47.211 19.031  1.00 93.84  ? 9   DG  D N1    1 
ATOM   1813 C C2    . DG  F 5 6  ? -9.329  48.239 19.396  1.00 95.56  ? 9   DG  D C2    1 
ATOM   1814 N N2    . DG  F 5 6  ? -9.656  49.458 18.944  1.00 93.65  ? 9   DG  D N2    1 
ATOM   1815 N N3    . DG  F 5 6  ? -8.250  48.085 20.153  1.00 99.15  ? 9   DG  D N3    1 
ATOM   1816 C C4    . DG  F 5 6  ? -8.072  46.793 20.519  1.00 100.80 ? 9   DG  D C4    1 
ATOM   1817 P P     . DC  F 5 7  ? -4.727  49.506 25.113  1.00 129.14 ? 10  DC  D P     1 
ATOM   1818 O OP1   . DC  F 5 7  ? -3.722  50.537 25.454  1.00 131.80 ? 10  DC  D OP1   1 
ATOM   1819 O OP2   . DC  F 5 7  ? -5.180  48.547 26.145  1.00 134.31 ? 10  DC  D OP2   1 
ATOM   1820 O "O5'" . DC  F 5 7  ? -6.024  50.226 24.511  1.00 118.03 ? 10  DC  D "O5'" 1 
ATOM   1821 C "C5'" . DC  F 5 7  ? -5.892  51.142 23.428  1.00 112.73 ? 10  DC  D "C5'" 1 
ATOM   1822 C "C4'" . DC  F 5 7  ? -7.210  51.842 23.143  1.00 111.18 ? 10  DC  D "C4'" 1 
ATOM   1823 O "O4'" . DC  F 5 7  ? -8.097  50.922 22.448  1.00 106.97 ? 10  DC  D "O4'" 1 
ATOM   1824 C "C3'" . DC  F 5 7  ? -7.970  52.317 24.386  1.00 117.66 ? 10  DC  D "C3'" 1 
ATOM   1825 O "O3'" . DC  F 5 7  ? -8.481  53.641 24.202  1.00 117.17 ? 10  DC  D "O3'" 1 
ATOM   1826 C "C2'" . DC  F 5 7  ? -9.079  51.283 24.542  1.00 117.76 ? 10  DC  D "C2'" 1 
ATOM   1827 C "C1'" . DC  F 5 7  ? -9.344  50.869 23.105  1.00 110.09 ? 10  DC  D "C1'" 1 
ATOM   1828 N N1    . DC  F 5 7  ? -9.904  49.487 22.960  1.00 108.91 ? 10  DC  D N1    1 
ATOM   1829 C C2    . DC  F 5 7  ? -11.117 49.288 22.285  1.00 105.47 ? 10  DC  D C2    1 
ATOM   1830 O O2    . DC  F 5 7  ? -11.719 50.261 21.814  1.00 103.30 ? 10  DC  D O2    1 
ATOM   1831 N N3    . DC  F 5 7  ? -11.600 48.028 22.166  1.00 104.85 ? 10  DC  D N3    1 
ATOM   1832 C C4    . DC  F 5 7  ? -10.927 47.001 22.684  1.00 107.43 ? 10  DC  D C4    1 
ATOM   1833 N N4    . DC  F 5 7  ? -11.446 45.779 22.540  1.00 106.99 ? 10  DC  D N4    1 
ATOM   1834 C C5    . DC  F 5 7  ? -9.692  47.182 23.373  1.00 110.84 ? 10  DC  D C5    1 
ATOM   1835 C C6    . DC  F 5 7  ? -9.222  48.427 23.485  1.00 111.49 ? 10  DC  D C6    1 
ATOM   1836 P P     . DT  F 5 8  ? -9.499  54.261 25.270  1.00 138.99 ? 11  DT  D P     1 
ATOM   1837 O OP1   . DT  F 5 8  ? -9.390  55.741 25.203  1.00 139.35 ? 11  DT  D OP1   1 
ATOM   1838 O OP2   . DT  F 5 8  ? -9.286  53.566 26.565  1.00 145.41 ? 11  DT  D OP2   1 
ATOM   1839 O "O5'" . DT  F 5 8  ? -10.923 53.837 24.697  1.00 135.71 ? 11  DT  D "O5'" 1 
ATOM   1840 C "C5'" . DT  F 5 8  ? -11.485 54.499 23.547  1.00 127.37 ? 11  DT  D "C5'" 1 
ATOM   1841 C "C4'" . DT  F 5 8  ? -12.994 54.485 23.622  1.00 124.01 ? 11  DT  D "C4'" 1 
ATOM   1842 O "O4'" . DT  F 5 8  ? -13.475 53.145 23.361  1.00 121.91 ? 11  DT  D "O4'" 1 
ATOM   1843 C "C3'" . DT  F 5 8  ? -13.570 54.879 24.981  1.00 130.75 ? 11  DT  D "C3'" 1 
ATOM   1844 O "O3'" . DT  F 5 8  ? -14.802 55.586 24.812  1.00 129.64 ? 11  DT  D "O3'" 1 
ATOM   1845 C "C2'" . DT  F 5 8  ? -13.811 53.541 25.655  1.00 132.75 ? 11  DT  D "C2'" 1 
ATOM   1846 C "C1'" . DT  F 5 8  ? -14.195 52.653 24.484  1.00 125.74 ? 11  DT  D "C1'" 1 
ATOM   1847 N N1    . DT  F 5 8  ? -13.841 51.234 24.659  1.00 126.40 ? 11  DT  D N1    1 
ATOM   1848 C C2    . DT  F 5 8  ? -14.592 50.288 24.001  1.00 123.16 ? 11  DT  D C2    1 
ATOM   1849 O O2    . DT  F 5 8  ? -15.536 50.571 23.280  1.00 119.69 ? 11  DT  D O2    1 
ATOM   1850 N N3    . DT  F 5 8  ? -14.197 48.992 24.218  1.00 124.37 ? 11  DT  D N3    1 
ATOM   1851 C C4    . DT  F 5 8  ? -13.150 48.558 25.009  1.00 128.34 ? 11  DT  D C4    1 
ATOM   1852 O O4    . DT  F 5 8  ? -12.913 47.358 25.108  1.00 129.27 ? 11  DT  D O4    1 
ATOM   1853 C C5    . DT  F 5 8  ? -12.404 49.605 25.670  1.00 131.56 ? 11  DT  D C5    1 
ATOM   1854 C C7    . DT  F 5 8  ? -11.252 49.232 26.548  1.00 136.24 ? 11  DT  D C7    1 
ATOM   1855 C C6    . DT  F 5 8  ? -12.782 50.873 25.464  1.00 130.50 ? 11  DT  D C6    1 
ATOM   1856 P P     . DA  F 5 9  ? -15.466 56.345 26.054  1.00 213.05 ? 12  DA  D P     1 
ATOM   1857 O OP1   . DA  F 5 9  ? -15.395 57.805 25.793  1.00 207.76 ? 12  DA  D OP1   1 
ATOM   1858 O OP2   . DA  F 5 9  ? -14.877 55.791 27.300  1.00 216.28 ? 12  DA  D OP2   1 
ATOM   1859 O "O5'" . DA  F 5 9  ? -16.993 55.896 25.975  1.00 147.67 ? 12  DA  D "O5'" 1 
ATOM   1860 C "C5'" . DA  F 5 9  ? -17.949 56.657 25.213  1.00 140.80 ? 12  DA  D "C5'" 1 
ATOM   1861 C "C4'" . DA  F 5 9  ? -19.106 55.778 24.800  1.00 138.83 ? 12  DA  D "C4'" 1 
ATOM   1862 O "O4'" . DA  F 5 9  ? -18.659 54.403 24.719  1.00 138.23 ? 12  DA  D "O4'" 1 
ATOM   1863 C "C3'" . DA  F 5 9  ? -20.285 55.776 25.772  1.00 144.26 ? 12  DA  D "C3'" 1 
ATOM   1864 O "O3'" . DA  F 5 9  ? -21.516 55.624 25.059  1.00 141.04 ? 12  DA  D "O3'" 1 
ATOM   1865 C "C2'" . DA  F 5 9  ? -20.015 54.558 26.636  1.00 148.68 ? 12  DA  D "C2'" 1 
ATOM   1866 C "C1'" . DA  F 5 9  ? -19.366 53.598 25.653  1.00 143.17 ? 12  DA  D "C1'" 1 
ATOM   1867 N N9    . DA  F 5 9  ? -18.410 52.674 26.261  1.00 146.08 ? 12  DA  D N9    1 
ATOM   1868 C C8    . DA  F 5 9  ? -17.497 52.940 27.252  1.00 151.21 ? 12  DA  D C8    1 
ATOM   1869 N N7    . DA  F 5 9  ? -16.771 51.903 27.593  1.00 152.92 ? 12  DA  D N7    1 
ATOM   1870 C C5    . DA  F 5 9  ? -17.236 50.886 26.771  1.00 148.62 ? 12  DA  D C5    1 
ATOM   1871 C C6    . DA  F 5 9  ? -16.873 49.534 26.642  1.00 148.05 ? 12  DA  D C6    1 
ATOM   1872 N N6    . DA  F 5 9  ? -15.918 48.950 27.370  1.00 151.91 ? 12  DA  D N6    1 
ATOM   1873 N N1    . DA  F 5 9  ? -17.533 48.791 25.727  1.00 143.61 ? 12  DA  D N1    1 
ATOM   1874 C C2    . DA  F 5 9  ? -18.491 49.377 24.997  1.00 139.98 ? 12  DA  D C2    1 
ATOM   1875 N N3    . DA  F 5 9  ? -18.921 50.637 25.026  1.00 139.97 ? 12  DA  D N3    1 
ATOM   1876 C C4    . DA  F 5 9  ? -18.245 51.347 25.946  1.00 144.44 ? 12  DA  D C4    1 
ATOM   1877 P P     . DA  F 5 10 ? -22.906 55.638 25.851  1.00 183.29 ? 13  DA  D P     1 
ATOM   1878 O OP1   . DA  F 5 10 ? -23.859 56.487 25.092  1.00 180.04 ? 13  DA  D OP1   1 
ATOM   1879 O OP2   . DA  F 5 10 ? -22.621 55.946 27.275  1.00 190.50 ? 13  DA  D OP2   1 
ATOM   1880 O "O5'" . DA  F 5 10 ? -23.393 54.125 25.749  1.00 166.91 ? 13  DA  D "O5'" 1 
ATOM   1881 C "C5'" . DA  F 5 10 ? -23.837 53.574 24.495  1.00 160.66 ? 13  DA  D "C5'" 1 
ATOM   1882 C "C4'" . DA  F 5 10 ? -24.422 52.197 24.708  1.00 162.12 ? 13  DA  D "C4'" 1 
ATOM   1883 O "O4'" . DA  F 5 10 ? -23.384 51.300 25.171  1.00 163.96 ? 13  DA  D "O4'" 1 
ATOM   1884 C "C3'" . DA  F 5 10 ? -25.530 52.130 25.758  1.00 168.11 ? 13  DA  D "C3'" 1 
ATOM   1885 O "O3'" . DA  F 5 10 ? -26.504 51.149 25.390  1.00 166.71 ? 13  DA  D "O3'" 1 
ATOM   1886 C "C2'" . DA  F 5 10 ? -24.791 51.704 27.012  1.00 174.40 ? 13  DA  D "C2'" 1 
ATOM   1887 C "C1'" . DA  F 5 10 ? -23.709 50.792 26.458  1.00 170.82 ? 13  DA  D "C1'" 1 
ATOM   1888 N N9    . DA  F 5 10 ? -22.482 50.767 27.251  1.00 174.26 ? 13  DA  D N9    1 
ATOM   1889 C C8    . DA  F 5 10 ? -21.855 51.824 27.865  1.00 177.21 ? 13  DA  D C8    1 
ATOM   1890 N N7    . DA  F 5 10 ? -20.764 51.489 28.509  1.00 180.61 ? 13  DA  D N7    1 
ATOM   1891 C C5    . DA  F 5 10 ? -20.664 50.119 28.307  1.00 179.54 ? 13  DA  D C5    1 
ATOM   1892 C C6    . DA  F 5 10 ? -19.723 49.166 28.733  1.00 182.20 ? 13  DA  D C6    1 
ATOM   1893 N N6    . DA  F 5 10 ? -18.658 49.460 29.483  1.00 186.75 ? 13  DA  D N6    1 
ATOM   1894 N N1    . DA  F 5 10 ? -19.916 47.883 28.358  1.00 180.00 ? 13  DA  D N1    1 
ATOM   1895 C C2    . DA  F 5 10 ? -20.984 47.589 27.606  1.00 176.01 ? 13  DA  D C2    1 
ATOM   1896 N N3    . DA  F 5 10 ? -21.937 48.395 27.143  1.00 173.60 ? 13  DA  D N3    1 
ATOM   1897 C C4    . DA  F 5 10 ? -21.716 49.662 27.534  1.00 175.55 ? 13  DA  D C4    1 
HETATM 1898 O O     . HOH G 6 .  ? 2.087   7.231  -3.303  1.00 48.90  ? 101 HOH B O     1 
HETATM 1899 O O     . HOH G 6 .  ? -17.793 18.175 7.126   1.00 17.85  ? 102 HOH B O     1 
HETATM 1900 O O     . HOH G 6 .  ? -0.506  9.237  -6.498  1.00 12.93  ? 103 HOH B O     1 
HETATM 1901 O O     . HOH G 6 .  ? -0.243  11.214 20.700  1.00 11.79  ? 104 HOH B O     1 
HETATM 1902 O O     . HOH G 6 .  ? -3.337  29.398 -4.865  1.00 23.03  ? 105 HOH B O     1 
HETATM 1903 O O     . HOH G 6 .  ? -13.110 19.230 12.403  1.00 8.22   ? 106 HOH B O     1 
HETATM 1904 O O     . HOH G 6 .  ? 3.880   7.907  -5.463  1.00 19.67  ? 107 HOH B O     1 
HETATM 1905 O O     . HOH G 6 .  ? -19.156 12.546 14.377  1.00 53.91  ? 108 HOH B O     1 
HETATM 1906 O O     . HOH G 6 .  ? -18.720 13.577 18.402  1.00 1.54   ? 110 HOH B O     1 
HETATM 1907 O O     . HOH H 6 .  ? 2.045   32.653 14.148  1.00 1.89   ? 101 HOH L O     1 
HETATM 1908 O O     . HOH H 6 .  ? 8.959   35.993 15.838  1.00 26.20  ? 102 HOH L O     1 
HETATM 1909 O O     . HOH I 6 .  ? 6.377   10.274 1.926   1.00 20.92  ? 101 HOH M O     1 
HETATM 1910 O O     . HOH I 6 .  ? -9.228  28.528 37.981  1.00 32.13  ? 102 HOH M O     1 
HETATM 1911 O O     . HOH I 6 .  ? 0.224   35.938 24.175  1.00 6.05   ? 103 HOH M O     1 
HETATM 1912 O O     . HOH I 6 .  ? 3.091   33.326 17.357  1.00 40.01  ? 104 HOH M O     1 
HETATM 1913 O O     . HOH I 6 .  ? 10.221  33.497 21.267  1.00 5.01   ? 105 HOH M O     1 
HETATM 1914 O O     . HOH I 6 .  ? 5.835   35.463 20.366  1.00 20.87  ? 106 HOH M O     1 
HETATM 1915 O O     . HOH I 6 .  ? -13.064 29.932 29.568  1.00 16.58  ? 107 HOH M O     1 
HETATM 1916 O O     . HOH I 6 .  ? -18.188 12.894 23.685  1.00 6.31   ? 108 HOH M O     1 
HETATM 1917 O O     . HOH J 6 .  ? -29.698 56.313 3.436   1.00 14.23  ? 101 HOH A O     1 
HETATM 1918 O O     . HOH J 6 .  ? -22.664 54.435 10.182  1.00 37.73  ? 102 HOH A O     1 
HETATM 1919 O O     . HOH J 6 .  ? -21.769 31.534 3.628   1.00 6.40   ? 103 HOH A O     1 
HETATM 1920 O O     . HOH J 6 .  ? -22.091 36.897 -9.700  1.00 42.29  ? 104 HOH A O     1 
HETATM 1921 O O     . HOH J 6 .  ? -30.015 37.595 2.062   1.00 13.40  ? 105 HOH A O     1 
HETATM 1922 O O     . HOH J 6 .  ? -26.615 49.852 16.845  1.00 11.26  ? 106 HOH A O     1 
HETATM 1923 O O     . HOH J 6 .  ? -30.958 35.316 0.948   1.00 3.50   ? 107 HOH A O     1 
HETATM 1924 O O     . HOH J 6 .  ? -37.327 37.684 17.370  1.00 40.39  ? 108 HOH A O     1 
HETATM 1925 O O     . HOH J 6 .  ? -22.650 30.714 22.709  1.00 19.30  ? 109 HOH A O     1 
HETATM 1926 O O     . HOH K 6 .  ? -26.677 37.748 36.972  1.00 22.59  ? 101 HOH C O     1 
HETATM 1927 O O     . HOH K 6 .  ? -26.388 45.165 17.909  1.00 15.19  ? 102 HOH C O     1 
HETATM 1928 O O     . HOH K 6 .  ? -14.838 28.805 37.975  1.00 21.00  ? 103 HOH C O     1 
HETATM 1929 O O     . HOH L 6 .  ? -4.554  37.387 7.244   1.00 39.55  ? 101 HOH D O     1 
HETATM 1930 O O     . HOH L 6 .  ? -1.942  41.177 13.122  1.00 8.85   ? 102 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PHE 1  5  5  PHE PHE B . n 
A 1 2  PRO 2  6  6  PRO PRO B . n 
A 1 3  LYS 3  7  7  LYS LYS B . n 
A 1 4  VAL 4  8  8  VAL VAL B . n 
A 1 5  ALA 5  9  9  ALA ALA B . n 
A 1 6  THR 6  10 10 THR THR B . n 
A 1 7  ASN 7  11 11 ASN ASN B . n 
A 1 8  ILE 8  12 12 ILE ILE B . n 
A 1 9  MET 9  13 13 MET MET B . n 
A 1 10 ARG 10 14 14 ARG ARG B . n 
A 1 11 ALA 11 15 15 ALA ALA B . n 
A 1 12 TRP 12 16 16 TRP TRP B . n 
A 1 13 LEU 13 17 17 LEU LEU B . n 
A 1 14 PHE 14 18 18 PHE PHE B . n 
A 1 15 GLN 15 19 19 GLN GLN B . n 
A 1 16 HIS 16 20 20 HIS HIS B . n 
A 1 17 LEU 17 21 21 LEU LEU B . n 
A 1 18 THR 18 22 22 THR THR B . n 
A 1 19 HIS 19 23 23 HIS HIS B . n 
A 1 20 PRO 20 24 24 PRO PRO B . n 
A 1 21 TYR 21 25 25 TYR TYR B . n 
A 1 22 PRO 22 26 26 PRO PRO B . n 
A 1 23 SER 23 27 27 SER SER B . n 
A 1 24 GLU 24 28 28 GLU GLU B . n 
A 1 25 GLU 25 29 29 GLU GLU B . n 
A 1 26 GLN 26 30 30 GLN GLN B . n 
A 1 27 LYS 27 31 31 LYS LYS B . n 
A 1 28 LYS 28 32 32 LYS LYS B . n 
A 1 29 GLN 29 33 33 GLN GLN B . n 
A 1 30 LEU 30 34 34 LEU LEU B . n 
A 1 31 ALA 31 35 35 ALA ALA B . n 
A 1 32 GLN 32 36 36 GLN GLN B . n 
A 1 33 ASP 33 37 37 ASP ASP B . n 
A 1 34 THR 34 38 38 THR THR B . n 
A 1 35 GLY 35 39 39 GLY GLY B . n 
A 1 36 LEU 36 40 40 LEU LEU B . n 
A 1 37 THR 37 41 41 THR THR B . n 
A 1 38 ILE 38 42 42 ILE ILE B . n 
A 1 39 LEU 39 43 43 LEU LEU B . n 
A 1 40 GLN 40 44 44 GLN GLN B . n 
A 1 41 VAL 41 45 45 VAL VAL B . n 
A 1 42 ASN 42 46 46 ASN ASN B . n 
A 1 43 ASN 43 47 47 ASN ASN B . n 
A 1 44 TRP 44 48 48 TRP TRP B . n 
A 1 45 PHE 45 49 49 PHE PHE B . n 
A 1 46 ILE 46 50 50 ILE ILE B . n 
A 1 47 ASN 47 51 51 ASN ASN B . n 
A 1 48 ALA 48 52 52 ALA ALA B . n 
A 1 49 ARG 49 53 53 ARG ARG B . n 
A 1 50 ARG 50 54 54 ARG ARG B . n 
A 1 51 ARG 51 55 55 ARG ARG B . n 
A 1 52 ILE 52 56 56 ILE ILE B . n 
A 1 53 VAL 53 57 57 VAL VAL B . n 
A 1 54 GLN 54 58 58 GLN GLN B . n 
A 1 55 PRO 55 59 59 PRO PRO B . n 
A 1 56 MET 56 60 60 MET MET B . n 
A 1 57 ILE 57 61 61 ILE ILE B . n 
A 1 58 ASP 58 62 62 ASP ASP B . n 
A 1 59 GLN 59 63 63 GLN GLN B . n 
A 1 60 SER 60 64 64 SER SER B . n 
B 2 1  DT  1  26 26 DT  DT  L . n 
B 2 2  DT  2  27 27 DT  DT  L . n 
B 2 3  DA  3  28 28 DA  DA  L . n 
B 2 4  DG  4  29 29 DG  DG  L . n 
B 2 5  DC  5  30 30 DC  DC  L . n 
B 2 6  DT  6  31 31 DT  DT  L . n 
B 2 7  DG  7  32 32 DG  DG  L . n 
B 2 8  DT  8  33 33 DT  DT  L . n 
B 2 9  DC  9  34 34 DC  DC  L . n 
B 2 10 DA  10 35 35 DA  DA  L . n 
C 3 1  DT  1  4  4  DT  DT  M . n 
C 3 2  DG  2  5  5  DG  DG  M . n 
C 3 3  DA  3  6  6  DA  DA  M . n 
C 3 4  DC  4  7  7  DC  DC  M . n 
C 3 5  DA  5  8  8  DA  DA  M . n 
C 3 6  DG  6  9  9  DG  DG  M . n 
C 3 7  DC  7  10 10 DC  DC  M . n 
C 3 8  DT  8  11 11 DT  DT  M . n 
C 3 9  DA  9  12 12 DA  DA  M . n 
C 3 10 DA  10 13 13 DA  DA  M . n 
C 3 11 DC  11 15 15 DC  DC  M . n 
C 3 12 DG  12 16 16 DG  DG  M . n 
D 1 1  PHE 1  5  ?  ?   ?   A . n 
D 1 2  PRO 2  6  6  PRO PRO A . n 
D 1 3  LYS 3  7  7  LYS LYS A . n 
D 1 4  VAL 4  8  8  VAL VAL A . n 
D 1 5  ALA 5  9  9  ALA ALA A . n 
D 1 6  THR 6  10 10 THR THR A . n 
D 1 7  ASN 7  11 11 ASN ASN A . n 
D 1 8  ILE 8  12 12 ILE ILE A . n 
D 1 9  MET 9  13 13 MET MET A . n 
D 1 10 ARG 10 14 14 ARG ARG A . n 
D 1 11 ALA 11 15 15 ALA ALA A . n 
D 1 12 TRP 12 16 16 TRP TRP A . n 
D 1 13 LEU 13 17 17 LEU LEU A . n 
D 1 14 PHE 14 18 18 PHE PHE A . n 
D 1 15 GLN 15 19 19 GLN GLN A . n 
D 1 16 HIS 16 20 20 HIS HIS A . n 
D 1 17 LEU 17 21 21 LEU LEU A . n 
D 1 18 THR 18 22 22 THR THR A . n 
D 1 19 HIS 19 23 23 HIS HIS A . n 
D 1 20 PRO 20 24 24 PRO PRO A . n 
D 1 21 TYR 21 25 25 TYR TYR A . n 
D 1 22 PRO 22 26 26 PRO PRO A . n 
D 1 23 SER 23 27 27 SER SER A . n 
D 1 24 GLU 24 28 28 GLU GLU A . n 
D 1 25 GLU 25 29 29 GLU GLU A . n 
D 1 26 GLN 26 30 30 GLN GLN A . n 
D 1 27 LYS 27 31 31 LYS LYS A . n 
D 1 28 LYS 28 32 32 LYS LYS A . n 
D 1 29 GLN 29 33 33 GLN GLN A . n 
D 1 30 LEU 30 34 34 LEU LEU A . n 
D 1 31 ALA 31 35 35 ALA ALA A . n 
D 1 32 GLN 32 36 36 GLN GLN A . n 
D 1 33 ASP 33 37 37 ASP ASP A . n 
D 1 34 THR 34 38 38 THR THR A . n 
D 1 35 GLY 35 39 39 GLY GLY A . n 
D 1 36 LEU 36 40 40 LEU LEU A . n 
D 1 37 THR 37 41 41 THR THR A . n 
D 1 38 ILE 38 42 42 ILE ILE A . n 
D 1 39 LEU 39 43 43 LEU LEU A . n 
D 1 40 GLN 40 44 44 GLN GLN A . n 
D 1 41 VAL 41 45 45 VAL VAL A . n 
D 1 42 ASN 42 46 46 ASN ASN A . n 
D 1 43 ASN 43 47 47 ASN ASN A . n 
D 1 44 TRP 44 48 48 TRP TRP A . n 
D 1 45 PHE 45 49 49 PHE PHE A . n 
D 1 46 ILE 46 50 50 ILE ILE A . n 
D 1 47 ASN 47 51 51 ASN ASN A . n 
D 1 48 ALA 48 52 52 ALA ALA A . n 
D 1 49 ARG 49 53 53 ARG ARG A . n 
D 1 50 ARG 50 54 54 ARG ARG A . n 
D 1 51 ARG 51 55 55 ARG ARG A . n 
D 1 52 ILE 52 56 56 ILE ILE A . n 
D 1 53 VAL 53 57 57 VAL VAL A . n 
D 1 54 GLN 54 58 58 GLN GLN A . n 
D 1 55 PRO 55 59 59 PRO PRO A . n 
D 1 56 MET 56 60 60 MET MET A . n 
D 1 57 ILE 57 61 61 ILE ILE A . n 
D 1 58 ASP 58 62 62 ASP ASP A . n 
D 1 59 GLN 59 63 63 GLN GLN A . n 
D 1 60 SER 60 64 64 SER SER A . n 
E 4 1  DG  1  24 24 DG  DG  C . n 
E 4 2  DA  2  25 25 DA  DA  C . n 
E 4 3  DT  3  26 26 DT  DT  C . n 
E 4 4  DT  4  27 27 DT  DT  C . n 
E 4 5  DA  5  28 28 DA  DA  C . n 
E 4 6  DG  6  29 29 DG  DG  C . n 
E 4 7  DC  7  30 30 DC  DC  C . n 
E 4 8  DT  8  31 31 DT  DT  C . n 
E 4 9  DG  9  32 32 DG  DG  C . n 
E 4 10 DT  10 33 33 DT  DT  C . n 
E 4 11 DC  11 34 34 DC  DC  C . n 
E 4 12 DA  12 35 35 DA  DA  C . n 
F 5 1  DT  1  4  4  DT  DT  D . n 
F 5 2  DG  2  5  5  DG  DG  D . n 
F 5 3  DA  3  6  6  DA  DA  D . n 
F 5 4  DC  4  7  7  DC  DC  D . n 
F 5 5  DA  5  8  8  DA  DA  D . n 
F 5 6  DG  6  9  9  DG  DG  D . n 
F 5 7  DC  7  10 10 DC  DC  D . n 
F 5 8  DT  8  11 11 DT  DT  D . n 
F 5 9  DA  9  12 12 DA  DA  D . n 
F 5 10 DA  10 13 13 DA  DA  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 6 HOH 1 101 63 HOH HOH B . 
G 6 HOH 2 102 24 HOH HOH B . 
G 6 HOH 3 103 36 HOH HOH B . 
G 6 HOH 4 104 27 HOH HOH B . 
G 6 HOH 5 105 35 HOH HOH B . 
G 6 HOH 6 106 37 HOH HOH B . 
G 6 HOH 7 107 64 HOH HOH B . 
G 6 HOH 8 108 21 HOH HOH B . 
G 6 HOH 9 110 20 HOH HOH B . 
H 6 HOH 1 101 58 HOH HOH L . 
H 6 HOH 2 102 78 HOH HOH L . 
I 6 HOH 1 101 49 HOH HOH M . 
I 6 HOH 2 102 71 HOH HOH M . 
I 6 HOH 3 103 16 HOH HOH M . 
I 6 HOH 4 104 75 HOH HOH M . 
I 6 HOH 5 105 57 HOH HOH M . 
I 6 HOH 6 106 77 HOH HOH M . 
I 6 HOH 7 107 13 HOH HOH M . 
I 6 HOH 8 108 17 HOH HOH M . 
J 6 HOH 1 101 74 HOH HOH A . 
J 6 HOH 2 102 76 HOH HOH A . 
J 6 HOH 3 103 73 HOH HOH A . 
J 6 HOH 4 104 26 HOH HOH A . 
J 6 HOH 5 105 29 HOH HOH A . 
J 6 HOH 6 106 68 HOH HOH A . 
J 6 HOH 7 107 65 HOH HOH A . 
J 6 HOH 8 108 34 HOH HOH A . 
J 6 HOH 9 109 6  HOH HOH A . 
K 6 HOH 1 101 10 HOH HOH C . 
K 6 HOH 2 102 66 HOH HOH C . 
K 6 HOH 3 103 72 HOH HOH C . 
L 6 HOH 1 101 38 HOH HOH D . 
L 6 HOH 2 102 1  HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA trimeric 3 
2 software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,H,I 
2 1 D,E,F,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2230 ? 
1 MORE         -13  ? 
1 'SSA (A^2)'  7960 ? 
2 'ABSA (A^2)' 2130 ? 
2 MORE         -12  ? 
2 'SSA (A^2)'  7990 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-11-04 
2 'Structure model' 1 1 2015-11-18 
3 'Structure model' 1 2 2015-12-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined -4.7792  11.7004 6.2853  0.5081 ? 0.0019  ? -0.0723 ? 0.2111 ? -0.0627 ? 0.3263 ? 1.5181 ? -0.8288 
? 0.0415  ? 0.6699 ? 0.1217  ? 0.1253 ? -0.3678 ? -0.4227 ? -0.2138 ? -0.1626 ? 0.6565  ? 0.0800  ? -0.1493 ? 0.1063  ? 0.1923  ? 
2 'X-RAY DIFFRACTION' ? refined -22.0355 42.5940 6.7413  0.4851 ? 0.0301  ? -0.1355 ? 0.6792 ? -0.0357 ? 0.6893 ? 2.0149 ? -0.0259 
? -0.1718 ? 1.7139 ? -0.8544 ? 0.9997 ? 0.0360  ? 1.3307  ? -0.5318 ? 0.3448  ? -0.0307 ? -0.1262 ? -0.1934 ? 0.1738  ? -0.0428 ? 
3 'X-RAY DIFFRACTION' ? refined 2.4454   22.4079 15.3042 0.5153 ? 0.0412  ? -0.0728 ? 0.6669 ? -0.0515 ? 0.5003 ? 2.5952 ? -0.1583 
? 0.9119  ? 1.3379 ? 0.0940  ? 0.3107 ? -0.1198 ? 0.2697  ? 0.9974  ? -0.2111 ? -0.3328 ? 0.0377  ? 0.2999  ? 0.7241  ? -0.4903 ? 
4 'X-RAY DIFFRACTION' ? refined 2.6484   22.0833 16.1472 0.9110 ? -0.1765 ? -0.0018 ? 1.3283 ? -0.3871 ? 1.2112 ? 0.1015 ? -0.2333 
? 0.1398  ? 0.4820 ? -0.2682 ? 0.1074 ? -0.1219 ? -0.2085 ? 1.8649  ? 0.8126  ? 0.5769  ? -1.1832 ? 0.5856  ? -0.5832 ? 0.0094  ? 
5 'X-RAY DIFFRACTION' ? refined -11.0341 46.1383 16.5672 0.7026 ? 0.0601  ? -0.0549 ? 0.7697 ? 0.0318  ? 0.4281 ? 4.3426 ? -1.6865 
? -0.9816 ? 0.6305 ? 0.8049  ? 2.3150 ? 0.8927  ? -1.9384 ? 0.0825  ? 0.0364  ? 0.2548  ? -0.0796 ? -0.1131 ? -0.1169 ? 1.6924  ? 
6 'X-RAY DIFFRACTION' ? refined -10.9388 45.6975 17.1356 1.1217 ? -0.5919 ? -0.0462 ? 1.2501 ? -0.0675 ? 0.6933 ? 1.8579 ? -1.0905 
? -0.3432 ? 0.8233 ? -0.0926 ? 0.5447 ? -0.3543 ? -1.5593 ? -0.2442 ? 0.6324  ? 0.0833  ? -0.4350 ? -0.0885 ? -0.4260 ? 0.0206  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 5 through 64 )
;
2 'X-RAY DIFFRACTION' 2 ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 6 through 64 )
;
3 'X-RAY DIFFRACTION' 3 ? ? L 0 ? ? L 0 ? 
;chain 'L' and (resid 26 through 35 )
;
4 'X-RAY DIFFRACTION' 4 ? ? M 0 ? ? M 0 ? 
;chain 'M' and (resid 4 through 13 )
;
5 'X-RAY DIFFRACTION' 5 ? ? C 0 ? ? C 0 ? 
;chain 'C' and (resid 26 through 35 )
;
6 'X-RAY DIFFRACTION' 6 ? ? D 0 ? ? D 0 ? 
;chain 'D' and (resid 4 through 13 )
;
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? .    2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .    3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    4 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" M DC 15 ? ? "C1'" M DC 15 ? ? N1 M DC 15 ? ? 112.02 108.30 3.72 0.30 N 
2 1 "O4'" C DA 25 ? ? "C1'" C DA 25 ? ? N9 C DA 25 ? ? 110.36 108.30 2.06 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS B 20 ? ? -144.92 56.10   
2  1 PRO B 24 ? ? -77.27  20.14   
3  1 LYS A 7  ? ? -82.01  -79.84  
4  1 HIS A 23 ? ? -160.87 68.63   
5  1 SER A 27 ? ? -75.97  -146.99 
6  1 ALA A 35 ? ? -95.86  -73.38  
7  1 ASP A 37 ? ? 87.73   -107.11 
8  1 LEU A 40 ? ? 68.84   114.92  
9  1 THR A 41 ? ? -173.26 77.19   
10 1 ARG A 54 ? ? -79.06  20.93   
11 1 ARG A 55 ? ? -141.95 -26.56  
12 1 VAL A 57 ? ? -91.56  -66.15  
13 1 GLN A 63 ? ? 52.22   -90.23  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    37 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   THR 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    38 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -142.93 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   "O3'" 
_pdbx_validate_polymer_linkage.auth_asym_id_1   M 
_pdbx_validate_polymer_linkage.auth_comp_id_1   DA 
_pdbx_validate_polymer_linkage.auth_seq_id_1    13 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   P 
_pdbx_validate_polymer_linkage.auth_asym_id_2   M 
_pdbx_validate_polymer_linkage.auth_comp_id_2   DC 
_pdbx_validate_polymer_linkage.auth_seq_id_2    15 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             15.81 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? B HOH 109 ? 7.54  . 
2 1 O ? B HOH 110 ? 8.11  . 
3 1 O ? L HOH 102 ? 7.05  . 
4 1 O ? M HOH 107 ? 6.55  . 
5 1 O ? M HOH 108 ? 10.73 . 
6 1 O ? A HOH 107 ? 5.98  . 
7 1 O ? A HOH 108 ? 7.57  . 
8 1 O ? A HOH 109 ? 7.62  . 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     PHE 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      5 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    D 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    PHE 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5BNG 'double helix'        
5BNG 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 2  1_555 C DA 9  1_555 -0.311 -0.159 0.708  -10.865 -16.750 -1.858  1  L_DT27:DA12_M L 27 ? M 12 ? 20 1 
1 B DA 3  1_555 C DT 8  1_555 -0.655 -0.156 0.696  2.426   -4.880  -5.175  2  L_DA28:DT11_M L 28 ? M 11 ? 20 1 
1 B DG 4  1_555 C DC 7  1_555 0.588  0.545  0.382  8.011   -6.075  3.073   3  L_DG29:DC10_M L 29 ? M 10 ? ?  ? 
1 B DC 5  1_555 C DG 6  1_555 0.817  0.085  -0.020 -0.511  -1.266  2.817   4  L_DC30:DG9_M  L 30 ? M 9  ? 19 1 
1 B DT 6  1_555 C DA 5  1_555 0.121  0.344  0.421  -15.661 -11.894 -8.723  5  L_DT31:DA8_M  L 31 ? M 8  ? 20 1 
1 B DG 7  1_555 C DC 4  1_555 -0.927 0.650  -0.115 -21.251 -5.772  7.736   6  L_DG32:DC7_M  L 32 ? M 7  ? ?  ? 
1 B DT 8  1_555 C DA 3  1_555 0.949  -0.173 0.883  10.296  -10.354 8.822   7  L_DT33:DA6_M  L 33 ? M 6  ? ?  1 
1 B DC 9  1_555 C DG 2  1_555 0.374  -0.152 0.174  14.658  -9.992  -4.966  8  L_DC34:DG5_M  L 34 ? M 5  ? 19 1 
1 B DA 10 1_555 C DT 1  1_555 0.427  0.664  0.225  34.429  -6.896  10.215  9  L_DA35:DT4_M  L 35 ? M 4  ? ?  ? 
1 E DT 3  1_555 F DA 10 1_555 -1.000 0.136  0.727  -31.344 -9.927  0.843   10 C_DT26:DA13_D C 26 ? D 13 ? 20 1 
1 E DT 4  1_555 F DA 9  1_555 -1.027 -0.318 -0.144 -19.180 -21.394 -13.366 11 C_DT27:DA12_D C 27 ? D 12 ? 20 1 
1 E DG 6  1_555 F DC 7  1_555 0.398  0.139  0.257  6.334   -6.994  1.395   12 C_DG29:DC10_D C 29 ? D 10 ? 19 1 
1 E DC 7  1_555 F DG 6  1_555 -0.182 -0.134 -0.233 -0.484  -6.922  -4.495  13 C_DC30:DG9_D  C 30 ? D 9  ? 19 1 
1 E DT 8  1_555 F DA 5  1_555 -0.353 -0.079 0.760  -22.968 -6.438  -11.723 14 C_DT31:DA8_D  C 31 ? D 8  ? 20 1 
1 E DG 9  1_555 F DC 4  1_555 -0.742 -0.328 0.185  -4.727  -3.741  -6.815  15 C_DG32:DC7_D  C 32 ? D 7  ? 19 1 
1 E DC 11 1_555 F DG 2  1_555 0.015  -0.171 1.109  -1.274  1.713   -6.353  16 C_DC34:DG5_D  C 34 ? D 5  ? 19 1 
1 E DA 12 1_555 F DT 1  1_555 1.569  0.382  0.682  14.809  -11.293 18.535  17 C_DA35:DT4_D  C 35 ? D 4  ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 2  1_555 C DA 9  1_555 B DA 3  1_555 C DT 8 1_555 -0.224 0.395  2.845 -4.728 -0.577 38.787 0.652  -0.162 2.846 -0.864 7.086 
39.067 1  LL_DT27DA28:DT11DA12_MM L 27 ? M 12 ? L 28 ? M 11 ? 
1 B DA 3  1_555 C DT 8  1_555 B DG 4  1_555 C DC 7 1_555 0.865  -0.688 3.218 3.224  -0.811 35.372 -1.009 -0.948 3.295 -1.330 
-5.292  35.523 2  LL_DA28DG29:DC10DT11_MM L 28 ? M 11 ? L 29 ? M 10 ? 
1 B DG 4  1_555 C DC 7  1_555 B DC 5  1_555 C DG 6 1_555 -0.124 -0.418 3.460 2.356  5.150  38.526 -1.282 0.485  3.366 7.755  
-3.547  38.925 3  LL_DG29DC30:DG9DC10_MM  L 29 ? M 10 ? L 30 ? M 9  ? 
1 B DC 5  1_555 C DG 6  1_555 B DT 6  1_555 C DA 5 1_555 -0.878 -0.988 3.682 -0.723 3.328  30.655 -2.578 1.493  3.576 6.270  1.363 
30.839 4  LL_DC30DT31:DA8DG9_MM   L 30 ? M 9  ? L 31 ? M 8  ? 
1 B DT 6  1_555 C DA 5  1_555 B DG 7  1_555 C DC 4 1_555 1.513  0.199  3.391 5.041  5.289  33.473 -0.557 -1.717 3.564 9.049  
-8.624  34.239 5  LL_DT31DG32:DC7DA8_MM   L 31 ? M 8  ? L 32 ? M 7  ? 
1 B DG 7  1_555 C DC 4  1_555 B DT 8  1_555 C DA 3 1_555 0.136  -0.142 2.484 -8.982 11.440 32.027 -1.521 -1.235 2.194 19.526 
15.330  35.096 6  LL_DG32DT33:DA6DC7_MM   L 32 ? M 7  ? L 33 ? M 6  ? 
1 B DT 8  1_555 C DA 3  1_555 B DC 9  1_555 C DG 2 1_555 -1.207 -0.302 3.176 0.334  -1.724 33.718 -0.248 2.131  3.175 -2.969 
-0.575  33.762 7  LL_DT33DC34:DG5DA6_MM   L 33 ? M 6  ? L 34 ? M 5  ? 
1 B DC 9  1_555 C DG 2  1_555 B DA 10 1_555 C DT 1 1_555 1.038  0.843  2.946 5.896  -2.748 37.206 1.629  -0.906 3.002 -4.266 
-9.156  37.751 8  LL_DC34DA35:DT4DG5_MM   L 34 ? M 5  ? L 35 ? M 4  ? 
1 E DT 3  1_555 F DA 10 1_555 E DT 4  1_555 F DA 9 1_555 0.320  -0.899 3.078 11.440 0.006  30.719 -1.596 1.329  3.003 0.011  
-20.715 32.732 9  CC_DT26DT27:DA12DA13_DD C 26 ? D 13 ? C 27 ? D 12 ? 
1 E DT 4  1_555 F DA 9  1_555 E DG 6  1_555 F DC 7 1_555 1.601  0.910  6.132 -6.328 2.135  77.549 0.612  -1.607 6.027 1.701  5.043 
77.791 10 CC_DT27DG29:DC10DA12_DD C 27 ? D 12 ? C 29 ? D 10 ? 
1 E DG 6  1_555 F DC 7  1_555 E DC 7  1_555 F DG 6 1_555 -0.343 -0.842 3.348 2.933  3.548  35.317 -1.896 0.991  3.213 5.817  
-4.809  35.607 11 CC_DG29DC30:DG9DC10_DD  C 29 ? D 10 ? C 30 ? D 9  ? 
1 E DC 7  1_555 F DG 6  1_555 E DT 8  1_555 F DA 5 1_555 -0.086 -1.021 4.065 -2.063 -0.078 33.792 -1.738 -0.266 4.065 -0.134 3.545 
33.853 12 CC_DC30DT31:DA8DG9_DD   C 30 ? D 9  ? C 31 ? D 8  ? 
1 E DT 8  1_555 F DA 5  1_555 E DG 9  1_555 F DC 4 1_555 0.984  0.239  2.792 6.869  3.375  35.295 -0.037 -0.728 2.935 5.487  
-11.167 36.090 13 CC_DT31DG32:DC7DA8_DD   C 31 ? D 8  ? C 32 ? D 7  ? 
1 E DG 9  1_555 F DC 4  1_555 E DC 11 1_555 F DG 2 1_555 0.400  -2.112 6.546 -6.443 9.698  65.774 -2.672 -0.862 6.160 8.858  5.885 
66.683 14 CC_DG32DC34:DG5DC7_DD   C 32 ? D 7  ? C 34 ? D 5  ? 
1 E DC 11 1_555 F DG 2  1_555 E DA 12 1_555 F DT 1 1_555 1.620  0.250  3.111 5.144  -1.062 39.824 0.482  -1.786 3.279 -1.551 
-7.512  40.155 15 CC_DC34DA35:DT4DG5_DD   C 34 ? D 5  ? C 35 ? D 4  ? 
# 
_pdbx_entity_nonpoly.entity_id   6 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#