data_5C5A
# 
_entry.id   5C5A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5C5A         
WWPDB D_1000210771 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5C5A 
_pdbx_database_status.recvd_initial_deposition_date   2015-06-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Orts, J.'      1 
'Waelti, M.A.'  2 
'Marsh, M.'     3 
'Vera, L.'      4 
'Gossert, A.D.' 5 
'Guentert, P.'  6 
'Riek, R.'      7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'NMR Molecular Replacement, NMR2' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Orts, J.'      1 
primary 'Waelti, M.A.'  2 
primary 'Marsh, M.'     3 
primary 'Vera, L.'      4 
primary 'Gossert, A.D.' 5 
primary 'Guentert, P.'  6 
primary 'Riek, R.'      7 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.04 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5C5A 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     41.620 
_cell.length_a_esd                 ? 
_cell.length_b                     43.630 
_cell.length_b_esd                 ? 
_cell.length_c                     52.670 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5C5A 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'E3 ubiquitin-protein ligase Mdm2' 10770.636 2   6.3.2.- ? ? ? 
2 non-polymer syn 
'4-({(4S,5R)-4,5-bis(4-chlorophenyl)-2-[4-methoxy-2-(propan-2-yloxy)phenyl]-4,5-dihydro-1H-imidazol-1-yl}carbonyl)piperazin-2-one' 
581.490   2   ?       ? ? ? 
3 non-polymer syn 'SULFATE ION' 96.063    2   ?       ? ? ? 
4 non-polymer syn 'CHLORIDE ION' 35.453    2   ?       ? ? ? 
5 non-polymer syn 'IODIDE ION' 126.904   4   ?       ? ? ? 
6 water       nat water 18.015    172 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Double minute 2 protein,Hdm2,Oncoprotein Mdm2,p53-binding protein Mdm2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKI
YTMIYRNLVVVN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKI
YTMIYRNLVVVN
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  ALA n 
1 3  SER n 
1 4  GLU n 
1 5  GLN n 
1 6  GLU n 
1 7  THR n 
1 8  LEU n 
1 9  VAL n 
1 10 ARG n 
1 11 PRO n 
1 12 LYS n 
1 13 PRO n 
1 14 LEU n 
1 15 LEU n 
1 16 LEU n 
1 17 LYS n 
1 18 LEU n 
1 19 LEU n 
1 20 LYS n 
1 21 SER n 
1 22 VAL n 
1 23 GLY n 
1 24 ALA n 
1 25 GLN n 
1 26 LYS n 
1 27 ASP n 
1 28 THR n 
1 29 TYR n 
1 30 THR n 
1 31 MET n 
1 32 LYS n 
1 33 GLU n 
1 34 VAL n 
1 35 LEU n 
1 36 PHE n 
1 37 TYR n 
1 38 LEU n 
1 39 GLY n 
1 40 GLN n 
1 41 TYR n 
1 42 ILE n 
1 43 MET n 
1 44 THR n 
1 45 LYS n 
1 46 ARG n 
1 47 LEU n 
1 48 TYR n 
1 49 ASP n 
1 50 GLU n 
1 51 LYS n 
1 52 GLN n 
1 53 GLN n 
1 54 HIS n 
1 55 ILE n 
1 56 VAL n 
1 57 TYR n 
1 58 CYS n 
1 59 SER n 
1 60 ASN n 
1 61 ASP n 
1 62 LEU n 
1 63 LEU n 
1 64 GLY n 
1 65 ASP n 
1 66 LEU n 
1 67 PHE n 
1 68 GLY n 
1 69 VAL n 
1 70 PRO n 
1 71 SER n 
1 72 PHE n 
1 73 SER n 
1 74 VAL n 
1 75 LYS n 
1 76 GLU n 
1 77 HIS n 
1 78 ARG n 
1 79 LYS n 
1 80 ILE n 
1 81 TYR n 
1 82 THR n 
1 83 MET n 
1 84 ILE n 
1 85 TYR n 
1 86 ARG n 
1 87 ASN n 
1 88 LEU n 
1 89 VAL n 
1 90 VAL n 
1 91 VAL n 
1 92 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   92 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 MDM2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MDM2_HUMAN 
_struct_ref.pdbx_db_accession          Q00987 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKI
YTMIYRNLVVVN
;
_struct_ref.pdbx_align_begin           20 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5C5A A 1 ? 92 ? Q00987 20 ? 111 ? 20 111 
2 1 5C5A B 1 ? 92 ? Q00987 20 ? 111 ? 20 111 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?           'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ?           'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ?           'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?           'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION' ?           'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE ?           'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE ?           'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?           'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ?           'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ?           'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ?           'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?           'C6 H13 N O2'       131.173 
IOD non-polymer         . 'IODIDE ION' ?           'I -1'              126.904 
LEU 'L-peptide linking' y LEUCINE ?           'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ?           'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ?           'C5 H11 N O2 S'     149.211 
NUT non-polymer         . 
'4-({(4S,5R)-4,5-bis(4-chlorophenyl)-2-[4-methoxy-2-(propan-2-yloxy)phenyl]-4,5-dihydro-1H-imidazol-1-yl}carbonyl)piperazin-2-one' 
'Nutlin 3a' 'C30 H30 Cl2 N4 O4' 581.490 
PHE 'L-peptide linking' y PHENYLALANINE ?           'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ?           'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ?           'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION' ?           'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE ?           'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE ?           'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ?           'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5C5A 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.19 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         43.9 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2M Potassium iodide, 2.2M Ammonium Sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5C5A 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.146 
_reflns.d_resolution_low                 41.62 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       53751 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             79.13 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.9 
_reflns.pdbx_Rmerge_I_obs                0.06794 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.58 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.146 
_reflns_shell.d_res_low                   1.187 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        12.95 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5C5A 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.146 
_refine.ls_d_res_low                             41.620 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     53749 
_refine.ls_number_reflns_R_free                  3521 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    69.83 
_refine.ls_percent_reflns_R_free                 3.78 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1537 
_refine.ls_R_factor_R_free                       0.1683 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1531 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.05 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4HG7 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.11 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.13 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1512 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         96 
_refine_hist.number_atoms_solvent             172 
_refine_hist.number_atoms_total               1780 
_refine_hist.d_res_high                       1.146 
_refine_hist.d_res_low                        41.620 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.014  ? 1708 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.593  ? 2322 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.080 ? 702  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.189  ? 256  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.009  ? 338  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.1456 1.1613  . . 4   162  3.00  . . . 0.5061 . 0.4376 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.1613 1.1779  . . 24  379  7.00  . . . 0.4235 . 0.3550 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.1779 1.1954  . . 17  747  14.00 . . . 0.4497 . 0.3235 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.1954 1.2141  . . 47  1135 22.00 . . . 0.2936 . 0.3152 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.2141 1.2340  . . 57  1512 30.00 . . . 0.3461 . 0.3173 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.2340 1.2553  . . 82  1965 38.00 . . . 0.2823 . 0.3315 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.2553 1.2781  . . 90  2417 48.00 . . . 0.2757 . 0.3031 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.2781 1.3027  . . 116 2958 57.00 . . . 0.3207 . 0.2851 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3027 1.3293  . . 143 3431 67.00 . . . 0.2705 . 0.2837 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3293 1.3582  . . 168 4046 78.00 . . . 0.3254 . 0.2626 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3582 1.3898  . . 152 4227 83.00 . . . 0.3439 . 0.2582 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3898 1.4246  . . 178 4421 85.00 . . . 0.3062 . 0.2357 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4246 1.4631  . . 206 4345 86.00 . . . 0.2133 . 0.2076 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4631 1.5061  . . 179 4588 89.00 . . . 0.1899 . 0.1911 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5061 1.5548  . . 178 4698 92.00 . . . 0.2306 . 0.1731 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5548 1.6103  . . 195 4676 92.00 . . . 0.1750 . 0.1558 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6103 1.6748  . . 165 4874 93.00 . . . 0.1876 . 0.1417 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6748 1.7510  . . 216 4759 95.00 . . . 0.1558 . 0.1273 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7510 1.8434  . . 164 4850 95.00 . . . 0.1388 . 0.1289 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8434 1.9588  . . 196 4969 95.00 . . . 0.1281 . 0.1222 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9588 2.1101  . . 191 4854 95.00 . . . 0.1628 . 0.1115 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1101 2.3224  . . 193 4816 94.00 . . . 0.0967 . 0.1121 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3224 2.6584  . . 190 4877 95.00 . . . 0.1387 . 0.1282 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6584 3.3491  . . 190 4934 95.00 . . . 0.1492 . 0.1316 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3491 41.6475 . . 180 4873 95.00 . . . 0.1522 . 0.1509 . . . . . . . . . . 
# 
_struct.entry_id                     5C5A 
_struct.title                        'Crystal Structure of HDM2 in complex with Nutlin-3a' 
_struct.pdbx_descriptor              'E3 ubiquitin-protein ligase Mdm2 (E.C.6.3.2.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5C5A 
_struct_keywords.text            'Drug Design, HDM2, complex structure, ligase' 
_struct_keywords.pdbx_keywords   LIGASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 LYS A 12 ? GLY A 23 ? LYS A 31 GLY A 42  1 ? 12 
HELX_P HELX_P2 AA2 MET A 31 ? ARG A 46 ? MET A 50 ARG A 65  1 ? 16 
HELX_P HELX_P3 AA3 ASP A 61 ? GLY A 68 ? ASP A 80 GLY A 87  1 ? 8  
HELX_P HELX_P4 AA4 GLU A 76 ? ARG A 86 ? GLU A 95 ARG A 105 1 ? 11 
HELX_P HELX_P5 AA5 LYS B 12 ? GLY B 23 ? LYS B 31 GLY B 42  1 ? 12 
HELX_P HELX_P6 AA6 MET B 31 ? ARG B 46 ? MET B 50 ARG B 65  1 ? 16 
HELX_P HELX_P7 AA7 ASP B 61 ? GLY B 68 ? ASP B 80 GLY B 87  1 ? 8  
HELX_P HELX_P8 AA8 GLU B 76 ? ARG B 86 ? GLU B 95 ARG B 105 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 29 ? THR A 30 ? TYR A 48  THR A 49  
AA1 2 LEU A 8  ? PRO A 11 ? LEU A 27  PRO A 30  
AA1 3 LEU A 88 ? VAL A 90 ? LEU A 107 VAL A 109 
AA2 1 TYR A 48 ? ASP A 49 ? TYR A 67  ASP A 68  
AA2 2 GLN A 52 ? TYR A 57 ? GLN A 71  TYR A 76  
AA2 3 SER A 71 ? SER A 73 ? SER A 90  SER A 92  
AA3 1 TYR B 29 ? THR B 30 ? TYR B 48  THR B 49  
AA3 2 LEU B 8  ? PRO B 11 ? LEU B 27  PRO B 30  
AA3 3 LEU B 88 ? VAL B 90 ? LEU B 107 VAL B 109 
AA4 1 TYR B 48 ? ASP B 49 ? TYR B 67  ASP B 68  
AA4 2 GLN B 52 ? TYR B 57 ? GLN B 71  TYR B 76  
AA4 3 SER B 71 ? SER B 73 ? SER B 90  SER B 92  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O TYR A 29 ? O TYR A 48 N VAL A 9  ? N VAL A 28  
AA1 2 3 N ARG A 10 ? N ARG A 29 O VAL A 89 ? O VAL A 108 
AA2 1 2 N ASP A 49 ? N ASP A 68 O ILE A 55 ? O ILE A 74  
AA2 2 3 N VAL A 56 ? N VAL A 75 O PHE A 72 ? O PHE A 91  
AA3 1 2 O TYR B 29 ? O TYR B 48 N VAL B 9  ? N VAL B 28  
AA3 2 3 N ARG B 10 ? N ARG B 29 O VAL B 89 ? O VAL B 108 
AA4 1 2 N ASP B 49 ? N ASP B 68 O ILE B 55 ? O ILE B 74  
AA4 2 3 N VAL B 56 ? N VAL B 75 O PHE B 72 ? O PHE B 91  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NUT 201 ? 12 'binding site for residue NUT A 201' 
AC2 Software A SO4 202 ? 3  'binding site for residue SO4 A 202' 
AC3 Software A IOD 204 ? 2  'binding site for residue IOD A 204' 
AC4 Software B NUT 201 ? 12 'binding site for residue NUT B 201' 
AC5 Software B SO4 202 ? 7  'binding site for residue SO4 B 202' 
AC6 Software B IOD 204 ? 2  'binding site for residue IOD B 204' 
AC7 Software B IOD 205 ? 1  'binding site for residue IOD B 205' 
AC8 Software B IOD 206 ? 1  'binding site for residue IOD B 206' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 LEU A 35 ? LEU A 54  . ? 1_555 ? 
2  AC1 12 GLY A 39 ? GLY A 58  . ? 1_555 ? 
3  AC1 12 GLN A 40 ? GLN A 59  . ? 1_555 ? 
4  AC1 12 MET A 43 ? MET A 62  . ? 1_555 ? 
5  AC1 12 GLN A 53 ? GLN A 72  . ? 1_555 ? 
6  AC1 12 VAL A 74 ? VAL A 93  . ? 1_555 ? 
7  AC1 12 HIS A 77 ? HIS A 96  . ? 1_555 ? 
8  AC1 12 ILE A 80 ? ILE A 99  . ? 1_555 ? 
9  AC1 12 TYR A 81 ? TYR A 100 . ? 1_555 ? 
10 AC1 12 HOH M .  ? HOH A 335 . ? 1_555 ? 
11 AC1 12 HOH M .  ? HOH A 350 . ? 1_555 ? 
12 AC1 12 ARG B 10 ? ARG B 29  . ? 1_555 ? 
13 AC2 3  ARG A 86 ? ARG A 105 . ? 1_555 ? 
14 AC2 3  HOH M .  ? HOH A 302 . ? 1_555 ? 
15 AC2 3  HOH M .  ? HOH A 304 . ? 1_555 ? 
16 AC3 2  THR A 7  ? THR A 26  . ? 1_555 ? 
17 AC3 2  LYS A 32 ? LYS A 51  . ? 1_555 ? 
18 AC4 12 ARG A 10 ? ARG A 29  . ? 1_655 ? 
19 AC4 12 LEU B 35 ? LEU B 54  . ? 1_555 ? 
20 AC4 12 GLY B 39 ? GLY B 58  . ? 1_555 ? 
21 AC4 12 GLN B 40 ? GLN B 59  . ? 1_555 ? 
22 AC4 12 MET B 43 ? MET B 62  . ? 1_555 ? 
23 AC4 12 GLN B 53 ? GLN B 72  . ? 1_555 ? 
24 AC4 12 VAL B 74 ? VAL B 93  . ? 1_555 ? 
25 AC4 12 HIS B 77 ? HIS B 96  . ? 1_555 ? 
26 AC4 12 ILE B 80 ? ILE B 99  . ? 1_555 ? 
27 AC4 12 TYR B 81 ? TYR B 100 . ? 1_555 ? 
28 AC4 12 HOH N .  ? HOH B 332 . ? 1_555 ? 
29 AC4 12 HOH N .  ? HOH B 347 . ? 1_555 ? 
30 AC5 7  SER B 3  ? SER B 22  . ? 1_565 ? 
31 AC5 7  GLU B 4  ? GLU B 23  . ? 1_565 ? 
32 AC5 7  GLN B 5  ? GLN B 24  . ? 1_565 ? 
33 AC5 7  LYS B 51 ? LYS B 70  . ? 1_555 ? 
34 AC5 7  HOH N .  ? HOH B 304 . ? 1_555 ? 
35 AC5 7  HOH N .  ? HOH B 320 . ? 1_565 ? 
36 AC5 7  HOH N .  ? HOH B 329 . ? 1_565 ? 
37 AC6 2  THR B 7  ? THR B 26  . ? 1_555 ? 
38 AC6 2  LYS B 32 ? LYS B 51  . ? 1_555 ? 
39 AC7 1  LEU A 14 ? LEU A 33  . ? 1_655 ? 
40 AC8 1  LEU B 14 ? LEU B 33  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5C5A 
_atom_sites.fract_transf_matrix[1][1]   0.024027 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000016 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022920 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018986 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
I  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . PRO A 1 1  ? -12.903 30.024  -15.325 1.00 30.18 ? 20  PRO A N    1 
ATOM   2    C  CA   . PRO A 1 1  ? -11.957 29.022  -15.845 1.00 29.86 ? 20  PRO A CA   1 
ATOM   3    C  C    . PRO A 1 1  ? -11.399 29.361  -17.239 1.00 28.31 ? 20  PRO A C    1 
ATOM   4    O  O    . PRO A 1 1  ? -12.104 29.899  -18.125 1.00 30.00 ? 20  PRO A O    1 
ATOM   5    C  CB   . PRO A 1 1  ? -12.794 27.733  -15.886 1.00 30.50 ? 20  PRO A CB   1 
ATOM   6    C  CG   . PRO A 1 1  ? -13.779 27.902  -14.826 1.00 30.66 ? 20  PRO A CG   1 
ATOM   7    C  CD   . PRO A 1 1  ? -14.099 29.388  -14.746 1.00 30.64 ? 20  PRO A CD   1 
ATOM   8    H  HA   . PRO A 1 1  ? -11.220 28.905  -15.226 1.00 35.84 ? 20  PRO A HA   1 
ATOM   9    H  HB2  . PRO A 1 1  ? -13.227 27.650  -16.750 1.00 36.60 ? 20  PRO A HB2  1 
ATOM   10   H  HB3  . PRO A 1 1  ? -12.225 26.967  -15.710 1.00 36.60 ? 20  PRO A HB3  1 
ATOM   11   H  HG2  . PRO A 1 1  ? -14.577 27.397  -15.045 1.00 36.79 ? 20  PRO A HG2  1 
ATOM   12   H  HG3  . PRO A 1 1  ? -13.403 27.593  -13.987 1.00 36.79 ? 20  PRO A HG3  1 
ATOM   13   H  HD2  . PRO A 1 1  ? -14.884 29.594  -15.278 1.00 36.77 ? 20  PRO A HD2  1 
ATOM   14   H  HD3  . PRO A 1 1  ? -14.214 29.660  -13.822 1.00 36.77 ? 20  PRO A HD3  1 
ATOM   15   N  N    . ALA A 1 2  ? -10.127 29.041  -17.440 1.00 24.99 ? 21  ALA A N    1 
ATOM   16   C  CA   . ALA A 1 2  ? -9.449  29.400  -18.682 1.00 22.38 ? 21  ALA A CA   1 
ATOM   17   C  C    . ALA A 1 2  ? -9.979  28.592  -19.866 1.00 20.05 ? 21  ALA A C    1 
ATOM   18   O  O    . ALA A 1 2  ? -10.083 29.096  -20.976 1.00 20.00 ? 21  ALA A O    1 
ATOM   19   C  CB   . ALA A 1 2  ? -7.970  29.180  -18.541 1.00 22.64 ? 21  ALA A CB   1 
ATOM   20   H  H    . ALA A 1 2  ? -9.634  28.618  -16.876 1.00 29.98 ? 21  ALA A H    1 
ATOM   21   H  HA   . ALA A 1 2  ? -9.599  30.341  -18.867 1.00 26.86 ? 21  ALA A HA   1 
ATOM   22   H  HB1  . ALA A 1 2  ? -7.636  29.734  -17.818 1.00 27.17 ? 21  ALA A HB1  1 
ATOM   23   H  HB2  . ALA A 1 2  ? -7.808  28.244  -18.343 1.00 27.17 ? 21  ALA A HB2  1 
ATOM   24   H  HB3  . ALA A 1 2  ? -7.534  29.423  -19.373 1.00 27.17 ? 21  ALA A HB3  1 
ATOM   25   N  N    . SER A 1 3  ? -10.273 27.318  -19.647 1.00 18.46 ? 22  SER A N    1 
ATOM   26   C  CA   . SER A 1 3  ? -10.680 26.462  -20.749 1.00 17.62 ? 22  SER A CA   1 
ATOM   27   C  C    . SER A 1 3  ? -12.166 26.597  -21.059 1.00 16.64 ? 22  SER A C    1 
ATOM   28   O  O    . SER A 1 3  ? -13.035 26.211  -20.250 1.00 19.08 ? 22  SER A O    1 
ATOM   29   C  CB   . SER A 1 3  ? -10.383 25.001  -20.443 1.00 18.14 ? 22  SER A CB   1 
ATOM   30   O  OG   . SER A 1 3  ? -11.008 24.187  -21.405 1.00 19.21 ? 22  SER A OG   1 
ATOM   31   H  H    . SER A 1 3  ? -10.245 26.929  -18.880 1.00 22.15 ? 22  SER A H    1 
ATOM   32   H  HA   . SER A 1 3  ? -10.182 26.711  -21.543 1.00 21.14 ? 22  SER A HA   1 
ATOM   33   H  HB2  . SER A 1 3  ? -9.424  24.856  -20.474 1.00 21.77 ? 22  SER A HB2  1 
ATOM   34   H  HB3  . SER A 1 3  ? -10.728 24.781  -19.564 1.00 21.77 ? 22  SER A HB3  1 
ATOM   35   H  HG   . SER A 1 3  ? -10.719 24.374  -22.171 1.00 23.06 ? 22  SER A HG   1 
ATOM   36   N  N    . GLU A 1 4  ? -12.464 27.111  -22.238 1.00 13.36 ? 23  GLU A N    1 
ATOM   37   C  CA   . GLU A 1 4  ? -13.845 27.285  -22.626 1.00 14.57 ? 23  GLU A CA   1 
ATOM   38   C  C    . GLU A 1 4  ? -14.441 25.970  -23.068 1.00 13.37 ? 23  GLU A C    1 
ATOM   39   O  O    . GLU A 1 4  ? -15.651 25.809  -23.031 1.00 14.19 ? 23  GLU A O    1 
ATOM   40   C  CB   . GLU A 1 4  ? -13.984 28.292  -23.771 1.00 15.45 ? 23  GLU A CB   1 
ATOM   41   C  CG   . GLU A 1 4  ? -13.452 29.677  -23.473 1.00 16.93 ? 23  GLU A CG   1 
ATOM   42   C  CD   . GLU A 1 4  ? -14.228 30.423  -22.383 1.00 18.85 ? 23  GLU A CD   1 
ATOM   43   O  OE1  . GLU A 1 4  ? -15.285 29.962  -21.936 1.00 19.61 ? 23  GLU A OE1  1 
ATOM   44   O  OE2  . GLU A 1 4  ? -13.790 31.505  -21.972 1.00 20.11 ? 23  GLU A OE2  1 
ATOM   45   H  H    . GLU A 1 4  ? -11.890 27.365  -22.826 1.00 16.03 ? 23  GLU A H    1 
ATOM   46   H  HA   . GLU A 1 4  ? -14.354 27.612  -21.867 1.00 17.48 ? 23  GLU A HA   1 
ATOM   47   H  HB2  . GLU A 1 4  ? -13.501 27.952  -24.540 1.00 18.53 ? 23  GLU A HB2  1 
ATOM   48   H  HB3  . GLU A 1 4  ? -14.924 28.381  -23.991 1.00 18.53 ? 23  GLU A HB3  1 
ATOM   49   H  HG2  . GLU A 1 4  ? -12.530 29.601  -23.180 1.00 20.31 ? 23  GLU A HG2  1 
ATOM   50   H  HG3  . GLU A 1 4  ? -13.495 30.209  -24.284 1.00 20.31 ? 23  GLU A HG3  1 
ATOM   51   N  N    . GLN A 1 5  ? -13.595 25.018  -23.462 1.00 15.16 ? 24  GLN A N    1 
ATOM   52   C  CA   . GLN A 1 5  ? -14.100 23.741  -23.952 1.00 13.53 ? 24  GLN A CA   1 
ATOM   53   C  C    . GLN A 1 5  ? -14.412 22.703  -22.880 1.00 13.30 ? 24  GLN A C    1 
ATOM   54   O  O    . GLN A 1 5  ? -15.136 21.742  -23.157 1.00 15.81 ? 24  GLN A O    1 
ATOM   55   C  CB   . GLN A 1 5  ? -13.125 23.151  -24.969 1.00 15.75 ? 24  GLN A CB   1 
ATOM   56   C  CG   . GLN A 1 5  ? -13.057 24.052  -26.216 1.00 17.51 ? 24  GLN A CG   1 
ATOM   57   C  CD   . GLN A 1 5  ? -12.176 23.508  -27.326 1.00 19.20 ? 24  GLN A CD   1 
ATOM   58   O  OE1  . GLN A 1 5  ? -11.296 22.678  -27.082 1.00 20.17 ? 24  GLN A OE1  1 
ATOM   59   N  NE2  . GLN A 1 5  ? -12.403 23.991  -28.561 1.00 18.96 ? 24  GLN A NE2  1 
ATOM   60   H  H    . GLN A 1 5  ? -12.737 25.087  -23.456 1.00 18.19 ? 24  GLN A H    1 
ATOM   61   H  HA   . GLN A 1 5  ? -14.929 23.913  -24.424 1.00 16.24 ? 24  GLN A HA   1 
ATOM   62   H  HB2  . GLN A 1 5  ? -12.239 23.098  -24.577 1.00 18.90 ? 24  GLN A HB2  1 
ATOM   63   H  HB3  . GLN A 1 5  ? -13.431 22.271  -25.239 1.00 18.90 ? 24  GLN A HB3  1 
ATOM   64   H  HG2  . GLN A 1 5  ? -13.953 24.157  -26.574 1.00 21.01 ? 24  GLN A HG2  1 
ATOM   65   H  HG3  . GLN A 1 5  ? -12.705 24.917  -25.956 1.00 21.01 ? 24  GLN A HG3  1 
ATOM   66   H  HE21 . GLN A 1 5  ? -11.931 23.715  -29.225 1.00 22.75 ? 24  GLN A HE21 1 
ATOM   67   H  HE22 . GLN A 1 5  ? -13.020 24.577  -28.688 1.00 22.75 ? 24  GLN A HE22 1 
ATOM   68   N  N    . GLU A 1 6  ? -13.905 22.892  -21.666 1.00 14.46 ? 25  GLU A N    1 
ATOM   69   C  CA   . GLU A 1 6  ? -14.141 21.972  -20.557 1.00 15.14 ? 25  GLU A CA   1 
ATOM   70   C  C    . GLU A 1 6  ? -15.630 21.769  -20.322 1.00 12.60 ? 25  GLU A C    1 
ATOM   71   O  O    . GLU A 1 6  ? -16.415 22.687  -20.566 1.00 12.88 ? 25  GLU A O    1 
ATOM   72   C  CB   . GLU A 1 6  ? -13.507 22.564  -19.298 1.00 18.05 ? 25  GLU A CB   1 
ATOM   73   C  CG   . GLU A 1 6  ? -13.906 21.965  -17.970 1.00 22.77 ? 25  GLU A CG   1 
ATOM   74   C  CD   . GLU A 1 6  ? -13.192 22.676  -16.845 1.00 26.71 ? 25  GLU A CD   1 
ATOM   75   O  OE1  . GLU A 1 6  ? -13.811 23.544  -16.152 1.00 28.78 ? 25  GLU A OE1  1 
ATOM   76   O  OE2  . GLU A 1 6  ? -11.987 22.391  -16.680 1.00 27.69 ? 25  GLU A OE2  1 
ATOM   77   H  H    . GLU A 1 6  ? -13.409 23.561  -21.455 1.00 17.36 ? 25  GLU A H    1 
ATOM   78   H  HA   . GLU A 1 6  ? -13.731 21.113  -20.745 1.00 18.17 ? 25  GLU A HA   1 
ATOM   79   H  HB2  . GLU A 1 6  ? -12.544 22.470  -19.374 1.00 21.66 ? 25  GLU A HB2  1 
ATOM   80   H  HB3  . GLU A 1 6  ? -13.732 23.507  -19.263 1.00 21.66 ? 25  GLU A HB3  1 
ATOM   81   H  HG2  . GLU A 1 6  ? -14.862 22.067  -17.842 1.00 27.32 ? 25  GLU A HG2  1 
ATOM   82   H  HG3  . GLU A 1 6  ? -13.658 21.028  -17.949 1.00 27.32 ? 25  GLU A HG3  1 
ATOM   83   N  N    . THR A 1 7  ? -16.020 20.582  -19.835 1.00 11.95 ? 26  THR A N    1 
ATOM   84   C  CA   . THR A 1 7  ? -17.387 20.336  -19.388 1.00 11.69 ? 26  THR A CA   1 
ATOM   85   C  C    . THR A 1 7  ? -17.401 19.926  -17.925 1.00 13.18 ? 26  THR A C    1 
ATOM   86   O  O    . THR A 1 7  ? -16.758 18.959  -17.580 1.00 14.66 ? 26  THR A O    1 
ATOM   87   C  CB   . THR A 1 7  ? -18.093 19.242  -20.212 1.00 12.72 ? 26  THR A CB   1 
ATOM   88   O  OG1  . THR A 1 7  ? -18.037 19.592  -21.595 1.00 12.66 ? 26  THR A OG1  1 
ATOM   89   C  CG2  . THR A 1 7  ? -19.535 19.079  -19.809 1.00 15.41 ? 26  THR A CG2  1 
ATOM   90   H  H    . THR A 1 7  ? -15.502 19.900  -19.755 1.00 14.34 ? 26  THR A H    1 
ATOM   91   H  HA   . THR A 1 7  ? -17.899 21.155  -19.475 1.00 14.03 ? 26  THR A HA   1 
ATOM   92   H  HB   . THR A 1 7  ? -17.640 18.395  -20.077 1.00 15.27 ? 26  THR A HB   1 
ATOM   93   H  HG1  . THR A 1 7  ? -18.419 19.003  -22.056 1.00 15.19 ? 26  THR A HG1  1 
ATOM   94   H  HG21 . THR A 1 7  ? -19.591 18.832  -18.872 1.00 18.49 ? 26  THR A HG21 1 
ATOM   95   H  HG22 . THR A 1 7  ? -20.013 19.912  -19.944 1.00 18.49 ? 26  THR A HG22 1 
ATOM   96   H  HG23 . THR A 1 7  ? -19.952 18.385  -20.343 1.00 18.49 ? 26  THR A HG23 1 
ATOM   97   N  N    . LEU A 1 8  ? -18.150 20.636  -17.099 1.00 13.63 ? 27  LEU A N    1 
ATOM   98   C  CA   . LEU A 1 8  ? -18.339 20.253  -15.695 1.00 13.33 ? 27  LEU A CA   1 
ATOM   99   C  C    . LEU A 1 8  ? -19.642 19.500  -15.597 1.00 11.21 ? 27  LEU A C    1 
ATOM   100  O  O    . LEU A 1 8  ? -20.647 19.890  -16.219 1.00 11.64 ? 27  LEU A O    1 
ATOM   101  C  CB   . LEU A 1 8  ? -18.431 21.499  -14.820 1.00 15.94 ? 27  LEU A CB   1 
ATOM   102  C  CG   . LEU A 1 8  ? -17.188 22.380  -14.768 1.00 19.93 ? 27  LEU A CG   1 
ATOM   103  C  CD1  . LEU A 1 8  ? -17.358 23.466  -13.720 1.00 22.37 ? 27  LEU A CD1  1 
ATOM   104  C  CD2  . LEU A 1 8  ? -15.949 21.560  -14.478 1.00 22.13 ? 27  LEU A CD2  1 
ATOM   105  H  H    . LEU A 1 8  ? -18.568 21.354  -17.323 1.00 16.35 ? 27  LEU A H    1 
ATOM   106  H  HA   . LEU A 1 8  ? -17.610 19.689  -15.390 1.00 15.99 ? 27  LEU A HA   1 
ATOM   107  H  HB2  . LEU A 1 8  ? -19.160 22.048  -15.149 1.00 19.13 ? 27  LEU A HB2  1 
ATOM   108  H  HB3  . LEU A 1 8  ? -18.624 21.219  -13.912 1.00 19.13 ? 27  LEU A HB3  1 
ATOM   109  H  HG   . LEU A 1 8  ? -17.069 22.810  -15.629 1.00 23.91 ? 27  LEU A HG   1 
ATOM   110  H  HD11 . LEU A 1 8  ? -18.127 24.010  -13.951 1.00 26.84 ? 27  LEU A HD11 1 
ATOM   111  H  HD12 . LEU A 1 8  ? -17.494 23.051  -12.854 1.00 26.84 ? 27  LEU A HD12 1 
ATOM   112  H  HD13 . LEU A 1 8  ? -16.558 24.015  -13.702 1.00 26.84 ? 27  LEU A HD13 1 
ATOM   113  H  HD21 . LEU A 1 8  ? -16.056 21.118  -13.622 1.00 26.56 ? 27  LEU A HD21 1 
ATOM   114  H  HD22 . LEU A 1 8  ? -15.836 20.900  -15.180 1.00 26.56 ? 27  LEU A HD22 1 
ATOM   115  H  HD23 . LEU A 1 8  ? -15.179 22.151  -14.452 1.00 26.56 ? 27  LEU A HD23 1 
ATOM   116  N  N    . VAL A 1 9  ? -19.643 18.415  -14.845 1.00 10.70 ? 28  VAL A N    1 
ATOM   117  C  CA   . VAL A 1 9  ? -20.787 17.524  -14.797 1.00 10.65 ? 28  VAL A CA   1 
ATOM   118  C  C    . VAL A 1 9  ? -21.060 17.056  -13.357 1.00 9.59  ? 28  VAL A C    1 
ATOM   119  O  O    . VAL A 1 9  ? -20.128 16.961  -12.523 1.00 11.34 ? 28  VAL A O    1 
ATOM   120  C  CB   . VAL A 1 9  ? -20.570 16.268  -15.694 1.00 9.92  ? 28  VAL A CB   1 
ATOM   121  C  CG1  . VAL A 1 9  ? -20.313 16.648  -17.122 1.00 11.00 ? 28  VAL A CG1  1 
ATOM   122  C  CG2  . VAL A 1 9  ? -19.465 15.369  -15.126 1.00 10.38 ? 28  VAL A CG2  1 
ATOM   123  H  H    . VAL A 1 9  ? -18.986 18.169  -14.347 1.00 12.84 ? 28  VAL A H    1 
ATOM   124  H  HA   . VAL A 1 9  ? -21.572 17.995  -15.117 1.00 12.78 ? 28  VAL A HA   1 
ATOM   125  H  HB   . VAL A 1 9  ? -21.389 15.749  -15.684 1.00 11.90 ? 28  VAL A HB   1 
ATOM   126  H  HG11 . VAL A 1 9  ? -20.184 15.842  -17.645 1.00 13.20 ? 28  VAL A HG11 1 
ATOM   127  H  HG12 . VAL A 1 9  ? -21.077 17.143  -17.459 1.00 13.20 ? 28  VAL A HG12 1 
ATOM   128  H  HG13 . VAL A 1 9  ? -19.517 17.201  -17.163 1.00 13.20 ? 28  VAL A HG13 1 
ATOM   129  H  HG21 . VAL A 1 9  ? -19.120 15.770  -14.312 1.00 12.46 ? 28  VAL A HG21 1 
ATOM   130  H  HG22 . VAL A 1 9  ? -19.838 14.495  -14.932 1.00 12.46 ? 28  VAL A HG22 1 
ATOM   131  H  HG23 . VAL A 1 9  ? -18.755 15.289  -15.782 1.00 12.46 ? 28  VAL A HG23 1 
ATOM   132  N  N    . ARG A 1 10 ? -22.310 16.730  -13.072 1.00 8.60  ? 29  ARG A N    1 
ATOM   133  C  CA   . ARG A 1 10 ? -22.685 16.148  -11.806 1.00 10.37 ? 29  ARG A CA   1 
ATOM   134  C  C    . ARG A 1 10 ? -23.258 14.788  -12.145 1.00 8.91  ? 29  ARG A C    1 
ATOM   135  O  O    . ARG A 1 10 ? -24.315 14.680  -12.787 1.00 9.30  ? 29  ARG A O    1 
ATOM   136  C  CB   . ARG A 1 10 ? -23.734 16.999  -11.113 1.00 12.84 ? 29  ARG A CB   1 
ATOM   137  C  CG   . ARG A 1 10 ? -23.247 18.349  -10.718 1.00 16.08 ? 29  ARG A CG   1 
ATOM   138  C  CD   . ARG A 1 10 ? -24.192 18.991  -9.741  1.00 20.39 ? 29  ARG A CD   1 
ATOM   139  N  NE   . ARG A 1 10 ? -23.676 20.292  -9.373  1.00 22.63 ? 29  ARG A NE   1 
ATOM   140  C  CZ   . ARG A 1 10 ? -24.281 21.451  -9.614  1.00 25.90 ? 29  ARG A CZ   1 
ATOM   141  N  NH1  . ARG A 1 10 ? -25.484 21.509  -10.177 1.00 27.35 ? 29  ARG A NH1  1 
ATOM   142  N  NH2  . ARG A 1 10 ? -23.671 22.563  -9.257  1.00 27.08 ? 29  ARG A NH2  1 
ATOM   143  H  H    . ARG A 1 10 ? -22.971 16.841  -13.611 1.00 10.33 ? 29  ARG A H    1 
ATOM   144  H  HA   . ARG A 1 10 ? -21.911 16.044  -11.231 1.00 12.44 ? 29  ARG A HA   1 
ATOM   145  H  HB2  . ARG A 1 10 ? -24.486 17.119  -11.714 1.00 15.41 ? 29  ARG A HB2  1 
ATOM   146  H  HB3  . ARG A 1 10 ? -24.026 16.542  -10.308 1.00 15.41 ? 29  ARG A HB3  1 
ATOM   147  H  HG2  . ARG A 1 10 ? -22.378 18.268  -10.295 1.00 19.29 ? 29  ARG A HG2  1 
ATOM   148  H  HG3  . ARG A 1 10 ? -23.189 18.914  -11.504 1.00 19.29 ? 29  ARG A HG3  1 
ATOM   149  H  HD2  . ARG A 1 10 ? -25.062 19.106  -10.153 1.00 24.47 ? 29  ARG A HD2  1 
ATOM   150  H  HD3  . ARG A 1 10 ? -24.259 18.444  -8.942  1.00 24.47 ? 29  ARG A HD3  1 
ATOM   151  H  HE   . ARG A 1 10 ? -22.919 20.318  -8.966  1.00 27.15 ? 29  ARG A HE   1 
ATOM   152  H  HH11 . ARG A 1 10 ? -25.881 20.785  -10.419 1.00 32.82 ? 29  ARG A HH11 1 
ATOM   153  H  HH12 . ARG A 1 10 ? -25.859 22.271  -10.313 1.00 32.82 ? 29  ARG A HH12 1 
ATOM   154  H  HH21 . ARG A 1 10 ? -22.899 22.529  -8.880  1.00 32.50 ? 29  ARG A HH21 1 
ATOM   155  H  HH22 . ARG A 1 10 ? -24.055 23.323  -9.383  1.00 32.50 ? 29  ARG A HH22 1 
ATOM   156  N  N    . PRO A 1 11 ? -22.580 13.708  -11.694 1.00 9.64  ? 30  PRO A N    1 
ATOM   157  C  CA   . PRO A 1 11 ? -23.070 12.359  -11.998 1.00 8.96  ? 30  PRO A CA   1 
ATOM   158  C  C    . PRO A 1 11 ? -24.342 11.992  -11.245 1.00 8.67  ? 30  PRO A C    1 
ATOM   159  O  O    . PRO A 1 11 ? -24.505 12.365  -10.086 1.00 10.05 ? 30  PRO A O    1 
ATOM   160  C  CB   . PRO A 1 11 ? -21.937 11.464  -11.522 1.00 9.73  ? 30  PRO A CB   1 
ATOM   161  C  CG   . PRO A 1 11 ? -21.260 12.275  -10.389 1.00 13.16 ? 30  PRO A CG   1 
ATOM   162  C  CD   . PRO A 1 11 ? -21.371 13.701  -10.852 1.00 11.35 ? 30  PRO A CD   1 
ATOM   163  H  HA   . PRO A 1 11 ? -23.204 12.244  -12.952 1.00 10.75 ? 30  PRO A HA   1 
ATOM   164  H  HB2  . PRO A 1 11 ? -22.296 10.630  -11.182 1.00 11.67 ? 30  PRO A HB2  1 
ATOM   165  H  HB3  . PRO A 1 11 ? -21.316 11.303  -12.250 1.00 11.67 ? 30  PRO A HB3  1 
ATOM   166  H  HG2  . PRO A 1 11 ? -21.739 12.142  -9.556  1.00 15.79 ? 30  PRO A HG2  1 
ATOM   167  H  HG3  . PRO A 1 11 ? -20.331 12.010  -10.302 1.00 15.79 ? 30  PRO A HG3  1 
ATOM   168  H  HD2  . PRO A 1 11 ? -21.487 14.294  -10.093 1.00 13.62 ? 30  PRO A HD2  1 
ATOM   169  H  HD3  . PRO A 1 11 ? -20.593 13.946  -11.377 1.00 13.62 ? 30  PRO A HD3  1 
ATOM   170  N  N    . LYS A 1 12 ? -25.173 11.172  -11.877 1.00 9.61  ? 31  LYS A N    1 
ATOM   171  C  CA   . LYS A 1 12 ? -26.285 10.561  -11.168 1.00 10.01 ? 31  LYS A CA   1 
ATOM   172  C  C    . LYS A 1 12 ? -25.736 9.631   -10.081 1.00 10.82 ? 31  LYS A C    1 
ATOM   173  O  O    . LYS A 1 12 ? -24.588 9.188   -10.122 1.00 9.82  ? 31  LYS A O    1 
ATOM   174  C  CB   . LYS A 1 12 ? -27.179 9.787   -12.143 1.00 14.20 ? 31  LYS A CB   1 
ATOM   175  C  CG   . LYS A 1 12 ? -27.837 10.780  -13.143 1.00 17.73 ? 31  LYS A CG   1 
ATOM   176  C  CD   . LYS A 1 12 ? -28.492 10.270  -14.434 1.00 19.68 ? 31  LYS A CD   1 
ATOM   177  C  CE   . LYS A 1 12 ? -29.751 9.573   -14.205 1.00 17.65 ? 31  LYS A CE   1 
ATOM   178  N  NZ   . LYS A 1 12 ? -30.279 8.897   -15.445 1.00 16.13 ? 31  LYS A NZ   1 
ATOM   179  H  H    . LYS A 1 12 ? -25.115 10.956  -12.707 1.00 11.53 ? 31  LYS A H    1 
ATOM   180  H  HA   . LYS A 1 12 ? -26.818 11.252  -10.743 1.00 12.01 ? 31  LYS A HA   1 
ATOM   181  H  HB2  . LYS A 1 12 ? -26.642 9.153   -12.644 1.00 17.04 ? 31  LYS A HB2  1 
ATOM   182  H  HB3  . LYS A 1 12 ? -27.880 9.330   -11.652 1.00 17.04 ? 31  LYS A HB3  1 
ATOM   183  H  HG2  . LYS A 1 12 ? -28.527 11.261  -12.659 1.00 21.27 ? 31  LYS A HG2  1 
ATOM   184  H  HG3  . LYS A 1 12 ? -27.153 11.411  -13.415 1.00 21.27 ? 31  LYS A HG3  1 
ATOM   185  H  HD2  . LYS A 1 12 ? -28.671 11.026  -15.015 1.00 23.62 ? 31  LYS A HD2  1 
ATOM   186  H  HD3  . LYS A 1 12 ? -27.885 9.653   -14.872 1.00 23.62 ? 31  LYS A HD3  1 
ATOM   187  H  HE2  . LYS A 1 12 ? -29.617 8.892   -13.527 1.00 21.18 ? 31  LYS A HE2  1 
ATOM   188  H  HE3  . LYS A 1 12 ? -30.416 10.212  -13.905 1.00 21.18 ? 31  LYS A HE3  1 
ATOM   189  H  HZ1  . LYS A 1 12 ? -29.690 8.298   -15.739 1.00 19.35 ? 31  LYS A HZ1  1 
ATOM   190  H  HZ2  . LYS A 1 12 ? -31.046 8.485   -15.264 1.00 19.35 ? 31  LYS A HZ2  1 
ATOM   191  H  HZ3  . LYS A 1 12 ? -30.420 9.501   -16.084 1.00 19.35 ? 31  LYS A HZ3  1 
ATOM   192  N  N    . PRO A 1 13 ? -26.577 9.304   -9.097  1.00 11.76 ? 32  PRO A N    1 
ATOM   193  C  CA   . PRO A 1 13 ? -26.117 8.513   -7.951  1.00 12.51 ? 32  PRO A CA   1 
ATOM   194  C  C    . PRO A 1 13 ? -25.388 7.217   -8.318  1.00 14.16 ? 32  PRO A C    1 
ATOM   195  O  O    . PRO A 1 13 ? -24.358 6.936   -7.711  1.00 13.11 ? 32  PRO A O    1 
ATOM   196  C  CB   . PRO A 1 13 ? -27.416 8.266   -7.161  1.00 14.93 ? 32  PRO A CB   1 
ATOM   197  C  CG   . PRO A 1 13 ? -28.259 9.494   -7.447  1.00 15.83 ? 32  PRO A CG   1 
ATOM   198  C  CD   . PRO A 1 13 ? -27.951 9.806   -8.897  1.00 14.08 ? 32  PRO A CD   1 
ATOM   199  H  HA   . PRO A 1 13 ? -25.524 9.053   -7.405  1.00 15.01 ? 32  PRO A HA   1 
ATOM   200  H  HB2  . PRO A 1 13 ? -27.852 7.463   -7.486  1.00 17.92 ? 32  PRO A HB2  1 
ATOM   201  H  HB3  . PRO A 1 13 ? -27.218 8.195   -6.214  1.00 17.92 ? 32  PRO A HB3  1 
ATOM   202  H  HG2  . PRO A 1 13 ? -29.199 9.285   -7.328  1.00 19.00 ? 32  PRO A HG2  1 
ATOM   203  H  HG3  . PRO A 1 13 ? -27.989 10.224  -6.868  1.00 19.00 ? 32  PRO A HG3  1 
ATOM   204  H  HD2  . PRO A 1 13 ? -28.567 9.337   -9.480  1.00 16.90 ? 32  PRO A HD2  1 
ATOM   205  H  HD3  . PRO A 1 13 ? -27.983 10.764  -9.048  1.00 16.90 ? 32  PRO A HD3  1 
ATOM   206  N  N    . LEU A 1 14 ? -25.865 6.438   -9.292  1.00 13.21 ? 33  LEU A N    1 
ATOM   207  C  CA   . LEU A 1 14 ? -25.201 5.170   -9.576  1.00 13.27 ? 33  LEU A CA   1 
ATOM   208  C  C    . LEU A 1 14 ? -23.900 5.377   -10.344 1.00 10.34 ? 33  LEU A C    1 
ATOM   209  O  O    . LEU A 1 14 ? -22.954 4.634   -10.159 1.00 10.97 ? 33  LEU A O    1 
ATOM   210  C  CB   . LEU A 1 14 ? -26.127 4.200   -10.282 1.00 15.36 ? 33  LEU A CB   1 
ATOM   211  C  CG   . LEU A 1 14 ? -27.151 3.603   -9.301  1.00 18.23 ? 33  LEU A CG   1 
ATOM   212  C  CD1  . LEU A 1 14 ? -28.033 2.643   -10.044 1.00 19.59 ? 33  LEU A CD1  1 
ATOM   213  C  CD2  . LEU A 1 14 ? -26.511 2.907   -8.096  1.00 20.96 ? 33  LEU A CD2  1 
ATOM   214  H  H    . LEU A 1 14 ? -26.548 6.614   -9.785  1.00 15.85 ? 33  LEU A H    1 
ATOM   215  H  HA   . LEU A 1 14 ? -24.964 4.764   -8.728  1.00 15.92 ? 33  LEU A HA   1 
ATOM   216  H  HB2  . LEU A 1 14 ? -26.610 4.668   -10.982 1.00 18.43 ? 33  LEU A HB2  1 
ATOM   217  H  HB3  . LEU A 1 14 ? -25.606 3.474   -10.659 1.00 18.43 ? 33  LEU A HB3  1 
ATOM   218  H  HG   . LEU A 1 14 ? -27.713 4.319   -8.963  1.00 21.88 ? 33  LEU A HG   1 
ATOM   219  H  HD11 . LEU A 1 14 ? -28.492 3.121   -10.753 1.00 23.50 ? 33  LEU A HD11 1 
ATOM   220  H  HD12 . LEU A 1 14 ? -27.484 1.938   -10.421 1.00 23.50 ? 33  LEU A HD12 1 
ATOM   221  H  HD13 . LEU A 1 14 ? -28.679 2.266   -9.427  1.00 23.50 ? 33  LEU A HD13 1 
ATOM   222  H  HD21 . LEU A 1 14 ? -25.976 3.551   -7.607  1.00 25.15 ? 33  LEU A HD21 1 
ATOM   223  H  HD22 . LEU A 1 14 ? -27.213 2.557   -7.524  1.00 25.15 ? 33  LEU A HD22 1 
ATOM   224  H  HD23 . LEU A 1 14 ? -25.950 2.182   -8.412  1.00 25.15 ? 33  LEU A HD23 1 
ATOM   225  N  N    . LEU A 1 15 ? -23.827 6.430   -11.166 1.00 10.02 ? 34  LEU A N    1 
ATOM   226  C  CA   . LEU A 1 15 ? -22.540 6.769   -11.782 1.00 9.86  ? 34  LEU A CA   1 
ATOM   227  C  C    . LEU A 1 15 ? -21.541 7.229   -10.715 1.00 9.36  ? 34  LEU A C    1 
ATOM   228  O  O    . LEU A 1 15 ? -20.357 6.889   -10.754 1.00 9.65  ? 34  LEU A O    1 
ATOM   229  C  CB   . LEU A 1 15 ? -22.692 7.817   -12.882 1.00 10.15 ? 34  LEU A CB   1 
ATOM   230  C  CG   . LEU A 1 15 ? -21.366 8.251   -13.537 1.00 10.41 ? 34  LEU A CG   1 
ATOM   231  C  CD1  . LEU A 1 15 ? -20.582 7.104   -14.124 1.00 11.57 ? 34  LEU A CD1  1 
ATOM   232  C  CD2  . LEU A 1 15 ? -21.631 9.275   -14.636 1.00 10.74 ? 34  LEU A CD2  1 
ATOM   233  H  H    . LEU A 1 15 ? -24.482 6.946   -11.377 1.00 12.03 ? 34  LEU A H    1 
ATOM   234  H  HA   . LEU A 1 15 ? -22.177 5.968   -12.192 1.00 11.83 ? 34  LEU A HA   1 
ATOM   235  H  HB2  . LEU A 1 15 ? -23.260 7.454   -13.580 1.00 12.18 ? 34  LEU A HB2  1 
ATOM   236  H  HB3  . LEU A 1 15 ? -23.105 8.608   -12.503 1.00 12.18 ? 34  LEU A HB3  1 
ATOM   237  H  HG   . LEU A 1 15 ? -20.810 8.675   -12.865 1.00 12.49 ? 34  LEU A HG   1 
ATOM   238  H  HD11 . LEU A 1 15 ? -21.120 6.671   -14.805 1.00 13.89 ? 34  LEU A HD11 1 
ATOM   239  H  HD12 . LEU A 1 15 ? -19.765 7.449   -14.516 1.00 13.89 ? 34  LEU A HD12 1 
ATOM   240  H  HD13 . LEU A 1 15 ? -20.371 6.473   -13.418 1.00 13.89 ? 34  LEU A HD13 1 
ATOM   241  H  HD21 . LEU A 1 15 ? -22.206 8.876   -15.307 1.00 12.89 ? 34  LEU A HD21 1 
ATOM   242  H  HD22 . LEU A 1 15 ? -22.066 10.050  -14.246 1.00 12.89 ? 34  LEU A HD22 1 
ATOM   243  H  HD23 . LEU A 1 15 ? -20.787 9.536   -15.035 1.00 12.89 ? 34  LEU A HD23 1 
ATOM   244  N  N    . LEU A 1 16 ? -22.012 8.003   -9.751  1.00 10.16 ? 35  LEU A N    1 
ATOM   245  C  CA   . LEU A 1 16 ? -21.177 8.395   -8.642  1.00 10.98 ? 35  LEU A CA   1 
ATOM   246  C  C    . LEU A 1 16 ? -20.651 7.171   -7.917  1.00 10.42 ? 35  LEU A C    1 
ATOM   247  O  O    . LEU A 1 16 ? -19.473 7.128   -7.543  1.00 11.06 ? 35  LEU A O    1 
ATOM   248  C  CB   . LEU A 1 16 ? -21.905 9.334   -7.687  1.00 11.39 ? 35  LEU A CB   1 
ATOM   249  C  CG   . LEU A 1 16 ? -21.081 9.827   -6.504  1.00 14.59 ? 35  LEU A CG   1 
ATOM   250  C  CD1  . LEU A 1 16 ? -19.842 10.587  -6.960  1.00 16.70 ? 35  LEU A CD1  1 
ATOM   251  C  CD2  . LEU A 1 16 ? -21.965 10.708  -5.608  1.00 18.31 ? 35  LEU A CD2  1 
ATOM   252  H  H    . LEU A 1 16 ? -22.814 8.314   -9.719  1.00 12.20 ? 35  LEU A H    1 
ATOM   253  H  HA   . LEU A 1 16 ? -20.411 8.875   -8.992  1.00 13.18 ? 35  LEU A HA   1 
ATOM   254  H  HB2  . LEU A 1 16 ? -22.194 10.115  -8.186  1.00 13.67 ? 35  LEU A HB2  1 
ATOM   255  H  HB3  . LEU A 1 16 ? -22.679 8.872   -7.331  1.00 13.67 ? 35  LEU A HB3  1 
ATOM   256  H  HG   . LEU A 1 16 ? -20.790 9.063   -5.981  1.00 17.50 ? 35  LEU A HG   1 
ATOM   257  H  HD11 . LEU A 1 16 ? -19.348 10.882  -6.179  1.00 20.04 ? 35  LEU A HD11 1 
ATOM   258  H  HD12 . LEU A 1 16 ? -19.290 9.998   -7.498  1.00 20.04 ? 35  LEU A HD12 1 
ATOM   259  H  HD13 . LEU A 1 16 ? -20.118 11.354  -7.486  1.00 20.04 ? 35  LEU A HD13 1 
ATOM   260  H  HD21 . LEU A 1 16 ? -21.439 11.021  -4.856  1.00 21.98 ? 35  LEU A HD21 1 
ATOM   261  H  HD22 . LEU A 1 16 ? -22.284 11.464  -6.126  1.00 21.98 ? 35  LEU A HD22 1 
ATOM   262  H  HD23 . LEU A 1 16 ? -22.717 10.183  -5.292  1.00 21.98 ? 35  LEU A HD23 1 
ATOM   263  N  N    . LYS A 1 17 ? -21.513 6.185   -7.683  1.00 10.38 ? 36  LYS A N    1 
ATOM   264  C  CA   . LYS A 1 17 ? -21.066 4.938   -7.021  1.00 12.06 ? 36  LYS A CA   1 
ATOM   265  C  C    . LYS A 1 17 ? -19.925 4.306   -7.792  1.00 10.81 ? 36  LYS A C    1 
ATOM   266  O  O    . LYS A 1 17 ? -18.897 3.879   -7.212  1.00 11.57 ? 36  LYS A O    1 
ATOM   267  C  CB   . LYS A 1 17 ? -22.239 3.971   -6.887  1.00 13.57 ? 36  LYS A CB   1 
ATOM   268  C  CG   . LYS A 1 17 ? -21.878 2.637   -6.238  1.00 15.06 ? 36  LYS A CG   1 
ATOM   269  C  CD   . LYS A 1 17 ? -23.108 1.774   -6.059  1.00 17.91 ? 36  LYS A CD   1 
ATOM   270  C  CE   . LYS A 1 17 ? -22.768 0.509   -5.302  1.00 22.80 ? 36  LYS A CE   1 
ATOM   271  N  NZ   . LYS A 1 17 ? -23.981 -0.169  -4.918  1.00 26.92 ? 36  LYS A NZ   1 
ATOM   272  H  H    . LYS A 1 17 ? -22.348 6.202   -7.888  1.00 12.45 ? 36  LYS A H    1 
ATOM   273  H  HA   . LYS A 1 17 ? -20.746 5.149   -6.130  1.00 14.47 ? 36  LYS A HA   1 
ATOM   274  H  HB2  . LYS A 1 17 ? -22.926 4.387   -6.344  1.00 16.28 ? 36  LYS A HB2  1 
ATOM   275  H  HB3  . LYS A 1 17 ? -22.591 3.783   -7.772  1.00 16.28 ? 36  LYS A HB3  1 
ATOM   276  H  HG2  . LYS A 1 17 ? -21.250 2.162   -6.805  1.00 18.07 ? 36  LYS A HG2  1 
ATOM   277  H  HG3  . LYS A 1 17 ? -21.488 2.799   -5.364  1.00 18.07 ? 36  LYS A HG3  1 
ATOM   278  H  HD2  . LYS A 1 17 ? -23.775 2.264   -5.553  1.00 21.49 ? 36  LYS A HD2  1 
ATOM   279  H  HD3  . LYS A 1 17 ? -23.458 1.526   -6.929  1.00 21.49 ? 36  LYS A HD3  1 
ATOM   280  H  HE2  . LYS A 1 17 ? -22.250 -0.081  -5.871  1.00 27.36 ? 36  LYS A HE2  1 
ATOM   281  H  HE3  . LYS A 1 17 ? -22.272 0.733   -4.500  1.00 27.36 ? 36  LYS A HE3  1 
ATOM   282  H  HZ1  . LYS A 1 17 ? -24.453 -0.381  -5.643  1.00 32.30 ? 36  LYS A HZ1  1 
ATOM   283  H  HZ2  . LYS A 1 17 ? -23.785 -0.914  -4.473  1.00 32.30 ? 36  LYS A HZ2  1 
ATOM   284  H  HZ3  . LYS A 1 17 ? -24.473 0.358   -4.397  1.00 32.30 ? 36  LYS A HZ3  1 
ATOM   285  N  N    . LEU A 1 18 ? -20.077 4.231   -9.106  1.00 10.58 ? 37  LEU A N    1 
ATOM   286  C  CA   . LEU A 1 18 ? -19.012 3.681   -9.954  1.00 9.80  ? 37  LEU A CA   1 
ATOM   287  C  C    . LEU A 1 18 ? -17.711 4.491   -9.840  1.00 10.75 ? 37  LEU A C    1 
ATOM   288  O  O    . LEU A 1 18 ? -16.618 3.929   -9.617  1.00 11.54 ? 37  LEU A O    1 
ATOM   289  C  CB   . LEU A 1 18 ? -19.480 3.574   -11.430 1.00 10.59 ? 37  LEU A CB   1 
ATOM   290  C  CG   . LEU A 1 18 ? -18.545 2.897   -12.459 1.00 12.91 ? 37  LEU A CG   1 
ATOM   291  C  CD1  . LEU A 1 18 ? -19.313 2.403   -13.646 1.00 14.79 ? 37  LEU A CD1  1 
ATOM   292  C  CD2  . LEU A 1 18 ? -17.406 3.874   -12.909 1.00 14.33 ? 37  LEU A CD2  1 
ATOM   293  H  H    . LEU A 1 18 ? -20.777 4.488   -9.534  1.00 12.70 ? 37  LEU A H    1 
ATOM   294  H  HA   . LEU A 1 18 ? -18.817 2.781   -9.649  1.00 11.77 ? 37  LEU A HA   1 
ATOM   295  H  HB2  . LEU A 1 18 ? -20.313 3.078   -11.440 1.00 12.71 ? 37  LEU A HB2  1 
ATOM   296  H  HB3  . LEU A 1 18 ? -19.646 4.474   -11.753 1.00 12.71 ? 37  LEU A HB3  1 
ATOM   297  H  HG   . LEU A 1 18 ? -18.126 2.130   -12.039 1.00 15.49 ? 37  LEU A HG   1 
ATOM   298  H  HD11 . LEU A 1 18 ? -18.697 1.986   -14.269 1.00 17.75 ? 37  LEU A HD11 1 
ATOM   299  H  HD12 . LEU A 1 18 ? -19.972 1.757   -13.349 1.00 17.75 ? 37  LEU A HD12 1 
ATOM   300  H  HD13 . LEU A 1 18 ? -19.754 3.155   -14.071 1.00 17.75 ? 37  LEU A HD13 1 
ATOM   301  H  HD21 . LEU A 1 18 ? -17.806 4.659   -13.315 1.00 17.20 ? 37  LEU A HD21 1 
ATOM   302  H  HD22 . LEU A 1 18 ? -16.886 4.132   -12.132 1.00 17.20 ? 37  LEU A HD22 1 
ATOM   303  H  HD23 . LEU A 1 18 ? -16.839 3.421   -13.553 1.00 17.20 ? 37  LEU A HD23 1 
ATOM   304  N  N    . LEU A 1 19 ? -17.832 5.802   -9.986  1.00 10.15 ? 38  LEU A N    1 
ATOM   305  C  CA   . LEU A 1 19 ? -16.655 6.656   -9.935  1.00 9.78  ? 38  LEU A CA   1 
ATOM   306  C  C    . LEU A 1 19 ? -15.958 6.548   -8.586  1.00 11.34 ? 38  LEU A C    1 
ATOM   307  O  O    . LEU A 1 19 ? -14.725 6.577   -8.550  1.00 11.90 ? 38  LEU A O    1 
ATOM   308  C  CB   . LEU A 1 19 ? -17.050 8.099   -10.200 1.00 9.48  ? 38  LEU A CB   1 
ATOM   309  C  CG   . LEU A 1 19 ? -17.591 8.394   -11.597 1.00 9.78  ? 38  LEU A CG   1 
ATOM   310  C  CD1  . LEU A 1 19 ? -18.166 9.814   -11.615 1.00 10.61 ? 38  LEU A CD1  1 
ATOM   311  C  CD2  . LEU A 1 19 ? -16.479 8.220   -12.613 1.00 11.80 ? 38  LEU A CD2  1 
ATOM   312  H  H    . LEU A 1 19 ? -18.574 6.218   -10.114 1.00 12.18 ? 38  LEU A H    1 
ATOM   313  H  HA   . LEU A 1 19 ? -16.029 6.380   -10.623 1.00 11.74 ? 38  LEU A HA   1 
ATOM   314  H  HB2  . LEU A 1 19 ? -17.738 8.350   -9.564  1.00 11.38 ? 38  LEU A HB2  1 
ATOM   315  H  HB3  . LEU A 1 19 ? -16.269 8.659   -10.068 1.00 11.38 ? 38  LEU A HB3  1 
ATOM   316  H  HG   . LEU A 1 19 ? -18.303 7.770   -11.808 1.00 11.74 ? 38  LEU A HG   1 
ATOM   317  H  HD11 . LEU A 1 19 ? -18.511 10.003  -12.502 1.00 12.73 ? 38  LEU A HD11 1 
ATOM   318  H  HD12 . LEU A 1 19 ? -18.881 9.872   -10.962 1.00 12.73 ? 38  LEU A HD12 1 
ATOM   319  H  HD13 . LEU A 1 19 ? -17.461 10.442  -11.392 1.00 12.73 ? 38  LEU A HD13 1 
ATOM   320  H  HD21 . LEU A 1 19 ? -16.829 8.408   -13.498 1.00 14.16 ? 38  LEU A HD21 1 
ATOM   321  H  HD22 . LEU A 1 19 ? -15.761 8.836   -12.403 1.00 14.16 ? 38  LEU A HD22 1 
ATOM   322  H  HD23 . LEU A 1 19 ? -16.155 7.307   -12.572 1.00 14.16 ? 38  LEU A HD23 1 
ATOM   323  N  N    . LYS A 1 20 ? -16.718 6.484   -7.492  1.00 10.58 ? 39  LYS A N    1 
ATOM   324  C  CA   . LYS A 1 20 ? -16.094 6.399   -6.179  1.00 11.43 ? 39  LYS A CA   1 
ATOM   325  C  C    . LYS A 1 20 ? -15.298 5.106   -5.983  1.00 10.64 ? 39  LYS A C    1 
ATOM   326  O  O    . LYS A 1 20 ? -14.381 5.064   -5.141  1.00 11.55 ? 39  LYS A O    1 
ATOM   327  C  CB   . LYS A 1 20 ? -17.119 6.535   -5.073  1.00 14.18 ? 39  LYS A CB   1 
ATOM   328  C  CG   . LYS A 1 20 ? -17.684 7.923   -4.933  1.00 17.75 ? 39  LYS A CG   1 
ATOM   329  C  CD   . LYS A 1 20 ? -18.821 7.952   -3.933  1.00 19.69 ? 39  LYS A CD   1 
ATOM   330  C  CE   . LYS A 1 20 ? -18.378 7.450   -2.546  1.00 22.27 ? 39  LYS A CE   1 
ATOM   331  N  NZ   . LYS A 1 20 ? -19.481 7.584   -1.557  1.00 25.95 ? 39  LYS A NZ   1 
ATOM   332  H  H    . LYS A 1 20 ? -17.578 6.487   -7.486  1.00 12.70 ? 39  LYS A H    1 
ATOM   333  H  HA   . LYS A 1 20 ? -15.472 7.138   -6.089  1.00 13.71 ? 39  LYS A HA   1 
ATOM   334  H  HB2  . LYS A 1 20 ? -17.857 5.932   -5.256  1.00 17.01 ? 39  LYS A HB2  1 
ATOM   335  H  HB3  . LYS A 1 20 ? -16.702 6.298   -4.230  1.00 17.01 ? 39  LYS A HB3  1 
ATOM   336  H  HG2  . LYS A 1 20 ? -16.989 8.523   -4.621  1.00 21.30 ? 39  LYS A HG2  1 
ATOM   337  H  HG3  . LYS A 1 20 ? -18.025 8.219   -5.791  1.00 21.30 ? 39  LYS A HG3  1 
ATOM   338  H  HD2  . LYS A 1 20 ? -19.139 8.863   -3.838  1.00 23.62 ? 39  LYS A HD2  1 
ATOM   339  H  HD3  . LYS A 1 20 ? -19.537 7.378   -4.248  1.00 23.62 ? 39  LYS A HD3  1 
ATOM   340  H  HE2  . LYS A 1 20 ? -18.132 6.514   -2.606  1.00 26.73 ? 39  LYS A HE2  1 
ATOM   341  H  HE3  . LYS A 1 20 ? -17.625 7.978   -2.238  1.00 26.73 ? 39  LYS A HE3  1 
ATOM   342  H  HZ1  . LYS A 1 20 ? -20.185 7.106   -1.819  1.00 31.14 ? 39  LYS A HZ1  1 
ATOM   343  H  HZ2  . LYS A 1 20 ? -19.213 7.292   -0.760  1.00 31.14 ? 39  LYS A HZ2  1 
ATOM   344  H  HZ3  . LYS A 1 20 ? -19.723 8.438   -1.485  1.00 31.14 ? 39  LYS A HZ3  1 
ATOM   345  N  N    . SER A 1 21 ? -15.653 4.068   -6.733  1.00 10.24 ? 40  SER A N    1 
ATOM   346  C  CA   . SER A 1 21 ? -14.987 2.795   -6.576  1.00 11.28 ? 40  SER A CA   1 
ATOM   347  C  C    . SER A 1 21 ? -13.567 2.813   -7.146  1.00 10.57 ? 40  SER A C    1 
ATOM   348  O  O    . SER A 1 21 ? -12.701 2.041   -6.702  1.00 12.02 ? 40  SER A O    1 
ATOM   349  C  CB   . SER A 1 21 ? -15.778 1.648   -7.198  1.00 12.55 ? 40  SER A CB   1 
ATOM   350  O  OG   . SER A 1 21 ? -15.667 1.588   -8.610  1.00 13.14 ? 40  SER A OG   1 
ATOM   351  H  H    . SER A 1 21 ? -16.270 4.080   -7.332  1.00 12.29 ? 40  SER A H    1 
ATOM   352  H  HA   . SER A 1 21 ? -14.912 2.609   -5.627  1.00 13.54 ? 40  SER A HA   1 
ATOM   353  H  HB2  . SER A 1 21 ? -15.451 0.813   -6.828  1.00 15.06 ? 40  SER A HB2  1 
ATOM   354  H  HB3  . SER A 1 21 ? -16.714 1.759   -6.967  1.00 15.06 ? 40  SER A HB3  1 
ATOM   355  H  HG   . SER A 1 21 ? -15.953 2.300   -8.951  1.00 15.77 ? 40  SER A HG   1 
ATOM   356  N  N    A VAL A 1 22 ? -13.355 3.712   -8.094  0.59 10.72 ? 41  VAL A N    1 
ATOM   357  N  N    B VAL A 1 22 ? -13.304 3.672   -8.129  0.41 10.27 ? 41  VAL A N    1 
ATOM   358  C  CA   A VAL A 1 22 ? -12.124 3.749   -8.838  0.59 10.37 ? 41  VAL A CA   1 
ATOM   359  C  CA   B VAL A 1 22 ? -11.968 3.741   -8.721  0.41 9.51  ? 41  VAL A CA   1 
ATOM   360  C  C    A VAL A 1 22 ? -11.336 5.040   -8.552  0.59 9.88  ? 41  VAL A C    1 
ATOM   361  C  C    B VAL A 1 22 ? -11.299 5.101   -8.606  0.41 9.70  ? 41  VAL A C    1 
ATOM   362  O  O    A VAL A 1 22 ? -10.120 5.049   -8.668  0.59 10.72 ? 41  VAL A O    1 
ATOM   363  O  O    B VAL A 1 22 ? -10.137 5.256   -8.978  0.41 10.39 ? 41  VAL A O    1 
ATOM   364  C  CB   A VAL A 1 22 ? -12.420 3.579   -10.342 0.59 12.15 ? 41  VAL A CB   1 
ATOM   365  C  CB   B VAL A 1 22 ? -11.968 3.382   -10.213 0.41 9.26  ? 41  VAL A CB   1 
ATOM   366  C  CG1  A VAL A 1 22 ? -13.253 4.776   -10.878 0.59 10.65 ? 41  VAL A CG1  1 
ATOM   367  C  CG1  B VAL A 1 22 ? -12.314 1.934   -10.396 0.41 9.31  ? 41  VAL A CG1  1 
ATOM   368  C  CG2  A VAL A 1 22 ? -11.137 3.389   -11.118 0.59 14.34 ? 41  VAL A CG2  1 
ATOM   369  C  CG2  B VAL A 1 22 ? -12.934 4.293   -11.008 0.41 9.44  ? 41  VAL A CG2  1 
ATOM   370  H  H    A VAL A 1 22 ? -13.921 4.318   -8.323  0.59 12.86 ? 41  VAL A H    1 
ATOM   371  H  H    B VAL A 1 22 ? -13.874 4.220   -8.469  0.41 12.32 ? 41  VAL A H    1 
ATOM   372  H  HA   A VAL A 1 22 ? -11.572 3.001   -8.561  0.59 12.44 ? 41  VAL A HA   1 
ATOM   373  H  HA   B VAL A 1 22 ? -11.400 3.099   -8.268  0.41 11.41 ? 41  VAL A HA   1 
ATOM   374  H  HB   A VAL A 1 22 ? -12.953 2.777   -10.461 0.59 14.58 ? 41  VAL A HB   1 
ATOM   375  H  HB   B VAL A 1 22 ? -11.075 3.520   -10.567 0.41 11.11 ? 41  VAL A HB   1 
ATOM   376  H  HG11 A VAL A 1 22 ? -13.424 4.643   -11.824 0.59 12.78 ? 41  VAL A HG11 1 
ATOM   377  H  HG11 B VAL A 1 22 ? -12.464 1.533   -9.526  0.41 11.17 ? 41  VAL A HG11 1 
ATOM   378  H  HG12 A VAL A 1 22 ? -14.092 4.819   -10.393 0.59 12.78 ? 41  VAL A HG12 1 
ATOM   379  H  HG12 B VAL A 1 22 ? -13.118 1.867   -10.935 0.41 11.17 ? 41  VAL A HG12 1 
ATOM   380  H  HG13 A VAL A 1 22 ? -12.751 5.595   -10.744 0.59 12.78 ? 41  VAL A HG13 1 
ATOM   381  H  HG13 B VAL A 1 22 ? -11.578 1.488   -10.844 0.41 11.17 ? 41  VAL A HG13 1 
ATOM   382  H  HG21 A VAL A 1 22 ? -11.351 3.285   -12.058 0.59 17.21 ? 41  VAL A HG21 1 
ATOM   383  H  HG21 B VAL A 1 22 ? -12.909 4.039   -11.944 0.41 11.32 ? 41  VAL A HG21 1 
ATOM   384  H  HG22 A VAL A 1 22 ? -10.574 4.168   -10.991 0.59 17.21 ? 41  VAL A HG22 1 
ATOM   385  H  HG22 B VAL A 1 22 ? -13.832 4.181   -10.658 0.41 11.32 ? 41  VAL A HG22 1 
ATOM   386  H  HG23 A VAL A 1 22 ? -10.685 2.596   -10.791 0.59 17.21 ? 41  VAL A HG23 1 
ATOM   387  H  HG23 B VAL A 1 22 ? -12.653 5.216   -10.907 0.41 11.32 ? 41  VAL A HG23 1 
ATOM   388  N  N    . GLY A 1 23 ? -12.038 6.097   -8.131  1.00 10.41 ? 42  GLY A N    1 
ATOM   389  C  CA   . GLY A 1 23 ? -11.460 7.420   -8.021  1.00 10.95 ? 42  GLY A CA   1 
ATOM   390  C  C    . GLY A 1 23 ? -11.909 8.196   -6.818  1.00 10.66 ? 42  GLY A C    1 
ATOM   391  O  O    . GLY A 1 23 ? -12.407 7.644   -5.853  1.00 10.45 ? 42  GLY A O    1 
ATOM   392  H  H    . GLY A 1 23 ? -12.861 6.046   -7.887  0.54 12.49 ? 42  GLY A H    1 
ATOM   393  H  HA2  . GLY A 1 23 ? -10.494 7.341   -7.985  1.00 13.14 ? 42  GLY A HA2  1 
ATOM   394  H  HA3  . GLY A 1 23 ? -11.691 7.932   -8.812  1.00 13.14 ? 42  GLY A HA3  1 
ATOM   395  N  N    . ALA A 1 24 ? -11.723 9.508   -6.881  1.00 10.47 ? 43  ALA A N    1 
ATOM   396  C  CA   . ALA A 1 24 ? -12.083 10.398  -5.808  1.00 11.02 ? 43  ALA A CA   1 
ATOM   397  C  C    . ALA A 1 24 ? -13.554 10.749  -5.877  1.00 10.44 ? 43  ALA A C    1 
ATOM   398  O  O    . ALA A 1 24 ? -14.139 10.836  -6.973  1.00 12.69 ? 43  ALA A O    1 
ATOM   399  C  CB   . ALA A 1 24 ? -11.269 11.663  -5.875  1.00 15.18 ? 43  ALA A CB   1 
ATOM   400  H  H    . ALA A 1 24 ? -11.379 9.910   -7.559  1.00 12.57 ? 43  ALA A H    1 
ATOM   401  H  HA   . ALA A 1 24 ? -11.909 9.965   -4.958  1.00 13.22 ? 43  ALA A HA   1 
ATOM   402  H  HB1  . ALA A 1 24 ? -10.329 11.437  -5.801  1.00 18.21 ? 43  ALA A HB1  1 
ATOM   403  H  HB2  . ALA A 1 24 ? -11.438 12.102  -6.724  1.00 18.21 ? 43  ALA A HB2  1 
ATOM   404  H  HB3  . ALA A 1 24 ? -11.530 12.244  -5.144  1.00 18.21 ? 43  ALA A HB3  1 
ATOM   405  N  N    . GLN A 1 25 ? -14.125 10.968  -4.693  1.00 11.15 ? 44  GLN A N    1 
ATOM   406  C  CA   . GLN A 1 25 ? -15.476 11.461  -4.531  1.00 14.51 ? 44  GLN A CA   1 
ATOM   407  C  C    . GLN A 1 25 ? -15.478 12.978  -4.638  1.00 15.79 ? 44  GLN A C    1 
ATOM   408  O  O    . GLN A 1 25 ? -14.763 13.635  -3.925  1.00 17.55 ? 44  GLN A O    1 
ATOM   409  C  CB   . GLN A 1 25 ? -16.062 11.034  -3.185  1.00 17.49 ? 44  GLN A CB   1 
ATOM   410  C  CG   . GLN A 1 25 ? -17.480 11.664  -2.986  1.00 21.15 ? 44  GLN A CG   1 
ATOM   411  C  CD   . GLN A 1 25 ? -18.340 11.040  -1.893  1.00 26.24 ? 44  GLN A CD   1 
ATOM   412  O  OE1  . GLN A 1 25 ? -17.866 10.292  -1.071  1.00 26.71 ? 44  GLN A OE1  1 
ATOM   413  N  NE2  . GLN A 1 25 ? -19.640 11.370  -1.896  1.00 28.37 ? 44  GLN A NE2  1 
ATOM   414  H  H    . GLN A 1 25 ? -13.726 10.831  -3.944  1.00 13.38 ? 44  GLN A H    1 
ATOM   415  H  HA   . GLN A 1 25 ? -16.036 11.103  -5.236  1.00 17.42 ? 44  GLN A HA   1 
ATOM   416  H  HB2  . GLN A 1 25 ? -16.149 10.068  -3.161  1.00 20.99 ? 44  GLN A HB2  1 
ATOM   417  H  HB3  . GLN A 1 25 ? -15.485 11.342  -2.468  1.00 20.99 ? 44  GLN A HB3  1 
ATOM   418  H  HG2  . GLN A 1 25 ? -17.369 12.603  -2.766  1.00 25.38 ? 44  GLN A HG2  1 
ATOM   419  H  HG3  . GLN A 1 25 ? -17.969 11.585  -3.820  1.00 25.38 ? 44  GLN A HG3  1 
ATOM   420  H  HE21 . GLN A 1 25 ? -19.946 11.908  -2.493  1.00 34.04 ? 44  GLN A HE21 1 
ATOM   421  H  HE22 . GLN A 1 25 ? -20.168 11.045  -1.300  1.00 34.04 ? 44  GLN A HE22 1 
ATOM   422  N  N    . LYS A 1 26 ? -16.262 13.516  -5.583  1.00 15.49 ? 45  LYS A N    1 
ATOM   423  C  CA   . LYS A 1 26 ? -16.365 14.952  -5.796  1.00 17.25 ? 45  LYS A CA   1 
ATOM   424  C  C    . LYS A 1 26 ? -17.798 15.301  -6.070  1.00 18.67 ? 45  LYS A C    1 
ATOM   425  O  O    . LYS A 1 26 ? -18.588 14.434  -6.441  1.00 18.44 ? 45  LYS A O    1 
ATOM   426  C  CB   . LYS A 1 26 ? -15.511 15.361  -7.003  1.00 19.78 ? 45  LYS A CB   1 
ATOM   427  C  CG   . LYS A 1 26 ? -14.057 15.076  -6.796  1.00 23.91 ? 45  LYS A CG   1 
ATOM   428  C  CD   . LYS A 1 26 ? -13.218 16.047  -7.536  1.00 25.89 ? 45  LYS A CD   1 
ATOM   429  C  CE   . LYS A 1 26 ? -13.131 15.627  -8.938  1.00 26.01 ? 45  LYS A CE   1 
ATOM   430  N  NZ   . LYS A 1 26 ? -12.145 16.463  -9.648  1.00 25.88 ? 45  LYS A NZ   1 
ATOM   431  H  H    . LYS A 1 26 ? -16.750 13.054  -6.119  1.00 18.58 ? 45  LYS A H    1 
ATOM   432  H  HA   . LYS A 1 26 ? -16.062 15.433  -5.010  1.00 20.70 ? 45  LYS A HA   1 
ATOM   433  H  HB2  . LYS A 1 26 ? -15.807 14.867  -7.783  1.00 23.73 ? 45  LYS A HB2  1 
ATOM   434  H  HB3  . LYS A 1 26 ? -15.613 16.314  -7.155  1.00 23.73 ? 45  LYS A HB3  1 
ATOM   435  H  HG2  . LYS A 1 26 ? -13.846 15.147  -5.852  1.00 28.70 ? 45  LYS A HG2  1 
ATOM   436  H  HG3  . LYS A 1 26 ? -13.853 14.186  -7.122  1.00 28.70 ? 45  LYS A HG3  1 
ATOM   437  H  HD2  . LYS A 1 26 ? -13.624 16.927  -7.498  1.00 31.06 ? 45  LYS A HD2  1 
ATOM   438  H  HD3  . LYS A 1 26 ? -12.324 16.063  -7.159  1.00 31.06 ? 45  LYS A HD3  1 
ATOM   439  H  HE2  . LYS A 1 26 ? -12.843 14.702  -8.984  1.00 31.21 ? 45  LYS A HE2  1 
ATOM   440  H  HE3  . LYS A 1 26 ? -13.995 15.738  -9.365  1.00 31.21 ? 45  LYS A HE3  1 
ATOM   441  H  HZ1  . LYS A 1 26 ? -12.089 16.211  -10.499 1.00 31.05 ? 45  LYS A HZ1  1 
ATOM   442  H  HZ2  . LYS A 1 26 ? -12.390 17.318  -9.614  1.00 31.05 ? 45  LYS A HZ2  1 
ATOM   443  H  HZ3  . LYS A 1 26 ? -11.344 16.377  -9.268  1.00 31.05 ? 45  LYS A HZ3  1 
ATOM   444  N  N    . ASP A 1 27 ? -18.135 16.574  -5.867  1.00 21.75 ? 46  ASP A N    1 
ATOM   445  C  CA   . ASP A 1 27 ? -19.459 17.091  -6.202  1.00 24.10 ? 46  ASP A CA   1 
ATOM   446  C  C    . ASP A 1 27 ? -19.547 17.245  -7.720  1.00 22.41 ? 46  ASP A C    1 
ATOM   447  O  O    . ASP A 1 27 ? -20.539 16.869  -8.358  1.00 24.13 ? 46  ASP A O    1 
ATOM   448  C  CB   . ASP A 1 27 ? -19.667 18.470  -5.549  1.00 29.09 ? 46  ASP A CB   1 
ATOM   449  C  CG   . ASP A 1 27 ? -19.394 18.476  -4.044  1.00 34.24 ? 46  ASP A CG   1 
ATOM   450  O  OD1  . ASP A 1 27 ? -19.571 17.432  -3.379  1.00 35.22 ? 46  ASP A OD1  1 
ATOM   451  O  OD2  . ASP A 1 27 ? -19.007 19.548  -3.513  1.00 37.04 ? 46  ASP A OD2  1 
ATOM   452  H  H    . ASP A 1 27 ? -17.607 17.165  -5.533  1.00 26.10 ? 46  ASP A H    1 
ATOM   453  H  HA   . ASP A 1 27 ? -20.149 16.481  -5.898  1.00 28.92 ? 46  ASP A HA   1 
ATOM   454  H  HB2  . ASP A 1 27 ? -19.066 19.108  -5.963  1.00 34.91 ? 46  ASP A HB2  1 
ATOM   455  H  HB3  . ASP A 1 27 ? -20.587 18.746  -5.686  1.00 34.91 ? 46  ASP A HB3  1 
ATOM   456  N  N    . THR A 1 28 ? -18.500 17.823  -8.302  1.00 19.97 ? 47  THR A N    1 
ATOM   457  C  CA   . THR A 1 28 ? -18.486 18.089  -9.731  1.00 20.05 ? 47  THR A CA   1 
ATOM   458  C  C    . THR A 1 28 ? -17.231 17.475  -10.323 1.00 17.74 ? 47  THR A C    1 
ATOM   459  O  O    . THR A 1 28 ? -16.160 17.541  -9.704  1.00 17.65 ? 47  THR A O    1 
ATOM   460  C  CB   . THR A 1 28 ? -18.488 19.605  -9.978  1.00 24.67 ? 47  THR A CB   1 
ATOM   461  O  OG1  . THR A 1 28 ? -19.688 20.169  -9.432  1.00 28.64 ? 47  THR A OG1  1 
ATOM   462  C  CG2  . THR A 1 28 ? -18.470 19.907  -11.419 1.00 25.58 ? 47  THR A CG2  1 
ATOM   463  H  H    . THR A 1 28 ? -17.786 18.069  -7.890  1.00 23.96 ? 47  THR A H    1 
ATOM   464  H  HA   . THR A 1 28 ? -19.266 17.695  -10.153 1.00 24.06 ? 47  THR A HA   1 
ATOM   465  H  HB   . THR A 1 28 ? -17.712 20.010  -9.560  1.00 29.60 ? 47  THR A HB   1 
ATOM   466  H  HG1  . THR A 1 28 ? -19.725 20.021  -8.606  1.00 34.36 ? 47  THR A HG1  1 
ATOM   467  H  HG21 . THR A 1 28 ? -17.674 19.532  -11.827 1.00 30.70 ? 47  THR A HG21 1 
ATOM   468  H  HG22 . THR A 1 28 ? -19.253 19.527  -11.847 1.00 30.70 ? 47  THR A HG22 1 
ATOM   469  H  HG23 . THR A 1 28 ? -18.472 20.868  -11.556 1.00 30.70 ? 47  THR A HG23 1 
ATOM   470  N  N    . TYR A 1 29 ? -17.377 16.827  -11.474 1.00 14.69 ? 48  TYR A N    1 
ATOM   471  C  CA   . TYR A 1 29 ? -16.266 16.242  -12.214 1.00 12.70 ? 48  TYR A CA   1 
ATOM   472  C  C    . TYR A 1 29 ? -16.184 16.956  -13.556 1.00 13.72 ? 48  TYR A C    1 
ATOM   473  O  O    . TYR A 1 29 ? -17.123 17.664  -13.931 1.00 14.48 ? 48  TYR A O    1 
ATOM   474  C  CB   . TYR A 1 29 ? -16.493 14.738  -12.471 1.00 11.76 ? 48  TYR A CB   1 
ATOM   475  C  CG   . TYR A 1 29 ? -16.500 13.861  -11.214 1.00 11.40 ? 48  TYR A CG   1 
ATOM   476  C  CD1  . TYR A 1 29 ? -17.631 13.744  -10.429 1.00 12.04 ? 48  TYR A CD1  1 
ATOM   477  C  CD2  . TYR A 1 29 ? -15.395 13.132  -10.843 1.00 10.71 ? 48  TYR A CD2  1 
ATOM   478  C  CE1  . TYR A 1 29 ? -17.658 12.958  -9.289  1.00 11.99 ? 48  TYR A CE1  1 
ATOM   479  C  CE2  . TYR A 1 29 ? -15.405 12.348  -9.702  1.00 10.72 ? 48  TYR A CE2  1 
ATOM   480  C  CZ   . TYR A 1 29 ? -16.548 12.251  -8.942  1.00 11.28 ? 48  TYR A CZ   1 
ATOM   481  O  OH   . TYR A 1 29 ? -16.588 11.488  -7.807  1.00 11.46 ? 48  TYR A OH   1 
ATOM   482  H  H    . TYR A 1 29 ? -18.137 16.709  -11.858 1.00 17.63 ? 48  TYR A H    1 
ATOM   483  H  HA   . TYR A 1 29 ? -15.434 16.365  -11.730 1.00 15.24 ? 48  TYR A HA   1 
ATOM   484  H  HB2  . TYR A 1 29 ? -17.351 14.626  -12.910 1.00 14.11 ? 48  TYR A HB2  1 
ATOM   485  H  HB3  . TYR A 1 29 ? -15.786 14.414  -13.050 1.00 14.11 ? 48  TYR A HB3  1 
ATOM   486  H  HD1  . TYR A 1 29 ? -18.393 14.223  -10.663 1.00 14.45 ? 48  TYR A HD1  1 
ATOM   487  H  HD2  . TYR A 1 29 ? -14.618 13.189  -11.351 1.00 12.86 ? 48  TYR A HD2  1 
ATOM   488  H  HE1  . TYR A 1 29 ? -18.430 12.903  -8.774  1.00 14.38 ? 48  TYR A HE1  1 
ATOM   489  H  HE2  . TYR A 1 29 ? -14.647 11.866  -9.463  1.00 12.86 ? 48  TYR A HE2  1 
ATOM   490  H  HH   . TYR A 1 29 ? -15.852 11.100  -7.696  1.00 13.75 ? 48  TYR A HH   1 
ATOM   491  N  N    . THR A 1 30 ? -15.081 16.764  -14.279 1.00 12.57 ? 49  THR A N    1 
ATOM   492  C  CA   . THR A 1 30 ? -15.077 17.100  -15.689 1.00 12.18 ? 49  THR A CA   1 
ATOM   493  C  C    . THR A 1 30 ? -15.407 15.884  -16.532 1.00 11.68 ? 49  THR A C    1 
ATOM   494  O  O    . THR A 1 30 ? -15.252 14.727  -16.092 1.00 10.92 ? 49  THR A O    1 
ATOM   495  C  CB   . THR A 1 30 ? -13.764 17.681  -16.150 1.00 15.18 ? 49  THR A CB   1 
ATOM   496  O  OG1  . THR A 1 30 ? -12.764 16.654  -16.117 1.00 16.08 ? 49  THR A OG1  1 
ATOM   497  C  CG2  . THR A 1 30 ? -13.391 18.886  -15.298 1.00 15.17 ? 49  THR A CG2  1 
ATOM   498  H  H    . THR A 1 30 ? -14.339 16.448  -13.979 1.00 15.09 ? 49  THR A H    1 
ATOM   499  H  HA   . THR A 1 30 ? -15.764 17.764  -15.850 1.00 14.62 ? 49  THR A HA   1 
ATOM   500  H  HB   . THR A 1 30 ? -13.865 17.987  -17.065 1.00 18.21 ? 49  THR A HB   1 
ATOM   501  H  HG1  . THR A 1 30 ? -12.681 16.359  -15.335 1.00 19.29 ? 49  THR A HG1  1 
ATOM   502  H  HG21 . THR A 1 30 ? -14.077 19.568  -15.371 1.00 18.20 ? 49  THR A HG21 1 
ATOM   503  H  HG22 . THR A 1 30 ? -13.305 18.621  -14.369 1.00 18.20 ? 49  THR A HG22 1 
ATOM   504  H  HG23 . THR A 1 30 ? -12.546 19.255  -15.600 1.00 18.20 ? 49  THR A HG23 1 
ATOM   505  N  N    . MET A 1 31 ? -15.847 16.136  -17.756 1.00 12.09 ? 50  MET A N    1 
ATOM   506  C  CA   . MET A 1 31 ? -16.140 15.028  -18.659 1.00 12.77 ? 50  MET A CA   1 
ATOM   507  C  C    . MET A 1 31 ? -14.858 14.222  -18.917 1.00 12.98 ? 50  MET A C    1 
ATOM   508  O  O    . MET A 1 31 ? -14.919 13.003  -19.006 1.00 12.06 ? 50  MET A O    1 
ATOM   509  C  CB   . MET A 1 31 ? -16.699 15.538  -19.970 1.00 12.71 ? 50  MET A CB   1 
ATOM   510  C  CG   . MET A 1 31 ? -16.965 14.436  -20.970 1.00 15.74 ? 50  MET A CG   1 
ATOM   511  S  SD   . MET A 1 31 ? -18.238 13.295  -20.431 1.00 18.97 ? 50  MET A SD   1 
ATOM   512  C  CE   . MET A 1 31 ? -19.615 14.376  -20.645 1.00 21.06 ? 50  MET A CE   1 
ATOM   513  H  H    . MET A 1 31 ? -15.982 16.919  -18.085 1.00 14.51 ? 50  MET A H    1 
ATOM   514  H  HA   . MET A 1 31 ? -16.804 14.450  -18.251 1.00 15.33 ? 50  MET A HA   1 
ATOM   515  H  HB2  . MET A 1 31 ? -17.537 15.994  -19.798 1.00 15.25 ? 50  MET A HB2  1 
ATOM   516  H  HB3  . MET A 1 31 ? -16.062 16.153  -20.365 1.00 15.25 ? 50  MET A HB3  1 
ATOM   517  H  HG2  . MET A 1 31 ? -17.254 14.833  -21.807 1.00 18.89 ? 50  MET A HG2  1 
ATOM   518  H  HG3  . MET A 1 31 ? -16.149 13.931  -21.108 1.00 18.89 ? 50  MET A HG3  1 
ATOM   519  H  HE1  . MET A 1 31 ? -19.493 15.157  -20.083 1.00 25.27 ? 50  MET A HE1  1 
ATOM   520  H  HE2  . MET A 1 31 ? -19.665 14.643  -21.576 1.00 25.27 ? 50  MET A HE2  1 
ATOM   521  H  HE3  . MET A 1 31 ? -20.426 13.908  -20.390 1.00 25.27 ? 50  MET A HE3  1 
ATOM   522  N  N    . LYS A 1 32 ? -13.702 14.879  -19.070 1.00 14.94 ? 51  LYS A N    1 
ATOM   523  C  CA   . LYS A 1 32 ? -12.497 14.096  -19.396 1.00 16.35 ? 51  LYS A CA   1 
ATOM   524  C  C    . LYS A 1 32 ? -12.111 13.197  -18.213 1.00 12.46 ? 51  LYS A C    1 
ATOM   525  O  O    . LYS A 1 32 ? -11.619 12.092  -18.410 1.00 13.15 ? 51  LYS A O    1 
ATOM   526  C  CB   . LYS A 1 32 ? -11.295 14.938  -19.913 1.00 22.83 ? 51  LYS A CB   1 
ATOM   527  C  CG   . LYS A 1 32 ? -10.607 15.748  -18.934 1.00 26.85 ? 51  LYS A CG   1 
ATOM   528  C  CD   . LYS A 1 32 ? -9.332  16.416  -19.538 1.00 28.81 ? 51  LYS A CD   1 
ATOM   529  C  CE   . LYS A 1 32 ? -9.528  17.008  -20.930 1.00 30.54 ? 51  LYS A CE   1 
ATOM   530  N  NZ   . LYS A 1 32 ? -8.245  17.602  -21.454 1.00 33.26 ? 51  LYS A NZ   1 
ATOM   531  H  H    . LYS A 1 32 ? -13.588 15.728  -18.996 1.00 17.92 ? 51  LYS A H    1 
ATOM   532  H  HA   . LYS A 1 32 ? -12.735 13.498  -20.122 1.00 19.62 ? 51  LYS A HA   1 
ATOM   533  H  HB2  . LYS A 1 32 ? -10.641 14.332  -20.294 1.00 27.40 ? 51  LYS A HB2  1 
ATOM   534  H  HB3  . LYS A 1 32 ? -11.619 15.536  -20.604 1.00 27.40 ? 51  LYS A HB3  1 
ATOM   535  H  HG2  . LYS A 1 32 ? -11.201 16.451  -18.626 1.00 32.22 ? 51  LYS A HG2  1 
ATOM   536  H  HG3  . LYS A 1 32 ? -10.334 15.189  -18.190 1.00 32.22 ? 51  LYS A HG3  1 
ATOM   537  H  HD2  . LYS A 1 32 ? -9.050  17.134  -18.950 1.00 34.57 ? 51  LYS A HD2  1 
ATOM   538  H  HD3  . LYS A 1 32 ? -8.631  15.748  -19.598 1.00 34.57 ? 51  LYS A HD3  1 
ATOM   539  H  HE2  . LYS A 1 32 ? -9.812  16.309  -21.539 1.00 36.65 ? 51  LYS A HE2  1 
ATOM   540  H  HE3  . LYS A 1 32 ? -10.196 17.711  -20.889 1.00 36.65 ? 51  LYS A HE3  1 
ATOM   541  H  HZ1  . LYS A 1 32 ? -7.616  16.974  -21.503 1.00 39.91 ? 51  LYS A HZ1  1 
ATOM   542  H  HZ2  . LYS A 1 32 ? -8.377  17.943  -22.266 1.00 39.91 ? 51  LYS A HZ2  1 
ATOM   543  H  HZ3  . LYS A 1 32 ? -7.965  18.250  -20.911 1.00 39.91 ? 51  LYS A HZ3  1 
ATOM   544  N  N    . GLU A 1 33 ? -12.370 13.659  -16.989 1.00 12.24 ? 52  GLU A N    1 
ATOM   545  C  CA   . GLU A 1 33 ? -12.134 12.887  -15.811 1.00 12.48 ? 52  GLU A CA   1 
ATOM   546  C  C    . GLU A 1 33 ? -13.061 11.649  -15.790 1.00 10.98 ? 52  GLU A C    1 
ATOM   547  O  O    . GLU A 1 33 ? -12.637 10.533  -15.421 1.00 10.58 ? 52  GLU A O    1 
ATOM   548  C  CB   . GLU A 1 33 ? -12.479 13.811  -14.674 1.00 18.11 ? 52  GLU A CB   1 
ATOM   549  C  CG   . GLU A 1 33 ? -12.243 13.344  -13.379 1.00 19.55 ? 52  GLU A CG   1 
ATOM   550  C  CD   . GLU A 1 33 ? -12.341 14.492  -12.351 1.00 16.79 ? 52  GLU A CD   1 
ATOM   551  O  OE1  . GLU A 1 33 ? -13.073 15.535  -12.494 1.00 15.94 ? 52  GLU A OE1  1 
ATOM   552  O  OE2  . GLU A 1 33 ? -11.684 14.285  -11.353 1.00 15.85 ? 52  GLU A OE2  1 
ATOM   553  H  H    . GLU A 1 33 ? -12.691 14.440  -16.830 1.00 14.69 ? 52  GLU A H    1 
ATOM   554  H  HA   . GLU A 1 33 ? -11.205 12.614  -15.751 1.00 14.97 ? 52  GLU A HA   1 
ATOM   555  H  HB2  . GLU A 1 33 ? -11.964 14.626  -14.781 1.00 21.73 ? 52  GLU A HB2  1 
ATOM   556  H  HB3  . GLU A 1 33 ? -13.424 14.021  -14.733 1.00 21.73 ? 52  GLU A HB3  1 
ATOM   557  H  HG2  . GLU A 1 33 ? -12.906 12.673  -13.152 1.00 23.46 ? 52  GLU A HG2  1 
ATOM   558  H  HG3  . GLU A 1 33 ? -11.351 12.966  -13.331 1.00 23.46 ? 52  GLU A HG3  1 
ATOM   559  N  N    . VAL A 1 34 ? -14.339 11.859  -16.108 1.00 9.92  ? 53  VAL A N    1 
ATOM   560  C  CA   . VAL A 1 34 ? -15.290 10.779  -16.092 1.00 9.13  ? 53  VAL A CA   1 
ATOM   561  C  C    . VAL A 1 34 ? -14.903 9.738   -17.119 1.00 9.72  ? 53  VAL A C    1 
ATOM   562  O  O    . VAL A 1 34 ? -14.949 8.543   -16.850 1.00 8.65  ? 53  VAL A O    1 
ATOM   563  C  CB   . VAL A 1 34 ? -16.723 11.327  -16.307 1.00 10.09 ? 53  VAL A CB   1 
ATOM   564  C  CG1  . VAL A 1 34 ? -17.686 10.182  -16.582 1.00 11.59 ? 53  VAL A CG1  1 
ATOM   565  C  CG2  . VAL A 1 34 ? -17.166 12.101  -15.094 1.00 11.71 ? 53  VAL A CG2  1 
ATOM   566  H  H    . VAL A 1 34 ? -14.669 12.621  -16.334 1.00 11.90 ? 53  VAL A H    1 
ATOM   567  H  HA   . VAL A 1 34 ? -15.265 10.355  -15.220 1.00 10.96 ? 53  VAL A HA   1 
ATOM   568  H  HB   . VAL A 1 34 ? -16.729 11.924  -17.071 1.00 12.11 ? 53  VAL A HB   1 
ATOM   569  H  HG11 . VAL A 1 34 ? -18.576 10.544  -16.713 1.00 13.91 ? 53  VAL A HG11 1 
ATOM   570  H  HG12 . VAL A 1 34 ? -17.398 9.712   -17.380 1.00 13.91 ? 53  VAL A HG12 1 
ATOM   571  H  HG13 . VAL A 1 34 ? -17.683 9.578   -15.823 1.00 13.91 ? 53  VAL A HG13 1 
ATOM   572  H  HG21 . VAL A 1 34 ? -18.063 12.436  -15.244 1.00 14.06 ? 53  VAL A HG21 1 
ATOM   573  H  HG22 . VAL A 1 34 ? -17.157 11.511  -14.323 1.00 14.06 ? 53  VAL A HG22 1 
ATOM   574  H  HG23 . VAL A 1 34 ? -16.555 12.841  -14.951 1.00 14.06 ? 53  VAL A HG23 1 
ATOM   575  N  N    . LEU A 1 35 ? -14.538 10.174  -18.318 1.00 9.98  ? 54  LEU A N    1 
ATOM   576  C  CA   . LEU A 1 35 ? -14.093 9.225   -19.340 1.00 9.69  ? 54  LEU A CA   1 
ATOM   577  C  C    . LEU A 1 35 ? -12.910 8.397   -18.825 1.00 9.26  ? 54  LEU A C    1 
ATOM   578  O  O    . LEU A 1 35 ? -12.898 7.164   -18.962 1.00 9.94  ? 54  LEU A O    1 
ATOM   579  C  CB   . LEU A 1 35 ? -13.700 9.969   -20.621 1.00 9.87  ? 54  LEU A CB   1 
ATOM   580  C  CG   . LEU A 1 35 ? -14.860 10.409  -21.521 1.00 11.58 ? 54  LEU A CG   1 
ATOM   581  C  CD1  . LEU A 1 35 ? -14.355 11.535  -22.466 1.00 14.19 ? 54  LEU A CD1  1 
ATOM   582  C  CD2  . LEU A 1 35 ? -15.435 9.240   -22.294 1.00 11.65 ? 54  LEU A CD2  1 
ATOM   583  H  H    . LEU A 1 35 ? -14.537 10.997  -18.566 1.00 11.98 ? 54  LEU A H    1 
ATOM   584  H  HA   . LEU A 1 35 ? -14.819 8.618   -19.552 1.00 11.62 ? 54  LEU A HA   1 
ATOM   585  H  HB2  . LEU A 1 35 ? -13.208 10.767  -20.372 1.00 11.84 ? 54  LEU A HB2  1 
ATOM   586  H  HB3  . LEU A 1 35 ? -13.128 9.389   -21.149 1.00 11.84 ? 54  LEU A HB3  1 
ATOM   587  H  HG   . LEU A 1 35 ? -15.566 10.778  -20.967 1.00 13.89 ? 54  LEU A HG   1 
ATOM   588  H  HD11 . LEU A 1 35 ? -15.085 11.818  -23.039 1.00 17.03 ? 54  LEU A HD11 1 
ATOM   589  H  HD12 . LEU A 1 35 ? -14.045 12.282  -21.930 1.00 17.03 ? 54  LEU A HD12 1 
ATOM   590  H  HD13 . LEU A 1 35 ? -13.626 11.190  -23.006 1.00 17.03 ? 54  LEU A HD13 1 
ATOM   591  H  HD21 . LEU A 1 35 ? -14.738 8.856   -22.849 1.00 13.98 ? 54  LEU A HD21 1 
ATOM   592  H  HD22 . LEU A 1 35 ? -15.761 8.576   -21.666 1.00 13.98 ? 54  LEU A HD22 1 
ATOM   593  H  HD23 . LEU A 1 35 ? -16.164 9.557   -22.849 1.00 13.98 ? 54  LEU A HD23 1 
ATOM   594  N  N    . PHE A 1 36 ? -11.896 9.081   -18.307 1.00 9.35  ? 55  PHE A N    1 
ATOM   595  C  CA   . PHE A 1 36 ? -10.730 8.385   -17.797 1.00 8.87  ? 55  PHE A CA   1 
ATOM   596  C  C    . PHE A 1 36 ? -11.099 7.333   -16.748 1.00 8.21  ? 55  PHE A C    1 
ATOM   597  O  O    . PHE A 1 36 ? -10.649 6.182   -16.818 1.00 9.04  ? 55  PHE A O    1 
ATOM   598  C  CB   . PHE A 1 36 ? -9.741  9.397   -17.222 1.00 10.52 ? 55  PHE A CB   1 
ATOM   599  C  CG   . PHE A 1 36 ? -8.599  8.752   -16.512 1.00 11.74 ? 55  PHE A CG   1 
ATOM   600  C  CD1  . PHE A 1 36 ? -7.517  8.262   -17.230 1.00 12.12 ? 55  PHE A CD1  1 
ATOM   601  C  CD2  . PHE A 1 36 ? -8.598  8.632   -15.132 1.00 13.08 ? 55  PHE A CD2  1 
ATOM   602  C  CE1  . PHE A 1 36 ? -6.460  7.664   -16.596 1.00 14.45 ? 55  PHE A CE1  1 
ATOM   603  C  CE2  . PHE A 1 36 ? -7.505  8.025   -14.478 1.00 15.56 ? 55  PHE A CE2  1 
ATOM   604  C  CZ   . PHE A 1 36 ? -6.462  7.530   -15.229 1.00 14.72 ? 55  PHE A CZ   1 
ATOM   605  H  H    A PHE A 1 36 ? -11.861 9.938   -18.240 1.00 11.22 ? 55  PHE A H    1 
ATOM   606  H  H    B PHE A 1 36 ? -11.861 9.938   -18.240 0.00 11.22 ? 55  PHE A H    1 
ATOM   607  H  HA   . PHE A 1 36 ? -10.293 7.929   -18.533 1.00 10.64 ? 55  PHE A HA   1 
ATOM   608  H  HB2  . PHE A 1 36 ? -9.379  9.932   -17.947 1.00 12.63 ? 55  PHE A HB2  1 
ATOM   609  H  HB3  . PHE A 1 36 ? -10.204 9.967   -16.589 1.00 12.63 ? 55  PHE A HB3  1 
ATOM   610  H  HD1  . PHE A 1 36 ? -7.512  8.336   -18.157 1.00 14.54 ? 55  PHE A HD1  1 
ATOM   611  H  HD2  . PHE A 1 36 ? -9.313  8.958   -14.636 1.00 15.70 ? 55  PHE A HD2  1 
ATOM   612  H  HE1  . PHE A 1 36 ? -5.746  7.336   -17.094 1.00 17.34 ? 55  PHE A HE1  1 
ATOM   613  H  HE2  . PHE A 1 36 ? -7.503  7.935   -13.552 1.00 18.67 ? 55  PHE A HE2  1 
ATOM   614  H  HZ   . PHE A 1 36 ? -5.737  7.133   -14.804 1.00 17.66 ? 55  PHE A HZ   1 
ATOM   615  N  N    . TYR A 1 37 ? -11.902 7.745   -15.783 1.00 8.74  ? 56  TYR A N    1 
ATOM   616  C  CA   . TYR A 1 37 ? -12.265 6.847   -14.707 1.00 8.80  ? 56  TYR A CA   1 
ATOM   617  C  C    . TYR A 1 37 ? -13.102 5.651   -15.190 1.00 9.00  ? 56  TYR A C    1 
ATOM   618  O  O    . TYR A 1 37 ? -12.950 4.538   -14.697 1.00 8.77  ? 56  TYR A O    1 
ATOM   619  C  CB   . TYR A 1 37 ? -13.010 7.583   -13.596 1.00 8.25  ? 56  TYR A CB   1 
ATOM   620  C  CG   . TYR A 1 37 ? -12.191 8.359   -12.593 1.00 8.67  ? 56  TYR A CG   1 
ATOM   621  C  CD1  . TYR A 1 37 ? -11.008 7.867   -12.051 1.00 9.00  ? 56  TYR A CD1  1 
ATOM   622  C  CD2  . TYR A 1 37 ? -12.639 9.585   -12.124 1.00 9.27  ? 56  TYR A CD2  1 
ATOM   623  C  CE1  . TYR A 1 37 ? -10.330 8.552   -11.050 1.00 8.49  ? 56  TYR A CE1  1 
ATOM   624  C  CE2  . TYR A 1 37 ? -11.954 10.276  -11.121 1.00 9.75  ? 56  TYR A CE2  1 
ATOM   625  C  CZ   . TYR A 1 37 ? -10.807 9.750   -10.589 1.00 9.27  ? 56  TYR A CZ   1 
ATOM   626  O  OH   . TYR A 1 37 ? -10.190 10.442  -9.575  1.00 11.86 ? 56  TYR A OH   1 
ATOM   627  H  H    . TYR A 1 37 ? -12.246 8.531   -15.728 1.00 10.49 ? 56  TYR A H    1 
ATOM   628  H  HA   . TYR A 1 37 ? -11.449 6.491   -14.321 1.00 10.56 ? 56  TYR A HA   1 
ATOM   629  H  HB2  . TYR A 1 37 ? -13.619 8.213   -14.011 1.00 9.90  ? 56  TYR A HB2  1 
ATOM   630  H  HB3  . TYR A 1 37 ? -13.522 6.928   -13.096 1.00 9.90  ? 56  TYR A HB3  1 
ATOM   631  H  HD1  . TYR A 1 37 ? -10.693 7.036   -12.326 1.00 10.80 ? 56  TYR A HD1  1 
ATOM   632  H  HD2  . TYR A 1 37 ? -13.439 9.931   -12.449 1.00 11.13 ? 56  TYR A HD2  1 
ATOM   633  H  HE1  . TYR A 1 37 ? -9.552  8.193   -10.689 1.00 10.19 ? 56  TYR A HE1  1 
ATOM   634  H  HE2  . TYR A 1 37 ? -12.285 11.086  -10.805 1.00 11.70 ? 56  TYR A HE2  1 
ATOM   635  H  HH   . TYR A 1 37 ? -9.513  10.022  -9.310  1.00 14.23 ? 56  TYR A HH   1 
ATOM   636  N  N    . LEU A 1 38 ? -14.017 5.883   -16.117 1.00 8.77  ? 57  LEU A N    1 
ATOM   637  C  CA   . LEU A 1 38 ? -14.790 4.779   -16.681 1.00 7.66  ? 57  LEU A CA   1 
ATOM   638  C  C    . LEU A 1 38 ? -13.850 3.771   -17.343 1.00 8.29  ? 57  LEU A C    1 
ATOM   639  O  O    . LEU A 1 38 ? -14.010 2.542   -17.173 1.00 9.21  ? 57  LEU A O    1 
ATOM   640  C  CB   . LEU A 1 38 ? -15.857 5.295   -17.655 1.00 8.29  ? 57  LEU A CB   1 
ATOM   641  C  CG   . LEU A 1 38 ? -17.083 5.861   -16.965 1.00 10.16 ? 57  LEU A CG   1 
ATOM   642  C  CD1  . LEU A 1 38 ? -17.895 6.676   -17.949 1.00 11.29 ? 57  LEU A CD1  1 
ATOM   643  C  CD2  . LEU A 1 38 ? -17.931 4.741   -16.432 1.00 12.60 ? 57  LEU A CD2  1 
ATOM   644  H  H    . LEU A 1 38 ? -14.211 6.658   -16.436 1.00 10.53 ? 57  LEU A H    1 
ATOM   645  H  HA   . LEU A 1 38 ? -15.249 4.322   -15.959 1.00 9.19  ? 57  LEU A HA   1 
ATOM   646  H  HB2  . LEU A 1 38 ? -15.470 5.999   -18.199 1.00 9.94  ? 57  LEU A HB2  1 
ATOM   647  H  HB3  . LEU A 1 38 ? -16.146 4.562   -18.221 1.00 9.94  ? 57  LEU A HB3  1 
ATOM   648  H  HG   . LEU A 1 38 ? -16.815 6.432   -16.228 1.00 12.19 ? 57  LEU A HG   1 
ATOM   649  H  HD11 . LEU A 1 38 ? -18.676 7.032   -17.495 1.00 13.55 ? 57  LEU A HD11 1 
ATOM   650  H  HD12 . LEU A 1 38 ? -17.347 7.403   -18.285 1.00 13.55 ? 57  LEU A HD12 1 
ATOM   651  H  HD13 . LEU A 1 38 ? -18.171 6.103   -18.681 1.00 13.55 ? 57  LEU A HD13 1 
ATOM   652  H  HD21 . LEU A 1 38 ? -18.207 4.176   -17.170 1.00 15.13 ? 57  LEU A HD21 1 
ATOM   653  H  HD22 . LEU A 1 38 ? -17.410 4.226   -15.796 1.00 15.13 ? 57  LEU A HD22 1 
ATOM   654  H  HD23 . LEU A 1 38 ? -18.711 5.117   -15.993 1.00 15.13 ? 57  LEU A HD23 1 
ATOM   655  N  N    . GLY A 1 39 ? -12.897 4.256   -18.117 1.00 8.45  ? 58  GLY A N    1 
ATOM   656  C  CA   . GLY A 1 39 ? -11.967 3.334   -18.730 1.00 8.79  ? 58  GLY A CA   1 
ATOM   657  C  C    . GLY A 1 39 ? -11.170 2.545   -17.711 1.00 8.05  ? 58  GLY A C    1 
ATOM   658  O  O    . GLY A 1 39 ? -10.941 1.343   -17.852 1.00 9.19  ? 58  GLY A O    1 
ATOM   659  H  H    . GLY A 1 39 ? -12.769 5.087   -18.299 1.00 10.14 ? 58  GLY A H    1 
ATOM   660  H  HA2  . GLY A 1 39 ? -12.454 2.708   -19.288 1.00 10.55 ? 58  GLY A HA2  1 
ATOM   661  H  HA3  . GLY A 1 39 ? -11.346 3.826   -19.290 1.00 10.55 ? 58  GLY A HA3  1 
ATOM   662  N  N    . GLN A 1 40 ? -10.742 3.201   -16.638 1.00 9.01  ? 59  GLN A N    1 
ATOM   663  C  CA   . GLN A 1 40 ? -9.978  2.516   -15.607 1.00 9.34  ? 59  GLN A CA   1 
ATOM   664  C  C    . GLN A 1 40 ? -10.825 1.571   -14.784 1.00 9.82  ? 59  GLN A C    1 
ATOM   665  O  O    . GLN A 1 40 ? -10.318 0.559   -14.316 1.00 11.52 ? 59  GLN A O    1 
ATOM   666  C  CB   . GLN A 1 40 ? -9.245  3.524   -14.723 1.00 10.52 ? 59  GLN A CB   1 
ATOM   667  C  CG   . GLN A 1 40 ? -8.143  4.297   -15.471 1.00 11.01 ? 59  GLN A CG   1 
ATOM   668  C  CD   . GLN A 1 40 ? -7.139  3.378   -16.147 1.00 12.22 ? 59  GLN A CD   1 
ATOM   669  O  OE1  . GLN A 1 40 ? -6.585  2.474   -15.509 1.00 13.52 ? 59  GLN A OE1  1 
ATOM   670  N  NE2  . GLN A 1 40 ? -6.977  3.538   -17.439 1.00 14.53 ? 59  GLN A NE2  1 
ATOM   671  H  H    . GLN A 1 40 ? -10.879 4.036   -16.486 1.00 10.81 ? 59  GLN A H    1 
ATOM   672  H  HA   . GLN A 1 40 ? -9.300  1.978   -16.045 1.00 11.20 ? 59  GLN A HA   1 
ATOM   673  H  HB2  . GLN A 1 40 ? -9.884  4.170   -14.384 1.00 12.62 ? 59  GLN A HB2  1 
ATOM   674  H  HB3  . GLN A 1 40 ? -8.829  3.052   -13.985 1.00 12.62 ? 59  GLN A HB3  1 
ATOM   675  H  HG2  . GLN A 1 40 ? -8.553  4.850   -16.155 1.00 13.21 ? 59  GLN A HG2  1 
ATOM   676  H  HG3  . GLN A 1 40 ? -7.662  4.854   -14.839 1.00 13.21 ? 59  GLN A HG3  1 
ATOM   677  H  HE21 . GLN A 1 40 ? -7.427  4.139   -17.859 1.00 17.44 ? 59  GLN A HE21 1 
ATOM   678  H  HE22 . GLN A 1 40 ? -6.420  3.042   -17.867 1.00 17.44 ? 59  GLN A HE22 1 
ATOM   679  N  N    . TYR A 1 41 ? -12.100 1.859   -14.634 1.00 9.53  ? 60  TYR A N    1 
ATOM   680  C  CA   . TYR A 1 41 ? -13.033 0.912   -14.028 1.00 9.53  ? 60  TYR A CA   1 
ATOM   681  C  C    . TYR A 1 41 ? -13.100 -0.363  -14.863 1.00 9.34  ? 60  TYR A C    1 
ATOM   682  O  O    . TYR A 1 41 ? -13.038 -1.469  -14.317 1.00 10.90 ? 60  TYR A O    1 
ATOM   683  C  CB   . TYR A 1 41 ? -14.407 1.565   -13.891 1.00 9.97  ? 60  TYR A CB   1 
ATOM   684  C  CG   . TYR A 1 41 ? -15.501 0.666   -13.406 1.00 9.77  ? 60  TYR A CG   1 
ATOM   685  C  CD1  . TYR A 1 41 ? -15.747 0.523   -12.050 1.00 11.09 ? 60  TYR A CD1  1 
ATOM   686  C  CD2  . TYR A 1 41 ? -16.308 -0.032  -14.286 1.00 9.04  ? 60  TYR A CD2  1 
ATOM   687  C  CE1  . TYR A 1 41 ? -16.755 -0.289  -11.594 1.00 10.64 ? 60  TYR A CE1  1 
ATOM   688  C  CE2  . TYR A 1 41 ? -17.294 -0.830  -13.854 1.00 10.65 ? 60  TYR A CE2  1 
ATOM   689  C  CZ   . TYR A 1 41 ? -17.532 -0.965  -12.491 1.00 11.42 ? 60  TYR A CZ   1 
ATOM   690  O  OH   . TYR A 1 41 ? -18.535 -1.777  -11.988 1.00 14.04 ? 60  TYR A OH   1 
ATOM   691  H  H    . TYR A 1 41 ? -12.461 2.602   -14.874 1.00 11.43 ? 60  TYR A H    1 
ATOM   692  H  HA   . TYR A 1 41 ? -12.719 0.677   -13.141 1.00 11.44 ? 60  TYR A HA   1 
ATOM   693  H  HB2  . TYR A 1 41 ? -14.335 2.301   -13.263 1.00 11.96 ? 60  TYR A HB2  1 
ATOM   694  H  HB3  . TYR A 1 41 ? -14.673 1.905   -14.759 1.00 11.96 ? 60  TYR A HB3  1 
ATOM   695  H  HD1  . TYR A 1 41 ? -15.221 0.986   -11.439 1.00 13.31 ? 60  TYR A HD1  1 
ATOM   696  H  HD2  . TYR A 1 41 ? -16.160 0.053   -15.201 1.00 10.84 ? 60  TYR A HD2  1 
ATOM   697  H  HE1  . TYR A 1 41 ? -16.908 -0.377  -10.681 1.00 12.77 ? 60  TYR A HE1  1 
ATOM   698  H  HE2  . TYR A 1 41 ? -17.821 -1.290  -14.466 1.00 12.78 ? 60  TYR A HE2  1 
ATOM   699  H  HH   . TYR A 1 41 ? -18.951 -2.144  -12.618 1.00 16.85 ? 60  TYR A HH   1 
ATOM   700  N  N    . ILE A 1 42 ? -13.249 -0.210  -16.174 1.00 8.64  ? 61  ILE A N    1 
ATOM   701  C  CA   . ILE A 1 42 ? -13.244 -1.345  -17.057 1.00 8.05  ? 61  ILE A CA   1 
ATOM   702  C  C    . ILE A 1 42 ? -11.961 -2.163  -16.953 1.00 9.55  ? 61  ILE A C    1 
ATOM   703  O  O    . ILE A 1 42 ? -11.984 -3.410  -16.910 1.00 11.09 ? 61  ILE A O    1 
ATOM   704  C  CB   . ILE A 1 42 ? -13.503 -0.864  -18.522 1.00 7.82  ? 61  ILE A CB   1 
ATOM   705  C  CG1  . ILE A 1 42 ? -14.906 -0.328  -18.675 1.00 9.20  ? 61  ILE A CG1  1 
ATOM   706  C  CG2  . ILE A 1 42 ? -13.258 -1.984  -19.542 1.00 9.67  ? 61  ILE A CG2  1 
ATOM   707  C  CD1  . ILE A 1 42 ? -15.109 0.577   -19.906 1.00 9.40  ? 61  ILE A CD1  1 
ATOM   708  H  H    . ILE A 1 42 ? -13.355 0.546   -16.569 1.00 10.36 ? 61  ILE A H    1 
ATOM   709  H  HA   . ILE A 1 42 ? -13.979 -1.928  -16.810 1.00 9.66  ? 61  ILE A HA   1 
ATOM   710  H  HB   . ILE A 1 42 ? -12.884 -0.143  -18.714 1.00 9.38  ? 61  ILE A HB   1 
ATOM   711  H  HG12 . ILE A 1 42 ? -15.518 -1.077  -18.755 1.00 11.04 ? 61  ILE A HG12 1 
ATOM   712  H  HG13 . ILE A 1 42 ? -15.127 0.193   -17.887 1.00 11.04 ? 61  ILE A HG13 1 
ATOM   713  H  HG21 . ILE A 1 42 ? -12.336 -2.277  -19.472 1.00 11.61 ? 61  ILE A HG21 1 
ATOM   714  H  HG22 . ILE A 1 42 ? -13.856 -2.723  -19.349 1.00 11.61 ? 61  ILE A HG22 1 
ATOM   715  H  HG23 . ILE A 1 42 ? -13.430 -1.642  -20.433 1.00 11.61 ? 61  ILE A HG23 1 
ATOM   716  H  HD11 . ILE A 1 42 ? -14.515 1.340   -19.838 1.00 11.28 ? 61  ILE A HD11 1 
ATOM   717  H  HD12 . ILE A 1 42 ? -14.906 0.069   -20.708 1.00 11.28 ? 61  ILE A HD12 1 
ATOM   718  H  HD13 . ILE A 1 42 ? -16.032 0.876   -19.929 1.00 11.28 ? 61  ILE A HD13 1 
ATOM   719  N  N    . MET A 1 43 ? -10.836 -1.468  -16.907 1.00 10.34 ? 62  MET A N    1 
ATOM   720  C  CA   . MET A 1 43 ? -9.540  -2.154  -16.772 1.00 11.45 ? 62  MET A CA   1 
ATOM   721  C  C    . MET A 1 43 ? -9.423  -2.930  -15.443 1.00 11.90 ? 62  MET A C    1 
ATOM   722  O  O    . MET A 1 43 ? -9.005  -4.092  -15.423 1.00 13.79 ? 62  MET A O    1 
ATOM   723  C  CB   . MET A 1 43 ? -8.391  -1.139  -16.826 1.00 12.06 ? 62  MET A CB   1 
ATOM   724  C  CG   . MET A 1 43 ? -8.245  -0.397  -18.145 1.00 12.82 ? 62  MET A CG   1 
ATOM   725  S  SD   . MET A 1 43 ? -8.082  -1.473  -19.576 1.00 15.52 ? 62  MET A SD   1 
ATOM   726  C  CE   . MET A 1 43 ? -6.544  -2.316  -19.277 1.00 18.32 ? 62  MET A CE   1 
ATOM   727  H  H    . MET A 1 43 ? -10.784 -0.610  -16.951 1.00 12.41 ? 62  MET A H    1 
ATOM   728  H  HA   . MET A 1 43 ? -9.431  -2.773  -17.511 1.00 13.74 ? 62  MET A HA   1 
ATOM   729  H  HB2  . MET A 1 43 ? -8.532  -0.476  -16.132 1.00 14.48 ? 62  MET A HB2  1 
ATOM   730  H  HB3  . MET A 1 43 ? -7.558  -1.608  -16.662 1.00 14.48 ? 62  MET A HB3  1 
ATOM   731  H  HG2  . MET A 1 43 ? -9.030  0.157   -18.279 1.00 15.38 ? 62  MET A HG2  1 
ATOM   732  H  HG3  . MET A 1 43 ? -7.453  0.161   -18.102 1.00 15.38 ? 62  MET A HG3  1 
ATOM   733  H  HE1  . MET A 1 43 ? -6.372  -2.927  -20.010 1.00 21.98 ? 62  MET A HE1  1 
ATOM   734  H  HE2  . MET A 1 43 ? -5.831  -1.660  -19.218 1.00 21.98 ? 62  MET A HE2  1 
ATOM   735  H  HE3  . MET A 1 43 ? -6.611  -2.808  -18.444 1.00 21.98 ? 62  MET A HE3  1 
ATOM   736  N  N    A THR A 1 44 ? -9.845  -2.276  -14.368 0.56 12.08 ? 63  THR A N    1 
ATOM   737  N  N    B THR A 1 44 ? -9.795  -2.310  -14.340 0.44 11.78 ? 63  THR A N    1 
ATOM   738  C  CA   A THR A 1 44 ? -9.754  -2.794  -13.001 0.56 12.69 ? 63  THR A CA   1 
ATOM   739  C  CA   B THR A 1 44 ? -9.607  -2.984  -13.065 0.44 12.01 ? 63  THR A CA   1 
ATOM   740  C  C    A THR A 1 44 ? -10.599 -4.049  -12.809 0.56 13.03 ? 63  THR A C    1 
ATOM   741  C  C    B THR A 1 44 ? -10.526 -4.195  -12.961 0.44 12.57 ? 63  THR A C    1 
ATOM   742  O  O    A THR A 1 44 ? -10.207 -4.963  -12.077 0.56 14.00 ? 63  THR A O    1 
ATOM   743  O  O    B THR A 1 44 ? -10.088 -5.254  -12.491 0.44 13.11 ? 63  THR A O    1 
ATOM   744  C  CB   A THR A 1 44 ? -10.191 -1.665  -12.014 0.56 13.66 ? 63  THR A CB   1 
ATOM   745  C  CB   B THR A 1 44 ? -9.780  -2.025  -11.874 0.44 12.86 ? 63  THR A CB   1 
ATOM   746  O  OG1  A THR A 1 44 ? -9.191  -0.638  -11.978 0.56 15.18 ? 63  THR A OG1  1 
ATOM   747  O  OG1  B THR A 1 44 ? -9.310  -2.670  -10.685 0.44 14.74 ? 63  THR A OG1  1 
ATOM   748  C  CG2  A THR A 1 44 ? -10.444 -2.192  -10.598 0.56 14.64 ? 63  THR A CG2  1 
ATOM   749  C  CG2  B THR A 1 44 ? -11.232 -1.642  -11.687 0.44 12.69 ? 63  THR A CG2  1 
ATOM   750  H  H    A THR A 1 44 ? -10.204 -1.495  -14.405 0.56 14.50 ? 63  THR A H    1 
ATOM   751  H  H    B THR A 1 44 ? -10.147 -1.526  -14.297 0.44 14.14 ? 63  THR A H    1 
ATOM   752  H  HA   A THR A 1 44 ? -8.831  -3.021  -12.809 0.56 15.23 ? 63  THR A HA   1 
ATOM   753  H  HA   B THR A 1 44 ? -8.696  -3.315  -13.033 0.44 14.41 ? 63  THR A HA   1 
ATOM   754  H  HB   A THR A 1 44 ? -11.020 -1.277  -12.335 0.56 16.39 ? 63  THR A HB   1 
ATOM   755  H  HB   B THR A 1 44 ? -9.265  -1.218  -12.030 0.44 15.43 ? 63  THR A HB   1 
ATOM   756  H  HG1  A THR A 1 44 ? -9.090  -0.309  -12.744 0.56 18.21 ? 63  THR A HG1  1 
ATOM   757  H  HG1  B THR A 1 44 ? -9.750  -3.371  -10.545 0.44 17.68 ? 63  THR A HG1  1 
ATOM   758  H  HG21 A THR A 1 44 ? -9.635  -2.596  -10.246 0.56 17.57 ? 63  THR A HG21 1 
ATOM   759  H  HG21 B THR A 1 44 ? -11.321 -1.038  -10.933 0.44 15.23 ? 63  THR A HG21 1 
ATOM   760  H  HG22 A THR A 1 44 ? -10.712 -1.463  -10.017 0.56 17.57 ? 63  THR A HG22 1 
ATOM   761  H  HG22 B THR A 1 44 ? -11.563 -1.200  -12.485 0.44 15.23 ? 63  THR A HG22 1 
ATOM   762  H  HG23 A THR A 1 44 ? -11.148 -2.858  -10.614 0.56 17.57 ? 63  THR A HG23 1 
ATOM   763  H  HG23 B THR A 1 44 ? -11.765 -2.435  -11.521 0.44 15.23 ? 63  THR A HG23 1 
ATOM   764  N  N    . LYS A 1 45 ? -11.762 -4.077  -13.460 1.00 12.70 ? 64  LYS A N    1 
ATOM   765  C  CA   . LYS A 1 45 ? -12.677 -5.215  -13.391 1.00 13.51 ? 64  LYS A CA   1 
ATOM   766  C  C    . LYS A 1 45 ? -12.511 -6.224  -14.520 1.00 14.18 ? 64  LYS A C    1 
ATOM   767  O  O    . LYS A 1 45 ? -13.197 -7.253  -14.546 1.00 16.73 ? 64  LYS A O    1 
ATOM   768  C  CB   . LYS A 1 45 ? -14.114 -4.743  -13.277 1.00 15.17 ? 64  LYS A CB   1 
ATOM   769  C  CG   . LYS A 1 45 ? -14.311 -3.937  -12.017 1.00 16.81 ? 64  LYS A CG   1 
ATOM   770  C  CD   . LYS A 1 45 ? -15.759 -3.678  -11.722 1.00 19.12 ? 64  LYS A CD   1 
ATOM   771  C  CE   . LYS A 1 45 ? -16.424 -4.910  -11.084 1.00 20.77 ? 64  LYS A CE   1 
ATOM   772  N  NZ   . LYS A 1 45 ? -17.854 -4.608  -10.717 1.00 21.95 ? 64  LYS A NZ   1 
ATOM   773  H  H    . LYS A 1 45 ? -12.066 -3.403  -13.897 0.52 15.24 ? 64  LYS A H    1 
ATOM   774  H  HA   . LYS A 1 45 ? -12.480 -5.692  -12.570 1.00 16.22 ? 64  LYS A HA   1 
ATOM   775  H  HB2  . LYS A 1 45 ? -14.330 -4.182  -14.038 1.00 18.21 ? 64  LYS A HB2  1 
ATOM   776  H  HB3  . LYS A 1 45 ? -14.704 -5.512  -13.245 1.00 18.21 ? 64  LYS A HB3  1 
ATOM   777  H  HG2  . LYS A 1 45 ? -13.934 -4.423  -11.268 1.00 20.17 ? 64  LYS A HG2  1 
ATOM   778  H  HG3  . LYS A 1 45 ? -13.867 -3.080  -12.116 1.00 20.17 ? 64  LYS A HG3  1 
ATOM   779  H  HD2  . LYS A 1 45 ? -15.832 -2.936  -11.102 1.00 22.95 ? 64  LYS A HD2  1 
ATOM   780  H  HD3  . LYS A 1 45 ? -16.224 -3.474  -12.548 1.00 22.95 ? 64  LYS A HD3  1 
ATOM   781  H  HE2  . LYS A 1 45 ? -16.417 -5.645  -11.717 1.00 24.92 ? 64  LYS A HE2  1 
ATOM   782  H  HE3  . LYS A 1 45 ? -15.945 -5.154  -10.276 1.00 24.92 ? 64  LYS A HE3  1 
ATOM   783  H  HZ1  . LYS A 1 45 ? -18.231 -5.325  -10.349 1.00 26.34 ? 64  LYS A HZ1  1 
ATOM   784  H  HZ2  . LYS A 1 45 ? -17.883 -3.935  -10.136 1.00 26.34 ? 64  LYS A HZ2  1 
ATOM   785  H  HZ3  . LYS A 1 45 ? -18.313 -4.381  -11.445 1.00 26.34 ? 64  LYS A HZ3  1 
ATOM   786  N  N    . ARG A 1 46 ? -11.601 -5.934  -15.434 1.00 13.78 ? 65  ARG A N    1 
ATOM   787  C  CA   . ARG A 1 46 ? -11.328 -6.810  -16.589 1.00 13.27 ? 65  ARG A CA   1 
ATOM   788  C  C    . ARG A 1 46 ? -12.606 -7.083  -17.381 1.00 11.72 ? 65  ARG A C    1 
ATOM   789  O  O    . ARG A 1 46 ? -12.853 -8.218  -17.792 1.00 13.21 ? 65  ARG A O    1 
ATOM   790  C  CB   . ARG A 1 46 ? -10.674 -8.141  -16.146 1.00 15.98 ? 65  ARG A CB   1 
ATOM   791  C  CG   . ARG A 1 46 ? -9.411  -8.013  -15.312 1.00 17.94 ? 65  ARG A CG   1 
ATOM   792  C  CD   . ARG A 1 46 ? -8.267  -7.326  -16.033 1.00 20.27 ? 65  ARG A CD   1 
ATOM   793  N  NE   . ARG A 1 46 ? -6.992  -7.572  -15.329 1.00 23.42 ? 65  ARG A NE   1 
ATOM   794  C  CZ   . ARG A 1 46 ? -6.507  -6.808  -14.346 1.00 24.13 ? 65  ARG A CZ   1 
ATOM   795  N  NH1  . ARG A 1 46 ? -7.167  -5.735  -13.944 1.00 24.80 ? 65  ARG A NH1  1 
ATOM   796  N  NH2  . ARG A 1 46 ? -5.350  -7.100  -13.769 1.00 25.29 ? 65  ARG A NH2  1 
ATOM   797  H  H    . ARG A 1 46 ? -11.114 -5.226  -15.417 1.00 16.54 ? 65  ARG A H    1 
ATOM   798  H  HA   . ARG A 1 46 ? -10.705 -6.359  -17.181 1.00 15.93 ? 65  ARG A HA   1 
ATOM   799  H  HB2  . ARG A 1 46 ? -11.319 -8.638  -15.619 1.00 19.18 ? 65  ARG A HB2  1 
ATOM   800  H  HB3  . ARG A 1 46 ? -10.446 -8.649  -16.940 1.00 19.18 ? 65  ARG A HB3  1 
ATOM   801  H  HG2  . ARG A 1 46 ? -9.612  -7.497  -14.517 1.00 21.53 ? 65  ARG A HG2  1 
ATOM   802  H  HG3  . ARG A 1 46 ? -9.111  -8.901  -15.061 1.00 21.53 ? 65  ARG A HG3  1 
ATOM   803  H  HD2  . ARG A 1 46 ? -8.194  -7.679  -16.934 1.00 24.33 ? 65  ARG A HD2  1 
ATOM   804  H  HD3  . ARG A 1 46 ? -8.427  -6.370  -16.056 1.00 24.33 ? 65  ARG A HD3  1 
ATOM   805  H  HE   . ARG A 1 46 ? -6.529  -8.255  -15.570 1.00 28.10 ? 65  ARG A HE   1 
ATOM   806  H  HH11 . ARG A 1 46 ? -7.918  -5.530  -14.309 1.00 29.76 ? 65  ARG A HH11 1 
ATOM   807  H  HH12 . ARG A 1 46 ? -6.848  -5.246  -13.312 1.00 29.76 ? 65  ARG A HH12 1 
ATOM   808  H  HH21 . ARG A 1 46 ? -4.907  -7.793  -14.020 1.00 30.35 ? 65  ARG A HH21 1 
ATOM   809  H  HH22 . ARG A 1 46 ? -5.045  -6.600  -13.139 1.00 30.35 ? 65  ARG A HH22 1 
ATOM   810  N  N    . LEU A 1 47 ? -13.399 -6.034  -17.650 1.00 10.91 ? 66  LEU A N    1 
ATOM   811  C  CA   . LEU A 1 47 ? -14.656 -6.251  -18.385 1.00 11.09 ? 66  LEU A CA   1 
ATOM   812  C  C    . LEU A 1 47 ? -14.418 -6.467  -19.881 1.00 11.99 ? 66  LEU A C    1 
ATOM   813  O  O    . LEU A 1 47 ? -15.282 -6.954  -20.611 1.00 13.47 ? 66  LEU A O    1 
ATOM   814  C  CB   . LEU A 1 47 ? -15.637 -5.101  -18.178 1.00 12.00 ? 66  LEU A CB   1 
ATOM   815  C  CG   . LEU A 1 47 ? -16.066 -4.912  -16.712 1.00 13.28 ? 66  LEU A CG   1 
ATOM   816  C  CD1  . LEU A 1 47 ? -16.993 -3.707  -16.553 1.00 15.38 ? 66  LEU A CD1  1 
ATOM   817  C  CD2  . LEU A 1 47 ? -16.785 -6.152  -16.198 1.00 16.55 ? 66  LEU A CD2  1 
ATOM   818  H  H    . LEU A 1 47 ? -13.240 -5.219  -17.427 1.00 13.09 ? 66  LEU A H    1 
ATOM   819  H  HA   . LEU A 1 47 ? -15.075 -7.055  -18.040 1.00 13.30 ? 66  LEU A HA   1 
ATOM   820  H  HB2  . LEU A 1 47 ? -15.220 -4.277  -18.474 1.00 14.40 ? 66  LEU A HB2  1 
ATOM   821  H  HB3  . LEU A 1 47 ? -16.436 -5.272  -18.701 1.00 14.40 ? 66  LEU A HB3  1 
ATOM   822  H  HG   . LEU A 1 47 ? -15.280 -4.766  -16.164 1.00 15.94 ? 66  LEU A HG   1 
ATOM   823  H  HD11 . LEU A 1 47 ? -16.526 -2.909  -16.847 1.00 18.46 ? 66  LEU A HD11 1 
ATOM   824  H  HD12 . LEU A 1 47 ? -17.786 -3.845  -17.095 1.00 18.46 ? 66  LEU A HD12 1 
ATOM   825  H  HD13 . LEU A 1 47 ? -17.241 -3.621  -15.619 1.00 18.46 ? 66  LEU A HD13 1 
ATOM   826  H  HD21 . LEU A 1 47 ? -17.044 -6.006  -15.275 1.00 19.86 ? 66  LEU A HD21 1 
ATOM   827  H  HD22 . LEU A 1 47 ? -17.573 -6.308  -16.742 1.00 19.86 ? 66  LEU A HD22 1 
ATOM   828  H  HD23 . LEU A 1 47 ? -16.186 -6.912  -16.258 1.00 19.86 ? 66  LEU A HD23 1 
ATOM   829  N  N    . TYR A 1 48 ? -13.230 -6.168  -20.337 1.00 11.52 ? 67  TYR A N    1 
ATOM   830  C  CA   . TYR A 1 48 ? -12.883 -6.335  -21.737 1.00 11.08 ? 67  TYR A CA   1 
ATOM   831  C  C    . TYR A 1 48 ? -12.550 -7.801  -22.037 1.00 11.57 ? 67  TYR A C    1 
ATOM   832  O  O    . TYR A 1 48 ? -12.364 -8.624  -21.138 1.00 11.22 ? 67  TYR A O    1 
ATOM   833  C  CB   . TYR A 1 48 ? -11.676 -5.458  -22.057 1.00 11.06 ? 67  TYR A CB   1 
ATOM   834  C  CG   . TYR A 1 48 ? -10.443 -5.700  -21.184 1.00 12.32 ? 67  TYR A CG   1 
ATOM   835  C  CD1  . TYR A 1 48 ? -9.503  -6.664  -21.505 1.00 13.26 ? 67  TYR A CD1  1 
ATOM   836  C  CD2  . TYR A 1 48 ? -10.200 -4.928  -20.077 1.00 13.99 ? 67  TYR A CD2  1 
ATOM   837  C  CE1  . TYR A 1 48 ? -8.382  -6.879  -20.725 1.00 13.50 ? 67  TYR A CE1  1 
ATOM   838  C  CE2  . TYR A 1 48 ? -9.084  -5.127  -19.292 1.00 15.76 ? 67  TYR A CE2  1 
ATOM   839  C  CZ   . TYR A 1 48 ? -8.156  -6.092  -19.640 1.00 14.70 ? 67  TYR A CZ   1 
ATOM   840  O  OH   . TYR A 1 48 ? -7.016  -6.272  -18.884 1.00 16.98 ? 67  TYR A OH   1 
ATOM   841  H  H    . TYR A 1 48 ? -12.589 -5.860  -19.853 1.00 13.83 ? 67  TYR A H    1 
ATOM   842  H  HA   . TYR A 1 48 ? -13.627 -6.061  -22.296 1.00 13.29 ? 67  TYR A HA   1 
ATOM   843  H  HB2  . TYR A 1 48 ? -11.417 -5.615  -22.978 1.00 13.28 ? 67  TYR A HB2  1 
ATOM   844  H  HB3  . TYR A 1 48 ? -11.934 -4.529  -21.946 1.00 13.28 ? 67  TYR A HB3  1 
ATOM   845  H  HD1  . TYR A 1 48 ? -9.641  -7.198  -22.253 1.00 15.91 ? 67  TYR A HD1  1 
ATOM   846  H  HD2  . TYR A 1 48 ? -10.810 -4.266  -19.842 1.00 16.78 ? 67  TYR A HD2  1 
ATOM   847  H  HE1  . TYR A 1 48 ? -7.761  -7.526  -20.970 1.00 16.20 ? 67  TYR A HE1  1 
ATOM   848  H  HE2  . TYR A 1 48 ? -8.934  -4.584  -18.551 1.00 18.92 ? 67  TYR A HE2  1 
ATOM   849  H  HH   . TYR A 1 48 ? -7.003  -5.722  -18.249 1.00 20.38 ? 67  TYR A HH   1 
ATOM   850  N  N    . ASP A 1 49 ? -12.530 -8.110  -23.331 1.00 9.76  ? 68  ASP A N    1 
ATOM   851  C  CA   . ASP A 1 49 ? -12.040 -9.407  -23.797 1.00 9.96  ? 68  ASP A CA   1 
ATOM   852  C  C    . ASP A 1 49 ? -10.515 -9.406  -23.788 1.00 9.45  ? 68  ASP A C    1 
ATOM   853  O  O    . ASP A 1 49 ? -9.893  -8.571  -24.441 1.00 10.10 ? 68  ASP A O    1 
ATOM   854  C  CB   . ASP A 1 49 ? -12.604 -9.652  -25.226 1.00 9.77  ? 68  ASP A CB   1 
ATOM   855  C  CG   . ASP A 1 49 ? -12.160 -10.977 -25.866 1.00 10.82 ? 68  ASP A CG   1 
ATOM   856  O  OD1  . ASP A 1 49 ? -11.275 -11.664 -25.306 1.00 10.74 ? 68  ASP A OD1  1 
ATOM   857  O  OD2  . ASP A 1 49 ? -12.706 -11.328 -26.947 1.00 11.53 ? 68  ASP A OD2  1 
ATOM   858  H  H    . ASP A 1 49 ? -12.795 -7.587  -23.960 1.00 11.71 ? 68  ASP A H    1 
ATOM   859  H  HA   . ASP A 1 49 ? -12.357 -10.110 -23.210 1.00 11.95 ? 68  ASP A HA   1 
ATOM   860  H  HB2  . ASP A 1 49 ? -13.573 -9.657  -25.181 1.00 11.73 ? 68  ASP A HB2  1 
ATOM   861  H  HB3  . ASP A 1 49 ? -12.308 -8.932  -25.805 1.00 11.73 ? 68  ASP A HB3  1 
ATOM   862  N  N    . GLU A 1 50 ? -9.897  -10.325 -23.038 1.00 10.18 ? 69  GLU A N    1 
ATOM   863  C  CA   . GLU A 1 50 ? -8.468  -10.386 -22.975 1.00 11.90 ? 69  GLU A CA   1 
ATOM   864  C  C    . GLU A 1 50 ? -7.793  -10.502 -24.330 1.00 10.74 ? 69  GLU A C    1 
ATOM   865  O  O    . GLU A 1 50 ? -6.647  -10.043 -24.497 1.00 12.37 ? 69  GLU A O    1 
ATOM   866  C  CB   . GLU A 1 50 ? -8.054  -11.595 -22.124 1.00 14.56 ? 69  GLU A CB   1 
ATOM   867  C  CG   . GLU A 1 50 ? -6.579  -11.872 -22.111 1.00 18.17 ? 69  GLU A CG   1 
ATOM   868  C  CD   . GLU A 1 50 ? -5.794  -10.810 -21.385 1.00 21.60 ? 69  GLU A CD   1 
ATOM   869  O  OE1  . GLU A 1 50 ? -6.391  -10.091 -20.562 1.00 22.63 ? 69  GLU A OE1  1 
ATOM   870  O  OE2  . GLU A 1 50 ? -4.566  -10.701 -21.645 1.00 23.82 ? 69  GLU A OE2  1 
ATOM   871  H  H    . GLU A 1 50 ? -10.299 -10.919 -22.563 1.00 12.22 ? 69  GLU A H    1 
ATOM   872  H  HA   . GLU A 1 50 ? -8.136  -9.585  -22.541 1.00 14.28 ? 69  GLU A HA   1 
ATOM   873  H  HB2  . GLU A 1 50 ? -8.332  -11.439 -21.207 1.00 17.47 ? 69  GLU A HB2  1 
ATOM   874  H  HB3  . GLU A 1 50 ? -8.499  -12.385 -22.470 1.00 17.47 ? 69  GLU A HB3  1 
ATOM   875  H  HG2  . GLU A 1 50 ? -6.420  -12.719 -21.666 1.00 21.81 ? 69  GLU A HG2  1 
ATOM   876  H  HG3  . GLU A 1 50 ? -6.257  -11.912 -23.025 1.00 21.81 ? 69  GLU A HG3  1 
ATOM   877  N  N    A LYS A 1 51 ? -8.493  -11.138 -25.262 0.39 9.89  ? 70  LYS A N    1 
ATOM   878  N  N    B LYS A 1 51 ? -8.457  -11.148 -25.278 0.61 10.09 ? 70  LYS A N    1 
ATOM   879  C  CA   A LYS A 1 51 ? -7.979  -11.357 -26.602 0.39 9.52  ? 70  LYS A CA   1 
ATOM   880  C  CA   B LYS A 1 51 ? -7.893  -11.279 -26.612 0.61 10.24 ? 70  LYS A CA   1 
ATOM   881  C  C    A LYS A 1 51 ? -8.391  -10.256 -27.576 0.39 9.22  ? 70  LYS A C    1 
ATOM   882  C  C    B LYS A 1 51 ? -8.507  -10.330 -27.625 0.61 9.83  ? 70  LYS A C    1 
ATOM   883  O  O    A LYS A 1 51 ? -7.883  -10.200 -28.695 0.39 8.49  ? 70  LYS A O    1 
ATOM   884  O  O    B LYS A 1 51 ? -8.290  -10.472 -28.824 0.61 9.78  ? 70  LYS A O    1 
ATOM   885  C  CB   A LYS A 1 51 ? -8.437  -12.723 -27.133 0.39 9.91  ? 70  LYS A CB   1 
ATOM   886  C  CB   B LYS A 1 51 ? -7.998  -12.724 -27.107 0.61 11.51 ? 70  LYS A CB   1 
ATOM   887  C  CG   A LYS A 1 51 ? -7.919  -13.916 -26.308 0.39 11.62 ? 70  LYS A CG   1 
ATOM   888  C  CG   B LYS A 1 51 ? -7.138  -13.659 -26.280 0.61 13.66 ? 70  LYS A CG   1 
ATOM   889  C  CD   A LYS A 1 51 ? -6.392  -13.988 -26.319 0.39 13.79 ? 70  LYS A CD   1 
ATOM   890  C  CD   B LYS A 1 51 ? -7.168  -15.078 -26.783 0.61 15.89 ? 70  LYS A CD   1 
ATOM   891  C  CE   A LYS A 1 51 ? -5.850  -15.037 -25.365 0.39 15.43 ? 70  LYS A CE   1 
ATOM   892  C  CE   B LYS A 1 51 ? -6.161  -15.935 -26.017 0.61 17.01 ? 70  LYS A CE   1 
ATOM   893  N  NZ   A LYS A 1 51 ? -4.483  -14.669 -24.933 0.39 17.43 ? 70  LYS A NZ   1 
ATOM   894  N  NZ   B LYS A 1 51 ? -6.318  -17.346 -26.354 0.61 20.06 ? 70  LYS A NZ   1 
ATOM   895  H  H    A LYS A 1 51 ? -9.282  -11.457 -25.137 0.39 11.87 ? 70  LYS A H    1 
ATOM   896  H  H    B LYS A 1 51 ? -9.228  -11.516 -25.177 0.61 12.11 ? 70  LYS A H    1 
ATOM   897  H  HA   A LYS A 1 51 ? -7.010  -11.367 -26.564 0.39 11.43 ? 70  LYS A HA   1 
ATOM   898  H  HA   B LYS A 1 51 ? -6.948  -11.065 -26.559 0.61 12.29 ? 70  LYS A HA   1 
ATOM   899  H  HB2  A LYS A 1 51 ? -9.406  -12.753 -27.122 0.39 11.89 ? 70  LYS A HB2  1 
ATOM   900  H  HB2  B LYS A 1 51 ? -8.919  -13.020 -27.040 0.61 13.81 ? 70  LYS A HB2  1 
ATOM   901  H  HB3  A LYS A 1 51 ? -8.115  -12.829 -28.042 0.39 11.89 ? 70  LYS A HB3  1 
ATOM   902  H  HB3  B LYS A 1 51 ? -7.697  -12.769 -28.028 0.61 13.81 ? 70  LYS A HB3  1 
ATOM   903  H  HG2  A LYS A 1 51 ? -8.212  -13.820 -25.388 0.39 13.95 ? 70  LYS A HG2  1 
ATOM   904  H  HG2  B LYS A 1 51 ? -6.219  -13.350 -26.308 0.61 16.39 ? 70  LYS A HG2  1 
ATOM   905  H  HG3  A LYS A 1 51 ? -8.265  -14.740 -26.686 0.39 13.95 ? 70  LYS A HG3  1 
ATOM   906  H  HG3  B LYS A 1 51 ? -7.460  -13.658 -25.365 0.61 16.39 ? 70  LYS A HG3  1 
ATOM   907  H  HD2  A LYS A 1 51 ? -6.092  -14.212 -27.214 0.39 16.54 ? 70  LYS A HD2  1 
ATOM   908  H  HD2  B LYS A 1 51 ? -8.053  -15.451 -26.650 0.61 19.07 ? 70  LYS A HD2  1 
ATOM   909  H  HD3  A LYS A 1 51 ? -6.033  -13.127 -26.054 0.39 16.54 ? 70  LYS A HD3  1 
ATOM   910  H  HD3  B LYS A 1 51 ? -6.931  -15.093 -27.724 0.61 19.07 ? 70  LYS A HD3  1 
ATOM   911  H  HE2  A LYS A 1 51 ? -6.418  -15.089 -24.581 0.39 18.51 ? 70  LYS A HE2  1 
ATOM   912  H  HE2  B LYS A 1 51 ? -5.260  -15.662 -26.253 0.61 20.41 ? 70  LYS A HE2  1 
ATOM   913  H  HE3  A LYS A 1 51 ? -5.811  -15.896 -25.815 0.39 18.51 ? 70  LYS A HE3  1 
ATOM   914  H  HE3  B LYS A 1 51 ? -6.307  -15.829 -25.064 0.61 20.41 ? 70  LYS A HE3  1 
ATOM   915  H  HZ1  A LYS A 1 51 ? -4.497  -13.881 -24.519 0.39 20.91 ? 70  LYS A HZ1  1 
ATOM   916  H  HZ1  B LYS A 1 51 ? -6.186  -17.467 -27.225 0.61 24.08 ? 70  LYS A HZ1  1 
ATOM   917  H  HZ2  A LYS A 1 51 ? -4.165  -15.284 -24.374 0.39 20.91 ? 70  LYS A HZ2  1 
ATOM   918  H  HZ2  B LYS A 1 51 ? -5.726  -17.834 -25.901 0.61 24.08 ? 70  LYS A HZ2  1 
ATOM   919  H  HZ3  A LYS A 1 51 ? -3.945  -14.615 -25.640 0.39 20.91 ? 70  LYS A HZ3  1 
ATOM   920  H  HZ3  B LYS A 1 51 ? -7.139  -17.619 -26.144 0.61 24.08 ? 70  LYS A HZ3  1 
ATOM   921  N  N    . GLN A 1 52 ? -9.282  -9.368  -27.135 1.00 8.93  ? 71  GLN A N    1 
ATOM   922  C  CA   . GLN A 1 52 ? -9.750  -8.309  -28.010 1.00 8.64  ? 71  GLN A CA   1 
ATOM   923  C  C    . GLN A 1 52 ? -10.070 -7.131  -27.089 1.00 8.05  ? 71  GLN A C    1 
ATOM   924  O  O    . GLN A 1 52 ? -11.224 -6.846  -26.796 1.00 8.38  ? 71  GLN A O    1 
ATOM   925  C  CB   . GLN A 1 52 ? -10.942 -8.739  -28.901 1.00 9.79  ? 71  GLN A CB   1 
ATOM   926  C  CG   . GLN A 1 52 ? -11.115 -7.721  -30.032 1.00 8.95  ? 71  GLN A CG   1 
ATOM   927  C  CD   . GLN A 1 52 ? -12.075 -8.084  -31.144 1.00 9.46  ? 71  GLN A CD   1 
ATOM   928  O  OE1  . GLN A 1 52 ? -11.927 -7.599  -32.262 1.00 9.75  ? 71  GLN A OE1  1 
ATOM   929  N  NE2  . GLN A 1 52 ? -13.060 -8.917  -30.861 1.00 9.62  ? 71  GLN A NE2  1 
ATOM   930  H  H    . GLN A 1 52 ? -9.583  -9.337  -26.330 0.59 10.71 ? 71  GLN A H    1 
ATOM   931  H  HA   . GLN A 1 52 ? -9.024  -8.042  -28.595 1.00 10.37 ? 71  GLN A HA   1 
ATOM   932  H  HB2  . GLN A 1 52 ? -10.764 -9.609  -29.290 1.00 11.75 ? 71  GLN A HB2  1 
ATOM   933  H  HB3  . GLN A 1 52 ? -11.755 -8.759  -28.373 1.00 11.75 ? 71  GLN A HB3  1 
ATOM   934  H  HG2  . GLN A 1 52 ? -11.429 -6.890  -29.644 1.00 10.74 ? 71  GLN A HG2  1 
ATOM   935  H  HG3  . GLN A 1 52 ? -10.248 -7.575  -30.441 1.00 10.74 ? 71  GLN A HG3  1 
ATOM   936  H  HE21 . GLN A 1 52 ? -13.622 -9.142  -31.472 1.00 11.54 ? 71  GLN A HE21 1 
ATOM   937  H  HE22 . GLN A 1 52 ? -13.140 -9.234  -30.066 1.00 11.54 ? 71  GLN A HE22 1 
ATOM   938  N  N    . GLN A 1 53 ? -9.033  -6.443  -26.645 1.00 9.37  ? 72  GLN A N    1 
ATOM   939  C  CA   . GLN A 1 53 ? -9.139  -5.549  -25.502 1.00 9.79  ? 72  GLN A CA   1 
ATOM   940  C  C    . GLN A 1 53 ? -9.906  -4.269  -25.761 1.00 8.93  ? 72  GLN A C    1 
ATOM   941  O  O    . GLN A 1 53 ? -10.236 -3.552  -24.816 1.00 10.91 ? 72  GLN A O    1 
ATOM   942  C  CB   . GLN A 1 53 ? -7.763  -5.290  -24.895 1.00 11.87 ? 72  GLN A CB   1 
ATOM   943  C  CG   . GLN A 1 53 ? -7.166  -6.601  -24.395 1.00 13.70 ? 72  GLN A CG   1 
ATOM   944  C  CD   . GLN A 1 53 ? -5.961  -6.484  -23.511 1.00 18.67 ? 72  GLN A CD   1 
ATOM   945  O  OE1  . GLN A 1 53 ? -5.535  -5.383  -23.154 1.00 21.02 ? 72  GLN A OE1  1 
ATOM   946  N  NE2  . GLN A 1 53 ? -5.392  -7.637  -23.147 1.00 19.05 ? 72  GLN A NE2  1 
ATOM   947  H  H    . GLN A 1 53 ? -8.247  -6.474  -26.991 1.00 11.25 ? 72  GLN A H    1 
ATOM   948  H  HA   . GLN A 1 53 ? -9.643  -6.024  -24.822 1.00 11.75 ? 72  GLN A HA   1 
ATOM   949  H  HB2  . GLN A 1 53 ? -7.174  -4.919  -25.570 1.00 14.24 ? 72  GLN A HB2  1 
ATOM   950  H  HB3  . GLN A 1 53 ? -7.848  -4.682  -24.144 1.00 14.24 ? 72  GLN A HB3  1 
ATOM   951  H  HG2  . GLN A 1 53 ? -7.847  -7.074  -23.892 1.00 16.45 ? 72  GLN A HG2  1 
ATOM   952  H  HG3  . GLN A 1 53 ? -6.908  -7.131  -25.165 1.00 16.45 ? 72  GLN A HG3  1 
ATOM   953  H  HE21 . GLN A 1 53 ? -4.698  -7.633  -22.640 1.00 22.85 ? 72  GLN A HE21 1 
ATOM   954  H  HE22 . GLN A 1 53 ? -5.721  -8.384  -23.420 1.00 22.85 ? 72  GLN A HE22 1 
ATOM   955  N  N    . HIS A 1 54 ? -10.170 -3.992  -27.028 1.00 9.09  ? 73  HIS A N    1 
ATOM   956  C  CA   . HIS A 1 54 ? -10.983 -2.858  -27.428 1.00 8.82  ? 73  HIS A CA   1 
ATOM   957  C  C    . HIS A 1 54 ? -12.489 -3.168  -27.424 1.00 8.82  ? 73  HIS A C    1 
ATOM   958  O  O    . HIS A 1 54 ? -13.289 -2.258  -27.701 1.00 9.19  ? 73  HIS A O    1 
ATOM   959  C  CB   . HIS A 1 54 ? -10.497 -2.291  -28.784 1.00 9.37  ? 73  HIS A CB   1 
ATOM   960  C  CG   . HIS A 1 54 ? -10.222 -3.336  -29.802 1.00 8.97  ? 73  HIS A CG   1 
ATOM   961  N  ND1  . HIS A 1 54 ? -11.205 -3.816  -30.658 1.00 9.82  ? 73  HIS A ND1  1 
ATOM   962  C  CD2  . HIS A 1 54 ? -9.071  -3.967  -30.137 1.00 9.69  ? 73  HIS A CD2  1 
ATOM   963  C  CE1  . HIS A 1 54 ? -10.655 -4.704  -31.477 1.00 9.66  ? 73  HIS A CE1  1 
ATOM   964  N  NE2  . HIS A 1 54 ? -9.361  -4.803  -31.187 1.00 10.19 ? 73  HIS A NE2  1 
ATOM   965  H  H    . HIS A 1 54 ? -9.883  -4.459  -27.691 1.00 10.91 ? 73  HIS A H    1 
ATOM   966  H  HA   . HIS A 1 54 ? -10.846 -2.157  -26.772 1.00 10.58 ? 73  HIS A HA   1 
ATOM   967  H  HB2  . HIS A 1 54 ? -11.181 -1.703  -29.140 1.00 11.24 ? 73  HIS A HB2  1 
ATOM   968  H  HB3  . HIS A 1 54 ? -9.677  -1.794  -28.640 1.00 11.24 ? 73  HIS A HB3  1 
ATOM   969  H  HD2  . HIS A 1 54 ? -8.237  -3.841  -29.745 1.00 11.63 ? 73  HIS A HD2  1 
ATOM   970  H  HE1  . HIS A 1 54 ? -11.100 -5.179  -32.141 1.00 11.59 ? 73  HIS A HE1  1 
ATOM   971  H  HE2  . HIS A 1 54 ? -8.803  -5.330  -31.574 1.00 12.23 ? 73  HIS A HE2  1 
ATOM   972  N  N    . ILE A 1 55 ? -12.868 -4.397  -27.058 1.00 7.69  ? 74  ILE A N    1 
ATOM   973  C  CA   . ILE A 1 55 ? -14.269 -4.771  -26.856 1.00 7.72  ? 74  ILE A CA   1 
ATOM   974  C  C    . ILE A 1 55 ? -14.565 -4.932  -25.373 1.00 7.21  ? 74  ILE A C    1 
ATOM   975  O  O    . ILE A 1 55 ? -13.849 -5.655  -24.659 1.00 9.42  ? 74  ILE A O    1 
ATOM   976  C  CB   . ILE A 1 55 ? -14.618 -6.070  -27.633 1.00 8.37  ? 74  ILE A CB   1 
ATOM   977  C  CG1  . ILE A 1 55 ? -14.371 -5.875  -29.136 1.00 9.76  ? 74  ILE A CG1  1 
ATOM   978  C  CG2  . ILE A 1 55 ? -15.982 -6.583  -27.326 1.00 11.26 ? 74  ILE A CG2  1 
ATOM   979  C  CD1  . ILE A 1 55 ? -15.142 -4.764  -29.769 1.00 11.01 ? 74  ILE A CD1  1 
ATOM   980  H  H    . ILE A 1 55 ? -12.318 -5.043  -26.918 1.00 9.23  ? 74  ILE A H    1 
ATOM   981  H  HA   . ILE A 1 55 ? -14.835 -4.060  -27.197 1.00 9.27  ? 74  ILE A HA   1 
ATOM   982  H  HB   . ILE A 1 55 ? -13.993 -6.749  -27.334 1.00 10.04 ? 74  ILE A HB   1 
ATOM   983  H  HG12 . ILE A 1 55 ? -13.429 -5.691  -29.271 1.00 11.72 ? 74  ILE A HG12 1 
ATOM   984  H  HG13 . ILE A 1 55 ? -14.611 -6.695  -29.595 1.00 11.72 ? 74  ILE A HG13 1 
ATOM   985  H  HG21 . ILE A 1 55 ? -16.039 -6.777  -26.377 1.00 13.52 ? 74  ILE A HG21 1 
ATOM   986  H  HG22 . ILE A 1 55 ? -16.634 -5.907  -27.566 1.00 13.52 ? 74  ILE A HG22 1 
ATOM   987  H  HG23 . ILE A 1 55 ? -16.137 -7.392  -27.839 1.00 13.52 ? 74  ILE A HG23 1 
ATOM   988  H  HD11 . ILE A 1 55 ? -16.090 -4.936  -29.661 1.00 13.22 ? 74  ILE A HD11 1 
ATOM   989  H  HD12 . ILE A 1 55 ? -14.905 -3.929  -29.336 1.00 13.22 ? 74  ILE A HD12 1 
ATOM   990  H  HD13 . ILE A 1 55 ? -14.918 -4.723  -30.712 1.00 13.22 ? 74  ILE A HD13 1 
ATOM   991  N  N    . VAL A 1 56 ? -15.646 -4.304  -24.921 1.00 9.02  ? 75  VAL A N    1 
ATOM   992  C  CA   . VAL A 1 56 ? -16.101 -4.386  -23.543 1.00 9.13  ? 75  VAL A CA   1 
ATOM   993  C  C    . VAL A 1 56 ? -17.419 -5.142  -23.404 1.00 9.42  ? 75  VAL A C    1 
ATOM   994  O  O    . VAL A 1 56 ? -18.314 -4.881  -24.206 1.00 10.34 ? 75  VAL A O    1 
ATOM   995  C  CB   . VAL A 1 56 ? -16.314 -2.938  -22.989 1.00 10.32 ? 75  VAL A CB   1 
ATOM   996  C  CG1  . VAL A 1 56 ? -16.805 -2.951  -21.533 1.00 11.49 ? 75  VAL A CG1  1 
ATOM   997  C  CG2  . VAL A 1 56 ? -15.021 -2.144  -23.144 1.00 11.22 ? 75  VAL A CG2  1 
ATOM   998  H  H    . VAL A 1 56 ? -16.148 -3.808  -25.413 1.00 10.82 ? 75  VAL A H    1 
ATOM   999  H  HA   . VAL A 1 56 ? -15.429 -4.831  -23.003 1.00 10.96 ? 75  VAL A HA   1 
ATOM   1000 H  HB   . VAL A 1 56 ? -16.994 -2.498  -23.524 1.00 12.38 ? 75  VAL A HB   1 
ATOM   1001 H  HG11 . VAL A 1 56 ? -16.923 -2.037  -21.232 1.00 13.79 ? 75  VAL A HG11 1 
ATOM   1002 H  HG12 . VAL A 1 56 ? -17.650 -3.426  -21.490 1.00 13.79 ? 75  VAL A HG12 1 
ATOM   1003 H  HG13 . VAL A 1 56 ? -16.144 -3.399  -20.982 1.00 13.79 ? 75  VAL A HG13 1 
ATOM   1004 H  HG21 . VAL A 1 56 ? -15.157 -1.248  -22.800 1.00 13.46 ? 75  VAL A HG21 1 
ATOM   1005 H  HG22 . VAL A 1 56 ? -14.317 -2.588  -22.645 1.00 13.46 ? 75  VAL A HG22 1 
ATOM   1006 H  HG23 . VAL A 1 56 ? -14.786 -2.106  -24.085 1.00 13.46 ? 75  VAL A HG23 1 
ATOM   1007 N  N    . TYR A 1 57 ? -17.507 -6.121  -22.491 1.00 9.63  ? 76  TYR A N    1 
ATOM   1008 C  CA   . TYR A 1 57 ? -18.789 -6.760  -22.178 1.00 11.42 ? 76  TYR A CA   1 
ATOM   1009 C  C    . TYR A 1 57 ? -19.114 -6.380  -20.758 1.00 11.31 ? 76  TYR A C    1 
ATOM   1010 O  O    . TYR A 1 57 ? -18.366 -6.712  -19.827 1.00 12.11 ? 76  TYR A O    1 
ATOM   1011 C  CB   . TYR A 1 57 ? -18.762 -8.288  -22.364 1.00 13.14 ? 76  TYR A CB   1 
ATOM   1012 C  CG   . TYR A 1 57 ? -20.135 -8.913  -22.235 1.00 13.56 ? 76  TYR A CG   1 
ATOM   1013 C  CD1  . TYR A 1 57 ? -20.963 -9.022  -23.344 1.00 12.91 ? 76  TYR A CD1  1 
ATOM   1014 C  CD2  . TYR A 1 57 ? -20.625 -9.337  -21.002 1.00 14.39 ? 76  TYR A CD2  1 
ATOM   1015 C  CE1  . TYR A 1 57 ? -22.238 -9.555  -23.248 1.00 15.16 ? 76  TYR A CE1  1 
ATOM   1016 C  CE2  . TYR A 1 57 ? -21.891 -9.852  -20.886 1.00 14.40 ? 76  TYR A CE2  1 
ATOM   1017 C  CZ   . TYR A 1 57 ? -22.701 -9.974  -22.017 1.00 15.36 ? 76  TYR A CZ   1 
ATOM   1018 O  OH   . TYR A 1 57 ? -23.981 -10.503 -21.930 1.00 15.99 ? 76  TYR A OH   1 
ATOM   1019 H  H    . TYR A 1 57 ? -16.841 -6.431  -22.043 1.00 11.56 ? 76  TYR A H    1 
ATOM   1020 H  HA   . TYR A 1 57 ? -19.477 -6.396  -22.756 1.00 13.71 ? 76  TYR A HA   1 
ATOM   1021 H  HB2  . TYR A 1 57 ? -18.420 -8.494  -23.248 1.00 15.77 ? 76  TYR A HB2  1 
ATOM   1022 H  HB3  . TYR A 1 57 ? -18.189 -8.680  -21.686 1.00 15.77 ? 76  TYR A HB3  1 
ATOM   1023 H  HD1  . TYR A 1 57 ? -20.652 -8.736  -24.173 1.00 15.49 ? 76  TYR A HD1  1 
ATOM   1024 H  HD2  . TYR A 1 57 ? -20.092 -9.254  -20.245 1.00 17.27 ? 76  TYR A HD2  1 
ATOM   1025 H  HE1  . TYR A 1 57 ? -22.777 -9.628  -24.003 1.00 18.19 ? 76  TYR A HE1  1 
ATOM   1026 H  HE2  . TYR A 1 57 ? -22.202 -10.142 -20.059 1.00 17.28 ? 76  TYR A HE2  1 
ATOM   1027 H  HH   . TYR A 1 57 ? -24.149 -10.721 -21.136 1.00 19.18 ? 76  TYR A HH   1 
ATOM   1028 N  N    . CYS A 1 58 ? -20.227 -5.672  -20.599 1.00 11.61 ? 77  CYS A N    1 
ATOM   1029 C  CA   . CYS A 1 58 ? -20.590 -5.061  -19.314 1.00 11.89 ? 77  CYS A CA   1 
ATOM   1030 C  C    . CYS A 1 58 ? -22.001 -5.452  -18.859 1.00 11.41 ? 77  CYS A C    1 
ATOM   1031 O  O    . CYS A 1 58 ? -22.485 -4.911  -17.880 1.00 11.41 ? 77  CYS A O    1 
ATOM   1032 C  CB   . CYS A 1 58 ? -20.494 -3.527  -19.426 1.00 12.20 ? 77  CYS A CB   1 
ATOM   1033 S  SG   . CYS A 1 58 ? -21.340 -2.821  -20.869 1.00 12.41 ? 77  CYS A SG   1 
ATOM   1034 H  H    . CYS A 1 58 ? -20.799 -5.527  -21.224 1.00 13.93 ? 77  CYS A H    1 
ATOM   1035 H  HA   . CYS A 1 58 ? -19.962 -5.354  -18.635 1.00 14.27 ? 77  CYS A HA   1 
ATOM   1036 H  HB2  . CYS A 1 58 ? -20.888 -3.133  -18.632 1.00 14.64 ? 77  CYS A HB2  1 
ATOM   1037 H  HB3  . CYS A 1 58 ? -19.558 -3.279  -19.483 1.00 14.64 ? 77  CYS A HB3  1 
ATOM   1038 H  HG   . CYS A 1 58 ? -20.858 -3.280  -21.868 1.00 14.89 ? 77  CYS A HG   1 
ATOM   1039 N  N    . SER A 1 59 ? -22.648 -6.420  -19.509 1.00 13.07 ? 78  SER A N    1 
ATOM   1040 C  CA   . SER A 1 59 ? -24.023 -6.738  -19.151 1.00 13.42 ? 78  SER A CA   1 
ATOM   1041 C  C    . SER A 1 59 ? -24.073 -7.215  -17.690 1.00 16.32 ? 78  SER A C    1 
ATOM   1042 O  O    . SER A 1 59 ? -23.202 -7.966  -17.212 1.00 17.73 ? 78  SER A O    1 
ATOM   1043 C  CB   . SER A 1 59 ? -24.651 -7.774  -20.081 1.00 14.34 ? 78  SER A CB   1 
ATOM   1044 O  OG   . SER A 1 59 ? -26.064 -7.796  -19.886 1.00 17.79 ? 78  SER A OG   1 
ATOM   1045 H  H    . SER A 1 59 ? -22.320 -6.896  -20.146 1.00 15.69 ? 78  SER A H    1 
ATOM   1046 H  HA   . SER A 1 59 ? -24.553 -5.928  -19.213 1.00 16.10 ? 78  SER A HA   1 
ATOM   1047 H  HB2  . SER A 1 59 ? -24.460 -7.535  -21.002 1.00 17.21 ? 78  SER A HB2  1 
ATOM   1048 H  HB3  . SER A 1 59 ? -24.286 -8.649  -19.879 1.00 17.21 ? 78  SER A HB3  1 
ATOM   1049 H  HG   . SER A 1 59 ? -26.389 -7.041  -20.054 1.00 21.34 ? 78  SER A HG   1 
ATOM   1050 N  N    . ASN A 1 60 ? -25.088 -6.753  -16.981 1.00 17.43 ? 79  ASN A N    1 
ATOM   1051 C  CA   . ASN A 1 60 ? -25.250 -7.012  -15.540 1.00 23.35 ? 79  ASN A CA   1 
ATOM   1052 C  C    . ASN A 1 60 ? -24.051 -6.666  -14.604 1.00 23.37 ? 79  ASN A C    1 
ATOM   1053 O  O    . ASN A 1 60 ? -24.081 -7.040  -13.419 1.00 27.80 ? 79  ASN A O    1 
ATOM   1054 C  CB   . ASN A 1 60 ? -25.761 -8.438  -15.325 1.00 27.43 ? 79  ASN A CB   1 
ATOM   1055 C  CG   . ASN A 1 60 ? -27.163 -8.649  -15.936 1.00 31.30 ? 79  ASN A CG   1 
ATOM   1056 O  OD1  . ASN A 1 60 ? -28.128 -8.001  -15.512 1.00 33.11 ? 79  ASN A OD1  1 
ATOM   1057 N  ND2  . ASN A 1 60 ? -27.269 -9.525  -16.941 1.00 32.24 ? 79  ASN A ND2  1 
ATOM   1058 H  H    . ASN A 1 60 ? -25.720 -6.273  -17.313 1.00 20.91 ? 79  ASN A H    1 
ATOM   1059 H  HA   . ASN A 1 60 ? -25.972 -6.435  -15.244 1.00 28.02 ? 79  ASN A HA   1 
ATOM   1060 H  HB2  . ASN A 1 60 ? -25.150 -9.062  -15.747 1.00 32.92 ? 79  ASN A HB2  1 
ATOM   1061 H  HB3  . ASN A 1 60 ? -25.815 -8.617  -14.373 1.00 32.92 ? 79  ASN A HB3  1 
ATOM   1062 H  HD21 . ASN A 1 60 ? -26.572 -9.944  -17.221 1.00 38.69 ? 79  ASN A HD21 1 
ATOM   1063 H  HD22 . ASN A 1 60 ? -28.033 -9.670  -17.307 1.00 38.69 ? 79  ASN A HD22 1 
ATOM   1064 N  N    . ASP A 1 61 ? -23.009 -5.987  -15.111 1.00 17.63 ? 80  ASP A N    1 
ATOM   1065 C  CA   . ASP A 1 61 ? -22.152 -5.166  -14.257 1.00 13.76 ? 80  ASP A CA   1 
ATOM   1066 C  C    . ASP A 1 61 ? -22.896 -3.855  -14.085 1.00 11.95 ? 80  ASP A C    1 
ATOM   1067 O  O    . ASP A 1 61 ? -23.721 -3.486  -14.926 1.00 12.68 ? 80  ASP A O    1 
ATOM   1068 C  CB   . ASP A 1 61 ? -20.798 -4.902  -14.915 1.00 12.36 ? 80  ASP A CB   1 
ATOM   1069 C  CG   . ASP A 1 61 ? -19.827 -4.206  -14.002 1.00 13.22 ? 80  ASP A CG   1 
ATOM   1070 O  OD1  . ASP A 1 61 ? -19.110 -4.901  -13.266 1.00 15.53 ? 80  ASP A OD1  1 
ATOM   1071 O  OD2  . ASP A 1 61 ? -19.808 -2.965  -13.969 1.00 12.49 ? 80  ASP A OD2  1 
ATOM   1072 H  H    A ASP A 1 61 ? -22.783 -5.988  -15.941 0.43 21.15 ? 80  ASP A H    1 
ATOM   1073 H  H    B ASP A 1 61 ? -22.783 -5.988  -15.941 0.57 21.15 ? 80  ASP A H    1 
ATOM   1074 H  HA   . ASP A 1 61 ? -22.023 -5.587  -13.393 1.00 16.51 ? 80  ASP A HA   1 
ATOM   1075 H  HB2  . ASP A 1 61 ? -20.405 -5.749  -15.180 1.00 14.84 ? 80  ASP A HB2  1 
ATOM   1076 H  HB3  . ASP A 1 61 ? -20.930 -4.341  -15.695 1.00 14.84 ? 80  ASP A HB3  1 
ATOM   1077 N  N    . LEU A 1 62 ? -22.580 -3.144  -13.011 1.00 12.29 ? 81  LEU A N    1 
ATOM   1078 C  CA   . LEU A 1 62 ? -23.073 -1.795  -12.818 1.00 12.78 ? 81  LEU A CA   1 
ATOM   1079 C  C    . LEU A 1 62 ? -22.923 -0.956  -14.099 1.00 11.89 ? 81  LEU A C    1 
ATOM   1080 O  O    . LEU A 1 62 ? -23.815 -0.178  -14.437 1.00 13.46 ? 81  LEU A O    1 
ATOM   1081 C  CB   . LEU A 1 62 ? -22.348 -1.115  -11.661 1.00 14.72 ? 81  LEU A CB   1 
ATOM   1082 C  CG   . LEU A 1 62 ? -22.612 0.371   -11.382 1.00 18.19 ? 81  LEU A CG   1 
ATOM   1083 C  CD1  . LEU A 1 62 ? -24.078 0.615   -11.151 1.00 21.20 ? 81  LEU A CD1  1 
ATOM   1084 C  CD2  . LEU A 1 62 ? -21.770 0.847   -10.186 1.00 19.61 ? 81  LEU A CD2  1 
ATOM   1085 H  H    . LEU A 1 62 ? -22.076 -3.426  -12.374 1.00 14.75 ? 81  LEU A H    1 
ATOM   1086 H  HA   . LEU A 1 62 ? -24.017 -1.835  -12.597 1.00 15.34 ? 81  LEU A HA   1 
ATOM   1087 H  HB2  . LEU A 1 62 ? -22.576 -1.595  -10.849 1.00 17.66 ? 81  LEU A HB2  1 
ATOM   1088 H  HB3  . LEU A 1 62 ? -21.395 -1.202  -11.819 1.00 17.66 ? 81  LEU A HB3  1 
ATOM   1089 H  HG   . LEU A 1 62 ? -22.344 0.887   -12.158 1.00 21.83 ? 81  LEU A HG   1 
ATOM   1090 H  HD11 . LEU A 1 62 ? -24.571 0.347   -11.943 1.00 25.43 ? 81  LEU A HD11 1 
ATOM   1091 H  HD12 . LEU A 1 62 ? -24.369 0.091   -10.388 1.00 25.43 ? 81  LEU A HD12 1 
ATOM   1092 H  HD13 . LEU A 1 62 ? -24.217 1.559   -10.978 1.00 25.43 ? 81  LEU A HD13 1 
ATOM   1093 H  HD21 . LEU A 1 62 ? -22.010 0.326   -9.404  1.00 23.53 ? 81  LEU A HD21 1 
ATOM   1094 H  HD22 . LEU A 1 62 ? -20.830 0.722   -10.392 1.00 23.53 ? 81  LEU A HD22 1 
ATOM   1095 H  HD23 . LEU A 1 62 ? -21.951 1.787   -10.027 1.00 23.53 ? 81  LEU A HD23 1 
ATOM   1096 N  N    . LEU A 1 63 ? -21.817 -1.116  -14.813 1.00 11.35 ? 82  LEU A N    1 
ATOM   1097 C  CA   . LEU A 1 63 ? -21.616 -0.317  -16.022 1.00 10.53 ? 82  LEU A CA   1 
ATOM   1098 C  C    . LEU A 1 63 ? -22.700 -0.591  -17.091 1.00 10.60 ? 82  LEU A C    1 
ATOM   1099 O  O    . LEU A 1 63 ? -23.188 0.336   -17.740 1.00 10.72 ? 82  LEU A O    1 
ATOM   1100 C  CB   . LEU A 1 63 ? -20.213 -0.511  -16.590 1.00 10.53 ? 82  LEU A CB   1 
ATOM   1101 C  CG   . LEU A 1 63 ? -19.918 0.177   -17.921 1.00 11.11 ? 82  LEU A CG   1 
ATOM   1102 C  CD1  . LEU A 1 63 ? -20.083 1.688   -17.748 1.00 13.03 ? 82  LEU A CD1  1 
ATOM   1103 C  CD2  . LEU A 1 63 ? -18.532 -0.218  -18.411 1.00 11.39 ? 82  LEU A CD2  1 
ATOM   1104 H  H    . LEU A 1 63 ? -21.181 -1.664  -14.628 1.00 13.62 ? 82  LEU A H    1 
ATOM   1105 H  HA   . LEU A 1 63 ? -21.694 0.618   -15.777 1.00 12.64 ? 82  LEU A HA   1 
ATOM   1106 H  HB2  . LEU A 1 63 ? -19.574 -0.171  -15.944 1.00 12.63 ? 82  LEU A HB2  1 
ATOM   1107 H  HB3  . LEU A 1 63 ? -20.065 -1.461  -16.718 1.00 12.63 ? 82  LEU A HB3  1 
ATOM   1108 H  HG   . LEU A 1 63 ? -20.565 -0.121  -18.580 1.00 13.34 ? 82  LEU A HG   1 
ATOM   1109 H  HD11 . LEU A 1 63 ? -20.994 1.877   -17.472 1.00 15.63 ? 82  LEU A HD11 1 
ATOM   1110 H  HD12 . LEU A 1 63 ? -19.461 1.998   -17.071 1.00 15.63 ? 82  LEU A HD12 1 
ATOM   1111 H  HD13 . LEU A 1 63 ? -19.896 2.125   -18.594 1.00 15.63 ? 82  LEU A HD13 1 
ATOM   1112 H  HD21 . LEU A 1 63 ? -17.875 0.055   -17.752 1.00 13.67 ? 82  LEU A HD21 1 
ATOM   1113 H  HD22 . LEU A 1 63 ? -18.502 -1.181  -18.529 1.00 13.67 ? 82  LEU A HD22 1 
ATOM   1114 H  HD23 . LEU A 1 63 ? -18.358 0.225   -19.256 1.00 13.67 ? 82  LEU A HD23 1 
ATOM   1115 N  N    . GLY A 1 64 ? -23.062 -1.861  -17.272 1.00 10.93 ? 83  GLY A N    1 
ATOM   1116 C  CA   . GLY A 1 64 ? -24.120 -2.235  -18.192 1.00 11.09 ? 83  GLY A CA   1 
ATOM   1117 C  C    . GLY A 1 64 ? -25.471 -1.683  -17.776 1.00 11.12 ? 83  GLY A C    1 
ATOM   1118 O  O    . GLY A 1 64 ? -26.278 -1.280  -18.616 1.00 12.82 ? 83  GLY A O    1 
ATOM   1119 H  H    . GLY A 1 64 ? -22.703 -2.528  -16.865 1.00 13.12 ? 83  GLY A H    1 
ATOM   1120 H  HA2  . GLY A 1 64 ? -23.910 -1.900  -19.078 1.00 13.31 ? 83  GLY A HA2  1 
ATOM   1121 H  HA3  . GLY A 1 64 ? -24.183 -3.202  -18.236 1.00 13.31 ? 83  GLY A HA3  1 
ATOM   1122 N  N    . ASP A 1 65 ? -25.717 -1.620  -16.465 1.00 12.50 ? 84  ASP A N    1 
ATOM   1123 C  CA   . ASP A 1 65 ? -26.963 -1.075  -15.974 1.00 13.57 ? 84  ASP A CA   1 
ATOM   1124 C  C    . ASP A 1 65 ? -27.028 0.419   -16.286 1.00 14.40 ? 84  ASP A C    1 
ATOM   1125 O  O    . ASP A 1 65 ? -28.084 0.918   -16.684 1.00 16.21 ? 84  ASP A O    1 
ATOM   1126 C  CB   . ASP A 1 65 ? -27.110 -1.286  -14.466 1.00 16.26 ? 84  ASP A CB   1 
ATOM   1127 C  CG   . ASP A 1 65 ? -27.234 -2.761  -14.072 1.00 20.26 ? 84  ASP A CG   1 
ATOM   1128 O  OD1  . ASP A 1 65 ? -27.447 -3.659  -14.934 1.00 19.55 ? 84  ASP A OD1  1 
ATOM   1129 O  OD2  . ASP A 1 65 ? -27.108 -3.012  -12.862 1.00 24.18 ? 84  ASP A OD2  1 
ATOM   1130 H  H    . ASP A 1 65 ? -25.177 -1.887  -15.851 1.00 15.00 ? 84  ASP A H    1 
ATOM   1131 H  HA   . ASP A 1 65 ? -27.705 -1.514  -16.419 1.00 16.29 ? 84  ASP A HA   1 
ATOM   1132 H  HB2  . ASP A 1 65 ? -26.330 -0.922  -14.020 1.00 19.51 ? 84  ASP A HB2  1 
ATOM   1133 H  HB3  . ASP A 1 65 ? -27.909 -0.827  -14.161 1.00 19.51 ? 84  ASP A HB3  1 
ATOM   1134 N  N    . LEU A 1 66 ? -25.898 1.123   -16.146 1.00 12.00 ? 85  LEU A N    1 
ATOM   1135 C  CA   . LEU A 1 66 ? -25.866 2.535   -16.440 1.00 12.19 ? 85  LEU A CA   1 
ATOM   1136 C  C    . LEU A 1 66 ? -25.978 2.849   -17.926 1.00 11.26 ? 85  LEU A C    1 
ATOM   1137 O  O    . LEU A 1 66 ? -26.749 3.730   -18.343 1.00 12.55 ? 85  LEU A O    1 
ATOM   1138 C  CB   . LEU A 1 66 ? -24.587 3.160   -15.901 1.00 14.52 ? 85  LEU A CB   1 
ATOM   1139 C  CG   . LEU A 1 66 ? -24.418 3.157   -14.389 1.00 19.67 ? 85  LEU A CG   1 
ATOM   1140 C  CD1  . LEU A 1 66 ? -23.050 3.621   -14.006 1.00 21.19 ? 85  LEU A CD1  1 
ATOM   1141 C  CD2  . LEU A 1 66 ? -25.434 4.027   -13.710 1.00 23.45 ? 85  LEU A CD2  1 
ATOM   1142 H  H    . LEU A 1 66 ? -25.147 0.798   -15.883 1.00 14.40 ? 85  LEU A H    1 
ATOM   1143 H  HA   . LEU A 1 66 ? -26.614 2.961   -15.993 1.00 14.63 ? 85  LEU A HA   1 
ATOM   1144 H  HB2  . LEU A 1 66 ? -23.833 2.680   -16.276 1.00 17.43 ? 85  LEU A HB2  1 
ATOM   1145 H  HB3  . LEU A 1 66 ? -24.556 4.085   -16.192 1.00 17.43 ? 85  LEU A HB3  1 
ATOM   1146 H  HG   . LEU A 1 66 ? -24.531 2.251   -14.060 1.00 23.60 ? 85  LEU A HG   1 
ATOM   1147 H  HD11 . LEU A 1 66 ? -22.394 3.026   -14.400 1.00 25.42 ? 85  LEU A HD11 1 
ATOM   1148 H  HD12 . LEU A 1 66 ? -22.920 4.524   -14.337 1.00 25.42 ? 85  LEU A HD12 1 
ATOM   1149 H  HD13 . LEU A 1 66 ? -22.972 3.608   -13.039 1.00 25.42 ? 85  LEU A HD13 1 
ATOM   1150 H  HD21 . LEU A 1 66 ? -26.322 3.699   -13.922 1.00 28.14 ? 85  LEU A HD21 1 
ATOM   1151 H  HD22 . LEU A 1 66 ? -25.288 3.994   -12.752 1.00 28.14 ? 85  LEU A HD22 1 
ATOM   1152 H  HD23 . LEU A 1 66 ? -25.332 4.937   -14.029 1.00 28.14 ? 85  LEU A HD23 1 
ATOM   1153 N  N    . PHE A 1 67 ? -25.173 2.171   -18.730 1.00 11.42 ? 86  PHE A N    1 
ATOM   1154 C  CA   . PHE A 1 67 ? -25.146 2.427   -20.168 1.00 11.28 ? 86  PHE A CA   1 
ATOM   1155 C  C    . PHE A 1 67 ? -26.364 1.854   -20.886 1.00 12.72 ? 86  PHE A C    1 
ATOM   1156 O  O    . PHE A 1 67 ? -26.717 2.333   -21.953 1.00 15.37 ? 86  PHE A O    1 
ATOM   1157 C  CB   . PHE A 1 67 ? -23.873 1.868   -20.774 1.00 11.18 ? 86  PHE A CB   1 
ATOM   1158 C  CG   . PHE A 1 67 ? -22.680 2.778   -20.663 1.00 10.34 ? 86  PHE A CG   1 
ATOM   1159 C  CD1  . PHE A 1 67 ? -22.637 3.885   -19.812 1.00 11.56 ? 86  PHE A CD1  1 
ATOM   1160 C  CD2  . PHE A 1 67 ? -21.553 2.482   -21.412 1.00 11.72 ? 86  PHE A CD2  1 
ATOM   1161 C  CE1  . PHE A 1 67 ? -21.503 4.673   -19.768 1.00 11.65 ? 86  PHE A CE1  1 
ATOM   1162 C  CE2  . PHE A 1 67 ? -20.440 3.270   -21.360 1.00 12.90 ? 86  PHE A CE2  1 
ATOM   1163 C  CZ   . PHE A 1 67 ? -20.404 4.371   -20.561 1.00 11.93 ? 86  PHE A CZ   1 
ATOM   1164 H  H    . PHE A 1 67 ? -24.630 1.556   -18.471 1.00 13.70 ? 86  PHE A H    1 
ATOM   1165 H  HA   . PHE A 1 67 ? -25.144 3.387   -20.311 1.00 13.54 ? 86  PHE A HA   1 
ATOM   1166 H  HB2  . PHE A 1 67 ? -23.653 1.038   -20.323 1.00 13.41 ? 86  PHE A HB2  1 
ATOM   1167 H  HB3  . PHE A 1 67 ? -24.026 1.698   -21.716 1.00 13.41 ? 86  PHE A HB3  1 
ATOM   1168 H  HD1  . PHE A 1 67 ? -23.378 4.106   -19.296 1.00 13.87 ? 86  PHE A HD1  1 
ATOM   1169 H  HD2  . PHE A 1 67 ? -21.565 1.748   -21.982 1.00 14.07 ? 86  PHE A HD2  1 
ATOM   1170 H  HE1  . PHE A 1 67 ? -21.480 5.419   -19.213 1.00 13.98 ? 86  PHE A HE1  1 
ATOM   1171 H  HE2  . PHE A 1 67 ? -19.702 3.058   -21.885 1.00 15.48 ? 86  PHE A HE2  1 
ATOM   1172 H  HZ   . PHE A 1 67 ? -19.637 4.894   -20.516 1.00 14.32 ? 86  PHE A HZ   1 
ATOM   1173 N  N    . GLY A 1 68 ? -26.973 0.807   -20.323 1.00 12.67 ? 87  GLY A N    1 
ATOM   1174 C  CA   . GLY A 1 68 ? -28.132 0.176   -20.900 1.00 12.23 ? 87  GLY A CA   1 
ATOM   1175 C  C    . GLY A 1 68 ? -27.821 -0.685  -22.107 1.00 12.44 ? 87  GLY A C    1 
ATOM   1176 O  O    . GLY A 1 68 ? -28.745 -0.960  -22.901 1.00 14.08 ? 87  GLY A O    1 
ATOM   1177 H  H    . GLY A 1 68 ? -26.717 0.444   -19.587 1.00 15.20 ? 87  GLY A H    1 
ATOM   1178 H  HA2  . GLY A 1 68 ? -28.556 -0.383  -20.230 1.00 14.68 ? 87  GLY A HA2  1 
ATOM   1179 H  HA3  . GLY A 1 68 ? -28.766 0.859   -21.170 1.00 14.68 ? 87  GLY A HA3  1 
ATOM   1180 N  N    . VAL A 1 69 ? -26.571 -1.119  -22.253 1.00 12.26 ? 88  VAL A N    1 
ATOM   1181 C  CA   . VAL A 1 69 ? -26.170 -2.020  -23.323 1.00 11.99 ? 88  VAL A CA   1 
ATOM   1182 C  C    . VAL A 1 69 ? -25.320 -3.128  -22.720 1.00 11.43 ? 88  VAL A C    1 
ATOM   1183 O  O    . VAL A 1 69 ? -24.718 -2.956  -21.669 1.00 12.39 ? 88  VAL A O    1 
ATOM   1184 C  CB   . VAL A 1 69 ? -25.343 -1.289  -24.416 1.00 14.07 ? 88  VAL A CB   1 
ATOM   1185 C  CG1  . VAL A 1 69 ? -26.184 -0.189  -25.070 1.00 16.06 ? 88  VAL A CG1  1 
ATOM   1186 C  CG2  . VAL A 1 69 ? -24.036 -0.712  -23.867 1.00 14.91 ? 88  VAL A CG2  1 
ATOM   1187 H  H    . VAL A 1 69 ? -25.924 -0.899  -21.730 1.00 14.71 ? 88  VAL A H    1 
ATOM   1188 H  HA   . VAL A 1 69 ? -26.955 -2.414  -23.734 1.00 14.39 ? 88  VAL A HA   1 
ATOM   1189 H  HB   . VAL A 1 69 ? -25.112 -1.929  -25.107 1.00 16.88 ? 88  VAL A HB   1 
ATOM   1190 H  HG11 . VAL A 1 69 ? -25.652 0.255   -25.748 1.00 19.28 ? 88  VAL A HG11 1 
ATOM   1191 H  HG12 . VAL A 1 69 ? -26.969 -0.591  -25.475 1.00 19.28 ? 88  VAL A HG12 1 
ATOM   1192 H  HG13 . VAL A 1 69 ? -26.453 0.449   -24.390 1.00 19.28 ? 88  VAL A HG13 1 
ATOM   1193 H  HG21 . VAL A 1 69 ? -23.560 -0.269  -24.586 1.00 17.89 ? 88  VAL A HG21 1 
ATOM   1194 H  HG22 . VAL A 1 69 ? -24.243 -0.076  -23.164 1.00 17.89 ? 88  VAL A HG22 1 
ATOM   1195 H  HG23 . VAL A 1 69 ? -23.497 -1.436  -23.510 1.00 17.89 ? 88  VAL A HG23 1 
ATOM   1196 N  N    . PRO A 1 70 ? -25.276 -4.299  -23.368 1.00 11.22 ? 89  PRO A N    1 
ATOM   1197 C  CA   . PRO A 1 70 ? -24.500 -5.408  -22.807 1.00 10.99 ? 89  PRO A CA   1 
ATOM   1198 C  C    . PRO A 1 70 ? -23.021 -5.337  -23.160 1.00 10.76 ? 89  PRO A C    1 
ATOM   1199 O  O    . PRO A 1 70 ? -22.252 -6.066  -22.534 1.00 10.99 ? 89  PRO A O    1 
ATOM   1200 C  CB   . PRO A 1 70 ? -25.128 -6.643  -23.453 1.00 11.72 ? 89  PRO A CB   1 
ATOM   1201 C  CG   . PRO A 1 70 ? -25.696 -6.140  -24.750 1.00 12.98 ? 89  PRO A CG   1 
ATOM   1202 C  CD   . PRO A 1 70 ? -26.139 -4.715  -24.476 1.00 12.83 ? 89  PRO A CD   1 
ATOM   1203 H  HA   . PRO A 1 70 ? -24.608 -5.451  -21.844 1.00 13.19 ? 89  PRO A HA   1 
ATOM   1204 H  HB2  . PRO A 1 70 ? -24.446 -7.314  -23.612 1.00 14.07 ? 89  PRO A HB2  1 
ATOM   1205 H  HB3  . PRO A 1 70 ? -25.830 -6.993  -22.882 1.00 14.07 ? 89  PRO A HB3  1 
ATOM   1206 H  HG2  . PRO A 1 70 ? -25.010 -6.159  -25.435 1.00 15.58 ? 89  PRO A HG2  1 
ATOM   1207 H  HG3  . PRO A 1 70 ? -26.453 -6.690  -25.009 1.00 15.58 ? 89  PRO A HG3  1 
ATOM   1208 H  HD2  . PRO A 1 70 ? -25.983 -4.157  -25.254 1.00 15.40 ? 89  PRO A HD2  1 
ATOM   1209 H  HD3  . PRO A 1 70 ? -27.070 -4.696  -24.205 1.00 15.40 ? 89  PRO A HD3  1 
ATOM   1210 N  N    . SER A 1 71 ? -22.658 -4.523  -24.137 1.00 10.73 ? 90  SER A N    1 
ATOM   1211 C  CA   . SER A 1 71 ? -21.316 -4.531  -24.703 1.00 10.13 ? 90  SER A CA   1 
ATOM   1212 C  C    . SER A 1 71 ? -21.137 -3.320  -25.605 1.00 10.72 ? 90  SER A C    1 
ATOM   1213 O  O    . SER A 1 71 ? -22.125 -2.695  -26.022 1.00 11.44 ? 90  SER A O    1 
ATOM   1214 C  CB   . SER A 1 71 ? -21.137 -5.783  -25.563 1.00 11.66 ? 90  SER A CB   1 
ATOM   1215 O  OG   . SER A 1 71 ? -22.035 -5.781  -26.676 1.00 12.99 ? 90  SER A OG   1 
ATOM   1216 H  H    . SER A 1 71 ? -23.181 -3.944  -24.499 1.00 12.88 ? 90  SER A H    1 
ATOM   1217 H  HA   . SER A 1 71 ? -20.647 -4.517  -24.001 1.00 12.15 ? 90  SER A HA   1 
ATOM   1218 H  HB2  . SER A 1 71 ? -20.226 -5.809  -25.894 1.00 13.99 ? 90  SER A HB2  1 
ATOM   1219 H  HB3  . SER A 1 71 ? -21.312 -6.566  -25.018 1.00 13.99 ? 90  SER A HB3  1 
ATOM   1220 H  HG   . SER A 1 71 ? -22.830 -5.760  -26.403 1.00 15.59 ? 90  SER A HG   1 
ATOM   1221 N  N    . PHE A 1 72 ? -19.889 -2.997  -25.912 1.00 8.86  ? 91  PHE A N    1 
ATOM   1222 C  CA   . PHE A 1 72 ? -19.571 -1.939  -26.862 1.00 8.65  ? 91  PHE A CA   1 
ATOM   1223 C  C    . PHE A 1 72 ? -18.104 -1.997  -27.202 1.00 8.86  ? 91  PHE A C    1 
ATOM   1224 O  O    . PHE A 1 72 ? -17.322 -2.599  -26.472 1.00 9.20  ? 91  PHE A O    1 
ATOM   1225 C  CB   . PHE A 1 72 ? -19.928 -0.536  -26.307 1.00 9.03  ? 91  PHE A CB   1 
ATOM   1226 C  CG   . PHE A 1 72 ? -19.229 -0.168  -25.032 1.00 8.87  ? 91  PHE A CG   1 
ATOM   1227 C  CD1  . PHE A 1 72 ? -18.028 0.530   -25.053 1.00 9.27  ? 91  PHE A CD1  1 
ATOM   1228 C  CD2  . PHE A 1 72 ? -19.771 -0.460  -23.797 1.00 9.20  ? 91  PHE A CD2  1 
ATOM   1229 C  CE1  . PHE A 1 72 ? -17.403 0.894   -23.855 1.00 10.16 ? 91  PHE A CE1  1 
ATOM   1230 C  CE2  . PHE A 1 72 ? -19.138 -0.116  -22.636 1.00 9.88  ? 91  PHE A CE2  1 
ATOM   1231 C  CZ   . PHE A 1 72 ? -17.961 0.555   -22.657 1.00 10.81 ? 91  PHE A CZ   1 
ATOM   1232 H  H    . PHE A 1 72 ? -19.196 -3.382  -25.578 1.00 10.63 ? 91  PHE A H    1 
ATOM   1233 H  HA   . PHE A 1 72 ? -20.078 -2.080  -27.677 1.00 10.38 ? 91  PHE A HA   1 
ATOM   1234 H  HB2  . PHE A 1 72 ? -19.693 0.128   -26.973 1.00 10.84 ? 91  PHE A HB2  1 
ATOM   1235 H  HB3  . PHE A 1 72 ? -20.883 -0.504  -26.138 1.00 10.84 ? 91  PHE A HB3  1 
ATOM   1236 H  HD1  . PHE A 1 72 ? -17.639 0.758   -25.866 1.00 11.13 ? 91  PHE A HD1  1 
ATOM   1237 H  HD2  . PHE A 1 72 ? -20.575 -0.927  -23.754 1.00 11.03 ? 91  PHE A HD2  1 
ATOM   1238 H  HE1  . PHE A 1 72 ? -16.592 1.348   -23.876 1.00 12.20 ? 91  PHE A HE1  1 
ATOM   1239 H  HE2  . PHE A 1 72 ? -19.526 -0.337  -21.820 1.00 11.85 ? 91  PHE A HE2  1 
ATOM   1240 H  HZ   . PHE A 1 72 ? -17.543 0.794   -21.861 1.00 12.98 ? 91  PHE A HZ   1 
ATOM   1241 N  N    . SER A 1 73 ? -17.755 -1.400  -28.336 1.00 9.32  ? 92  SER A N    1 
ATOM   1242 C  CA   . SER A 1 73 ? -16.388 -1.145  -28.708 1.00 9.40  ? 92  SER A CA   1 
ATOM   1243 C  C    . SER A 1 73 ? -15.975 0.235   -28.264 1.00 9.18  ? 92  SER A C    1 
ATOM   1244 O  O    . SER A 1 73 ? -16.733 1.179   -28.352 1.00 9.86  ? 92  SER A O    1 
ATOM   1245 C  CB   . SER A 1 73 ? -16.240 -1.247  -30.222 1.00 8.82  ? 92  SER A CB   1 
ATOM   1246 O  OG   . SER A 1 73 ? -15.028 -0.650  -30.654 1.00 9.97  ? 92  SER A OG   1 
ATOM   1247 H  H    . SER A 1 73 ? -18.322 -1.126  -28.922 1.00 11.19 ? 92  SER A H    1 
ATOM   1248 H  HA   . SER A 1 73 ? -15.804 -1.798  -28.290 1.00 11.28 ? 92  SER A HA   1 
ATOM   1249 H  HB2  . SER A 1 73 ? -16.239 -2.183  -30.476 1.00 10.59 ? 92  SER A HB2  1 
ATOM   1250 H  HB3  . SER A 1 73 ? -16.985 -0.790  -30.643 1.00 10.59 ? 92  SER A HB3  1 
ATOM   1251 H  HG   . SER A 1 73 ? -14.959 -0.713  -31.489 1.00 11.96 ? 92  SER A HG   1 
ATOM   1252 N  N    . VAL A 1 74 ? -14.730 0.349   -27.844 1.00 9.01  ? 93  VAL A N    1 
ATOM   1253 C  CA   . VAL A 1 74 ? -14.196 1.636   -27.442 1.00 8.41  ? 93  VAL A CA   1 
ATOM   1254 C  C    . VAL A 1 74 ? -14.042 2.594   -28.630 1.00 9.36  ? 93  VAL A C    1 
ATOM   1255 O  O    . VAL A 1 74 ? -13.826 3.782   -28.446 1.00 10.37 ? 93  VAL A O    1 
ATOM   1256 C  CB   . VAL A 1 74 ? -12.836 1.521   -26.710 1.00 10.17 ? 93  VAL A CB   1 
ATOM   1257 C  CG1  . VAL A 1 74 ? -12.979 0.688   -25.431 1.00 10.94 ? 93  VAL A CG1  1 
ATOM   1258 C  CG2  . VAL A 1 74 ? -11.722 0.976   -27.614 1.00 11.46 ? 93  VAL A CG2  1 
ATOM   1259 H  H    . VAL A 1 74 ? -14.172 -0.303  -27.783 1.00 10.82 ? 93  VAL A H    1 
ATOM   1260 H  HA   . VAL A 1 74 ? -14.822 2.043   -26.823 1.00 10.09 ? 93  VAL A HA   1 
ATOM   1261 H  HB   . VAL A 1 74 ? -12.567 2.412   -26.438 1.00 12.21 ? 93  VAL A HB   1 
ATOM   1262 H  HG11 . VAL A 1 74 ? -12.115 0.631   -24.993 1.00 13.12 ? 93  VAL A HG11 1 
ATOM   1263 H  HG12 . VAL A 1 74 ? -13.620 1.118   -24.844 1.00 13.12 ? 93  VAL A HG12 1 
ATOM   1264 H  HG13 . VAL A 1 74 ? -13.290 -0.201  -25.666 1.00 13.12 ? 93  VAL A HG13 1 
ATOM   1265 H  HG21 . VAL A 1 74 ? -10.898 0.927   -27.104 1.00 13.75 ? 93  VAL A HG21 1 
ATOM   1266 H  HG22 . VAL A 1 74 ? -11.972 0.092   -27.925 1.00 13.75 ? 93  VAL A HG22 1 
ATOM   1267 H  HG23 . VAL A 1 74 ? -11.608 1.574   -28.370 1.00 13.75 ? 93  VAL A HG23 1 
ATOM   1268 N  N    . LYS A 1 75 ? -14.186 2.090   -29.847 1.00 9.07  ? 94  LYS A N    1 
ATOM   1269 C  CA   . LYS A 1 75 ? -14.172 2.962   -31.036 1.00 9.71  ? 94  LYS A CA   1 
ATOM   1270 C  C    . LYS A 1 75 ? -15.493 3.704   -31.186 1.00 9.70  ? 94  LYS A C    1 
ATOM   1271 O  O    . LYS A 1 75 ? -15.586 4.634   -31.975 1.00 10.95 ? 94  LYS A O    1 
ATOM   1272 C  CB   . LYS A 1 75 ? -13.934 2.144   -32.298 1.00 11.77 ? 94  LYS A CB   1 
ATOM   1273 C  CG   . LYS A 1 75 ? -12.597 1.444   -32.356 1.00 13.12 ? 94  LYS A CG   1 
ATOM   1274 C  CD   . LYS A 1 75 ? -12.464 0.641   -33.672 1.00 14.87 ? 94  LYS A CD   1 
ATOM   1275 C  CE   . LYS A 1 75 ? -11.071 0.042   -33.819 1.00 14.99 ? 94  LYS A CE   1 
ATOM   1276 N  NZ   . LYS A 1 75 ? -10.749 -0.979  -32.772 1.00 13.83 ? 94  LYS A NZ   1 
ATOM   1277 H  H    . LYS A 1 75 ? -14.292 1.255   -30.021 1.00 10.88 ? 94  LYS A H    1 
ATOM   1278 H  HA   . LYS A 1 75 ? -13.459 3.614   -30.952 1.00 11.65 ? 94  LYS A HA   1 
ATOM   1279 H  HB2  . LYS A 1 75 ? -14.624 1.465   -32.362 1.00 14.12 ? 94  LYS A HB2  1 
ATOM   1280 H  HB3  . LYS A 1 75 ? -13.988 2.736   -33.065 1.00 14.12 ? 94  LYS A HB3  1 
ATOM   1281 H  HG2  . LYS A 1 75 ? -11.885 2.102   -32.324 1.00 15.75 ? 94  LYS A HG2  1 
ATOM   1282 H  HG3  . LYS A 1 75 ? -12.522 0.827   -31.611 1.00 15.75 ? 94  LYS A HG3  1 
ATOM   1283 H  HD2  . LYS A 1 75 ? -13.108 -0.084  -33.671 1.00 17.85 ? 94  LYS A HD2  1 
ATOM   1284 H  HD3  . LYS A 1 75 ? -12.622 1.231   -34.425 1.00 17.85 ? 94  LYS A HD3  1 
ATOM   1285 H  HE2  . LYS A 1 75 ? -11.006 -0.389  -34.686 1.00 17.99 ? 94  LYS A HE2  1 
ATOM   1286 H  HE3  . LYS A 1 75 ? -10.415 0.753   -33.754 1.00 17.99 ? 94  LYS A HE3  1 
ATOM   1287 H  HZ1  . LYS A 1 75 ? -9.928  -1.298  -32.901 1.00 16.60 ? 94  LYS A HZ1  1 
ATOM   1288 H  HZ2  . LYS A 1 75 ? -10.792 -0.609  -31.963 1.00 16.60 ? 94  LYS A HZ2  1 
ATOM   1289 H  HZ3  . LYS A 1 75 ? -11.331 -1.651  -32.813 1.00 16.60 ? 94  LYS A HZ3  1 
ATOM   1290 N  N    . GLU A 1 76 ? -16.532 3.285   -30.470 1.00 8.49  ? 95  GLU A N    1 
ATOM   1291 C  CA   . GLU A 1 76 ? -17.866 3.855   -30.660 1.00 8.44  ? 95  GLU A CA   1 
ATOM   1292 C  C    . GLU A 1 76 ? -18.027 5.133   -29.825 1.00 9.06  ? 95  GLU A C    1 
ATOM   1293 O  O    . GLU A 1 76 ? -18.727 5.153   -28.816 1.00 10.39 ? 95  GLU A O    1 
ATOM   1294 C  CB   . GLU A 1 76 ? -18.955 2.827   -30.299 1.00 8.99  ? 95  GLU A CB   1 
ATOM   1295 C  CG   . GLU A 1 76 ? -18.913 1.592   -31.186 1.00 9.85  ? 95  GLU A CG   1 
ATOM   1296 C  CD   . GLU A 1 76 ? -19.999 0.615   -30.808 1.00 11.08 ? 95  GLU A CD   1 
ATOM   1297 O  OE1  . GLU A 1 76 ? -19.729 -0.291  -30.040 1.00 11.60 ? 95  GLU A OE1  1 
ATOM   1298 O  OE2  . GLU A 1 76 ? -21.125 0.741   -31.312 1.00 13.18 ? 95  GLU A OE2  1 
ATOM   1299 H  H    . GLU A 1 76 ? -16.492 2.672   -29.868 1.00 10.19 ? 95  GLU A H    1 
ATOM   1300 H  HA   . GLU A 1 76 ? -17.977 4.092   -31.594 1.00 10.13 ? 95  GLU A HA   1 
ATOM   1301 H  HB2  . GLU A 1 76 ? -18.829 2.542   -29.381 1.00 10.79 ? 95  GLU A HB2  1 
ATOM   1302 H  HB3  . GLU A 1 76 ? -19.827 3.241   -30.402 1.00 10.79 ? 95  GLU A HB3  1 
ATOM   1303 H  HG2  . GLU A 1 76 ? -19.046 1.855   -32.110 1.00 11.81 ? 95  GLU A HG2  1 
ATOM   1304 H  HG3  . GLU A 1 76 ? -18.055 1.151   -31.082 1.00 11.81 ? 95  GLU A HG3  1 
ATOM   1305 N  N    . HIS A 1 77 ? -17.370 6.205   -30.243 1.00 8.96  ? 96  HIS A N    1 
ATOM   1306 C  CA   . HIS A 1 77 ? -17.281 7.392   -29.407 1.00 9.51  ? 96  HIS A CA   1 
ATOM   1307 C  C    . HIS A 1 77 ? -18.605 8.092   -29.233 1.00 8.80  ? 96  HIS A C    1 
ATOM   1308 O  O    . HIS A 1 77 ? -18.896 8.568   -28.139 1.00 9.22  ? 96  HIS A O    1 
ATOM   1309 C  CB   . HIS A 1 77 ? -16.191 8.332   -29.933 1.00 11.52 ? 96  HIS A CB   1 
ATOM   1310 C  CG   . HIS A 1 77 ? -14.820 7.840   -29.608 1.00 14.98 ? 96  HIS A CG   1 
ATOM   1311 N  ND1  . HIS A 1 77 ? -13.715 8.656   -29.591 1.00 20.07 ? 96  HIS A ND1  1 
ATOM   1312 C  CD2  . HIS A 1 77 ? -14.388 6.619   -29.220 1.00 14.30 ? 96  HIS A CD2  1 
ATOM   1313 C  CE1  . HIS A 1 77 ? -12.649 7.951   -29.250 1.00 20.61 ? 96  HIS A CE1  1 
ATOM   1314 N  NE2  . HIS A 1 77 ? -13.032 6.713   -29.000 1.00 18.54 ? 96  HIS A NE2  1 
ATOM   1315 H  H    . HIS A 1 77 ? -16.969 6.271   -31.001 1.00 10.75 ? 96  HIS A H    1 
ATOM   1316 H  HA   . HIS A 1 77 ? -17.001 7.108   -28.523 1.00 11.41 ? 96  HIS A HA   1 
ATOM   1317 H  HB2  . HIS A 1 77 ? -16.267 8.400   -30.897 1.00 13.82 ? 96  HIS A HB2  1 
ATOM   1318 H  HB3  . HIS A 1 77 ? -16.302 9.206   -29.527 1.00 13.82 ? 96  HIS A HB3  1 
ATOM   1319 H  HD1  . HIS A 1 77 ? -13.713 9.490   -29.798 1.00 24.09 ? 96  HIS A HD1  1 
ATOM   1320 H  HD2  . HIS A 1 77 ? -14.910 5.855   -29.125 1.00 17.16 ? 96  HIS A HD2  1 
ATOM   1321 H  HE1  . HIS A 1 77 ? -11.782 8.279   -29.174 1.00 24.73 ? 96  HIS A HE1  1 
ATOM   1322 N  N    . ARG A 1 78 ? -19.424 8.190   -30.282 1.00 10.01 ? 97  ARG A N    1 
ATOM   1323 C  CA   . ARG A 1 78 ? -20.738 8.815   -30.128 1.00 9.82  ? 97  ARG A CA   1 
ATOM   1324 C  C    . ARG A 1 78 ? -21.580 8.042   -29.105 1.00 9.93  ? 97  ARG A C    1 
ATOM   1325 O  O    . ARG A 1 78 ? -22.259 8.621   -28.261 1.00 9.19  ? 97  ARG A O    1 
ATOM   1326 C  CB   . ARG A 1 78 ? -21.493 8.890   -31.457 1.00 10.11 ? 97  ARG A CB   1 
ATOM   1327 C  CG   . ARG A 1 78 ? -22.862 9.547   -31.311 1.00 10.66 ? 97  ARG A CG   1 
ATOM   1328 C  CD   . ARG A 1 78 ? -23.610 9.730   -32.662 1.00 12.70 ? 97  ARG A CD   1 
ATOM   1329 N  NE   . ARG A 1 78 ? -24.932 10.246  -32.314 1.00 13.61 ? 97  ARG A NE   1 
ATOM   1330 C  CZ   . ARG A 1 78 ? -25.334 11.499  -32.438 1.00 14.77 ? 97  ARG A CZ   1 
ATOM   1331 N  NH1  . ARG A 1 78 ? -24.575 12.399  -33.071 1.00 16.06 ? 97  ARG A NH1  1 
ATOM   1332 N  NH2  . ARG A 1 78 ? -26.518 11.845  -31.952 1.00 16.02 ? 97  ARG A NH2  1 
ATOM   1333 H  H    . ARG A 1 78 ? -19.248 7.909   -31.076 1.00 12.01 ? 97  ARG A H    1 
ATOM   1334 H  HA   . ARG A 1 78 ? -20.621 9.720   -29.798 1.00 11.79 ? 97  ARG A HA   1 
ATOM   1335 H  HB2  . ARG A 1 78 ? -20.974 9.413   -32.088 1.00 12.14 ? 97  ARG A HB2  1 
ATOM   1336 H  HB3  . ARG A 1 78 ? -21.625 7.992   -31.799 1.00 12.14 ? 97  ARG A HB3  1 
ATOM   1337 H  HG2  . ARG A 1 78 ? -23.415 8.994   -30.737 1.00 12.79 ? 97  ARG A HG2  1 
ATOM   1338 H  HG3  . ARG A 1 78 ? -22.748 10.424  -30.913 1.00 12.79 ? 97  ARG A HG3  1 
ATOM   1339 H  HD2  . ARG A 1 78 ? -23.149 10.377  -33.219 1.00 15.24 ? 97  ARG A HD2  1 
ATOM   1340 H  HD3  . ARG A 1 78 ? -23.706 8.877   -33.114 1.00 15.24 ? 97  ARG A HD3  1 
ATOM   1341 H  HE   . ARG A 1 78 ? -25.501 9.682   -32.001 1.00 16.33 ? 97  ARG A HE   1 
ATOM   1342 H  HH11 . ARG A 1 78 ? -23.794 12.178  -33.356 1.00 19.27 ? 97  ARG A HH11 1 
ATOM   1343 H  HH12 . ARG A 1 78 ? -24.855 13.206  -33.169 1.00 19.27 ? 97  ARG A HH12 1 
ATOM   1344 H  HH21 . ARG A 1 78 ? -27.017 11.254  -31.577 1.00 19.22 ? 97  ARG A HH21 1 
ATOM   1345 H  HH22 . ARG A 1 78 ? -26.819 12.640  -32.084 1.00 19.22 ? 97  ARG A HH22 1 
ATOM   1346 N  N    . LYS A 1 79 ? -21.566 6.719   -29.200 1.00 10.02 ? 98  LYS A N    1 
ATOM   1347 C  CA   . LYS A 1 79 ? -22.334 5.912   -28.263 1.00 9.75  ? 98  LYS A CA   1 
ATOM   1348 C  C    . LYS A 1 79 ? -21.868 6.106   -26.820 1.00 9.60  ? 98  LYS A C    1 
ATOM   1349 O  O    . LYS A 1 79 ? -22.683 6.256   -25.899 1.00 10.01 ? 98  LYS A O    1 
ATOM   1350 C  CB   . LYS A 1 79 ? -22.221 4.443   -28.640 1.00 9.93  ? 98  LYS A CB   1 
ATOM   1351 C  CG   . LYS A 1 79 ? -22.922 3.464   -27.720 1.00 11.39 ? 98  LYS A CG   1 
ATOM   1352 C  CD   . LYS A 1 79 ? -22.697 2.024   -28.158 1.00 11.78 ? 98  LYS A CD   1 
ATOM   1353 C  CE   . LYS A 1 79 ? -23.505 1.736   -29.373 1.00 12.19 ? 98  LYS A CE   1 
ATOM   1354 N  NZ   . LYS A 1 79 ? -23.311 0.346   -29.867 1.00 11.96 ? 98  LYS A NZ   1 
ATOM   1355 H  H    . LYS A 1 79 ? -21.127 6.270   -29.787 1.00 12.02 ? 98  LYS A H    1 
ATOM   1356 H  HA   . LYS A 1 79 ? -23.269 6.167   -28.315 1.00 11.70 ? 98  LYS A HA   1 
ATOM   1357 H  HB2  . LYS A 1 79 ? -22.595 4.325   -29.527 1.00 11.92 ? 98  LYS A HB2  1 
ATOM   1358 H  HB3  . LYS A 1 79 ? -21.281 4.203   -28.653 1.00 11.92 ? 98  LYS A HB3  1 
ATOM   1359 H  HG2  . LYS A 1 79 ? -22.575 3.565   -26.820 1.00 13.67 ? 98  LYS A HG2  1 
ATOM   1360 H  HG3  . LYS A 1 79 ? -23.876 3.639   -27.733 1.00 13.67 ? 98  LYS A HG3  1 
ATOM   1361 H  HD2  . LYS A 1 79 ? -21.760 1.891   -28.372 1.00 14.14 ? 98  LYS A HD2  1 
ATOM   1362 H  HD3  . LYS A 1 79 ? -22.975 1.420   -27.451 1.00 14.14 ? 98  LYS A HD3  1 
ATOM   1363 H  HE2  . LYS A 1 79 ? -24.445 1.852   -29.163 1.00 14.62 ? 98  LYS A HE2  1 
ATOM   1364 H  HE3  . LYS A 1 79 ? -23.244 2.346   -30.080 1.00 14.62 ? 98  LYS A HE3  1 
ATOM   1365 H  HZ1  . LYS A 1 79 ? -23.808 0.209   -30.592 1.00 14.36 ? 98  LYS A HZ1  1 
ATOM   1366 H  HZ2  . LYS A 1 79 ? -22.455 0.213   -30.074 1.00 14.36 ? 98  LYS A HZ2  1 
ATOM   1367 H  HZ3  . LYS A 1 79 ? -23.550 -0.237  -29.238 1.00 14.36 ? 98  LYS A HZ3  1 
ATOM   1368 N  N    . ILE A 1 80 ? -20.546 6.088   -26.631 1.00 9.56  ? 99  ILE A N    1 
ATOM   1369 C  CA   . ILE A 1 80 ? -19.996 6.218   -25.300 1.00 8.08  ? 99  ILE A CA   1 
ATOM   1370 C  C    . ILE A 1 80 ? -20.339 7.593   -24.734 1.00 8.18  ? 99  ILE A C    1 
ATOM   1371 O  O    . ILE A 1 80 ? -20.809 7.691   -23.609 1.00 8.91  ? 99  ILE A O    1 
ATOM   1372 C  CB   . ILE A 1 80 ? -18.476 5.926   -25.320 1.00 9.04  ? 99  ILE A CB   1 
ATOM   1373 C  CG1  . ILE A 1 80 ? -18.297 4.426   -25.603 1.00 11.18 ? 99  ILE A CG1  1 
ATOM   1374 C  CG2  . ILE A 1 80 ? -17.833 6.327   -24.006 1.00 10.48 ? 99  ILE A CG2  1 
ATOM   1375 C  CD1  . ILE A 1 80 ? -16.911 3.996   -25.980 1.00 12.04 ? 99  ILE A CD1  1 
ATOM   1376 H  H    . ILE A 1 80 ? -19.960 6.003   -27.255 1.00 11.47 ? 99  ILE A H    1 
ATOM   1377 H  HA   . ILE A 1 80 ? -20.412 5.555   -24.728 1.00 9.69  ? 99  ILE A HA   1 
ATOM   1378 H  HB   . ILE A 1 80 ? -18.067 6.434   -26.038 1.00 10.85 ? 99  ILE A HB   1 
ATOM   1379 H  HG12 . ILE A 1 80 ? -18.547 3.933   -24.806 1.00 13.41 ? 99  ILE A HG12 1 
ATOM   1380 H  HG13 . ILE A 1 80 ? -18.886 4.180   -26.334 1.00 13.41 ? 99  ILE A HG13 1 
ATOM   1381 H  HG21 . ILE A 1 80 ? -18.243 5.821   -23.287 1.00 12.58 ? 99  ILE A HG21 1 
ATOM   1382 H  HG22 . ILE A 1 80 ? -16.883 6.133   -24.047 1.00 12.58 ? 99  ILE A HG22 1 
ATOM   1383 H  HG23 . ILE A 1 80 ? -17.971 7.276   -23.863 1.00 12.58 ? 99  ILE A HG23 1 
ATOM   1384 H  HD11 . ILE A 1 80 ? -16.644 4.463   -26.787 1.00 14.45 ? 99  ILE A HD11 1 
ATOM   1385 H  HD12 . ILE A 1 80 ? -16.305 4.215   -25.254 1.00 14.45 ? 99  ILE A HD12 1 
ATOM   1386 H  HD13 . ILE A 1 80 ? -16.910 3.038   -26.135 1.00 14.45 ? 99  ILE A HD13 1 
ATOM   1387 N  N    . TYR A 1 81 ? -20.085 8.683   -25.476 1.00 8.58  ? 100 TYR A N    1 
ATOM   1388 C  CA   . TYR A 1 81 ? -20.491 9.991   -24.979 1.00 8.48  ? 100 TYR A CA   1 
ATOM   1389 C  C    . TYR A 1 81 ? -21.968 10.069  -24.682 1.00 8.24  ? 100 TYR A C    1 
ATOM   1390 O  O    . TYR A 1 81 ? -22.332 10.587  -23.636 1.00 8.98  ? 100 TYR A O    1 
ATOM   1391 C  CB   . TYR A 1 81 ? -20.081 11.093  -25.983 1.00 9.25  ? 100 TYR A CB   1 
ATOM   1392 C  CG   . TYR A 1 81 ? -18.704 11.658  -25.835 1.00 10.42 ? 100 TYR A CG   1 
ATOM   1393 C  CD1  . TYR A 1 81 ? -17.631 11.145  -26.490 1.00 13.59 ? 100 TYR A CD1  1 
ATOM   1394 C  CD2  . TYR A 1 81 ? -18.498 12.744  -25.064 1.00 14.75 ? 100 TYR A CD2  1 
ATOM   1395 C  CE1  . TYR A 1 81 ? -16.366 11.702  -26.354 1.00 15.45 ? 100 TYR A CE1  1 
ATOM   1396 C  CE2  . TYR A 1 81 ? -17.249 13.326  -24.933 1.00 16.07 ? 100 TYR A CE2  1 
ATOM   1397 C  CZ   . TYR A 1 81 ? -16.192 12.774  -25.569 1.00 14.13 ? 100 TYR A CZ   1 
ATOM   1398 O  OH   . TYR A 1 81 ? -14.959 13.339  -25.424 1.00 16.00 ? 100 TYR A OH   1 
ATOM   1399 H  H    . TYR A 1 81 ? -19.693 8.687   -26.241 1.00 10.30 ? 100 TYR A H    1 
ATOM   1400 H  HA   . TYR A 1 81 ? -20.019 10.163  -24.150 1.00 10.18 ? 100 TYR A HA   1 
ATOM   1401 H  HB2  . TYR A 1 81 ? -20.145 10.726  -26.878 1.00 11.11 ? 100 TYR A HB2  1 
ATOM   1402 H  HB3  . TYR A 1 81 ? -20.705 11.831  -25.894 1.00 11.11 ? 100 TYR A HB3  1 
ATOM   1403 H  HD1  . TYR A 1 81 ? -17.742 10.396  -27.031 1.00 16.31 ? 100 TYR A HD1  1 
ATOM   1404 H  HD2  . TYR A 1 81 ? -19.221 13.125  -24.619 1.00 17.70 ? 100 TYR A HD2  1 
ATOM   1405 H  HE1  . TYR A 1 81 ? -15.641 11.329  -26.800 1.00 18.54 ? 100 TYR A HE1  1 
ATOM   1406 H  HE2  . TYR A 1 81 ? -17.132 14.065  -24.382 1.00 19.29 ? 100 TYR A HE2  1 
ATOM   1407 H  HH   . TYR A 1 81 ? -15.005 13.998  -24.905 1.00 19.20 ? 100 TYR A HH   1 
ATOM   1408 N  N    . THR A 1 82 ? -22.836 9.614   -25.603 1.00 8.21  ? 101 THR A N    1 
ATOM   1409 C  CA   . THR A 1 82 ? -24.277 9.779   -25.366 1.00 8.61  ? 101 THR A CA   1 
ATOM   1410 C  C    . THR A 1 82 ? -24.713 8.983   -24.138 1.00 9.29  ? 101 THR A C    1 
ATOM   1411 O  O    . THR A 1 82 ? -25.515 9.447   -23.368 1.00 9.33  ? 101 THR A O    1 
ATOM   1412 C  CB   . THR A 1 82 ? -25.152 9.527   -26.574 1.00 11.17 ? 101 THR A CB   1 
ATOM   1413 O  OG1  . THR A 1 82 ? -24.897 8.249   -27.101 1.00 12.36 ? 101 THR A OG1  1 
ATOM   1414 C  CG2  . THR A 1 82 ? -24.844 10.492  -27.664 1.00 11.33 ? 101 THR A CG2  1 
ATOM   1415 H  H    . THR A 1 82 ? -22.626 9.224   -26.340 1.00 9.86  ? 101 THR A H    1 
ATOM   1416 H  HA   . THR A 1 82 ? -24.415 10.711  -25.136 1.00 10.33 ? 101 THR A HA   1 
ATOM   1417 H  HB   . THR A 1 82 ? -26.088 9.608   -26.333 1.00 13.41 ? 101 THR A HB   1 
ATOM   1418 H  HG1  . THR A 1 82 ? -24.092 8.189   -27.332 1.00 14.83 ? 101 THR A HG1  1 
ATOM   1419 H  HG21 . THR A 1 82 ? -23.916 10.404  -27.932 1.00 13.60 ? 101 THR A HG21 1 
ATOM   1420 H  HG22 . THR A 1 82 ? -25.412 10.319  -28.431 1.00 13.60 ? 101 THR A HG22 1 
ATOM   1421 H  HG23 . THR A 1 82 ? -24.998 11.399  -27.356 1.00 13.60 ? 101 THR A HG23 1 
ATOM   1422 N  N    A MET A 1 83 ? -24.189 7.783   -23.973 0.80 9.28  ? 102 MET A N    1 
ATOM   1423 N  N    B MET A 1 83 ? -24.148 7.790   -23.976 0.20 8.71  ? 102 MET A N    1 
ATOM   1424 C  CA   A MET A 1 83 ? -24.562 7.019   -22.781 0.80 8.39  ? 102 MET A CA   1 
ATOM   1425 C  CA   B MET A 1 83 ? -24.466 6.934   -22.831 0.20 8.26  ? 102 MET A CA   1 
ATOM   1426 C  C    A MET A 1 83 ? -24.071 7.713   -21.508 0.80 8.12  ? 102 MET A C    1 
ATOM   1427 C  C    B MET A 1 83 ? -23.981 7.544   -21.511 0.20 7.44  ? 102 MET A C    1 
ATOM   1428 O  O    A MET A 1 83 ? -24.773 7.754   -20.494 0.80 9.40  ? 102 MET A O    1 
ATOM   1429 O  O    B MET A 1 83 ? -24.595 7.344   -20.464 0.20 6.37  ? 102 MET A O    1 
ATOM   1430 C  CB   A MET A 1 83 ? -24.070 5.568   -22.845 0.80 8.86  ? 102 MET A CB   1 
ATOM   1431 C  CB   B MET A 1 83 ? -23.869 5.528   -23.015 0.20 9.04  ? 102 MET A CB   1 
ATOM   1432 C  CG   A MET A 1 83 ? -24.681 4.714   -23.950 0.80 10.49 ? 102 MET A CG   1 
ATOM   1433 C  CG   B MET A 1 83 ? -24.562 4.671   -24.078 0.20 10.05 ? 102 MET A CG   1 
ATOM   1434 S  SD   A MET A 1 83 ? -26.484 4.795   -24.129 0.80 12.61 ? 102 MET A SD   1 
ATOM   1435 S  SD   B MET A 1 83 ? -23.954 2.962   -24.213 0.20 10.87 ? 102 MET A SD   1 
ATOM   1436 C  CE   A MET A 1 83 ? -26.642 5.897   -25.512 0.80 15.04 ? 102 MET A CE   1 
ATOM   1437 C  CE   B MET A 1 83 ? -22.175 3.177   -24.335 0.20 10.67 ? 102 MET A CE   1 
ATOM   1438 H  H    A MET A 1 83 ? -23.638 7.395   -24.507 0.80 11.14 ? 102 MET A H    1 
ATOM   1439 H  H    B MET A 1 83 ? -23.573 7.449   -24.517 0.20 10.45 ? 102 MET A H    1 
ATOM   1440 H  HA   A MET A 1 83 ? -25.531 6.984   -22.744 0.80 10.06 ? 102 MET A HA   1 
ATOM   1441 H  HA   B MET A 1 83 ? -25.430 6.835   -22.784 0.20 9.91  ? 102 MET A HA   1 
ATOM   1442 H  HB2  A MET A 1 83 ? -23.110 5.576   -22.981 0.80 10.64 ? 102 MET A HB2  1 
ATOM   1443 H  HB2  B MET A 1 83 ? -22.939 5.618   -23.272 0.20 10.85 ? 102 MET A HB2  1 
ATOM   1444 H  HB3  A MET A 1 83 ? -24.273 5.138   -22.000 0.80 10.64 ? 102 MET A HB3  1 
ATOM   1445 H  HB3  B MET A 1 83 ? -23.930 5.053   -22.171 0.20 10.85 ? 102 MET A HB3  1 
ATOM   1446 H  HG2  A MET A 1 83 ? -24.295 4.991   -24.796 0.80 12.59 ? 102 MET A HG2  1 
ATOM   1447 H  HG2  B MET A 1 83 ? -25.509 4.628   -23.870 0.20 12.06 ? 102 MET A HG2  1 
ATOM   1448 H  HG3  A MET A 1 83 ? -24.450 3.788   -23.780 0.80 12.59 ? 102 MET A HG3  1 
ATOM   1449 H  HG3  B MET A 1 83 ? -24.439 5.093   -24.943 0.20 12.06 ? 102 MET A HG3  1 
ATOM   1450 H  HE1  A MET A 1 83 ? -27.584 6.023   -25.709 0.80 18.04 ? 102 MET A HE1  1 
ATOM   1451 H  HE1  B MET A 1 83 ? -21.756 2.306   -24.412 0.20 12.80 ? 102 MET A HE1  1 
ATOM   1452 H  HE2  A MET A 1 83 ? -26.235 6.748   -25.285 0.80 18.04 ? 102 MET A HE2  1 
ATOM   1453 H  HE2  B MET A 1 83 ? -21.975 3.711   -25.120 0.20 12.80 ? 102 MET A HE2  1 
ATOM   1454 H  HE3  A MET A 1 83 ? -26.192 5.508   -26.278 0.80 18.04 ? 102 MET A HE3  1 
ATOM   1455 H  HE3  B MET A 1 83 ? -21.856 3.628   -23.538 0.20 12.80 ? 102 MET A HE3  1 
ATOM   1456 N  N    . ILE A 1 84 ? -22.847 8.237   -21.562 1.00 7.60  ? 103 ILE A N    1 
ATOM   1457 C  CA   . ILE A 1 84 ? -22.336 8.964   -20.404 1.00 7.48  ? 103 ILE A CA   1 
ATOM   1458 C  C    . ILE A 1 84 ? -23.259 10.139  -20.095 1.00 8.16  ? 103 ILE A C    1 
ATOM   1459 O  O    . ILE A 1 84 ? -23.622 10.330  -18.936 1.00 8.84  ? 103 ILE A O    1 
ATOM   1460 C  CB   . ILE A 1 84 ? -20.885 9.397   -20.576 1.00 8.47  ? 103 ILE A CB   1 
ATOM   1461 C  CG1  . ILE A 1 84 ? -19.963 8.171   -20.545 1.00 8.64  ? 103 ILE A CG1  1 
ATOM   1462 C  CG2  . ILE A 1 84 ? -20.440 10.385  -19.548 1.00 8.86  ? 103 ILE A CG2  1 
ATOM   1463 C  CD1  . ILE A 1 84 ? -18.567 8.429   -20.977 1.00 9.53  ? 103 ILE A CD1  1 
ATOM   1464 H  H    . ILE A 1 84 ? -22.331 8.244   -22.249 0.26 9.12  ? 103 ILE A H    1 
ATOM   1465 H  HA   . ILE A 1 84 ? -22.365 8.370   -19.639 1.00 8.98  ? 103 ILE A HA   1 
ATOM   1466 H  HB   . ILE A 1 84 ? -20.800 9.814   -21.448 1.00 10.16 ? 103 ILE A HB   1 
ATOM   1467 H  HG12 . ILE A 1 84 ? -19.931 7.832   -19.636 1.00 10.37 ? 103 ILE A HG12 1 
ATOM   1468 H  HG13 . ILE A 1 84 ? -20.331 7.493   -21.132 1.00 10.37 ? 103 ILE A HG13 1 
ATOM   1469 H  HG21 . ILE A 1 84 ? -19.513 10.617  -19.715 1.00 10.63 ? 103 ILE A HG21 1 
ATOM   1470 H  HG22 . ILE A 1 84 ? -20.996 11.178  -19.611 1.00 10.63 ? 103 ILE A HG22 1 
ATOM   1471 H  HG23 . ILE A 1 84 ? -20.529 9.987   -18.668 1.00 10.63 ? 103 ILE A HG23 1 
ATOM   1472 H  HD11 . ILE A 1 84 ? -18.173 9.094   -20.391 1.00 11.43 ? 103 ILE A HD11 1 
ATOM   1473 H  HD12 . ILE A 1 84 ? -18.062 7.602   -20.924 1.00 11.43 ? 103 ILE A HD12 1 
ATOM   1474 H  HD13 . ILE A 1 84 ? -18.574 8.755   -21.890 1.00 11.43 ? 103 ILE A HD13 1 
ATOM   1475 N  N    . TYR A 1 85 ? -23.634 10.945  -21.085 1.00 8.02  ? 104 TYR A N    1 
ATOM   1476 C  CA   . TYR A 1 85 ? -24.518 12.082  -20.799 1.00 7.07  ? 104 TYR A CA   1 
ATOM   1477 C  C    . TYR A 1 85 ? -25.838 11.682  -20.243 1.00 7.49  ? 104 TYR A C    1 
ATOM   1478 O  O    . TYR A 1 85 ? -26.461 12.448  -19.522 1.00 9.16  ? 104 TYR A O    1 
ATOM   1479 C  CB   . TYR A 1 85 ? -24.735 12.936  -22.044 1.00 8.54  ? 104 TYR A CB   1 
ATOM   1480 C  CG   . TYR A 1 85 ? -23.652 13.928  -22.402 1.00 9.28  ? 104 TYR A CG   1 
ATOM   1481 C  CD1  . TYR A 1 85 ? -22.834 13.706  -23.508 1.00 10.31 ? 104 TYR A CD1  1 
ATOM   1482 C  CD2  . TYR A 1 85 ? -23.521 15.148  -21.725 1.00 11.33 ? 104 TYR A CD2  1 
ATOM   1483 C  CE1  . TYR A 1 85 ? -21.884 14.641  -23.917 1.00 10.14 ? 104 TYR A CE1  1 
ATOM   1484 C  CE2  . TYR A 1 85 ? -22.576 16.100  -22.141 1.00 11.11 ? 104 TYR A CE2  1 
ATOM   1485 C  CZ   . TYR A 1 85 ? -21.746 15.834  -23.215 1.00 10.71 ? 104 TYR A CZ   1 
ATOM   1486 O  OH   . TYR A 1 85 ? -20.791 16.733  -23.689 1.00 11.90 ? 104 TYR A OH   1 
ATOM   1487 H  H    . TYR A 1 85 ? -23.401 10.863  -21.908 1.00 9.63  ? 104 TYR A H    1 
ATOM   1488 H  HA   . TYR A 1 85 ? -24.086 12.643  -20.136 1.00 8.48  ? 104 TYR A HA   1 
ATOM   1489 H  HB2  . TYR A 1 85 ? -24.838 12.341  -22.802 1.00 10.25 ? 104 TYR A HB2  1 
ATOM   1490 H  HB3  . TYR A 1 85 ? -25.554 13.441  -21.922 1.00 10.25 ? 104 TYR A HB3  1 
ATOM   1491 H  HD1  . TYR A 1 85 ? -22.922 12.912  -23.983 1.00 12.38 ? 104 TYR A HD1  1 
ATOM   1492 H  HD2  . TYR A 1 85 ? -24.076 15.336  -21.003 1.00 13.60 ? 104 TYR A HD2  1 
ATOM   1493 H  HE1  . TYR A 1 85 ? -21.338 14.463  -24.648 1.00 12.17 ? 104 TYR A HE1  1 
ATOM   1494 H  HE2  . TYR A 1 85 ? -22.484 16.897  -21.670 1.00 13.33 ? 104 TYR A HE2  1 
ATOM   1495 H  HH   . TYR A 1 85 ? -20.778 17.420  -23.206 1.00 14.28 ? 104 TYR A HH   1 
ATOM   1496 N  N    . ARG A 1 86 ? -26.309 10.487  -20.597 1.00 8.08  ? 105 ARG A N    1 
ATOM   1497 C  CA   . ARG A 1 86 ? -27.568 9.964   -20.021 1.00 8.12  ? 105 ARG A CA   1 
ATOM   1498 C  C    . ARG A 1 86 ? -27.450 9.588   -18.548 1.00 9.42  ? 105 ARG A C    1 
ATOM   1499 O  O    . ARG A 1 86 ? -28.433 9.292   -17.904 1.00 10.53 ? 105 ARG A O    1 
ATOM   1500 C  CB   . ARG A 1 86 ? -28.089 8.751   -20.818 1.00 8.69  ? 105 ARG A CB   1 
ATOM   1501 C  CG   . ARG A 1 86 ? -28.603 9.102   -22.196 1.00 9.51  ? 105 ARG A CG   1 
ATOM   1502 C  CD   . ARG A 1 86 ? -29.044 7.837   -22.896 1.00 10.74 ? 105 ARG A CD   1 
ATOM   1503 N  NE   . ARG A 1 86 ? -29.469 8.108   -24.255 1.00 10.00 ? 105 ARG A NE   1 
ATOM   1504 C  CZ   . ARG A 1 86 ? -29.944 7.187   -25.073 1.00 10.53 ? 105 ARG A CZ   1 
ATOM   1505 N  NH1  . ARG A 1 86 ? -30.122 5.950   -24.604 1.00 13.46 ? 105 ARG A NH1  1 
ATOM   1506 N  NH2  . ARG A 1 86 ? -30.282 7.486   -26.319 1.00 10.87 ? 105 ARG A NH2  1 
ATOM   1507 H  H    . ARG A 1 86 ? -25.931 9.959   -21.162 1.00 9.69  ? 105 ARG A H    1 
ATOM   1508 H  HA   . ARG A 1 86 ? -28.240 10.660  -20.085 1.00 9.75  ? 105 ARG A HA   1 
ATOM   1509 H  HB2  . ARG A 1 86 ? -27.367 8.113   -20.925 1.00 10.43 ? 105 ARG A HB2  1 
ATOM   1510 H  HB3  . ARG A 1 86 ? -28.818 8.343   -20.325 1.00 10.43 ? 105 ARG A HB3  1 
ATOM   1511 H  HG2  . ARG A 1 86 ? -29.365 9.697   -22.120 1.00 11.41 ? 105 ARG A HG2  1 
ATOM   1512 H  HG3  . ARG A 1 86 ? -27.895 9.514   -22.715 1.00 11.41 ? 105 ARG A HG3  1 
ATOM   1513 H  HD2  . ARG A 1 86 ? -28.302 7.213   -22.928 1.00 12.89 ? 105 ARG A HD2  1 
ATOM   1514 H  HD3  . ARG A 1 86 ? -29.791 7.448   -22.415 1.00 12.89 ? 105 ARG A HD3  1 
ATOM   1515 H  HE   . ARG A 1 86 ? -29.504 8.929   -24.509 1.00 12.00 ? 105 ARG A HE   1 
ATOM   1516 H  HH11 . ARG A 1 86 ? -29.894 5.759   -23.797 1.00 16.15 ? 105 ARG A HH11 1 
ATOM   1517 H  HH12 . ARG A 1 86 ? -30.441 5.338   -25.116 1.00 16.15 ? 105 ARG A HH12 1 
ATOM   1518 H  HH21 . ARG A 1 86 ? -30.183 8.289   -26.611 1.00 13.04 ? 105 ARG A HH21 1 
ATOM   1519 H  HH22 . ARG A 1 86 ? -30.617 6.881   -26.830 1.00 13.04 ? 105 ARG A HH22 1 
ATOM   1520 N  N    . ASN A 1 87 ? -26.243 9.689   -18.018 1.00 8.80  ? 106 ASN A N    1 
ATOM   1521 C  CA   . ASN A 1 87 ? -25.940 9.322   -16.639 1.00 9.13  ? 106 ASN A CA   1 
ATOM   1522 C  C    . ASN A 1 87 ? -25.433 10.489  -15.770 1.00 9.59  ? 106 ASN A C    1 
ATOM   1523 O  O    . ASN A 1 87 ? -24.926 10.275  -14.670 1.00 10.10 ? 106 ASN A O    1 
ATOM   1524 C  CB   . ASN A 1 87 ? -24.976 8.135   -16.615 1.00 9.51  ? 106 ASN A CB   1 
ATOM   1525 C  CG   . ASN A 1 87 ? -25.687 6.860   -16.867 1.00 9.96  ? 106 ASN A CG   1 
ATOM   1526 O  OD1  . ASN A 1 87 ? -26.317 6.326   -15.959 1.00 12.51 ? 106 ASN A OD1  1 
ATOM   1527 N  ND2  . ASN A 1 87 ? -25.675 6.407   -18.113 1.00 11.10 ? 106 ASN A ND2  1 
ATOM   1528 H  H    . ASN A 1 87 ? -25.558 9.976   -18.451 1.00 10.57 ? 106 ASN A H    1 
ATOM   1529 H  HA   . ASN A 1 87 ? -26.765 9.016   -16.231 1.00 10.96 ? 106 ASN A HA   1 
ATOM   1530 H  HB2  . ASN A 1 87 ? -24.306 8.252   -17.307 1.00 11.41 ? 106 ASN A HB2  1 
ATOM   1531 H  HB3  . ASN A 1 87 ? -24.554 8.082   -15.743 1.00 11.41 ? 106 ASN A HB3  1 
ATOM   1532 H  HD21 . ASN A 1 87 ? -26.075 5.671   -18.307 1.00 13.32 ? 106 ASN A HD21 1 
ATOM   1533 H  HD22 . ASN A 1 87 ? -25.267 6.850   -18.728 1.00 13.32 ? 106 ASN A HD22 1 
ATOM   1534 N  N    . LEU A 1 88 ? -25.628 11.709  -16.254 1.00 9.28  ? 107 LEU A N    1 
ATOM   1535 C  CA   . LEU A 1 88 ? -25.178 12.887  -15.530 1.00 8.86  ? 107 LEU A CA   1 
ATOM   1536 C  C    . LEU A 1 88 ? -25.951 14.106  -16.022 1.00 8.03  ? 107 LEU A C    1 
ATOM   1537 O  O    . LEU A 1 88 ? -26.729 14.016  -16.982 1.00 9.73  ? 107 LEU A O    1 
ATOM   1538 C  CB   . LEU A 1 88 ? -23.667 13.069  -15.737 1.00 10.15 ? 107 LEU A CB   1 
ATOM   1539 C  CG   . LEU A 1 88 ? -23.121 13.201  -17.177 1.00 10.16 ? 107 LEU A CG   1 
ATOM   1540 C  CD1  . LEU A 1 88 ? -23.469 14.532  -17.826 1.00 10.63 ? 107 LEU A CD1  1 
ATOM   1541 C  CD2  . LEU A 1 88 ? -21.627 12.975  -17.142 1.00 10.84 ? 107 LEU A CD2  1 
ATOM   1542 H  H    . LEU A 1 88 ? -26.018 11.881  -17.001 1.00 11.13 ? 107 LEU A H    1 
ATOM   1543 H  HA   . LEU A 1 88 ? -25.349 12.772  -14.582 1.00 10.63 ? 107 LEU A HA   1 
ATOM   1544 H  HB2  . LEU A 1 88 ? -23.399 13.871  -15.262 1.00 12.19 ? 107 LEU A HB2  1 
ATOM   1545 H  HB3  . LEU A 1 88 ? -23.221 12.305  -15.339 1.00 12.19 ? 107 LEU A HB3  1 
ATOM   1546 H  HG   . LEU A 1 88 ? -23.511 12.499  -17.721 1.00 12.19 ? 107 LEU A HG   1 
ATOM   1547 H  HD11 . LEU A 1 88 ? -24.434 14.622  -17.864 1.00 12.76 ? 107 LEU A HD11 1 
ATOM   1548 H  HD12 . LEU A 1 88 ? -23.090 15.250  -17.296 1.00 12.76 ? 107 LEU A HD12 1 
ATOM   1549 H  HD13 . LEU A 1 88 ? -23.099 14.552  -18.723 1.00 12.76 ? 107 LEU A HD13 1 
ATOM   1550 H  HD21 . LEU A 1 88 ? -21.221 13.641  -16.565 1.00 13.01 ? 107 LEU A HD21 1 
ATOM   1551 H  HD22 . LEU A 1 88 ? -21.451 12.086  -16.796 1.00 13.01 ? 107 LEU A HD22 1 
ATOM   1552 H  HD23 . LEU A 1 88 ? -21.275 13.056  -18.041 1.00 13.01 ? 107 LEU A HD23 1 
ATOM   1553 N  N    . VAL A 1 89 ? -25.699 15.257  -15.395 1.00 8.84  ? 108 VAL A N    1 
ATOM   1554 C  CA   . VAL A 1 89 ? -26.135 16.514  -15.936 1.00 9.53  ? 108 VAL A CA   1 
ATOM   1555 C  C    . VAL A 1 89 ? -24.931 17.422  -16.087 1.00 9.20  ? 108 VAL A C    1 
ATOM   1556 O  O    . VAL A 1 89 ? -23.960 17.323  -15.317 1.00 9.51  ? 108 VAL A O    1 
ATOM   1557 C  CB   . VAL A 1 89 ? -27.213 17.201  -15.088 1.00 10.96 ? 108 VAL A CB   1 
ATOM   1558 C  CG1  . VAL A 1 89 ? -28.493 16.339  -14.988 1.00 12.42 ? 108 VAL A CG1  1 
ATOM   1559 C  CG2  . VAL A 1 89 ? -26.678 17.559  -13.752 1.00 11.75 ? 108 VAL A CG2  1 
ATOM   1560 H  H    . VAL A 1 89 ? -25.273 15.322  -14.651 1.00 10.60 ? 108 VAL A H    1 
ATOM   1561 H  HA   . VAL A 1 89 ? -26.506 16.362  -16.820 1.00 11.44 ? 108 VAL A HA   1 
ATOM   1562 H  HB   . VAL A 1 89 ? -27.460 18.029  -15.528 1.00 13.16 ? 108 VAL A HB   1 
ATOM   1563 H  HG11 . VAL A 1 89 ? -28.361 15.519  -15.489 1.00 14.91 ? 108 VAL A HG11 1 
ATOM   1564 H  HG12 . VAL A 1 89 ? -28.662 16.133  -14.055 1.00 14.91 ? 108 VAL A HG12 1 
ATOM   1565 H  HG13 . VAL A 1 89 ? -29.238 16.837  -15.358 1.00 14.91 ? 108 VAL A HG13 1 
ATOM   1566 H  HG21 . VAL A 1 89 ? -27.379 17.991  -13.238 1.00 14.10 ? 108 VAL A HG21 1 
ATOM   1567 H  HG22 . VAL A 1 89 ? -26.387 16.751  -13.302 1.00 14.10 ? 108 VAL A HG22 1 
ATOM   1568 H  HG23 . VAL A 1 89 ? -25.929 18.164  -13.864 1.00 14.10 ? 108 VAL A HG23 1 
ATOM   1569 N  N    . VAL A 1 90 ? -25.011 18.312  -17.060 1.00 9.80  ? 109 VAL A N    1 
ATOM   1570 C  CA   . VAL A 1 90 ? -23.976 19.309  -17.224 1.00 11.15 ? 109 VAL A CA   1 
ATOM   1571 C  C    . VAL A 1 90 ? -24.285 20.483  -16.319 1.00 14.09 ? 109 VAL A C    1 
ATOM   1572 O  O    . VAL A 1 90 ? -25.446 20.866  -16.194 1.00 16.57 ? 109 VAL A O    1 
ATOM   1573 C  CB   . VAL A 1 90 ? -23.930 19.753  -18.712 1.00 13.28 ? 109 VAL A CB   1 
ATOM   1574 C  CG1  . VAL A 1 90 ? -22.951 20.852  -18.946 1.00 15.24 ? 109 VAL A CG1  1 
ATOM   1575 C  CG2  . VAL A 1 90 ? -23.633 18.565  -19.603 1.00 14.61 ? 109 VAL A CG2  1 
ATOM   1576 H  H    . VAL A 1 90 ? -25.649 18.359  -17.634 1.00 11.76 ? 109 VAL A H    1 
ATOM   1577 H  HA   . VAL A 1 90 ? -23.114 18.937  -16.978 1.00 13.38 ? 109 VAL A HA   1 
ATOM   1578 H  HB   . VAL A 1 90 ? -24.806 20.089  -18.959 1.00 15.94 ? 109 VAL A HB   1 
ATOM   1579 H  HG11 . VAL A 1 90 ? -22.963 21.089  -19.886 1.00 18.29 ? 109 VAL A HG11 1 
ATOM   1580 H  HG12 . VAL A 1 90 ? -23.203 21.618  -18.407 1.00 18.29 ? 109 VAL A HG12 1 
ATOM   1581 H  HG13 . VAL A 1 90 ? -22.067 20.545  -18.693 1.00 18.29 ? 109 VAL A HG13 1 
ATOM   1582 H  HG21 . VAL A 1 90 ? -23.534 17.774  -19.050 1.00 17.54 ? 109 VAL A HG21 1 
ATOM   1583 H  HG22 . VAL A 1 90 ? -24.368 18.445  -20.224 1.00 17.54 ? 109 VAL A HG22 1 
ATOM   1584 H  HG23 . VAL A 1 90 ? -22.811 18.734  -20.090 1.00 17.54 ? 109 VAL A HG23 1 
ATOM   1585 N  N    . VAL A 1 91 ? -23.267 21.049  -15.692 1.00 14.01 ? 110 VAL A N    1 
ATOM   1586 C  CA   . VAL A 1 91 ? -23.477 22.131  -14.742 1.00 17.08 ? 110 VAL A CA   1 
ATOM   1587 C  C    . VAL A 1 91 ? -23.592 23.434  -15.492 1.00 21.97 ? 110 VAL A C    1 
ATOM   1588 O  O    . VAL A 1 91 ? -22.714 23.748  -16.309 1.00 23.07 ? 110 VAL A O    1 
ATOM   1589 C  CB   . VAL A 1 91 ? -22.327 22.197  -13.698 1.00 18.17 ? 110 VAL A CB   1 
ATOM   1590 C  CG1  . VAL A 1 91 ? -22.417 23.485  -12.857 1.00 20.74 ? 110 VAL A CG1  1 
ATOM   1591 C  CG2  . VAL A 1 91 ? -22.361 20.990  -12.832 1.00 18.54 ? 110 VAL A CG2  1 
ATOM   1592 H  H    . VAL A 1 91 ? -22.443 20.827  -15.799 1.00 16.82 ? 110 VAL A H    1 
ATOM   1593 H  HA   . VAL A 1 91 ? -24.309 21.981  -14.267 1.00 20.50 ? 110 VAL A HA   1 
ATOM   1594 H  HB   . VAL A 1 91 ? -21.477 22.205  -14.166 1.00 21.81 ? 110 VAL A HB   1 
ATOM   1595 H  HG11 . VAL A 1 91 ? -23.183 24.001  -13.153 1.00 24.89 ? 110 VAL A HG11 1 
ATOM   1596 H  HG12 . VAL A 1 91 ? -22.520 23.245  -11.923 1.00 24.89 ? 110 VAL A HG12 1 
ATOM   1597 H  HG13 . VAL A 1 91 ? -21.604 23.999  -12.979 1.00 24.89 ? 110 VAL A HG13 1 
ATOM   1598 H  HG21 . VAL A 1 91 ? -21.639 21.044  -12.186 1.00 22.25 ? 110 VAL A HG21 1 
ATOM   1599 H  HG22 . VAL A 1 91 ? -23.215 20.956  -12.372 1.00 22.25 ? 110 VAL A HG22 1 
ATOM   1600 H  HG23 . VAL A 1 91 ? -22.251 20.201  -13.385 1.00 22.25 ? 110 VAL A HG23 1 
ATOM   1601 N  N    . ASN A 1 92 ? -24.684 24.160  -15.175 1.00 26.47 ? 111 ASN A N    1 
ATOM   1602 C  CA   . ASN A 1 92 ? -24.953 25.543  -15.559 1.00 30.58 ? 111 ASN A CA   1 
ATOM   1603 C  C    . ASN A 1 92 ? -23.905 26.486  -14.992 1.00 34.13 ? 111 ASN A C    1 
ATOM   1604 O  O    . ASN A 1 92 ? -24.138 27.119  -13.964 1.00 37.67 ? 111 ASN A O    1 
ATOM   1605 C  CB   . ASN A 1 92 ? -26.320 25.981  -14.986 1.00 32.28 ? 111 ASN A CB   1 
ATOM   1606 C  CG   . ASN A 1 92 ? -27.476 25.476  -15.816 1.00 35.15 ? 111 ASN A CG   1 
ATOM   1607 O  OD1  . ASN A 1 92 ? -27.511 24.299  -16.194 1.00 38.57 ? 111 ASN A OD1  1 
ATOM   1608 N  ND2  . ASN A 1 92 ? -28.421 26.364  -16.139 1.00 35.76 ? 111 ASN A ND2  1 
ATOM   1609 H  H    . ASN A 1 92 ? -25.323 23.834  -14.701 1.00 31.76 ? 111 ASN A H    1 
ATOM   1610 H  HA   . ASN A 1 92 ? -24.969 25.627  -16.525 1.00 36.70 ? 111 ASN A HA   1 
ATOM   1611 H  HB2  . ASN A 1 92 ? -26.416 25.626  -14.088 1.00 38.73 ? 111 ASN A HB2  1 
ATOM   1612 H  HB3  . ASN A 1 92 ? -26.362 26.950  -14.968 1.00 38.73 ? 111 ASN A HB3  1 
ATOM   1613 H  HD21 . ASN A 1 92 ? -28.353 27.180  -15.874 1.00 42.91 ? 111 ASN A HD21 1 
ATOM   1614 H  HD22 . ASN A 1 92 ? -29.097 26.120  -16.610 1.00 42.91 ? 111 ASN A HD22 1 
ATOM   1615 N  N    . PRO B 1 1  ? 7.863   -8.109  -11.040 1.00 29.01 ? 20  PRO B N    1 
ATOM   1616 C  CA   . PRO B 1 1  ? 8.849   -7.141  -10.535 1.00 29.44 ? 20  PRO B CA   1 
ATOM   1617 C  C    . PRO B 1 1  ? 9.406   -7.531  -9.161  1.00 28.70 ? 20  PRO B C    1 
ATOM   1618 O  O    . PRO B 1 1  ? 8.686   -8.109  -8.336  1.00 30.58 ? 20  PRO B O    1 
ATOM   1619 C  CB   . PRO B 1 1  ? 8.052   -5.836  -10.429 1.00 29.72 ? 20  PRO B CB   1 
ATOM   1620 C  CG   . PRO B 1 1  ? 6.935   -5.983  -11.379 1.00 29.34 ? 20  PRO B CG   1 
ATOM   1621 C  CD   . PRO B 1 1  ? 6.596   -7.459  -11.425 1.00 29.11 ? 20  PRO B CD   1 
ATOM   1622 H  HA   . PRO B 1 1  ? 9.577   -7.030  -11.167 1.00 35.33 ? 20  PRO B HA   1 
ATOM   1623 H  HB2  . PRO B 1 1  ? 7.719   -5.729  -9.524  1.00 35.66 ? 20  PRO B HB2  1 
ATOM   1624 H  HB3  . PRO B 1 1  ? 8.617   -5.087  -10.677 1.00 35.66 ? 20  PRO B HB3  1 
ATOM   1625 H  HG2  . PRO B 1 1  ? 6.174   -5.471  -11.065 1.00 35.21 ? 20  PRO B HG2  1 
ATOM   1626 H  HG3  . PRO B 1 1  ? 7.214   -5.673  -12.255 1.00 35.21 ? 20  PRO B HG3  1 
ATOM   1627 H  HD2  . PRO B 1 1  ? 5.900   -7.666  -10.782 1.00 34.93 ? 20  PRO B HD2  1 
ATOM   1628 H  HD3  . PRO B 1 1  ? 6.341   -7.720  -12.324 1.00 34.93 ? 20  PRO B HD3  1 
ATOM   1629 N  N    . ALA B 1 2  ? 10.673  -7.225  -8.916  1.00 26.37 ? 21  ALA B N    1 
ATOM   1630 C  CA   . ALA B 1 2  ? 11.308  -7.603  -7.653  1.00 23.80 ? 21  ALA B CA   1 
ATOM   1631 C  C    . ALA B 1 2  ? 10.799  -6.763  -6.480  1.00 19.84 ? 21  ALA B C    1 
ATOM   1632 O  O    . ALA B 1 2  ? 10.747  -7.245  -5.343  1.00 19.50 ? 21  ALA B O    1 
ATOM   1633 C  CB   . ALA B 1 2  ? 12.806  -7.460  -7.774  1.00 23.56 ? 21  ALA B CB   1 
ATOM   1634 H  H    . ALA B 1 2  ? 11.188  -6.802  -9.460  1.00 31.64 ? 21  ALA B H    1 
ATOM   1635 H  HA   . ALA B 1 2  ? 11.108  -8.533  -7.465  1.00 28.56 ? 21  ALA B HA   1 
ATOM   1636 H  HB1  . ALA B 1 2  ? 13.122  -8.041  -8.484  1.00 28.27 ? 21  ALA B HB1  1 
ATOM   1637 H  HB2  . ALA B 1 2  ? 13.018  -6.537  -7.982  1.00 28.27 ? 21  ALA B HB2  1 
ATOM   1638 H  HB3  . ALA B 1 2  ? 13.216  -7.712  -6.932  1.00 28.27 ? 21  ALA B HB3  1 
ATOM   1639 N  N    . SER B 1 3  ? 10.475  -5.495  -6.723  1.00 18.96 ? 22  SER B N    1 
ATOM   1640 C  CA   . SER B 1 3  ? 10.089  -4.614  -5.617  1.00 16.94 ? 22  SER B CA   1 
ATOM   1641 C  C    . SER B 1 3  ? 8.606   -4.751  -5.284  1.00 15.57 ? 22  SER B C    1 
ATOM   1642 O  O    . SER B 1 3  ? 7.729   -4.345  -6.066  1.00 18.87 ? 22  SER B O    1 
ATOM   1643 C  CB   . SER B 1 3  ? 10.362  -3.155  -5.942  1.00 17.71 ? 22  SER B CB   1 
ATOM   1644 O  OG   . SER B 1 3  ? 9.780   -2.315  -4.969  1.00 19.99 ? 22  SER B OG   1 
ATOM   1645 H  H    . SER B 1 3  ? 10.470  -5.125  -7.499  1.00 22.75 ? 22  SER B H    1 
ATOM   1646 H  HA   . SER B 1 3  ? 10.600  -4.850  -4.827  1.00 20.32 ? 22  SER B HA   1 
ATOM   1647 H  HB2  . SER B 1 3  ? 11.320  -3.008  -5.955  1.00 21.25 ? 22  SER B HB2  1 
ATOM   1648 H  HB3  . SER B 1 3  ? 9.981   -2.947  -6.809  1.00 21.25 ? 22  SER B HB3  1 
ATOM   1649 H  HG   . SER B 1 3  ? 10.101  -2.487  -4.212  1.00 23.99 ? 22  SER B HG   1 
ATOM   1650 N  N    . GLU B 1 4  ? 8.322   -5.265  -4.107  1.00 14.47 ? 23  GLU B N    1 
ATOM   1651 C  CA   . GLU B 1 4  ? 6.952   -5.429  -3.694  1.00 14.36 ? 23  GLU B CA   1 
ATOM   1652 C  C    . GLU B 1 4  ? 6.367   -4.101  -3.254  1.00 13.27 ? 23  GLU B C    1 
ATOM   1653 O  O    . GLU B 1 4  ? 5.164   -3.947  -3.248  1.00 15.40 ? 23  GLU B O    1 
ATOM   1654 C  CB   . GLU B 1 4  ? 6.819   -6.423  -2.543  1.00 14.52 ? 23  GLU B CB   1 
ATOM   1655 C  CG   . GLU B 1 4  ? 7.347   -7.818  -2.833  1.00 15.67 ? 23  GLU B CG   1 
ATOM   1656 C  CD   . GLU B 1 4  ? 6.593   -8.576  -3.928  1.00 17.63 ? 23  GLU B CD   1 
ATOM   1657 O  OE1  . GLU B 1 4  ? 5.534   -8.115  -4.391  1.00 18.50 ? 23  GLU B OE1  1 
ATOM   1658 O  OE2  . GLU B 1 4  ? 7.067   -9.655  -4.336  1.00 19.48 ? 23  GLU B OE2  1 
ATOM   1659 H  H    . GLU B 1 4  ? 8.904   -5.526  -3.530  1.00 17.36 ? 23  GLU B H    1 
ATOM   1660 H  HA   . GLU B 1 4  ? 6.430   -5.758  -4.442  1.00 17.23 ? 23  GLU B HA   1 
ATOM   1661 H  HB2  . GLU B 1 4  ? 7.308   -6.079  -1.780  1.00 17.43 ? 23  GLU B HB2  1 
ATOM   1662 H  HB3  . GLU B 1 4  ? 5.880   -6.508  -2.316  1.00 17.43 ? 23  GLU B HB3  1 
ATOM   1663 H  HG2  . GLU B 1 4  ? 8.273   -7.745  -3.112  1.00 18.80 ? 23  GLU B HG2  1 
ATOM   1664 H  HG3  . GLU B 1 4  ? 7.292   -8.344  -2.021  1.00 18.80 ? 23  GLU B HG3  1 
ATOM   1665 N  N    . GLN B 1 5  ? 7.208   -3.148  -2.861  1.00 14.05 ? 24  GLN B N    1 
ATOM   1666 C  CA   . GLN B 1 5  ? 6.693   -1.871  -2.369  1.00 13.55 ? 24  GLN B CA   1 
ATOM   1667 C  C    . GLN B 1 5  ? 6.392   -0.835  -3.440  1.00 13.58 ? 24  GLN B C    1 
ATOM   1668 O  O    . GLN B 1 5  ? 5.684   0.134   -3.175  1.00 16.13 ? 24  GLN B O    1 
ATOM   1669 C  CB   . GLN B 1 5  ? 7.656   -1.276  -1.349  1.00 15.21 ? 24  GLN B CB   1 
ATOM   1670 C  CG   . GLN B 1 5  ? 7.739   -2.169  -0.122  1.00 17.10 ? 24  GLN B CG   1 
ATOM   1671 C  CD   . GLN B 1 5  ? 8.610   -1.626  0.994   1.00 19.70 ? 24  GLN B CD   1 
ATOM   1672 O  OE1  . GLN B 1 5  ? 9.521   -0.829  0.758   1.00 20.98 ? 24  GLN B OE1  1 
ATOM   1673 N  NE2  . GLN B 1 5  ? 8.350   -2.093  2.229   1.00 18.81 ? 24  GLN B NE2  1 
ATOM   1674 H  H    . GLN B 1 5  ? 8.066   -3.211  -2.868  1.00 16.86 ? 24  GLN B H    1 
ATOM   1675 H  HA   . GLN B 1 5  ? 5.860   -2.046  -1.905  1.00 16.27 ? 24  GLN B HA   1 
ATOM   1676 H  HB2  . GLN B 1 5  ? 8.541   -1.207  -1.740  1.00 18.25 ? 24  GLN B HB2  1 
ATOM   1677 H  HB3  . GLN B 1 5  ? 7.337   -0.403  -1.073  1.00 18.25 ? 24  GLN B HB3  1 
ATOM   1678 H  HG2  . GLN B 1 5  ? 6.845   -2.290  0.235   1.00 20.52 ? 24  GLN B HG2  1 
ATOM   1679 H  HG3  . GLN B 1 5  ? 8.104   -3.028  -0.387  1.00 20.52 ? 24  GLN B HG3  1 
ATOM   1680 H  HE21 . GLN B 1 5  ? 8.813   -1.818  2.899   1.00 22.58 ? 24  GLN B HE21 1 
ATOM   1681 H  HE22 . GLN B 1 5  ? 7.719   -2.666  2.348   1.00 22.58 ? 24  GLN B HE22 1 
ATOM   1682 N  N    . GLU B 1 6  ? 6.908   -1.029  -4.655  1.00 13.14 ? 25  GLU B N    1 
ATOM   1683 C  CA   . GLU B 1 6  ? 6.652   -0.119  -5.764  1.00 15.38 ? 25  GLU B CA   1 
ATOM   1684 C  C    . GLU B 1 6  ? 5.146   0.084   -5.981  1.00 13.47 ? 25  GLU B C    1 
ATOM   1685 O  O    . GLU B 1 6  ? 4.377   -0.822  -5.745  1.00 14.20 ? 25  GLU B O    1 
ATOM   1686 C  CB   . GLU B 1 6  ? 7.304   -0.714  -7.017  1.00 18.74 ? 25  GLU B CB   1 
ATOM   1687 C  CG   . GLU B 1 6  ? 6.961   -0.089  -8.348  1.00 22.67 ? 25  GLU B CG   1 
ATOM   1688 C  CD   . GLU B 1 6  ? 7.714   -0.794  -9.440  1.00 26.81 ? 25  GLU B CD   1 
ATOM   1689 O  OE1  . GLU B 1 6  ? 7.155   -1.716  -10.121 1.00 28.98 ? 25  GLU B OE1  1 
ATOM   1690 O  OE2  . GLU B 1 6  ? 8.894   -0.438  -9.590  1.00 27.19 ? 25  GLU B OE2  1 
ATOM   1691 H  H    . GLU B 1 6  ? 7.416   -1.691  -4.861  1.00 15.77 ? 25  GLU B H    1 
ATOM   1692 H  HA   . GLU B 1 6  ? 7.058   0.743   -5.581  1.00 18.45 ? 25  GLU B HA   1 
ATOM   1693 H  HB2  . GLU B 1 6  ? 8.266   -0.649  -6.913  1.00 22.48 ? 25  GLU B HB2  1 
ATOM   1694 H  HB3  . GLU B 1 6  ? 7.053   -1.649  -7.069  1.00 22.48 ? 25  GLU B HB3  1 
ATOM   1695 H  HG2  . GLU B 1 6  ? 6.010   -0.182  -8.517  1.00 27.20 ? 25  GLU B HG2  1 
ATOM   1696 H  HG3  . GLU B 1 6  ? 7.219   0.846   -8.346  1.00 27.20 ? 25  GLU B HG3  1 
ATOM   1697 N  N    . THR B 1 7  ? 4.732   1.257   -6.492  1.00 12.65 ? 26  THR B N    1 
ATOM   1698 C  CA   . THR B 1 7  ? 3.366   1.492   -6.954  1.00 12.05 ? 26  THR B CA   1 
ATOM   1699 C  C    . THR B 1 7  ? 3.386   1.914   -8.414  1.00 12.10 ? 26  THR B C    1 
ATOM   1700 O  O    . THR B 1 7  ? 4.058   2.891   -8.745  1.00 13.59 ? 26  THR B O    1 
ATOM   1701 C  CB   . THR B 1 7  ? 2.679   2.606   -6.143  1.00 13.27 ? 26  THR B CB   1 
ATOM   1702 O  OG1  . THR B 1 7  ? 2.733   2.276   -4.755  1.00 13.61 ? 26  THR B OG1  1 
ATOM   1703 C  CG2  . THR B 1 7  ? 1.234   2.805   -6.525  1.00 15.76 ? 26  THR B CG2  1 
ATOM   1704 H  H    . THR B 1 7  ? 5.242   1.943   -6.580  1.00 15.18 ? 26  THR B H    1 
ATOM   1705 H  HA   . THR B 1 7  ? 2.846   0.678   -6.870  1.00 14.46 ? 26  THR B HA   1 
ATOM   1706 H  HB   . THR B 1 7  ? 3.149   3.442   -6.289  1.00 15.92 ? 26  THR B HB   1 
ATOM   1707 H  HG1  . THR B 1 7  ? 2.361   2.877   -4.302  1.00 16.33 ? 26  THR B HG1  1 
ATOM   1708 H  HG21 . THR B 1 7  ? 1.169   3.046   -7.462  1.00 18.91 ? 26  THR B HG21 1 
ATOM   1709 H  HG22 . THR B 1 7  ? 0.736   1.987   -6.375  1.00 18.91 ? 26  THR B HG22 1 
ATOM   1710 H  HG23 . THR B 1 7  ? 0.845   3.514   -5.990  1.00 18.91 ? 26  THR B HG23 1 
ATOM   1711 N  N    . LEU B 1 8  ? 2.619   1.214   -9.240  1.00 12.49 ? 27  LEU B N    1 
ATOM   1712 C  CA   . LEU B 1 8  ? 2.425   1.581   -10.638 1.00 12.73 ? 27  LEU B CA   1 
ATOM   1713 C  C    . LEU B 1 8  ? 1.118   2.338   -10.729 1.00 11.38 ? 27  LEU B C    1 
ATOM   1714 O  O    . LEU B 1 8  ? 0.115   1.953   -10.129 1.00 11.65 ? 27  LEU B O    1 
ATOM   1715 C  CB   . LEU B 1 8  ? 2.346   0.314   -11.492 1.00 15.10 ? 27  LEU B CB   1 
ATOM   1716 C  CG   . LEU B 1 8  ? 3.661   -0.455  -11.636 1.00 18.79 ? 27  LEU B CG   1 
ATOM   1717 C  CD1  . LEU B 1 8  ? 3.502   -1.676  -12.516 1.00 21.27 ? 27  LEU B CD1  1 
ATOM   1718 C  CD2  . LEU B 1 8  ? 4.711   0.444   -12.233 1.00 21.38 ? 27  LEU B CD2  1 
ATOM   1719 H  H    . LEU B 1 8  ? 2.189   0.506   -9.009  1.00 14.99 ? 27  LEU B H    1 
ATOM   1720 H  HA   . LEU B 1 8  ? 3.151   2.142   -10.950 1.00 15.28 ? 27  LEU B HA   1 
ATOM   1721 H  HB2  . LEU B 1 8  ? 1.698   -0.288  -11.092 1.00 18.11 ? 27  LEU B HB2  1 
ATOM   1722 H  HB3  . LEU B 1 8  ? 2.053   0.560   -12.383 1.00 18.11 ? 27  LEU B HB3  1 
ATOM   1723 H  HG   . LEU B 1 8  ? 3.965   -0.744  -10.761 1.00 22.55 ? 27  LEU B HG   1 
ATOM   1724 H  HD11 . LEU B 1 8  ? 2.840   -2.265  -12.121 1.00 25.52 ? 27  LEU B HD11 1 
ATOM   1725 H  HD12 . LEU B 1 8  ? 3.210   -1.394  -13.397 1.00 25.52 ? 27  LEU B HD12 1 
ATOM   1726 H  HD13 . LEU B 1 8  ? 4.355   -2.132  -12.580 1.00 25.52 ? 27  LEU B HD13 1 
ATOM   1727 H  HD21 . LEU B 1 8  ? 4.411   0.743   -13.106 1.00 25.66 ? 27  LEU B HD21 1 
ATOM   1728 H  HD22 . LEU B 1 8  ? 4.842   1.207   -11.649 1.00 25.66 ? 27  LEU B HD22 1 
ATOM   1729 H  HD23 . LEU B 1 8  ? 5.540   -0.053  -12.319 1.00 25.66 ? 27  LEU B HD23 1 
ATOM   1730 N  N    . VAL B 1 9  ? 1.147   3.438   -11.467 1.00 10.19 ? 28  VAL B N    1 
ATOM   1731 C  CA   . VAL B 1 9  ? 0.019   4.365   -11.549 1.00 10.26 ? 28  VAL B CA   1 
ATOM   1732 C  C    . VAL B 1 9  ? -0.252  4.801   -12.988 1.00 10.16 ? 28  VAL B C    1 
ATOM   1733 O  O    . VAL B 1 9  ? 0.655   4.896   -13.817 1.00 11.53 ? 28  VAL B O    1 
ATOM   1734 C  CB   . VAL B 1 9  ? 0.258   5.617   -10.669 1.00 9.83  ? 28  VAL B CB   1 
ATOM   1735 C  CG1  . VAL B 1 9  ? 0.442   5.254   -9.220  1.00 10.77 ? 28  VAL B CG1  1 
ATOM   1736 C  CG2  . VAL B 1 9  ? 1.417   6.450   -11.201 1.00 10.37 ? 28  VAL B CG2  1 
ATOM   1737 H  H    . VAL B 1 9  ? 1.823   3.678   -11.941 1.00 12.22 ? 28  VAL B H    1 
ATOM   1738 H  HA   . VAL B 1 9  ? -0.776  3.919   -11.219 1.00 12.31 ? 28  VAL B HA   1 
ATOM   1739 H  HB   . VAL B 1 9  ? -0.535  6.173   -10.722 1.00 11.79 ? 28  VAL B HB   1 
ATOM   1740 H  HG11 . VAL B 1 9  ? 0.588   6.065   -8.709  1.00 12.93 ? 28  VAL B HG11 1 
ATOM   1741 H  HG12 . VAL B 1 9  ? -0.356  4.803   -8.905  1.00 12.93 ? 28  VAL B HG12 1 
ATOM   1742 H  HG13 . VAL B 1 9  ? 1.209   4.667   -9.137  1.00 12.93 ? 28  VAL B HG13 1 
ATOM   1743 H  HG21 . VAL B 1 9  ? 1.776   6.021   -11.994 1.00 12.44 ? 28  VAL B HG21 1 
ATOM   1744 H  HG22 . VAL B 1 9  ? 1.093   7.337   -11.422 1.00 12.44 ? 28  VAL B HG22 1 
ATOM   1745 H  HG23 . VAL B 1 9  ? 2.103   6.508   -10.517 1.00 12.44 ? 28  VAL B HG23 1 
ATOM   1746 N  N    . ARG B 1 10 ? -1.507  5.108   -13.264 1.00 9.41  ? 29  ARG B N    1 
ATOM   1747 C  CA   . ARG B 1 10 ? -1.883  5.686   -14.528 1.00 9.83  ? 29  ARG B CA   1 
ATOM   1748 C  C    . ARG B 1 10 ? -2.444  7.067   -14.184 1.00 8.57  ? 29  ARG B C    1 
ATOM   1749 O  O    . ARG B 1 10 ? -3.503  7.169   -13.539 1.00 9.43  ? 29  ARG B O    1 
ATOM   1750 C  CB   . ARG B 1 10 ? -2.947  4.845   -15.251 1.00 13.36 ? 29  ARG B CB   1 
ATOM   1751 C  CG   . ARG B 1 10 ? -2.492  3.470   -15.619 1.00 16.21 ? 29  ARG B CG   1 
ATOM   1752 C  CD   . ARG B 1 10 ? -3.337  2.854   -16.694 1.00 19.23 ? 29  ARG B CD   1 
ATOM   1753 N  NE   . ARG B 1 10 ? -2.851  1.525   -17.022 1.00 21.83 ? 29  ARG B NE   1 
ATOM   1754 C  CZ   . ARG B 1 10 ? -3.488  0.385   -16.754 1.00 24.72 ? 29  ARG B CZ   1 
ATOM   1755 N  NH1  . ARG B 1 10 ? -4.687  0.394   -16.171 1.00 25.39 ? 29  ARG B NH1  1 
ATOM   1756 N  NH2  . ARG B 1 10 ? -2.914  -0.762  -17.088 1.00 27.07 ? 29  ARG B NH2  1 
ATOM   1757 H  H    . ARG B 1 10 ? -2.166  4.988   -12.724 1.00 11.29 ? 29  ARG B H    1 
ATOM   1758 H  HA   . ARG B 1 10 ? -1.106  5.786   -15.100 1.00 11.79 ? 29  ARG B HA   1 
ATOM   1759 H  HB2  . ARG B 1 10 ? -3.719  4.756   -14.672 1.00 16.04 ? 29  ARG B HB2  1 
ATOM   1760 H  HB3  . ARG B 1 10 ? -3.201  5.301   -16.068 1.00 16.04 ? 29  ARG B HB3  1 
ATOM   1761 H  HG2  . ARG B 1 10 ? -1.579  3.514   -15.943 1.00 19.45 ? 29  ARG B HG2  1 
ATOM   1762 H  HG3  . ARG B 1 10 ? -2.540  2.900   -14.836 1.00 19.45 ? 29  ARG B HG3  1 
ATOM   1763 H  HD2  . ARG B 1 10 ? -4.252  2.779   -16.382 1.00 23.07 ? 29  ARG B HD2  1 
ATOM   1764 H  HD3  . ARG B 1 10 ? -3.295  3.403   -17.492 1.00 23.07 ? 29  ARG B HD3  1 
ATOM   1765 H  HE   . ARG B 1 10 ? -2.091  1.469   -17.422 1.00 26.20 ? 29  ARG B HE   1 
ATOM   1766 H  HH11 . ARG B 1 10 ? -5.052  1.141   -15.951 1.00 30.47 ? 29  ARG B HH11 1 
ATOM   1767 H  HH12 . ARG B 1 10 ? -5.092  -0.347  -16.008 1.00 30.47 ? 29  ARG B HH12 1 
ATOM   1768 H  HH21 . ARG B 1 10 ? -2.144  -0.762  -17.471 1.00 32.48 ? 29  ARG B HH21 1 
ATOM   1769 H  HH22 . ARG B 1 10 ? -3.318  -1.505  -16.935 1.00 32.48 ? 29  ARG B HH22 1 
ATOM   1770 N  N    . PRO B 1 11 ? -1.773  8.137   -14.635 1.00 8.82  ? 30  PRO B N    1 
ATOM   1771 C  CA   . PRO B 1 11 ? -2.266  9.482   -14.325 1.00 9.28  ? 30  PRO B CA   1 
ATOM   1772 C  C    . PRO B 1 11 ? -3.506  9.869   -15.117 1.00 8.98  ? 30  PRO B C    1 
ATOM   1773 O  O    . PRO B 1 11 ? -3.684  9.470   -16.278 1.00 10.12 ? 30  PRO B O    1 
ATOM   1774 C  CB   . PRO B 1 11 ? -1.121  10.380  -14.777 1.00 11.56 ? 30  PRO B CB   1 
ATOM   1775 C  CG   . PRO B 1 11 ? -0.479  9.568   -15.963 1.00 14.54 ? 30  PRO B CG   1 
ATOM   1776 C  CD   . PRO B 1 11 ? -0.530  8.153   -15.439 1.00 12.84 ? 30  PRO B CD   1 
ATOM   1777 H  HA   . PRO B 1 11 ? -2.423  9.591   -13.374 1.00 11.14 ? 30  PRO B HA   1 
ATOM   1778 H  HB2  . PRO B 1 11 ? -1.468  11.232  -15.085 1.00 13.87 ? 30  PRO B HB2  1 
ATOM   1779 H  HB3  . PRO B 1 11 ? -0.487  10.501  -14.053 1.00 13.87 ? 30  PRO B HB3  1 
ATOM   1780 H  HG2  . PRO B 1 11 ? -1.015  9.665   -16.765 1.00 17.45 ? 30  PRO B HG2  1 
ATOM   1781 H  HG3  . PRO B 1 11 ? 0.435   9.855   -16.111 1.00 17.45 ? 30  PRO B HG3  1 
ATOM   1782 H  HD2  . PRO B 1 11 ? -0.593  7.522   -16.173 1.00 15.40 ? 30  PRO B HD2  1 
ATOM   1783 H  HD3  . PRO B 1 11 ? 0.239   7.972   -14.877 1.00 15.40 ? 30  PRO B HD3  1 
ATOM   1784 N  N    . LYS B 1 12 ? -4.350  10.672  -14.479 1.00 9.94  ? 31  LYS B N    1 
ATOM   1785 C  CA   . LYS B 1 12 ? -5.460  11.302  -15.164 1.00 10.51 ? 31  LYS B CA   1 
ATOM   1786 C  C    . LYS B 1 12 ? -4.924  12.227  -16.258 1.00 10.30 ? 31  LYS B C    1 
ATOM   1787 O  O    . LYS B 1 12 ? -3.789  12.671  -16.189 1.00 9.64  ? 31  LYS B O    1 
ATOM   1788 C  CB   . LYS B 1 12 ? -6.360  12.053  -14.162 1.00 14.44 ? 31  LYS B CB   1 
ATOM   1789 C  CG   . LYS B 1 12 ? -7.039  11.063  -13.223 1.00 16.76 ? 31  LYS B CG   1 
ATOM   1790 C  CD   . LYS B 1 12 ? -7.650  11.581  -11.915 1.00 20.42 ? 31  LYS B CD   1 
ATOM   1791 C  CE   . LYS B 1 12 ? -8.935  12.297  -12.116 1.00 19.40 ? 31  LYS B CE   1 
ATOM   1792 N  NZ   . LYS B 1 12 ? -9.433  12.925  -10.845 1.00 16.61 ? 31  LYS B NZ   1 
ATOM   1793 H  H    . LYS B 1 12 ? -4.298  10.866  -13.643 1.00 11.93 ? 31  LYS B H    1 
ATOM   1794 H  HA   . LYS B 1 12 ? -5.997  10.616  -15.591 1.00 12.61 ? 31  LYS B HA   1 
ATOM   1795 H  HB2  . LYS B 1 12 ? -5.820  12.660  -13.633 1.00 17.33 ? 31  LYS B HB2  1 
ATOM   1796 H  HB3  . LYS B 1 12 ? -7.046  12.541  -14.645 1.00 17.33 ? 31  LYS B HB3  1 
ATOM   1797 H  HG2  . LYS B 1 12 ? -7.757  10.635  -13.715 1.00 20.11 ? 31  LYS B HG2  1 
ATOM   1798 H  HG3  . LYS B 1 12 ? -6.383  10.392  -12.978 1.00 20.11 ? 31  LYS B HG3  1 
ATOM   1799 H  HD2  . LYS B 1 12 ? -7.815  10.829  -11.325 1.00 24.50 ? 31  LYS B HD2  1 
ATOM   1800 H  HD3  . LYS B 1 12 ? -7.026  12.197  -11.499 1.00 24.50 ? 31  LYS B HD3  1 
ATOM   1801 H  HE2  . LYS B 1 12 ? -8.809  13.000  -12.772 1.00 23.27 ? 31  LYS B HE2  1 
ATOM   1802 H  HE3  . LYS B 1 12 ? -9.605  11.667  -12.425 1.00 23.27 ? 31  LYS B HE3  1 
ATOM   1803 H  HZ1  . LYS B 1 12 ? -9.562  12.299  -10.226 1.00 19.93 ? 31  LYS B HZ1  1 
ATOM   1804 H  HZ2  . LYS B 1 12 ? -8.837  13.513  -10.542 1.00 19.93 ? 31  LYS B HZ2  1 
ATOM   1805 H  HZ3  . LYS B 1 12 ? -10.203 13.346  -10.996 1.00 19.93 ? 31  LYS B HZ3  1 
ATOM   1806 N  N    . PRO B 1 13 ? -5.761  12.522  -17.281 1.00 11.38 ? 32  PRO B N    1 
ATOM   1807 C  CA   . PRO B 1 13 ? -5.290  13.332  -18.410 1.00 12.04 ? 32  PRO B CA   1 
ATOM   1808 C  C    . PRO B 1 13 ? -4.563  14.630  -18.035 1.00 12.62 ? 32  PRO B C    1 
ATOM   1809 O  O    . PRO B 1 13 ? -3.515  14.931  -18.626 1.00 12.77 ? 32  PRO B O    1 
ATOM   1810 C  CB   . PRO B 1 13 ? -6.567  13.579  -19.234 1.00 14.40 ? 32  PRO B CB   1 
ATOM   1811 C  CG   . PRO B 1 13 ? -7.407  12.341  -18.971 1.00 14.49 ? 32  PRO B CG   1 
ATOM   1812 C  CD   . PRO B 1 13 ? -7.132  12.022  -17.508 1.00 12.59 ? 32  PRO B CD   1 
ATOM   1813 H  HA   . PRO B 1 13 ? -4.685  12.798  -18.949 1.00 14.44 ? 32  PRO B HA   1 
ATOM   1814 H  HB2  . PRO B 1 13 ? -7.016  14.378  -18.917 1.00 17.28 ? 32  PRO B HB2  1 
ATOM   1815 H  HB3  . PRO B 1 13 ? -6.344  13.655  -20.175 1.00 17.28 ? 32  PRO B HB3  1 
ATOM   1816 H  HG2  . PRO B 1 13 ? -8.345  12.541  -19.113 1.00 17.39 ? 32  PRO B HG2  1 
ATOM   1817 H  HG3  . PRO B 1 13 ? -7.115  11.615  -19.545 1.00 17.39 ? 32  PRO B HG3  1 
ATOM   1818 H  HD2  . PRO B 1 13 ? -7.760  12.493  -16.938 1.00 15.11 ? 32  PRO B HD2  1 
ATOM   1819 H  HD3  . PRO B 1 13 ? -7.169  11.064  -17.360 1.00 15.11 ? 32  PRO B HD3  1 
ATOM   1820 N  N    . LEU B 1 14 ? -5.059  15.404  -17.068 1.00 12.06 ? 33  LEU B N    1 
ATOM   1821 C  CA   . LEU B 1 14 ? -4.385  16.662  -16.787 1.00 12.88 ? 33  LEU B CA   1 
ATOM   1822 C  C    . LEU B 1 14 ? -3.093  16.464  -15.990 1.00 10.55 ? 33  LEU B C    1 
ATOM   1823 O  O    . LEU B 1 14 ? -2.140  17.217  -16.162 1.00 10.24 ? 33  LEU B O    1 
ATOM   1824 C  CB   . LEU B 1 14 ? -5.320  17.643  -16.097 1.00 14.50 ? 33  LEU B CB   1 
ATOM   1825 C  CG   . LEU B 1 14 ? -6.404  18.224  -17.023 1.00 17.87 ? 33  LEU B CG   1 
ATOM   1826 C  CD1  . LEU B 1 14 ? -7.304  19.151  -16.261 1.00 19.73 ? 33  LEU B CD1  1 
ATOM   1827 C  CD2  . LEU B 1 14 ? -5.796  18.973  -18.199 1.00 20.62 ? 33  LEU B CD2  1 
ATOM   1828 H  H    . LEU B 1 14 ? -5.749  15.232  -16.584 1.00 14.47 ? 33  LEU B H    1 
ATOM   1829 H  HA   . LEU B 1 14 ? -4.134  17.061  -17.635 1.00 15.45 ? 33  LEU B HA   1 
ATOM   1830 H  HB2  . LEU B 1 14 ? -5.768  17.187  -15.367 1.00 17.40 ? 33  LEU B HB2  1 
ATOM   1831 H  HB3  . LEU B 1 14 ? -4.798  18.383  -15.751 1.00 17.40 ? 33  LEU B HB3  1 
ATOM   1832 H  HG   . LEU B 1 14 ? -6.944  17.499  -17.374 1.00 21.44 ? 33  LEU B HG   1 
ATOM   1833 H  HD11 . LEU B 1 14 ? -7.730  18.658  -15.543 1.00 23.67 ? 33  LEU B HD11 1 
ATOM   1834 H  HD12 . LEU B 1 14 ? -6.774  19.877  -15.896 1.00 23.67 ? 33  LEU B HD12 1 
ATOM   1835 H  HD13 . LEU B 1 14 ? -7.977  19.504  -16.865 1.00 23.67 ? 33  LEU B HD13 1 
ATOM   1836 H  HD21 . LEU B 1 14 ? -5.245  18.361  -18.712 1.00 24.74 ? 33  LEU B HD21 1 
ATOM   1837 H  HD22 . LEU B 1 14 ? -6.510  19.322  -18.755 1.00 24.74 ? 33  LEU B HD22 1 
ATOM   1838 H  HD23 . LEU B 1 14 ? -5.253  19.703  -17.861 1.00 24.74 ? 33  LEU B HD23 1 
ATOM   1839 N  N    . LEU B 1 15 ? -3.031  15.426  -15.157 1.00 10.10 ? 34  LEU B N    1 
ATOM   1840 C  CA   . LEU B 1 15 ? -1.746  15.072  -14.563 1.00 9.01  ? 34  LEU B CA   1 
ATOM   1841 C  C    . LEU B 1 15 ? -0.743  14.621  -15.625 1.00 9.59  ? 34  LEU B C    1 
ATOM   1842 O  O    . LEU B 1 15 ? 0.436   14.981  -15.570 1.00 10.05 ? 34  LEU B O    1 
ATOM   1843 C  CB   . LEU B 1 15 ? -1.880  14.029  -13.458 1.00 9.57  ? 34  LEU B CB   1 
ATOM   1844 C  CG   . LEU B 1 15 ? -0.565  13.589  -12.805 1.00 10.60 ? 34  LEU B CG   1 
ATOM   1845 C  CD1  . LEU B 1 15 ? 0.237   14.720  -12.232 1.00 10.93 ? 34  LEU B CD1  1 
ATOM   1846 C  CD2  . LEU B 1 15 ? -0.883  12.568  -11.687 1.00 10.96 ? 34  LEU B CD2  1 
ATOM   1847 H  H    . LEU B 1 15 ? -3.693  14.928  -14.927 1.00 12.12 ? 34  LEU B H    1 
ATOM   1848 H  HA   . LEU B 1 15 ? -1.380  15.871  -14.152 1.00 10.81 ? 34  LEU B HA   1 
ATOM   1849 H  HB2  . LEU B 1 15 ? -2.445  14.394  -12.758 1.00 11.49 ? 34  LEU B HB2  1 
ATOM   1850 H  HB3  . LEU B 1 15 ? -2.299  13.238  -13.831 1.00 11.49 ? 34  LEU B HB3  1 
ATOM   1851 H  HG   . LEU B 1 15 ? -0.018  13.143  -13.470 1.00 12.72 ? 34  LEU B HG   1 
ATOM   1852 H  HD11 . LEU B 1 15 ? -0.291  15.168  -11.552 1.00 13.12 ? 34  LEU B HD11 1 
ATOM   1853 H  HD12 . LEU B 1 15 ? 1.049   14.364  -11.840 1.00 13.12 ? 34  LEU B HD12 1 
ATOM   1854 H  HD13 . LEU B 1 15 ? 0.457   15.342  -12.943 1.00 13.12 ? 34  LEU B HD13 1 
ATOM   1855 H  HD21 . LEU B 1 15 ? -1.457  12.990  -11.029 1.00 13.15 ? 34  LEU B HD21 1 
ATOM   1856 H  HD22 . LEU B 1 15 ? -1.333  11.803  -12.078 1.00 13.15 ? 34  LEU B HD22 1 
ATOM   1857 H  HD23 . LEU B 1 15 ? -0.053  12.287  -11.272 1.00 13.15 ? 34  LEU B HD23 1 
ATOM   1858 N  N    . LEU B 1 16 ? -1.211  13.844  -16.589 1.00 10.27 ? 35  LEU B N    1 
ATOM   1859 C  CA   . LEU B 1 16 ? -0.352  13.466  -17.690 1.00 11.00 ? 35  LEU B CA   1 
ATOM   1860 C  C    . LEU B 1 16 ? 0.174   14.680  -18.443 1.00 11.12 ? 35  LEU B C    1 
ATOM   1861 O  O    . LEU B 1 16 ? 1.347   14.741  -18.798 1.00 10.84 ? 35  LEU B O    1 
ATOM   1862 C  CB   . LEU B 1 16 ? -1.067  12.524  -18.644 1.00 12.14 ? 35  LEU B CB   1 
ATOM   1863 C  CG   . LEU B 1 16 ? -0.229  12.047  -19.818 1.00 14.32 ? 35  LEU B CG   1 
ATOM   1864 C  CD1  . LEU B 1 16 ? 0.985   11.221  -19.382 1.00 16.38 ? 35  LEU B CD1  1 
ATOM   1865 C  CD2  . LEU B 1 16 ? -1.133  11.213  -20.728 1.00 16.57 ? 35  LEU B CD2  1 
ATOM   1866 H  H    . LEU B 1 16 ? -2.010  13.528  -16.627 1.00 12.32 ? 35  LEU B H    1 
ATOM   1867 H  HA   . LEU B 1 16 ? 0.415   12.991  -17.332 1.00 13.20 ? 35  LEU B HA   1 
ATOM   1868 H  HB2  . LEU B 1 16 ? -1.351  11.740  -18.149 1.00 14.57 ? 35  LEU B HB2  1 
ATOM   1869 H  HB3  . LEU B 1 16 ? -1.843  12.980  -19.005 1.00 14.57 ? 35  LEU B HB3  1 
ATOM   1870 H  HG   . LEU B 1 16 ? 0.087   12.814  -20.320 1.00 17.19 ? 35  LEU B HG   1 
ATOM   1871 H  HD11 . LEU B 1 16 ? 1.479   10.947  -20.171 1.00 19.65 ? 35  LEU B HD11 1 
ATOM   1872 H  HD12 . LEU B 1 16 ? 1.549   11.767  -18.811 1.00 19.65 ? 35  LEU B HD12 1 
ATOM   1873 H  HD13 . LEU B 1 16 ? 0.677   10.441  -18.895 1.00 19.65 ? 35  LEU B HD13 1 
ATOM   1874 H  HD21 . LEU B 1 16 ? -0.615  10.899  -21.485 1.00 19.88 ? 35  LEU B HD21 1 
ATOM   1875 H  HD22 . LEU B 1 16 ? -1.477  10.458  -20.226 1.00 19.88 ? 35  LEU B HD22 1 
ATOM   1876 H  HD23 . LEU B 1 16 ? -1.867  11.767  -21.037 1.00 19.88 ? 35  LEU B HD23 1 
ATOM   1877 N  N    . LYS B 1 17 ? -0.688  15.674  -18.651 1.00 10.99 ? 36  LYS B N    1 
ATOM   1878 C  CA   . LYS B 1 17 ? -0.232  16.907  -19.312 1.00 10.88 ? 36  LYS B CA   1 
ATOM   1879 C  C    . LYS B 1 17 ? 0.912   17.557  -18.546 1.00 10.77 ? 36  LYS B C    1 
ATOM   1880 O  O    . LYS B 1 17 ? 1.916   17.997  -19.136 1.00 11.83 ? 36  LYS B O    1 
ATOM   1881 C  CB   . LYS B 1 17 ? -1.409  17.881  -19.451 1.00 13.27 ? 36  LYS B CB   1 
ATOM   1882 C  CG   . LYS B 1 17 ? -1.050  19.194  -20.090 1.00 16.03 ? 36  LYS B CG   1 
ATOM   1883 C  CD   . LYS B 1 17 ? -2.264  20.079  -20.246 1.00 18.71 ? 36  LYS B CD   1 
ATOM   1884 C  CE   . LYS B 1 17 ? -1.935  21.354  -20.973 1.00 22.99 ? 36  LYS B CE   1 
ATOM   1885 N  NZ   . LYS B 1 17 ? -3.167  22.031  -21.367 1.00 26.27 ? 36  LYS B NZ   1 
ATOM   1886 H  H    . LYS B 1 17 ? -1.518  15.667  -18.428 1.00 13.19 ? 36  LYS B H    1 
ATOM   1887 H  HA   . LYS B 1 17 ? 0.087   16.691  -20.203 1.00 13.06 ? 36  LYS B HA   1 
ATOM   1888 H  HB2  . LYS B 1 17 ? -2.095  17.465  -19.996 1.00 15.92 ? 36  LYS B HB2  1 
ATOM   1889 H  HB3  . LYS B 1 17 ? -1.763  18.070  -18.567 1.00 15.92 ? 36  LYS B HB3  1 
ATOM   1890 H  HG2  . LYS B 1 17 ? -0.406  19.657  -19.532 1.00 19.24 ? 36  LYS B HG2  1 
ATOM   1891 H  HG3  . LYS B 1 17 ? -0.677  19.031  -20.970 1.00 19.24 ? 36  LYS B HG3  1 
ATOM   1892 H  HD2  . LYS B 1 17 ? -2.940  19.606  -20.756 1.00 22.45 ? 36  LYS B HD2  1 
ATOM   1893 H  HD3  . LYS B 1 17 ? -2.606  20.309  -19.368 1.00 22.45 ? 36  LYS B HD3  1 
ATOM   1894 H  HE2  . LYS B 1 17 ? -1.433  21.942  -20.387 1.00 27.59 ? 36  LYS B HE2  1 
ATOM   1895 H  HE3  . LYS B 1 17 ? -1.424  21.151  -21.772 1.00 27.59 ? 36  LYS B HE3  1 
ATOM   1896 H  HZ1  . LYS B 1 17 ? -3.652  22.224  -20.647 1.00 31.52 ? 36  LYS B HZ1  1 
ATOM   1897 H  HZ2  . LYS B 1 17 ? -2.975  22.786  -21.798 1.00 31.52 ? 36  LYS B HZ2  1 
ATOM   1898 H  HZ3  . LYS B 1 17 ? -3.643  21.505  -21.905 1.00 31.52 ? 36  LYS B HZ3  1 
ATOM   1899 N  N    . LEU B 1 18 ? 0.766   17.640  -17.223 1.00 9.60  ? 37  LEU B N    1 
ATOM   1900 C  CA   . LEU B 1 18 ? 1.823   18.197  -16.385 1.00 9.87  ? 37  LEU B CA   1 
ATOM   1901 C  C    . LEU B 1 18 ? 3.112   17.358  -16.507 1.00 10.43 ? 37  LEU B C    1 
ATOM   1902 O  O    . LEU B 1 18 ? 4.219   17.889  -16.722 1.00 11.01 ? 37  LEU B O    1 
ATOM   1903 C  CB   . LEU B 1 18 ? 1.362   18.277  -14.933 1.00 11.36 ? 37  LEU B CB   1 
ATOM   1904 C  CG   . LEU B 1 18 ? 2.304   18.939  -13.902 1.00 12.75 ? 37  LEU B CG   1 
ATOM   1905 C  CD1  . LEU B 1 18 ? 1.511   19.466  -12.699 1.00 15.24 ? 37  LEU B CD1  1 
ATOM   1906 C  CD2  . LEU B 1 18 ? 3.380   17.948  -13.470 1.00 14.32 ? 37  LEU B CD2  1 
ATOM   1907 H  H    . LEU B 1 18 ? 0.070   17.381  -16.790 1.00 11.52 ? 37  LEU B H    1 
ATOM   1908 H  HA   . LEU B 1 18 ? 2.022   19.097  -16.686 1.00 11.84 ? 37  LEU B HA   1 
ATOM   1909 H  HB2  . LEU B 1 18 ? 0.529   18.774  -14.913 1.00 13.63 ? 37  LEU B HB2  1 
ATOM   1910 H  HB3  . LEU B 1 18 ? 1.197   17.372  -14.623 1.00 13.63 ? 37  LEU B HB3  1 
ATOM   1911 H  HG   . LEU B 1 18 ? 2.746   19.694  -14.321 1.00 15.30 ? 37  LEU B HG   1 
ATOM   1912 H  HD11 . LEU B 1 18 ? 2.126   19.875  -12.071 1.00 18.29 ? 37  LEU B HD11 1 
ATOM   1913 H  HD12 . LEU B 1 18 ? 0.868   20.123  -13.009 1.00 18.29 ? 37  LEU B HD12 1 
ATOM   1914 H  HD13 . LEU B 1 18 ? 1.049   18.725  -12.277 1.00 18.29 ? 37  LEU B HD13 1 
ATOM   1915 H  HD21 . LEU B 1 18 ? 2.953   17.175  -13.069 1.00 17.19 ? 37  LEU B HD21 1 
ATOM   1916 H  HD22 . LEU B 1 18 ? 3.891   17.678  -14.249 1.00 17.19 ? 37  LEU B HD22 1 
ATOM   1917 H  HD23 . LEU B 1 18 ? 3.962   18.378  -12.824 1.00 17.19 ? 37  LEU B HD23 1 
ATOM   1918 N  N    . LEU B 1 19 ? 2.979   16.046  -16.361 1.00 10.54 ? 38  LEU B N    1 
ATOM   1919 C  CA   . LEU B 1 19 ? 4.137   15.187  -16.410 1.00 10.49 ? 38  LEU B CA   1 
ATOM   1920 C  C    . LEU B 1 19 ? 4.872   15.288  -17.752 1.00 11.33 ? 38  LEU B C    1 
ATOM   1921 O  O    . LEU B 1 19 ? 6.105   15.300  -17.806 1.00 11.98 ? 38  LEU B O    1 
ATOM   1922 C  CB   . LEU B 1 19 ? 3.720   13.747  -16.150 1.00 10.09 ? 38  LEU B CB   1 
ATOM   1923 C  CG   . LEU B 1 19 ? 3.227   13.479  -14.726 1.00 10.14 ? 38  LEU B CG   1 
ATOM   1924 C  CD1  . LEU B 1 19 ? 2.641   12.078  -14.658 1.00 11.57 ? 38  LEU B CD1  1 
ATOM   1925 C  CD2  . LEU B 1 19 ? 4.346   13.651  -13.702 1.00 11.36 ? 38  LEU B CD2  1 
ATOM   1926 H  H    . LEU B 1 19 ? 2.233   15.637  -16.233 1.00 12.65 ? 38  LEU B H    1 
ATOM   1927 H  HA   . LEU B 1 19 ? 4.754   15.451  -15.711 1.00 12.58 ? 38  LEU B HA   1 
ATOM   1928 H  HB2  . LEU B 1 19 ? 3.000   13.517  -16.759 1.00 12.11 ? 38  LEU B HB2  1 
ATOM   1929 H  HB3  . LEU B 1 19 ? 4.482   13.169  -16.311 1.00 12.11 ? 38  LEU B HB3  1 
ATOM   1930 H  HG   . LEU B 1 19 ? 2.522   14.111  -14.511 1.00 12.16 ? 38  LEU B HG   1 
ATOM   1931 H  HD11 . LEU B 1 19 ? 2.329   11.910  -13.755 1.00 13.89 ? 38  LEU B HD11 1 
ATOM   1932 H  HD12 . LEU B 1 19 ? 1.901   12.015  -15.282 1.00 13.89 ? 38  LEU B HD12 1 
ATOM   1933 H  HD13 . LEU B 1 19 ? 3.329   11.437  -14.896 1.00 13.89 ? 38  LEU B HD13 1 
ATOM   1934 H  HD21 . LEU B 1 19 ? 3.993   13.473  -12.816 1.00 13.63 ? 38  LEU B HD21 1 
ATOM   1935 H  HD22 . LEU B 1 19 ? 5.059   13.026  -13.906 1.00 13.63 ? 38  LEU B HD22 1 
ATOM   1936 H  HD23 . LEU B 1 19 ? 4.679   14.561  -13.749 1.00 13.63 ? 38  LEU B HD23 1 
ATOM   1937 N  N    . LYS B 1 20 ? 4.121   15.386  -18.843 1.00 11.15 ? 39  LYS B N    1 
ATOM   1938 C  CA   . LYS B 1 20 ? 4.726   15.475  -20.160 1.00 11.75 ? 39  LYS B CA   1 
ATOM   1939 C  C    . LYS B 1 20 ? 5.513   16.767  -20.354 1.00 11.17 ? 39  LYS B C    1 
ATOM   1940 O  O    . LYS B 1 20 ? 6.430   16.801  -21.171 1.00 11.73 ? 39  LYS B O    1 
ATOM   1941 C  CB   . LYS B 1 20 ? 3.681   15.346  -21.262 1.00 14.04 ? 39  LYS B CB   1 
ATOM   1942 C  CG   . LYS B 1 20 ? 3.192   13.942  -21.430 1.00 16.76 ? 39  LYS B CG   1 
ATOM   1943 C  CD   . LYS B 1 20 ? 2.060   13.855  -22.417 1.00 19.74 ? 39  LYS B CD   1 
ATOM   1944 C  CE   . LYS B 1 20 ? 2.409   14.491  -23.778 1.00 21.73 ? 39  LYS B CE   1 
ATOM   1945 N  NZ   . LYS B 1 20 ? 1.381   14.147  -24.808 1.00 24.94 ? 39  LYS B NZ   1 
ATOM   1946 H  H    . LYS B 1 20 ? 3.261   15.402  -18.845 1.00 13.38 ? 39  LYS B H    1 
ATOM   1947 H  HA   . LYS B 1 20 ? 5.348   14.738  -20.261 1.00 14.10 ? 39  LYS B HA   1 
ATOM   1948 H  HB2  . LYS B 1 20 ? 2.919   15.905  -21.043 1.00 16.85 ? 39  LYS B HB2  1 
ATOM   1949 H  HB3  . LYS B 1 20 ? 4.071   15.631  -22.103 1.00 16.85 ? 39  LYS B HB3  1 
ATOM   1950 H  HG2  . LYS B 1 20 ? 3.919   13.387  -21.753 1.00 20.11 ? 39  LYS B HG2  1 
ATOM   1951 H  HG3  . LYS B 1 20 ? 2.873   13.611  -20.575 1.00 20.11 ? 39  LYS B HG3  1 
ATOM   1952 H  HD2  . LYS B 1 20 ? 1.844   12.922  -22.569 1.00 23.69 ? 39  LYS B HD2  1 
ATOM   1953 H  HD3  . LYS B 1 20 ? 1.290   14.321  -22.056 1.00 23.69 ? 39  LYS B HD3  1 
ATOM   1954 H  HE2  . LYS B 1 20 ? 2.437   15.456  -23.684 1.00 26.07 ? 39  LYS B HE2  1 
ATOM   1955 H  HE3  . LYS B 1 20 ? 3.268   14.156  -24.079 1.00 26.07 ? 39  LYS B HE3  1 
ATOM   1956 H  HZ1  . LYS B 1 20 ? 0.583   14.446  -24.553 1.00 29.93 ? 39  LYS B HZ1  1 
ATOM   1957 H  HZ2  . LYS B 1 20 ? 1.594   14.520  -25.587 1.00 29.93 ? 39  LYS B HZ2  1 
ATOM   1958 H  HZ3  . LYS B 1 20 ? 1.339   13.264  -24.912 1.00 29.93 ? 39  LYS B HZ3  1 
ATOM   1959 N  N    . SER B 1 21 ? 5.160   17.807  -19.603 1.00 10.36 ? 40  SER B N    1 
ATOM   1960 C  CA   . SER B 1 21 ? 5.838   19.078  -19.779 1.00 11.16 ? 40  SER B CA   1 
ATOM   1961 C  C    . SER B 1 21 ? 7.258   19.056  -19.192 1.00 10.93 ? 40  SER B C    1 
ATOM   1962 O  O    . SER B 1 21 ? 8.137   19.813  -19.645 1.00 11.70 ? 40  SER B O    1 
ATOM   1963 C  CB   . SER B 1 21 ? 5.040   20.219  -19.160 1.00 12.35 ? 40  SER B CB   1 
ATOM   1964 O  OG   . SER B 1 21 ? 5.148   20.265  -17.750 1.00 12.87 ? 40  SER B OG   1 
ATOM   1965 H  H    . SER B 1 21 ? 4.546   17.802  -19.001 1.00 12.43 ? 40  SER B H    1 
ATOM   1966 H  HA   . SER B 1 21 ? 5.916   19.256  -20.729 1.00 13.39 ? 40  SER B HA   1 
ATOM   1967 H  HB2  . SER B 1 21 ? 5.367   21.057  -19.523 1.00 14.82 ? 40  SER B HB2  1 
ATOM   1968 H  HB3  . SER B 1 21 ? 4.105   20.105  -19.394 1.00 14.82 ? 40  SER B HB3  1 
ATOM   1969 H  HG   . SER B 1 21 ? 4.863   19.549  -17.416 1.00 15.45 ? 40  SER B HG   1 
ATOM   1970 N  N    A VAL B 1 22 ? 7.460   18.161  -18.235 0.59 10.60 ? 41  VAL B N    1 
ATOM   1971 N  N    B VAL B 1 22 ? 7.524   18.188  -18.219 0.41 10.07 ? 41  VAL B N    1 
ATOM   1972 C  CA   A VAL B 1 22 ? 8.688   18.110  -17.467 0.59 10.23 ? 41  VAL B CA   1 
ATOM   1973 C  CA   B VAL B 1 22 ? 8.870   18.108  -17.639 0.41 9.05  ? 41  VAL B CA   1 
ATOM   1974 C  C    A VAL B 1 22 ? 9.486   16.826  -17.783 0.59 10.02 ? 41  VAL B C    1 
ATOM   1975 C  C    B VAL B 1 22 ? 9.520   16.746  -17.715 0.41 9.25  ? 41  VAL B C    1 
ATOM   1976 O  O    A VAL B 1 22 ? 10.715  16.857  -17.719 0.59 10.01 ? 41  VAL B O    1 
ATOM   1977 O  O    B VAL B 1 22 ? 10.664  16.594  -17.309 0.41 9.31  ? 41  VAL B O    1 
ATOM   1978 C  CB   A VAL B 1 22 ? 8.381   18.268  -15.941 0.59 11.82 ? 41  VAL B CB   1 
ATOM   1979 C  CB   B VAL B 1 22 ? 8.894   18.470  -16.156 0.41 8.99  ? 41  VAL B CB   1 
ATOM   1980 C  CG1  A VAL B 1 22 ? 7.624   17.046  -15.385 0.59 10.74 ? 41  VAL B CG1  1 
ATOM   1981 C  CG1  B VAL B 1 22 ? 8.558   19.898  -15.991 0.41 8.57  ? 41  VAL B CG1  1 
ATOM   1982 C  CG2  A VAL B 1 22 ? 9.639   18.552  -15.153 0.59 13.72 ? 41  VAL B CG2  1 
ATOM   1983 C  CG2  B VAL B 1 22 ? 7.945   17.577  -15.333 0.41 8.52  ? 41  VAL B CG2  1 
ATOM   1984 H  H    A VAL B 1 22 ? 6.887   17.562  -18.008 0.59 12.72 ? 41  VAL B H    1 
ATOM   1985 H  H    B VAL B 1 22 ? 6.955   17.640  -17.879 0.41 12.08 ? 41  VAL B H    1 
ATOM   1986 H  HA   A VAL B 1 22 ? 9.241   18.863  -17.728 0.59 12.28 ? 41  VAL B HA   1 
ATOM   1987 H  HA   B VAL B 1 22 ? 9.445   18.734  -18.105 0.41 10.86 ? 41  VAL B HA   1 
ATOM   1988 H  HB   A VAL B 1 22 ? 7.799   19.036  -15.830 0.59 14.19 ? 41  VAL B HB   1 
ATOM   1989 H  HB   B VAL B 1 22 ? 9.793   18.337  -15.817 0.41 10.79 ? 41  VAL B HB   1 
ATOM   1990 H  HG11 A VAL B 1 22 ? 7.454   17.183  -14.440 0.59 12.89 ? 41  VAL B HG11 1 
ATOM   1991 H  HG11 B VAL B 1 22 ? 8.397   20.287  -16.865 0.41 10.28 ? 41  VAL B HG11 1 
ATOM   1992 H  HG12 A VAL B 1 22 ? 6.785   16.951  -15.863 0.59 12.89 ? 41  VAL B HG12 1 
ATOM   1993 H  HG12 B VAL B 1 22 ? 7.762   19.973  -15.443 0.41 10.28 ? 41  VAL B HG12 1 
ATOM   1994 H  HG13 A VAL B 1 22 ? 8.169   16.253  -15.512 0.59 12.89 ? 41  VAL B HG13 1 
ATOM   1995 H  HG13 B VAL B 1 22 ? 9.301   20.350  -15.560 0.41 10.28 ? 41  VAL B HG13 1 
ATOM   1996 H  HG21 A VAL B 1 22 ? 9.409   18.643  -14.215 0.59 16.47 ? 41  VAL B HG21 1 
ATOM   1997 H  HG21 B VAL B 1 22 ? 7.992   17.841  -14.401 0.41 10.22 ? 41  VAL B HG21 1 
ATOM   1998 H  HG22 A VAL B 1 22 ? 10.258  17.815  -15.273 0.59 16.47 ? 41  VAL B HG22 1 
ATOM   1999 H  HG22 B VAL B 1 22 ? 7.040   17.690  -15.664 0.41 10.22 ? 41  VAL B HG22 1 
ATOM   2000 H  HG23 A VAL B 1 22 ? 10.036  19.375  -15.479 0.59 16.47 ? 41  VAL B HG23 1 
ATOM   2001 H  HG23 B VAL B 1 22 ? 8.220   16.652  -15.429 0.41 10.22 ? 41  VAL B HG23 1 
ATOM   2002 N  N    . GLY B 1 23 ? 8.789   15.748  -18.187 1.00 9.33  ? 42  GLY B N    1 
ATOM   2003 C  CA   . GLY B 1 23 ? 9.362   14.427  -18.251 1.00 10.55 ? 42  GLY B CA   1 
ATOM   2004 C  C    . GLY B 1 23 ? 8.906   13.667  -19.476 1.00 10.16 ? 42  GLY B C    1 
ATOM   2005 O  O    . GLY B 1 23 ? 8.399   14.231  -20.457 1.00 10.47 ? 42  GLY B O    1 
ATOM   2006 H  H    . GLY B 1 23 ? 7.971   15.795  -18.450 0.55 11.19 ? 42  GLY B H    1 
ATOM   2007 H  HA2  . GLY B 1 23 ? 10.330  14.494  -18.272 1.00 12.66 ? 42  GLY B HA2  1 
ATOM   2008 H  HA3  . GLY B 1 23 ? 9.106   13.924  -17.462 1.00 12.66 ? 42  GLY B HA3  1 
ATOM   2009 N  N    . ALA B 1 24 ? 9.086   12.353  -19.429 1.00 10.48 ? 43  ALA B N    1 
ATOM   2010 C  CA   . ALA B 1 24 ? 8.735   11.473  -20.525 1.00 10.85 ? 43  ALA B CA   1 
ATOM   2011 C  C    . ALA B 1 24 ? 7.257   11.111  -20.467 1.00 11.24 ? 43  ALA B C    1 
ATOM   2012 O  O    . ALA B 1 24 ? 6.663   11.030  -19.392 1.00 13.47 ? 43  ALA B O    1 
ATOM   2013 C  CB   . ALA B 1 24 ? 9.568   10.192  -20.481 1.00 12.95 ? 43  ALA B CB   1 
ATOM   2014 H  H    . ALA B 1 24 ? 9.420   11.940  -18.753 1.00 12.58 ? 43  ALA B H    1 
ATOM   2015 H  HA   . ALA B 1 24 ? 8.908   11.923  -21.367 1.00 13.02 ? 43  ALA B HA   1 
ATOM   2016 H  HB1  . ALA B 1 24 ? 10.508  10.424  -20.549 1.00 15.54 ? 43  ALA B HB1  1 
ATOM   2017 H  HB2  . ALA B 1 24 ? 9.400   9.735   -19.642 1.00 15.54 ? 43  ALA B HB2  1 
ATOM   2018 H  HB3  . ALA B 1 24 ? 9.313   9.624   -21.225 1.00 15.54 ? 43  ALA B HB3  1 
ATOM   2019 N  N    . GLN B 1 25 ? 6.690   10.873  -21.645 1.00 11.10 ? 44  GLN B N    1 
ATOM   2020 C  CA   . GLN B 1 25 ? 5.340   10.392  -21.793 1.00 14.55 ? 44  GLN B CA   1 
ATOM   2021 C  C    . GLN B 1 25 ? 5.335   8.884   -21.701 1.00 16.31 ? 44  GLN B C    1 
ATOM   2022 O  O    . GLN B 1 25 ? 6.051   8.244   -22.424 1.00 17.75 ? 44  GLN B O    1 
ATOM   2023 C  CB   . GLN B 1 25 ? 4.746   10.819  -23.139 1.00 17.24 ? 44  GLN B CB   1 
ATOM   2024 C  CG   . GLN B 1 25 ? 3.352   10.182  -23.303 1.00 21.71 ? 44  GLN B CG   1 
ATOM   2025 C  CD   . GLN B 1 25 ? 2.485   10.818  -24.367 1.00 26.99 ? 44  GLN B CD   1 
ATOM   2026 O  OE1  . GLN B 1 25 ? 2.977   11.424  -25.296 1.00 26.92 ? 44  GLN B OE1  1 
ATOM   2027 N  NE2  . GLN B 1 25 ? 1.155   10.653  -24.233 1.00 30.13 ? 44  GLN B NE2  1 
ATOM   2028 H  H    . GLN B 1 25 ? 7.091   10.990  -22.397 1.00 13.32 ? 44  GLN B H    1 
ATOM   2029 H  HA   . GLN B 1 25 ? 4.786   10.749  -21.081 1.00 17.46 ? 44  GLN B HA   1 
ATOM   2030 H  HB2  . GLN B 1 25 ? 4.652   11.784  -23.164 1.00 20.69 ? 44  GLN B HB2  1 
ATOM   2031 H  HB3  . GLN B 1 25 ? 5.316   10.511  -23.861 1.00 20.69 ? 44  GLN B HB3  1 
ATOM   2032 H  HG2  . GLN B 1 25 ? 3.464   9.247   -23.537 1.00 26.05 ? 44  GLN B HG2  1 
ATOM   2033 H  HG3  . GLN B 1 25 ? 2.878   10.252  -22.460 1.00 26.05 ? 44  GLN B HG3  1 
ATOM   2034 H  HE21 . GLN B 1 25 ? 0.842   10.205  -23.569 1.00 36.15 ? 44  GLN B HE21 1 
ATOM   2035 H  HE22 . GLN B 1 25 ? 0.619   10.995  -24.812 1.00 36.15 ? 44  GLN B HE22 1 
ATOM   2036 N  N    . LYS B 1 26 ? 4.544   8.339   -20.777 1.00 16.69 ? 45  LYS B N    1 
ATOM   2037 C  CA   . LYS B 1 26 ? 4.429   6.907   -20.560 1.00 18.04 ? 45  LYS B CA   1 
ATOM   2038 C  C    . LYS B 1 26 ? 2.997   6.561   -20.265 1.00 19.90 ? 45  LYS B C    1 
ATOM   2039 O  O    . LYS B 1 26 ? 2.221   7.412   -19.844 1.00 19.70 ? 45  LYS B O    1 
ATOM   2040 C  CB   . LYS B 1 26 ? 5.284   6.538   -19.339 1.00 19.05 ? 45  LYS B CB   1 
ATOM   2041 C  CG   . LYS B 1 26 ? 6.725   6.842   -19.576 1.00 22.74 ? 45  LYS B CG   1 
ATOM   2042 C  CD   . LYS B 1 26 ? 7.607   5.896   -18.866 1.00 25.88 ? 45  LYS B CD   1 
ATOM   2043 C  CE   . LYS B 1 26 ? 7.770   6.353   -17.505 1.00 25.16 ? 45  LYS B CE   1 
ATOM   2044 N  NZ   . LYS B 1 26 ? 8.761   5.516   -16.816 1.00 25.90 ? 45  LYS B NZ   1 
ATOM   2045 H  H    . LYS B 1 26 ? 4.048   8.801   -20.248 1.00 20.03 ? 45  LYS B H    1 
ATOM   2046 H  HA   . LYS B 1 26 ? 4.734   6.414   -21.337 1.00 21.65 ? 45  LYS B HA   1 
ATOM   2047 H  HB2  . LYS B 1 26 ? 4.986   7.051   -18.572 1.00 22.86 ? 45  LYS B HB2  1 
ATOM   2048 H  HB3  . LYS B 1 26 ? 5.198   5.588   -19.163 1.00 22.86 ? 45  LYS B HB3  1 
ATOM   2049 H  HG2  . LYS B 1 26 ? 6.913   6.778   -20.526 1.00 27.29 ? 45  LYS B HG2  1 
ATOM   2050 H  HG3  . LYS B 1 26 ? 6.919   7.737   -19.256 1.00 27.29 ? 45  LYS B HG3  1 
ATOM   2051 H  HD2  . LYS B 1 26 ? 7.202   5.015   -18.854 1.00 31.06 ? 45  LYS B HD2  1 
ATOM   2052 H  HD3  . LYS B 1 26 ? 8.476   5.872   -19.295 1.00 31.06 ? 45  LYS B HD3  1 
ATOM   2053 H  HE2  . LYS B 1 26 ? 8.086   7.270   -17.505 1.00 30.19 ? 45  LYS B HE2  1 
ATOM   2054 H  HE3  . LYS B 1 26 ? 6.925   6.283   -17.034 1.00 30.19 ? 45  LYS B HE3  1 
ATOM   2055 H  HZ1  . LYS B 1 26 ? 9.544   5.565   -17.235 1.00 31.08 ? 45  LYS B HZ1  1 
ATOM   2056 H  HZ2  . LYS B 1 26 ? 8.864   5.795   -15.977 1.00 31.08 ? 45  LYS B HZ2  1 
ATOM   2057 H  HZ3  . LYS B 1 26 ? 8.489   4.668   -16.808 1.00 31.08 ? 45  LYS B HZ3  1 
ATOM   2058 N  N    . ASP B 1 27 ? 2.655   5.290   -20.454 1.00 22.15 ? 46  ASP B N    1 
ATOM   2059 C  CA   . ASP B 1 27 ? 1.332   4.815   -20.108 1.00 24.66 ? 46  ASP B CA   1 
ATOM   2060 C  C    . ASP B 1 27 ? 1.259   4.642   -18.591 1.00 23.35 ? 46  ASP B C    1 
ATOM   2061 O  O    . ASP B 1 27 ? 0.272   5.024   -17.939 1.00 24.86 ? 46  ASP B O    1 
ATOM   2062 C  CB   . ASP B 1 27 ? 1.061   3.481   -20.816 1.00 29.10 ? 46  ASP B CB   1 
ATOM   2063 C  CG   . ASP B 1 27 ? 1.372   3.534   -22.328 1.00 34.35 ? 46  ASP B CG   1 
ATOM   2064 O  OD1  . ASP B 1 27 ? 1.976   4.520   -22.820 1.00 36.43 ? 46  ASP B OD1  1 
ATOM   2065 O  OD2  . ASP B 1 27 ? 1.041   2.563   -23.036 1.00 37.40 ? 46  ASP B OD2  1 
ATOM   2066 H  H    . ASP B 1 27 ? 3.173   4.688   -20.782 1.00 26.57 ? 46  ASP B H    1 
ATOM   2067 H  HA   . ASP B 1 27 ? 0.664   5.461   -20.386 1.00 29.59 ? 46  ASP B HA   1 
ATOM   2068 H  HB2  . ASP B 1 27 ? 1.618   2.794   -20.419 1.00 34.92 ? 46  ASP B HB2  1 
ATOM   2069 H  HB3  . ASP B 1 27 ? 0.124   3.252   -20.710 1.00 34.92 ? 46  ASP B HB3  1 
ATOM   2070 N  N    . THR B 1 28 ? 2.319   4.071   -18.025 1.00 20.56 ? 47  THR B N    1 
ATOM   2071 C  CA   . THR B 1 28 ? 2.360   3.804   -16.605 1.00 19.65 ? 47  THR B CA   1 
ATOM   2072 C  C    . THR B 1 28 ? 3.619   4.428   -16.035 1.00 17.52 ? 47  THR B C    1 
ATOM   2073 O  O    . THR B 1 28 ? 4.692   4.367   -16.647 1.00 18.34 ? 47  THR B O    1 
ATOM   2074 C  CB   . THR B 1 28 ? 2.382   2.294   -16.348 1.00 23.19 ? 47  THR B CB   1 
ATOM   2075 O  OG1  . THR B 1 28 ? 1.227   1.698   -16.956 1.00 27.23 ? 47  THR B OG1  1 
ATOM   2076 C  CG2  . THR B 1 28 ? 2.347   2.027   -14.891 1.00 24.00 ? 47  THR B CG2  1 
ATOM   2077 H  H    . THR B 1 28 ? 3.027   3.831   -18.450 1.00 24.67 ? 47  THR B H    1 
ATOM   2078 H  HA   . THR B 1 28 ? 1.586   4.191   -16.169 1.00 23.58 ? 47  THR B HA   1 
ATOM   2079 H  HB   . THR B 1 28 ? 3.189   1.906   -16.720 1.00 27.82 ? 47  THR B HB   1 
ATOM   2080 H  HG1  . THR B 1 28 ? 1.233   1.840   -17.784 1.00 32.68 ? 47  THR B HG1  1 
ATOM   2081 H  HG21 . THR B 1 28 ? 3.117   2.431   -14.462 1.00 28.81 ? 47  THR B HG21 1 
ATOM   2082 H  HG22 . THR B 1 28 ? 1.539   2.401   -14.505 1.00 28.81 ? 47  THR B HG22 1 
ATOM   2083 H  HG23 . THR B 1 28 ? 2.360   1.071   -14.728 1.00 28.81 ? 47  THR B HG23 1 
ATOM   2084 N  N    . TYR B 1 29 ? 3.464   5.032   -14.865 1.00 14.55 ? 48  TYR B N    1 
ATOM   2085 C  CA   . TYR B 1 29 ? 4.548   5.626   -14.100 1.00 13.84 ? 48  TYR B CA   1 
ATOM   2086 C  C    . TYR B 1 29 ? 4.617   4.920   -12.775 1.00 14.15 ? 48  TYR B C    1 
ATOM   2087 O  O    . TYR B 1 29 ? 3.688   4.209   -12.407 1.00 14.48 ? 48  TYR B O    1 
ATOM   2088 C  CB   . TYR B 1 29 ? 4.320   7.131   -13.838 1.00 12.69 ? 48  TYR B CB   1 
ATOM   2089 C  CG   . TYR B 1 29 ? 4.327   8.021   -15.094 1.00 11.07 ? 48  TYR B CG   1 
ATOM   2090 C  CD1  . TYR B 1 29 ? 3.204   8.115   -15.897 1.00 10.58 ? 48  TYR B CD1  1 
ATOM   2091 C  CD2  . TYR B 1 29 ? 5.443   8.744   -15.467 1.00 11.09 ? 48  TYR B CD2  1 
ATOM   2092 C  CE1  . TYR B 1 29 ? 3.146   8.903   -17.015 1.00 11.30 ? 48  TYR B CE1  1 
ATOM   2093 C  CE2  . TYR B 1 29 ? 5.412   9.540   -16.616 1.00 10.74 ? 48  TYR B CE2  1 
ATOM   2094 C  CZ   . TYR B 1 29 ? 4.254   9.608   -17.380 1.00 10.95 ? 48  TYR B CZ   1 
ATOM   2095 O  OH   . TYR B 1 29 ? 4.234   10.373  -18.527 1.00 11.42 ? 48  TYR B OH   1 
ATOM   2096 H  H    . TYR B 1 29 ? 2.701   5.112   -14.477 1.00 17.46 ? 48  TYR B H    1 
ATOM   2097 H  HA   . TYR B 1 29 ? 5.390   5.508   -14.567 1.00 16.61 ? 48  TYR B HA   1 
ATOM   2098 H  HB2  . TYR B 1 29 ? 3.458   7.241   -13.406 1.00 15.22 ? 48  TYR B HB2  1 
ATOM   2099 H  HB3  . TYR B 1 29 ? 5.021   7.451   -13.249 1.00 15.22 ? 48  TYR B HB3  1 
ATOM   2100 H  HD1  . TYR B 1 29 ? 2.443   7.639   -15.652 1.00 12.70 ? 48  TYR B HD1  1 
ATOM   2101 H  HD2  . TYR B 1 29 ? 6.218   8.701   -14.954 1.00 13.30 ? 48  TYR B HD2  1 
ATOM   2102 H  HE1  . TYR B 1 29 ? 2.374   8.932   -17.533 1.00 13.56 ? 48  TYR B HE1  1 
ATOM   2103 H  HE2  . TYR B 1 29 ? 6.166   10.023  -16.868 1.00 12.89 ? 48  TYR B HE2  1 
ATOM   2104 H  HH   . TYR B 1 29 ? 4.976   10.752  -18.632 1.00 13.71 ? 48  TYR B HH   1 
ATOM   2105 N  N    . THR B 1 30 ? 5.707   5.122   -12.051 1.00 13.10 ? 49  THR B N    1 
ATOM   2106 C  CA   . THR B 1 30 ? 5.721   4.751   -10.664 1.00 12.48 ? 49  THR B CA   1 
ATOM   2107 C  C    . THR B 1 30 ? 5.387   5.977   -9.826  1.00 11.54 ? 49  THR B C    1 
ATOM   2108 O  O    . THR B 1 30 ? 5.550   7.125   -10.265 1.00 11.24 ? 49  THR B O    1 
ATOM   2109 C  CB   . THR B 1 30 ? 7.045   4.157   -10.220 1.00 14.77 ? 49  THR B CB   1 
ATOM   2110 O  OG1  . THR B 1 30 ? 8.018   5.198   -10.186 1.00 14.94 ? 49  THR B OG1  1 
ATOM   2111 C  CG2  . THR B 1 30 ? 7.459   3.011   -11.118 1.00 15.92 ? 49  THR B CG2  1 
ATOM   2112 H  H    . THR B 1 30 ? 6.439   5.468   -12.342 1.00 15.72 ? 49  THR B H    1 
ATOM   2113 H  HA   . THR B 1 30 ? 5.031   4.087   -10.510 1.00 14.97 ? 49  THR B HA   1 
ATOM   2114 H  HB   . THR B 1 30 ? 6.940   3.803   -9.323  1.00 17.72 ? 49  THR B HB   1 
ATOM   2115 H  HG1  . THR B 1 30 ? 8.101   5.537   -10.950 1.00 17.92 ? 49  THR B HG1  1 
ATOM   2116 H  HG21 . THR B 1 30 ? 6.788   2.312   -11.094 1.00 19.10 ? 49  THR B HG21 1 
ATOM   2117 H  HG22 . THR B 1 30 ? 7.556   3.325   -12.031 1.00 19.10 ? 49  THR B HG22 1 
ATOM   2118 H  HG23 . THR B 1 30 ? 8.307   2.646   -10.819 1.00 19.10 ? 49  THR B HG23 1 
ATOM   2119 N  N    . MET B 1 31 ? 4.952   5.741   -8.599  1.00 12.59 ? 50  MET B N    1 
ATOM   2120 C  CA   . MET B 1 31 ? 4.692   6.839   -7.668  1.00 13.53 ? 50  MET B CA   1 
ATOM   2121 C  C    . MET B 1 31 ? 5.951   7.667   -7.430  1.00 13.00 ? 50  MET B C    1 
ATOM   2122 O  O    . MET B 1 31 ? 5.871   8.893   -7.347  1.00 12.60 ? 50  MET B O    1 
ATOM   2123 C  CB   . MET B 1 31 ? 4.151   6.329   -6.334  1.00 15.22 ? 50  MET B CB   1 
ATOM   2124 C  CG   . MET B 1 31 ? 3.832   7.450   -5.351  1.00 16.92 ? 50  MET B CG   1 
ATOM   2125 S  SD   . MET B 1 31 ? 2.567   8.569   -5.904  1.00 19.64 ? 50  MET B SD   1 
ATOM   2126 C  CE   . MET B 1 31 ? 1.166   7.518   -5.753  1.00 20.03 ? 50  MET B CE   1 
ATOM   2127 H  H    . MET B 1 31 ? 4.798   4.959   -8.277  1.00 15.11 ? 50  MET B H    1 
ATOM   2128 H  HA   . MET B 1 31 ? 4.014   7.415   -8.055  1.00 16.24 ? 50  MET B HA   1 
ATOM   2129 H  HB2  . MET B 1 31 ? 3.334   5.831   -6.495  1.00 18.26 ? 50  MET B HB2  1 
ATOM   2130 H  HB3  . MET B 1 31 ? 4.815   5.753   -5.924  1.00 18.26 ? 50  MET B HB3  1 
ATOM   2131 H  HG2  . MET B 1 31 ? 3.533   7.056   -4.517  1.00 20.31 ? 50  MET B HG2  1 
ATOM   2132 H  HG3  . MET B 1 31 ? 4.638   7.968   -5.199  1.00 20.31 ? 50  MET B HG3  1 
ATOM   2133 H  HE1  . MET B 1 31 ? 1.291   6.742   -6.322  1.00 24.04 ? 50  MET B HE1  1 
ATOM   2134 H  HE2  . MET B 1 31 ? 1.079   7.239   -4.828  1.00 24.04 ? 50  MET B HE2  1 
ATOM   2135 H  HE3  . MET B 1 31 ? 0.374   8.006   -6.028  1.00 24.04 ? 50  MET B HE3  1 
ATOM   2136 N  N    . LYS B 1 32 ? 7.093   7.002   -7.260  1.00 15.16 ? 51  LYS B N    1 
ATOM   2137 C  CA   . LYS B 1 32 ? 8.309   7.746   -6.920  1.00 16.75 ? 51  LYS B CA   1 
ATOM   2138 C  C    . LYS B 1 32 ? 8.692   8.647   -8.107  1.00 13.67 ? 51  LYS B C    1 
ATOM   2139 O  O    . LYS B 1 32 ? 9.140   9.762   -7.918  1.00 13.40 ? 51  LYS B O    1 
ATOM   2140 C  CB   . LYS B 1 32 ? 9.471   6.854   -6.425  1.00 23.47 ? 51  LYS B CB   1 
ATOM   2141 C  CG   . LYS B 1 32 ? 10.253  6.170   -7.444  1.00 26.96 ? 51  LYS B CG   1 
ATOM   2142 C  CD   . LYS B 1 32 ? 11.464  5.405   -6.814  1.00 28.00 ? 51  LYS B CD   1 
ATOM   2143 C  CE   . LYS B 1 32 ? 11.218  4.868   -5.413  1.00 29.49 ? 51  LYS B CE   1 
ATOM   2144 N  NZ   . LYS B 1 32 ? 12.465  4.226   -4.903  1.00 32.32 ? 51  LYS B NZ   1 
ATOM   2145 H  H    . LYS B 1 32 ? 7.191   6.150   -7.331  1.00 18.19 ? 51  LYS B H    1 
ATOM   2146 H  HA   . LYS B 1 32 ? 8.090   8.340   -6.185  1.00 20.10 ? 51  LYS B HA   1 
ATOM   2147 H  HB2  . LYS B 1 32 ? 10.083  7.410   -5.918  1.00 28.16 ? 51  LYS B HB2  1 
ATOM   2148 H  HB3  . LYS B 1 32 ? 9.101   6.172   -5.842  1.00 28.16 ? 51  LYS B HB3  1 
ATOM   2149 H  HG2  . LYS B 1 32 ? 9.691   5.526   -7.902  1.00 32.35 ? 51  LYS B HG2  1 
ATOM   2150 H  HG3  . LYS B 1 32 ? 10.599  6.822   -8.073  1.00 32.35 ? 51  LYS B HG3  1 
ATOM   2151 H  HD2  . LYS B 1 32 ? 11.682  4.650   -7.383  1.00 33.60 ? 51  LYS B HD2  1 
ATOM   2152 H  HD3  . LYS B 1 32 ? 12.221  6.009   -6.768  1.00 33.60 ? 51  LYS B HD3  1 
ATOM   2153 H  HE2  . LYS B 1 32 ? 10.980  5.598   -4.821  1.00 35.39 ? 51  LYS B HE2  1 
ATOM   2154 H  HE3  . LYS B 1 32 ? 10.513  4.202   -5.437  1.00 35.39 ? 51  LYS B HE3  1 
ATOM   2155 H  HZ1  . LYS B 1 32 ? 13.125  4.822   -4.878  1.00 38.78 ? 51  LYS B HZ1  1 
ATOM   2156 H  HZ2  . LYS B 1 32 ? 12.330  3.908   -4.083  1.00 38.78 ? 51  LYS B HZ2  1 
ATOM   2157 H  HZ3  . LYS B 1 32 ? 12.701  3.554   -5.438  1.00 38.78 ? 51  LYS B HZ3  1 
ATOM   2158 N  N    . GLU B 1 33 ? 8.446   8.198   -9.331  1.00 13.95 ? 52  GLU B N    1 
ATOM   2159 C  CA   . GLU B 1 33 ? 8.691   8.996   -10.495 1.00 13.33 ? 52  GLU B CA   1 
ATOM   2160 C  C    . GLU B 1 33 ? 7.749   10.230  -10.557 1.00 10.54 ? 52  GLU B C    1 
ATOM   2161 O  O    . GLU B 1 33 ? 8.183   11.344  -10.919 1.00 9.87  ? 52  GLU B O    1 
ATOM   2162 C  CB   . GLU B 1 33 ? 8.458   8.036   -11.635 1.00 18.62 ? 52  GLU B CB   1 
ATOM   2163 C  CG   . GLU B 1 33 ? 8.583   8.512   -12.934 1.00 19.60 ? 52  GLU B CG   1 
ATOM   2164 C  CD   . GLU B 1 33 ? 8.464   7.367   -13.984 1.00 15.74 ? 52  GLU B CD   1 
ATOM   2165 O  OE1  . GLU B 1 33 ? 7.722   6.325   -13.831 1.00 15.17 ? 52  GLU B OE1  1 
ATOM   2166 O  OE2  . GLU B 1 33 ? 9.132   7.577   -14.989 1.00 16.67 ? 52  GLU B OE2  1 
ATOM   2167 H  H    . GLU B 1 33 ? 8.130   7.417   -9.504  1.00 16.74 ? 52  GLU B H    1 
ATOM   2168 H  HA   . GLU B 1 33 ? 9.614   9.295   -10.510 1.00 15.99 ? 52  GLU B HA   1 
ATOM   2169 H  HB2  . GLU B 1 33 ? 9.090   7.306   -11.542 1.00 22.35 ? 52  GLU B HB2  1 
ATOM   2170 H  HB3  . GLU B 1 33 ? 7.558   7.687   -11.549 1.00 22.35 ? 52  GLU B HB3  1 
ATOM   2171 H  HG2  . GLU B 1 33 ? 7.879   9.157   -13.107 1.00 23.52 ? 52  GLU B HG2  1 
ATOM   2172 H  HG3  . GLU B 1 33 ? 9.453   8.930   -13.039 1.00 23.52 ? 52  GLU B HG3  1 
ATOM   2173 N  N    . VAL B 1 34 ? 6.479   10.012  -10.236 1.00 9.52  ? 53  VAL B N    1 
ATOM   2174 C  CA   . VAL B 1 34 ? 5.516   11.081  -10.225 1.00 8.78  ? 53  VAL B CA   1 
ATOM   2175 C  C    . VAL B 1 34 ? 5.886   12.138  -9.193  1.00 9.21  ? 53  VAL B C    1 
ATOM   2176 O  O    . VAL B 1 34 ? 5.846   13.342  -9.486  1.00 9.69  ? 53  VAL B O    1 
ATOM   2177 C  CB   . VAL B 1 34 ? 4.097   10.533  -10.030 1.00 9.85  ? 53  VAL B CB   1 
ATOM   2178 C  CG1  . VAL B 1 34 ? 3.107   11.646  -9.809  1.00 9.74  ? 53  VAL B CG1  1 
ATOM   2179 C  CG2  . VAL B 1 34 ? 3.675   9.707   -11.223 1.00 11.47 ? 53  VAL B CG2  1 
ATOM   2180 H  H    . VAL B 1 34 ? 6.156   9.245   -10.021 1.00 11.43 ? 53  VAL B H    1 
ATOM   2181 H  HA   . VAL B 1 34 ? 5.537   11.513  -11.093 1.00 10.54 ? 53  VAL B HA   1 
ATOM   2182 H  HB   . VAL B 1 34 ? 4.083   9.959   -9.248  1.00 11.82 ? 53  VAL B HB   1 
ATOM   2183 H  HG11 . VAL B 1 34 ? 2.224   11.264  -9.691  1.00 11.69 ? 53  VAL B HG11 1 
ATOM   2184 H  HG12 . VAL B 1 34 ? 3.363   12.142  -9.016  1.00 11.69 ? 53  VAL B HG12 1 
ATOM   2185 H  HG13 . VAL B 1 34 ? 3.114   12.232  -10.583 1.00 11.69 ? 53  VAL B HG13 1 
ATOM   2186 H  HG21 . VAL B 1 34 ? 2.777   9.374   -11.074 1.00 13.76 ? 53  VAL B HG21 1 
ATOM   2187 H  HG22 . VAL B 1 34 ? 3.694   10.266  -12.015 1.00 13.76 ? 53  VAL B HG22 1 
ATOM   2188 H  HG23 . VAL B 1 34 ? 4.291   8.965   -11.326 1.00 13.76 ? 53  VAL B HG23 1 
ATOM   2189 N  N    . LEU B 1 35 ? 6.262   11.705  -7.991  1.00 9.70  ? 54  LEU B N    1 
ATOM   2190 C  CA   . LEU B 1 35 ? 6.720   12.633  -6.967  1.00 9.74  ? 54  LEU B CA   1 
ATOM   2191 C  C    . LEU B 1 35 ? 7.884   13.466  -7.500  1.00 9.77  ? 54  LEU B C    1 
ATOM   2192 O  O    . LEU B 1 35 ? 7.914   14.695  -7.350  1.00 10.29 ? 54  LEU B O    1 
ATOM   2193 C  CB   . LEU B 1 35 ? 7.107   11.882  -5.690  1.00 10.76 ? 54  LEU B CB   1 
ATOM   2194 C  CG   . LEU B 1 35 ? 5.915   11.446  -4.837  1.00 12.68 ? 54  LEU B CG   1 
ATOM   2195 C  CD1  . LEU B 1 35 ? 6.346   10.376  -3.873  1.00 13.88 ? 54  LEU B CD1  1 
ATOM   2196 C  CD2  . LEU B 1 35 ? 5.332   12.617  -4.083  1.00 12.92 ? 54  LEU B CD2  1 
ATOM   2197 H  H    . LEU B 1 35 ? 6.260   10.880  -7.746  1.00 11.64 ? 54  LEU B H    1 
ATOM   2198 H  HA   . LEU B 1 35 ? 5.996   13.240  -6.748  1.00 11.68 ? 54  LEU B HA   1 
ATOM   2199 H  HB2  . LEU B 1 35 ? 7.602   11.085  -5.936  1.00 12.92 ? 54  LEU B HB2  1 
ATOM   2200 H  HB3  . LEU B 1 35 ? 7.664   12.460  -5.146  1.00 12.92 ? 54  LEU B HB3  1 
ATOM   2201 H  HG   . LEU B 1 35 ? 5.225   11.079  -5.412  1.00 15.22 ? 54  LEU B HG   1 
ATOM   2202 H  HD11 . LEU B 1 35 ? 5.583   10.107  -3.338  1.00 16.66 ? 54  LEU B HD11 1 
ATOM   2203 H  HD12 . LEU B 1 35 ? 6.682   9.616   -4.375  1.00 16.66 ? 54  LEU B HD12 1 
ATOM   2204 H  HD13 . LEU B 1 35 ? 7.044   10.729  -3.300  1.00 16.66 ? 54  LEU B HD13 1 
ATOM   2205 H  HD21 . LEU B 1 35 ? 6.014   12.991  -3.503  1.00 15.51 ? 54  LEU B HD21 1 
ATOM   2206 H  HD22 . LEU B 1 35 ? 5.035   13.286  -4.720  1.00 15.51 ? 54  LEU B HD22 1 
ATOM   2207 H  HD23 . LEU B 1 35 ? 4.580   12.309  -3.553  1.00 15.51 ? 54  LEU B HD23 1 
ATOM   2208 N  N    . PHE B 1 36 ? 8.888   12.786  -8.042  1.00 9.82  ? 55  PHE B N    1 
ATOM   2209 C  CA   . PHE B 1 36 ? 10.080  13.460  -8.524  1.00 9.63  ? 55  PHE B CA   1 
ATOM   2210 C  C    . PHE B 1 36 ? 9.694   14.513  -9.568  1.00 8.47  ? 55  PHE B C    1 
ATOM   2211 O  O    . PHE B 1 36 ? 10.168  15.655  -9.527  1.00 8.97  ? 55  PHE B O    1 
ATOM   2212 C  CB   . PHE B 1 36 ? 11.067  12.455  -9.102  1.00 10.27 ? 55  PHE B CB   1 
ATOM   2213 C  CG   . PHE B 1 36 ? 12.202  13.103  -9.826  1.00 10.74 ? 55  PHE B CG   1 
ATOM   2214 C  CD1  . PHE B 1 36 ? 13.262  13.593  -9.095  1.00 12.34 ? 55  PHE B CD1  1 
ATOM   2215 C  CD2  . PHE B 1 36 ? 12.213  13.233  -11.206 1.00 12.89 ? 55  PHE B CD2  1 
ATOM   2216 C  CE1  . PHE B 1 36 ? 14.319  14.194  -9.703  1.00 14.08 ? 55  PHE B CE1  1 
ATOM   2217 C  CE2  . PHE B 1 36 ? 13.312  13.847  -11.834 1.00 15.77 ? 55  PHE B CE2  1 
ATOM   2218 C  CZ   . PHE B 1 36 ? 14.341  14.337  -11.057 1.00 15.29 ? 55  PHE B CZ   1 
ATOM   2219 H  H    A PHE B 1 36 ? 8.901   11.932  -8.142  1.00 11.78 ? 55  PHE B H    1 
ATOM   2220 H  H    B PHE B 1 36 ? 8.901   11.932  -8.142  0.00 11.78 ? 55  PHE B H    1 
ATOM   2221 H  HA   . PHE B 1 36 ? 10.510  13.914  -7.782  1.00 11.55 ? 55  PHE B HA   1 
ATOM   2222 H  HB2  . PHE B 1 36 ? 11.437  11.925  -8.379  1.00 12.33 ? 55  PHE B HB2  1 
ATOM   2223 H  HB3  . PHE B 1 36 ? 10.601  11.880  -9.729  1.00 12.33 ? 55  PHE B HB3  1 
ATOM   2224 H  HD1  . PHE B 1 36 ? 13.255  13.511  -8.169  1.00 14.81 ? 55  PHE B HD1  1 
ATOM   2225 H  HD2  . PHE B 1 36 ? 11.506  12.905  -11.714 1.00 15.46 ? 55  PHE B HD2  1 
ATOM   2226 H  HE1  . PHE B 1 36 ? 15.024  14.521  -9.192  1.00 16.89 ? 55  PHE B HE1  1 
ATOM   2227 H  HE2  . PHE B 1 36 ? 13.332  13.946  -12.759 1.00 18.92 ? 55  PHE B HE2  1 
ATOM   2228 H  HZ   . PHE B 1 36 ? 15.072  14.742  -11.464 1.00 18.35 ? 55  PHE B HZ   1 
ATOM   2229 N  N    . TYR B 1 37 ? 8.902   14.094  -10.535 1.00 8.16  ? 56  TYR B N    1 
ATOM   2230 C  CA   . TYR B 1 37 ? 8.544   15.000  -11.614 1.00 8.00  ? 56  TYR B CA   1 
ATOM   2231 C  C    . TYR B 1 37 ? 7.702   16.196  -11.132 1.00 8.15  ? 56  TYR B C    1 
ATOM   2232 O  O    . TYR B 1 37 ? 7.862   17.324  -11.630 1.00 9.14  ? 56  TYR B O    1 
ATOM   2233 C  CB   . TYR B 1 37 ? 7.815   14.266  -12.728 1.00 7.81  ? 56  TYR B CB   1 
ATOM   2234 C  CG   . TYR B 1 37 ? 8.649   13.508  -13.732 1.00 8.28  ? 56  TYR B CG   1 
ATOM   2235 C  CD1  . TYR B 1 37 ? 9.822   14.008  -14.269 1.00 9.49  ? 56  TYR B CD1  1 
ATOM   2236 C  CD2  . TYR B 1 37 ? 8.189   12.279  -14.191 1.00 9.22  ? 56  TYR B CD2  1 
ATOM   2237 C  CE1  . TYR B 1 37 ? 10.505  13.322  -15.255 1.00 9.54  ? 56  TYR B CE1  1 
ATOM   2238 C  CE2  . TYR B 1 37 ? 8.851   11.601  -15.180 1.00 9.99  ? 56  TYR B CE2  1 
ATOM   2239 C  CZ   . TYR B 1 37 ? 10.004  12.136  -15.732 1.00 10.10 ? 56  TYR B CZ   1 
ATOM   2240 O  OH   . TYR B 1 37 ? 10.628  11.448  -16.752 1.00 12.09 ? 56  TYR B OH   1 
ATOM   2241 H  H    . TYR B 1 37 ? 8.562   13.306  -10.593 1.00 9.80  ? 56  TYR B H    1 
ATOM   2242 H  HA   . TYR B 1 37 ? 9.362   15.359  -11.993 1.00 9.60  ? 56  TYR B HA   1 
ATOM   2243 H  HB2  . TYR B 1 37 ? 7.213   13.625  -12.319 1.00 9.37  ? 56  TYR B HB2  1 
ATOM   2244 H  HB3  . TYR B 1 37 ? 7.295   14.917  -13.225 1.00 9.37  ? 56  TYR B HB3  1 
ATOM   2245 H  HD1  . TYR B 1 37 ? 10.137  14.836  -13.987 1.00 11.39 ? 56  TYR B HD1  1 
ATOM   2246 H  HD2  . TYR B 1 37 ? 7.386   11.942  -13.865 1.00 11.07 ? 56  TYR B HD2  1 
ATOM   2247 H  HE1  . TYR B 1 37 ? 11.275  13.687  -15.628 1.00 11.45 ? 56  TYR B HE1  1 
ATOM   2248 H  HE2  . TYR B 1 37 ? 8.513   10.795  -15.498 1.00 11.99 ? 56  TYR B HE2  1 
ATOM   2249 H  HH   . TYR B 1 37 ? 11.315  11.863  -17.000 1.00 14.51 ? 56  TYR B HH   1 
ATOM   2250 N  N    . LEU B 1 38 ? 6.766   15.973  -10.227 1.00 8.66  ? 57  LEU B N    1 
ATOM   2251 C  CA   . LEU B 1 38 ? 6.008   17.089  -9.673  1.00 8.80  ? 57  LEU B CA   1 
ATOM   2252 C  C    . LEU B 1 38 ? 6.933   18.090  -8.989  1.00 8.41  ? 57  LEU B C    1 
ATOM   2253 O  O    . LEU B 1 38 ? 6.789   19.300  -9.161  1.00 9.40  ? 57  LEU B O    1 
ATOM   2254 C  CB   . LEU B 1 38 ? 4.945   16.586  -8.701  1.00 10.23 ? 57  LEU B CB   1 
ATOM   2255 C  CG   . LEU B 1 38 ? 3.702   15.994  -9.346  1.00 11.37 ? 57  LEU B CG   1 
ATOM   2256 C  CD1  . LEU B 1 38 ? 2.939   15.198  -8.326  1.00 12.72 ? 57  LEU B CD1  1 
ATOM   2257 C  CD2  . LEU B 1 38 ? 2.825   17.071  -9.896  1.00 12.38 ? 57  LEU B CD2  1 
ATOM   2258 H  H    . LEU B 1 38 ? 6.550   15.200  -9.919  1.00 10.39 ? 57  LEU B H    1 
ATOM   2259 H  HA   . LEU B 1 38 ? 5.555   17.549  -10.396 1.00 10.56 ? 57  LEU B HA   1 
ATOM   2260 H  HB2  . LEU B 1 38 ? 5.340   15.897  -8.144  1.00 12.27 ? 57  LEU B HB2  1 
ATOM   2261 H  HB3  . LEU B 1 38 ? 4.660   17.328  -8.146  1.00 12.27 ? 57  LEU B HB3  1 
ATOM   2262 H  HG   . LEU B 1 38 ? 3.960   15.404  -10.071 1.00 13.64 ? 57  LEU B HG   1 
ATOM   2263 H  HD11 . LEU B 1 38 ? 2.148   14.825  -8.745  1.00 15.27 ? 57  LEU B HD11 1 
ATOM   2264 H  HD12 . LEU B 1 38 ? 3.507   14.485  -7.994  1.00 15.27 ? 57  LEU B HD12 1 
ATOM   2265 H  HD13 . LEU B 1 38 ? 2.683   15.784  -7.597  1.00 15.27 ? 57  LEU B HD13 1 
ATOM   2266 H  HD21 . LEU B 1 38 ? 2.557   17.660  -9.173  1.00 14.86 ? 57  LEU B HD21 1 
ATOM   2267 H  HD22 . LEU B 1 38 ? 3.321   17.571  -10.564 1.00 14.86 ? 57  LEU B HD22 1 
ATOM   2268 H  HD23 . LEU B 1 38 ? 2.042   16.665  -10.300 1.00 14.86 ? 57  LEU B HD23 1 
ATOM   2269 N  N    . GLY B 1 39 ? 7.888   17.607  -8.215  1.00 8.48  ? 58  GLY B N    1 
ATOM   2270 C  CA   . GLY B 1 39 ? 8.807   18.538  -7.582  1.00 8.53  ? 58  GLY B CA   1 
ATOM   2271 C  C    . GLY B 1 39 ? 9.616   19.309  -8.616  1.00 9.82  ? 58  GLY B C    1 
ATOM   2272 O  O    . GLY B 1 39 ? 9.857   20.512  -8.476  1.00 9.80  ? 58  GLY B O    1 
ATOM   2273 H  H    . GLY B 1 39 ? 8.024   16.776  -8.043  1.00 10.18 ? 58  GLY B H    1 
ATOM   2274 H  HA2  . GLY B 1 39 ? 8.309   19.172  -7.041  1.00 10.23 ? 58  GLY B HA2  1 
ATOM   2275 H  HA3  . GLY B 1 39 ? 9.419   18.053  -7.007  1.00 10.23 ? 58  GLY B HA3  1 
ATOM   2276 N  N    . GLN B 1 40 ? 10.057  18.644  -9.678  1.00 9.40  ? 59  GLN B N    1 
ATOM   2277 C  CA   . GLN B 1 40 ? 10.823  19.350  -10.689 1.00 9.58  ? 59  GLN B CA   1 
ATOM   2278 C  C    . GLN B 1 40 ? 9.980   20.308  -11.526 1.00 10.13 ? 59  GLN B C    1 
ATOM   2279 O  O    . GLN B 1 40 ? 10.497  21.313  -12.004 1.00 11.68 ? 59  GLN B O    1 
ATOM   2280 C  CB   . GLN B 1 40 ? 11.549  18.339  -11.585 1.00 10.31 ? 59  GLN B CB   1 
ATOM   2281 C  CG   . GLN B 1 40 ? 12.634  17.540  -10.865 1.00 10.51 ? 59  GLN B CG   1 
ATOM   2282 C  CD   . GLN B 1 40 ? 13.637  18.465  -10.198 1.00 11.13 ? 59  GLN B CD   1 
ATOM   2283 O  OE1  . GLN B 1 40 ? 14.174  19.406  -10.832 1.00 13.17 ? 59  GLN B OE1  1 
ATOM   2284 N  NE2  . GLN B 1 40 ? 13.823  18.272  -8.914  1.00 13.42 ? 59  GLN B NE2  1 
ATOM   2285 H  H    . GLN B 1 40 ? 9.930   17.807  -9.831  1.00 11.28 ? 59  GLN B H    1 
ATOM   2286 H  HA   . GLN B 1 40 ? 11.501  19.880  -10.242 1.00 11.49 ? 59  GLN B HA   1 
ATOM   2287 H  HB2  . GLN B 1 40 ? 10.900  17.709  -11.935 1.00 12.38 ? 59  GLN B HB2  1 
ATOM   2288 H  HB3  . GLN B 1 40 ? 11.970  18.817  -12.317 1.00 12.38 ? 59  GLN B HB3  1 
ATOM   2289 H  HG2  . GLN B 1 40 ? 12.226  16.987  -10.181 1.00 12.62 ? 59  GLN B HG2  1 
ATOM   2290 H  HG3  . GLN B 1 40 ? 13.107  16.988  -11.508 1.00 12.62 ? 59  GLN B HG3  1 
ATOM   2291 H  HE21 . GLN B 1 40 ? 13.389  17.653  -8.505  1.00 16.10 ? 59  GLN B HE21 1 
ATOM   2292 H  HE22 . GLN B 1 40 ? 14.379  18.766  -8.482  1.00 16.10 ? 59  GLN B HE22 1 
ATOM   2293 N  N    . TYR B 1 41 ? 8.700   20.021  -11.677 1.00 9.61  ? 60  TYR B N    1 
ATOM   2294 C  CA   . TYR B 1 41 ? 7.771   20.963  -12.330 1.00 9.80  ? 60  TYR B CA   1 
ATOM   2295 C  C    . TYR B 1 41 ? 7.714   22.238  -11.475 1.00 9.19  ? 60  TYR B C    1 
ATOM   2296 O  O    . TYR B 1 41 ? 7.765   23.357  -11.999 1.00 10.67 ? 60  TYR B O    1 
ATOM   2297 C  CB   . TYR B 1 41 ? 6.383   20.303  -12.422 1.00 9.80  ? 60  TYR B CB   1 
ATOM   2298 C  CG   . TYR B 1 41 ? 5.298   21.183  -12.932 1.00 9.55  ? 60  TYR B CG   1 
ATOM   2299 C  CD1  . TYR B 1 41 ? 5.055   21.333  -14.287 1.00 9.73  ? 60  TYR B CD1  1 
ATOM   2300 C  CD2  . TYR B 1 41 ? 4.490   21.875  -12.055 1.00 10.32 ? 60  TYR B CD2  1 
ATOM   2301 C  CE1  . TYR B 1 41 ? 4.040   22.173  -14.726 1.00 9.75  ? 60  TYR B CE1  1 
ATOM   2302 C  CE2  . TYR B 1 41 ? 3.515   22.690  -12.472 1.00 11.20 ? 60  TYR B CE2  1 
ATOM   2303 C  CZ   . TYR B 1 41 ? 3.275   22.844  -13.830 1.00 12.13 ? 60  TYR B CZ   1 
ATOM   2304 O  OH   . TYR B 1 41 ? 2.271   23.644  -14.318 1.00 14.76 ? 60  TYR B OH   1 
ATOM   2305 H  H    . TYR B 1 41 ? 8.331   19.290  -11.414 1.00 11.53 ? 60  TYR B H    1 
ATOM   2306 H  HA   . TYR B 1 41 ? 8.083   21.184  -13.221 1.00 11.76 ? 60  TYR B HA   1 
ATOM   2307 H  HB2  . TYR B 1 41 ? 6.444   19.539  -13.016 1.00 11.76 ? 60  TYR B HB2  1 
ATOM   2308 H  HB3  . TYR B 1 41 ? 6.125   20.005  -11.535 1.00 11.76 ? 60  TYR B HB3  1 
ATOM   2309 H  HD1  . TYR B 1 41 ? 5.582   20.881  -14.905 1.00 11.68 ? 60  TYR B HD1  1 
ATOM   2310 H  HD2  . TYR B 1 41 ? 4.643   21.788  -11.141 1.00 12.39 ? 60  TYR B HD2  1 
ATOM   2311 H  HE1  . TYR B 1 41 ? 3.880   22.270  -15.637 1.00 11.70 ? 60  TYR B HE1  1 
ATOM   2312 H  HE2  . TYR B 1 41 ? 2.988   23.140  -11.852 1.00 13.44 ? 60  TYR B HE2  1 
ATOM   2313 H  HH   . TYR B 1 41 ? 1.861   24.011  -13.682 1.00 17.72 ? 60  TYR B HH   1 
ATOM   2314 N  N    . ILE B 1 42 ? 7.580   22.076  -10.158 1.00 8.60  ? 61  ILE B N    1 
ATOM   2315 C  CA   . ILE B 1 42 ? 7.552   23.209  -9.268  1.00 9.02  ? 61  ILE B CA   1 
ATOM   2316 C  C    . ILE B 1 42 ? 8.838   24.022  -9.374  1.00 10.20 ? 61  ILE B C    1 
ATOM   2317 O  O    . ILE B 1 42 ? 8.808   25.276  -9.431  1.00 11.01 ? 61  ILE B O    1 
ATOM   2318 C  CB   . ILE B 1 42 ? 7.319   22.739  -7.824  1.00 8.09  ? 61  ILE B CB   1 
ATOM   2319 C  CG1  . ILE B 1 42 ? 5.905   22.235  -7.642  1.00 8.98  ? 61  ILE B CG1  1 
ATOM   2320 C  CG2  . ILE B 1 42 ? 7.582   23.857  -6.812  1.00 9.82  ? 61  ILE B CG2  1 
ATOM   2321 C  CD1  . ILE B 1 42 ? 5.752   21.318  -6.432  1.00 9.90  ? 61  ILE B CD1  1 
ATOM   2322 H  H    . ILE B 1 42 ? 7.505   21.315  -9.765  1.00 10.32 ? 61  ILE B H    1 
ATOM   2323 H  HA   . ILE B 1 42 ? 6.813   23.786  -9.517  1.00 10.82 ? 61  ILE B HA   1 
ATOM   2324 H  HB   . ILE B 1 42 ? 7.930   22.009  -7.638  1.00 9.71  ? 61  ILE B HB   1 
ATOM   2325 H  HG12 . ILE B 1 42 ? 5.313   22.993  -7.520  1.00 10.78 ? 61  ILE B HG12 1 
ATOM   2326 H  HG13 . ILE B 1 42 ? 5.645   21.735  -8.431  1.00 10.78 ? 61  ILE B HG13 1 
ATOM   2327 H  HG21 . ILE B 1 42 ? 8.504   24.148  -6.897  1.00 11.79 ? 61  ILE B HG21 1 
ATOM   2328 H  HG22 . ILE B 1 42 ? 6.982   24.596  -6.996  1.00 11.79 ? 61  ILE B HG22 1 
ATOM   2329 H  HG23 . ILE B 1 42 ? 7.424   23.516  -5.918  1.00 11.79 ? 61  ILE B HG23 1 
ATOM   2330 H  HD11 . ILE B 1 42 ? 6.333   20.549  -6.544  1.00 11.88 ? 61  ILE B HD11 1 
ATOM   2331 H  HD12 . ILE B 1 42 ? 6.001   21.807  -5.632  1.00 11.88 ? 61  ILE B HD12 1 
ATOM   2332 H  HD13 . ILE B 1 42 ? 4.828   21.030  -6.370  1.00 11.88 ? 61  ILE B HD13 1 
ATOM   2333 N  N    . MET B 1 43 ? 9.974   23.330  -9.460  1.00 10.58 ? 62  MET B N    1 
ATOM   2334 C  CA   . MET B 1 43 ? 11.269  24.016  -9.570  1.00 11.94 ? 62  MET B CA   1 
ATOM   2335 C  C    . MET B 1 43 ? 11.357  24.804  -10.881 1.00 12.88 ? 62  MET B C    1 
ATOM   2336 O  O    . MET B 1 43 ? 11.749  25.994  -10.915 1.00 14.54 ? 62  MET B O    1 
ATOM   2337 C  CB   . MET B 1 43 ? 12.425  23.001  -9.506  1.00 13.16 ? 62  MET B CB   1 
ATOM   2338 C  CG   . MET B 1 43 ? 12.574  22.258  -8.181  1.00 13.18 ? 62  MET B CG   1 
ATOM   2339 S  SD   . MET B 1 43 ? 12.749  23.357  -6.754  1.00 16.14 ? 62  MET B SD   1 
ATOM   2340 C  CE   . MET B 1 43 ? 14.270  24.220  -7.116  1.00 18.17 ? 62  MET B CE   1 
ATOM   2341 H  H    . MET B 1 43 ? 10.026  22.472  -9.457  1.00 12.70 ? 62  MET B H    1 
ATOM   2342 H  HA   . MET B 1 43 ? 11.366  24.629  -8.825  1.00 14.33 ? 62  MET B HA   1 
ATOM   2343 H  HB2  . MET B 1 43 ? 12.288  22.336  -10.199 1.00 15.79 ? 62  MET B HB2  1 
ATOM   2344 H  HB3  . MET B 1 43 ? 13.257  23.473  -9.670  1.00 15.79 ? 62  MET B HB3  1 
ATOM   2345 H  HG2  . MET B 1 43 ? 11.787  21.708  -8.039  1.00 15.82 ? 62  MET B HG2  1 
ATOM   2346 H  HG3  . MET B 1 43 ? 13.365  21.697  -8.223  1.00 15.82 ? 62  MET B HG3  1 
ATOM   2347 H  HE1  . MET B 1 43 ? 14.456  24.845  -6.398  1.00 21.81 ? 62  MET B HE1  1 
ATOM   2348 H  HE2  . MET B 1 43 ? 14.990  23.574  -7.188  1.00 21.81 ? 62  MET B HE2  1 
ATOM   2349 H  HE3  . MET B 1 43 ? 14.170  24.698  -7.954  1.00 21.81 ? 62  MET B HE3  1 
ATOM   2350 N  N    A THR B 1 44 ? 10.957  24.127  -11.943 0.54 12.43 ? 63  THR B N    1 
ATOM   2351 N  N    B THR B 1 44 ? 11.023  24.173  -11.995 0.46 12.49 ? 63  THR B N    1 
ATOM   2352 C  CA   A THR B 1 44 ? 11.057  24.638  -13.299 0.54 13.15 ? 63  THR B CA   1 
ATOM   2353 C  CA   B THR B 1 44 ? 11.219  24.873  -13.259 0.46 13.21 ? 63  THR B CA   1 
ATOM   2354 C  C    A THR B 1 44 ? 10.220  25.899  -13.513 0.54 13.08 ? 63  THR B C    1 
ATOM   2355 C  C    B THR B 1 44 ? 10.288  26.070  -13.369 0.46 12.93 ? 63  THR B C    1 
ATOM   2356 O  O    A THR B 1 44 ? 10.612  26.783  -14.270 0.54 14.27 ? 63  THR B O    1 
ATOM   2357 O  O    B THR B 1 44 ? 10.703  27.123  -13.855 0.46 13.06 ? 63  THR B O    1 
ATOM   2358 C  CB   A THR B 1 44 ? 10.608  23.526  -14.277 0.54 13.90 ? 63  THR B CB   1 
ATOM   2359 C  CB   B THR B 1 44 ? 11.078  23.961  -14.503 0.46 14.61 ? 63  THR B CB   1 
ATOM   2360 O  OG1  A THR B 1 44 ? 11.588  22.476  -14.290 0.54 15.72 ? 63  THR B OG1  1 
ATOM   2361 O  OG1  B THR B 1 44 ? 11.466  24.707  -15.668 0.46 15.79 ? 63  THR B OG1  1 
ATOM   2362 C  CG2  A THR B 1 44 ? 10.415  24.056  -15.688 0.54 14.89 ? 63  THR B CG2  1 
ATOM   2363 C  CG2  B THR B 1 44 ? 9.661   23.457  -14.668 0.46 15.08 ? 63  THR B CG2  1 
ATOM   2364 H  H    A THR B 1 44 ? 10.611  23.341  -11.903 0.54 14.91 ? 63  THR B H    1 
ATOM   2365 H  H    B THR B 1 44 ? 10.697  23.380  -12.052 0.46 14.99 ? 63  THR B H    1 
ATOM   2366 H  HA   A THR B 1 44 ? 11.983  24.854  -13.490 0.54 15.78 ? 63  THR B HA   1 
ATOM   2367 H  HA   B THR B 1 44 ? 12.125  25.220  -13.267 0.46 15.85 ? 63  THR B HA   1 
ATOM   2368 H  HB   A THR B 1 44 ? 9.761   23.163  -13.975 0.54 16.68 ? 63  THR B HB   1 
ATOM   2369 H  HB   B THR B 1 44 ? 11.664  23.194  -14.405 0.46 17.53 ? 63  THR B HB   1 
ATOM   2370 H  HG1  A THR B 1 44 ? 11.671  22.150  -13.520 0.54 18.86 ? 63  THR B HG1  1 
ATOM   2371 H  HG1  B THR B 1 44 ? 10.971  25.380  -15.755 0.46 18.94 ? 63  THR B HG1  1 
ATOM   2372 H  HG21 A THR B 1 44 ? 11.247  24.428  -16.019 0.54 17.87 ? 63  THR B HG21 1 
ATOM   2373 H  HG21 B THR B 1 44 ? 9.601   22.890  -15.453 0.46 18.09 ? 63  THR B HG21 1 
ATOM   2374 H  HG22 A THR B 1 44 ? 10.135  23.338  -16.277 0.54 17.87 ? 63  THR B HG22 1 
ATOM   2375 H  HG22 B THR B 1 44 ? 9.399   22.945  -13.888 0.46 18.09 ? 63  THR B HG22 1 
ATOM   2376 H  HG23 A THR B 1 44 ? 9.736   24.749  -15.692 0.54 17.87 ? 63  THR B HG23 1 
ATOM   2377 H  HG23 B THR B 1 44 ? 9.054   24.206  -14.773 0.46 18.09 ? 63  THR B HG23 1 
ATOM   2378 N  N    . LYS B 1 45 ? 9.060   25.946  -12.865 1.00 12.62 ? 64  LYS B N    1 
ATOM   2379 C  CA   . LYS B 1 45 ? 8.140   27.082  -12.950 1.00 13.73 ? 64  LYS B CA   1 
ATOM   2380 C  C    . LYS B 1 45 ? 8.290   28.080  -11.815 1.00 13.59 ? 64  LYS B C    1 
ATOM   2381 O  O    . LYS B 1 45 ? 7.597   29.094  -11.788 1.00 16.12 ? 64  LYS B O    1 
ATOM   2382 C  CB   . LYS B 1 45 ? 6.703   26.610  -13.027 1.00 14.25 ? 64  LYS B CB   1 
ATOM   2383 C  CG   . LYS B 1 45 ? 6.476   25.790  -14.290 1.00 16.57 ? 64  LYS B CG   1 
ATOM   2384 C  CD   . LYS B 1 45 ? 5.037   25.526  -14.643 1.00 18.14 ? 64  LYS B CD   1 
ATOM   2385 C  CE   . LYS B 1 45 ? 4.390   26.759  -15.284 1.00 20.32 ? 64  LYS B CE   1 
ATOM   2386 N  NZ   . LYS B 1 45 ? 2.921   26.546  -15.590 1.00 21.64 ? 64  LYS B NZ   1 
ATOM   2387 H  H    . LYS B 1 45 ? 8.759   25.279  -12.416 0.53 15.15 ? 64  LYS B H    1 
ATOM   2388 H  HA   . LYS B 1 45 ? 8.328   27.558  -13.774 1.00 16.48 ? 64  LYS B HA   1 
ATOM   2389 H  HB2  . LYS B 1 45 ? 6.504   26.052  -12.259 1.00 17.09 ? 64  LYS B HB2  1 
ATOM   2390 H  HB3  . LYS B 1 45 ? 6.111   27.378  -13.050 1.00 17.09 ? 64  LYS B HB3  1 
ATOM   2391 H  HG2  . LYS B 1 45 ? 6.878   26.260  -15.038 1.00 19.89 ? 64  LYS B HG2  1 
ATOM   2392 H  HG3  . LYS B 1 45 ? 6.910   24.929  -14.179 1.00 19.89 ? 64  LYS B HG3  1 
ATOM   2393 H  HD2  . LYS B 1 45 ? 4.990   24.793  -15.276 1.00 21.76 ? 64  LYS B HD2  1 
ATOM   2394 H  HD3  . LYS B 1 45 ? 4.544   25.308  -13.837 1.00 21.76 ? 64  LYS B HD3  1 
ATOM   2395 H  HE2  . LYS B 1 45 ? 4.466   27.510  -14.675 1.00 24.38 ? 64  LYS B HE2  1 
ATOM   2396 H  HE3  . LYS B 1 45 ? 4.845   26.958  -16.118 1.00 24.38 ? 64  LYS B HE3  1 
ATOM   2397 H  HZ1  . LYS B 1 45 ? 2.578   27.278  -15.960 1.00 25.96 ? 64  LYS B HZ1  1 
ATOM   2398 H  HZ2  . LYS B 1 45 ? 2.823   25.864  -16.153 1.00 25.96 ? 64  LYS B HZ2  1 
ATOM   2399 H  HZ3  . LYS B 1 45 ? 2.477   26.366  -14.839 1.00 25.96 ? 64  LYS B HZ3  1 
ATOM   2400 N  N    . ARG B 1 46 ? 9.189   27.808  -10.882 1.00 12.98 ? 65  ARG B N    1 
ATOM   2401 C  CA   . ARG B 1 46 ? 9.446   28.688  -9.729  1.00 13.15 ? 65  ARG B CA   1 
ATOM   2402 C  C    . ARG B 1 46 ? 8.160   28.948  -8.946  1.00 12.39 ? 65  ARG B C    1 
ATOM   2403 O  O    . ARG B 1 46 ? 7.906   30.076  -8.533  1.00 14.02 ? 65  ARG B O    1 
ATOM   2404 C  CB   . ARG B 1 46 ? 10.073  30.026  -10.159 1.00 16.65 ? 65  ARG B CB   1 
ATOM   2405 C  CG   . ARG B 1 46 ? 11.330  29.902  -10.993 1.00 18.97 ? 65  ARG B CG   1 
ATOM   2406 C  CD   . ARG B 1 46 ? 12.462  29.213  -10.298 1.00 20.68 ? 65  ARG B CD   1 
ATOM   2407 N  NE   . ARG B 1 46 ? 13.731  29.477  -11.009 1.00 24.34 ? 65  ARG B NE   1 
ATOM   2408 C  CZ   . ARG B 1 46 ? 14.287  28.668  -11.922 1.00 24.74 ? 65  ARG B CZ   1 
ATOM   2409 N  NH1  . ARG B 1 46 ? 13.714  27.511  -12.251 1.00 24.53 ? 65  ARG B NH1  1 
ATOM   2410 N  NH2  . ARG B 1 46 ? 15.435  29.003  -12.496 1.00 27.36 ? 65  ARG B NH2  1 
ATOM   2411 H  H    . ARG B 1 46 ? 9.680   27.102  -10.886 1.00 15.58 ? 65  ARG B H    1 
ATOM   2412 H  HA   . ARG B 1 46 ? 10.071  28.246  -9.133  1.00 15.78 ? 65  ARG B HA   1 
ATOM   2413 H  HB2  . ARG B 1 46 ? 9.422   30.518  -10.682 1.00 19.98 ? 65  ARG B HB2  1 
ATOM   2414 H  HB3  . ARG B 1 46 ? 10.300  30.530  -9.362  1.00 19.98 ? 65  ARG B HB3  1 
ATOM   2415 H  HG2  . ARG B 1 46 ? 11.123  29.394  -11.794 1.00 22.77 ? 65  ARG B HG2  1 
ATOM   2416 H  HG3  . ARG B 1 46 ? 11.630  30.791  -11.238 1.00 22.77 ? 65  ARG B HG3  1 
ATOM   2417 H  HD2  . ARG B 1 46 ? 12.541  29.552  -9.392  1.00 24.82 ? 65  ARG B HD2  1 
ATOM   2418 H  HD3  . ARG B 1 46 ? 12.306  28.256  -10.291 1.00 24.82 ? 65  ARG B HD3  1 
ATOM   2419 H  HE   . ARG B 1 46 ? 14.144  30.208  -10.823 1.00 29.20 ? 65  ARG B HE   1 
ATOM   2420 H  HH11 . ARG B 1 46 ? 12.972  27.279  -11.885 1.00 29.43 ? 65  ARG B HH11 1 
ATOM   2421 H  HH12 . ARG B 1 46 ? 14.083  26.999  -12.836 1.00 29.43 ? 65  ARG B HH12 1 
ATOM   2422 H  HH21 . ARG B 1 46 ? 15.818  29.745  -12.292 1.00 32.83 ? 65  ARG B HH21 1 
ATOM   2423 H  HH22 . ARG B 1 46 ? 15.792  28.481  -13.079 1.00 32.83 ? 65  ARG B HH22 1 
ATOM   2424 N  N    . LEU B 1 47 ? 7.383   27.898  -8.674  1.00 10.57 ? 66  LEU B N    1 
ATOM   2425 C  CA   . LEU B 1 47 ? 6.129   28.097  -7.933  1.00 10.17 ? 66  LEU B CA   1 
ATOM   2426 C  C    . LEU B 1 47 ? 6.374   28.349  -6.438  1.00 11.65 ? 66  LEU B C    1 
ATOM   2427 O  O    . LEU B 1 47 ? 5.492   28.834  -5.695  1.00 13.39 ? 66  LEU B O    1 
ATOM   2428 C  CB   . LEU B 1 47 ? 5.186   26.928  -8.145  1.00 10.60 ? 66  LEU B CB   1 
ATOM   2429 C  CG   . LEU B 1 47 ? 4.678   26.762  -9.591  1.00 12.97 ? 66  LEU B CG   1 
ATOM   2430 C  CD1  . LEU B 1 47 ? 3.747   25.563  -9.717  1.00 14.39 ? 66  LEU B CD1  1 
ATOM   2431 C  CD2  . LEU B 1 47 ? 3.952   28.007  -10.094 1.00 15.38 ? 66  LEU B CD2  1 
ATOM   2432 H  H    . LEU B 1 47 ? 7.549   27.084  -8.897  1.00 12.68 ? 66  LEU B H    1 
ATOM   2433 H  HA   . LEU B 1 47 ? 5.691   28.887  -8.288  1.00 12.20 ? 66  LEU B HA   1 
ATOM   2434 H  HB2  . LEU B 1 47 ? 5.647   26.110  -7.900  1.00 12.72 ? 66  LEU B HB2  1 
ATOM   2435 H  HB3  . LEU B 1 47 ? 4.411   27.048  -7.573  1.00 12.72 ? 66  LEU B HB3  1 
ATOM   2436 H  HG   . LEU B 1 47 ? 5.439   26.608  -10.172 1.00 15.56 ? 66  LEU B HG   1 
ATOM   2437 H  HD11 . LEU B 1 47 ? 4.229   24.762  -9.461  1.00 17.27 ? 66  LEU B HD11 1 
ATOM   2438 H  HD12 . LEU B 1 47 ? 2.985   25.693  -9.131  1.00 17.27 ? 66  LEU B HD12 1 
ATOM   2439 H  HD13 . LEU B 1 47 ? 3.449   25.491  -10.637 1.00 17.27 ? 66  LEU B HD13 1 
ATOM   2440 H  HD21 . LEU B 1 47 ? 3.655   27.851  -11.004 1.00 18.46 ? 66  LEU B HD21 1 
ATOM   2441 H  HD22 . LEU B 1 47 ? 3.189   28.180  -9.521  1.00 18.46 ? 66  LEU B HD22 1 
ATOM   2442 H  HD23 . LEU B 1 47 ? 4.563   28.760  -10.070 1.00 18.46 ? 66  LEU B HD23 1 
ATOM   2443 N  N    . TYR B 1 48 ? 7.565   28.042  -6.004  1.00 11.72 ? 67  TYR B N    1 
ATOM   2444 C  CA   . TYR B 1 48 ? 7.922   28.188  -4.596  1.00 10.36 ? 67  TYR B CA   1 
ATOM   2445 C  C    . TYR B 1 48 ? 8.262   29.653  -4.291  1.00 10.53 ? 67  TYR B C    1 
ATOM   2446 O  O    . TYR B 1 48 ? 8.462   30.499  -5.184  1.00 10.85 ? 67  TYR B O    1 
ATOM   2447 C  CB   . TYR B 1 48 ? 9.112   27.292  -4.267  1.00 10.95 ? 67  TYR B CB   1 
ATOM   2448 C  CG   . TYR B 1 48 ? 10.354  27.537  -5.125  1.00 12.85 ? 67  TYR B CG   1 
ATOM   2449 C  CD1  . TYR B 1 48 ? 11.278  28.523  -4.815  1.00 13.06 ? 67  TYR B CD1  1 
ATOM   2450 C  CD2  . TYR B 1 48 ? 10.582  26.793  -6.273  1.00 15.53 ? 67  TYR B CD2  1 
ATOM   2451 C  CE1  . TYR B 1 48 ? 12.378  28.736  -5.611  1.00 13.26 ? 67  TYR B CE1  1 
ATOM   2452 C  CE2  . TYR B 1 48 ? 11.698  27.010  -7.063  1.00 15.83 ? 67  TYR B CE2  1 
ATOM   2453 C  CZ   . TYR B 1 48 ? 12.608  27.968  -6.717  1.00 15.73 ? 67  TYR B CZ   1 
ATOM   2454 O  OH   . TYR B 1 48 ? 13.732  28.186  -7.495  1.00 17.79 ? 67  TYR B OH   1 
ATOM   2455 H  H    . TYR B 1 48 ? 8.200   27.742  -6.499  1.00 14.06 ? 67  TYR B H    1 
ATOM   2456 H  HA   . TYR B 1 48 ? 7.172   27.922  -4.041  1.00 12.43 ? 67  TYR B HA   1 
ATOM   2457 H  HB2  . TYR B 1 48 ? 9.362   27.436  -3.341  1.00 13.14 ? 67  TYR B HB2  1 
ATOM   2458 H  HB3  . TYR B 1 48 ? 8.847   26.367  -4.393  1.00 13.14 ? 67  TYR B HB3  1 
ATOM   2459 H  HD1  . TYR B 1 48 ? 11.153  29.046  -4.056  1.00 15.67 ? 67  TYR B HD1  1 
ATOM   2460 H  HD2  . TYR B 1 48 ? 9.980   26.125  -6.509  1.00 18.63 ? 67  TYR B HD2  1 
ATOM   2461 H  HE1  . TYR B 1 48 ? 12.996  29.389  -5.371  1.00 15.91 ? 67  TYR B HE1  1 
ATOM   2462 H  HE2  . TYR B 1 48 ? 11.840  26.485  -7.818  1.00 19.00 ? 67  TYR B HE2  1 
ATOM   2463 H  HH   . TYR B 1 48 ? 13.746  27.645  -8.138  1.00 21.35 ? 67  TYR B HH   1 
ATOM   2464 N  N    . ASP B 1 49 ? 8.269   29.963  -2.998  1.00 10.39 ? 68  ASP B N    1 
ATOM   2465 C  CA   . ASP B 1 49 ? 8.740   31.266  -2.506  1.00 9.70  ? 68  ASP B CA   1 
ATOM   2466 C  C    . ASP B 1 49 ? 10.263  31.244  -2.523  1.00 10.17 ? 68  ASP B C    1 
ATOM   2467 O  O    . ASP B 1 49 ? 10.889  30.399  -1.885  1.00 10.18 ? 68  ASP B O    1 
ATOM   2468 C  CB   . ASP B 1 49 ? 8.196   31.504  -1.079  1.00 9.70  ? 68  ASP B CB   1 
ATOM   2469 C  CG   . ASP B 1 49 ? 8.648   32.833  -0.454  1.00 10.68 ? 68  ASP B CG   1 
ATOM   2470 O  OD1  . ASP B 1 49 ? 9.529   33.524  -0.999  1.00 11.01 ? 68  ASP B OD1  1 
ATOM   2471 O  OD2  . ASP B 1 49 ? 8.078   33.173  0.597   1.00 12.02 ? 68  ASP B OD2  1 
ATOM   2472 H  H    . ASP B 1 49 ? 8.004   29.433  -2.375  1.00 12.46 ? 68  ASP B H    1 
ATOM   2473 H  HA   . ASP B 1 49 ? 8.426   31.976  -3.088  1.00 11.64 ? 68  ASP B HA   1 
ATOM   2474 H  HB2  . ASP B 1 49 ? 7.227   31.505  -1.110  1.00 11.64 ? 68  ASP B HB2  1 
ATOM   2475 H  HB3  . ASP B 1 49 ? 8.505   30.786  -0.504  1.00 11.64 ? 68  ASP B HB3  1 
ATOM   2476 N  N    . GLU B 1 50 ? 10.874  32.164  -3.273  1.00 10.66 ? 69  GLU B N    1 
ATOM   2477 C  CA   . GLU B 1 50 ? 12.312  32.246  -3.379  1.00 12.34 ? 69  GLU B CA   1 
ATOM   2478 C  C    . GLU B 1 50 ? 13.006  32.355  -2.034  1.00 11.25 ? 69  GLU B C    1 
ATOM   2479 O  O    . GLU B 1 50 ? 14.130  31.875  -1.860  1.00 12.65 ? 69  GLU B O    1 
ATOM   2480 C  CB   . GLU B 1 50 ? 12.681  33.454  -4.259  1.00 15.99 ? 69  GLU B CB   1 
ATOM   2481 C  CG   . GLU B 1 50 ? 14.147  33.760  -4.333  1.00 18.22 ? 69  GLU B CG   1 
ATOM   2482 C  CD   . GLU B 1 50 ? 14.956  32.680  -4.993  1.00 21.62 ? 69  GLU B CD   1 
ATOM   2483 O  OE1  . GLU B 1 50 ? 14.386  31.886  -5.766  1.00 22.84 ? 69  GLU B OE1  1 
ATOM   2484 O  OE2  . GLU B 1 50 ? 16.180  32.634  -4.731  1.00 25.41 ? 69  GLU B OE2  1 
ATOM   2485 H  H    . GLU B 1 50 ? 10.459  32.759  -3.735  1.00 12.80 ? 69  GLU B H    1 
ATOM   2486 H  HA   . GLU B 1 50 ? 12.640  31.446  -3.818  1.00 14.80 ? 69  GLU B HA   1 
ATOM   2487 H  HB2  . GLU B 1 50 ? 12.372  33.283  -5.163  1.00 19.19 ? 69  GLU B HB2  1 
ATOM   2488 H  HB3  . GLU B 1 50 ? 12.235  34.240  -3.907  1.00 19.19 ? 69  GLU B HB3  1 
ATOM   2489 H  HG2  . GLU B 1 50 ? 14.271  34.576  -4.841  1.00 21.87 ? 69  GLU B HG2  1 
ATOM   2490 H  HG3  . GLU B 1 50 ? 14.487  33.878  -3.432  1.00 21.87 ? 69  GLU B HG3  1 
ATOM   2491 N  N    A LYS B 1 51 ? 12.320  33.000  -1.104  0.43 10.15 ? 70  LYS B N    1 
ATOM   2492 N  N    B LYS B 1 51 ? 12.356  33.001  -1.077  0.57 10.20 ? 70  LYS B N    1 
ATOM   2493 C  CA   A LYS B 1 51 ? 12.832  33.209  0.233   0.43 9.76  ? 70  LYS B CA   1 
ATOM   2494 C  CA   B LYS B 1 51 ? 12.909  33.138  0.266   0.57 10.29 ? 70  LYS B CA   1 
ATOM   2495 C  C    A LYS B 1 51 ? 12.426  32.108  1.207   0.43 8.76  ? 70  LYS B C    1 
ATOM   2496 C  C    B LYS B 1 51 ? 12.259  32.197  1.284   0.57 9.33  ? 70  LYS B C    1 
ATOM   2497 O  O    A LYS B 1 51 ? 12.950  32.069  2.329   0.43 7.91  ? 70  LYS B O    1 
ATOM   2498 O  O    B LYS B 1 51 ? 12.421  32.349  2.506   0.57 9.66  ? 70  LYS B O    1 
ATOM   2499 C  CB   A LYS B 1 51 ? 12.357  34.569  0.775   0.43 10.35 ? 70  LYS B CB   1 
ATOM   2500 C  CB   B LYS B 1 51 ? 12.792  34.596  0.740   0.57 11.82 ? 70  LYS B CB   1 
ATOM   2501 C  CG   A LYS B 1 51 ? 12.800  35.756  -0.072  0.43 12.48 ? 70  LYS B CG   1 
ATOM   2502 C  CG   B LYS B 1 51 ? 13.654  35.546  -0.088  0.57 13.71 ? 70  LYS B CG   1 
ATOM   2503 C  CD   A LYS B 1 51 ? 14.325  35.880  -0.129  0.43 14.80 ? 70  LYS B CD   1 
ATOM   2504 C  CD   B LYS B 1 51 ? 13.477  36.998  0.313   0.57 15.33 ? 70  LYS B CD   1 
ATOM   2505 C  CE   A LYS B 1 51 ? 14.774  37.109  -0.905  0.43 17.00 ? 70  LYS B CE   1 
ATOM   2506 C  CE   B LYS B 1 51 ? 14.506  37.906  -0.351  0.57 16.63 ? 70  LYS B CE   1 
ATOM   2507 N  NZ   A LYS B 1 51 ? 16.131  36.928  -1.429  0.43 20.04 ? 70  LYS B NZ   1 
ATOM   2508 N  NZ   B LYS B 1 51 ? 14.166  39.309  -0.082  0.57 19.73 ? 70  LYS B NZ   1 
ATOM   2509 H  H    A LYS B 1 51 ? 11.537  33.332  -1.230  0.43 12.18 ? 70  LYS B H    1 
ATOM   2510 H  H    B LYS B 1 51 ? 11.588  33.373  -1.179  0.57 12.24 ? 70  LYS B H    1 
ATOM   2511 H  HA   A LYS B 1 51 ? 13.801  33.227  0.196   0.43 11.71 ? 70  LYS B HA   1 
ATOM   2512 H  HA   B LYS B 1 51 ? 13.853  32.918  0.232   0.57 12.35 ? 70  LYS B HA   1 
ATOM   2513 H  HB2  A LYS B 1 51 ? 11.387  34.572  0.806   0.43 12.42 ? 70  LYS B HB2  1 
ATOM   2514 H  HB2  B LYS B 1 51 ? 11.869  34.882  0.663   0.57 14.19 ? 70  LYS B HB2  1 
ATOM   2515 H  HB3  A LYS B 1 51 ? 12.715  34.692  1.668   0.43 12.42 ? 70  LYS B HB3  1 
ATOM   2516 H  HB3  B LYS B 1 51 ? 13.083  34.653  1.664   0.57 14.19 ? 70  LYS B HB3  1 
ATOM   2517 H  HG2  A LYS B 1 51 ? 12.472  35.642  -0.978  0.43 14.98 ? 70  LYS B HG2  1 
ATOM   2518 H  HG2  B LYS B 1 51 ? 14.587  35.313  0.033   0.57 16.45 ? 70  LYS B HG2  1 
ATOM   2519 H  HG3  A LYS B 1 51 ? 12.445  36.573  0.312   0.43 14.98 ? 70  LYS B HG3  1 
ATOM   2520 H  HG3  B LYS B 1 51 ? 13.409  35.461  -1.023  0.57 16.45 ? 70  LYS B HG3  1 
ATOM   2521 H  HD2  A LYS B 1 51 ? 14.672  35.950  0.775   0.43 17.76 ? 70  LYS B HD2  1 
ATOM   2522 H  HD2  B LYS B 1 51 ? 12.594  37.296  0.046   0.57 18.39 ? 70  LYS B HD2  1 
ATOM   2523 H  HD3  A LYS B 1 51 ? 14.691  35.095  -0.567  0.43 17.76 ? 70  LYS B HD3  1 
ATOM   2524 H  HD3  B LYS B 1 51 ? 13.580  37.077  1.274   0.57 18.39 ? 70  LYS B HD3  1 
ATOM   2525 H  HE2  A LYS B 1 51 ? 14.174  37.255  -1.653  0.43 20.40 ? 70  LYS B HE2  1 
ATOM   2526 H  HE2  B LYS B 1 51 ? 15.386  37.724  0.014   0.57 19.96 ? 70  LYS B HE2  1 
ATOM   2527 H  HE3  A LYS B 1 51 ? 14.774  37.880  -0.316  0.43 20.40 ? 70  LYS B HE3  1 
ATOM   2528 H  HE3  B LYS B 1 51 ? 14.497  37.763  -1.310  0.57 19.96 ? 70  LYS B HE3  1 
ATOM   2529 H  HZ1  A LYS B 1 51 ? 16.155  36.225  -1.974  0.43 24.05 ? 70  LYS B HZ1  1 
ATOM   2530 H  HZ1  B LYS B 1 51 ? 14.166  39.459  0.795   0.57 23.67 ? 70  LYS B HZ1  1 
ATOM   2531 H  HZ2  A LYS B 1 51 ? 16.382  37.653  -1.880  0.43 24.05 ? 70  LYS B HZ2  1 
ATOM   2532 H  HZ2  B LYS B 1 51 ? 14.763  39.845  -0.467  0.57 23.67 ? 70  LYS B HZ2  1 
ATOM   2533 H  HZ3  A LYS B 1 51 ? 16.700  36.794  -0.758  0.43 24.05 ? 70  LYS B HZ3  1 
ATOM   2534 H  HZ3  B LYS B 1 51 ? 13.359  39.494  -0.408  0.57 23.67 ? 70  LYS B HZ3  1 
ATOM   2535 N  N    . GLN B 1 52 ? 11.521  31.216  0.795   1.00 8.41  ? 71  GLN B N    1 
ATOM   2536 C  CA   . GLN B 1 52 ? 11.065  30.161  1.670   1.00 8.59  ? 71  GLN B CA   1 
ATOM   2537 C  C    . GLN B 1 52 ? 10.723  28.972  0.776   1.00 7.56  ? 71  GLN B C    1 
ATOM   2538 O  O    . GLN B 1 52 ? 9.570   28.687  0.479   1.00 8.07  ? 71  GLN B O    1 
ATOM   2539 C  CB   . GLN B 1 52 ? 9.871   30.585  2.567   1.00 9.44  ? 71  GLN B CB   1 
ATOM   2540 C  CG   . GLN B 1 52 ? 9.690   29.557  3.693   1.00 9.75  ? 71  GLN B CG   1 
ATOM   2541 C  CD   . GLN B 1 52 ? 8.719   29.923  4.788   1.00 9.29  ? 71  GLN B CD   1 
ATOM   2542 O  OE1  . GLN B 1 52 ? 8.857   29.429  5.911   1.00 9.98  ? 71  GLN B OE1  1 
ATOM   2543 N  NE2  . GLN B 1 52 ? 7.744   30.776  4.504   1.00 10.19 ? 71  GLN B NE2  1 
ATOM   2544 H  H    . GLN B 1 52 ? 11.219  31.176  -0.008  0.59 10.09 ? 71  GLN B H    1 
ATOM   2545 H  HA   . GLN B 1 52 ? 11.795  29.897  2.251   1.00 10.31 ? 71  GLN B HA   1 
ATOM   2546 H  HB2  . GLN B 1 52 ? 10.052  31.451  2.963   1.00 11.33 ? 71  GLN B HB2  1 
ATOM   2547 H  HB3  . GLN B 1 52 ? 9.059   30.613  2.038   1.00 11.33 ? 71  GLN B HB3  1 
ATOM   2548 H  HG2  . GLN B 1 52 ? 9.379   28.727  3.299   1.00 11.70 ? 71  GLN B HG2  1 
ATOM   2549 H  HG3  . GLN B 1 52 ? 10.553  29.409  4.111   1.00 11.70 ? 71  GLN B HG3  1 
ATOM   2550 H  HE21 . GLN B 1 52 ? 7.178   31.001  5.111   1.00 12.23 ? 71  GLN B HE21 1 
ATOM   2551 H  HE22 . GLN B 1 52 ? 7.678   31.105  3.711   1.00 12.23 ? 71  GLN B HE22 1 
ATOM   2552 N  N    . GLN B 1 53 ? 11.753  28.302  0.319   1.00 9.23  ? 72  GLN B N    1 
ATOM   2553 C  CA   . GLN B 1 53 ? 11.639  27.417  -0.833  1.00 8.81  ? 72  GLN B CA   1 
ATOM   2554 C  C    . GLN B 1 53 ? 10.904  26.111  -0.573  1.00 9.00  ? 72  GLN B C    1 
ATOM   2555 O  O    . GLN B 1 53 ? 10.538  25.408  -1.510  1.00 10.37 ? 72  GLN B O    1 
ATOM   2556 C  CB   . GLN B 1 53 ? 13.018  27.168  -1.450  1.00 11.49 ? 72  GLN B CB   1 
ATOM   2557 C  CG   . GLN B 1 53 ? 13.620  28.472  -1.999  1.00 13.75 ? 72  GLN B CG   1 
ATOM   2558 C  CD   . GLN B 1 53 ? 14.860  28.340  -2.843  1.00 18.87 ? 72  GLN B CD   1 
ATOM   2559 O  OE1  . GLN B 1 53 ? 15.352  27.236  -3.124  1.00 22.39 ? 72  GLN B OE1  1 
ATOM   2560 N  NE2  . GLN B 1 53 ? 15.396  29.497  -3.250  1.00 19.69 ? 72  GLN B NE2  1 
ATOM   2561 H  H    . GLN B 1 53 ? 12.543  28.336  0.658   1.00 11.08 ? 72  GLN B H    1 
ATOM   2562 H  HA   . GLN B 1 53 ? 11.121  27.888  -1.505  1.00 10.58 ? 72  GLN B HA   1 
ATOM   2563 H  HB2  . GLN B 1 53 ? 13.615  26.818  -0.771  1.00 13.79 ? 72  GLN B HB2  1 
ATOM   2564 H  HB3  . GLN B 1 53 ? 12.933  26.538  -2.183  1.00 13.79 ? 72  GLN B HB3  1 
ATOM   2565 H  HG2  . GLN B 1 53 ? 12.947  28.910  -2.544  1.00 16.50 ? 72  GLN B HG2  1 
ATOM   2566 H  HG3  . GLN B 1 53 ? 13.844  29.042  -1.247  1.00 16.50 ? 72  GLN B HG3  1 
ATOM   2567 H  HE21 . GLN B 1 53 ? 16.106  29.494  -3.736  1.00 23.63 ? 72  GLN B HE21 1 
ATOM   2568 H  HE22 . GLN B 1 53 ? 15.031  30.243  -3.027  1.00 23.63 ? 72  GLN B HE22 1 
ATOM   2569 N  N    . HIS B 1 54 ? 10.617  25.859  0.706   1.00 9.13  ? 73  HIS B N    1 
ATOM   2570 C  CA   . HIS B 1 54 ? 9.795   24.722  1.093   1.00 8.12  ? 73  HIS B CA   1 
ATOM   2571 C  C    . HIS B 1 54 ? 8.298   25.011  1.086   1.00 8.18  ? 73  HIS B C    1 
ATOM   2572 O  O    . HIS B 1 54 ? 7.501   24.118  1.376   1.00 9.46  ? 73  HIS B O    1 
ATOM   2573 C  CB   . HIS B 1 54 ? 10.277  24.154  2.452   1.00 9.54  ? 73  HIS B CB   1 
ATOM   2574 C  CG   . HIS B 1 54 ? 10.550  25.196  3.486   1.00 9.33  ? 73  HIS B CG   1 
ATOM   2575 N  ND1  . HIS B 1 54 ? 9.570   25.677  4.336   1.00 10.17 ? 73  HIS B ND1  1 
ATOM   2576 C  CD2  . HIS B 1 54 ? 11.699  25.817  3.832   1.00 9.63  ? 73  HIS B CD2  1 
ATOM   2577 C  CE1  . HIS B 1 54 ? 10.112  26.560  5.159   1.00 9.45  ? 73  HIS B CE1  1 
ATOM   2578 N  NE2  . HIS B 1 54 ? 11.401  26.660  4.872   1.00 10.43 ? 73  HIS B NE2  1 
ATOM   2579 H  H    . HIS B 1 54 ? 10.890  26.336  1.368   1.00 10.95 ? 73  HIS B H    1 
ATOM   2580 H  HA   . HIS B 1 54 ? 9.941   24.023  0.437   1.00 9.74  ? 73  HIS B HA   1 
ATOM   2581 H  HB2  . HIS B 1 54 ? 9.593   23.562  2.802   1.00 11.44 ? 73  HIS B HB2  1 
ATOM   2582 H  HB3  . HIS B 1 54 ? 11.098  23.658  2.309   1.00 11.44 ? 73  HIS B HB3  1 
ATOM   2583 H  HD2  . HIS B 1 54 ? 12.534  25.694  3.441   1.00 11.56 ? 73  HIS B HD2  1 
ATOM   2584 H  HE1  . HIS B 1 54 ? 9.663   27.034  5.821   1.00 11.34 ? 73  HIS B HE1  1 
ATOM   2585 H  HE2  . HIS B 1 54 ? 11.961  27.180  5.269   1.00 12.52 ? 73  HIS B HE2  1 
ATOM   2586 N  N    . ILE B 1 55 ? 7.916   26.228  0.701   1.00 7.76  ? 74  ILE B N    1 
ATOM   2587 C  CA   . ILE B 1 55 ? 6.513   26.612  0.529   1.00 8.07  ? 74  ILE B CA   1 
ATOM   2588 C  C    . ILE B 1 55 ? 6.205   26.800  -0.956  1.00 8.35  ? 74  ILE B C    1 
ATOM   2589 O  O    . ILE B 1 55 ? 6.937   27.492  -1.666  1.00 9.37  ? 74  ILE B O    1 
ATOM   2590 C  CB   . ILE B 1 55 ? 6.201   27.926  1.308   1.00 8.26  ? 74  ILE B CB   1 
ATOM   2591 C  CG1  . ILE B 1 55 ? 6.435   27.738  2.808   1.00 8.79  ? 74  ILE B CG1  1 
ATOM   2592 C  CG2  . ILE B 1 55 ? 4.831   28.425  1.017   1.00 11.78 ? 74  ILE B CG2  1 
ATOM   2593 C  CD1  . ILE B 1 55 ? 5.640   26.618  3.423   1.00 10.92 ? 74  ILE B CD1  1 
ATOM   2594 H  H    . ILE B 1 55 ? 8.466   26.866  0.529   1.00 9.31  ? 74  ILE B H    1 
ATOM   2595 H  HA   . ILE B 1 55 ? 5.941   25.908  0.874   1.00 9.69  ? 74  ILE B HA   1 
ATOM   2596 H  HB   . ILE B 1 55 ? 6.826   28.601  0.999   1.00 9.91  ? 74  ILE B HB   1 
ATOM   2597 H  HG12 . ILE B 1 55 ? 7.375   27.548  2.954   1.00 10.54 ? 74  ILE B HG12 1 
ATOM   2598 H  HG13 . ILE B 1 55 ? 6.192   28.558  3.266   1.00 10.54 ? 74  ILE B HG13 1 
ATOM   2599 H  HG21 . ILE B 1 55 ? 4.755   28.602  0.066   1.00 14.14 ? 74  ILE B HG21 1 
ATOM   2600 H  HG22 . ILE B 1 55 ? 4.187   27.749  1.280   1.00 14.14 ? 74  ILE B HG22 1 
ATOM   2601 H  HG23 . ILE B 1 55 ? 4.679   29.240  1.520   1.00 14.14 ? 74  ILE B HG23 1 
ATOM   2602 H  HD11 . ILE B 1 55 ? 4.695   26.796  3.299   1.00 13.11 ? 74  ILE B HD11 1 
ATOM   2603 H  HD12 . ILE B 1 55 ? 5.880   25.785  2.987   1.00 13.11 ? 74  ILE B HD12 1 
ATOM   2604 H  HD13 . ILE B 1 55 ? 5.847   26.568  4.370   1.00 13.11 ? 74  ILE B HD13 1 
ATOM   2605 N  N    . VAL B 1 56 ? 5.128   26.164  -1.403  1.00 9.12  ? 75  VAL B N    1 
ATOM   2606 C  CA   . VAL B 1 56 ? 4.690   26.240  -2.792  1.00 9.20  ? 75  VAL B CA   1 
ATOM   2607 C  C    . VAL B 1 56 ? 3.377   26.986  -2.902  1.00 9.27  ? 75  VAL B C    1 
ATOM   2608 O  O    . VAL B 1 56 ? 2.476   26.712  -2.125  1.00 10.25 ? 75  VAL B O    1 
ATOM   2609 C  CB   . VAL B 1 56 ? 4.483   24.794  -3.339  1.00 10.08 ? 75  VAL B CB   1 
ATOM   2610 C  CG1  . VAL B 1 56 ? 3.971   24.796  -4.781  1.00 10.99 ? 75  VAL B CG1  1 
ATOM   2611 C  CG2  . VAL B 1 56 ? 5.789   24.019  -3.212  1.00 11.11 ? 75  VAL B CG2  1 
ATOM   2612 H  H    . VAL B 1 56 ? 4.624   25.672  -0.910  1.00 10.95 ? 75  VAL B H    1 
ATOM   2613 H  HA   . VAL B 1 56 ? 5.359   26.692  -3.329  1.00 11.04 ? 75  VAL B HA   1 
ATOM   2614 H  HB   . VAL B 1 56 ? 3.820   24.346  -2.791  1.00 12.09 ? 75  VAL B HB   1 
ATOM   2615 H  HG11 . VAL B 1 56 ? 3.859   23.879  -5.077  1.00 13.18 ? 75  VAL B HG11 1 
ATOM   2616 H  HG12 . VAL B 1 56 ? 3.121   25.261  -4.813  1.00 13.18 ? 75  VAL B HG12 1 
ATOM   2617 H  HG13 . VAL B 1 56 ? 4.618   25.248  -5.345  1.00 13.18 ? 75  VAL B HG13 1 
ATOM   2618 H  HG21 . VAL B 1 56 ? 5.657   23.121  -3.553  1.00 13.33 ? 75  VAL B HG21 1 
ATOM   2619 H  HG22 . VAL B 1 56 ? 6.475   24.472  -3.726  1.00 13.33 ? 75  VAL B HG22 1 
ATOM   2620 H  HG23 . VAL B 1 56 ? 6.045   23.985  -2.277  1.00 13.33 ? 75  VAL B HG23 1 
ATOM   2621 N  N    . TYR B 1 57 ? 3.294   27.974  -3.811  1.00 10.05 ? 76  TYR B N    1 
ATOM   2622 C  CA   . TYR B 1 57 ? 2.023   28.625  -4.136  1.00 10.40 ? 76  TYR B CA   1 
ATOM   2623 C  C    . TYR B 1 57 ? 1.698   28.247  -5.582  1.00 10.52 ? 76  TYR B C    1 
ATOM   2624 O  O    . TYR B 1 57 ? 2.433   28.577  -6.513  1.00 12.24 ? 76  TYR B O    1 
ATOM   2625 C  CB   . TYR B 1 57 ? 2.039   30.153  -3.911  1.00 11.87 ? 76  TYR B CB   1 
ATOM   2626 C  CG   . TYR B 1 57 ? 0.664   30.776  -4.061  1.00 13.17 ? 76  TYR B CG   1 
ATOM   2627 C  CD1  . TYR B 1 57 ? -0.184  30.896  -2.961  1.00 13.74 ? 76  TYR B CD1  1 
ATOM   2628 C  CD2  . TYR B 1 57 ? 0.190   31.172  -5.301  1.00 14.66 ? 76  TYR B CD2  1 
ATOM   2629 C  CE1  . TYR B 1 57 ? -1.443  31.410  -3.077  1.00 15.32 ? 76  TYR B CE1  1 
ATOM   2630 C  CE2  . TYR B 1 57 ? -1.098  31.700  -5.437  1.00 15.61 ? 76  TYR B CE2  1 
ATOM   2631 C  CZ   . TYR B 1 57 ? -1.911  31.806  -4.307  1.00 14.67 ? 76  TYR B CZ   1 
ATOM   2632 O  OH   . TYR B 1 57 ? -3.181  32.349  -4.417  1.00 14.87 ? 76  TYR B OH   1 
ATOM   2633 H  H    . TYR B 1 57 ? 3.965   28.282  -4.252  1.00 12.06 ? 76  TYR B H    1 
ATOM   2634 H  HA   . TYR B 1 57 ? 1.329   28.252  -3.570  1.00 12.48 ? 76  TYR B HA   1 
ATOM   2635 H  HB2  . TYR B 1 57 ? 2.356   30.338  -3.013  1.00 14.25 ? 76  TYR B HB2  1 
ATOM   2636 H  HB3  . TYR B 1 57 ? 2.628   30.563  -4.563  1.00 14.25 ? 76  TYR B HB3  1 
ATOM   2637 H  HD1  . TYR B 1 57 ? 0.117   30.619  -2.126  1.00 16.49 ? 76  TYR B HD1  1 
ATOM   2638 H  HD2  . TYR B 1 57 ? 0.734   31.086  -6.050  1.00 17.59 ? 76  TYR B HD2  1 
ATOM   2639 H  HE1  . TYR B 1 57 ? -1.985  31.490  -2.325  1.00 18.39 ? 76  TYR B HE1  1 
ATOM   2640 H  HE2  . TYR B 1 57 ? -1.409  31.976  -6.269  1.00 18.73 ? 76  TYR B HE2  1 
ATOM   2641 H  HH   . TYR B 1 57 ? -3.340  32.547  -5.217  1.00 17.84 ? 76  TYR B HH   1 
ATOM   2642 N  N    . CYS B 1 58 ? 0.597   27.518  -5.727  1.00 12.20 ? 77  CYS B N    1 
ATOM   2643 C  CA   . CYS B 1 58 ? 0.202   26.934  -7.023  1.00 12.88 ? 77  CYS B CA   1 
ATOM   2644 C  C    . CYS B 1 58 ? -1.197  27.323  -7.486  1.00 12.28 ? 77  CYS B C    1 
ATOM   2645 O  O    . CYS B 1 58 ? -1.659  26.785  -8.461  1.00 11.42 ? 77  CYS B O    1 
ATOM   2646 C  CB   . CYS B 1 58 ? 0.324   25.401  -6.942  1.00 13.39 ? 77  CYS B CB   1 
ATOM   2647 S  SG   . CYS B 1 58 ? -0.513  24.672  -5.472  1.00 12.76 ? 77  CYS B SG   1 
ATOM   2648 H  H    . CYS B 1 58 ? 0.051   27.340  -5.087  1.00 14.64 ? 77  CYS B H    1 
ATOM   2649 H  HA   . CYS B 1 58 ? 0.826   27.240  -7.699  1.00 15.46 ? 77  CYS B HA   1 
ATOM   2650 H  HB2  . CYS B 1 58 ? -0.077  25.013  -7.735  1.00 16.07 ? 77  CYS B HB2  1 
ATOM   2651 H  HB3  . CYS B 1 58 ? 1.263   25.164  -6.897  1.00 16.07 ? 77  CYS B HB3  1 
ATOM   2652 H  HG   . CYS B 1 58 ? -0.023  25.129  -4.477  1.00 15.31 ? 77  CYS B HG   1 
ATOM   2653 N  N    . SER B 1 59 ? -1.860  28.269  -6.827  1.00 13.20 ? 78  SER B N    1 
ATOM   2654 C  CA   . SER B 1 59 ? -3.256  28.567  -7.152  1.00 14.17 ? 78  SER B CA   1 
ATOM   2655 C  C    . SER B 1 59 ? -3.425  28.966  -8.595  1.00 17.81 ? 78  SER B C    1 
ATOM   2656 O  O    . SER B 1 59 ? -4.370  28.528  -9.273  1.00 18.74 ? 78  SER B O    1 
ATOM   2657 C  CB   . SER B 1 59 ? -3.842  29.649  -6.248  1.00 15.25 ? 78  SER B CB   1 
ATOM   2658 O  OG   . SER B 1 59 ? -5.247  29.687  -6.447  1.00 18.82 ? 78  SER B OG   1 
ATOM   2659 H  H    . SER B 1 59 ? -1.531  28.749  -6.194  1.00 15.85 ? 78  SER B H    1 
ATOM   2660 H  HA   . SER B 1 59 ? -3.778  27.761  -7.012  1.00 17.00 ? 78  SER B HA   1 
ATOM   2661 H  HB2  . SER B 1 59 ? -3.652  29.434  -5.321  1.00 18.30 ? 78  SER B HB2  1 
ATOM   2662 H  HB3  . SER B 1 59 ? -3.458  30.508  -6.483  1.00 18.30 ? 78  SER B HB3  1 
ATOM   2663 H  HG   . SER B 1 59 ? -5.418  29.865  -7.250  1.00 22.58 ? 78  SER B HG   1 
ATOM   2664 N  N    . ASN B 1 60 ? -2.543  29.776  -9.123  1.00 17.70 ? 79  ASN B N    1 
ATOM   2665 C  CA   . ASN B 1 60 ? -2.805  30.067  -10.508 1.00 24.77 ? 79  ASN B CA   1 
ATOM   2666 C  C    . ASN B 1 60 ? -2.244  29.209  -11.605 1.00 23.27 ? 79  ASN B C    1 
ATOM   2667 O  O    . ASN B 1 60 ? -1.980  29.666  -12.714 1.00 27.01 ? 79  ASN B O    1 
ATOM   2668 C  CB   . ASN B 1 60 ? -3.759  31.224  -10.846 1.00 31.09 ? 79  ASN B CB   1 
ATOM   2669 C  CG   . ASN B 1 60 ? -5.240  30.787  -10.866 1.00 35.35 ? 79  ASN B CG   1 
ATOM   2670 O  OD1  . ASN B 1 60 ? -5.633  29.964  -11.694 1.00 38.03 ? 79  ASN B OD1  1 
ATOM   2671 N  ND2  . ASN B 1 60 ? -6.064  31.365  -9.974  1.00 36.20 ? 79  ASN B ND2  1 
ATOM   2672 H  H    . ASN B 1 60 ? -1.855  30.136  -8.753  1.00 21.24 ? 79  ASN B H    1 
ATOM   2673 H  HA   . ASN B 1 60 ? -2.038  30.658  -10.563 1.00 29.73 ? 79  ASN B HA   1 
ATOM   2674 H  HB2  . ASN B 1 60 ? -3.660  31.920  -10.178 1.00 37.30 ? 79  ASN B HB2  1 
ATOM   2675 H  HB3  . ASN B 1 60 ? -3.537  31.571  -11.724 1.00 37.30 ? 79  ASN B HB3  1 
ATOM   2676 H  HD21 . ASN B 1 60 ? -5.759  31.951  -9.424  1.00 43.44 ? 79  ASN B HD21 1 
ATOM   2677 H  HD22 . ASN B 1 60 ? -6.896  31.148  -9.954  1.00 43.44 ? 79  ASN B HD22 1 
ATOM   2678 N  N    . ASP B 1 61 ? -2.083  27.931  -11.261 1.00 17.88 ? 80  ASP B N    1 
ATOM   2679 C  CA   . ASP B 1 61 ? -1.346  27.004  -12.089 1.00 13.19 ? 80  ASP B CA   1 
ATOM   2680 C  C    . ASP B 1 61 ? -2.117  25.710  -12.268 1.00 11.71 ? 80  ASP B C    1 
ATOM   2681 O  O    . ASP B 1 61 ? -2.915  25.358  -11.426 1.00 12.66 ? 80  ASP B O    1 
ATOM   2682 C  CB   . ASP B 1 61 ? -0.015  26.707  -11.406 1.00 12.72 ? 80  ASP B CB   1 
ATOM   2683 C  CG   . ASP B 1 61 ? 0.985   26.045  -12.318 1.00 12.56 ? 80  ASP B CG   1 
ATOM   2684 O  OD1  . ASP B 1 61 ? 1.705   26.760  -13.041 1.00 15.24 ? 80  ASP B OD1  1 
ATOM   2685 O  OD2  . ASP B 1 61 ? 1.036   24.806  -12.341 1.00 12.71 ? 80  ASP B OD2  1 
ATOM   2686 H  H    A ASP B 1 61 ? -2.399  27.580  -10.542 0.42 21.46 ? 80  ASP B H    1 
ATOM   2687 H  H    B ASP B 1 61 ? -2.399  27.580  -10.542 0.58 21.46 ? 80  ASP B H    1 
ATOM   2688 H  HA   . ASP B 1 61 ? -1.176  27.396  -12.960 1.00 15.83 ? 80  ASP B HA   1 
ATOM   2689 H  HB2  . ASP B 1 61 ? 0.372   27.541  -11.095 1.00 15.27 ? 80  ASP B HB2  1 
ATOM   2690 H  HB3  . ASP B 1 61 ? -0.172  26.114  -10.655 1.00 15.27 ? 80  ASP B HB3  1 
ATOM   2691 N  N    . LEU B 1 62 ? -1.806  24.976  -13.332 1.00 11.46 ? 81  LEU B N    1 
ATOM   2692 C  CA   . LEU B 1 62 ? -2.311  23.636  -13.514 1.00 13.01 ? 81  LEU B CA   1 
ATOM   2693 C  C    . LEU B 1 62 ? -2.152  22.816  -12.237 1.00 11.92 ? 81  LEU B C    1 
ATOM   2694 O  O    . LEU B 1 62 ? -3.032  22.038  -11.889 1.00 13.03 ? 81  LEU B O    1 
ATOM   2695 C  CB   . LEU B 1 62 ? -1.601  22.952  -14.677 1.00 15.19 ? 81  LEU B CB   1 
ATOM   2696 C  CG   . LEU B 1 62 ? -1.884  21.481  -14.962 1.00 18.76 ? 81  LEU B CG   1 
ATOM   2697 C  CD1  . LEU B 1 62 ? -3.353  21.250  -15.220 1.00 21.47 ? 81  LEU B CD1  1 
ATOM   2698 C  CD2  . LEU B 1 62 ? -1.021  21.004  -16.146 1.00 19.90 ? 81  LEU B CD2  1 
ATOM   2699 H  H    . LEU B 1 62 ? -1.295  25.243  -13.970 1.00 13.75 ? 81  LEU B H    1 
ATOM   2700 H  HA   . LEU B 1 62 ? -3.256  23.681  -13.725 1.00 15.61 ? 81  LEU B HA   1 
ATOM   2701 H  HB2  . LEU B 1 62 ? -1.825  23.439  -15.485 1.00 18.23 ? 81  LEU B HB2  1 
ATOM   2702 H  HB3  . LEU B 1 62 ? -0.646  23.025  -14.522 1.00 18.23 ? 81  LEU B HB3  1 
ATOM   2703 H  HG   . LEU B 1 62 ? -1.635  20.959  -14.184 1.00 22.51 ? 81  LEU B HG   1 
ATOM   2704 H  HD11 . LEU B 1 62 ? -3.857  21.521  -14.437 1.00 25.76 ? 81  LEU B HD11 1 
ATOM   2705 H  HD12 . LEU B 1 62 ? -3.625  21.777  -15.988 1.00 25.76 ? 81  LEU B HD12 1 
ATOM   2706 H  HD13 . LEU B 1 62 ? -3.497  20.308  -15.397 1.00 25.76 ? 81  LEU B HD13 1 
ATOM   2707 H  HD21 . LEU B 1 62 ? -1.238  21.535  -16.928 1.00 23.88 ? 81  LEU B HD21 1 
ATOM   2708 H  HD22 . LEU B 1 62 ? -0.085  21.117  -15.918 1.00 23.88 ? 81  LEU B HD22 1 
ATOM   2709 H  HD23 . LEU B 1 62 ? -1.210  20.068  -16.317 1.00 23.88 ? 81  LEU B HD23 1 
ATOM   2710 N  N    . LEU B 1 63 ? -1.048  22.988  -11.523 1.00 10.72 ? 82  LEU B N    1 
ATOM   2711 C  CA   . LEU B 1 63 ? -0.825  22.193  -10.314 1.00 10.39 ? 82  LEU B CA   1 
ATOM   2712 C  C    . LEU B 1 63 ? -1.900  22.451  -9.254  1.00 10.84 ? 82  LEU B C    1 
ATOM   2713 O  O    . LEU B 1 63 ? -2.385  21.540  -8.579  1.00 10.32 ? 82  LEU B O    1 
ATOM   2714 C  CB   . LEU B 1 63 ? 0.567   22.407  -9.757  1.00 10.52 ? 82  LEU B CB   1 
ATOM   2715 C  CG   . LEU B 1 63 ? 0.898   21.692  -8.443  1.00 11.56 ? 82  LEU B CG   1 
ATOM   2716 C  CD1  . LEU B 1 63 ? 0.776   20.180  -8.583  1.00 12.58 ? 82  LEU B CD1  1 
ATOM   2717 C  CD2  . LEU B 1 63 ? 2.298   22.087  -8.013  1.00 12.29 ? 82  LEU B CD2  1 
ATOM   2718 H  H    . LEU B 1 63 ? -0.421  23.546  -11.709 1.00 12.87 ? 82  LEU B H    1 
ATOM   2719 H  HA   . LEU B 1 63 ? -0.890  21.257  -10.558 1.00 12.47 ? 82  LEU B HA   1 
ATOM   2720 H  HB2  . LEU B 1 63 ? 1.208   22.103  -10.418 1.00 12.62 ? 82  LEU B HB2  1 
ATOM   2721 H  HB3  . LEU B 1 63 ? 0.689   23.357  -9.605  1.00 12.62 ? 82  LEU B HB3  1 
ATOM   2722 H  HG   . LEU B 1 63 ? 0.277   21.983  -7.756  1.00 13.88 ? 82  LEU B HG   1 
ATOM   2723 H  HD11 . LEU B 1 63 ? -0.134  19.959  -8.837  1.00 15.10 ? 82  LEU B HD11 1 
ATOM   2724 H  HD12 . LEU B 1 63 ? 1.394   19.877  -9.267  1.00 15.10 ? 82  LEU B HD12 1 
ATOM   2725 H  HD13 . LEU B 1 63 ? 0.993   19.766  -7.733  1.00 15.10 ? 82  LEU B HD13 1 
ATOM   2726 H  HD21 . LEU B 1 63 ? 2.926   21.823  -8.703  1.00 14.75 ? 82  LEU B HD21 1 
ATOM   2727 H  HD22 . LEU B 1 63 ? 2.330   23.048  -7.886  1.00 14.75 ? 82  LEU B HD22 1 
ATOM   2728 H  HD23 . LEU B 1 63 ? 2.512   21.636  -7.181  1.00 14.75 ? 82  LEU B HD23 1 
ATOM   2729 N  N    . GLY B 1 64 ? -2.233  23.722  -9.065  1.00 10.47 ? 83  GLY B N    1 
ATOM   2730 C  CA   . GLY B 1 64 ? -3.313  24.069  -8.156  1.00 11.14 ? 83  GLY B CA   1 
ATOM   2731 C  C    . GLY B 1 64 ? -4.678  23.533  -8.563  1.00 11.22 ? 83  GLY B C    1 
ATOM   2732 O  O    . GLY B 1 64 ? -5.476  23.144  -7.730  1.00 12.23 ? 83  GLY B O    1 
ATOM   2733 H  H    . GLY B 1 64 ? -1.854  24.394  -9.446  1.00 12.56 ? 83  GLY B H    1 
ATOM   2734 H  HA2  . GLY B 1 64 ? -3.107  23.724  -7.273  1.00 13.37 ? 83  GLY B HA2  1 
ATOM   2735 H  HA3  . GLY B 1 64 ? -3.376  25.035  -8.094  1.00 13.37 ? 83  GLY B HA3  1 
ATOM   2736 N  N    . ASP B 1 65 ? -4.941  23.493  -9.868  1.00 11.73 ? 84  ASP B N    1 
ATOM   2737 C  CA   . ASP B 1 65 ? -6.176  22.948  -10.355 1.00 14.22 ? 84  ASP B CA   1 
ATOM   2738 C  C    . ASP B 1 65 ? -6.244  21.455  -10.039 1.00 15.47 ? 84  ASP B C    1 
ATOM   2739 O  O    . ASP B 1 65 ? -7.296  20.954  -9.643  1.00 17.45 ? 84  ASP B O    1 
ATOM   2740 C  CB   . ASP B 1 65 ? -6.293  23.154  -11.853 1.00 16.12 ? 84  ASP B CB   1 
ATOM   2741 C  CG   . ASP B 1 65 ? -6.460  24.627  -12.240 1.00 19.87 ? 84  ASP B CG   1 
ATOM   2742 O  OD1  . ASP B 1 65 ? -6.710  25.498  -11.368 1.00 20.87 ? 84  ASP B OD1  1 
ATOM   2743 O  OD2  . ASP B 1 65 ? -6.388  24.904  -13.453 1.00 23.33 ? 84  ASP B OD2  1 
ATOM   2744 H  H    . ASP B 1 65 ? -4.412  23.779  -10.483 1.00 14.08 ? 84  ASP B H    1 
ATOM   2745 H  HA   . ASP B 1 65 ? -6.922  23.392  -9.922  1.00 17.06 ? 84  ASP B HA   1 
ATOM   2746 H  HB2  . ASP B 1 65 ? -5.489  22.821  -12.281 1.00 19.34 ? 84  ASP B HB2  1 
ATOM   2747 H  HB3  . ASP B 1 65 ? -7.067  22.669  -12.179 1.00 19.34 ? 84  ASP B HB3  1 
ATOM   2748 N  N    . LEU B 1 66 ? -5.132  20.752  -10.202 1.00 11.94 ? 85  LEU B N    1 
ATOM   2749 C  CA   . LEU B 1 66 ? -5.067  19.325  -9.923  1.00 13.26 ? 85  LEU B CA   1 
ATOM   2750 C  C    . LEU B 1 66 ? -5.182  19.006  -8.433  1.00 12.18 ? 85  LEU B C    1 
ATOM   2751 O  O    . LEU B 1 66 ? -5.941  18.104  -8.024  1.00 12.99 ? 85  LEU B O    1 
ATOM   2752 C  CB   . LEU B 1 66 ? -3.757  18.739  -10.433 1.00 15.27 ? 85  LEU B CB   1 
ATOM   2753 C  CG   . LEU B 1 66 ? -3.543  18.706  -11.943 1.00 20.05 ? 85  LEU B CG   1 
ATOM   2754 C  CD1  . LEU B 1 66 ? -2.104  18.335  -12.231 1.00 22.11 ? 85  LEU B CD1  1 
ATOM   2755 C  CD2  . LEU B 1 66 ? -4.459  17.759  -12.648 1.00 24.10 ? 85  LEU B CD2  1 
ATOM   2756 H  H    . LEU B 1 66 ? -4.388  21.084  -10.478 1.00 14.33 ? 85  LEU B H    1 
ATOM   2757 H  HA   . LEU B 1 66 ? -5.796  18.880  -10.383 1.00 15.91 ? 85  LEU B HA   1 
ATOM   2758 H  HB2  . LEU B 1 66 ? -3.029  19.256  -10.054 1.00 18.32 ? 85  LEU B HB2  1 
ATOM   2759 H  HB3  . LEU B 1 66 ? -3.694  17.824  -10.118 1.00 18.32 ? 85  LEU B HB3  1 
ATOM   2760 H  HG   . LEU B 1 66 ? -3.699  19.594  -12.302 1.00 24.07 ? 85  LEU B HG   1 
ATOM   2761 H  HD11 . LEU B 1 66 ? -1.521  18.997  -11.829 1.00 26.54 ? 85  LEU B HD11 1 
ATOM   2762 H  HD12 . LEU B 1 66 ? -1.922  17.460  -11.853 1.00 26.54 ? 85  LEU B HD12 1 
ATOM   2763 H  HD13 . LEU B 1 66 ? -1.970  18.314  -13.192 1.00 26.54 ? 85  LEU B HD13 1 
ATOM   2764 H  HD21 . LEU B 1 66 ? -5.377  18.026  -12.483 1.00 28.92 ? 85  LEU B HD21 1 
ATOM   2765 H  HD22 . LEU B 1 66 ? -4.271  17.787  -13.599 1.00 28.92 ? 85  LEU B HD22 1 
ATOM   2766 H  HD23 . LEU B 1 66 ? -4.309  16.863  -12.307 1.00 28.92 ? 85  LEU B HD23 1 
ATOM   2767 N  N    . PHE B 1 67 ? -4.400  19.716  -7.633  1.00 12.07 ? 86  PHE B N    1 
ATOM   2768 C  CA   . PHE B 1 67 ? -4.354  19.452  -6.199  1.00 10.98 ? 86  PHE B CA   1 
ATOM   2769 C  C    . PHE B 1 67 ? -5.589  19.999  -5.461  1.00 12.08 ? 86  PHE B C    1 
ATOM   2770 O  O    . PHE B 1 67 ? -5.936  19.497  -4.387  1.00 14.82 ? 86  PHE B O    1 
ATOM   2771 C  CB   . PHE B 1 67 ? -3.081  20.012  -5.567  1.00 11.03 ? 86  PHE B CB   1 
ATOM   2772 C  CG   . PHE B 1 67 ? -1.850  19.100  -5.678  1.00 10.30 ? 86  PHE B CG   1 
ATOM   2773 C  CD1  . PHE B 1 67 ? -1.817  17.986  -6.488  1.00 11.09 ? 86  PHE B CD1  1 
ATOM   2774 C  CD2  . PHE B 1 67 ? -0.721  19.380  -4.931  1.00 10.72 ? 86  PHE B CD2  1 
ATOM   2775 C  CE1  . PHE B 1 67 ? -0.673  17.175  -6.533  1.00 11.64 ? 86  PHE B CE1  1 
ATOM   2776 C  CE2  . PHE B 1 67 ? 0.401   18.577  -4.975  1.00 11.81 ? 86  PHE B CE2  1 
ATOM   2777 C  CZ   . PHE B 1 67 ? 0.427   17.481  -5.779  1.00 12.12 ? 86  PHE B CZ   1 
ATOM   2778 H  H    . PHE B 1 67 ? -3.887  20.356  -7.892  1.00 14.48 ? 86  PHE B H    1 
ATOM   2779 H  HA   . PHE B 1 67 ? -4.342  18.491  -6.068  1.00 13.18 ? 86  PHE B HA   1 
ATOM   2780 H  HB2  . PHE B 1 67 ? -2.864  20.851  -6.001  1.00 13.24 ? 86  PHE B HB2  1 
ATOM   2781 H  HB3  . PHE B 1 67 ? -3.247  20.166  -4.624  1.00 13.24 ? 86  PHE B HB3  1 
ATOM   2782 H  HD1  . PHE B 1 67 ? -2.561  17.765  -7.001  1.00 13.30 ? 86  PHE B HD1  1 
ATOM   2783 H  HD2  . PHE B 1 67 ? -0.723  20.123  -4.372  1.00 12.86 ? 86  PHE B HD2  1 
ATOM   2784 H  HE1  . PHE B 1 67 ? -0.660  16.426  -7.085  1.00 13.97 ? 86  PHE B HE1  1 
ATOM   2785 H  HE2  . PHE B 1 67 ? 1.146   18.795  -4.463  1.00 14.17 ? 86  PHE B HE2  1 
ATOM   2786 H  HZ   . PHE B 1 67 ? 1.186   16.945  -5.816  1.00 14.54 ? 86  PHE B HZ   1 
ATOM   2787 N  N    . GLY B 1 68 ? -6.188  21.049  -6.008  1.00 12.94 ? 87  GLY B N    1 
ATOM   2788 C  CA   . GLY B 1 68 ? -7.321  21.684  -5.399  1.00 13.13 ? 87  GLY B CA   1 
ATOM   2789 C  C    . GLY B 1 68 ? -7.027  22.552  -4.194  1.00 12.82 ? 87  GLY B C    1 
ATOM   2790 O  O    . GLY B 1 68 ? -7.949  22.835  -3.429  1.00 14.33 ? 87  GLY B O    1 
ATOM   2791 H  H    . GLY B 1 68 ? -5.942  21.412  -6.748  1.00 15.53 ? 87  GLY B H    1 
ATOM   2792 H  HA2  . GLY B 1 68 ? -7.760  22.240  -6.063  1.00 15.76 ? 87  GLY B HA2  1 
ATOM   2793 H  HA3  . GLY B 1 68 ? -7.950  20.999  -5.124  1.00 15.76 ? 87  GLY B HA3  1 
ATOM   2794 N  N    . VAL B 1 69 ? -5.783  23.009  -4.071  1.00 11.96 ? 88  VAL B N    1 
ATOM   2795 C  CA   . VAL B 1 69 ? -5.352  23.879  -2.990  1.00 11.29 ? 88  VAL B CA   1 
ATOM   2796 C  C    . VAL B 1 69 ? -4.530  24.987  -3.607  1.00 10.97 ? 88  VAL B C    1 
ATOM   2797 O  O    . VAL B 1 69 ? -3.924  24.795  -4.653  1.00 12.29 ? 88  VAL B O    1 
ATOM   2798 C  CB   . VAL B 1 69 ? -4.525  23.128  -1.930  1.00 13.44 ? 88  VAL B CB   1 
ATOM   2799 C  CG1  . VAL B 1 69 ? -5.343  22.019  -1.297  1.00 17.10 ? 88  VAL B CG1  1 
ATOM   2800 C  CG2  . VAL B 1 69 ? -3.275  22.577  -2.525  1.00 14.69 ? 88  VAL B CG2  1 
ATOM   2801 H  H    . VAL B 1 69 ? -5.153  22.820  -4.624  1.00 14.35 ? 88  VAL B H    1 
ATOM   2802 H  HA   . VAL B 1 69 ? -6.126  24.271  -2.558  1.00 13.54 ? 88  VAL B HA   1 
ATOM   2803 H  HB   . VAL B 1 69 ? -4.273  23.750  -1.229  1.00 16.13 ? 88  VAL B HB   1 
ATOM   2804 H  HG11 . VAL B 1 69 ? -4.799  21.564  -0.635  1.00 20.52 ? 88  VAL B HG11 1 
ATOM   2805 H  HG12 . VAL B 1 69 ? -6.125  22.406  -0.874  1.00 20.52 ? 88  VAL B HG12 1 
ATOM   2806 H  HG13 . VAL B 1 69 ? -5.615  21.394  -1.988  1.00 20.52 ? 88  VAL B HG13 1 
ATOM   2807 H  HG21 . VAL B 1 69 ? -2.776  22.111  -1.836  1.00 17.63 ? 88  VAL B HG21 1 
ATOM   2808 H  HG22 . VAL B 1 69 ? -3.510  21.962  -3.237  1.00 17.63 ? 88  VAL B HG22 1 
ATOM   2809 H  HG23 . VAL B 1 69 ? -2.746  23.308  -2.880  1.00 17.63 ? 88  VAL B HG23 1 
ATOM   2810 N  N    . PRO B 1 70 ? -4.504  26.159  -2.965  1.00 11.00 ? 89  PRO B N    1 
ATOM   2811 C  CA   . PRO B 1 70 ? -3.731  27.272  -3.533  1.00 11.74 ? 89  PRO B CA   1 
ATOM   2812 C  C    . PRO B 1 70 ? -2.248  27.203  -3.187  1.00 11.22 ? 89  PRO B C    1 
ATOM   2813 O  O    . PRO B 1 70 ? -1.452  27.922  -3.792  1.00 10.82 ? 89  PRO B O    1 
ATOM   2814 C  CB   . PRO B 1 70 ? -4.354  28.497  -2.878  1.00 12.93 ? 89  PRO B CB   1 
ATOM   2815 C  CG   . PRO B 1 70 ? -4.913  27.966  -1.593  1.00 12.95 ? 89  PRO B CG   1 
ATOM   2816 C  CD   . PRO B 1 70 ? -5.381  26.572  -1.868  1.00 12.40 ? 89  PRO B CD   1 
ATOM   2817 H  HA   . PRO B 1 70 ? -3.846  27.318  -4.495  1.00 14.08 ? 89  PRO B HA   1 
ATOM   2818 H  HB2  . PRO B 1 70 ? -3.672  29.166  -2.710  1.00 15.52 ? 89  PRO B HB2  1 
ATOM   2819 H  HB3  . PRO B 1 70 ? -5.059  28.852  -3.442  1.00 15.52 ? 89  PRO B HB3  1 
ATOM   2820 H  HG2  . PRO B 1 70 ? -4.217  27.962  -0.917  1.00 15.54 ? 89  PRO B HG2  1 
ATOM   2821 H  HG3  . PRO B 1 70 ? -5.655  28.523  -1.311  1.00 15.54 ? 89  PRO B HG3  1 
ATOM   2822 H  HD2  . PRO B 1 70 ? -5.245  26.008  -1.091  1.00 14.88 ? 89  PRO B HD2  1 
ATOM   2823 H  HD3  . PRO B 1 70 ? -6.308  26.574  -2.154  1.00 14.88 ? 89  PRO B HD3  1 
ATOM   2824 N  N    . SER B 1 71 ? -1.894  26.353  -2.226  1.00 10.99 ? 90  SER B N    1 
ATOM   2825 C  CA   . SER B 1 71 ? -0.563  26.369  -1.627  1.00 10.61 ? 90  SER B CA   1 
ATOM   2826 C  C    . SER B 1 71 ? -0.376  25.155  -0.722  1.00 9.77  ? 90  SER B C    1 
ATOM   2827 O  O    . SER B 1 71 ? -1.350  24.497  -0.322  1.00 11.97 ? 90  SER B O    1 
ATOM   2828 C  CB   . SER B 1 71 ? -0.374  27.635  -0.777  1.00 11.57 ? 90  SER B CB   1 
ATOM   2829 O  OG   . SER B 1 71 ? -1.271  27.655  0.321   1.00 12.90 ? 90  SER B OG   1 
ATOM   2830 H  H    . SER B 1 71 ? -2.414  25.751  -1.900  1.00 13.19 ? 90  SER B H    1 
ATOM   2831 H  HA   . SER B 1 71 ? 0.113   26.352  -2.322  1.00 12.73 ? 90  SER B HA   1 
ATOM   2832 H  HB2  . SER B 1 71 ? 0.535   27.654  -0.440  1.00 13.89 ? 90  SER B HB2  1 
ATOM   2833 H  HB3  . SER B 1 71 ? -0.538  28.414  -1.331  1.00 13.89 ? 90  SER B HB3  1 
ATOM   2834 H  HG   . SER B 1 71 ? -2.064  27.639  0.044   1.00 15.48 ? 90  SER B HG   1 
ATOM   2835 N  N    . PHE B 1 72 ? 0.876   24.849  -0.418  1.00 8.83  ? 91  PHE B N    1 
ATOM   2836 C  CA   . PHE B 1 72 ? 1.210   23.799  0.540   1.00 8.99  ? 91  PHE B CA   1 
ATOM   2837 C  C    . PHE B 1 72 ? 2.677   23.877  0.858   1.00 8.83  ? 91  PHE B C    1 
ATOM   2838 O  O    . PHE B 1 72 ? 3.472   24.449  0.130   1.00 9.50  ? 91  PHE B O    1 
ATOM   2839 C  CB   . PHE B 1 72 ? 0.845   22.409  -0.033  1.00 9.15  ? 91  PHE B CB   1 
ATOM   2840 C  CG   . PHE B 1 72 ? 1.561   22.034  -1.314  1.00 8.64  ? 91  PHE B CG   1 
ATOM   2841 C  CD1  . PHE B 1 72 ? 2.772   21.354  -1.285  1.00 10.06 ? 91  PHE B CD1  1 
ATOM   2842 C  CD2  . PHE B 1 72 ? 1.006   22.331  -2.557  1.00 9.84  ? 91  PHE B CD2  1 
ATOM   2843 C  CE1  . PHE B 1 72 ? 3.401   20.980  -2.484  1.00 10.18 ? 91  PHE B CE1  1 
ATOM   2844 C  CE2  . PHE B 1 72 ? 1.633   21.969  -3.735  1.00 10.74 ? 91  PHE B CE2  1 
ATOM   2845 C  CZ   . PHE B 1 72 ? 2.826   21.298  -3.701  1.00 10.32 ? 91  PHE B CZ   1 
ATOM   2846 H  H    . PHE B 1 72 ? 1.563   25.240  -0.756  1.00 10.59 ? 91  PHE B H    1 
ATOM   2847 H  HA   . PHE B 1 72 ? 0.709   23.936  1.359   1.00 10.79 ? 91  PHE B HA   1 
ATOM   2848 H  HB2  . PHE B 1 72 ? 1.061   21.736  0.631   1.00 10.98 ? 91  PHE B HB2  1 
ATOM   2849 H  HB3  . PHE B 1 72 ? -0.108  22.391  -0.215  1.00 10.98 ? 91  PHE B HB3  1 
ATOM   2850 H  HD1  . PHE B 1 72 ? 3.159   21.132  -0.470  1.00 12.07 ? 91  PHE B HD1  1 
ATOM   2851 H  HD2  . PHE B 1 72 ? 0.193   22.780  -2.595  1.00 11.81 ? 91  PHE B HD2  1 
ATOM   2852 H  HE1  . PHE B 1 72 ? 4.216   20.531  -2.459  1.00 12.21 ? 91  PHE B HE1  1 
ATOM   2853 H  HE2  . PHE B 1 72 ? 1.244   22.183  -4.552  1.00 12.89 ? 91  PHE B HE2  1 
ATOM   2854 H  HZ   . PHE B 1 72 ? 3.251   21.061  -4.494  1.00 12.39 ? 91  PHE B HZ   1 
ATOM   2855 N  N    . SER B 1 73 ? 3.030   23.295  2.001   1.00 8.61  ? 92  SER B N    1 
ATOM   2856 C  CA   . SER B 1 73 ? 4.416   23.039  2.363   1.00 8.83  ? 92  SER B CA   1 
ATOM   2857 C  C    . SER B 1 73 ? 4.828   21.646  1.913   1.00 8.43  ? 92  SER B C    1 
ATOM   2858 O  O    . SER B 1 73 ? 4.056   20.695  2.047   1.00 9.40  ? 92  SER B O    1 
ATOM   2859 C  CB   . SER B 1 73 ? 4.552   23.112  3.884   1.00 8.91  ? 92  SER B CB   1 
ATOM   2860 O  OG   . SER B 1 73 ? 5.779   22.510  4.288   1.00 9.77  ? 92  SER B OG   1 
ATOM   2861 H  H    . SER B 1 73 ? 2.468   23.034  2.597   1.00 10.33 ? 92  SER B H    1 
ATOM   2862 H  HA   . SER B 1 73 ? 5.001   23.696  1.954   1.00 10.59 ? 92  SER B HA   1 
ATOM   2863 H  HB2  . SER B 1 73 ? 4.547   24.042  4.161   1.00 10.69 ? 92  SER B HB2  1 
ATOM   2864 H  HB3  . SER B 1 73 ? 3.813   22.636  4.294   1.00 10.69 ? 92  SER B HB3  1 
ATOM   2865 H  HG   . SER B 1 73 ? 5.857   22.549  5.123   1.00 11.73 ? 92  SER B HG   1 
ATOM   2866 N  N    . VAL B 1 74 ? 6.073   21.536  1.485   1.00 9.00  ? 93  VAL B N    1 
ATOM   2867 C  CA   . VAL B 1 74 ? 6.619   20.244  1.111   1.00 8.94  ? 93  VAL B CA   1 
ATOM   2868 C  C    . VAL B 1 74 ? 6.751   19.283  2.297   1.00 9.17  ? 93  VAL B C    1 
ATOM   2869 O  O    . VAL B 1 74 ? 6.935   18.090  2.103   1.00 11.17 ? 93  VAL B O    1 
ATOM   2870 C  CB   . VAL B 1 74 ? 7.990   20.348  0.393   1.00 10.16 ? 93  VAL B CB   1 
ATOM   2871 C  CG1  . VAL B 1 74 ? 7.834   21.169  -0.886  1.00 12.42 ? 93  VAL B CG1  1 
ATOM   2872 C  CG2  . VAL B 1 74 ? 9.084   20.906  1.312   1.00 9.81  ? 93  VAL B CG2  1 
ATOM   2873 H  H    . VAL B 1 74 ? 6.622   22.192  1.401   1.00 10.80 ? 93  VAL B H    1 
ATOM   2874 H  HA   . VAL B 1 74 ? 6.004   19.834  0.483   1.00 10.73 ? 93  VAL B HA   1 
ATOM   2875 H  HB   . VAL B 1 74 ? 8.264   19.456  0.130   1.00 12.20 ? 93  VAL B HB   1 
ATOM   2876 H  HG11 . VAL B 1 74 ? 8.695   21.230  -1.329  1.00 14.90 ? 93  VAL B HG11 1 
ATOM   2877 H  HG12 . VAL B 1 74 ? 7.193   20.729  -1.467  1.00 14.90 ? 93  VAL B HG12 1 
ATOM   2878 H  HG13 . VAL B 1 74 ? 7.517   22.056  -0.655  1.00 14.90 ? 93  VAL B HG13 1 
ATOM   2879 H  HG21 . VAL B 1 74 ? 9.918   20.951  0.818   1.00 11.78 ? 93  VAL B HG21 1 
ATOM   2880 H  HG22 . VAL B 1 74 ? 8.826   21.793  1.607   1.00 11.78 ? 93  VAL B HG22 1 
ATOM   2881 H  HG23 . VAL B 1 74 ? 9.183   20.318  2.077   1.00 11.78 ? 93  VAL B HG23 1 
ATOM   2882 N  N    . LYS B 1 75 ? 6.614   19.772  3.515   1.00 8.66  ? 94  LYS B N    1 
ATOM   2883 C  CA   . LYS B 1 75 ? 6.590   18.884  4.685   1.00 8.82  ? 94  LYS B CA   1 
ATOM   2884 C  C    . LYS B 1 75 ? 5.270   18.150  4.861   1.00 8.92  ? 94  LYS B C    1 
ATOM   2885 O  O    . LYS B 1 75 ? 5.205   17.217  5.648   1.00 10.88 ? 94  LYS B O    1 
ATOM   2886 C  CB   . LYS B 1 75 ? 6.847   19.674  5.966   1.00 11.69 ? 94  LYS B CB   1 
ATOM   2887 C  CG   . LYS B 1 75 ? 8.164   20.408  6.035   1.00 14.01 ? 94  LYS B CG   1 
ATOM   2888 C  CD   . LYS B 1 75 ? 8.335   21.177  7.365   1.00 14.84 ? 94  LYS B CD   1 
ATOM   2889 C  CE   . LYS B 1 75 ? 9.750   21.811  7.471   1.00 15.68 ? 94  LYS B CE   1 
ATOM   2890 N  NZ   . LYS B 1 75 ? 9.998   22.787  6.392   1.00 14.30 ? 94  LYS B NZ   1 
ATOM   2891 H  H    . LYS B 1 75 ? 6.534   20.607  3.701   1.00 10.40 ? 94  LYS B H    1 
ATOM   2892 H  HA   . LYS B 1 75 ? 7.293   18.221  4.593   1.00 10.58 ? 94  LYS B HA   1 
ATOM   2893 H  HB2  . LYS B 1 75 ? 6.142   20.333  6.065   1.00 14.02 ? 94  LYS B HB2  1 
ATOM   2894 H  HB3  . LYS B 1 75 ? 6.819   19.058  6.715   1.00 14.02 ? 94  LYS B HB3  1 
ATOM   2895 H  HG2  . LYS B 1 75 ? 8.889   19.767  5.962   1.00 16.82 ? 94  LYS B HG2  1 
ATOM   2896 H  HG3  . LYS B 1 75 ? 8.209   21.048  5.308   1.00 16.82 ? 94  LYS B HG3  1 
ATOM   2897 H  HD2  . LYS B 1 75 ? 7.678   21.889  7.411   1.00 17.81 ? 94  LYS B HD2  1 
ATOM   2898 H  HD3  . LYS B 1 75 ? 8.220   20.563  8.108   1.00 17.81 ? 94  LYS B HD3  1 
ATOM   2899 H  HE2  . LYS B 1 75 ? 9.830   22.272  8.321   1.00 18.81 ? 94  LYS B HE2  1 
ATOM   2900 H  HE3  . LYS B 1 75 ? 10.419  21.111  7.406   1.00 18.81 ? 94  LYS B HE3  1 
ATOM   2901 H  HZ1  . LYS B 1 75 ? 10.814  23.134  6.477   1.00 17.16 ? 94  LYS B HZ1  1 
ATOM   2902 H  HZ2  . LYS B 1 75 ? 9.935   22.387  5.599   1.00 17.16 ? 94  LYS B HZ2  1 
ATOM   2903 H  HZ3  . LYS B 1 75 ? 9.399   23.444  6.433   1.00 17.16 ? 94  LYS B HZ3  1 
ATOM   2904 N  N    . GLU B 1 76 ? 4.246   18.563  4.132   1.00 8.40  ? 95  GLU B N    1 
ATOM   2905 C  CA   . GLU B 1 76 ? 2.904   18.026  4.306   1.00 8.59  ? 95  GLU B CA   1 
ATOM   2906 C  C    . GLU B 1 76 ? 2.733   16.742  3.480   1.00 9.03  ? 95  GLU B C    1 
ATOM   2907 O  O    . GLU B 1 76 ? 2.044   16.703  2.482   1.00 9.30  ? 95  GLU B O    1 
ATOM   2908 C  CB   . GLU B 1 76 ? 1.824   19.049  3.959   1.00 8.79  ? 95  GLU B CB   1 
ATOM   2909 C  CG   . GLU B 1 76 ? 1.874   20.268  4.898   1.00 9.62  ? 95  GLU B CG   1 
ATOM   2910 C  CD   . GLU B 1 76 ? 0.785   21.250  4.511   1.00 10.15 ? 95  GLU B CD   1 
ATOM   2911 O  OE1  . GLU B 1 76 ? 1.052   22.135  3.698   1.00 11.43 ? 95  GLU B OE1  1 
ATOM   2912 O  OE2  . GLU B 1 76 ? -0.335  21.105  5.049   1.00 12.83 ? 95  GLU B OE2  1 
ATOM   2913 H  H    . GLU B 1 76 ? 4.302   19.164  3.519   1.00 10.08 ? 95  GLU B H    1 
ATOM   2914 H  HA   . GLU B 1 76 ? 2.789   17.788  5.239   1.00 10.31 ? 95  GLU B HA   1 
ATOM   2915 H  HB2  . GLU B 1 76 ? 1.958   19.360  3.050   1.00 10.55 ? 95  GLU B HB2  1 
ATOM   2916 H  HB3  . GLU B 1 76 ? 0.951   18.635  4.046   1.00 10.55 ? 95  GLU B HB3  1 
ATOM   2917 H  HG2  . GLU B 1 76 ? 1.724   19.983  5.812   1.00 11.54 ? 95  GLU B HG2  1 
ATOM   2918 H  HG3  . GLU B 1 76 ? 2.734   20.710  4.814   1.00 11.54 ? 95  GLU B HG3  1 
ATOM   2919 N  N    . HIS B 1 77 ? 3.419   15.679  3.886   1.00 9.38  ? 96  HIS B N    1 
ATOM   2920 C  CA   . HIS B 1 77 ? 3.497   14.486  3.059   1.00 9.31  ? 96  HIS B CA   1 
ATOM   2921 C  C    . HIS B 1 77 ? 2.189   13.767  2.898   1.00 8.55  ? 96  HIS B C    1 
ATOM   2922 O  O    . HIS B 1 77 ? 1.889   13.318  1.805   1.00 9.03  ? 96  HIS B O    1 
ATOM   2923 C  CB   . HIS B 1 77 ? 4.587   13.559  3.594   1.00 11.17 ? 96  HIS B CB   1 
ATOM   2924 C  CG   . HIS B 1 77 ? 5.978   14.039  3.264   1.00 14.61 ? 96  HIS B CG   1 
ATOM   2925 N  ND1  . HIS B 1 77 ? 7.072   13.199  3.181   1.00 18.72 ? 96  HIS B ND1  1 
ATOM   2926 C  CD2  . HIS B 1 77 ? 6.423   15.260  2.891   1.00 15.24 ? 96  HIS B CD2  1 
ATOM   2927 C  CE1  . HIS B 1 77 ? 8.141   13.903  2.838   1.00 19.13 ? 96  HIS B CE1  1 
ATOM   2928 N  NE2  . HIS B 1 77 ? 7.771   15.155  2.651   1.00 18.07 ? 96  HIS B NE2  1 
ATOM   2929 H  H    . HIS B 1 77 ? 3.845   15.624  4.632   1.00 11.26 ? 96  HIS B H    1 
ATOM   2930 H  HA   . HIS B 1 77 ? 3.774   14.761  2.171   1.00 11.17 ? 96  HIS B HA   1 
ATOM   2931 H  HB2  . HIS B 1 77 ? 4.510   13.506  4.559   1.00 13.40 ? 96  HIS B HB2  1 
ATOM   2932 H  HB3  . HIS B 1 77 ? 4.473   12.679  3.203   1.00 13.40 ? 96  HIS B HB3  1 
ATOM   2933 H  HD1  . HIS B 1 77 ? 7.068   12.358  3.361   1.00 22.47 ? 96  HIS B HD1  1 
ATOM   2934 H  HD2  . HIS B 1 77 ? 5.916   16.037  2.842   1.00 18.29 ? 96  HIS B HD2  1 
ATOM   2935 H  HE1  . HIS B 1 77 ? 9.002   13.568  2.732   1.00 22.95 ? 96  HIS B HE1  1 
ATOM   2936 N  N    . ARG B 1 78 ? 1.366   13.650  3.937   1.00 9.72  ? 97  ARG B N    1 
ATOM   2937 C  CA   . ARG B 1 78 ? 0.045   13.044  3.774   1.00 9.31  ? 97  ARG B CA   1 
ATOM   2938 C  C    . ARG B 1 78 ? -0.805  13.809  2.769   1.00 9.43  ? 97  ARG B C    1 
ATOM   2939 O  O    . ARG B 1 78 ? -1.480  13.221  1.923   1.00 9.23  ? 97  ARG B O    1 
ATOM   2940 C  CB   . ARG B 1 78 ? -0.712  12.981  5.103   1.00 10.28 ? 97  ARG B CB   1 
ATOM   2941 C  CG   . ARG B 1 78 ? -2.062  12.310  4.947   1.00 10.33 ? 97  ARG B CG   1 
ATOM   2942 C  CD   . ARG B 1 78 ? -2.818  12.142  6.288   1.00 13.50 ? 97  ARG B CD   1 
ATOM   2943 N  NE   . ARG B 1 78 ? -4.141  11.619  6.008   1.00 13.77 ? 97  ARG B NE   1 
ATOM   2944 C  CZ   . ARG B 1 78 ? -4.533  10.365  6.151   1.00 15.31 ? 97  ARG B CZ   1 
ATOM   2945 N  NH1  . ARG B 1 78 ? -3.753  9.457   6.742   1.00 16.67 ? 97  ARG B NH1  1 
ATOM   2946 N  NH2  . ARG B 1 78 ? -5.743  10.021  5.724   1.00 17.11 ? 97  ARG B NH2  1 
ATOM   2947 H  H    . ARG B 1 78 ? 1.545   13.909  4.737   1.00 11.66 ? 97  ARG B H    1 
ATOM   2948 H  HA   . ARG B 1 78 ? 0.153   12.137  3.447   1.00 11.17 ? 97  ARG B HA   1 
ATOM   2949 H  HB2  . ARG B 1 78 ? -0.192  12.472  5.743   1.00 12.33 ? 97  ARG B HB2  1 
ATOM   2950 H  HB3  . ARG B 1 78 ? -0.858  13.883  5.430   1.00 12.33 ? 97  ARG B HB3  1 
ATOM   2951 H  HG2  . ARG B 1 78 ? -2.615  12.846  4.358   1.00 12.39 ? 97  ARG B HG2  1 
ATOM   2952 H  HG3  . ARG B 1 78 ? -1.932  11.427  4.566   1.00 12.39 ? 97  ARG B HG3  1 
ATOM   2953 H  HD2  . ARG B 1 78 ? -2.345  11.514  6.856   1.00 16.20 ? 97  ARG B HD2  1 
ATOM   2954 H  HD3  . ARG B 1 78 ? -2.907  13.003  6.725   1.00 16.20 ? 97  ARG B HD3  1 
ATOM   2955 H  HE   . ARG B 1 78 ? -4.727  12.178  5.721   1.00 16.52 ? 97  ARG B HE   1 
ATOM   2956 H  HH11 . ARG B 1 78 ? -2.958  9.670   6.992   1.00 20.00 ? 97  ARG B HH11 1 
ATOM   2957 H  HH12 . ARG B 1 78 ? -4.035  8.651   6.848   1.00 20.00 ? 97  ARG B HH12 1 
ATOM   2958 H  HH21 . ARG B 1 78 ? -6.259  10.613  5.375   1.00 20.53 ? 97  ARG B HH21 1 
ATOM   2959 H  HH22 . ARG B 1 78 ? -6.037  9.225   5.867   1.00 20.53 ? 97  ARG B HH22 1 
ATOM   2960 N  N    . LYS B 1 79 ? -0.813  15.123  2.864   1.00 9.52  ? 98  LYS B N    1 
ATOM   2961 C  CA   . LYS B 1 79 ? -1.551  15.951  1.924   1.00 9.48  ? 98  LYS B CA   1 
ATOM   2962 C  C    . LYS B 1 79 ? -1.057  15.772  0.498   1.00 9.42  ? 98  LYS B C    1 
ATOM   2963 O  O    . LYS B 1 79 ? -1.879  15.584  -0.423  1.00 9.91  ? 98  LYS B O    1 
ATOM   2964 C  CB   . LYS B 1 79 ? -1.425  17.427  2.341   1.00 10.78 ? 98  LYS B CB   1 
ATOM   2965 C  CG   . LYS B 1 79 ? -2.125  18.406  1.389   1.00 12.71 ? 98  LYS B CG   1 
ATOM   2966 C  CD   . LYS B 1 79 ? -1.952  19.862  1.846   1.00 13.11 ? 98  LYS B CD   1 
ATOM   2967 C  CE   . LYS B 1 79 ? -2.782  20.098  3.069   1.00 13.82 ? 98  LYS B CE   1 
ATOM   2968 N  NZ   . LYS B 1 79 ? -2.618  21.504  3.561   1.00 12.53 ? 98  LYS B NZ   1 
ATOM   2969 H  H    . LYS B 1 79 ? -0.394  15.568  3.469   1.00 11.43 ? 98  LYS B H    1 
ATOM   2970 H  HA   . LYS B 1 79 ? -2.489  15.707  1.953   1.00 11.38 ? 98  LYS B HA   1 
ATOM   2971 H  HB2  . LYS B 1 79 ? -1.818  17.537  3.220   1.00 12.94 ? 98  LYS B HB2  1 
ATOM   2972 H  HB3  . LYS B 1 79 ? -0.485  17.663  2.369   1.00 12.94 ? 98  LYS B HB3  1 
ATOM   2973 H  HG2  . LYS B 1 79 ? -1.742  18.319  0.502   1.00 15.25 ? 98  LYS B HG2  1 
ATOM   2974 H  HG3  . LYS B 1 79 ? -3.074  18.206  1.366   1.00 15.25 ? 98  LYS B HG3  1 
ATOM   2975 H  HD2  . LYS B 1 79 ? -1.022  20.028  2.065   1.00 15.74 ? 98  LYS B HD2  1 
ATOM   2976 H  HD3  . LYS B 1 79 ? -2.252  20.463  1.146   1.00 15.74 ? 98  LYS B HD3  1 
ATOM   2977 H  HE2  . LYS B 1 79 ? -3.718  19.956  2.856   1.00 16.58 ? 98  LYS B HE2  1 
ATOM   2978 H  HE3  . LYS B 1 79 ? -2.500  19.493  3.772   1.00 16.58 ? 98  LYS B HE3  1 
ATOM   2979 H  HZ1  . LYS B 1 79 ? -3.116  21.631  4.288   1.00 15.04 ? 98  LYS B HZ1  1 
ATOM   2980 H  HZ2  . LYS B 1 79 ? -1.766  21.657  3.764   1.00 15.04 ? 98  LYS B HZ2  1 
ATOM   2981 H  HZ3  . LYS B 1 79 ? -2.873  22.078  2.931   1.00 15.04 ? 98  LYS B HZ3  1 
ATOM   2982 N  N    . ILE B 1 80 ? 0.262   15.779  0.302   1.00 9.04  ? 99  ILE B N    1 
ATOM   2983 C  CA   . ILE B 1 80 ? 0.819   15.625  -1.031  1.00 9.31  ? 99  ILE B CA   1 
ATOM   2984 C  C    . ILE B 1 80 ? 0.477   14.249  -1.616  1.00 8.17  ? 99  ILE B C    1 
ATOM   2985 O  O    . ILE B 1 80 ? -0.008  14.159  -2.746  1.00 9.45  ? 99  ILE B O    1 
ATOM   2986 C  CB   . ILE B 1 80 ? 2.340   15.957  -1.026  1.00 9.92  ? 99  ILE B CB   1 
ATOM   2987 C  CG1  . ILE B 1 80 ? 2.509   17.455  -0.765  1.00 11.64 ? 99  ILE B CG1  1 
ATOM   2988 C  CG2  . ILE B 1 80 ? 2.997   15.587  -2.346  1.00 11.01 ? 99  ILE B CG2  1 
ATOM   2989 C  CD1  . ILE B 1 80 ? 3.892   17.876  -0.350  1.00 11.57 ? 99  ILE B CD1  1 
ATOM   2990 H  H    . ILE B 1 80 ? 0.849   15.871  0.923   1.00 10.84 ? 99  ILE B H    1 
ATOM   2991 H  HA   . ILE B 1 80 ? 0.395   16.282  -1.604  1.00 11.17 ? 99  ILE B HA   1 
ATOM   2992 H  HB   . ILE B 1 80 ? 2.768   15.461  -0.310  1.00 11.91 ? 99  ILE B HB   1 
ATOM   2993 H  HG12 . ILE B 1 80 ? 2.288   17.936  -1.577  1.00 13.97 ? 99  ILE B HG12 1 
ATOM   2994 H  HG13 . ILE B 1 80 ? 1.899   17.715  -0.057  1.00 13.97 ? 99  ILE B HG13 1 
ATOM   2995 H  HG21 . ILE B 1 80 ? 2.573   16.087  -3.060  1.00 13.21 ? 99  ILE B HG21 1 
ATOM   2996 H  HG22 . ILE B 1 80 ? 3.941   15.809  -2.301  1.00 13.21 ? 99  ILE B HG22 1 
ATOM   2997 H  HG23 . ILE B 1 80 ? 2.887   14.635  -2.497  1.00 13.21 ? 99  ILE B HG23 1 
ATOM   2998 H  HD11 . ILE B 1 80 ? 4.128   17.418  0.472   1.00 13.89 ? 99  ILE B HD11 1 
ATOM   2999 H  HD12 . ILE B 1 80 ? 4.518   17.640  -1.052  1.00 13.89 ? 99  ILE B HD12 1 
ATOM   3000 H  HD13 . ILE B 1 80 ? 3.900   18.836  -0.208  1.00 13.89 ? 99  ILE B HD13 1 
ATOM   3001 N  N    . TYR B 1 81 ? 0.699   13.179  -0.861  1.00 8.26  ? 100 TYR B N    1 
ATOM   3002 C  CA   . TYR B 1 81 ? 0.303   11.873  -1.348  1.00 8.07  ? 100 TYR B CA   1 
ATOM   3003 C  C    . TYR B 1 81 ? -1.173  11.815  -1.636  1.00 8.24  ? 100 TYR B C    1 
ATOM   3004 O  O    . TYR B 1 81 ? -1.550  11.284  -2.704  1.00 9.00  ? 100 TYR B O    1 
ATOM   3005 C  CB   . TYR B 1 81 ? 0.685   10.780  -0.337  1.00 8.80  ? 100 TYR B CB   1 
ATOM   3006 C  CG   . TYR B 1 81 ? 2.058   10.216  -0.493  1.00 10.44 ? 100 TYR B CG   1 
ATOM   3007 C  CD1  . TYR B 1 81 ? 3.123   10.691  0.199   1.00 13.47 ? 100 TYR B CD1  1 
ATOM   3008 C  CD2  . TYR B 1 81 ? 2.271   9.132   -1.272  1.00 16.04 ? 100 TYR B CD2  1 
ATOM   3009 C  CE1  . TYR B 1 81 ? 4.409   10.125  0.061   1.00 14.40 ? 100 TYR B CE1  1 
ATOM   3010 C  CE2  . TYR B 1 81 ? 3.528   8.562   -1.409  1.00 16.79 ? 100 TYR B CE2  1 
ATOM   3011 C  CZ   . TYR B 1 81 ? 4.592   9.057   -0.740  1.00 14.27 ? 100 TYR B CZ   1 
ATOM   3012 O  OH   . TYR B 1 81 ? 5.845   8.477   -0.912  1.00 16.23 ? 100 TYR B OH   1 
ATOM   3013 H  H    . TYR B 1 81 ? 1.067   13.184  -0.084  1.00 9.91  ? 100 TYR B H    1 
ATOM   3014 H  HA   . TYR B 1 81 ? 0.775   11.691  -2.176  1.00 9.68  ? 100 TYR B HA   1 
ATOM   3015 H  HB2  . TYR B 1 81 ? 0.623   11.152  0.557   1.00 10.57 ? 100 TYR B HB2  1 
ATOM   3016 H  HB3  . TYR B 1 81 ? 0.057   10.046  -0.426  1.00 10.57 ? 100 TYR B HB3  1 
ATOM   3017 H  HD1  . TYR B 1 81 ? 3.009   11.429  0.754   1.00 16.16 ? 100 TYR B HD1  1 
ATOM   3018 H  HD2  . TYR B 1 81 ? 1.557   8.770   -1.747  1.00 19.24 ? 100 TYR B HD2  1 
ATOM   3019 H  HE1  . TYR B 1 81 ? 5.128   10.483  0.531   1.00 17.28 ? 100 TYR B HE1  1 
ATOM   3020 H  HE2  . TYR B 1 81 ? 3.641   7.831   -1.972  1.00 20.15 ? 100 TYR B HE2  1 
ATOM   3021 H  HH   . TYR B 1 81 ? 6.418   8.889   -0.457  1.00 19.48 ? 100 TYR B HH   1 
ATOM   3022 N  N    . THR B 1 82 ? -2.024  12.255  -0.721  1.00 8.54  ? 101 THR B N    1 
ATOM   3023 C  CA   . THR B 1 82 ? -3.443  12.067  -0.965  1.00 9.16  ? 101 THR B CA   1 
ATOM   3024 C  C    . THR B 1 82 ? -3.919  12.891  -2.178  1.00 9.03  ? 101 THR B C    1 
ATOM   3025 O  O    . THR B 1 82 ? -4.742  12.407  -2.957  1.00 9.19  ? 101 THR B O    1 
ATOM   3026 C  CB   . THR B 1 82 ? -4.325  12.308  0.231   1.00 11.59 ? 101 THR B CB   1 
ATOM   3027 O  OG1  . THR B 1 82 ? -4.107  13.601  0.737   1.00 11.89 ? 101 THR B OG1  1 
ATOM   3028 C  CG2  . THR B 1 82 ? -4.038  11.339  1.349   1.00 11.99 ? 101 THR B CG2  1 
ATOM   3029 H  H    . THR B 1 82 ? -1.819  12.647  0.016   1.00 10.24 ? 101 THR B H    1 
ATOM   3030 H  HA   . THR B 1 82 ? -3.568  11.136  -1.207  1.00 11.00 ? 101 THR B HA   1 
ATOM   3031 H  HB   . THR B 1 82 ? -5.255  12.214  -0.028  1.00 13.90 ? 101 THR B HB   1 
ATOM   3032 H  HG1  . THR B 1 82 ? -3.304  13.687  0.969   1.00 14.26 ? 101 THR B HG1  1 
ATOM   3033 H  HG21 . THR B 1 82 ? -3.116  11.428  1.636   1.00 14.39 ? 101 THR B HG21 1 
ATOM   3034 H  HG22 . THR B 1 82 ? -4.622  11.521  2.102   1.00 14.39 ? 101 THR B HG22 1 
ATOM   3035 H  HG23 . THR B 1 82 ? -4.188  10.430  1.046   1.00 14.39 ? 101 THR B HG23 1 
ATOM   3036 N  N    A MET B 1 83 ? -3.386  14.086  -2.352  0.76 8.96  ? 102 MET B N    1 
ATOM   3037 N  N    B MET B 1 83 ? -3.348  14.080  -2.360  0.24 8.76  ? 102 MET B N    1 
ATOM   3038 C  CA   A MET B 1 83 ? -3.779  14.839  -3.529  0.76 8.74  ? 102 MET B CA   1 
ATOM   3039 C  CA   B MET B 1 83 ? -3.672  14.929  -3.510  0.24 8.88  ? 102 MET B CA   1 
ATOM   3040 C  C    A MET B 1 83 ? -3.273  14.161  -4.809  0.76 8.06  ? 102 MET B C    1 
ATOM   3041 C  C    B MET B 1 83 ? -3.157  14.351  -4.835  0.24 7.48  ? 102 MET B C    1 
ATOM   3042 O  O    A MET B 1 83 ? -4.000  14.107  -5.812  0.76 8.61  ? 102 MET B O    1 
ATOM   3043 O  O    B MET B 1 83 ? -3.718  14.611  -5.905  0.24 5.99  ? 102 MET B O    1 
ATOM   3044 C  CB   A MET B 1 83 ? -3.292  16.295  -3.481  0.76 9.67  ? 102 MET B CB   1 
ATOM   3045 C  CB   B MET B 1 83 ? -3.087  16.337  -3.327  0.24 10.45 ? 102 MET B CB   1 
ATOM   3046 C  CG   A MET B 1 83 ? -3.904  17.167  -2.385  0.76 11.23 ? 102 MET B CG   1 
ATOM   3047 C  CG   B MET B 1 83 ? -3.777  17.188  -2.258  0.24 12.17 ? 102 MET B CG   1 
ATOM   3048 S  SD   A MET B 1 83 ? -5.694  17.068  -2.206  0.76 11.88 ? 102 MET B SD   1 
ATOM   3049 S  SD   B MET B 1 83 ? -3.161  18.891  -2.142  0.24 13.82 ? 102 MET B SD   1 
ATOM   3050 C  CE   A MET B 1 83 ? -5.870  15.997  -0.795  0.76 14.16 ? 102 MET B CE   1 
ATOM   3051 C  CE   B MET B 1 83 ? -1.382  18.655  -2.015  0.24 13.68 ? 102 MET B CE   1 
ATOM   3052 H  H    A MET B 1 83 ? -2.820  14.471  -1.831  0.76 10.75 ? 102 MET B H    1 
ATOM   3053 H  H    B MET B 1 83 ? -2.764  14.421  -1.828  0.24 10.51 ? 102 MET B H    1 
ATOM   3054 H  HA   A MET B 1 83 ? -4.748  14.863  -3.562  0.76 10.48 ? 102 MET B HA   1 
ATOM   3055 H  HA   B MET B 1 83 ? -4.636  15.017  -3.566  0.24 10.66 ? 102 MET B HA   1 
ATOM   3056 H  HB2  A MET B 1 83 ? -2.331  16.291  -3.346  0.76 11.61 ? 102 MET B HB2  1 
ATOM   3057 H  HB2  B MET B 1 83 ? -2.154  16.253  -3.076  0.24 12.54 ? 102 MET B HB2  1 
ATOM   3058 H  HB3  A MET B 1 83 ? -3.496  16.713  -4.332  0.76 11.61 ? 102 MET B HB3  1 
ATOM   3059 H  HB3  B MET B 1 83 ? -3.157  16.812  -4.169  0.24 12.54 ? 102 MET B HB3  1 
ATOM   3060 H  HG2  A MET B 1 83 ? -3.514  16.909  -1.535  0.76 13.48 ? 102 MET B HG2  1 
ATOM   3061 H  HG2  B MET B 1 83 ? -4.725  17.231  -2.459  0.24 14.61 ? 102 MET B HG2  1 
ATOM   3062 H  HG3  A MET B 1 83 ? -3.683  18.093  -2.572  0.76 13.48 ? 102 MET B HG3  1 
ATOM   3063 H  HG3  B MET B 1 83 ? -3.646  16.767  -1.394  0.24 14.61 ? 102 MET B HG3  1 
ATOM   3064 H  HE1  A MET B 1 83 ? -6.814  15.874  -0.608  0.76 16.99 ? 102 MET B HE1  1 
ATOM   3065 H  HE1  B MET B 1 83 ? -0.953  19.522  -1.947  0.24 16.42 ? 102 MET B HE1  1 
ATOM   3066 H  HE2  A MET B 1 83 ? -5.458  15.141  -0.995  0.76 16.99 ? 102 MET B HE2  1 
ATOM   3067 H  HE2  B MET B 1 83 ? -1.190  18.127  -1.224  0.24 16.42 ? 102 MET B HE2  1 
ATOM   3068 H  HE3  A MET B 1 83 ? -5.432  16.405  -0.032  0.76 16.99 ? 102 MET B HE3  1 
ATOM   3069 H  HE3  B MET B 1 83 ? -1.069  18.191  -2.807  0.24 16.42 ? 102 MET B HE3  1 
ATOM   3070 N  N    . ILE B 1 84 ? -2.054  13.617  -4.766  1.00 8.04  ? 103 ILE B N    1 
ATOM   3071 C  CA   . ILE B 1 84 ? -1.546  12.919  -5.920  1.00 7.95  ? 103 ILE B CA   1 
ATOM   3072 C  C    . ILE B 1 84 ? -2.466  11.737  -6.239  1.00 8.52  ? 103 ILE B C    1 
ATOM   3073 O  O    . ILE B 1 84 ? -2.842  11.526  -7.410  1.00 8.91  ? 103 ILE B O    1 
ATOM   3074 C  CB   . ILE B 1 84 ? -0.072  12.492  -5.756  1.00 8.60  ? 103 ILE B CB   1 
ATOM   3075 C  CG1  . ILE B 1 84 ? 0.861   13.709  -5.776  1.00 9.06  ? 103 ILE B CG1  1 
ATOM   3076 C  CG2  . ILE B 1 84 ? 0.332   11.514  -6.794  1.00 10.63 ? 103 ILE B CG2  1 
ATOM   3077 C  CD1  . ILE B 1 84 ? 2.284   13.439  -5.330  1.00 9.44  ? 103 ILE B CD1  1 
ATOM   3078 H  H    . ILE B 1 84 ? -1.551  13.578  -4.071  0.31 9.65  ? 103 ILE B H    1 
ATOM   3079 H  HA   . ILE B 1 84 ? -1.583  13.522  -6.678  1.00 9.54  ? 103 ILE B HA   1 
ATOM   3080 H  HB   . ILE B 1 84 ? 0.018   12.062  -4.891  1.00 10.32 ? 103 ILE B HB   1 
ATOM   3081 H  HG12 . ILE B 1 84 ? 0.900   14.052  -6.683  1.00 10.87 ? 103 ILE B HG12 1 
ATOM   3082 H  HG13 . ILE B 1 84 ? 0.494   14.388  -5.188  1.00 10.87 ? 103 ILE B HG13 1 
ATOM   3083 H  HG21 . ILE B 1 84 ? 1.262   11.272  -6.655  1.00 12.76 ? 103 ILE B HG21 1 
ATOM   3084 H  HG22 . ILE B 1 84 ? -0.229  10.726  -6.720  1.00 12.76 ? 103 ILE B HG22 1 
ATOM   3085 H  HG23 . ILE B 1 84 ? 0.222   11.918  -7.668  1.00 12.76 ? 103 ILE B HG23 1 
ATOM   3086 H  HD11 . ILE B 1 84 ? 2.678   12.774  -5.916  1.00 11.33 ? 103 ILE B HD11 1 
ATOM   3087 H  HD12 . ILE B 1 84 ? 2.791   14.265  -5.378  1.00 11.33 ? 103 ILE B HD12 1 
ATOM   3088 H  HD13 . ILE B 1 84 ? 2.271   13.111  -4.417  1.00 11.33 ? 103 ILE B HD13 1 
ATOM   3089 N  N    . TYR B 1 85 ? -2.811  10.930  -5.245  1.00 9.63  ? 104 TYR B N    1 
ATOM   3090 C  CA   . TYR B 1 85 ? -3.688  9.784   -5.525  1.00 8.43  ? 104 TYR B CA   1 
ATOM   3091 C  C    . TYR B 1 85 ? -5.023  10.207  -6.073  1.00 8.36  ? 104 TYR B C    1 
ATOM   3092 O  O    . TYR B 1 85 ? -5.634  9.427   -6.816  1.00 9.00  ? 104 TYR B O    1 
ATOM   3093 C  CB   . TYR B 1 85 ? -3.902  8.930   -4.276  1.00 9.40  ? 104 TYR B CB   1 
ATOM   3094 C  CG   . TYR B 1 85 ? -2.829  7.925   -3.914  1.00 8.60  ? 104 TYR B CG   1 
ATOM   3095 C  CD1  . TYR B 1 85 ? -1.992  8.170   -2.824  1.00 9.95  ? 104 TYR B CD1  1 
ATOM   3096 C  CD2  . TYR B 1 85 ? -2.712  6.704   -4.582  1.00 9.82  ? 104 TYR B CD2  1 
ATOM   3097 C  CE1  . TYR B 1 85 ? -1.075  7.225   -2.391  1.00 10.15 ? 104 TYR B CE1  1 
ATOM   3098 C  CE2  . TYR B 1 85 ? -1.747  5.759   -4.167  1.00 10.27 ? 104 TYR B CE2  1 
ATOM   3099 C  CZ   . TYR B 1 85 ? -0.930  6.024   -3.084  1.00 9.90  ? 104 TYR B CZ   1 
ATOM   3100 O  OH   . TYR B 1 85 ? 0.011   5.078   -2.630  1.00 12.00 ? 104 TYR B OH   1 
ATOM   3101 H  H    . TYR B 1 85 ? -2.565  11.013  -4.425  1.00 11.56 ? 104 TYR B H    1 
ATOM   3102 H  HA   . TYR B 1 85 ? -3.261  9.226   -6.194  1.00 10.11 ? 104 TYR B HA   1 
ATOM   3103 H  HB2  . TYR B 1 85 ? -3.997  9.527   -3.518  1.00 11.28 ? 104 TYR B HB2  1 
ATOM   3104 H  HB3  . TYR B 1 85 ? -4.727  8.432   -4.392  1.00 11.28 ? 104 TYR B HB3  1 
ATOM   3105 H  HD1  . TYR B 1 85 ? -2.088  8.962   -2.346  1.00 11.95 ? 104 TYR B HD1  1 
ATOM   3106 H  HD2  . TYR B 1 85 ? -3.265  6.515   -5.306  1.00 11.79 ? 104 TYR B HD2  1 
ATOM   3107 H  HE1  . TYR B 1 85 ? -0.520  7.413   -1.669  1.00 12.18 ? 104 TYR B HE1  1 
ATOM   3108 H  HE2  . TYR B 1 85 ? -1.669  4.949   -4.617  1.00 12.32 ? 104 TYR B HE2  1 
ATOM   3109 H  HH   . TYR B 1 85 ? 0.003   4.402   -3.129  1.00 14.41 ? 104 TYR B HH   1 
ATOM   3110 N  N    . ARG B 1 86 ? -5.531  11.400  -5.724  1.00 8.60  ? 105 ARG B N    1 
ATOM   3111 C  CA   . ARG B 1 86 ? -6.779  11.896  -6.323  1.00 8.74  ? 105 ARG B CA   1 
ATOM   3112 C  C    . ARG B 1 86 ? -6.653  12.252  -7.802  1.00 9.18  ? 105 ARG B C    1 
ATOM   3113 O  O    . ARG B 1 86 ? -7.642  12.575  -8.447  1.00 10.87 ? 105 ARG B O    1 
ATOM   3114 C  CB   . ARG B 1 86 ? -7.315  13.083  -5.528  1.00 9.67  ? 105 ARG B CB   1 
ATOM   3115 C  CG   . ARG B 1 86 ? -7.800  12.746  -4.155  1.00 9.23  ? 105 ARG B CG   1 
ATOM   3116 C  CD   . ARG B 1 86 ? -8.274  13.989  -3.417  1.00 10.34 ? 105 ARG B CD   1 
ATOM   3117 N  NE   . ARG B 1 86 ? -8.651  13.741  -2.049  1.00 9.87  ? 105 ARG B NE   1 
ATOM   3118 C  CZ   . ARG B 1 86 ? -9.165  14.656  -1.243  1.00 10.28 ? 105 ARG B CZ   1 
ATOM   3119 N  NH1  . ARG B 1 86 ? -9.343  15.900  -1.707  1.00 13.72 ? 105 ARG B NH1  1 
ATOM   3120 N  NH2  . ARG B 1 86 ? -9.464  14.362  0.021   1.00 10.53 ? 105 ARG B NH2  1 
ATOM   3121 H  H    . ARG B 1 86 ? -5.176  11.934  -5.151  1.00 10.32 ? 105 ARG B H    1 
ATOM   3122 H  HA   . ARG B 1 86 ? -7.441  11.190  -6.258  1.00 10.49 ? 105 ARG B HA   1 
ATOM   3123 H  HB2  . ARG B 1 86 ? -6.607  13.740  -5.436  1.00 11.60 ? 105 ARG B HB2  1 
ATOM   3124 H  HB3  . ARG B 1 86 ? -8.059  13.471  -6.015  1.00 11.60 ? 105 ARG B HB3  1 
ATOM   3125 H  HG2  . ARG B 1 86 ? -8.545  12.128  -4.220  1.00 11.08 ? 105 ARG B HG2  1 
ATOM   3126 H  HG3  . ARG B 1 86 ? -7.076  12.347  -3.647  1.00 11.08 ? 105 ARG B HG3  1 
ATOM   3127 H  HD2  . ARG B 1 86 ? -7.558  14.643  -3.414  1.00 12.41 ? 105 ARG B HD2  1 
ATOM   3128 H  HD3  . ARG B 1 86 ? -9.048  14.351  -3.877  1.00 12.41 ? 105 ARG B HD3  1 
ATOM   3129 H  HE   . ARG B 1 86 ? -8.586  12.935  -1.754  1.00 11.84 ? 105 ARG B HE   1 
ATOM   3130 H  HH11 . ARG B 1 86 ? -9.139  16.088  -2.521  1.00 16.46 ? 105 ARG B HH11 1 
ATOM   3131 H  HH12 . ARG B 1 86 ? -9.674  16.506  -1.195  1.00 16.46 ? 105 ARG B HH12 1 
ATOM   3132 H  HH21 . ARG B 1 86 ? -9.347  13.562  0.316   1.00 12.64 ? 105 ARG B HH21 1 
ATOM   3133 H  HH22 . ARG B 1 86 ? -9.800  14.964  0.535   1.00 12.64 ? 105 ARG B HH22 1 
ATOM   3134 N  N    . ASN B 1 87 ? -5.434  12.155  -8.329  1.00 8.57  ? 106 ASN B N    1 
ATOM   3135 C  CA   . ASN B 1 87 ? -5.148  12.531  -9.710  1.00 9.50  ? 106 ASN B CA   1 
ATOM   3136 C  C    . ASN B 1 87 ? -4.629  11.371  -10.558 1.00 9.78  ? 106 ASN B C    1 
ATOM   3137 O  O    . ASN B 1 87 ? -4.119  11.571  -11.672 1.00 10.46 ? 106 ASN B O    1 
ATOM   3138 C  CB   . ASN B 1 87 ? -4.178  13.718  -9.716  1.00 10.26 ? 106 ASN B CB   1 
ATOM   3139 C  CG   . ASN B 1 87 ? -4.886  14.989  -9.458  1.00 10.73 ? 106 ASN B CG   1 
ATOM   3140 O  OD1  . ASN B 1 87 ? -5.511  15.538  -10.360 1.00 12.68 ? 106 ASN B OD1  1 
ATOM   3141 N  ND2  . ASN B 1 87 ? -4.823  15.481  -8.219  1.00 11.47 ? 106 ASN B ND2  1 
ATOM   3142 H  H    . ASN B 1 87 ? -4.746  11.871  -7.899  1.00 10.28 ? 106 ASN B H    1 
ATOM   3143 H  HA   . ASN B 1 87 ? -5.974  12.835  -10.118 1.00 11.40 ? 106 ASN B HA   1 
ATOM   3144 H  HB2  . ASN B 1 87 ? -3.513  13.593  -9.020  1.00 12.31 ? 106 ASN B HB2  1 
ATOM   3145 H  HB3  . ASN B 1 87 ? -3.749  13.778  -10.584 1.00 12.31 ? 106 ASN B HB3  1 
ATOM   3146 H  HD21 . ASN B 1 87 ? -5.222  16.218  -8.028  1.00 13.76 ? 106 ASN B HD21 1 
ATOM   3147 H  HD22 . ASN B 1 87 ? -4.384  15.060  -7.611  1.00 13.76 ? 106 ASN B HD22 1 
ATOM   3148 N  N    . LEU B 1 88 ? -4.824  10.150  -10.061 1.00 8.87  ? 107 LEU B N    1 
ATOM   3149 C  CA   . LEU B 1 88 ? -4.377  8.966   -10.788 1.00 8.59  ? 107 LEU B CA   1 
ATOM   3150 C  C    . LEU B 1 88 ? -5.149  7.762   -10.307 1.00 7.99  ? 107 LEU B C    1 
ATOM   3151 O  O    . LEU B 1 88 ? -5.926  7.866   -9.360  1.00 9.81  ? 107 LEU B O    1 
ATOM   3152 C  CB   . LEU B 1 88 ? -2.866  8.767   -10.605 1.00 9.15  ? 107 LEU B CB   1 
ATOM   3153 C  CG   . LEU B 1 88 ? -2.305  8.679   -9.165  1.00 9.51  ? 107 LEU B CG   1 
ATOM   3154 C  CD1  . LEU B 1 88 ? -2.673  7.343   -8.509  1.00 11.28 ? 107 LEU B CD1  1 
ATOM   3155 C  CD2  . LEU B 1 88 ? -0.794  8.927   -9.214  1.00 9.89  ? 107 LEU B CD2  1 
ATOM   3156 H  H    . LEU B 1 88 ? -5.210  9.982   -9.310  1.00 10.64 ? 107 LEU B H    1 
ATOM   3157 H  HA   . LEU B 1 88 ? -4.556  9.084   -11.734 1.00 10.30 ? 107 LEU B HA   1 
ATOM   3158 H  HB2  . LEU B 1 88 ? -2.618  7.944   -11.054 1.00 10.98 ? 107 LEU B HB2  1 
ATOM   3159 H  HB3  . LEU B 1 88 ? -2.415  9.510   -11.037 1.00 10.98 ? 107 LEU B HB3  1 
ATOM   3160 H  HG   . LEU B 1 88 ? -2.701  9.386   -8.634  1.00 11.41 ? 107 LEU B HG   1 
ATOM   3161 H  HD11 . LEU B 1 88 ? -3.639  7.264   -8.475  1.00 13.54 ? 107 LEU B HD11 1 
ATOM   3162 H  HD12 . LEU B 1 88 ? -2.300  6.619   -9.037  1.00 13.54 ? 107 LEU B HD12 1 
ATOM   3163 H  HD13 . LEU B 1 88 ? -2.307  7.321   -7.611  1.00 13.54 ? 107 LEU B HD13 1 
ATOM   3164 H  HD21 . LEU B 1 88 ? -0.382  8.252   -9.776  1.00 11.87 ? 107 LEU B HD21 1 
ATOM   3165 H  HD22 . LEU B 1 88 ? -0.631  9.809   -9.583  1.00 11.87 ? 107 LEU B HD22 1 
ATOM   3166 H  HD23 . LEU B 1 88 ? -0.436  8.873   -8.314  1.00 11.87 ? 107 LEU B HD23 1 
ATOM   3167 N  N    . VAL B 1 89 ? -4.903  6.614   -10.959 1.00 8.45  ? 108 VAL B N    1 
ATOM   3168 C  CA   . VAL B 1 89 ? -5.338  5.367   -10.410 1.00 9.17  ? 108 VAL B CA   1 
ATOM   3169 C  C    . VAL B 1 89 ? -4.136  4.451   -10.252 1.00 9.20  ? 108 VAL B C    1 
ATOM   3170 O  O    . VAL B 1 89 ? -3.164  4.518   -11.029 1.00 10.10 ? 108 VAL B O    1 
ATOM   3171 C  CB   . VAL B 1 89 ? -6.404  4.682   -11.264 1.00 11.10 ? 108 VAL B CB   1 
ATOM   3172 C  CG1  . VAL B 1 89 ? -7.659  5.559   -11.397 1.00 12.57 ? 108 VAL B CG1  1 
ATOM   3173 C  CG2  . VAL B 1 89 ? -5.847  4.327   -12.596 1.00 12.43 ? 108 VAL B CG2  1 
ATOM   3174 H  H    . VAL B 1 89 ? -4.489  6.551   -11.710 1.00 10.14 ? 108 VAL B H    1 
ATOM   3175 H  HA   . VAL B 1 89 ? -5.714  5.524   -9.529  1.00 11.01 ? 108 VAL B HA   1 
ATOM   3176 H  HB   . VAL B 1 89 ? -6.667  3.857   -10.827 1.00 13.32 ? 108 VAL B HB   1 
ATOM   3177 H  HG11 . VAL B 1 89 ? -7.521  6.383   -10.905 1.00 15.08 ? 108 VAL B HG11 1 
ATOM   3178 H  HG12 . VAL B 1 89 ? -7.809  5.754   -12.335 1.00 15.08 ? 108 VAL B HG12 1 
ATOM   3179 H  HG13 . VAL B 1 89 ? -8.419  5.079   -11.033 1.00 15.08 ? 108 VAL B HG13 1 
ATOM   3180 H  HG21 . VAL B 1 89 ? -6.538  3.894   -13.122 1.00 14.92 ? 108 VAL B HG21 1 
ATOM   3181 H  HG22 . VAL B 1 89 ? -5.551  5.138   -13.040 1.00 14.92 ? 108 VAL B HG22 1 
ATOM   3182 H  HG23 . VAL B 1 89 ? -5.097  3.724   -12.474 1.00 14.92 ? 108 VAL B HG23 1 
ATOM   3183 N  N    . VAL B 1 90 ? -4.237  3.561   -9.277  1.00 9.27  ? 109 VAL B N    1 
ATOM   3184 C  CA   . VAL B 1 90 ? -3.214  2.539   -9.094  1.00 10.29 ? 109 VAL B CA   1 
ATOM   3185 C  C    . VAL B 1 90 ? -3.513  1.373   -10.025 1.00 13.08 ? 109 VAL B C    1 
ATOM   3186 O  O    . VAL B 1 90 ? -4.668  0.995   -10.204 1.00 16.40 ? 109 VAL B O    1 
ATOM   3187 C  CB   . VAL B 1 90 ? -3.142  2.104   -7.585  1.00 12.75 ? 109 VAL B CB   1 
ATOM   3188 C  CG1  . VAL B 1 90 ? -2.129  1.016   -7.365  1.00 16.04 ? 109 VAL B CG1  1 
ATOM   3189 C  CG2  . VAL B 1 90 ? -2.822  3.318   -6.731  1.00 14.70 ? 109 VAL B CG2  1 
ATOM   3190 H  H    . VAL B 1 90 ? -4.883  3.525   -8.710  1.00 11.12 ? 109 VAL B H    1 
ATOM   3191 H  HA   . VAL B 1 90 ? -2.351  2.907   -9.341  1.00 12.35 ? 109 VAL B HA   1 
ATOM   3192 H  HB   . VAL B 1 90 ? -4.009  1.766   -7.313  1.00 15.30 ? 109 VAL B HB   1 
ATOM   3193 H  HG11 . VAL B 1 90 ? -2.118  0.781   -6.424  1.00 19.24 ? 109 VAL B HG11 1 
ATOM   3194 H  HG12 . VAL B 1 90 ? -2.375  0.244   -7.897  1.00 19.24 ? 109 VAL B HG12 1 
ATOM   3195 H  HG13 . VAL B 1 90 ? -1.255  1.340   -7.635  1.00 19.24 ? 109 VAL B HG13 1 
ATOM   3196 H  HG21 . VAL B 1 90 ? -2.733  4.094   -7.306  1.00 17.64 ? 109 VAL B HG21 1 
ATOM   3197 H  HG22 . VAL B 1 90 ? -3.544  3.456   -6.098  1.00 17.64 ? 109 VAL B HG22 1 
ATOM   3198 H  HG23 . VAL B 1 90 ? -1.991  3.160   -6.257  1.00 17.64 ? 109 VAL B HG23 1 
ATOM   3199 N  N    . VAL B 1 91 ? -2.473  0.819   -10.639 1.00 13.65 ? 110 VAL B N    1 
ATOM   3200 C  CA   . VAL B 1 91 ? -2.683  -0.268  -11.602 1.00 16.98 ? 110 VAL B CA   1 
ATOM   3201 C  C    . VAL B 1 91 ? -2.774  -1.594  -10.890 1.00 22.12 ? 110 VAL B C    1 
ATOM   3202 O  O    . VAL B 1 91 ? -1.896  -1.924  -10.075 1.00 24.08 ? 110 VAL B O    1 
ATOM   3203 C  CB   . VAL B 1 91 ? -1.530  -0.339  -12.624 1.00 16.94 ? 110 VAL B CB   1 
ATOM   3204 C  CG1  . VAL B 1 91 ? -1.630  -1.626  -13.510 1.00 18.91 ? 110 VAL B CG1  1 
ATOM   3205 C  CG2  . VAL B 1 91 ? -1.489  0.895   -13.460 1.00 18.56 ? 110 VAL B CG2  1 
ATOM   3206 H  H    . VAL B 1 91 ? -1.651  1.045   -10.522 1.00 16.38 ? 110 VAL B H    1 
ATOM   3207 H  HA   . VAL B 1 91 ? -3.512  -0.119  -12.083 1.00 20.38 ? 110 VAL B HA   1 
ATOM   3208 H  HB   . VAL B 1 91 ? -0.692  -0.387  -12.137 1.00 20.33 ? 110 VAL B HB   1 
ATOM   3209 H  HG11 . VAL B 1 91 ? -2.409  -2.136  -13.239 1.00 22.70 ? 110 VAL B HG11 1 
ATOM   3210 H  HG12 . VAL B 1 91 ? -1.713  -1.363  -14.440 1.00 22.70 ? 110 VAL B HG12 1 
ATOM   3211 H  HG13 . VAL B 1 91 ? -0.828  -2.157  -13.387 1.00 22.70 ? 110 VAL B HG13 1 
ATOM   3212 H  HG21 . VAL B 1 91 ? -0.756  0.823   -14.092 1.00 22.28 ? 110 VAL B HG21 1 
ATOM   3213 H  HG22 . VAL B 1 91 ? -2.330  0.981   -13.936 1.00 22.28 ? 110 VAL B HG22 1 
ATOM   3214 H  HG23 . VAL B 1 91 ? -1.354  1.663   -12.883 1.00 22.28 ? 110 VAL B HG23 1 
ATOM   3215 N  N    . ASN B 1 92 ? -3.855  -2.322  -11.228 1.00 26.28 ? 111 ASN B N    1 
ATOM   3216 C  CA   . ASN B 1 92 ? -4.113  -3.724  -10.906 1.00 31.89 ? 111 ASN B CA   1 
ATOM   3217 C  C    . ASN B 1 92 ? -3.101  -4.650  -11.554 1.00 35.57 ? 111 ASN B C    1 
ATOM   3218 O  O    . ASN B 1 92 ? -3.342  -5.143  -12.658 1.00 39.20 ? 111 ASN B O    1 
ATOM   3219 C  CB   . ASN B 1 92 ? -5.499  -4.116  -11.458 1.00 33.71 ? 111 ASN B CB   1 
ATOM   3220 C  CG   . ASN B 1 92 ? -6.623  -3.636  -10.582 1.00 37.26 ? 111 ASN B CG   1 
ATOM   3221 O  OD1  . ASN B 1 92 ? -7.326  -4.441  -9.943  1.00 38.88 ? 111 ASN B OD1  1 
ATOM   3222 N  ND2  . ASN B 1 92 ? -6.801  -2.314  -10.518 1.00 39.39 ? 111 ASN B ND2  1 
ATOM   3223 H  H    . ASN B 1 92 ? -4.501  -1.983  -11.684 1.00 31.54 ? 111 ASN B H    1 
ATOM   3224 H  HA   . ASN B 1 92 ? -4.101  -3.857  -9.945  1.00 38.27 ? 111 ASN B HA   1 
ATOM   3225 H  HB2  . ASN B 1 92 ? -5.613  -3.721  -12.337 1.00 40.45 ? 111 ASN B HB2  1 
ATOM   3226 H  HB3  . ASN B 1 92 ? -5.555  -5.082  -11.517 1.00 40.45 ? 111 ASN B HB3  1 
ATOM   3227 H  HD21 . ASN B 1 92 ? -6.286  -1.789  -10.964 1.00 47.26 ? 111 ASN B HD21 1 
ATOM   3228 H  HD22 . ASN B 1 92 ? -7.431  -1.988  -10.031 1.00 47.26 ? 111 ASN B HD22 1 
HETATM 3229 O  O3   . NUT C 2 .  ? -9.537  3.676   -20.926 1.00 11.91 ? 201 NUT A O3   1 
HETATM 3230 C  C25  . NUT C 2 .  ? -8.989  3.506   -22.005 1.00 11.43 ? 201 NUT A C25  1 
HETATM 3231 N  N2   . NUT C 2 .  ? -7.797  2.881   -22.145 1.00 14.96 ? 201 NUT A N2   1 
HETATM 3232 C  C29  . NUT C 2 .  ? -7.283  2.131   -20.995 1.00 17.36 ? 201 NUT A C29  1 
HETATM 3233 C  C28  . NUT C 2 .  ? -5.945  2.550   -20.460 1.00 21.96 ? 201 NUT A C28  1 
HETATM 3234 O  O2   . NUT C 2 .  ? -5.497  2.070   -19.407 1.00 23.62 ? 201 NUT A O2   1 
HETATM 3235 N  N3   . NUT C 2 .  ? -5.272  3.453   -21.165 1.00 23.93 ? 201 NUT A N3   1 
HETATM 3236 C  C27  . NUT C 2 .  ? -5.714  4.091   -22.425 1.00 22.67 ? 201 NUT A C27  1 
HETATM 3237 C  C26  . NUT C 2 .  ? -6.769  3.244   -23.121 1.00 18.64 ? 201 NUT A C26  1 
HETATM 3238 N  N1   . NUT C 2 .  ? -9.738  3.954   -23.079 1.00 11.45 ? 201 NUT A N1   1 
HETATM 3239 C  C10  . NUT C 2 .  ? -9.795  3.534   -24.404 1.00 13.72 ? 201 NUT A C10  1 
HETATM 3240 C  C9   . NUT C 2 .  ? -9.213  2.278   -24.938 1.00 11.99 ? 201 NUT A C9   1 
HETATM 3241 C  C3   . NUT C 2 .  ? -8.468  2.255   -26.116 1.00 12.59 ? 201 NUT A C3   1 
HETATM 3242 C  C2   . NUT C 2 .  ? -7.948  1.070   -26.610 1.00 13.59 ? 201 NUT A C2   1 
HETATM 3243 C  C5   . NUT C 2 .  ? -9.410  1.056   -24.269 1.00 11.22 ? 201 NUT A C5   1 
HETATM 3244 O  O1   . NUT C 2 .  ? -10.192 1.110   -23.140 1.00 10.91 ? 201 NUT A O1   1 
HETATM 3245 C  C6   . NUT C 2 .  ? -10.385 -0.082  -22.290 1.00 9.47  ? 201 NUT A C6   1 
HETATM 3246 C  C8   . NUT C 2 .  ? -11.391 -1.019  -22.827 1.00 9.90  ? 201 NUT A C8   1 
HETATM 3247 C  C7   . NUT C 2 .  ? -10.789 0.506   -20.957 1.00 11.00 ? 201 NUT A C7   1 
HETATM 3248 C  C4   . NUT C 2 .  ? -8.881  -0.132  -24.741 1.00 13.45 ? 201 NUT A C4   1 
HETATM 3249 C  C1   . NUT C 2 .  ? -8.152  -0.122  -25.917 1.00 14.42 ? 201 NUT A C1   1 
HETATM 3250 O  O    . NUT C 2 .  ? -7.676  -1.362  -26.276 1.00 17.33 ? 201 NUT A O    1 
HETATM 3251 C  C    . NUT C 2 .  ? -6.925  -1.467  -27.473 1.00 18.63 ? 201 NUT A C    1 
HETATM 3252 C  C18  . NUT C 2 .  ? -10.634 5.128   -22.979 1.00 12.37 ? 201 NUT A C18  1 
HETATM 3253 C  C19  . NUT C 2 .  ? -12.037 4.754   -22.509 1.00 11.52 ? 201 NUT A C19  1 
HETATM 3254 C  C24  . NUT C 2 .  ? -12.821 5.695   -21.857 1.00 11.07 ? 201 NUT A C24  1 
HETATM 3255 C  C23  . NUT C 2 .  ? -14.124 5.417   -21.483 1.00 9.93  ? 201 NUT A C23  1 
HETATM 3256 C  C22  . NUT C 2 .  ? -14.649 4.167   -21.754 1.00 9.86  ? 201 NUT A C22  1 
HETATM 3257 CL CL1  . NUT C 2 .  ? -16.316 3.826   -21.363 1.00 10.85 ? 201 NUT A CL1  1 
HETATM 3258 C  C21  . NUT C 2 .  ? -13.884 3.193   -22.351 1.00 9.58  ? 201 NUT A C21  1 
HETATM 3259 C  C20  . NUT C 2 .  ? -12.580 3.490   -22.726 1.00 10.51 ? 201 NUT A C20  1 
HETATM 3260 C  C11  . NUT C 2 .  ? -10.576 5.637   -24.448 1.00 13.00 ? 201 NUT A C11  1 
HETATM 3261 N  N    . NUT C 2 .  ? -10.291 4.404   -25.207 1.00 13.10 ? 201 NUT A N    1 
HETATM 3262 C  C12  . NUT C 2 .  ? -11.843 6.328   -24.894 1.00 13.42 ? 201 NUT A C12  1 
HETATM 3263 C  C17  . NUT C 2 .  ? -12.929 5.620   -25.404 1.00 14.79 ? 201 NUT A C17  1 
HETATM 3264 C  C16  . NUT C 2 .  ? -14.077 6.276   -25.815 1.00 15.89 ? 201 NUT A C16  1 
HETATM 3265 C  C15  . NUT C 2 .  ? -14.132 7.652   -25.729 1.00 14.00 ? 201 NUT A C15  1 
HETATM 3266 CL CL   . NUT C 2 .  ? -15.588 8.484   -26.192 1.00 16.98 ? 201 NUT A CL   1 
HETATM 3267 C  C14  . NUT C 2 .  ? -13.077 8.379   -25.222 1.00 12.98 ? 201 NUT A C14  1 
HETATM 3268 C  C13  . NUT C 2 .  ? -11.946 7.709   -24.792 1.00 13.09 ? 201 NUT A C13  1 
HETATM 3269 H  H1   . NUT C 2 .  ? -7.980  2.204   -20.162 1.00 20.84 ? 201 NUT A H1   1 
HETATM 3270 H  H2   . NUT C 2 .  ? -7.170  1.078   -21.247 1.00 20.84 ? 201 NUT A H2   1 
HETATM 3271 H  H3   . NUT C 2 .  ? -4.363  3.746   -20.821 1.00 28.71 ? 201 NUT A H3   1 
HETATM 3272 H  H4   . NUT C 2 .  ? -4.849  4.266   -23.064 1.00 27.20 ? 201 NUT A H4   1 
HETATM 3273 H  H5   . NUT C 2 .  ? -6.105  5.084   -22.209 1.00 27.20 ? 201 NUT A H5   1 
HETATM 3274 H  H6   . NUT C 2 .  ? -6.322  2.354   -23.561 1.00 22.37 ? 201 NUT A H6   1 
HETATM 3275 H  H7   . NUT C 2 .  ? -7.184  3.794   -23.964 1.00 22.37 ? 201 NUT A H7   1 
HETATM 3276 H  H9   . NUT C 2 .  ? -8.295  3.188   -26.652 1.00 15.10 ? 201 NUT A H9   1 
HETATM 3277 H  H10  . NUT C 2 .  ? -7.391  1.134   -27.543 1.00 16.31 ? 201 NUT A H10  1 
HETATM 3278 H  H11  . NUT C 2 .  ? -9.436  -0.602  -22.169 1.00 11.37 ? 201 NUT A H11  1 
HETATM 3279 H  H12  . NUT C 2 .  ? -11.566 -1.863  -22.161 1.00 11.88 ? 201 NUT A H12  1 
HETATM 3280 H  H13  . NUT C 2 .  ? -12.353 -0.529  -22.974 1.00 11.88 ? 201 NUT A H13  1 
HETATM 3281 H  H14  . NUT C 2 .  ? -11.106 -1.445  -23.788 1.00 11.88 ? 201 NUT A H14  1 
HETATM 3282 H  H15  . NUT C 2 .  ? -11.724 1.060   -21.025 1.00 13.20 ? 201 NUT A H15  1 
HETATM 3283 H  H16  . NUT C 2 .  ? -10.938 -0.277  -20.215 1.00 13.20 ? 201 NUT A H16  1 
HETATM 3284 H  H17  . NUT C 2 .  ? -10.045 1.193   -20.559 1.00 13.20 ? 201 NUT A H17  1 
HETATM 3285 H  H18  . NUT C 2 .  ? -9.022  -1.075  -24.215 1.00 16.14 ? 201 NUT A H18  1 
HETATM 3286 H  H19  . NUT C 2 .  ? -7.518  -1.250  -28.361 1.00 22.35 ? 201 NUT A H19  1 
HETATM 3287 H  H20  . NUT C 2 .  ? -6.642  -2.519  -27.489 1.00 22.35 ? 201 NUT A H20  1 
HETATM 3288 H  H21  . NUT C 2 .  ? -6.024  -0.856  -27.459 1.00 22.35 ? 201 NUT A H21  1 
HETATM 3289 H  H22  . NUT C 2 .  ? -10.195 5.879   -22.324 1.00 14.84 ? 201 NUT A H22  1 
HETATM 3290 H  H23  . NUT C 2 .  ? -12.406 6.676   -21.632 1.00 13.28 ? 201 NUT A H23  1 
HETATM 3291 H  H24  . NUT C 2 .  ? -14.727 6.173   -20.982 1.00 11.92 ? 201 NUT A H24  1 
HETATM 3292 H  H25  . NUT C 2 .  ? -14.298 2.202   -22.526 1.00 11.49 ? 201 NUT A H25  1 
HETATM 3293 H  H26  . NUT C 2 .  ? -11.997 2.700   -23.197 1.00 12.61 ? 201 NUT A H26  1 
HETATM 3294 H  H27  . NUT C 2 .  ? -9.735  6.314   -24.591 1.00 15.61 ? 201 NUT A H27  1 
HETATM 3295 H  H30  . NUT C 2 .  ? -12.902 4.535   -25.492 1.00 17.74 ? 201 NUT A H30  1 
HETATM 3296 H  H31  . NUT C 2 .  ? -14.932 5.724   -26.202 1.00 19.07 ? 201 NUT A H31  1 
HETATM 3297 H  H32  . NUT C 2 .  ? -13.142 9.465   -25.164 1.00 15.58 ? 201 NUT A H32  1 
HETATM 3298 H  H33  . NUT C 2 .  ? -11.127 8.288   -24.367 1.00 15.71 ? 201 NUT A H33  1 
HETATM 3299 S  S    . SO4 D 3 .  ? -31.657 4.331   -27.924 1.00 15.15 ? 202 SO4 A S    1 
HETATM 3300 O  O1   . SO4 D 3 .  ? -30.969 3.245   -28.675 1.00 16.12 ? 202 SO4 A O1   1 
HETATM 3301 O  O2   . SO4 D 3 .  ? -31.105 5.632   -28.380 1.00 13.98 ? 202 SO4 A O2   1 
HETATM 3302 O  O3   . SO4 D 3 .  ? -31.446 4.178   -26.464 1.00 15.73 ? 202 SO4 A O3   1 
HETATM 3303 O  O4   . SO4 D 3 .  ? -33.087 4.280   -28.234 1.00 16.38 ? 202 SO4 A O4   1 
HETATM 3304 CL CL   . CL  E 4 .  ? -9.411  8.674   -21.497 1.00 14.50 ? 203 CL  A CL   1 
HETATM 3305 I  I    . IOD F 5 .  ? -13.327 18.232  -20.246 0.43 15.42 ? 204 IOD A I    1 
HETATM 3306 O  O3   . NUT G 2 .  ? 11.254  18.220  -5.418  1.00 11.95 ? 201 NUT B O3   1 
HETATM 3307 C  C25  . NUT G 2 .  ? 11.806  18.368  -4.334  1.00 11.91 ? 201 NUT B C25  1 
HETATM 3308 N  N2   . NUT G 2 .  ? 13.030  18.951  -4.199  1.00 14.76 ? 201 NUT B N2   1 
HETATM 3309 C  C29  . NUT G 2 .  ? 13.529  19.765  -5.306  1.00 17.71 ? 201 NUT B C29  1 
HETATM 3310 C  C28  . NUT G 2 .  ? 14.872  19.358  -5.836  1.00 22.04 ? 201 NUT B C28  1 
HETATM 3311 O  O2   . NUT G 2 .  ? 15.310  19.815  -6.908  1.00 23.44 ? 201 NUT B O2   1 
HETATM 3312 N  N3   . NUT G 2 .  ? 15.565  18.485  -5.101  1.00 23.62 ? 201 NUT B N3   1 
HETATM 3313 C  C27  . NUT G 2 .  ? 15.148  17.857  -3.832  1.00 22.17 ? 201 NUT B C27  1 
HETATM 3314 C  C26  . NUT G 2 .  ? 14.021  18.630  -3.177  1.00 17.46 ? 201 NUT B C26  1 
HETATM 3315 N  N1   . NUT G 2 .  ? 11.065  17.914  -3.258  1.00 12.19 ? 201 NUT B N1   1 
HETATM 3316 C  C10  . NUT G 2 .  ? 10.984  18.337  -1.939  1.00 13.07 ? 201 NUT B C10  1 
HETATM 3317 C  C9   . NUT G 2 .  ? 11.582  19.588  -1.409  1.00 12.27 ? 201 NUT B C9   1 
HETATM 3318 C  C3   . NUT G 2 .  ? 12.316  19.601  -0.221  1.00 13.97 ? 201 NUT B C3   1 
HETATM 3319 C  C2   . NUT G 2 .  ? 12.837  20.782  0.287   1.00 14.89 ? 201 NUT B C2   1 
HETATM 3320 C  C5   . NUT G 2 .  ? 11.388  20.817  -2.071  1.00 10.67 ? 201 NUT B C5   1 
HETATM 3321 O  O1   . NUT G 2 .  ? 10.618  20.765  -3.212  1.00 11.02 ? 201 NUT B O1   1 
HETATM 3322 C  C6   . NUT G 2 .  ? 10.429  21.951  -4.039  1.00 9.83  ? 201 NUT B C6   1 
HETATM 3323 C  C8   . NUT G 2 .  ? 9.411   22.863  -3.477  1.00 10.96 ? 201 NUT B C8   1 
HETATM 3324 C  C7   . NUT G 2 .  ? 10.014  21.399  -5.393  1.00 9.77  ? 201 NUT B C7   1 
HETATM 3325 C  C4   . NUT G 2 .  ? 11.899  22.006  -1.565  1.00 12.79 ? 201 NUT B C4   1 
HETATM 3326 C  C1   . NUT G 2 .  ? 12.624  21.987  -0.384  1.00 13.87 ? 201 NUT B C1   1 
HETATM 3327 O  O    . NUT G 2 .  ? 13.116  23.228  -0.034  1.00 16.40 ? 201 NUT B O    1 
HETATM 3328 C  C    . NUT G 2 .  ? 13.931  23.329  1.120   1.00 18.31 ? 201 NUT B C    1 
HETATM 3329 C  C18  . NUT G 2 .  ? 10.170  16.738  -3.352  1.00 10.86 ? 201 NUT B C18  1 
HETATM 3330 C  C19  . NUT G 2 .  ? 8.768   17.118  -3.828  1.00 10.68 ? 201 NUT B C19  1 
HETATM 3331 C  C24  . NUT G 2 .  ? 7.991   16.180  -4.493  1.00 10.10 ? 201 NUT B C24  1 
HETATM 3332 C  C23  . NUT G 2 .  ? 6.685   16.457  -4.860  1.00 10.34 ? 201 NUT B C23  1 
HETATM 3333 C  C22  . NUT G 2 .  ? 6.158   17.704  -4.583  1.00 9.83  ? 201 NUT B C22  1 
HETATM 3334 CL CL1  . NUT G 2 .  ? 4.487   18.043  -4.975  1.00 10.80 ? 201 NUT B CL1  1 
HETATM 3335 C  C21  . NUT G 2 .  ? 6.913   18.667  -3.956  1.00 9.95  ? 201 NUT B C21  1 
HETATM 3336 C  C20  . NUT G 2 .  ? 8.213   18.369  -3.577  1.00 10.45 ? 201 NUT B C20  1 
HETATM 3337 C  C11  . NUT G 2 .  ? 10.215  16.206  -1.885  1.00 12.91 ? 201 NUT B C11  1 
HETATM 3338 N  N    . NUT G 2 .  ? 10.489  17.454  -1.142  1.00 13.01 ? 201 NUT B N    1 
HETATM 3339 C  C12  . NUT G 2 .  ? 8.962   15.503  -1.410  1.00 13.95 ? 201 NUT B C12  1 
HETATM 3340 C  C17  . NUT G 2 .  ? 7.882   16.213  -0.903  1.00 14.37 ? 201 NUT B C17  1 
HETATM 3341 C  C16  . NUT G 2 .  ? 6.723   15.566  -0.514  1.00 14.78 ? 201 NUT B C16  1 
HETATM 3342 C  C15  . NUT G 2 .  ? 6.656   14.192  -0.614  1.00 13.82 ? 201 NUT B C15  1 
HETATM 3343 CL CL   . NUT G 2 .  ? 5.196   13.378  -0.154  1.00 16.13 ? 201 NUT B CL   1 
HETATM 3344 C  C14  . NUT G 2 .  ? 7.713   13.460  -1.101  1.00 12.79 ? 201 NUT B C14  1 
HETATM 3345 C  C13  . NUT G 2 .  ? 8.858   14.121  -1.504  1.00 13.96 ? 201 NUT B C13  1 
HETATM 3346 H  H1   . NUT G 2 .  ? 12.838  19.724  -6.147  1.00 21.25 ? 201 NUT B H1   1 
HETATM 3347 H  H2   . NUT G 2 .  ? 13.638  20.806  -5.006  1.00 21.25 ? 201 NUT B H2   1 
HETATM 3348 H  H3   . NUT G 2 .  ? 16.483  18.211  -5.437  1.00 28.34 ? 201 NUT B H3   1 
HETATM 3349 H  H4   . NUT G 2 .  ? 16.011  17.766  -3.174  1.00 26.60 ? 201 NUT B H4   1 
HETATM 3350 H  H5   . NUT G 2 .  ? 14.838  16.831  -4.025  1.00 26.60 ? 201 NUT B H5   1 
HETATM 3351 H  H6   . NUT G 2 .  ? 13.573  18.054  -2.369  1.00 20.96 ? 201 NUT B H6   1 
HETATM 3352 H  H7   . NUT G 2 .  ? 14.418  19.524  -2.698  1.00 20.96 ? 201 NUT B H7   1 
HETATM 3353 H  H9   . NUT G 2 .  ? 12.479  18.664  0.310   1.00 16.77 ? 201 NUT B H9   1 
HETATM 3354 H  H10  . NUT G 2 .  ? 13.403  20.703  1.214   1.00 17.86 ? 201 NUT B H10  1 
HETATM 3355 H  H11  . NUT G 2 .  ? 11.374  22.481  -4.147  1.00 11.80 ? 201 NUT B H11  1 
HETATM 3356 H  H12  . NUT G 2 .  ? 9.225   23.722  -4.121  1.00 13.16 ? 201 NUT B H12  1 
HETATM 3357 H  H13  . NUT G 2 .  ? 8.456   22.358  -3.342  1.00 13.16 ? 201 NUT B H13  1 
HETATM 3358 H  H14  . NUT G 2 .  ? 9.692   23.268  -2.506  1.00 13.16 ? 201 NUT B H14  1 
HETATM 3359 H  H15  . NUT G 2 .  ? 9.083   20.836  -5.334  1.00 11.73 ? 201 NUT B H15  1 
HETATM 3360 H  H16  . NUT G 2 .  ? 9.852   22.202  -6.111  1.00 11.73 ? 201 NUT B H16  1 
HETATM 3361 H  H17  . NUT G 2 .  ? 10.759  20.729  -5.819  1.00 11.73 ? 201 NUT B H17  1 
HETATM 3362 H  H18  . NUT G 2 .  ? 11.744  22.958  -2.071  1.00 15.35 ? 201 NUT B H18  1 
HETATM 3363 H  H19  . NUT G 2 .  ? 13.351  23.447  2.035   1.00 21.98 ? 201 NUT B H19  1 
HETATM 3364 H  H20  . NUT G 2 .  ? 14.492  24.245  0.940   1.00 21.98 ? 201 NUT B H20  1 
HETATM 3365 H  H21  . NUT G 2 .  ? 14.627  22.498  1.216   1.00 21.98 ? 201 NUT B H21  1 
HETATM 3366 H  H22  . NUT G 2 .  ? 10.607  15.991  -4.012  1.00 13.03 ? 201 NUT B H22  1 
HETATM 3367 H  H23  . NUT G 2 .  ? 8.412   15.205  -4.733  1.00 12.12 ? 201 NUT B H23  1 
HETATM 3368 H  H24  . NUT G 2 .  ? 6.081   15.701  -5.361  1.00 12.41 ? 201 NUT B H24  1 
HETATM 3369 H  H25  . NUT G 2 .  ? 6.490   19.651  -3.760  1.00 11.94 ? 201 NUT B H25  1 
HETATM 3370 H  H26  . NUT G 2 .  ? 8.785   19.149  -3.076  1.00 12.53 ? 201 NUT B H26  1 
HETATM 3371 H  H27  . NUT G 2 .  ? 11.067  15.544  -1.739  1.00 15.49 ? 201 NUT B H27  1 
HETATM 3372 H  H30  . NUT G 2 .  ? 7.920   17.296  -0.798  1.00 17.24 ? 201 NUT B H30  1 
HETATM 3373 H  H31  . NUT G 2 .  ? 5.868   16.123  -0.133  1.00 17.74 ? 201 NUT B H31  1 
HETATM 3374 H  H32  . NUT G 2 .  ? 7.640   12.375  -1.165  1.00 15.35 ? 201 NUT B H32  1 
HETATM 3375 H  H33  . NUT G 2 .  ? 9.687   13.535  -1.900  1.00 16.75 ? 201 NUT B H33  1 
HETATM 3376 S  S    . SO4 H 3 .  ? 10.849  39.338  -1.595  1.00 15.10 ? 202 SO4 B S    1 
HETATM 3377 O  O1   . SO4 H 3 .  ? 10.301  38.032  -2.040  1.00 14.24 ? 202 SO4 B O1   1 
HETATM 3378 O  O2   . SO4 H 3 .  ? 10.167  40.419  -2.322  1.00 15.28 ? 202 SO4 B O2   1 
HETATM 3379 O  O3   . SO4 H 3 .  ? 12.282  39.427  -1.939  1.00 17.72 ? 202 SO4 B O3   1 
HETATM 3380 O  O4   . SO4 H 3 .  ? 10.664  39.486  -0.133  1.00 16.05 ? 202 SO4 B O4   1 
HETATM 3381 CL CL   . CL  I 4 .  ? 11.366  13.160  -4.828  1.00 14.44 ? 203 CL  B CL   1 
HETATM 3382 I  I    . IOD J 5 .  ? 7.485   3.601   -6.086  0.42 14.64 ? 204 IOD B I    1 
HETATM 3383 I  I    . IOD K 5 .  ? 12.360  6.696   -10.702 0.94 25.12 ? 205 IOD B I    1 
HETATM 3384 I  I    . IOD L 5 .  ? -8.436  15.144  -15.613 0.84 24.10 ? 206 IOD B I    1 
HETATM 3385 O  O    . HOH M 6 .  ? -5.902  -3.034  -22.805 1.00 31.02 ? 301 HOH A O    1 
HETATM 3386 O  O    . HOH M 6 .  ? -33.258 4.081   -24.857 1.00 40.55 ? 302 HOH A O    1 
HETATM 3387 O  O    . HOH M 6 .  ? -15.945 9.132   -0.088  1.00 21.80 ? 303 HOH A O    1 
HETATM 3388 O  O    . HOH M 6 .  ? -33.975 2.392   -29.616 1.00 42.63 ? 304 HOH A O    1 
HETATM 3389 O  O    . HOH M 6 .  ? -13.171 24.671  -13.995 1.00 39.55 ? 305 HOH A O    1 
HETATM 3390 O  O    . HOH M 6 .  ? -18.876 -7.439  -13.114 1.00 28.97 ? 306 HOH A O    1 
HETATM 3391 O  O    . HOH M 6 .  ? -9.414  22.627  -25.321 1.00 36.60 ? 307 HOH A O    1 
HETATM 3392 O  O    . HOH M 6 .  ? -11.313 31.491  -21.256 1.00 16.10 ? 308 HOH A O    1 
HETATM 3393 O  O    . HOH M 6 .  ? -6.395  -4.820  -16.839 1.00 49.19 ? 309 HOH A O    1 
HETATM 3394 O  O    . HOH M 6 .  ? -5.232  -8.077  -19.432 1.00 28.56 ? 310 HOH A O    1 
HETATM 3395 O  O    . HOH M 6 .  ? -28.888 6.473   -15.709 1.00 25.59 ? 311 HOH A O    1 
HETATM 3396 O  O    . HOH M 6 .  ? -23.761 13.797  -8.042  1.00 29.41 ? 312 HOH A O    1 
HETATM 3397 O  O    . HOH M 6 .  ? -20.533 19.177  -22.808 1.00 13.49 ? 313 HOH A O    1 
HETATM 3398 O  O    . HOH M 6 .  ? -8.669  2.873   -8.704  1.00 13.51 ? 314 HOH A O    1 
HETATM 3399 O  O    . HOH M 6 .  ? -10.452 17.856  -16.351 1.00 23.05 ? 315 HOH A O    1 
HETATM 3400 O  O    . HOH M 6 .  ? -8.330  9.040   -8.332  1.00 11.15 ? 316 HOH A O    1 
HETATM 3401 O  O    . HOH M 6 .  ? -13.225 -2.275  -31.716 1.00 11.35 ? 317 HOH A O    1 
HETATM 3402 O  O    . HOH M 6 .  ? -17.098 28.032  -22.087 1.00 19.86 ? 318 HOH A O    1 
HETATM 3403 O  O    . HOH M 6 .  ? -21.781 2.969   -32.635 1.00 23.78 ? 319 HOH A O    1 
HETATM 3404 O  O    . HOH M 6 .  ? -8.101  28.527  -22.707 1.00 23.52 ? 320 HOH A O    1 
HETATM 3405 O  O    . HOH M 6 .  ? -21.102 14.284  -7.398  1.00 27.87 ? 321 HOH A O    1 
HETATM 3406 O  O    . HOH M 6 .  ? -26.732 -4.678  -17.494 1.00 24.25 ? 322 HOH A O    1 
HETATM 3407 O  O    . HOH M 6 .  ? -14.048 7.390   -3.726  1.00 15.47 ? 323 HOH A O    1 
HETATM 3408 O  O    . HOH M 6 .  ? -14.414 -9.970  -28.536 1.00 11.35 ? 324 HOH A O    1 
HETATM 3409 O  O    . HOH M 6 .  ? -23.775 -1.442  -27.753 1.00 16.35 ? 325 HOH A O    1 
HETATM 3410 O  O    . HOH M 6 .  ? -10.387 11.669  -20.795 1.00 22.29 ? 326 HOH A O    1 
HETATM 3411 O  O    . HOH M 6 .  ? -7.319  0.755   -13.535 1.00 24.23 ? 327 HOH A O    1 
HETATM 3412 O  O    . HOH M 6 .  ? -18.049 15.412  -2.364  1.00 40.89 ? 328 HOH A O    1 
HETATM 3413 O  O    . HOH M 6 .  ? -24.738 -11.467 -19.460 1.00 25.71 ? 329 HOH A O    1 
HETATM 3414 O  O    . HOH M 6 .  ? -27.447 -5.606  -20.866 1.00 27.91 ? 330 HOH A O    1 
HETATM 3415 O  O    . HOH M 6 .  ? -15.950 25.102  -16.999 1.00 27.93 ? 331 HOH A O    1 
HETATM 3416 O  O    . HOH M 6 .  ? -18.675 2.942   -4.595  1.00 20.93 ? 332 HOH A O    1 
HETATM 3417 O  O    . HOH M 6 .  ? -9.779  0.546   -30.641 1.00 19.66 ? 333 HOH A O    1 
HETATM 3418 O  O    . HOH M 6 .  ? -15.728 25.567  -19.857 1.00 31.02 ? 334 HOH A O    1 
HETATM 3419 O  O    . HOH M 6 .  ? -8.763  5.405   -18.864 1.00 12.63 ? 335 HOH A O    1 
HETATM 3420 O  O    . HOH M 6 .  ? -3.244  -7.148  -21.401 1.00 46.99 ? 336 HOH A O    1 
HETATM 3421 O  O    . HOH M 6 .  ? -14.337 -6.390  -33.113 1.00 11.57 ? 337 HOH A O    1 
HETATM 3422 O  O    . HOH M 6 .  ? -8.641  -3.147  -22.498 1.00 23.15 ? 338 HOH A O    1 
HETATM 3423 O  O    . HOH M 6 .  ? -12.148 14.777  -3.773  1.00 31.58 ? 339 HOH A O    1 
HETATM 3424 O  O    . HOH M 6 .  ? -5.544  16.684  -21.652 1.00 38.59 ? 340 HOH A O    1 
HETATM 3425 O  O    . HOH M 6 .  ? -27.217 18.066  -18.872 1.00 10.52 ? 341 HOH A O    1 
HETATM 3426 O  O    . HOH M 6 .  ? -7.532  1.215   -10.535 1.00 19.77 ? 342 HOH A O    1 
HETATM 3427 O  O    . HOH M 6 .  ? -13.250 0.618   -4.255  1.00 28.35 ? 343 HOH A O    1 
HETATM 3428 O  O    . HOH M 6 .  ? -18.474 7.397   1.144   1.00 45.43 ? 344 HOH A O    1 
HETATM 3429 O  O    . HOH M 6 .  ? -13.247 5.803   -33.210 1.00 30.59 ? 345 HOH A O    1 
HETATM 3430 O  O    . HOH M 6 .  ? -18.578 -7.095  -9.403  1.00 38.65 ? 346 HOH A O    1 
HETATM 3431 O  O    . HOH M 6 .  ? -26.102 6.860   -13.106 1.00 18.40 ? 347 HOH A O    1 
HETATM 3432 O  O    . HOH M 6 .  ? -6.362  -7.209  -27.518 1.00 14.82 ? 348 HOH A O    1 
HETATM 3433 O  O    . HOH M 6 .  ? -30.063 4.706   -21.967 1.00 31.80 ? 349 HOH A O    1 
HETATM 3434 O  O    . HOH M 6 .  ? -10.977 4.879   -28.040 1.00 17.98 ? 350 HOH A O    1 
HETATM 3435 O  O    . HOH M 6 .  ? -8.518  -10.383 -18.581 1.00 24.71 ? 351 HOH A O    1 
HETATM 3436 O  O    . HOH M 6 .  ? -14.754 29.010  -19.037 1.00 28.80 ? 352 HOH A O    1 
HETATM 3437 O  O    . HOH M 6 .  ? -21.176 -4.409  -10.752 1.00 21.14 ? 353 HOH A O    1 
HETATM 3438 O  O    . HOH M 6 .  ? -25.833 24.432  -10.496 1.00 27.73 ? 354 HOH A O    1 
HETATM 3439 O  O    . HOH M 6 .  ? -11.387 -10.482 -19.042 1.00 22.39 ? 355 HOH A O    1 
HETATM 3440 O  O    . HOH M 6 .  ? -9.921  25.800  -17.119 1.00 38.27 ? 356 HOH A O    1 
HETATM 3441 O  O    . HOH M 6 .  ? -14.310 11.573  -29.790 1.00 30.50 ? 357 HOH A O    1 
HETATM 3442 O  O    . HOH M 6 .  ? -20.676 5.420   -31.745 1.00 13.20 ? 358 HOH A O    1 
HETATM 3443 O  O    . HOH M 6 .  ? -4.128  -4.907  -20.555 1.00 32.89 ? 359 HOH A O    1 
HETATM 3444 O  O    . HOH M 6 .  ? -19.887 22.711  -18.399 1.00 22.75 ? 360 HOH A O    1 
HETATM 3445 O  O    . HOH M 6 .  ? -10.399 6.103   -30.309 1.00 55.82 ? 361 HOH A O    1 
HETATM 3446 O  O    . HOH M 6 .  ? -18.642 7.573   -33.122 1.00 25.16 ? 362 HOH A O    1 
HETATM 3447 O  O    . HOH M 6 .  ? -20.466 13.700  -4.201  1.00 34.32 ? 363 HOH A O    1 
HETATM 3448 O  O    . HOH M 6 .  ? -15.384 19.189  -24.911 1.00 36.63 ? 364 HOH A O    1 
HETATM 3449 O  O    . HOH M 6 .  ? -9.849  22.043  -14.386 1.00 51.85 ? 365 HOH A O    1 
HETATM 3450 O  O    . HOH M 6 .  ? -26.768 23.450  -12.901 1.00 22.88 ? 366 HOH A O    1 
HETATM 3451 O  O    . HOH M 6 .  ? -24.556 -4.084  -27.660 1.00 32.86 ? 367 HOH A O    1 
HETATM 3452 O  O    . HOH M 6 .  ? -28.082 -3.834  -19.534 1.00 44.23 ? 368 HOH A O    1 
HETATM 3453 O  O    . HOH M 6 .  ? -7.192  -17.068 -29.595 1.00 40.36 ? 369 HOH A O    1 
HETATM 3454 O  O    . HOH M 6 .  ? -15.735 18.885  -5.163  1.00 37.97 ? 370 HOH A O    1 
HETATM 3455 O  O    . HOH M 6 .  ? -13.407 31.860  -12.501 1.00 47.19 ? 371 HOH A O    1 
HETATM 3456 O  O    . HOH M 6 .  ? -6.688  6.462   -20.351 1.00 30.70 ? 372 HOH A O    1 
HETATM 3457 O  O    . HOH M 6 .  ? -24.237 25.936  -9.725  1.00 48.03 ? 373 HOH A O    1 
HETATM 3458 O  O    . HOH M 6 .  ? -16.157 2.630   -3.284  1.00 24.15 ? 374 HOH A O    1 
HETATM 3459 O  O    . HOH M 6 .  ? -13.626 -1.357  -8.795  1.00 40.18 ? 375 HOH A O    1 
HETATM 3460 O  O    . HOH M 6 .  ? -4.185  6.787   -20.072 1.00 45.49 ? 376 HOH A O    1 
HETATM 3461 O  O    . HOH M 6 .  ? -15.018 -1.838  -7.197  1.00 52.05 ? 377 HOH A O    1 
HETATM 3462 O  O    . HOH M 6 .  ? -24.824 7.156   -34.925 1.00 33.38 ? 378 HOH A O    1 
HETATM 3463 O  O    . HOH M 6 .  ? -15.797 4.676   -1.330  1.00 25.68 ? 379 HOH A O    1 
HETATM 3464 O  O    . HOH M 6 .  ? -10.154 3.248   -30.175 1.00 22.65 ? 380 HOH A O    1 
HETATM 3465 O  O    . HOH M 6 .  ? -23.449 5.553   -32.659 1.00 26.62 ? 381 HOH A O    1 
HETATM 3466 O  O    . HOH M 6 .  ? -14.501 -1.196  -4.590  1.00 49.01 ? 382 HOH A O    1 
HETATM 3467 O  O    . HOH M 6 .  ? -10.897 4.737   -32.258 1.00 31.37 ? 383 HOH A O    1 
HETATM 3468 O  O    . HOH M 6 .  ? -14.288 -3.575  -8.227  1.00 53.25 ? 384 HOH A O    1 
HETATM 3469 O  O    . HOH M 6 .  ? -9.585  7.671   -31.696 1.00 41.81 ? 385 HOH A O    1 
HETATM 3470 O  O    . HOH M 6 .  ? -15.756 0.291   -3.736  1.00 38.52 ? 386 HOH A O    1 
HETATM 3471 O  O    . HOH M 6 .  ? -17.190 27.203  -15.665 1.00 37.62 ? 387 HOH A O    1 
HETATM 3472 O  O    . HOH N 6 .  ? 2.922   6.457   -23.843 1.00 45.00 ? 301 HOH B O    1 
HETATM 3473 O  O    . HOH N 6 .  ? 9.434   -9.684  -5.050  1.00 15.34 ? 302 HOH B O    1 
HETATM 3474 O  O    . HOH N 6 .  ? 7.516   -2.915  -12.260 1.00 46.76 ? 303 HOH B O    1 
HETATM 3475 O  O    . HOH N 6 .  ? 13.208  41.050  -3.572  1.00 40.47 ? 304 HOH B O    1 
HETATM 3476 O  O    . HOH N 6 .  ? 15.517  29.945  -6.826  1.00 28.68 ? 305 HOH B O    1 
HETATM 3477 O  O    . HOH N 6 .  ? -2.903  7.936   -18.109 1.00 29.13 ? 306 HOH B O    1 
HETATM 3478 O  O    . HOH N 6 .  ? 4.870   12.758  -26.281 1.00 20.93 ? 307 HOH B O    1 
HETATM 3479 O  O    . HOH N 6 .  ? 14.861  24.790  -3.527  1.00 28.86 ? 308 HOH B O    1 
HETATM 3480 O  O    . HOH N 6 .  ? -8.015  15.397  -10.679 1.00 24.95 ? 309 HOH B O    1 
HETATM 3481 O  O    . HOH N 6 .  ? -5.902  26.533  -8.785  1.00 25.76 ? 310 HOH B O    1 
HETATM 3482 O  O    . HOH N 6 .  ? 12.161  18.992  -17.640 1.00 14.47 ? 311 HOH B O    1 
HETATM 3483 O  O    . HOH N 6 .  ? 14.206  26.744  -9.582  1.00 40.27 ? 312 HOH B O    1 
HETATM 3484 O  O    . HOH N 6 .  ? 1.840   29.343  -13.150 1.00 29.80 ? 313 HOH B O    1 
HETATM 3485 O  O    . HOH N 6 .  ? 0.281   2.648   -3.559  1.00 12.30 ? 314 HOH B O    1 
HETATM 3486 O  O    . HOH N 6 .  ? -1.039  18.879  6.253   1.00 25.24 ? 315 HOH B O    1 
HETATM 3487 O  O    . HOH N 6 .  ? -2.910  23.256  1.404   1.00 16.38 ? 316 HOH B O    1 
HETATM 3488 O  O    . HOH N 6 .  ? 12.506  12.820  -18.019 1.00 11.35 ? 317 HOH B O    1 
HETATM 3489 O  O    . HOH N 6 .  ? 7.573   24.150  5.371   1.00 11.66 ? 318 HOH B O    1 
HETATM 3490 O  O    . HOH N 6 .  ? 5.038   2.895   -3.497  1.00 21.47 ? 319 HOH B O    1 
HETATM 3491 O  O    . HOH N 6 .  ? 12.703  -6.606  -3.585  1.00 23.60 ? 320 HOH B O    1 
HETATM 3492 O  O    . HOH N 6 .  ? 6.376   31.837  2.224   1.00 11.05 ? 321 HOH B O    1 
HETATM 3493 O  O    . HOH N 6 .  ? 3.652   -6.170  -4.216  1.00 21.04 ? 322 HOH B O    1 
HETATM 3494 O  O    . HOH N 6 .  ? 13.412  21.098  -12.824 1.00 23.89 ? 323 HOH B O    1 
HETATM 3495 O  O    . HOH N 6 .  ? -0.301  7.580   -18.844 1.00 29.50 ? 324 HOH B O    1 
HETATM 3496 O  O    . HOH N 6 .  ? -3.293  14.536  -21.314 1.00 30.11 ? 325 HOH B O    1 
HETATM 3497 O  O    . HOH N 6 .  ? 10.400  10.205  -5.523  1.00 22.53 ? 326 HOH B O    1 
HETATM 3498 O  O    . HOH N 6 .  ? 6.766   14.475  -22.647 1.00 16.10 ? 327 HOH B O    1 
HETATM 3499 O  O    . HOH N 6 .  ? 5.065   -3.750  -6.441  1.00 32.05 ? 328 HOH B O    1 
HETATM 3500 O  O    . HOH N 6 .  ? 11.447  -0.736  -1.216  1.00 31.83 ? 329 HOH B O    1 
HETATM 3501 O  O    . HOH N 6 .  ? 2.150   18.862  -21.746 1.00 20.00 ? 330 HOH B O    1 
HETATM 3502 O  O    . HOH N 6 .  ? 11.017  21.275  4.311   1.00 19.44 ? 331 HOH B O    1 
HETATM 3503 O  O    . HOH N 6 .  ? 12.049  16.478  -7.447  1.00 12.92 ? 332 HOH B O    1 
HETATM 3504 O  O    . HOH N 6 .  ? 7.440   16.020  6.820   1.00 28.66 ? 333 HOH B O    1 
HETATM 3505 O  O    . HOH N 6 .  ? 8.596   7.037   -22.497 1.00 30.88 ? 334 HOH B O    1 
HETATM 3506 O  O    . HOH N 6 .  ? -6.692  27.465  -5.458  1.00 30.13 ? 335 HOH B O    1 
HETATM 3507 O  O    . HOH N 6 .  ? 2.119   28.838  -17.044 1.00 39.61 ? 336 HOH B O    1 
HETATM 3508 O  O    . HOH N 6 .  ? 10.353  25.780  -18.042 1.00 48.78 ? 337 HOH B O    1 
HETATM 3509 O  O    . HOH N 6 .  ? 12.162  24.959  -3.802  1.00 21.61 ? 338 HOH B O    1 
HETATM 3510 O  O    . HOH N 6 .  ? -6.406  3.774   -7.444  1.00 10.92 ? 339 HOH B O    1 
HETATM 3511 O  O    . HOH N 6 .  ? 4.897   -3.324  -9.426  1.00 29.95 ? 340 HOH B O    1 
HETATM 3512 O  O    . HOH N 6 .  ? -9.089  17.216  -4.241  1.00 30.81 ? 341 HOH B O    1 
HETATM 3513 O  O    . HOH N 6 .  ? 6.395   28.252  6.795   1.00 11.40 ? 342 HOH B O    1 
HETATM 3514 O  O    . HOH N 6 .  ? 7.483   21.371  -21.971 1.00 30.40 ? 343 HOH B O    1 
HETATM 3515 O  O    . HOH N 6 .  ? 15.212  5.103   -4.734  1.00 38.18 ? 344 HOH B O    1 
HETATM 3516 O  O    . HOH N 6 .  ? 17.282  33.687  -2.274  1.00 46.89 ? 345 HOH B O    1 
HETATM 3517 O  O    . HOH N 6 .  ? 13.288  20.652  -15.757 1.00 22.29 ? 346 HOH B O    1 
HETATM 3518 O  O    . HOH N 6 .  ? 9.808   17.002  1.719   1.00 18.60 ? 347 HOH B O    1 
HETATM 3519 O  O    . HOH N 6 .  ? 9.982   2.041   -8.513  1.00 43.64 ? 348 HOH B O    1 
HETATM 3520 O  O    . HOH N 6 .  ? 16.720  26.684  -5.644  1.00 31.59 ? 349 HOH B O    1 
HETATM 3521 O  O    . HOH N 6 .  ? 14.453  29.037  1.161   1.00 15.11 ? 350 HOH B O    1 
HETATM 3522 O  O    . HOH N 6 .  ? -0.381  26.180  -15.590 1.00 21.21 ? 351 HOH B O    1 
HETATM 3523 O  O    . HOH N 6 .  ? 6.101   -7.194  -7.297  1.00 27.19 ? 352 HOH B O    1 
HETATM 3524 O  O    . HOH N 6 .  ? 12.210  32.296  -7.751  1.00 25.69 ? 353 HOH B O    1 
HETATM 3525 O  O    . HOH N 6 .  ? 9.378   32.358  -7.317  1.00 20.66 ? 354 HOH B O    1 
HETATM 3526 O  O    . HOH N 6 .  ? 6.363   10.296  3.286   1.00 33.53 ? 355 HOH B O    1 
HETATM 3527 O  O    . HOH N 6 .  ? 0.816   -0.850  -8.037  1.00 25.00 ? 356 HOH B O    1 
HETATM 3528 O  O    . HOH N 6 .  ? 3.440   24.409  -17.624 1.00 33.33 ? 357 HOH B O    1 
HETATM 3529 O  O    . HOH N 6 .  ? 2.156   14.232  6.777   1.00 23.05 ? 358 HOH B O    1 
HETATM 3530 O  O    . HOH N 6 .  ? 4.474   2.618   -19.549 1.00 31.24 ? 359 HOH B O    1 
HETATM 3531 O  O    . HOH N 6 .  ? -4.871  -2.699  -15.852 1.00 32.86 ? 360 HOH B O    1 
HETATM 3532 O  O    . HOH N 6 .  ? 0.365   -1.205  -17.173 1.00 35.63 ? 361 HOH B O    1 
HETATM 3533 O  O    . HOH N 6 .  ? -3.655  25.941  1.095   1.00 31.54 ? 362 HOH B O    1 
HETATM 3534 O  O    . HOH N 6 .  ? 10.391  -3.923  -9.321  1.00 39.91 ? 363 HOH B O    1 
HETATM 3535 O  O    . HOH N 6 .  ? 0.133   16.452  5.440   1.00 13.84 ? 364 HOH B O    1 
HETATM 3536 O  O    . HOH N 6 .  ? -5.999  -1.557  -13.459 1.00 22.21 ? 365 HOH B O    1 
HETATM 3537 O  O    . HOH N 6 .  ? 1.401   24.099  -17.335 1.00 36.68 ? 366 HOH B O    1 
HETATM 3538 O  O    . HOH N 6 .  ? 2.776   0.606   -19.512 1.00 48.34 ? 367 HOH B O    1 
HETATM 3539 O  O    . HOH N 6 .  ? -3.340  -3.951  -16.664 1.00 50.34 ? 368 HOH B O    1 
HETATM 3540 O  O    . HOH N 6 .  ? 1.644   13.635  -28.025 1.00 51.81 ? 369 HOH B O    1 
HETATM 3541 O  O    . HOH N 6 .  ? 7.584   -9.947  -13.762 1.00 36.70 ? 370 HOH B O    1 
HETATM 3542 O  O    . HOH N 6 .  ? -7.288  25.846  -7.120  1.00 45.54 ? 371 HOH B O    1 
HETATM 3543 O  O    . HOH N 6 .  ? 9.204   10.732  2.368   1.00 49.60 ? 372 HOH B O    1 
HETATM 3544 O  O    . HOH N 6 .  ? 14.112  15.469  -5.906  1.00 33.93 ? 373 HOH B O    1 
HETATM 3545 O  O    . HOH N 6 .  ? 4.573   19.200  -23.053 1.00 22.92 ? 374 HOH B O    1 
HETATM 3546 O  O    . HOH N 6 .  ? 5.127   17.264  -24.962 1.00 26.45 ? 375 HOH B O    1 
HETATM 3547 O  O    . HOH N 6 .  ? -4.013  14.811  8.566   1.00 33.64 ? 376 HOH B O    1 
HETATM 3548 O  O    . HOH N 6 .  ? 10.619  18.560  3.838   1.00 23.76 ? 377 HOH B O    1 
HETATM 3549 O  O    . HOH N 6 .  ? 10.340  6.414   -20.512 1.00 36.47 ? 378 HOH B O    1 
HETATM 3550 O  O    . HOH N 6 .  ? -2.639  16.282  6.388   1.00 25.58 ? 379 HOH B O    1 
HETATM 3551 O  O    . HOH N 6 .  ? 5.256   4.600   -2.379  1.00 47.74 ? 380 HOH B O    1 
HETATM 3552 O  O    . HOH N 6 .  ? 9.912   17.098  5.885   1.00 32.52 ? 381 HOH B O    1 
HETATM 3553 O  O    . HOH N 6 .  ? 2.051   24.040  -19.291 1.00 62.96 ? 382 HOH B O    1 
HETATM 3554 O  O    . HOH N 6 .  ? -0.695  24.863  -17.891 1.00 39.57 ? 383 HOH B O    1 
HETATM 3555 O  O    . HOH N 6 .  ? 3.653   -5.439  -10.571 1.00 36.88 ? 384 HOH B O    1 
HETATM 3556 O  O    . HOH N 6 .  ? 11.272  12.116  0.673   1.00 43.26 ? 385 HOH B O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . PRO A 1  ? 0.4015 0.3661 0.3790 -0.0246 -0.0027 -0.0180 20  PRO A N   
2    C  CA  . PRO A 1  ? 0.4026 0.3547 0.3774 -0.0187 -0.0227 -0.0292 20  PRO A CA  
3    C  C   . PRO A 1  ? 0.3745 0.3527 0.3485 -0.0027 -0.0534 -0.0342 20  PRO A C   
4    O  O   . PRO A 1  ? 0.3833 0.3734 0.3830 0.0191  -0.0738 -0.0350 20  PRO A O   
5    C  CB  . PRO A 1  ? 0.4200 0.3487 0.3902 -0.0278 -0.0107 -0.0266 20  PRO A CB  
6    C  CG  . PRO A 1  ? 0.4225 0.3484 0.3942 -0.0217 0.0071  -0.0279 20  PRO A CG  
7    C  CD  . PRO A 1  ? 0.4119 0.3582 0.3941 -0.0325 0.0051  -0.0211 20  PRO A CD  
15   N  N   . ALA A 2  ? 0.3401 0.3138 0.2955 -0.0155 -0.0641 -0.0431 21  ALA A N   
16   C  CA  . ALA A 2  ? 0.2897 0.2819 0.2788 -0.0305 -0.0637 -0.0310 21  ALA A CA  
17   C  C   . ALA A 2  ? 0.2550 0.2508 0.2559 -0.0244 -0.0817 0.0173  21  ALA A C   
18   O  O   . ALA A 2  ? 0.2180 0.2747 0.2674 -0.0229 -0.0566 0.0486  21  ALA A O   
19   C  CB  . ALA A 2  ? 0.2677 0.3089 0.2835 -0.0462 -0.0857 -0.0413 21  ALA A CB  
25   N  N   . SER A 3  ? 0.2427 0.2294 0.2292 -0.0276 -0.0887 0.0449  22  SER A N   
26   C  CA  . SER A 3  ? 0.2456 0.2213 0.2026 -0.0086 -0.0986 0.0284  22  SER A CA  
27   C  C   . SER A 3  ? 0.2380 0.2298 0.1647 -0.0064 -0.0828 0.0415  22  SER A C   
28   O  O   . SER A 3  ? 0.2608 0.2869 0.1774 -0.0087 -0.0704 0.0671  22  SER A O   
29   C  CB  . SER A 3  ? 0.2762 0.2038 0.2093 -0.0326 -0.0961 0.0147  22  SER A CB  
30   O  OG  . SER A 3  ? 0.3065 0.2030 0.2205 -0.0078 -0.0921 0.0160  22  SER A OG  
36   N  N   . GLU A 4  ? 0.2034 0.1772 0.1270 0.0143  -0.0625 0.0156  23  GLU A N   
37   C  CA  . GLU A 4  ? 0.2154 0.1801 0.1581 0.0010  -0.0780 0.0161  23  GLU A CA  
38   C  C   . GLU A 4  ? 0.1902 0.1597 0.1580 0.0036  -0.0947 0.0071  23  GLU A C   
39   O  O   . GLU A 4  ? 0.1967 0.1665 0.1758 -0.0032 -0.0714 -0.0079 23  GLU A O   
40   C  CB  . GLU A 4  ? 0.2317 0.1778 0.1773 -0.0011 -0.0593 0.0417  23  GLU A CB  
41   C  CG  . GLU A 4  ? 0.2381 0.1809 0.2242 0.0086  -0.0423 0.0237  23  GLU A CG  
42   C  CD  . GLU A 4  ? 0.2485 0.2086 0.2590 -0.0147 -0.0266 -0.0095 23  GLU A CD  
43   O  OE1 . GLU A 4  ? 0.2627 0.2176 0.2646 -0.0228 0.0029  -0.0106 23  GLU A OE1 
44   O  OE2 . GLU A 4  ? 0.2719 0.2059 0.2863 -0.0152 -0.0315 -0.0230 23  GLU A OE2 
51   N  N   . GLN A 5  ? 0.2140 0.1813 0.1806 -0.0194 -0.0785 -0.0032 24  GLN A N   
52   C  CA  . GLN A 5  ? 0.2068 0.1570 0.1503 -0.0249 -0.0809 0.0018  24  GLN A CA  
53   C  C   . GLN A 5  ? 0.1825 0.1723 0.1504 -0.0048 -0.0919 0.0269  24  GLN A C   
54   O  O   . GLN A 5  ? 0.2136 0.2131 0.1740 -0.0388 -0.0800 0.0046  24  GLN A O   
55   C  CB  . GLN A 5  ? 0.2511 0.1784 0.1691 -0.0335 -0.0710 -0.0181 24  GLN A CB  
56   C  CG  . GLN A 5  ? 0.2741 0.2187 0.1727 -0.0065 -0.0540 -0.0033 24  GLN A CG  
57   C  CD  . GLN A 5  ? 0.3018 0.2314 0.1964 0.0271  -0.0581 -0.0227 24  GLN A CD  
58   O  OE1 . GLN A 5  ? 0.2969 0.2698 0.1997 0.0531  -0.0473 -0.0231 24  GLN A OE1 
59   N  NE2 . GLN A 5  ? 0.2955 0.2219 0.2029 0.0495  -0.0620 -0.0267 24  GLN A NE2 
68   N  N   . GLU A 6  ? 0.1910 0.1960 0.1625 -0.0408 -0.0752 0.0202  25  GLU A N   
69   C  CA  . GLU A 6  ? 0.1850 0.2178 0.1727 -0.0447 -0.0911 0.0411  25  GLU A CA  
70   C  C   . GLU A 6  ? 0.1712 0.1645 0.1430 -0.0290 -0.0765 0.0225  25  GLU A C   
71   O  O   . GLU A 6  ? 0.1841 0.1684 0.1370 -0.0002 -0.0758 0.0237  25  GLU A O   
72   C  CB  . GLU A 6  ? 0.2093 0.2871 0.1895 -0.0595 -0.1058 0.0455  25  GLU A CB  
73   C  CG  . GLU A 6  ? 0.2514 0.3755 0.2381 -0.0321 -0.1404 -0.0111 25  GLU A CG  
74   C  CD  . GLU A 6  ? 0.2968 0.4388 0.2790 0.0088  -0.1433 -0.0456 25  GLU A CD  
75   O  OE1 . GLU A 6  ? 0.3228 0.4809 0.2897 0.0273  -0.1567 -0.0569 25  GLU A OE1 
76   O  OE2 . GLU A 6  ? 0.2926 0.4519 0.3077 0.0036  -0.1275 -0.0528 25  GLU A OE2 
83   N  N   . THR A 7  ? 0.1878 0.1332 0.1331 -0.0137 -0.0523 0.0105  26  THR A N   
84   C  CA  . THR A 7  ? 0.1994 0.1135 0.1314 0.0062  -0.0549 0.0399  26  THR A CA  
85   C  C   . THR A 7  ? 0.2098 0.1459 0.1451 -0.0150 -0.0628 0.0592  26  THR A C   
86   O  O   . THR A 7  ? 0.2447 0.1498 0.1626 -0.0019 -0.0796 0.0618  26  THR A O   
87   C  CB  . THR A 7  ? 0.1903 0.1435 0.1497 -0.0200 -0.0835 0.0548  26  THR A CB  
88   O  OG1 . THR A 7  ? 0.1832 0.1328 0.1649 -0.0145 -0.0889 0.0468  26  THR A OG1 
89   C  CG2 . THR A 7  ? 0.2293 0.2110 0.1452 -0.0723 -0.0779 0.0755  26  THR A CG2 
97   N  N   . LEU A 8  ? 0.2221 0.1459 0.1498 0.0056  -0.0597 0.0493  27  LEU A N   
98   C  CA  . LEU A 8  ? 0.2189 0.1285 0.1590 -0.0116 -0.0438 0.0251  27  LEU A CA  
99   C  C   . LEU A 8  ? 0.1937 0.0997 0.1324 0.0092  -0.0679 0.0318  27  LEU A C   
100  O  O   . LEU A 8  ? 0.1758 0.1275 0.1390 0.0152  -0.0541 0.0578  27  LEU A O   
101  C  CB  . LEU A 8  ? 0.2265 0.1582 0.2209 -0.0470 -0.0471 -0.0151 27  LEU A CB  
102  C  CG  . LEU A 8  ? 0.2857 0.1945 0.2769 -0.0679 -0.0874 -0.0378 27  LEU A CG  
103  C  CD1 . LEU A 8  ? 0.3282 0.2212 0.3005 -0.0559 -0.0770 -0.0357 27  LEU A CD1 
104  C  CD2 . LEU A 8  ? 0.3263 0.2099 0.3046 -0.0610 -0.0929 -0.0429 27  LEU A CD2 
116  N  N   . VAL A 9  ? 0.1908 0.1011 0.1147 -0.0151 -0.0557 0.0366  28  VAL A N   
117  C  CA  . VAL A 9  ? 0.1822 0.1163 0.1061 -0.0131 -0.0586 0.0305  28  VAL A CA  
118  C  C   . VAL A 9  ? 0.1620 0.1036 0.0987 0.0056  -0.0567 0.0309  28  VAL A C   
119  O  O   . VAL A 9  ? 0.1761 0.1486 0.1061 0.0135  -0.0648 0.0338  28  VAL A O   
120  C  CB  . VAL A 9  ? 0.1532 0.1094 0.1142 -0.0010 -0.0593 0.0315  28  VAL A CB  
121  C  CG1 . VAL A 9  ? 0.1835 0.1069 0.1274 0.0149  -0.0605 0.0227  28  VAL A CG1 
122  C  CG2 . VAL A 9  ? 0.1598 0.1078 0.1270 -0.0048 -0.0482 0.0041  28  VAL A CG2 
132  N  N   . ARG A 10 ? 0.1595 0.0849 0.0826 -0.0043 -0.0550 0.0092  29  ARG A N   
133  C  CA  . ARG A 10 ? 0.1743 0.1266 0.0930 0.0094  -0.0477 0.0147  29  ARG A CA  
134  C  C   . ARG A 10 ? 0.1521 0.1153 0.0710 0.0154  -0.0452 -0.0022 29  ARG A C   
135  O  O   . ARG A 10 ? 0.1597 0.1107 0.0831 0.0107  -0.0612 0.0007  29  ARG A O   
136  C  CB  . ARG A 10 ? 0.1971 0.1567 0.1340 0.0257  -0.0343 -0.0147 29  ARG A CB  
137  C  CG  . ARG A 10 ? 0.2320 0.1935 0.1854 0.0007  -0.0105 -0.0408 29  ARG A CG  
138  C  CD  . ARG A 10 ? 0.2845 0.2480 0.2424 -0.0069 -0.0221 -0.0812 29  ARG A CD  
139  N  NE  . ARG A 10 ? 0.3333 0.2765 0.2498 -0.0309 -0.0411 -0.1072 29  ARG A NE  
140  C  CZ  . ARG A 10 ? 0.3757 0.3163 0.2920 -0.0675 -0.0382 -0.1168 29  ARG A CZ  
141  N  NH1 . ARG A 10 ? 0.3928 0.3167 0.3296 -0.0818 -0.0130 -0.1046 29  ARG A NH1 
142  N  NH2 . ARG A 10 ? 0.3877 0.3443 0.2969 -0.0986 -0.0610 -0.1275 29  ARG A NH2 
156  N  N   . PRO A 11 ? 0.1721 0.0967 0.0976 0.0193  -0.0616 0.0143  30  PRO A N   
157  C  CA  . PRO A 11 ? 0.1447 0.0995 0.0961 0.0220  -0.0453 0.0013  30  PRO A CA  
158  C  C   . PRO A 11 ? 0.1432 0.1003 0.0860 0.0243  -0.0593 -0.0029 30  PRO A C   
159  O  O   . PRO A 11 ? 0.1663 0.1303 0.0853 0.0295  -0.0486 -0.0059 30  PRO A O   
160  C  CB  . PRO A 11 ? 0.1387 0.1135 0.1173 0.0220  -0.0511 0.0062  30  PRO A CB  
161  C  CG  . PRO A 11 ? 0.1712 0.1588 0.1699 0.0348  -0.0568 0.0017  30  PRO A CG  
162  C  CD  . PRO A 11 ? 0.1799 0.1114 0.1402 0.0271  -0.0775 0.0051  30  PRO A CD  
170  N  N   . LYS A 12 ? 0.1693 0.0935 0.1022 0.0043  -0.0718 0.0015  31  LYS A N   
171  C  CA  . LYS A 12 ? 0.1342 0.1283 0.1179 0.0075  -0.0614 0.0106  31  LYS A CA  
172  C  C   . LYS A 12 ? 0.1548 0.1410 0.1153 0.0407  -0.0477 0.0211  31  LYS A C   
173  O  O   . LYS A 12 ? 0.1283 0.1239 0.1208 0.0162  -0.0481 0.0094  31  LYS A O   
174  C  CB  . LYS A 12 ? 0.1533 0.2187 0.1677 -0.0125 -0.0169 -0.0133 31  LYS A CB  
175  C  CG  . LYS A 12 ? 0.2002 0.2871 0.1862 0.0042  -0.0325 -0.0389 31  LYS A CG  
176  C  CD  . LYS A 12 ? 0.2168 0.3106 0.2203 -0.0127 -0.0298 -0.0369 31  LYS A CD  
177  C  CE  . LYS A 12 ? 0.1926 0.2515 0.2267 -0.0460 -0.0477 -0.0324 31  LYS A CE  
178  N  NZ  . LYS A 12 ? 0.1813 0.2222 0.2094 -0.0543 -0.0366 0.0011  31  LYS A NZ  
192  N  N   . PRO A 13 ? 0.1566 0.1456 0.1447 0.0360  0.0089  0.0548  32  PRO A N   
193  C  CA  . PRO A 13 ? 0.1698 0.1475 0.1580 0.0524  0.0164  0.0563  32  PRO A CA  
194  C  C   . PRO A 13 ? 0.1948 0.1715 0.1716 0.0557  -0.0186 0.0528  32  PRO A C   
195  O  O   . PRO A 13 ? 0.1919 0.1541 0.1520 0.0544  -0.0131 0.0491  32  PRO A O   
196  C  CB  . PRO A 13 ? 0.2080 0.1896 0.1696 0.0826  0.0426  0.0719  32  PRO A CB  
197  C  CG  . PRO A 13 ? 0.2091 0.2081 0.1842 0.0912  0.0470  0.0565  32  PRO A CG  
198  C  CD  . PRO A 13 ? 0.1770 0.1966 0.1614 0.0532  0.0445  0.0547  32  PRO A CD  
206  N  N   . LEU A 14 ? 0.1443 0.1613 0.1964 0.0236  -0.0583 0.0444  33  LEU A N   
207  C  CA  . LEU A 14 ? 0.1619 0.1506 0.1916 0.0015  -0.0398 0.0417  33  LEU A CA  
208  C  C   . LEU A 14 ? 0.1372 0.1232 0.1324 0.0175  -0.0551 0.0254  33  LEU A C   
209  O  O   . LEU A 14 ? 0.1320 0.1304 0.1542 0.0236  -0.0523 0.0081  33  LEU A O   
210  C  CB  . LEU A 14 ? 0.1890 0.1590 0.2356 0.0062  -0.0352 0.0323  33  LEU A CB  
211  C  CG  . LEU A 14 ? 0.2147 0.2087 0.2693 0.0071  -0.0098 0.0343  33  LEU A CG  
212  C  CD1 . LEU A 14 ? 0.2199 0.2447 0.2795 -0.0154 0.0121  -0.0100 33  LEU A CD1 
213  C  CD2 . LEU A 14 ? 0.2600 0.2426 0.2939 -0.0253 0.0066  0.0529  33  LEU A CD2 
225  N  N   . LEU A 15 ? 0.1355 0.1237 0.1216 0.0105  -0.0652 0.0139  34  LEU A N   
226  C  CA  . LEU A 15 ? 0.1359 0.1389 0.0999 0.0141  -0.0523 -0.0005 34  LEU A CA  
227  C  C   . LEU A 15 ? 0.1480 0.1159 0.0918 0.0043  -0.0451 0.0136  34  LEU A C   
228  O  O   . LEU A 15 ? 0.1303 0.1243 0.1121 0.0324  -0.0555 0.0066  34  LEU A O   
229  C  CB  . LEU A 15 ? 0.1442 0.1427 0.0986 -0.0071 -0.0617 0.0118  34  LEU A CB  
230  C  CG  . LEU A 15 ? 0.1690 0.1361 0.0903 -0.0117 -0.0599 0.0089  34  LEU A CG  
231  C  CD1 . LEU A 15 ? 0.1654 0.1684 0.1059 -0.0074 -0.0478 0.0114  34  LEU A CD1 
232  C  CD2 . LEU A 15 ? 0.1748 0.1460 0.0872 -0.0001 -0.0562 0.0020  34  LEU A CD2 
244  N  N   . LEU A 16 ? 0.1631 0.1155 0.1076 0.0117  -0.0588 -0.0199 35  LEU A N   
245  C  CA  . LEU A 16 ? 0.1823 0.1283 0.1067 -0.0088 -0.0516 -0.0233 35  LEU A CA  
246  C  C   . LEU A 16 ? 0.1638 0.1326 0.0994 -0.0045 -0.0607 -0.0024 35  LEU A C   
247  O  O   . LEU A 16 ? 0.1620 0.1429 0.1152 0.0014  -0.0786 -0.0012 35  LEU A O   
248  C  CB  . LEU A 16 ? 0.1888 0.1311 0.1130 0.0066  -0.0381 0.0007  35  LEU A CB  
249  C  CG  . LEU A 16 ? 0.2631 0.1799 0.1113 0.0044  -0.0415 -0.0216 35  LEU A CG  
250  C  CD1 . LEU A 16 ? 0.2880 0.2231 0.1234 -0.0166 -0.0353 -0.0047 35  LEU A CD1 
251  C  CD2 . LEU A 16 ? 0.3195 0.2347 0.1416 0.0053  -0.0374 -0.0559 35  LEU A CD2 
263  N  N   . LYS A 17 ? 0.1392 0.1310 0.1242 0.0113  -0.0515 0.0164  36  LYS A N   
264  C  CA  . LYS A 17 ? 0.1774 0.1449 0.1359 0.0114  -0.0526 0.0217  36  LYS A CA  
265  C  C   . LYS A 17 ? 0.1556 0.1311 0.1239 0.0111  -0.0806 0.0069  36  LYS A C   
266  O  O   . LYS A 17 ? 0.1699 0.1463 0.1234 0.0195  -0.0737 0.0289  36  LYS A O   
267  C  CB  . LYS A 17 ? 0.2064 0.1534 0.1556 0.0064  -0.0461 0.0672  36  LYS A CB  
268  C  CG  . LYS A 17 ? 0.1992 0.1684 0.2046 0.0048  -0.0642 0.0653  36  LYS A CG  
269  C  CD  . LYS A 17 ? 0.2320 0.1920 0.2563 -0.0204 -0.0588 0.0731  36  LYS A CD  
270  C  CE  . LYS A 17 ? 0.2937 0.2680 0.3046 -0.0560 -0.0319 0.0748  36  LYS A CE  
271  N  NZ  . LYS A 17 ? 0.3567 0.3371 0.3290 -0.0554 -0.0200 0.0744  36  LYS A NZ  
285  N  N   . LEU A 18 ? 0.1588 0.1342 0.1092 0.0367  -0.0633 -0.0078 37  LEU A N   
286  C  CA  . LEU A 18 ? 0.1353 0.1274 0.1099 0.0302  -0.0548 0.0072  37  LEU A CA  
287  C  C   . LEU A 18 ? 0.1570 0.1299 0.1215 0.0318  -0.0606 -0.0026 37  LEU A C   
288  O  O   . LEU A 18 ? 0.1579 0.1337 0.1468 0.0295  -0.0831 -0.0076 37  LEU A O   
289  C  CB  . LEU A 18 ? 0.1600 0.1299 0.1125 0.0337  -0.0639 0.0014  37  LEU A CB  
290  C  CG  . LEU A 18 ? 0.2130 0.1543 0.1232 0.0460  -0.0711 -0.0172 37  LEU A CG  
291  C  CD1 . LEU A 18 ? 0.2616 0.1859 0.1144 0.0294  -0.0661 -0.0472 37  LEU A CD1 
292  C  CD2 . LEU A 18 ? 0.2284 0.1644 0.1517 0.0556  -0.0967 -0.0246 37  LEU A CD2 
304  N  N   . LEU A 19 ? 0.1559 0.1114 0.1184 0.0242  -0.0726 -0.0015 38  LEU A N   
305  C  CA  . LEU A 19 ? 0.1377 0.1132 0.1206 0.0150  -0.0669 0.0105  38  LEU A CA  
306  C  C   . LEU A 19 ? 0.1502 0.1425 0.1381 0.0096  -0.0515 0.0009  38  LEU A C   
307  O  O   . LEU A 19 ? 0.1380 0.1621 0.1520 -0.0142 -0.0725 0.0205  38  LEU A O   
308  C  CB  . LEU A 19 ? 0.1275 0.1033 0.1295 -0.0007 -0.0654 0.0034  38  LEU A CB  
309  C  CG  . LEU A 19 ? 0.1084 0.1342 0.1290 0.0313  -0.0599 0.0143  38  LEU A CG  
310  C  CD1 . LEU A 19 ? 0.1275 0.1570 0.1187 0.0247  -0.0645 0.0257  38  LEU A CD1 
311  C  CD2 . LEU A 19 ? 0.1493 0.1522 0.1469 0.0345  -0.0515 0.0240  38  LEU A CD2 
323  N  N   . LYS A 20 ? 0.1339 0.1400 0.1281 0.0067  -0.0783 -0.0076 39  LYS A N   
324  C  CA  . LYS A 20 ? 0.1452 0.1686 0.1203 0.0120  -0.0773 -0.0139 39  LYS A CA  
325  C  C   . LYS A 20 ? 0.1353 0.1504 0.1186 0.0037  -0.0699 0.0288  39  LYS A C   
326  O  O   . LYS A 20 ? 0.1432 0.1639 0.1317 0.0023  -0.0795 0.0210  39  LYS A O   
327  C  CB  . LYS A 20 ? 0.1933 0.2134 0.1320 0.0301  -0.0877 -0.0246 39  LYS A CB  
328  C  CG  . LYS A 20 ? 0.2566 0.2859 0.1319 0.0259  -0.0871 -0.0314 39  LYS A CG  
329  C  CD  . LYS A 20 ? 0.2654 0.3540 0.1287 0.0412  -0.0632 -0.0245 39  LYS A CD  
330  C  CE  . LYS A 20 ? 0.2764 0.4142 0.1557 0.0362  -0.0130 -0.0072 39  LYS A CE  
331  N  NZ  . LYS A 20 ? 0.3310 0.4443 0.2105 0.0349  0.0083  -0.0297 39  LYS A NZ  
345  N  N   . SER A 21 ? 0.1427 0.1339 0.1126 0.0040  -0.0631 0.0315  40  SER A N   
346  C  CA  . SER A 21 ? 0.1456 0.1569 0.1262 0.0047  -0.0655 0.0216  40  SER A CA  
347  C  C   . SER A 21 ? 0.1514 0.1395 0.1107 -0.0014 -0.0749 0.0130  40  SER A C   
348  O  O   . SER A 21 ? 0.1461 0.1647 0.1457 0.0101  -0.0798 0.0147  40  SER A O   
349  C  CB  . SER A 21 ? 0.1841 0.1516 0.1411 -0.0092 -0.0794 0.0244  40  SER A CB  
350  O  OG  . SER A 21 ? 0.1954 0.1455 0.1584 -0.0095 -0.1032 0.0155  40  SER A OG  
356  N  N   A VAL A 22 ? 0.1553 0.1413 0.1107 0.0108  -0.0636 0.0084  41  VAL A N   
357  N  N   B VAL A 22 ? 0.1588 0.1297 0.1016 0.0006  -0.0657 0.0055  41  VAL A N   
358  C  CA  A VAL A 22 ? 0.1499 0.1393 0.1048 0.0204  -0.0535 0.0283  41  VAL A CA  
359  C  CA  B VAL A 22 ? 0.1576 0.1159 0.0878 0.0128  -0.0547 0.0185  41  VAL A CA  
360  C  C   A VAL A 22 ? 0.1373 0.1388 0.0994 0.0332  -0.0600 0.0074  41  VAL A C   
361  C  C   B VAL A 22 ? 0.1508 0.1287 0.0890 0.0211  -0.0602 0.0096  41  VAL A C   
362  O  O   A VAL A 22 ? 0.1407 0.1674 0.0991 0.0529  -0.0519 0.0007  41  VAL A O   
363  O  O   B VAL A 22 ? 0.1576 0.1513 0.0858 0.0199  -0.0556 0.0224  41  VAL A O   
364  C  CB  A VAL A 22 ? 0.1734 0.1746 0.1137 0.0215  -0.0489 0.0427  41  VAL A CB  
365  C  CB  B VAL A 22 ? 0.1597 0.1078 0.0841 0.0141  -0.0476 0.0172  41  VAL A CB  
366  C  CG1 A VAL A 22 ? 0.1329 0.1669 0.1048 0.0130  -0.0651 0.0230  41  VAL A CG1 
367  C  CG1 B VAL A 22 ? 0.1433 0.1223 0.0880 -0.0120 -0.0609 -0.0101 41  VAL A CG1 
368  C  CG2 A VAL A 22 ? 0.2000 0.2214 0.1236 0.0191  -0.0384 0.0506  41  VAL A CG2 
369  C  CG2 B VAL A 22 ? 0.1664 0.1035 0.0887 0.0284  -0.0607 0.0004  41  VAL A CG2 
388  N  N   . GLY A 23 ? 0.1687 0.1256 0.1012 0.0190  -0.0500 0.0029  42  GLY A N   
389  C  CA  . GLY A 23 ? 0.1533 0.1490 0.1138 -0.0020 -0.0629 0.0068  42  GLY A CA  
390  C  C   . GLY A 23 ? 0.1544 0.1410 0.1095 0.0044  -0.0593 0.0084  42  GLY A C   
391  O  O   . GLY A 23 ? 0.1423 0.1421 0.1127 -0.0106 -0.0606 0.0139  42  GLY A O   
395  N  N   . ALA A 24 ? 0.1607 0.1252 0.1121 0.0164  -0.0561 0.0017  43  ALA A N   
396  C  CA  . ALA A 24 ? 0.1646 0.1364 0.1178 0.0178  -0.0701 -0.0066 43  ALA A CA  
397  C  C   . ALA A 24 ? 0.1614 0.1400 0.0952 0.0157  -0.0681 0.0015  43  ALA A C   
398  O  O   . ALA A 24 ? 0.1848 0.1938 0.1038 0.0392  -0.0606 0.0029  43  ALA A O   
399  C  CB  . ALA A 24 ? 0.2073 0.1952 0.1742 -0.0194 -0.0813 -0.0245 43  ALA A CB  
405  N  N   . GLN A 25 ? 0.1636 0.1708 0.0893 0.0220  -0.0594 0.0191  44  GLN A N   
406  C  CA  . GLN A 25 ? 0.2095 0.2304 0.1115 0.0329  -0.0608 0.0086  44  GLN A CA  
407  C  C   . GLN A 25 ? 0.2431 0.2165 0.1404 0.0444  -0.0977 -0.0142 44  GLN A C   
408  O  O   . GLN A 25 ? 0.2911 0.2211 0.1546 0.0403  -0.1097 -0.0350 44  GLN A O   
409  C  CB  . GLN A 25 ? 0.2246 0.3075 0.1325 0.0622  -0.0293 0.0140  44  GLN A CB  
410  C  CG  . GLN A 25 ? 0.2541 0.3792 0.1703 0.0652  -0.0166 0.0267  44  GLN A CG  
411  C  CD  . GLN A 25 ? 0.3149 0.4544 0.2276 0.0756  -0.0108 0.0520  44  GLN A CD  
412  O  OE1 . GLN A 25 ? 0.3238 0.4657 0.2254 0.0696  -0.0256 0.0834  44  GLN A OE1 
413  N  NE2 . GLN A 25 ? 0.3386 0.4933 0.2460 0.0787  -0.0084 0.0599  44  GLN A NE2 
422  N  N   . LYS A 26 ? 0.2349 0.1872 0.1663 0.0507  -0.1023 0.0082  45  LYS A N   
423  C  CA  . LYS A 26 ? 0.2771 0.2093 0.1689 0.0514  -0.0921 0.0299  45  LYS A CA  
424  C  C   . LYS A 26 ? 0.2996 0.2382 0.1715 0.0746  -0.0848 0.0270  45  LYS A C   
425  O  O   . LYS A 26 ? 0.2550 0.2703 0.1755 0.0514  -0.0903 0.0125  45  LYS A O   
426  C  CB  . LYS A 26 ? 0.3057 0.2372 0.2086 0.0526  -0.0907 0.0412  45  LYS A CB  
427  C  CG  . LYS A 26 ? 0.3387 0.3004 0.2695 0.0210  -0.0445 -0.0002 45  LYS A CG  
428  C  CD  . LYS A 26 ? 0.3647 0.3164 0.3026 0.0249  -0.0311 -0.0347 45  LYS A CD  
429  C  CE  . LYS A 26 ? 0.3766 0.3132 0.2984 -0.0023 -0.0249 -0.0794 45  LYS A CE  
430  N  NZ  . LYS A 26 ? 0.3617 0.3079 0.3137 -0.0833 -0.0220 -0.1078 45  LYS A NZ  
444  N  N   . ASP A 27 ? 0.3515 0.2866 0.1884 0.0960  -0.0842 0.0418  46  ASP A N   
445  C  CA  . ASP A 27 ? 0.3926 0.3053 0.2179 0.1174  -0.0834 0.0336  46  ASP A CA  
446  C  C   . ASP A 27 ? 0.3701 0.2857 0.1957 0.1006  -0.0851 0.0341  46  ASP A C   
447  O  O   . ASP A 27 ? 0.3984 0.3196 0.1987 0.1032  -0.0699 0.0515  46  ASP A O   
448  C  CB  . ASP A 27 ? 0.4748 0.3534 0.2771 0.1210  -0.0752 0.0300  46  ASP A CB  
449  C  CG  . ASP A 27 ? 0.5514 0.4144 0.3354 0.0809  -0.0659 0.0073  46  ASP A CG  
450  O  OD1 . ASP A 27 ? 0.5741 0.4325 0.3315 0.0714  -0.0582 0.0419  46  ASP A OD1 
451  O  OD2 . ASP A 27 ? 0.5936 0.4479 0.3657 0.0665  -0.0633 -0.0184 46  ASP A OD2 
456  N  N   . THR A 28 ? 0.3507 0.2412 0.1668 0.0879  -0.0988 0.0076  47  THR A N   
457  C  CA  . THR A 28 ? 0.3390 0.2387 0.1841 0.0583  -0.1138 0.0273  47  THR A CA  
458  C  C   . THR A 28 ? 0.2865 0.2212 0.1661 0.0184  -0.1206 0.0003  47  THR A C   
459  O  O   . THR A 28 ? 0.2513 0.2558 0.1636 0.0040  -0.1162 -0.0094 47  THR A O   
460  C  CB  . THR A 28 ? 0.4191 0.2698 0.2485 0.0700  -0.0837 0.0348  47  THR A CB  
461  O  OG1 . THR A 28 ? 0.4536 0.3216 0.3130 0.0670  -0.0895 0.0629  47  THR A OG1 
462  C  CG2 . THR A 28 ? 0.4334 0.2831 0.2555 0.0433  -0.0909 0.0272  47  THR A CG2 
470  N  N   . TYR A 29 ? 0.2484 0.1610 0.1490 -0.0052 -0.1072 0.0142  48  TYR A N   
471  C  CA  . TYR A 29 ? 0.2029 0.1264 0.1531 -0.0164 -0.1020 0.0225  48  TYR A CA  
472  C  C   . TYR A 29 ? 0.2001 0.1443 0.1769 -0.0165 -0.1086 0.0329  48  TYR A C   
473  O  O   . TYR A 29 ? 0.1751 0.1711 0.2040 -0.0188 -0.0818 0.0659  48  TYR A O   
474  C  CB  . TYR A 29 ? 0.1851 0.1205 0.1412 -0.0057 -0.0897 0.0273  48  TYR A CB  
475  C  CG  . TYR A 29 ? 0.1836 0.1245 0.1250 -0.0025 -0.0824 0.0250  48  TYR A CG  
476  C  CD1 . TYR A 29 ? 0.1742 0.1508 0.1326 0.0113  -0.0801 0.0318  48  TYR A CD1 
477  C  CD2 . TYR A 29 ? 0.1457 0.1351 0.1263 0.0012  -0.0540 0.0153  48  TYR A CD2 
478  C  CE1 . TYR A 29 ? 0.1641 0.1575 0.1338 0.0112  -0.0737 0.0263  48  TYR A CE1 
479  C  CE2 . TYR A 29 ? 0.1488 0.1346 0.1238 0.0046  -0.0736 0.0132  48  TYR A CE2 
480  C  CZ  . TYR A 29 ? 0.1694 0.1389 0.1203 0.0022  -0.0696 0.0150  48  TYR A CZ  
481  O  OH  . TYR A 29 ? 0.1736 0.1628 0.0989 0.0188  -0.0565 0.0303  48  TYR A OH  
491  N  N   . THR A 30 ? 0.1922 0.1255 0.1601 0.0051  -0.1008 0.0162  49  THR A N   
492  C  CA  . THR A 30 ? 0.2005 0.1011 0.1612 0.0030  -0.0843 0.0191  49  THR A CA  
493  C  C   . THR A 30 ? 0.1720 0.1101 0.1619 0.0133  -0.0835 0.0299  49  THR A C   
494  O  O   . THR A 30 ? 0.1477 0.0905 0.1767 -0.0034 -0.0784 0.0267  49  THR A O   
495  C  CB  . THR A 30 ? 0.2446 0.1245 0.2075 -0.0208 -0.0864 -0.0028 49  THR A CB  
496  O  OG1 . THR A 30 ? 0.2466 0.1318 0.2325 -0.0365 -0.0649 0.0051  49  THR A OG1 
497  C  CG2 . THR A 30 ? 0.2332 0.1232 0.2199 -0.0192 -0.1012 0.0019  49  THR A CG2 
505  N  N   . MET A 31 ? 0.2018 0.1025 0.1552 -0.0065 -0.0980 0.0241  50  MET A N   
506  C  CA  . MET A 31 ? 0.1868 0.1419 0.1565 -0.0027 -0.0993 0.0208  50  MET A CA  
507  C  C   . MET A 31 ? 0.1914 0.1517 0.1501 -0.0029 -0.0906 0.0392  50  MET A C   
508  O  O   . MET A 31 ? 0.1933 0.1239 0.1411 0.0047  -0.0906 0.0223  50  MET A O   
509  C  CB  . MET A 31 ? 0.1830 0.1478 0.1520 -0.0361 -0.0884 0.0545  50  MET A CB  
510  C  CG  . MET A 31 ? 0.2414 0.1740 0.1826 -0.0656 -0.1124 0.0577  50  MET A CG  
511  S  SD  . MET A 31 ? 0.2799 0.2181 0.2229 -0.0393 -0.1411 0.0552  50  MET A SD  
512  C  CE  . MET A 31 ? 0.2951 0.2330 0.2720 -0.0012 -0.0806 0.0525  50  MET A CE  
522  N  N   . LYS A 32 ? 0.2190 0.1642 0.1843 -0.0284 -0.1003 0.0672  51  LYS A N   
523  C  CA  . LYS A 32 ? 0.2252 0.1865 0.2093 -0.0567 -0.0956 0.0800  51  LYS A CA  
524  C  C   . LYS A 32 ? 0.1754 0.1513 0.1468 -0.0304 -0.0888 0.0195  51  LYS A C   
525  O  O   . LYS A 32 ? 0.1826 0.1512 0.1659 -0.0273 -0.0735 0.0138  51  LYS A O   
526  C  CB  . LYS A 32 ? 0.3228 0.2668 0.2779 -0.0551 -0.0781 0.0971  51  LYS A CB  
527  C  CG  . LYS A 32 ? 0.3760 0.3132 0.3310 -0.0504 -0.0436 0.1054  51  LYS A CG  
528  C  CD  . LYS A 32 ? 0.3731 0.3615 0.3601 -0.0150 -0.0093 0.0996  51  LYS A CD  
529  C  CE  . LYS A 32 ? 0.3864 0.3917 0.3824 -0.0111 -0.0016 0.0992  51  LYS A CE  
530  N  NZ  . LYS A 32 ? 0.4215 0.4467 0.3955 -0.0012 -0.0092 0.0886  51  LYS A NZ  
544  N  N   . GLU A 33 ? 0.1806 0.1357 0.1490 -0.0066 -0.0739 0.0142  52  GLU A N   
545  C  CA  . GLU A 33 ? 0.1962 0.1476 0.1303 -0.0216 -0.0761 -0.0319 52  GLU A CA  
546  C  C   . GLU A 33 ? 0.1738 0.1370 0.1065 -0.0099 -0.0765 -0.0005 52  GLU A C   
547  O  O   . GLU A 33 ? 0.1815 0.1126 0.1078 0.0102  -0.0631 -0.0033 52  GLU A O   
548  C  CB  . GLU A 33 ? 0.2920 0.2090 0.1871 -0.0402 -0.0959 -0.0536 52  GLU A CB  
549  C  CG  . GLU A 33 ? 0.2918 0.2520 0.1991 -0.0283 -0.0812 -0.0467 52  GLU A CG  
550  C  CD  . GLU A 33 ? 0.2254 0.2328 0.1799 0.0058  -0.0796 -0.0293 52  GLU A CD  
551  O  OE1 . GLU A 33 ? 0.2023 0.2281 0.1751 -0.0303 -0.1088 0.0102  52  GLU A OE1 
552  O  OE2 . GLU A 33 ? 0.1909 0.2468 0.1647 0.0426  -0.0749 -0.0123 52  GLU A OE2 
559  N  N   . VAL A 34 ? 0.1334 0.1325 0.1111 -0.0222 -0.0642 0.0051  53  VAL A N   
560  C  CA  . VAL A 34 ? 0.1456 0.1010 0.1004 -0.0052 -0.0692 0.0124  53  VAL A CA  
561  C  C   . VAL A 34 ? 0.1559 0.1064 0.1071 -0.0147 -0.0592 0.0132  53  VAL A C   
562  O  O   . VAL A 34 ? 0.1594 0.0854 0.0838 -0.0181 -0.0614 0.0116  53  VAL A O   
563  C  CB  . VAL A 34 ? 0.1546 0.1125 0.1164 0.0069  -0.0600 0.0058  53  VAL A CB  
564  C  CG1 . VAL A 34 ? 0.1573 0.1558 0.1273 0.0272  -0.0711 0.0007  53  VAL A CG1 
565  C  CG2 . VAL A 34 ? 0.1667 0.1203 0.1581 0.0160  -0.0621 -0.0218 53  VAL A CG2 
575  N  N   . LEU A 35 ? 0.1480 0.1211 0.1101 -0.0086 -0.0740 0.0148  54  LEU A N   
576  C  CA  . LEU A 35 ? 0.1525 0.1252 0.0903 -0.0004 -0.0629 0.0178  54  LEU A CA  
577  C  C   . LEU A 35 ? 0.1436 0.1155 0.0928 -0.0090 -0.0544 0.0030  54  LEU A C   
578  O  O   . LEU A 35 ? 0.1560 0.1183 0.1035 -0.0260 -0.0685 -0.0025 54  LEU A O   
579  C  CB  . LEU A 35 ? 0.1741 0.1069 0.0941 -0.0146 -0.0671 0.0191  54  LEU A CB  
580  C  CG  . LEU A 35 ? 0.1911 0.1494 0.0995 -0.0155 -0.0632 0.0076  54  LEU A CG  
581  C  CD1 . LEU A 35 ? 0.2308 0.1838 0.1246 -0.0072 -0.0727 0.0469  54  LEU A CD1 
582  C  CD2 . LEU A 35 ? 0.1648 0.1780 0.0997 -0.0335 -0.0458 0.0185  54  LEU A CD2 
594  N  N   . PHE A 36 ? 0.1393 0.1157 0.1003 -0.0139 -0.0645 0.0057  55  PHE A N   
595  C  CA  . PHE A 36 ? 0.1278 0.1193 0.0899 -0.0128 -0.0400 0.0050  55  PHE A CA  
596  C  C   . PHE A 36 ? 0.1231 0.1077 0.0811 -0.0155 -0.0513 0.0045  55  PHE A C   
597  O  O   . PHE A 36 ? 0.1527 0.0987 0.0921 -0.0146 -0.0495 -0.0057 55  PHE A O   
598  C  CB  . PHE A 36 ? 0.1222 0.1393 0.1383 -0.0102 -0.0533 0.0033  55  PHE A CB  
599  C  CG  . PHE A 36 ? 0.1352 0.1390 0.1717 -0.0254 -0.0694 0.0086  55  PHE A CG  
600  C  CD1 . PHE A 36 ? 0.1465 0.1178 0.1961 -0.0185 -0.0661 -0.0040 55  PHE A CD1 
601  C  CD2 . PHE A 36 ? 0.1530 0.1581 0.1860 -0.0160 -0.0694 0.0308  55  PHE A CD2 
602  C  CE1 . PHE A 36 ? 0.1713 0.1383 0.2394 -0.0257 -0.0854 -0.0051 55  PHE A CE1 
603  C  CE2 . PHE A 36 ? 0.1934 0.1698 0.2280 -0.0321 -0.0894 0.0631  55  PHE A CE2 
604  C  CZ  . PHE A 36 ? 0.1852 0.1394 0.2347 -0.0410 -0.1122 0.0355  55  PHE A CZ  
615  N  N   . TYR A 37 ? 0.1379 0.1095 0.0849 -0.0037 -0.0596 0.0145  56  TYR A N   
616  C  CA  . TYR A 37 ? 0.1250 0.1234 0.0860 0.0084  -0.0598 -0.0023 56  TYR A CA  
617  C  C   . TYR A 37 ? 0.1369 0.1123 0.0929 -0.0125 -0.0644 0.0004  56  TYR A C   
618  O  O   . TYR A 37 ? 0.1525 0.0946 0.0862 -0.0094 -0.0613 -0.0066 56  TYR A O   
619  C  CB  . TYR A 37 ? 0.1240 0.1192 0.0700 -0.0109 -0.0435 0.0042  56  TYR A CB  
620  C  CG  . TYR A 37 ? 0.1303 0.1212 0.0778 -0.0026 -0.0550 -0.0024 56  TYR A CG  
621  C  CD1 . TYR A 37 ? 0.1485 0.1207 0.0727 0.0098  -0.0533 -0.0064 56  TYR A CD1 
622  C  CD2 . TYR A 37 ? 0.1466 0.1352 0.0706 0.0036  -0.0526 0.0042  56  TYR A CD2 
623  C  CE1 . TYR A 37 ? 0.1342 0.1112 0.0774 -0.0044 -0.0562 -0.0050 56  TYR A CE1 
624  C  CE2 . TYR A 37 ? 0.1578 0.1267 0.0860 0.0045  -0.0568 -0.0275 56  TYR A CE2 
625  C  CZ  . TYR A 37 ? 0.1312 0.1240 0.0971 -0.0121 -0.0586 -0.0247 56  TYR A CZ  
626  O  OH  . TYR A 37 ? 0.1737 0.1603 0.1165 0.0006  -0.0808 -0.0148 56  TYR A OH  
636  N  N   . LEU A 38 ? 0.1228 0.1131 0.0975 -0.0075 -0.0641 -0.0038 57  LEU A N   
637  C  CA  . LEU A 38 ? 0.0971 0.1189 0.0750 0.0077  -0.0473 0.0160  57  LEU A CA  
638  C  C   . LEU A 38 ? 0.1264 0.1077 0.0808 -0.0076 -0.0573 -0.0017 57  LEU A C   
639  O  O   . LEU A 38 ? 0.1648 0.0903 0.0948 -0.0078 -0.0669 0.0026  57  LEU A O   
640  C  CB  . LEU A 38 ? 0.1032 0.1276 0.0840 -0.0133 -0.0538 0.0003  57  LEU A CB  
641  C  CG  . LEU A 38 ? 0.1180 0.1573 0.1107 -0.0162 -0.0666 0.0004  57  LEU A CG  
642  C  CD1 . LEU A 38 ? 0.1375 0.1660 0.1257 0.0078  -0.0784 -0.0034 57  LEU A CD1 
643  C  CD2 . LEU A 38 ? 0.1659 0.1600 0.1529 0.0040  -0.0400 0.0110  57  LEU A CD2 
655  N  N   . GLY A 39 ? 0.1315 0.0988 0.0908 -0.0115 -0.0630 0.0044  58  GLY A N   
656  C  CA  . GLY A 39 ? 0.1240 0.1210 0.0891 0.0034  -0.0460 0.0115  58  GLY A CA  
657  C  C   . GLY A 39 ? 0.1112 0.1144 0.0802 -0.0105 -0.0506 -0.0181 58  GLY A C   
658  O  O   . GLY A 39 ? 0.1483 0.0916 0.1092 -0.0075 -0.0618 -0.0040 58  GLY A O   
662  N  N   . GLN A 40 ? 0.1292 0.1286 0.0846 0.0068  -0.0593 -0.0098 59  GLN A N   
663  C  CA  . GLN A 40 ? 0.1339 0.1223 0.0985 0.0019  -0.0669 0.0073  59  GLN A CA  
664  C  C   . GLN A 40 ? 0.1500 0.1174 0.1056 0.0155  -0.0726 -0.0094 59  GLN A C   
665  O  O   . GLN A 40 ? 0.1759 0.1134 0.1483 0.0312  -0.0893 -0.0022 59  GLN A O   
666  C  CB  . GLN A 40 ? 0.1494 0.1393 0.1110 -0.0082 -0.0755 0.0033  59  GLN A CB  
667  C  CG  . GLN A 40 ? 0.1487 0.1475 0.1222 0.0001  -0.0652 -0.0073 59  GLN A CG  
668  C  CD  . GLN A 40 ? 0.1534 0.1789 0.1321 -0.0040 -0.0482 -0.0048 59  GLN A CD  
669  O  OE1 . GLN A 40 ? 0.1750 0.1857 0.1530 0.0093  -0.0578 -0.0134 59  GLN A OE1 
670  N  NE2 . GLN A 40 ? 0.2011 0.2071 0.1439 0.0013  -0.0712 -0.0180 59  GLN A NE2 
679  N  N   . TYR A 41 ? 0.1482 0.1179 0.0958 -0.0145 -0.0533 -0.0214 60  TYR A N   
680  C  CA  . TYR A 41 ? 0.1539 0.1210 0.0873 0.0253  -0.0282 -0.0024 60  TYR A CA  
681  C  C   . TYR A 41 ? 0.1841 0.1075 0.0633 0.0224  -0.0340 0.0005  60  TYR A C   
682  O  O   . TYR A 41 ? 0.2167 0.1009 0.0964 0.0165  -0.0645 0.0107  60  TYR A O   
683  C  CB  . TYR A 41 ? 0.1522 0.1270 0.0994 0.0215  -0.0224 -0.0049 60  TYR A CB  
684  C  CG  . TYR A 41 ? 0.1466 0.1279 0.0968 -0.0001 -0.0450 0.0151  60  TYR A CG  
685  C  CD1 . TYR A 41 ? 0.1816 0.1404 0.0994 -0.0097 -0.0565 0.0025  60  TYR A CD1 
686  C  CD2 . TYR A 41 ? 0.1579 0.1249 0.0605 -0.0148 -0.0392 0.0182  60  TYR A CD2 
687  C  CE1 . TYR A 41 ? 0.1742 0.1541 0.0760 0.0081  -0.0554 0.0085  60  TYR A CE1 
688  C  CE2 . TYR A 41 ? 0.1793 0.1473 0.0780 -0.0146 -0.0553 0.0174  60  TYR A CE2 
689  C  CZ  . TYR A 41 ? 0.1871 0.1663 0.0805 0.0038  -0.0379 0.0177  60  TYR A CZ  
690  O  OH  . TYR A 41 ? 0.2322 0.1857 0.1156 0.0128  -0.0497 0.0410  60  TYR A OH  
700  N  N   . ILE A 42 ? 0.1779 0.0853 0.0649 0.0070  -0.0400 -0.0152 61  ILE A N   
701  C  CA  . ILE A 42 ? 0.1455 0.0941 0.0661 0.0089  -0.0486 -0.0092 61  ILE A CA  
702  C  C   . ILE A 42 ? 0.1648 0.1055 0.0925 0.0094  -0.0678 -0.0008 61  ILE A C   
703  O  O   . ILE A 42 ? 0.2005 0.1151 0.1057 0.0225  -0.0531 -0.0201 61  ILE A O   
704  C  CB  . ILE A 42 ? 0.1263 0.1073 0.0634 -0.0043 -0.0405 -0.0221 61  ILE A CB  
705  C  CG1 . ILE A 42 ? 0.1644 0.1047 0.0805 0.0120  -0.0570 -0.0160 61  ILE A CG1 
706  C  CG2 . ILE A 42 ? 0.1547 0.1292 0.0836 -0.0054 -0.0616 -0.0034 61  ILE A CG2 
707  C  CD1 . ILE A 42 ? 0.1572 0.1146 0.0855 0.0174  -0.0564 -0.0034 61  ILE A CD1 
719  N  N   . MET A 43 ? 0.1784 0.1064 0.1081 0.0105  -0.0782 -0.0065 62  MET A N   
720  C  CA  . MET A 43 ? 0.1879 0.1334 0.1137 0.0366  -0.0695 -0.0211 62  MET A CA  
721  C  C   . MET A 43 ? 0.2172 0.1331 0.1017 0.0266  -0.0658 -0.0199 62  MET A C   
722  O  O   . MET A 43 ? 0.2709 0.1318 0.1211 0.0467  -0.0544 0.0057  62  MET A O   
723  C  CB  . MET A 43 ? 0.1610 0.1596 0.1379 0.0196  -0.0510 -0.0107 62  MET A CB  
724  C  CG  . MET A 43 ? 0.1693 0.1750 0.1428 0.0227  -0.0457 -0.0171 62  MET A CG  
725  S  SD  . MET A 43 ? 0.2335 0.1991 0.1569 0.0491  -0.0436 -0.0030 62  MET A SD  
726  C  CE  . MET A 43 ? 0.2538 0.2650 0.1772 0.0644  -0.0252 -0.0071 62  MET A CE  
736  N  N   A THR A 44 ? 0.2205 0.1375 0.1011 0.0227  -0.0731 0.0018  63  THR A N   
737  N  N   B THR A 44 ? 0.2186 0.1320 0.0971 0.0243  -0.0692 0.0027  63  THR A N   
738  C  CA  A THR A 44 ? 0.2280 0.1459 0.1082 0.0345  -0.0755 0.0019  63  THR A CA  
739  C  CA  B THR A 44 ? 0.2141 0.1386 0.1037 0.0323  -0.0692 0.0095  63  THR A CA  
740  C  C   A THR A 44 ? 0.2585 0.1353 0.1012 0.0550  -0.0665 -0.0137 63  THR A C   
741  C  C   B THR A 44 ? 0.2361 0.1331 0.1085 0.0481  -0.0649 0.0083  63  THR A C   
742  O  O   A THR A 44 ? 0.2873 0.1391 0.1055 0.0654  -0.0663 -0.0250 63  THR A O   
743  O  O   B THR A 44 ? 0.2397 0.1419 0.1166 0.0583  -0.0540 0.0213  63  THR A O   
744  C  CB  A THR A 44 ? 0.2428 0.1602 0.1161 0.0266  -0.0834 0.0037  63  THR A CB  
745  C  CB  B THR A 44 ? 0.2202 0.1648 0.1035 0.0355  -0.0610 0.0135  63  THR A CB  
746  O  OG1 A THR A 44 ? 0.2599 0.1891 0.1276 0.0120  -0.0945 -0.0146 63  THR A OG1 
747  O  OG1 B THR A 44 ? 0.2444 0.2124 0.1031 0.0227  -0.0490 0.0330  63  THR A OG1 
748  C  CG2 A THR A 44 ? 0.2633 0.1741 0.1190 0.0315  -0.0818 0.0088  63  THR A CG2 
749  C  CG2 B THR A 44 ? 0.2196 0.1526 0.1101 0.0390  -0.0617 0.0068  63  THR A CG2 
764  N  N   . LYS A 45 ? 0.2418 0.1270 0.1137 0.0202  -0.0550 -0.0043 64  LYS A N   
765  C  CA  . LYS A 45 ? 0.2729 0.1275 0.1131 0.0021  -0.0732 0.0077  64  LYS A CA  
766  C  C   . LYS A 45 ? 0.2857 0.1303 0.1228 0.0022  -0.0612 0.0076  64  LYS A C   
767  O  O   . LYS A 45 ? 0.3368 0.1577 0.1412 -0.0495 -0.0310 0.0069  64  LYS A O   
768  C  CB  . LYS A 45 ? 0.2752 0.1630 0.1383 -0.0205 -0.0327 0.0087  64  LYS A CB  
769  C  CG  . LYS A 45 ? 0.2674 0.2010 0.1704 -0.0082 -0.0013 -0.0013 64  LYS A CG  
770  C  CD  . LYS A 45 ? 0.2824 0.2466 0.1975 0.0534  -0.0305 0.0224  64  LYS A CD  
771  C  CE  . LYS A 45 ? 0.3094 0.2743 0.2054 0.0712  -0.0422 0.0578  64  LYS A CE  
772  N  NZ  . LYS A 45 ? 0.3270 0.3001 0.2069 0.0732  -0.0371 0.0794  64  LYS A NZ  
786  N  N   . ARG A 46 ? 0.2609 0.1245 0.1382 0.0239  -0.0803 -0.0003 65  ARG A N   
787  C  CA  . ARG A 46 ? 0.2600 0.1129 0.1314 0.0323  -0.0813 0.0043  65  ARG A CA  
788  C  C   . ARG A 46 ? 0.2420 0.1001 0.1033 0.0262  -0.0582 0.0008  65  ARG A C   
789  O  O   . ARG A 46 ? 0.2749 0.1073 0.1197 0.0094  -0.0747 -0.0029 65  ARG A O   
790  C  CB  . ARG A 46 ? 0.2981 0.1411 0.1681 0.0487  -0.1063 -0.0007 65  ARG A CB  
791  C  CG  . ARG A 46 ? 0.3150 0.1670 0.1998 0.0782  -0.0841 0.0122  65  ARG A CG  
792  C  CD  . ARG A 46 ? 0.3096 0.2279 0.2328 0.0849  -0.1037 0.0186  65  ARG A CD  
793  N  NE  . ARG A 46 ? 0.3147 0.2966 0.2783 0.0883  -0.1165 0.0112  65  ARG A NE  
794  C  CZ  . ARG A 46 ? 0.3041 0.2963 0.3165 0.0916  -0.1096 0.0026  65  ARG A CZ  
795  N  NH1 . ARG A 46 ? 0.3039 0.2931 0.3454 0.1046  -0.1006 -0.0162 65  ARG A NH1 
796  N  NH2 . ARG A 46 ? 0.3222 0.3074 0.3313 0.0808  -0.1095 0.0249  65  ARG A NH2 
810  N  N   . LEU A 47 ? 0.2176 0.1027 0.0941 0.0152  -0.0384 -0.0018 66  LEU A N   
811  C  CA  . LEU A 47 ? 0.1858 0.1395 0.0959 -0.0237 -0.0269 0.0182  66  LEU A CA  
812  C  C   . LEU A 47 ? 0.1883 0.1630 0.1044 -0.0053 -0.0587 0.0241  66  LEU A C   
813  O  O   . LEU A 47 ? 0.1879 0.1875 0.1363 0.0027  -0.0599 -0.0185 66  LEU A O   
814  C  CB  . LEU A 47 ? 0.1926 0.1571 0.1062 0.0007  -0.0071 0.0190  66  LEU A CB  
815  C  CG  . LEU A 47 ? 0.2092 0.1593 0.1361 0.0032  -0.0005 -0.0197 66  LEU A CG  
816  C  CD1 . LEU A 47 ? 0.2392 0.1641 0.1813 0.0081  -0.0034 -0.0168 66  LEU A CD1 
817  C  CD2 . LEU A 47 ? 0.2718 0.1974 0.1596 0.0065  0.0103  -0.0061 66  LEU A CD2 
829  N  N   . TYR A 48 ? 0.1918 0.1399 0.1062 0.0166  -0.0587 0.0081  67  TYR A N   
830  C  CA  . TYR A 48 ? 0.1848 0.1391 0.0969 0.0162  -0.0475 -0.0141 67  TYR A CA  
831  C  C   . TYR A 48 ? 0.1919 0.1441 0.1036 0.0138  -0.0483 0.0024  67  TYR A C   
832  O  O   . TYR A 48 ? 0.1782 0.1434 0.1049 0.0075  -0.0319 0.0031  67  TYR A O   
833  C  CB  . TYR A 48 ? 0.1826 0.1364 0.1014 0.0244  -0.0342 -0.0150 67  TYR A CB  
834  C  CG  . TYR A 48 ? 0.1904 0.1452 0.1324 0.0126  -0.0892 -0.0259 67  TYR A CG  
835  C  CD1 . TYR A 48 ? 0.2094 0.1638 0.1307 0.0295  -0.0816 -0.0492 67  TYR A CD1 
836  C  CD2 . TYR A 48 ? 0.2005 0.1598 0.1712 0.0386  -0.0987 -0.0528 67  TYR A CD2 
837  C  CE1 . TYR A 48 ? 0.2154 0.1503 0.1473 0.0452  -0.0839 -0.0530 67  TYR A CE1 
838  C  CE2 . TYR A 48 ? 0.2393 0.1867 0.1729 0.0515  -0.1061 -0.0638 67  TYR A CE2 
839  C  CZ  . TYR A 48 ? 0.2137 0.1890 0.1559 0.0548  -0.0962 -0.0566 67  TYR A CZ  
840  O  OH  . TYR A 48 ? 0.2507 0.2214 0.1732 0.0422  -0.1090 -0.0511 67  TYR A OH  
850  N  N   . ASP A 49 ? 0.1805 0.1079 0.0824 0.0113  -0.0494 -0.0035 68  ASP A N   
851  C  CA  . ASP A 49 ? 0.1752 0.1135 0.0896 0.0015  -0.0442 -0.0083 68  ASP A CA  
852  C  C   . ASP A 49 ? 0.1714 0.1188 0.0686 0.0142  -0.0457 0.0119  68  ASP A C   
853  O  O   . ASP A 49 ? 0.1860 0.1128 0.0848 -0.0011 -0.0602 0.0103  68  ASP A O   
854  C  CB  . ASP A 49 ? 0.1739 0.1120 0.0854 -0.0302 -0.0283 0.0066  68  ASP A CB  
855  C  CG  . ASP A 49 ? 0.1967 0.1200 0.0945 -0.0338 -0.0611 0.0011  68  ASP A CG  
856  O  OD1 . ASP A 49 ? 0.1874 0.1188 0.1019 -0.0056 -0.0613 0.0014  68  ASP A OD1 
857  O  OD2 . ASP A 49 ? 0.2151 0.1071 0.1158 -0.0089 -0.0842 -0.0050 68  ASP A OD2 
862  N  N   . GLU A 50 ? 0.1745 0.1331 0.0792 0.0076  -0.0547 0.0058  69  GLU A N   
863  C  CA  . GLU A 50 ? 0.1826 0.1678 0.1019 0.0280  -0.0539 0.0101  69  GLU A CA  
864  C  C   . GLU A 50 ? 0.1642 0.1320 0.1121 0.0158  -0.0437 0.0031  69  GLU A C   
865  O  O   . GLU A 50 ? 0.1764 0.1506 0.1430 0.0202  -0.0584 -0.0028 69  GLU A O   
866  C  CB  . GLU A 50 ? 0.2094 0.2067 0.1369 0.0590  -0.0628 0.0089  69  GLU A CB  
867  C  CG  . GLU A 50 ? 0.2410 0.2508 0.1987 0.0523  -0.0690 -0.0177 69  GLU A CG  
868  C  CD  . GLU A 50 ? 0.2445 0.3150 0.2613 0.0517  -0.0771 -0.0573 69  GLU A CD  
869  O  OE1 . GLU A 50 ? 0.2839 0.3287 0.2473 0.0599  -0.1115 -0.0775 69  GLU A OE1 
870  O  OE2 . GLU A 50 ? 0.2320 0.3508 0.3222 0.0398  -0.0732 -0.0694 69  GLU A OE2 
877  N  N   A LYS A 51 ? 0.1525 0.1262 0.0972 0.0044  -0.0441 -0.0027 70  LYS A N   
878  N  N   B LYS A 51 ? 0.1605 0.1274 0.0955 0.0047  -0.0445 -0.0037 70  LYS A N   
879  C  CA  A LYS A 51 ? 0.1410 0.1234 0.0975 0.0214  -0.0317 -0.0105 70  LYS A CA  
880  C  CA  B LYS A 51 ? 0.1619 0.1270 0.1003 0.0355  -0.0275 -0.0180 70  LYS A CA  
881  C  C   A LYS A 51 ? 0.1320 0.1365 0.0818 0.0037  -0.0129 -0.0179 70  LYS A C   
882  C  C   B LYS A 51 ? 0.1508 0.1355 0.0872 -0.0018 -0.0332 -0.0179 70  LYS A C   
883  O  O   A LYS A 51 ? 0.1173 0.1403 0.0651 0.0103  0.0043  -0.0332 70  LYS A O   
884  O  O   B LYS A 51 ? 0.1660 0.1234 0.0820 0.0002  -0.0397 -0.0139 70  LYS A O   
885  C  CB  A LYS A 51 ? 0.1608 0.1137 0.1019 0.0249  -0.0425 -0.0050 70  LYS A CB  
886  C  CB  B LYS A 51 ? 0.1993 0.1326 0.1053 0.0471  -0.0242 -0.0139 70  LYS A CB  
887  C  CG  A LYS A 51 ? 0.1877 0.1174 0.1365 0.0241  -0.0557 0.0003  70  LYS A CG  
888  C  CG  B LYS A 51 ? 0.2089 0.1694 0.1406 0.0608  -0.0100 0.0001  70  LYS A CG  
889  C  CD  A LYS A 51 ? 0.2202 0.1383 0.1653 0.0386  -0.0532 0.0000  70  LYS A CD  
890  C  CD  B LYS A 51 ? 0.2528 0.1861 0.1650 0.0529  0.0096  0.0101  70  LYS A CD  
891  C  CE  A LYS A 51 ? 0.2326 0.1618 0.1917 0.0656  -0.0475 -0.0004 70  LYS A CE  
892  C  CE  B LYS A 51 ? 0.2700 0.1891 0.1872 0.0644  0.0108  0.0046  70  LYS A CE  
893  N  NZ  A LYS A 51 ? 0.2659 0.1822 0.2141 0.0837  -0.0327 -0.0016 70  LYS A NZ  
894  N  NZ  B LYS A 51 ? 0.3097 0.2287 0.2240 0.0648  0.0144  0.0076  70  LYS A NZ  
921  N  N   . GLN A 52 ? 0.1344 0.1228 0.0820 0.0177  -0.0273 -0.0016 71  GLN A N   
922  C  CA  . GLN A 52 ? 0.1419 0.1014 0.0849 -0.0047 -0.0357 0.0077  71  GLN A CA  
923  C  C   . GLN A 52 ? 0.1282 0.1030 0.0749 -0.0047 -0.0543 -0.0040 71  GLN A C   
924  O  O   . GLN A 52 ? 0.1429 0.1137 0.0618 -0.0020 -0.0458 0.0053  71  GLN A O   
925  C  CB  . GLN A 52 ? 0.1608 0.1112 0.1001 -0.0042 -0.0628 0.0057  71  GLN A CB  
926  C  CG  . GLN A 52 ? 0.1321 0.1108 0.0970 0.0065  -0.0313 -0.0039 71  GLN A CG  
927  C  CD  . GLN A 52 ? 0.1502 0.1175 0.0917 0.0021  -0.0450 -0.0003 71  GLN A CD  
928  O  OE1 . GLN A 52 ? 0.1439 0.1299 0.0968 -0.0064 -0.0421 -0.0182 71  GLN A OE1 
929  N  NE2 . GLN A 52 ? 0.1569 0.1064 0.1021 -0.0063 -0.0715 0.0131  71  GLN A NE2 
938  N  N   . GLN A 53 ? 0.1446 0.1351 0.0765 -0.0225 -0.0471 -0.0137 72  GLN A N   
939  C  CA  . GLN A 53 ? 0.1533 0.1205 0.0983 -0.0016 -0.0614 -0.0153 72  GLN A CA  
940  C  C   . GLN A 53 ? 0.1260 0.1267 0.0866 -0.0097 -0.0434 0.0065  72  GLN A C   
941  O  O   . GLN A 53 ? 0.1835 0.1389 0.0922 -0.0036 -0.0483 -0.0097 72  GLN A O   
942  C  CB  . GLN A 53 ? 0.1903 0.1363 0.1243 0.0006  -0.0826 -0.0235 72  GLN A CB  
943  C  CG  . GLN A 53 ? 0.1679 0.1807 0.1721 0.0003  -0.1009 0.0151  72  GLN A CG  
944  C  CD  . GLN A 53 ? 0.2328 0.2158 0.2607 -0.0093 -0.1421 0.0077  72  GLN A CD  
945  O  OE1 . GLN A 53 ? 0.2570 0.2414 0.3001 -0.0374 -0.1605 0.0017  72  GLN A OE1 
946  N  NE2 . GLN A 53 ? 0.2281 0.2121 0.2835 0.0093  -0.1493 0.0121  72  GLN A NE2 
955  N  N   . HIS A 54 ? 0.1385 0.1165 0.0903 -0.0131 -0.0428 0.0024  73  HIS A N   
956  C  CA  . HIS A 54 ? 0.1499 0.0953 0.0899 -0.0006 -0.0352 -0.0103 73  HIS A CA  
957  C  C   . HIS A 54 ? 0.1759 0.0724 0.0869 -0.0066 -0.0272 -0.0206 73  HIS A C   
958  O  O   . HIS A 54 ? 0.1617 0.0826 0.1048 0.0029  -0.0323 -0.0102 73  HIS A O   
959  C  CB  . HIS A 54 ? 0.1522 0.0937 0.1102 0.0235  -0.0342 -0.0189 73  HIS A CB  
960  C  CG  . HIS A 54 ? 0.1397 0.1082 0.0929 0.0004  -0.0408 -0.0017 73  HIS A CG  
961  N  ND1 . HIS A 54 ? 0.1372 0.1356 0.1003 0.0057  -0.0341 0.0142  73  HIS A ND1 
962  C  CD2 . HIS A 54 ? 0.1378 0.1181 0.1124 -0.0035 -0.0464 -0.0211 73  HIS A CD2 
963  C  CE1 . HIS A 54 ? 0.1491 0.1252 0.0926 -0.0028 -0.0316 -0.0006 73  HIS A CE1 
964  N  NE2 . HIS A 54 ? 0.1521 0.1326 0.1026 -0.0030 -0.0156 -0.0119 73  HIS A NE2 
972  N  N   . ILE A 55 ? 0.1200 0.0994 0.0729 0.0073  -0.0276 0.0061  74  ILE A N   
973  C  CA  . ILE A 55 ? 0.1278 0.1026 0.0629 0.0128  -0.0330 -0.0192 74  ILE A CA  
974  C  C   . ILE A 55 ? 0.1307 0.0867 0.0564 0.0017  -0.0372 -0.0162 74  ILE A C   
975  O  O   . ILE A 55 ? 0.1465 0.1009 0.1103 0.0099  -0.0358 -0.0018 74  ILE A O   
976  C  CB  . ILE A 55 ? 0.1329 0.1137 0.0713 0.0038  -0.0477 -0.0224 74  ILE A CB  
977  C  CG1 . ILE A 55 ? 0.1635 0.1305 0.0769 -0.0044 -0.0503 -0.0220 74  ILE A CG1 
978  C  CG2 . ILE A 55 ? 0.1627 0.1686 0.0967 -0.0388 -0.0561 -0.0193 74  ILE A CG2 
979  C  CD1 . ILE A 55 ? 0.1819 0.1579 0.0786 -0.0015 -0.0563 0.0160  74  ILE A CD1 
991  N  N   . VAL A 56 ? 0.1534 0.1218 0.0675 0.0231  -0.0207 -0.0056 75  VAL A N   
992  C  CA  . VAL A 56 ? 0.1320 0.1340 0.0810 0.0173  -0.0220 -0.0094 75  VAL A CA  
993  C  C   . VAL A 56 ? 0.1473 0.1146 0.0960 0.0225  -0.0223 0.0011  75  VAL A C   
994  O  O   . VAL A 56 ? 0.1605 0.1137 0.1186 -0.0104 -0.0468 0.0004  75  VAL A O   
995  C  CB  . VAL A 56 ? 0.1503 0.1577 0.0840 -0.0084 -0.0538 -0.0237 75  VAL A CB  
996  C  CG1 . VAL A 56 ? 0.1618 0.1990 0.0757 -0.0020 -0.0339 -0.0089 75  VAL A CG1 
997  C  CG2 . VAL A 56 ? 0.1581 0.1665 0.1016 -0.0203 -0.0283 -0.0116 75  VAL A CG2 
1007 N  N   . TYR A 57 ? 0.1442 0.1176 0.1041 0.0404  -0.0208 0.0271  76  TYR A N   
1008 C  CA  . TYR A 57 ? 0.1771 0.1375 0.1195 0.0282  -0.0100 0.0078  76  TYR A CA  
1009 C  C   . TYR A 57 ? 0.1694 0.1419 0.1182 0.0215  -0.0237 0.0059  76  TYR A C   
1010 O  O   . TYR A 57 ? 0.1646 0.1519 0.1436 0.0378  -0.0313 0.0239  76  TYR A O   
1011 C  CB  . TYR A 57 ? 0.2376 0.1397 0.1221 0.0209  -0.0045 0.0254  76  TYR A CB  
1012 C  CG  . TYR A 57 ? 0.2587 0.1213 0.1351 0.0195  -0.0437 0.0144  76  TYR A CG  
1013 C  CD1 . TYR A 57 ? 0.2555 0.1022 0.1328 -0.0044 -0.0302 -0.0050 76  TYR A CD1 
1014 C  CD2 . TYR A 57 ? 0.2641 0.1160 0.1666 0.0285  -0.0319 0.0248  76  TYR A CD2 
1015 C  CE1 . TYR A 57 ? 0.2858 0.1248 0.1653 -0.0114 -0.0186 -0.0141 76  TYR A CE1 
1016 C  CE2 . TYR A 57 ? 0.2676 0.1184 0.1611 0.0171  -0.0261 -0.0053 76  TYR A CE2 
1017 C  CZ  . TYR A 57 ? 0.2700 0.1464 0.1670 -0.0015 -0.0225 -0.0189 76  TYR A CZ  
1018 O  OH  . TYR A 57 ? 0.2443 0.1596 0.2035 -0.0034 -0.0209 -0.0434 76  TYR A OH  
1028 N  N   . CYS A 58 ? 0.1543 0.1752 0.1115 0.0231  -0.0277 -0.0177 77  CYS A N   
1029 C  CA  . CYS A 58 ? 0.1649 0.1766 0.1103 0.0307  -0.0292 -0.0055 77  CYS A CA  
1030 C  C   . CYS A 58 ? 0.1632 0.1584 0.1119 0.0324  -0.0056 -0.0118 77  CYS A C   
1031 O  O   . CYS A 58 ? 0.1853 0.1279 0.1203 0.0296  0.0038  0.0070  77  CYS A O   
1032 C  CB  . CYS A 58 ? 0.1513 0.1752 0.1369 0.0058  0.0083  -0.0177 77  CYS A CB  
1033 S  SG  . CYS A 58 ? 0.1892 0.1273 0.1549 -0.0061 -0.0039 -0.0105 77  CYS A SG  
1039 N  N   . SER A 59 ? 0.2025 0.1575 0.1366 0.0059  0.0010  -0.0157 78  SER A N   
1040 C  CA  . SER A 59 ? 0.2440 0.1314 0.1345 -0.0227 0.0074  -0.0096 78  SER A CA  
1041 C  C   . SER A 59 ? 0.3083 0.1623 0.1494 -0.0341 -0.0135 -0.0151 78  SER A C   
1042 O  O   . SER A 59 ? 0.3451 0.1544 0.1741 0.0085  -0.0229 -0.0031 78  SER A O   
1043 C  CB  . SER A 59 ? 0.2235 0.1527 0.1687 -0.0072 -0.0085 -0.0317 78  SER A CB  
1044 O  OG  . SER A 59 ? 0.2484 0.2226 0.2047 -0.0177 -0.0093 -0.0312 78  SER A OG  
1050 N  N   . ASN A 60 ? 0.3171 0.1913 0.1537 -0.0598 0.0087  -0.0014 79  ASN A N   
1051 C  CA  . ASN A 60 ? 0.3670 0.2953 0.2249 -0.1040 -0.0428 0.0204  79  ASN A CA  
1052 C  C   . ASN A 60 ? 0.3937 0.2962 0.1981 -0.1225 -0.0488 0.0333  79  ASN A C   
1053 O  O   . ASN A 60 ? 0.4639 0.3620 0.2303 -0.1710 -0.0561 0.0543  79  ASN A O   
1054 C  CB  . ASN A 60 ? 0.3825 0.3667 0.2931 -0.1116 -0.0647 0.0150  79  ASN A CB  
1055 C  CG  . ASN A 60 ? 0.4012 0.4357 0.3523 -0.1147 -0.0406 0.0056  79  ASN A CG  
1056 O  OD1 . ASN A 60 ? 0.4039 0.4665 0.3876 -0.0862 -0.0306 0.0216  79  ASN A OD1 
1057 N  ND2 . ASN A 60 ? 0.4178 0.4516 0.3555 -0.1487 -0.0388 -0.0103 79  ASN A ND2 
1064 N  N   . ASP A 61 ? 0.3099 0.2039 0.1560 -0.0791 -0.0211 0.0285  80  ASP A N   
1065 C  CA  . ASP A 61 ? 0.2408 0.1625 0.1195 -0.0471 -0.0276 0.0310  80  ASP A CA  
1066 C  C   . ASP A 61 ? 0.1946 0.1568 0.1025 -0.0278 -0.0450 0.0226  80  ASP A C   
1067 O  O   . ASP A 61 ? 0.1921 0.1785 0.1112 -0.0143 -0.0350 0.0141  80  ASP A O   
1068 C  CB  . ASP A 61 ? 0.2314 0.1344 0.1040 -0.0197 -0.0204 0.0127  80  ASP A CB  
1069 C  CG  . ASP A 61 ? 0.2266 0.1588 0.1170 0.0032  -0.0198 0.0418  80  ASP A CG  
1070 O  OD1 . ASP A 61 ? 0.2510 0.1988 0.1402 0.0464  -0.0551 0.0302  80  ASP A OD1 
1071 O  OD2 . ASP A 61 ? 0.1956 0.1390 0.1401 -0.0049 -0.0497 0.0295  80  ASP A OD2 
1077 N  N   . LEU A 62 ? 0.2325 0.1344 0.1002 0.0111  -0.0197 0.0108  81  LEU A N   
1078 C  CA  . LEU A 62 ? 0.2371 0.1337 0.1148 0.0211  -0.0084 0.0146  81  LEU A CA  
1079 C  C   . LEU A 62 ? 0.2089 0.1250 0.1180 0.0217  -0.0190 0.0144  81  LEU A C   
1080 O  O   . LEU A 62 ? 0.2242 0.1559 0.1314 0.0300  -0.0270 0.0078  81  LEU A O   
1081 C  CB  . LEU A 62 ? 0.2949 0.1455 0.1189 0.0069  0.0076  0.0159  81  LEU A CB  
1082 C  CG  . LEU A 62 ? 0.3812 0.1849 0.1252 0.0081  0.0052  0.0275  81  LEU A CG  
1083 C  CD1 . LEU A 62 ? 0.4240 0.2285 0.1529 0.0472  0.0232  0.0468  81  LEU A CD1 
1084 C  CD2 . LEU A 62 ? 0.4488 0.1698 0.1266 -0.0047 -0.0233 0.0248  81  LEU A CD2 
1096 N  N   . LEU A 63 ? 0.2061 0.1241 0.1009 0.0331  -0.0133 0.0156  82  LEU A N   
1097 C  CA  . LEU A 63 ? 0.1812 0.1247 0.0943 0.0206  -0.0345 -0.0028 82  LEU A CA  
1098 C  C   . LEU A 63 ? 0.1692 0.1233 0.1102 0.0250  -0.0344 -0.0030 82  LEU A C   
1099 O  O   . LEU A 63 ? 0.1697 0.1094 0.1283 0.0152  -0.0158 0.0166  82  LEU A O   
1100 C  CB  . LEU A 63 ? 0.1646 0.1439 0.0915 0.0003  -0.0469 0.0124  82  LEU A CB  
1101 C  CG  . LEU A 63 ? 0.1585 0.1626 0.1012 -0.0319 -0.0214 -0.0031 82  LEU A CG  
1102 C  CD1 . LEU A 63 ? 0.1854 0.1814 0.1281 -0.0115 -0.0379 -0.0170 82  LEU A CD1 
1103 C  CD2 . LEU A 63 ? 0.1889 0.1480 0.0958 -0.0316 -0.0277 0.0041  82  LEU A CD2 
1115 N  N   . GLY A 64 ? 0.1619 0.1190 0.1346 -0.0001 -0.0515 -0.0115 83  GLY A N   
1116 C  CA  . GLY A 64 ? 0.1678 0.1226 0.1311 0.0070  -0.0308 -0.0045 83  GLY A CA  
1117 C  C   . GLY A 64 ? 0.1744 0.1173 0.1307 0.0099  -0.0286 0.0030  83  GLY A C   
1118 O  O   . GLY A 64 ? 0.1553 0.1641 0.1678 0.0168  -0.0426 0.0180  83  GLY A O   
1122 N  N   . ASP A 65 ? 0.2010 0.1394 0.1344 0.0189  -0.0050 -0.0103 84  ASP A N   
1123 C  CA  . ASP A 65 ? 0.2038 0.1602 0.1517 0.0102  -0.0173 -0.0081 84  ASP A CA  
1124 C  C   . ASP A 65 ? 0.2120 0.1723 0.1630 0.0255  -0.0370 0.0084  84  ASP A C   
1125 O  O   . ASP A 65 ? 0.2153 0.1950 0.2055 0.0485  -0.0424 0.0127  84  ASP A O   
1126 C  CB  . ASP A 65 ? 0.2377 0.1956 0.1845 -0.0131 0.0201  0.0129  84  ASP A CB  
1127 C  CG  . ASP A 65 ? 0.3005 0.2450 0.2241 -0.0113 0.0180  0.0332  84  ASP A CG  
1128 O  OD1 . ASP A 65 ? 0.2766 0.2213 0.2449 -0.0133 0.0315  0.0290  84  ASP A OD1 
1129 O  OD2 . ASP A 65 ? 0.3708 0.2926 0.2552 -0.0233 0.0149  0.0774  84  ASP A OD2 
1134 N  N   . LEU A 66 ? 0.2000 0.1156 0.1405 -0.0013 -0.0493 0.0034  85  LEU A N   
1135 C  CA  . LEU A 66 ? 0.2183 0.1112 0.1337 0.0283  -0.0472 -0.0170 85  LEU A CA  
1136 C  C   . LEU A 66 ? 0.2103 0.0967 0.1206 0.0155  -0.0634 -0.0068 85  LEU A C   
1137 O  O   . LEU A 66 ? 0.2138 0.1067 0.1565 0.0194  -0.0809 -0.0157 85  LEU A O   
1138 C  CB  . LEU A 66 ? 0.2718 0.1186 0.1615 0.0086  -0.0704 0.0011  85  LEU A CB  
1139 C  CG  . LEU A 66 ? 0.3539 0.1897 0.2037 0.0524  -0.0813 0.0126  85  LEU A CG  
1140 C  CD1 . LEU A 66 ? 0.3877 0.2087 0.2086 0.0091  -0.1115 -0.0320 85  LEU A CD1 
1141 C  CD2 . LEU A 66 ? 0.3905 0.2738 0.2267 0.0632  -0.0758 0.0111  85  LEU A CD2 
1153 N  N   . PHE A 67 ? 0.1954 0.1197 0.1189 0.0202  -0.0602 -0.0049 86  PHE A N   
1154 C  CA  . PHE A 67 ? 0.1851 0.1228 0.1209 -0.0116 -0.0540 0.0151  86  PHE A CA  
1155 C  C   . PHE A 67 ? 0.1799 0.1484 0.1550 -0.0077 -0.0652 0.0246  86  PHE A C   
1156 O  O   . PHE A 67 ? 0.2300 0.1766 0.1773 -0.0212 -0.0877 0.0452  86  PHE A O   
1157 C  CB  . PHE A 67 ? 0.1892 0.1102 0.1254 -0.0101 -0.0647 -0.0037 86  PHE A CB  
1158 C  CG  . PHE A 67 ? 0.1846 0.0964 0.1120 -0.0156 -0.0507 -0.0014 86  PHE A CG  
1159 C  CD1 . PHE A 67 ? 0.1967 0.1034 0.1391 -0.0381 -0.0645 -0.0096 86  PHE A CD1 
1160 C  CD2 . PHE A 67 ? 0.1786 0.1200 0.1468 -0.0006 -0.0444 -0.0082 86  PHE A CD2 
1161 C  CE1 . PHE A 67 ? 0.1904 0.1086 0.1437 -0.0123 -0.0680 -0.0056 86  PHE A CE1 
1162 C  CE2 . PHE A 67 ? 0.1900 0.1571 0.1430 -0.0199 -0.0408 -0.0066 86  PHE A CE2 
1163 C  CZ  . PHE A 67 ? 0.1927 0.1182 0.1425 -0.0235 -0.0745 -0.0001 86  PHE A CZ  
1173 N  N   . GLY A 68 ? 0.1549 0.1487 0.1778 0.0050  -0.0533 -0.0096 87  GLY A N   
1174 C  CA  . GLY A 68 ? 0.1543 0.1483 0.1621 0.0198  -0.0557 -0.0081 87  GLY A CA  
1175 C  C   . GLY A 68 ? 0.1473 0.1492 0.1761 0.0063  -0.0699 -0.0246 87  GLY A C   
1176 O  O   . GLY A 68 ? 0.1297 0.2064 0.1990 -0.0072 -0.0629 -0.0156 87  GLY A O   
1180 N  N   . VAL A 69 ? 0.1562 0.1604 0.1492 -0.0014 -0.0560 -0.0183 88  VAL A N   
1181 C  CA  . VAL A 69 ? 0.1559 0.1587 0.1410 -0.0026 -0.0563 -0.0252 88  VAL A CA  
1182 C  C   . VAL A 69 ? 0.1623 0.1376 0.1345 -0.0176 -0.0528 -0.0389 88  VAL A C   
1183 O  O   . VAL A 69 ? 0.1621 0.1715 0.1372 -0.0072 -0.0610 -0.0510 88  VAL A O   
1184 C  CB  . VAL A 69 ? 0.1703 0.1913 0.1729 -0.0086 -0.0531 -0.0021 88  VAL A CB  
1185 C  CG1 . VAL A 69 ? 0.1898 0.2171 0.2033 0.0197  -0.0516 0.0308  88  VAL A CG1 
1186 C  CG2 . VAL A 69 ? 0.1703 0.2150 0.1810 -0.0159 -0.0304 0.0042  88  VAL A CG2 
1196 N  N   . PRO A 70 ? 0.1695 0.1351 0.1215 -0.0435 -0.0310 -0.0330 89  PRO A N   
1197 C  CA  . PRO A 70 ? 0.1669 0.1352 0.1155 -0.0381 -0.0032 -0.0099 89  PRO A CA  
1198 C  C   . PRO A 70 ? 0.1847 0.1065 0.1174 -0.0352 -0.0165 -0.0244 89  PRO A C   
1199 O  O   . PRO A 70 ? 0.2091 0.1038 0.1047 0.0052  -0.0464 -0.0057 89  PRO A O   
1200 C  CB  . PRO A 70 ? 0.1820 0.1274 0.1360 -0.0382 0.0032  -0.0204 89  PRO A CB  
1201 C  CG  . PRO A 70 ? 0.1919 0.1480 0.1535 -0.0454 -0.0420 -0.0374 89  PRO A CG  
1202 C  CD  . PRO A 70 ? 0.1964 0.1564 0.1346 -0.0553 -0.0403 -0.0533 89  PRO A CD  
1210 N  N   . SER A 71 ? 0.1767 0.1153 0.1157 -0.0247 -0.0367 -0.0069 90  SER A N   
1211 C  CA  . SER A 71 ? 0.1776 0.1068 0.1004 -0.0095 -0.0357 0.0069  90  SER A CA  
1212 C  C   . SER A 71 ? 0.1751 0.1224 0.1099 -0.0199 -0.0470 0.0037  90  SER A C   
1213 O  O   . SER A 71 ? 0.1820 0.1203 0.1322 -0.0228 -0.0502 0.0166  90  SER A O   
1214 C  CB  . SER A 71 ? 0.2142 0.1128 0.1158 -0.0038 -0.0627 -0.0048 90  SER A CB  
1215 O  OG  . SER A 71 ? 0.2176 0.1515 0.1244 -0.0150 -0.0456 -0.0296 90  SER A OG  
1221 N  N   . PHE A 72 ? 0.1432 0.1033 0.0903 -0.0167 -0.0487 -0.0066 91  PHE A N   
1222 C  CA  . PHE A 72 ? 0.1417 0.0954 0.0917 -0.0199 -0.0464 -0.0101 91  PHE A CA  
1223 C  C   . PHE A 72 ? 0.1366 0.1138 0.0861 -0.0134 -0.0370 -0.0118 91  PHE A C   
1224 O  O   . PHE A 72 ? 0.1514 0.1157 0.0826 0.0109  -0.0422 0.0272  91  PHE A O   
1225 C  CB  . PHE A 72 ? 0.1602 0.0876 0.0955 -0.0220 -0.0569 -0.0027 91  PHE A CB  
1226 C  CG  . PHE A 72 ? 0.1500 0.0965 0.0907 -0.0079 -0.0414 -0.0139 91  PHE A CG  
1227 C  CD1 . PHE A 72 ? 0.1468 0.1223 0.0831 -0.0206 -0.0342 -0.0135 91  PHE A CD1 
1228 C  CD2 . PHE A 72 ? 0.1347 0.0997 0.1151 -0.0101 -0.0448 -0.0174 91  PHE A CD2 
1229 C  CE1 . PHE A 72 ? 0.1555 0.1369 0.0938 -0.0369 -0.0395 -0.0124 91  PHE A CE1 
1230 C  CE2 . PHE A 72 ? 0.1749 0.1087 0.0917 -0.0180 -0.0437 -0.0135 91  PHE A CE2 
1231 C  CZ  . PHE A 72 ? 0.1845 0.1250 0.1014 -0.0164 -0.0398 -0.0262 91  PHE A CZ  
1241 N  N   . SER A 73 ? 0.1316 0.1345 0.0881 -0.0094 -0.0482 0.0156  92  SER A N   
1242 C  CA  . SER A 73 ? 0.1585 0.1051 0.0937 0.0099  -0.0493 0.0115  92  SER A CA  
1243 C  C   . SER A 73 ? 0.1393 0.1107 0.0989 0.0031  -0.0561 -0.0230 92  SER A C   
1244 O  O   . SER A 73 ? 0.1504 0.1204 0.1038 0.0124  -0.0697 -0.0108 92  SER A O   
1245 C  CB  . SER A 73 ? 0.1476 0.1135 0.0740 0.0230  -0.0460 -0.0022 92  SER A CB  
1246 O  OG  . SER A 73 ? 0.1657 0.1223 0.0906 -0.0115 -0.0421 -0.0047 92  SER A OG  
1252 N  N   . VAL A 74 ? 0.1427 0.1016 0.0982 -0.0039 -0.0560 -0.0002 93  VAL A N   
1253 C  CA  . VAL A 74 ? 0.1339 0.1026 0.0828 -0.0054 -0.0321 -0.0197 93  VAL A CA  
1254 C  C   . VAL A 74 ? 0.1423 0.1081 0.1052 0.0021  -0.0586 0.0001  93  VAL A C   
1255 O  O   . VAL A 74 ? 0.1779 0.0911 0.1249 -0.0104 -0.0481 -0.0151 93  VAL A O   
1256 C  CB  . VAL A 74 ? 0.1600 0.1170 0.1094 -0.0211 -0.0594 -0.0198 93  VAL A CB  
1257 C  CG1 . VAL A 74 ? 0.1539 0.1570 0.1046 -0.0070 -0.0703 -0.0193 93  VAL A CG1 
1258 C  CG2 . VAL A 74 ? 0.1576 0.1243 0.1535 0.0068  -0.0622 -0.0008 93  VAL A CG2 
1268 N  N   . LYS A 75 ? 0.1619 0.1000 0.0828 0.0167  -0.0538 -0.0021 94  LYS A N   
1269 C  CA  . LYS A 75 ? 0.1615 0.1285 0.0788 -0.0168 -0.0572 0.0111  94  LYS A CA  
1270 C  C   . LYS A 75 ? 0.1672 0.1116 0.0898 -0.0130 -0.0461 0.0017  94  LYS A C   
1271 O  O   . LYS A 75 ? 0.1809 0.1314 0.1035 0.0148  -0.0100 0.0018  94  LYS A O   
1272 C  CB  . LYS A 75 ? 0.1707 0.1684 0.1080 -0.0256 -0.0494 0.0218  94  LYS A CB  
1273 C  CG  . LYS A 75 ? 0.1974 0.1663 0.1348 -0.0047 -0.0328 0.0092  94  LYS A CG  
1274 C  CD  . LYS A 75 ? 0.2153 0.1971 0.1527 0.0079  -0.0122 0.0208  94  LYS A CD  
1275 C  CE  . LYS A 75 ? 0.2005 0.2178 0.1514 0.0069  -0.0126 0.0193  94  LYS A CE  
1276 N  NZ  . LYS A 75 ? 0.1772 0.2028 0.1455 -0.0163 -0.0164 -0.0025 94  LYS A NZ  
1290 N  N   . GLU A 76 ? 0.1619 0.0885 0.0723 0.0057  -0.0423 0.0078  95  GLU A N   
1291 C  CA  . GLU A 76 ? 0.1570 0.0880 0.0756 -0.0021 -0.0497 -0.0074 95  GLU A CA  
1292 C  C   . GLU A 76 ? 0.1405 0.0908 0.1129 0.0056  -0.0484 -0.0057 95  GLU A C   
1293 O  O   . GLU A 76 ? 0.1860 0.0822 0.1266 -0.0039 -0.0427 -0.0216 95  GLU A O   
1294 C  CB  . GLU A 76 ? 0.1541 0.0894 0.0980 0.0210  -0.0568 -0.0242 95  GLU A CB  
1295 C  CG  . GLU A 76 ? 0.1647 0.1057 0.1036 -0.0060 -0.0467 -0.0129 95  GLU A CG  
1296 C  CD  . GLU A 76 ? 0.1579 0.1413 0.1218 -0.0043 -0.0691 -0.0251 95  GLU A CD  
1297 O  OE1 . GLU A 76 ? 0.1647 0.1701 0.1059 -0.0104 -0.0747 0.0103  95  GLU A OE1 
1298 O  OE2 . GLU A 76 ? 0.1581 0.1658 0.1769 0.0113  -0.0981 -0.0013 95  GLU A OE2 
1305 N  N   . HIS A 77 ? 0.1580 0.0957 0.0866 -0.0043 -0.0257 0.0039  96  HIS A N   
1306 C  CA  . HIS A 77 ? 0.1593 0.0957 0.1062 -0.0067 -0.0377 0.0022  96  HIS A CA  
1307 C  C   . HIS A 77 ? 0.1588 0.0843 0.0911 -0.0066 -0.0541 -0.0087 96  HIS A C   
1308 O  O   . HIS A 77 ? 0.1651 0.0881 0.0971 0.0074  -0.0254 -0.0002 96  HIS A O   
1309 C  CB  . HIS A 77 ? 0.1689 0.0962 0.1724 0.0044  -0.0565 0.0223  96  HIS A CB  
1310 C  CG  . HIS A 77 ? 0.1795 0.1285 0.2611 -0.0052 -0.0320 0.0312  96  HIS A CG  
1311 N  ND1 . HIS A 77 ? 0.2222 0.1948 0.3457 0.0108  -0.0360 0.0502  96  HIS A ND1 
1312 C  CD2 . HIS A 77 ? 0.1613 0.1070 0.2750 0.0052  -0.0303 -0.0041 96  HIS A CD2 
1313 C  CE1 . HIS A 77 ? 0.2153 0.2018 0.3660 0.0295  -0.0404 0.0273  96  HIS A CE1 
1314 N  NE2 . HIS A 77 ? 0.2012 0.1606 0.3428 0.0283  -0.0509 0.0020  96  HIS A NE2 
1322 N  N   . ARG A 78 ? 0.1709 0.1110 0.0983 0.0103  -0.0388 -0.0204 97  ARG A N   
1323 C  CA  . ARG A 78 ? 0.1775 0.1234 0.0723 0.0060  -0.0242 -0.0264 97  ARG A CA  
1324 C  C   . ARG A 78 ? 0.1679 0.1210 0.0884 -0.0172 -0.0465 -0.0062 97  ARG A C   
1325 O  O   . ARG A 78 ? 0.1490 0.1092 0.0911 -0.0048 -0.0384 -0.0042 97  ARG A O   
1326 C  CB  . ARG A 78 ? 0.1870 0.1250 0.0722 0.0228  -0.0292 -0.0200 97  ARG A CB  
1327 C  CG  . ARG A 78 ? 0.1887 0.1287 0.0875 0.0108  -0.0263 -0.0093 97  ARG A CG  
1328 C  CD  . ARG A 78 ? 0.1847 0.1813 0.1165 0.0457  -0.0234 -0.0037 97  ARG A CD  
1329 N  NE  . ARG A 78 ? 0.1870 0.1749 0.1551 0.0446  -0.0596 0.0225  97  ARG A NE  
1330 C  CZ  . ARG A 78 ? 0.1957 0.1787 0.1868 0.0159  -0.0647 0.0123  97  ARG A CZ  
1331 N  NH1 . ARG A 78 ? 0.2411 0.2086 0.1605 -0.0144 -0.0568 0.0070  97  ARG A NH1 
1332 N  NH2 . ARG A 78 ? 0.2301 0.1677 0.2109 0.0453  -0.0288 0.0274  97  ARG A NH2 
1346 N  N   . LYS A 79 ? 0.1749 0.1010 0.1046 -0.0060 -0.0478 -0.0152 98  LYS A N   
1347 C  CA  . LYS A 79 ? 0.1613 0.1063 0.1030 -0.0017 -0.0397 -0.0262 98  LYS A CA  
1348 C  C   . LYS A 79 ? 0.1568 0.0957 0.1122 -0.0069 -0.0342 -0.0127 98  LYS A C   
1349 O  O   . LYS A 79 ? 0.1605 0.1082 0.1115 0.0012  -0.0362 -0.0022 98  LYS A O   
1350 C  CB  . LYS A 79 ? 0.1522 0.1059 0.1192 -0.0115 -0.0229 -0.0219 98  LYS A CB  
1351 C  CG  . LYS A 79 ? 0.1834 0.1099 0.1395 -0.0371 -0.0174 -0.0381 98  LYS A CG  
1352 C  CD  . LYS A 79 ? 0.1951 0.1304 0.1222 -0.0363 -0.0097 -0.0405 98  LYS A CD  
1353 C  CE  . LYS A 79 ? 0.1919 0.1356 0.1355 -0.0119 -0.0420 -0.0383 98  LYS A CE  
1354 N  NZ  . LYS A 79 ? 0.1860 0.1317 0.1368 -0.0188 -0.0628 -0.0496 98  LYS A NZ  
1368 N  N   . ILE A 80 ? 0.1508 0.1148 0.0974 -0.0025 -0.0449 0.0037  99  ILE A N   
1369 C  CA  . ILE A 80 ? 0.1487 0.0784 0.0797 0.0083  -0.0222 0.0031  99  ILE A CA  
1370 C  C   . ILE A 80 ? 0.1555 0.0772 0.0782 0.0154  -0.0468 -0.0014 99  ILE A C   
1371 O  O   . ILE A 80 ? 0.1672 0.0885 0.0830 0.0141  -0.0313 -0.0018 99  ILE A O   
1372 C  CB  . ILE A 80 ? 0.1666 0.1071 0.0699 0.0108  -0.0307 -0.0134 99  ILE A CB  
1373 C  CG1 . ILE A 80 ? 0.2020 0.1313 0.0914 0.0009  -0.0079 -0.0007 99  ILE A CG1 
1374 C  CG2 . ILE A 80 ? 0.1593 0.1656 0.0733 0.0019  -0.0252 0.0087  99  ILE A CG2 
1375 C  CD1 . ILE A 80 ? 0.2051 0.1191 0.1332 0.0157  -0.0303 0.0022  99  ILE A CD1 
1387 N  N   . TYR A 81 ? 0.1445 0.0913 0.0904 0.0102  -0.0402 0.0047  100 TYR A N   
1388 C  CA  . TYR A 81 ? 0.1557 0.0811 0.0855 -0.0031 -0.0345 0.0069  100 TYR A CA  
1389 C  C   . TYR A 81 ? 0.1622 0.0872 0.0638 -0.0038 -0.0444 0.0035  100 TYR A C   
1390 O  O   . TYR A 81 ? 0.1618 0.1009 0.0783 0.0231  -0.0166 -0.0015 100 TYR A O   
1391 C  CB  . TYR A 81 ? 0.1689 0.0690 0.1138 -0.0082 -0.0463 -0.0052 100 TYR A CB  
1392 C  CG  . TYR A 81 ? 0.1400 0.0865 0.1694 0.0126  -0.0410 -0.0154 100 TYR A CG  
1393 C  CD1 . TYR A 81 ? 0.1524 0.1313 0.2325 -0.0304 -0.0191 -0.0340 100 TYR A CD1 
1394 C  CD2 . TYR A 81 ? 0.1663 0.1717 0.2224 -0.0129 -0.0225 -0.1100 100 TYR A CD2 
1395 C  CE1 . TYR A 81 ? 0.1665 0.1742 0.2463 -0.0453 0.0042  -0.0193 100 TYR A CE1 
1396 C  CE2 . TYR A 81 ? 0.1914 0.1816 0.2377 -0.0424 -0.0304 -0.0879 100 TYR A CE2 
1397 C  CZ  . TYR A 81 ? 0.1602 0.1677 0.2091 -0.0359 -0.0504 0.0036  100 TYR A CZ  
1398 O  OH  . TYR A 81 ? 0.1892 0.1944 0.2244 -0.0403 -0.0794 0.0442  100 TYR A OH  
1408 N  N   . THR A 82 ? 0.1446 0.1063 0.0612 0.0179  -0.0351 0.0009  101 THR A N   
1409 C  CA  . THR A 82 ? 0.1457 0.1206 0.0608 0.0440  -0.0328 -0.0123 101 THR A CA  
1410 C  C   . THR A 82 ? 0.1388 0.1368 0.0773 0.0131  -0.0553 -0.0120 101 THR A C   
1411 O  O   . THR A 82 ? 0.1426 0.1317 0.0801 0.0167  -0.0280 -0.0181 101 THR A O   
1412 C  CB  . THR A 82 ? 0.1519 0.1834 0.0892 0.0403  -0.0296 0.0013  101 THR A CB  
1413 O  OG1 . THR A 82 ? 0.1625 0.1834 0.1237 0.0205  -0.0377 -0.0037 101 THR A OG1 
1414 C  CG2 . THR A 82 ? 0.1214 0.2139 0.0953 -0.0033 -0.0447 0.0329  101 THR A CG2 
1422 N  N   A MET A 83 ? 0.1408 0.1265 0.0854 0.0096  -0.0517 0.0017  102 MET A N   
1423 N  N   B MET A 83 ? 0.1337 0.1266 0.0707 0.0096  -0.0500 -0.0059 102 MET A N   
1424 C  CA  A MET A 83 ? 0.1369 0.1115 0.0703 0.0086  -0.0516 0.0037  102 MET A CA  
1425 C  CA  B MET A 83 ? 0.1320 0.1199 0.0619 0.0056  -0.0458 -0.0049 102 MET A CA  
1426 C  C   A MET A 83 ? 0.1414 0.1002 0.0671 0.0051  -0.0450 0.0162  102 MET A C   
1427 C  C   B MET A 83 ? 0.1148 0.1055 0.0625 -0.0014 -0.0445 0.0097  102 MET A C   
1428 O  O   A MET A 83 ? 0.1738 0.1170 0.0665 0.0125  -0.0474 -0.0037 102 MET A O   
1429 O  O   B MET A 83 ? 0.0920 0.0956 0.0544 0.0077  -0.0364 0.0138  102 MET A O   
1430 C  CB  A MET A 83 ? 0.1221 0.1299 0.0848 -0.0254 -0.0334 0.0190  102 MET A CB  
1431 C  CB  B MET A 83 ? 0.1488 0.1316 0.0632 0.0002  -0.0367 -0.0110 102 MET A CB  
1432 C  CG  A MET A 83 ? 0.1568 0.1434 0.0985 -0.0287 -0.0433 0.0027  102 MET A CG  
1433 C  CG  B MET A 83 ? 0.1731 0.1416 0.0673 -0.0070 -0.0403 -0.0151 102 MET A CG  
1434 S  SD  A MET A 83 ? 0.1955 0.1668 0.1169 -0.0470 -0.0668 -0.0125 102 MET A SD  
1435 S  SD  B MET A 83 ? 0.1933 0.1519 0.0677 -0.0115 -0.0373 -0.0198 102 MET A SD  
1436 C  CE  A MET A 83 ? 0.2009 0.2121 0.1583 -0.0338 -0.0618 0.0259  102 MET A CE  
1437 C  CE  B MET A 83 ? 0.1882 0.1462 0.0709 -0.0008 -0.0492 -0.0117 102 MET A CE  
1456 N  N   . ILE A 84 ? 0.1111 0.1065 0.0711 -0.0184 -0.0488 0.0063  103 ILE A N   
1457 C  CA  . ILE A 84 ? 0.1164 0.0959 0.0720 -0.0008 -0.0499 0.0136  103 ILE A CA  
1458 C  C   . ILE A 84 ? 0.1353 0.0965 0.0782 0.0203  -0.0488 0.0138  103 ILE A C   
1459 O  O   . ILE A 84 ? 0.1482 0.1032 0.0844 0.0156  -0.0535 0.0097  103 ILE A O   
1460 C  CB  . ILE A 84 ? 0.1263 0.1177 0.0777 -0.0179 -0.0542 0.0096  103 ILE A CB  
1461 C  CG1 . ILE A 84 ? 0.1272 0.1180 0.0832 0.0105  -0.0462 0.0031  103 ILE A CG1 
1462 C  CG2 . ILE A 84 ? 0.1448 0.1132 0.0787 -0.0295 -0.0492 0.0015  103 ILE A CG2 
1463 C  CD1 . ILE A 84 ? 0.1473 0.1127 0.1020 0.0255  -0.0267 -0.0159 103 ILE A CD1 
1475 N  N   . TYR A 85 ? 0.1292 0.1034 0.0721 0.0073  -0.0428 0.0033  104 TYR A N   
1476 C  CA  . TYR A 85 ? 0.1001 0.0945 0.0738 -0.0030 -0.0502 0.0058  104 TYR A CA  
1477 C  C   . TYR A 85 ? 0.1187 0.1006 0.0653 -0.0009 -0.0441 0.0187  104 TYR A C   
1478 O  O   . TYR A 85 ? 0.1527 0.1256 0.0700 0.0355  -0.0371 -0.0079 104 TYR A O   
1479 C  CB  . TYR A 85 ? 0.1266 0.1187 0.0793 0.0047  -0.0463 -0.0008 104 TYR A CB  
1480 C  CG  . TYR A 85 ? 0.1570 0.1072 0.0884 0.0001  -0.0539 0.0125  104 TYR A CG  
1481 C  CD1 . TYR A 85 ? 0.1625 0.1051 0.1243 -0.0178 -0.0210 0.0084  104 TYR A CD1 
1482 C  CD2 . TYR A 85 ? 0.1785 0.1448 0.1074 -0.0034 -0.0406 -0.0163 104 TYR A CD2 
1483 C  CE1 . TYR A 85 ? 0.1676 0.1003 0.1174 0.0043  -0.0106 0.0239  104 TYR A CE1 
1484 C  CE2 . TYR A 85 ? 0.1761 0.1140 0.1319 0.0074  -0.0410 0.0202  104 TYR A CE2 
1485 C  CZ  . TYR A 85 ? 0.1594 0.1121 0.1353 -0.0129 -0.0406 0.0133  104 TYR A CZ  
1486 O  OH  . TYR A 85 ? 0.1898 0.1305 0.1318 -0.0112 -0.0361 0.0120  104 TYR A OH  
1496 N  N   . ARG A 86 ? 0.1268 0.1056 0.0745 -0.0106 -0.0499 0.0083  105 ARG A N   
1497 C  CA  . ARG A 86 ? 0.1281 0.1085 0.0720 0.0148  -0.0383 0.0039  105 ARG A CA  
1498 C  C   . ARG A 86 ? 0.1539 0.1112 0.0930 0.0072  -0.0472 -0.0073 105 ARG A C   
1499 O  O   . ARG A 86 ? 0.1487 0.1485 0.1029 0.0045  -0.0368 -0.0053 105 ARG A O   
1500 C  CB  . ARG A 86 ? 0.1394 0.1160 0.0749 -0.0192 -0.0534 0.0140  105 ARG A CB  
1501 C  CG  . ARG A 86 ? 0.1586 0.1270 0.0756 0.0016  -0.0478 -0.0107 105 ARG A CG  
1502 C  CD  . ARG A 86 ? 0.1779 0.1484 0.0819 -0.0180 -0.0573 -0.0114 105 ARG A CD  
1503 N  NE  . ARG A 86 ? 0.1582 0.1416 0.0800 -0.0046 -0.0553 -0.0176 105 ARG A NE  
1504 C  CZ  . ARG A 86 ? 0.1670 0.1259 0.1073 0.0003  -0.0674 0.0076  105 ARG A CZ  
1505 N  NH1 . ARG A 86 ? 0.2222 0.1607 0.1285 -0.0129 -0.0788 0.0200  105 ARG A NH1 
1506 N  NH2 . ARG A 86 ? 0.1906 0.1043 0.1181 -0.0053 -0.0530 0.0089  105 ARG A NH2 
1520 N  N   . ASN A 87 ? 0.1425 0.1082 0.0838 0.0106  -0.0476 0.0188  106 ASN A N   
1521 C  CA  . ASN A 87 ? 0.1808 0.0831 0.0831 0.0039  -0.0545 0.0092  106 ASN A CA  
1522 C  C   . ASN A 87 ? 0.1904 0.0938 0.0804 0.0065  -0.0345 0.0100  106 ASN A C   
1523 O  O   . ASN A 87 ? 0.2020 0.1071 0.0746 -0.0072 -0.0489 0.0104  106 ASN A O   
1524 C  CB  . ASN A 87 ? 0.1980 0.0838 0.0795 -0.0001 -0.0570 0.0066  106 ASN A CB  
1525 C  CG  . ASN A 87 ? 0.2026 0.0997 0.0762 -0.0061 -0.0267 0.0010  106 ASN A CG  
1526 O  OD1 . ASN A 87 ? 0.2570 0.1273 0.0912 0.0032  -0.0075 0.0080  106 ASN A OD1 
1527 N  ND2 . ASN A 87 ? 0.2262 0.1120 0.0835 0.0151  -0.0394 -0.0018 106 ASN A ND2 
1534 N  N   . LEU A 88 ? 0.1653 0.0744 0.1127 -0.0051 -0.0300 -0.0035 107 LEU A N   
1535 C  CA  . LEU A 88 ? 0.1725 0.0727 0.0914 0.0130  -0.0484 -0.0006 107 LEU A CA  
1536 C  C   . LEU A 88 ? 0.1439 0.0912 0.0700 0.0069  -0.0501 0.0087  107 LEU A C   
1537 O  O   . LEU A 88 ? 0.1672 0.1268 0.0756 0.0034  -0.0565 0.0018  107 LEU A O   
1538 C  CB  . LEU A 88 ? 0.1763 0.1094 0.1001 0.0108  -0.0682 -0.0247 107 LEU A CB  
1539 C  CG  . LEU A 88 ? 0.1692 0.1159 0.1008 -0.0148 -0.0549 -0.0264 107 LEU A CG  
1540 C  CD1 . LEU A 88 ? 0.1768 0.1321 0.0951 -0.0143 -0.0583 -0.0276 107 LEU A CD1 
1541 C  CD2 . LEU A 88 ? 0.1889 0.1073 0.1156 -0.0045 -0.0063 -0.0546 107 LEU A CD2 
1553 N  N   . VAL A 89 ? 0.1722 0.0838 0.0798 0.0024  -0.0442 0.0073  108 VAL A N   
1554 C  CA  . VAL A 89 ? 0.1569 0.1236 0.0817 0.0020  -0.0540 0.0165  108 VAL A CA  
1555 C  C   . VAL A 89 ? 0.1465 0.1241 0.0788 0.0265  -0.0486 0.0109  108 VAL A C   
1556 O  O   . VAL A 89 ? 0.1674 0.1030 0.0908 0.0063  -0.0496 0.0320  108 VAL A O   
1557 C  CB  . VAL A 89 ? 0.1561 0.1482 0.1123 -0.0082 -0.0563 0.0111  108 VAL A CB  
1558 C  CG1 . VAL A 89 ? 0.1637 0.1891 0.1192 0.0281  -0.0179 0.0008  108 VAL A CG1 
1559 C  CG2 . VAL A 89 ? 0.1604 0.1461 0.1399 -0.0272 -0.0360 0.0165  108 VAL A CG2 
1569 N  N   . VAL A 90 ? 0.1489 0.1373 0.0862 0.0083  -0.0560 0.0120  109 VAL A N   
1570 C  CA  . VAL A 90 ? 0.1635 0.1416 0.1187 0.0056  -0.0602 0.0272  109 VAL A CA  
1571 C  C   . VAL A 90 ? 0.2099 0.1330 0.1926 0.0016  -0.0449 -0.0164 109 VAL A C   
1572 O  O   . VAL A 90 ? 0.2029 0.1601 0.2665 0.0126  -0.0139 -0.0776 109 VAL A O   
1573 C  CB  . VAL A 90 ? 0.1877 0.1688 0.1482 0.0307  -0.0696 0.0541  109 VAL A CB  
1574 C  CG1 . VAL A 90 ? 0.2254 0.1704 0.1832 0.0019  -0.0764 0.0647  109 VAL A CG1 
1575 C  CG2 . VAL A 90 ? 0.2050 0.2376 0.1127 0.0464  -0.0612 0.0312  109 VAL A CG2 
1585 N  N   . VAL A 91 ? 0.2107 0.1110 0.2108 0.0091  -0.0612 -0.0172 110 VAL A N   
1586 C  CA  . VAL A 91 ? 0.2545 0.1470 0.2476 0.0028  -0.0577 -0.0211 110 VAL A CA  
1587 C  C   . VAL A 91 ? 0.3046 0.2132 0.3171 -0.0118 -0.0302 0.0071  110 VAL A C   
1588 O  O   . VAL A 91 ? 0.3222 0.2514 0.3031 -0.0411 -0.0063 0.0550  110 VAL A O   
1589 C  CB  . VAL A 91 ? 0.3091 0.1452 0.2362 0.0205  -0.0364 -0.0553 110 VAL A CB  
1590 C  CG1 . VAL A 91 ? 0.3476 0.1920 0.2486 -0.0059 -0.0353 -0.0423 110 VAL A CG1 
1591 C  CG2 . VAL A 91 ? 0.3112 0.1781 0.2152 0.0596  -0.0213 -0.0628 110 VAL A CG2 
1601 N  N   . ASN A 92 ? 0.3754 0.2297 0.4005 -0.0099 -0.0352 -0.0128 111 ASN A N   
1602 C  CA  . ASN A 92 ? 0.4325 0.2671 0.4625 0.0261  -0.0269 -0.0446 111 ASN A CA  
1603 C  C   . ASN A 92 ? 0.5084 0.3084 0.4801 0.0130  -0.0123 -0.0736 111 ASN A C   
1604 O  O   . ASN A 92 ? 0.5631 0.3652 0.5031 0.0189  0.0038  -0.0805 111 ASN A O   
1605 C  CB  . ASN A 92 ? 0.4408 0.2843 0.5013 0.0523  -0.0211 -0.0580 111 ASN A CB  
1606 C  CG  . ASN A 92 ? 0.4629 0.3238 0.5488 0.0448  -0.0149 -0.0549 111 ASN A CG  
1607 O  OD1 . ASN A 92 ? 0.5095 0.3822 0.5739 0.0178  -0.0056 -0.0570 111 ASN A OD1 
1608 N  ND2 . ASN A 92 ? 0.4619 0.3443 0.5525 0.0317  -0.0239 -0.0364 111 ASN A ND2 
1615 N  N   . PRO B 1  ? 0.3905 0.3525 0.3593 -0.0056 -0.0899 -0.0308 20  PRO B N   
1616 C  CA  . PRO B 1  ? 0.4024 0.3586 0.3575 -0.0085 -0.0707 -0.0317 20  PRO B CA  
1617 C  C   . PRO B 1  ? 0.3910 0.3636 0.3359 -0.0149 -0.0527 -0.0240 20  PRO B C   
1618 O  O   . PRO B 1  ? 0.4169 0.3810 0.3639 -0.0259 -0.0324 -0.0266 20  PRO B O   
1619 C  CB  . PRO B 1  ? 0.4119 0.3509 0.3663 0.0110  -0.0844 -0.0338 20  PRO B CB  
1620 C  CG  . PRO B 1  ? 0.4073 0.3363 0.3711 -0.0130 -0.1072 -0.0474 20  PRO B CG  
1621 C  CD  . PRO B 1  ? 0.3966 0.3386 0.3708 -0.0036 -0.1001 -0.0396 20  PRO B CD  
1629 N  N   . ALA B 2  ? 0.3616 0.3433 0.2970 -0.0003 -0.0467 -0.0132 21  ALA B N   
1630 C  CA  . ALA B 2  ? 0.3116 0.3189 0.2738 0.0000  -0.0303 -0.0077 21  ALA B CA  
1631 C  C   . ALA B 2  ? 0.2460 0.2616 0.2460 0.0077  -0.0207 0.0374  21  ALA B C   
1632 O  O   . ALA B 2  ? 0.2436 0.2581 0.2392 0.0288  -0.0389 0.0755  21  ALA B O   
1633 C  CB  . ALA B 2  ? 0.2917 0.3298 0.2736 0.0137  0.0029  -0.0279 21  ALA B CB  
1639 N  N   . SER B 3  ? 0.2368 0.2445 0.2391 0.0282  0.0025  0.0368  22  SER B N   
1640 C  CA  . SER B 3  ? 0.2220 0.2032 0.2183 0.0152  0.0214  0.0216  22  SER B CA  
1641 C  C   . SER B 3  ? 0.2006 0.2063 0.1847 0.0117  -0.0079 0.0362  22  SER B C   
1642 O  O   . SER B 3  ? 0.2572 0.2806 0.1791 0.0001  -0.0311 0.0475  22  SER B O   
1643 C  CB  . SER B 3  ? 0.2674 0.1637 0.2417 0.0470  0.0288  0.0114  22  SER B CB  
1644 O  OG  . SER B 3  ? 0.3034 0.1750 0.2814 0.0281  0.0325  0.0021  22  SER B OG  
1650 N  N   . GLU B 4  ? 0.2001 0.1829 0.1667 0.0061  -0.0260 0.0307  23  GLU B N   
1651 C  CA  . GLU B 4  ? 0.2144 0.1659 0.1652 0.0174  -0.0385 0.0222  23  GLU B CA  
1652 C  C   . GLU B 4  ? 0.1851 0.1571 0.1618 0.0152  -0.0115 0.0255  23  GLU B C   
1653 O  O   . GLU B 4  ? 0.1968 0.2010 0.1874 -0.0020 -0.0237 0.0129  23  GLU B O   
1654 C  CB  . GLU B 4  ? 0.2250 0.1568 0.1699 0.0125  -0.0361 0.0387  23  GLU B CB  
1655 C  CG  . GLU B 4  ? 0.2091 0.1763 0.2099 -0.0038 -0.0601 -0.0029 23  GLU B CG  
1656 C  CD  . GLU B 4  ? 0.2419 0.1987 0.2294 0.0194  -0.0710 -0.0140 23  GLU B CD  
1657 O  OE1 . GLU B 4  ? 0.2464 0.2162 0.2403 -0.0133 -0.0754 0.0001  23  GLU B OE1 
1658 O  OE2 . GLU B 4  ? 0.2805 0.2202 0.2396 0.0426  -0.0783 -0.0278 23  GLU B OE2 
1665 N  N   . GLN B 5  ? 0.1942 0.1685 0.1711 0.0103  -0.0208 0.0009  24  GLN B N   
1666 C  CA  . GLN B 5  ? 0.2030 0.1493 0.1627 0.0163  -0.0190 -0.0033 24  GLN B CA  
1667 C  C   . GLN B 5  ? 0.1973 0.1417 0.1769 -0.0088 -0.0073 0.0068  24  GLN B C   
1668 O  O   . GLN B 5  ? 0.2248 0.1775 0.2104 0.0343  -0.0120 0.0082  24  GLN B O   
1669 C  CB  . GLN B 5  ? 0.2286 0.1730 0.1763 0.0459  -0.0301 -0.0362 24  GLN B CB  
1670 C  CG  . GLN B 5  ? 0.2467 0.2271 0.1759 0.0171  -0.0467 -0.0210 24  GLN B CG  
1671 C  CD  . GLN B 5  ? 0.2804 0.2640 0.2042 -0.0281 -0.0377 -0.0490 24  GLN B CD  
1672 O  OE1 . GLN B 5  ? 0.2627 0.3093 0.2250 -0.0745 -0.0432 -0.0538 24  GLN B OE1 
1673 N  NE2 . GLN B 5  ? 0.2779 0.2507 0.1863 -0.0190 -0.0475 -0.0473 24  GLN B NE2 
1682 N  N   . GLU B 6  ? 0.1695 0.1650 0.1648 0.0411  -0.0142 0.0187  25  GLU B N   
1683 C  CA  . GLU B 6  ? 0.2183 0.1858 0.1803 0.0488  0.0023  0.0455  25  GLU B CA  
1684 C  C   . GLU B 6  ? 0.2038 0.1489 0.1591 0.0316  -0.0071 0.0356  25  GLU B C   
1685 O  O   . GLU B 6  ? 0.2225 0.1456 0.1714 0.0003  -0.0442 0.0455  25  GLU B O   
1686 C  CB  . GLU B 6  ? 0.2455 0.2703 0.1961 0.0734  0.0236  0.0696  25  GLU B CB  
1687 C  CG  . GLU B 6  ? 0.2730 0.3345 0.2538 0.0261  0.0582  0.0273  25  GLU B CG  
1688 C  CD  . GLU B 6  ? 0.3156 0.3951 0.3079 0.0187  0.0518  -0.0326 25  GLU B CD  
1689 O  OE1 . GLU B 6  ? 0.3507 0.4271 0.3232 0.0045  0.0525  -0.0613 25  GLU B OE1 
1690 O  OE2 . GLU B 6  ? 0.2893 0.4121 0.3316 0.0268  0.0555  -0.0444 25  GLU B OE2 
1697 N  N   . THR B 7  ? 0.1966 0.1307 0.1533 0.0228  -0.0247 0.0313  26  THR B N   
1698 C  CA  . THR B 7  ? 0.1870 0.1272 0.1436 -0.0021 -0.0285 0.0368  26  THR B CA  
1699 C  C   . THR B 7  ? 0.1673 0.1357 0.1569 -0.0034 -0.0304 0.0512  26  THR B C   
1700 O  O   . THR B 7  ? 0.2382 0.1291 0.1491 -0.0214 0.0047  0.0356  26  THR B O   
1701 C  CB  . THR B 7  ? 0.1920 0.1540 0.1582 0.0253  -0.0123 0.0468  26  THR B CB  
1702 O  OG1 . THR B 7  ? 0.2115 0.1437 0.1618 0.0185  -0.0265 0.0378  26  THR B OG1 
1703 C  CG2 . THR B 7  ? 0.2197 0.2095 0.1696 0.0725  -0.0228 0.0657  26  THR B CG2 
1711 N  N   . LEU B 8  ? 0.1718 0.1413 0.1614 0.0128  -0.0385 0.0517  27  LEU B N   
1712 C  CA  . LEU B 8  ? 0.1865 0.1241 0.1732 0.0037  -0.0440 0.0316  27  LEU B CA  
1713 C  C   . LEU B 8  ? 0.1877 0.0923 0.1524 -0.0161 -0.0242 0.0333  27  LEU B C   
1714 O  O   . LEU B 8  ? 0.1805 0.1161 0.1461 -0.0138 -0.0405 0.0590  27  LEU B O   
1715 C  CB  . LEU B 8  ? 0.2046 0.1554 0.2136 0.0182  -0.0207 0.0080  27  LEU B CB  
1716 C  CG  . LEU B 8  ? 0.2720 0.1883 0.2535 0.0406  -0.0271 -0.0154 27  LEU B CG  
1717 C  CD1 . LEU B 8  ? 0.2993 0.2361 0.2726 0.0537  -0.0267 -0.0276 27  LEU B CD1 
1718 C  CD2 . LEU B 8  ? 0.3102 0.2172 0.2850 0.0273  -0.0189 -0.0223 27  LEU B CD2 
1730 N  N   . VAL B 9  ? 0.1688 0.0951 0.1231 -0.0029 -0.0177 0.0438  28  VAL B N   
1731 C  CA  . VAL B 9  ? 0.1746 0.1155 0.0997 -0.0041 -0.0433 0.0039  28  VAL B CA  
1732 C  C   . VAL B 9  ? 0.1798 0.1024 0.1039 -0.0398 -0.0494 0.0217  28  VAL B C   
1733 O  O   . VAL B 9  ? 0.1910 0.1367 0.1104 -0.0033 -0.0287 0.0337  28  VAL B O   
1734 C  CB  . VAL B 9  ? 0.1397 0.1302 0.1034 0.0024  -0.0340 0.0140  28  VAL B CB  
1735 C  CG1 . VAL B 9  ? 0.1839 0.1174 0.1081 -0.0036 -0.0250 0.0232  28  VAL B CG1 
1736 C  CG2 . VAL B 9  ? 0.1175 0.1551 0.1214 -0.0067 -0.0158 0.0043  28  VAL B CG2 
1746 N  N   . ARG B 10 ? 0.1754 0.0985 0.0834 -0.0136 -0.0321 0.0076  29  ARG B N   
1747 C  CA  . ARG B 10 ? 0.1823 0.1054 0.0857 -0.0167 -0.0365 0.0106  29  ARG B CA  
1748 C  C   . ARG B 10 ? 0.1493 0.0971 0.0794 -0.0324 -0.0502 -0.0002 29  ARG B C   
1749 O  O   . ARG B 10 ? 0.1571 0.1131 0.0882 -0.0314 -0.0534 0.0218  29  ARG B O   
1750 C  CB  . ARG B 10 ? 0.2149 0.1413 0.1516 -0.0168 -0.0608 -0.0123 29  ARG B CB  
1751 C  CG  . ARG B 10 ? 0.2407 0.1804 0.1947 0.0295  -0.0634 -0.0433 29  ARG B CG  
1752 C  CD  . ARG B 10 ? 0.2751 0.2120 0.2435 0.0329  -0.0614 -0.0769 29  ARG B CD  
1753 N  NE  . ARG B 10 ? 0.3302 0.2383 0.2610 0.0406  -0.0288 -0.0961 29  ARG B NE  
1754 C  CZ  . ARG B 10 ? 0.3616 0.2835 0.2942 0.1058  -0.0219 -0.1166 29  ARG B CZ  
1755 N  NH1 . ARG B 10 ? 0.3563 0.2946 0.3138 0.1207  -0.0506 -0.0991 29  ARG B NH1 
1756 N  NH2 . ARG B 10 ? 0.3988 0.3032 0.3263 0.1368  -0.0067 -0.1233 29  ARG B NH2 
1770 N  N   . PRO B 11 ? 0.1638 0.0757 0.0955 -0.0298 -0.0245 0.0160  30  PRO B N   
1771 C  CA  . PRO B 11 ? 0.1638 0.0983 0.0906 -0.0178 -0.0267 0.0071  30  PRO B CA  
1772 C  C   . PRO B 11 ? 0.1511 0.1126 0.0776 -0.0471 -0.0273 0.0025  30  PRO B C   
1773 O  O   . PRO B 11 ? 0.1615 0.1281 0.0949 -0.0166 -0.0356 0.0036  30  PRO B O   
1774 C  CB  . PRO B 11 ? 0.1756 0.1319 0.1318 -0.0258 -0.0510 -0.0047 30  PRO B CB  
1775 C  CG  . PRO B 11 ? 0.2024 0.1718 0.1782 -0.0314 -0.0507 -0.0024 30  PRO B CG  
1776 C  CD  . PRO B 11 ? 0.2073 0.1206 0.1599 -0.0428 -0.0305 0.0048  30  PRO B CD  
1784 N  N   . LYS B 12 ? 0.1658 0.1251 0.0867 -0.0264 -0.0351 -0.0059 31  LYS B N   
1785 C  CA  . LYS B 12 ? 0.1553 0.1214 0.1225 0.0078  -0.0557 0.0053  31  LYS B CA  
1786 C  C   . LYS B 12 ? 0.1447 0.1348 0.1120 -0.0080 -0.0746 0.0016  31  LYS B C   
1787 O  O   . LYS B 12 ? 0.1310 0.1345 0.1006 -0.0038 -0.0642 0.0001  31  LYS B O   
1788 C  CB  . LYS B 12 ? 0.1980 0.1963 0.1544 0.0392  -0.0928 -0.0142 31  LYS B CB  
1789 C  CG  . LYS B 12 ? 0.2179 0.2553 0.1637 0.0084  -0.0853 -0.0202 31  LYS B CG  
1790 C  CD  . LYS B 12 ? 0.2478 0.3065 0.2216 0.0007  -0.0682 -0.0211 31  LYS B CD  
1791 C  CE  . LYS B 12 ? 0.2295 0.2883 0.2191 0.0197  -0.0718 -0.0218 31  LYS B CE  
1792 N  NZ  . LYS B 12 ? 0.1931 0.2448 0.1930 0.0121  -0.0804 0.0010  31  LYS B NZ  
1806 N  N   . PRO B 13 ? 0.1581 0.1350 0.1393 -0.0198 -0.0839 0.0354  32  PRO B N   
1807 C  CA  . PRO B 13 ? 0.1684 0.1407 0.1482 -0.0338 -0.0885 0.0434  32  PRO B CA  
1808 C  C   . PRO B 13 ? 0.1842 0.1567 0.1388 -0.0283 -0.0864 0.0348  32  PRO B C   
1809 O  O   . PRO B 13 ? 0.1829 0.1600 0.1425 -0.0391 -0.0852 0.0525  32  PRO B O   
1810 C  CB  . PRO B 13 ? 0.2223 0.1596 0.1654 -0.0543 -0.1057 0.0497  32  PRO B CB  
1811 C  CG  . PRO B 13 ? 0.2218 0.1607 0.1680 -0.0679 -0.1056 0.0455  32  PRO B CG  
1812 C  CD  . PRO B 13 ? 0.1869 0.1441 0.1473 -0.0543 -0.0897 0.0227  32  PRO B CD  
1820 N  N   . LEU B 14 ? 0.1458 0.1528 0.1594 -0.0006 -0.0535 0.0219  33  LEU B N   
1821 C  CA  . LEU B 14 ? 0.1687 0.1418 0.1788 -0.0030 -0.0583 0.0222  33  LEU B CA  
1822 C  C   . LEU B 14 ? 0.1425 0.1188 0.1397 -0.0291 -0.0456 0.0265  33  LEU B C   
1823 O  O   . LEU B 14 ? 0.1166 0.1223 0.1503 -0.0142 -0.0310 -0.0034 33  LEU B O   
1824 C  CB  . LEU B 14 ? 0.1809 0.1284 0.2418 -0.0170 -0.0563 0.0074  33  LEU B CB  
1825 C  CG  . LEU B 14 ? 0.2295 0.1693 0.2801 -0.0039 -0.0535 0.0307  33  LEU B CG  
1826 C  CD1 . LEU B 14 ? 0.2610 0.2016 0.2871 0.0145  -0.0887 -0.0165 33  LEU B CD1 
1827 C  CD2 . LEU B 14 ? 0.2828 0.2031 0.2977 0.0126  -0.0691 0.0495  33  LEU B CD2 
1839 N  N   . LEU B 15 ? 0.1247 0.1339 0.1252 -0.0064 -0.0359 0.0411  34  LEU B N   
1840 C  CA  . LEU B 15 ? 0.1307 0.1178 0.0938 -0.0242 -0.0441 -0.0028 34  LEU B CA  
1841 C  C   . LEU B 15 ? 0.1592 0.0997 0.1055 -0.0118 -0.0518 0.0235  34  LEU B C   
1842 O  O   . LEU B 15 ? 0.1396 0.1165 0.1257 -0.0152 -0.0469 0.0121  34  LEU B O   
1843 C  CB  . LEU B 15 ? 0.1484 0.1221 0.0933 -0.0161 -0.0164 -0.0021 34  LEU B CB  
1844 C  CG  . LEU B 15 ? 0.1713 0.1352 0.0962 -0.0067 -0.0582 0.0008  34  LEU B CG  
1845 C  CD1 . LEU B 15 ? 0.1607 0.1744 0.0803 -0.0165 -0.0575 -0.0005 34  LEU B CD1 
1846 C  CD2 . LEU B 15 ? 0.1502 0.1641 0.1022 0.0290  -0.0367 0.0108  34  LEU B CD2 
1858 N  N   . LEU B 16 ? 0.1472 0.1151 0.1279 -0.0165 -0.0427 -0.0072 35  LEU B N   
1859 C  CA  . LEU B 16 ? 0.1546 0.1412 0.1221 -0.0141 -0.0502 -0.0214 35  LEU B CA  
1860 C  C   . LEU B 16 ? 0.1632 0.1520 0.1073 -0.0021 -0.0491 -0.0088 35  LEU B C   
1861 O  O   . LEU B 16 ? 0.1671 0.1418 0.1031 0.0031  -0.0224 0.0020  35  LEU B O   
1862 C  CB  . LEU B 16 ? 0.1943 0.1435 0.1237 -0.0005 -0.0413 -0.0249 35  LEU B CB  
1863 C  CG  . LEU B 16 ? 0.2398 0.1834 0.1211 0.0085  -0.0553 -0.0306 35  LEU B CG  
1864 C  CD1 . LEU B 16 ? 0.2641 0.2105 0.1476 0.0064  -0.0615 -0.0100 35  LEU B CD1 
1865 C  CD2 . LEU B 16 ? 0.2750 0.2162 0.1383 0.0063  -0.0397 -0.0663 35  LEU B CD2 
1877 N  N   . LYS B 17 ? 0.1442 0.1499 0.1234 -0.0049 -0.0348 0.0100  36  LYS B N   
1878 C  CA  . LYS B 17 ? 0.1625 0.1321 0.1188 0.0061  -0.0242 0.0120  36  LYS B CA  
1879 C  C   . LYS B 17 ? 0.1594 0.1328 0.1169 -0.0123 -0.0017 0.0213  36  LYS B C   
1880 O  O   . LYS B 17 ? 0.1658 0.1508 0.1329 -0.0323 -0.0095 0.0070  36  LYS B O   
1881 C  CB  . LYS B 17 ? 0.1841 0.1496 0.1703 -0.0157 -0.0449 0.0514  36  LYS B CB  
1882 C  CG  . LYS B 17 ? 0.2273 0.1670 0.2148 -0.0090 -0.0535 0.0717  36  LYS B CG  
1883 C  CD  . LYS B 17 ? 0.2670 0.1926 0.2512 0.0084  -0.0325 0.0818  36  LYS B CD  
1884 C  CE  . LYS B 17 ? 0.3145 0.2693 0.2899 0.0325  -0.0394 0.0710  36  LYS B CE  
1885 N  NZ  . LYS B 17 ? 0.3723 0.3160 0.3096 0.0438  -0.0422 0.0590  36  LYS B NZ  
1899 N  N   . LEU B 18 ? 0.1511 0.0990 0.1145 -0.0192 -0.0101 0.0070  37  LEU B N   
1900 C  CA  . LEU B 18 ? 0.1505 0.1047 0.1197 -0.0257 -0.0402 -0.0047 37  LEU B CA  
1901 C  C   . LEU B 18 ? 0.1612 0.1249 0.1103 -0.0228 -0.0401 -0.0041 37  LEU B C   
1902 O  O   . LEU B 18 ? 0.1651 0.1302 0.1230 -0.0305 -0.0095 -0.0084 37  LEU B O   
1903 C  CB  . LEU B 18 ? 0.1949 0.1090 0.1277 -0.0243 -0.0357 -0.0135 37  LEU B CB  
1904 C  CG  . LEU B 18 ? 0.2222 0.1378 0.1242 -0.0429 -0.0349 -0.0053 37  LEU B CG  
1905 C  CD1 . LEU B 18 ? 0.2727 0.1737 0.1328 -0.0151 -0.0197 -0.0241 37  LEU B CD1 
1906 C  CD2 . LEU B 18 ? 0.2572 0.1664 0.1206 -0.0501 -0.0608 -0.0233 37  LEU B CD2 
1918 N  N   . LEU B 19 ? 0.1600 0.1264 0.1140 -0.0169 -0.0493 0.0125  38  LEU B N   
1919 C  CA  . LEU B 19 ? 0.1218 0.1379 0.1388 -0.0357 -0.0401 0.0149  38  LEU B CA  
1920 C  C   . LEU B 19 ? 0.1470 0.1360 0.1475 -0.0122 -0.0406 0.0300  38  LEU B C   
1921 O  O   . LEU B 19 ? 0.1388 0.1677 0.1489 -0.0084 -0.0188 0.0253  38  LEU B O   
1922 C  CB  . LEU B 19 ? 0.1381 0.1107 0.1345 -0.0104 -0.0426 0.0073  38  LEU B CB  
1923 C  CG  . LEU B 19 ? 0.1307 0.1286 0.1258 -0.0136 -0.0405 0.0078  38  LEU B CG  
1924 C  CD1 . LEU B 19 ? 0.1524 0.1415 0.1458 -0.0129 -0.0489 0.0156  38  LEU B CD1 
1925 C  CD2 . LEU B 19 ? 0.1506 0.1473 0.1335 -0.0304 -0.0337 0.0301  38  LEU B CD2 
1937 N  N   . LYS B 20 ? 0.1339 0.1507 0.1389 -0.0222 -0.0161 0.0185  39  LYS B N   
1938 C  CA  . LYS B 20 ? 0.1732 0.1503 0.1231 -0.0279 -0.0210 -0.0024 39  LYS B CA  
1939 C  C   . LYS B 20 ? 0.1532 0.1572 0.1141 -0.0057 -0.0384 0.0072  39  LYS B C   
1940 O  O   . LYS B 20 ? 0.1574 0.1651 0.1233 0.0026  -0.0272 0.0240  39  LYS B O   
1941 C  CB  . LYS B 20 ? 0.2003 0.1900 0.1433 -0.0409 -0.0190 -0.0136 39  LYS B CB  
1942 C  CG  . LYS B 20 ? 0.2371 0.2408 0.1590 -0.0193 -0.0107 -0.0145 39  LYS B CG  
1943 C  CD  . LYS B 20 ? 0.2617 0.3163 0.1722 -0.0161 -0.0239 -0.0226 39  LYS B CD  
1944 C  CE  . LYS B 20 ? 0.2775 0.3674 0.1806 -0.0036 -0.0774 -0.0069 39  LYS B CE  
1945 N  NZ  . LYS B 20 ? 0.3325 0.3985 0.2165 0.0091  -0.1101 -0.0089 39  LYS B NZ  
1959 N  N   . SER B 21 ? 0.1335 0.1467 0.1133 -0.0157 -0.0295 -0.0077 40  SER B N   
1960 C  CA  . SER B 21 ? 0.1496 0.1464 0.1279 -0.0129 -0.0240 0.0039  40  SER B CA  
1961 C  C   . SER B 21 ? 0.1546 0.1479 0.1128 -0.0087 -0.0202 0.0052  40  SER B C   
1962 O  O   . SER B 21 ? 0.1334 0.1668 0.1443 0.0050  -0.0067 0.0254  40  SER B O   
1963 C  CB  . SER B 21 ? 0.1804 0.1428 0.1461 0.0061  -0.0241 0.0019  40  SER B CB  
1964 O  OG  . SER B 21 ? 0.1856 0.1359 0.1677 0.0054  -0.0027 -0.0002 40  SER B OG  
1970 N  N   A VAL B 22 ? 0.1546 0.1385 0.1097 -0.0122 -0.0410 0.0213  41  VAL B N   
1971 N  N   B VAL B 22 ? 0.1575 0.1280 0.0969 0.0004  -0.0282 0.0059  41  VAL B N   
1972 C  CA  A VAL B 22 ? 0.1566 0.1297 0.1024 -0.0296 -0.0427 0.0386  41  VAL B CA  
1973 C  CA  B VAL B 22 ? 0.1587 0.1096 0.0756 -0.0079 -0.0223 0.0065  41  VAL B CA  
1974 C  C   A VAL B 22 ? 0.1570 0.1337 0.0900 -0.0301 -0.0355 0.0165  41  VAL B C   
1975 C  C   B VAL B 22 ? 0.1592 0.1227 0.0696 -0.0137 -0.0249 0.0133  41  VAL B C   
1976 O  O   A VAL B 22 ? 0.1442 0.1545 0.0815 -0.0217 -0.0408 0.0182  41  VAL B O   
1977 O  O   B VAL B 22 ? 0.1501 0.1477 0.0560 0.0080  -0.0278 0.0301  41  VAL B O   
1978 C  CB  A VAL B 22 ? 0.1642 0.1658 0.1192 -0.0474 -0.0224 0.0543  41  VAL B CB  
1979 C  CB  B VAL B 22 ? 0.1556 0.1107 0.0753 0.0031  0.0005  -0.0151 41  VAL B CB  
1980 C  CG1 A VAL B 22 ? 0.1466 0.1571 0.1044 -0.0248 -0.0178 0.0587  41  VAL B CG1 
1981 C  CG1 B VAL B 22 ? 0.1442 0.1001 0.0813 0.0334  0.0113  -0.0369 41  VAL B CG1 
1982 C  CG2 A VAL B 22 ? 0.1831 0.2117 0.1266 -0.0323 -0.0340 0.0583  41  VAL B CG2 
1983 C  CG2 B VAL B 22 ? 0.1692 0.0948 0.0597 -0.0054 0.0161  -0.0233 41  VAL B CG2 
2002 N  N   . GLY B 23 ? 0.1806 0.0949 0.0788 -0.0241 -0.0282 0.0105  42  GLY B N   
2003 C  CA  . GLY B 23 ? 0.1713 0.1294 0.1002 -0.0105 -0.0388 -0.0101 42  GLY B CA  
2004 C  C   . GLY B 23 ? 0.1522 0.1319 0.1021 0.0104  -0.0361 -0.0013 42  GLY B C   
2005 O  O   . GLY B 23 ? 0.1380 0.1431 0.1167 -0.0022 -0.0406 0.0314  42  GLY B O   
2009 N  N   . ALA B 24 ? 0.1749 0.1237 0.0997 -0.0027 -0.0405 -0.0108 43  ALA B N   
2010 C  CA  . ALA B 24 ? 0.1673 0.1324 0.1126 -0.0118 -0.0252 -0.0037 43  ALA B CA  
2011 C  C   . ALA B 24 ? 0.1841 0.1513 0.0914 -0.0158 -0.0191 -0.0078 43  ALA B C   
2012 O  O   . ALA B 24 ? 0.2009 0.2125 0.0985 -0.0250 -0.0420 -0.0018 43  ALA B O   
2013 C  CB  . ALA B 24 ? 0.1582 0.1669 0.1668 0.0051  -0.0239 -0.0077 43  ALA B CB  
2019 N  N   . GLN B 25 ? 0.1856 0.1595 0.0767 -0.0442 -0.0102 0.0080  44  GLN B N   
2020 C  CA  . GLN B 25 ? 0.2292 0.2120 0.1117 -0.0632 -0.0055 -0.0174 44  GLN B CA  
2021 C  C   . GLN B 25 ? 0.2754 0.2111 0.1333 -0.0925 0.0352  -0.0398 44  GLN B C   
2022 O  O   . GLN B 25 ? 0.2812 0.2193 0.1739 -0.0807 0.0698  -0.0377 44  GLN B O   
2023 C  CB  . GLN B 25 ? 0.2316 0.2856 0.1380 -0.0733 -0.0277 -0.0084 44  GLN B CB  
2024 C  CG  . GLN B 25 ? 0.2806 0.3643 0.1799 -0.1005 -0.0202 0.0215  44  GLN B CG  
2025 C  CD  . GLN B 25 ? 0.3313 0.4511 0.2432 -0.1097 -0.0313 0.0353  44  GLN B CD  
2026 O  OE1 . GLN B 25 ? 0.3349 0.4601 0.2277 -0.1294 -0.0544 0.0655  44  GLN B OE1 
2027 N  NE2 . GLN B 25 ? 0.3598 0.5039 0.2810 -0.0923 -0.0109 0.0329  44  GLN B NE2 
2036 N  N   . LYS B 26 ? 0.2885 0.2036 0.1419 -0.1085 0.0406  -0.0239 45  LYS B N   
2037 C  CA  . LYS B 26 ? 0.2975 0.2441 0.1440 -0.0861 -0.0041 -0.0187 45  LYS B CA  
2038 C  C   . LYS B 26 ? 0.3273 0.2721 0.1565 -0.1132 -0.0269 -0.0173 45  LYS B C   
2039 O  O   . LYS B 26 ? 0.2790 0.3008 0.1686 -0.1091 -0.0259 0.0119  45  LYS B O   
2040 C  CB  . LYS B 26 ? 0.2752 0.2627 0.1860 -0.0589 -0.0212 -0.0194 45  LYS B CB  
2041 C  CG  . LYS B 26 ? 0.3129 0.3091 0.2422 -0.0205 -0.0668 -0.0268 45  LYS B CG  
2042 C  CD  . LYS B 26 ? 0.3685 0.3341 0.2809 0.0030  -0.0436 -0.0520 45  LYS B CD  
2043 C  CE  . LYS B 26 ? 0.3654 0.3250 0.2654 0.0385  -0.0348 -0.1053 45  LYS B CE  
2044 N  NZ  . LYS B 26 ? 0.3566 0.3355 0.2920 0.1180  -0.0286 -0.1183 45  LYS B NZ  
2058 N  N   . ASP B 27 ? 0.3741 0.3025 0.1649 -0.1202 -0.0276 0.0060  46  ASP B N   
2059 C  CA  . ASP B 27 ? 0.4185 0.3307 0.1877 -0.1429 -0.0202 0.0094  46  ASP B CA  
2060 C  C   . ASP B 27 ? 0.3880 0.3305 0.1687 -0.0989 0.0119  0.0323  46  ASP B C   
2061 O  O   . ASP B 27 ? 0.3897 0.3760 0.1787 -0.1097 0.0046  0.0820  46  ASP B O   
2062 C  CB  . ASP B 27 ? 0.4853 0.3717 0.2488 -0.1709 -0.0261 -0.0039 46  ASP B CB  
2063 C  CG  . ASP B 27 ? 0.5482 0.4406 0.3161 -0.1434 -0.0129 -0.0139 46  ASP B CG  
2064 O  OD1 . ASP B 27 ? 0.5910 0.4683 0.3247 -0.1016 0.0089  0.0192  46  ASP B OD1 
2065 O  OD2 . ASP B 27 ? 0.5804 0.4891 0.3516 -0.1105 -0.0271 -0.0302 46  ASP B OD2 
2070 N  N   . THR B 28 ? 0.3602 0.2683 0.1527 -0.0982 0.0226  0.0032  47  THR B N   
2071 C  CA  . THR B 28 ? 0.3305 0.2387 0.1774 -0.0619 0.0390  0.0174  47  THR B CA  
2072 C  C   . THR B 28 ? 0.2864 0.2193 0.1599 -0.0269 0.0376  0.0044  47  THR B C   
2073 O  O   . THR B 28 ? 0.2808 0.2537 0.1623 0.0131  0.0547  -0.0139 47  THR B O   
2074 C  CB  . THR B 28 ? 0.3881 0.2522 0.2407 -0.0744 0.0022  0.0187  47  THR B CB  
2075 O  OG1 . THR B 28 ? 0.4427 0.2941 0.2980 -0.0662 0.0021  0.0336  47  THR B OG1 
2076 C  CG2 . THR B 28 ? 0.3917 0.2637 0.2566 -0.0543 0.0051  0.0412  47  THR B CG2 
2084 N  N   . TYR B 29 ? 0.2389 0.1823 0.1317 0.0113  0.0264  0.0255  48  TYR B N   
2085 C  CA  . TYR B 29 ? 0.2099 0.1512 0.1649 0.0095  0.0271  0.0323  48  TYR B CA  
2086 C  C   . TYR B 29 ? 0.1949 0.1524 0.1905 0.0125  0.0216  0.0361  48  TYR B C   
2087 O  O   . TYR B 29 ? 0.1766 0.1782 0.1956 0.0083  -0.0132 0.0795  48  TYR B O   
2088 C  CB  . TYR B 29 ? 0.2026 0.1252 0.1542 0.0121  0.0162  0.0167  48  TYR B CB  
2089 C  CG  . TYR B 29 ? 0.1607 0.1248 0.1352 -0.0029 -0.0024 0.0128  48  TYR B CG  
2090 C  CD1 . TYR B 29 ? 0.1305 0.1417 0.1299 -0.0145 -0.0002 0.0027  48  TYR B CD1 
2091 C  CD2 . TYR B 29 ? 0.1619 0.1390 0.1202 -0.0198 -0.0320 0.0164  48  TYR B CD2 
2092 C  CE1 . TYR B 29 ? 0.1476 0.1554 0.1265 -0.0160 -0.0115 0.0117  48  TYR B CE1 
2093 C  CE2 . TYR B 29 ? 0.1718 0.1343 0.1021 -0.0366 -0.0199 0.0056  48  TYR B CE2 
2094 C  CZ  . TYR B 29 ? 0.1610 0.1568 0.0984 -0.0238 -0.0135 0.0117  48  TYR B CZ  
2095 O  OH  . TYR B 29 ? 0.1727 0.1763 0.0851 -0.0303 -0.0344 0.0272  48  TYR B OH  
2105 N  N   . THR B 30 ? 0.1861 0.1284 0.1831 0.0010  0.0165  0.0171  49  THR B N   
2106 C  CA  . THR B 30 ? 0.1748 0.1198 0.1794 0.0387  0.0156  0.0078  49  THR B CA  
2107 C  C   . THR B 30 ? 0.1604 0.1269 0.1513 0.0249  0.0134  0.0216  49  THR B C   
2108 O  O   . THR B 30 ? 0.1531 0.1195 0.1544 -0.0042 0.0091  0.0379  49  THR B O   
2109 C  CB  . THR B 30 ? 0.2050 0.1381 0.2179 0.0267  0.0104  0.0128  49  THR B CB  
2110 O  OG1 . THR B 30 ? 0.1840 0.1423 0.2412 0.0293  -0.0004 0.0136  49  THR B OG1 
2111 C  CG2 . THR B 30 ? 0.2149 0.1504 0.2395 0.0487  -0.0015 0.0190  49  THR B CG2 
2119 N  N   . MET B 31 ? 0.2099 0.1320 0.1365 0.0276  0.0193  0.0315  50  MET B N   
2120 C  CA  . MET B 31 ? 0.2080 0.1606 0.1455 0.0054  0.0224  0.0188  50  MET B CA  
2121 C  C   . MET B 31 ? 0.1918 0.1569 0.1453 0.0098  -0.0023 0.0488  50  MET B C   
2122 O  O   . MET B 31 ? 0.1911 0.1293 0.1583 -0.0021 -0.0089 0.0271  50  MET B O   
2123 C  CB  . MET B 31 ? 0.2200 0.1882 0.1699 0.0010  0.0234  0.0101  50  MET B CB  
2124 C  CG  . MET B 31 ? 0.2328 0.2042 0.2059 0.0344  0.0319  0.0384  50  MET B CG  
2125 S  SD  . MET B 31 ? 0.2613 0.2275 0.2573 0.0466  0.0184  0.0726  50  MET B SD  
2126 C  CE  . MET B 31 ? 0.2320 0.2403 0.2889 0.0195  -0.0161 0.0407  50  MET B CE  
2136 N  N   . LYS B 32 ? 0.2229 0.1671 0.1859 0.0307  -0.0119 0.0603  51  LYS B N   
2137 C  CA  . LYS B 32 ? 0.2331 0.1952 0.2083 0.0527  -0.0352 0.0686  51  LYS B CA  
2138 C  C   . LYS B 32 ? 0.1731 0.1859 0.1603 0.0404  -0.0412 0.0247  51  LYS B C   
2139 O  O   . LYS B 32 ? 0.1670 0.1664 0.1759 0.0467  -0.0322 0.0059  51  LYS B O   
2140 C  CB  . LYS B 32 ? 0.3411 0.2733 0.2773 0.0610  -0.0258 0.0648  51  LYS B CB  
2141 C  CG  . LYS B 32 ? 0.3928 0.3143 0.3171 0.0580  -0.0415 0.0784  51  LYS B CG  
2142 C  CD  . LYS B 32 ? 0.3883 0.3475 0.3280 0.0278  -0.0695 0.0758  51  LYS B CD  
2143 C  CE  . LYS B 32 ? 0.3988 0.3750 0.3467 0.0212  -0.0718 0.0770  51  LYS B CE  
2144 N  NZ  . LYS B 32 ? 0.4418 0.4263 0.3598 0.0077  -0.0616 0.0697  51  LYS B NZ  
2158 N  N   . GLU B 33 ? 0.1857 0.1723 0.1721 0.0231  -0.0418 0.0295  52  GLU B N   
2159 C  CA  . GLU B 33 ? 0.1872 0.1626 0.1564 0.0258  -0.0394 -0.0229 52  GLU B CA  
2160 C  C   . GLU B 33 ? 0.1474 0.1297 0.1234 -0.0043 -0.0485 -0.0067 52  GLU B C   
2161 O  O   . GLU B 33 ? 0.1558 0.1020 0.1171 -0.0027 -0.0346 -0.0114 52  GLU B O   
2162 C  CB  . GLU B 33 ? 0.2888 0.2090 0.2098 0.0335  -0.0138 -0.0430 52  GLU B CB  
2163 C  CG  . GLU B 33 ? 0.3032 0.2307 0.2108 0.0002  -0.0136 -0.0349 52  GLU B CG  
2164 C  CD  . GLU B 33 ? 0.2245 0.1881 0.1856 -0.0414 -0.0178 -0.0293 52  GLU B CD  
2165 O  OE1 . GLU B 33 ? 0.2285 0.1731 0.1749 0.0446  -0.0053 0.0340  52  GLU B OE1 
2166 O  OE2 . GLU B 33 ? 0.2113 0.2380 0.1840 -0.0431 -0.0213 -0.0004 52  GLU B OE2 
2173 N  N   . VAL B 34 ? 0.1273 0.1107 0.1238 0.0105  -0.0370 0.0265  53  VAL B N   
2174 C  CA  . VAL B 34 ? 0.1394 0.1098 0.0845 0.0075  -0.0277 0.0152  53  VAL B CA  
2175 C  C   . VAL B 34 ? 0.1355 0.1280 0.0863 -0.0107 -0.0243 0.0214  53  VAL B C   
2176 O  O   . VAL B 34 ? 0.1598 0.1173 0.0911 0.0022  -0.0255 0.0233  53  VAL B O   
2177 C  CB  . VAL B 34 ? 0.1478 0.1162 0.1103 0.0004  -0.0379 0.0134  53  VAL B CB  
2178 C  CG1 . VAL B 34 ? 0.1262 0.1204 0.1235 -0.0157 -0.0401 -0.0125 53  VAL B CG1 
2179 C  CG2 . VAL B 34 ? 0.1514 0.1219 0.1623 0.0002  -0.0581 0.0150  53  VAL B CG2 
2189 N  N   . LEU B 35 ? 0.1360 0.1323 0.1003 0.0031  -0.0311 0.0116  54  LEU B N   
2190 C  CA  . LEU B 35 ? 0.1506 0.1518 0.0675 0.0073  -0.0351 -0.0059 54  LEU B CA  
2191 C  C   . LEU B 35 ? 0.1444 0.1476 0.0794 0.0257  -0.0537 0.0000  54  LEU B C   
2192 O  O   . LEU B 35 ? 0.1610 0.1249 0.1050 0.0256  -0.0373 -0.0087 54  LEU B O   
2193 C  CB  . LEU B 35 ? 0.1705 0.1662 0.0722 0.0124  -0.0208 0.0309  54  LEU B CB  
2194 C  CG  . LEU B 35 ? 0.1856 0.2097 0.0865 0.0238  -0.0135 0.0286  54  LEU B CG  
2195 C  CD1 . LEU B 35 ? 0.1876 0.2311 0.1087 0.0038  0.0056  0.0579  54  LEU B CD1 
2196 C  CD2 . LEU B 35 ? 0.1844 0.2242 0.0824 0.0226  -0.0221 0.0036  54  LEU B CD2 
2208 N  N   . PHE B 36 ? 0.1435 0.1453 0.0843 0.0243  -0.0315 -0.0030 55  PHE B N   
2209 C  CA  . PHE B 36 ? 0.1276 0.1511 0.0871 0.0289  -0.0350 -0.0032 55  PHE B CA  
2210 C  C   . PHE B 36 ? 0.1299 0.1211 0.0707 0.0115  -0.0478 -0.0162 55  PHE B C   
2211 O  O   . PHE B 36 ? 0.1344 0.1012 0.1052 0.0057  -0.0558 -0.0214 55  PHE B O   
2212 C  CB  . PHE B 36 ? 0.1153 0.1403 0.1347 0.0056  -0.0101 0.0088  55  PHE B CB  
2213 C  CG  . PHE B 36 ? 0.1225 0.1154 0.1703 0.0406  -0.0263 0.0244  55  PHE B CG  
2214 C  CD1 . PHE B 36 ? 0.1649 0.0835 0.2206 -0.0003 -0.0267 0.0333  55  PHE B CD1 
2215 C  CD2 . PHE B 36 ? 0.1452 0.1431 0.2014 0.0387  -0.0277 0.0651  55  PHE B CD2 
2216 C  CE1 . PHE B 36 ? 0.1860 0.0922 0.2566 0.0075  -0.0003 0.0141  55  PHE B CE1 
2217 C  CE2 . PHE B 36 ? 0.1978 0.1685 0.2328 0.0446  -0.0250 0.0558  55  PHE B CE2 
2218 C  CZ  . PHE B 36 ? 0.2033 0.1252 0.2526 0.0542  0.0003  0.0334  55  PHE B CZ  
2229 N  N   . TYR B 37 ? 0.1392 0.1171 0.0539 0.0029  -0.0351 0.0010  56  TYR B N   
2230 C  CA  . TYR B 37 ? 0.1180 0.1297 0.0562 -0.0044 -0.0188 -0.0150 56  TYR B CA  
2231 C  C   . TYR B 37 ? 0.1274 0.1130 0.0692 0.0096  -0.0222 -0.0002 56  TYR B C   
2232 O  O   . TYR B 37 ? 0.1613 0.1085 0.0774 -0.0131 -0.0306 0.0072  56  TYR B O   
2233 C  CB  . TYR B 37 ? 0.1295 0.1089 0.0583 0.0124  -0.0419 0.0041  56  TYR B CB  
2234 C  CG  . TYR B 37 ? 0.1208 0.1143 0.0795 -0.0126 -0.0322 0.0077  56  TYR B CG  
2235 C  CD1 . TYR B 37 ? 0.1314 0.1401 0.0891 -0.0021 -0.0306 0.0144  56  TYR B CD1 
2236 C  CD2 . TYR B 37 ? 0.1456 0.1240 0.0808 0.0047  -0.0365 -0.0015 56  TYR B CD2 
2237 C  CE1 . TYR B 37 ? 0.1389 0.1310 0.0928 -0.0070 -0.0238 0.0140  56  TYR B CE1 
2238 C  CE2 . TYR B 37 ? 0.1503 0.1438 0.0854 0.0142  -0.0234 -0.0216 56  TYR B CE2 
2239 C  CZ  . TYR B 37 ? 0.1391 0.1460 0.0988 0.0005  -0.0272 -0.0186 56  TYR B CZ  
2240 O  OH  . TYR B 37 ? 0.1737 0.1523 0.1335 0.0157  -0.0213 -0.0108 56  TYR B OH  
2250 N  N   . LEU B 38 ? 0.1244 0.1180 0.0867 0.0033  -0.0204 0.0046  57  LEU B N   
2251 C  CA  . LEU B 38 ? 0.1250 0.1165 0.0928 -0.0015 -0.0246 0.0043  57  LEU B CA  
2252 C  C   . LEU B 38 ? 0.1355 0.1084 0.0755 0.0205  -0.0445 0.0176  57  LEU B C   
2253 O  O   . LEU B 38 ? 0.1667 0.0940 0.0965 0.0195  -0.0337 -0.0010 57  LEU B O   
2254 C  CB  . LEU B 38 ? 0.1437 0.1353 0.1096 0.0239  0.0046  -0.0246 57  LEU B CB  
2255 C  CG  . LEU B 38 ? 0.1489 0.1507 0.1322 0.0212  -0.0134 -0.0077 57  LEU B CG  
2256 C  CD1 . LEU B 38 ? 0.1582 0.1586 0.1667 -0.0113 0.0123  -0.0220 57  LEU B CD1 
2257 C  CD2 . LEU B 38 ? 0.1352 0.1613 0.1740 0.0003  -0.0209 0.0059  57  LEU B CD2 
2269 N  N   . GLY B 39 ? 0.1407 0.1074 0.0742 0.0109  -0.0523 -0.0024 58  GLY B N   
2270 C  CA  . GLY B 39 ? 0.1331 0.1172 0.0736 0.0227  -0.0433 -0.0120 58  GLY B CA  
2271 C  C   . GLY B 39 ? 0.1699 0.1223 0.0811 0.0117  -0.0237 -0.0009 58  GLY B C   
2272 O  O   . GLY B 39 ? 0.1738 0.1039 0.0946 -0.0011 -0.0340 0.0006  58  GLY B O   
2276 N  N   . GLN B 40 ? 0.1544 0.1212 0.0815 -0.0142 -0.0201 -0.0011 59  GLN B N   
2277 C  CA  . GLN B 40 ? 0.1307 0.1371 0.0962 0.0084  -0.0050 0.0047  59  GLN B CA  
2278 C  C   . GLN B 40 ? 0.1484 0.1370 0.0996 -0.0112 -0.0123 -0.0031 59  GLN B C   
2279 O  O   . GLN B 40 ? 0.1772 0.1360 0.1304 -0.0243 -0.0117 0.0109  59  GLN B O   
2280 C  CB  . GLN B 40 ? 0.1578 0.1436 0.0905 0.0081  -0.0001 0.0138  59  GLN B CB  
2281 C  CG  . GLN B 40 ? 0.1639 0.1301 0.1056 0.0020  -0.0126 -0.0144 59  GLN B CG  
2282 C  CD  . GLN B 40 ? 0.1588 0.1501 0.1141 -0.0041 -0.0043 -0.0241 59  GLN B CD  
2283 O  OE1 . GLN B 40 ? 0.1696 0.1814 0.1494 -0.0430 -0.0199 -0.0160 59  GLN B OE1 
2284 N  NE2 . GLN B 40 ? 0.1995 0.1776 0.1329 0.0009  -0.0409 -0.0146 59  GLN B NE2 
2293 N  N   . TYR B 41 ? 0.1667 0.1070 0.0912 -0.0172 -0.0465 0.0032  60  TYR B N   
2294 C  CA  . TYR B 41 ? 0.1595 0.1213 0.0916 -0.0138 -0.0520 0.0137  60  TYR B CA  
2295 C  C   . TYR B 41 ? 0.1542 0.1273 0.0676 0.0065  -0.0502 -0.0009 60  TYR B C   
2296 O  O   . TYR B 41 ? 0.2001 0.1053 0.1000 -0.0094 -0.0430 0.0181  60  TYR B O   
2297 C  CB  . TYR B 41 ? 0.1714 0.1090 0.0920 -0.0093 -0.0498 -0.0052 60  TYR B CB  
2298 C  CG  . TYR B 41 ? 0.1551 0.1106 0.0972 -0.0026 -0.0620 0.0043  60  TYR B CG  
2299 C  CD1 . TYR B 41 ? 0.1453 0.1219 0.1026 0.0088  -0.0278 0.0067  60  TYR B CD1 
2300 C  CD2 . TYR B 41 ? 0.1971 0.1217 0.0733 0.0117  -0.0494 0.0088  60  TYR B CD2 
2301 C  CE1 . TYR B 41 ? 0.1502 0.1350 0.0853 -0.0027 -0.0329 0.0068  60  TYR B CE1 
2302 C  CE2 . TYR B 41 ? 0.1978 0.1399 0.0879 0.0310  -0.0333 0.0175  60  TYR B CE2 
2303 C  CZ  . TYR B 41 ? 0.1860 0.1648 0.1101 0.0036  -0.0458 0.0258  60  TYR B CZ  
2304 O  OH  . TYR B 41 ? 0.2219 0.1936 0.1455 -0.0336 -0.0605 0.0394  60  TYR B OH  
2314 N  N   . ILE B 42 ? 0.1604 0.1127 0.0537 0.0033  -0.0353 -0.0052 61  ILE B N   
2315 C  CA  . ILE B 42 ? 0.1668 0.1205 0.0553 -0.0114 -0.0307 -0.0107 61  ILE B CA  
2316 C  C   . ILE B 42 ? 0.1715 0.1298 0.0862 -0.0149 -0.0326 0.0101  61  ILE B C   
2317 O  O   . ILE B 42 ? 0.1996 0.1218 0.0970 -0.0292 -0.0451 0.0010  61  ILE B O   
2318 C  CB  . ILE B 42 ? 0.1383 0.1180 0.0512 0.0012  -0.0356 -0.0080 61  ILE B CB  
2319 C  CG1 . ILE B 42 ? 0.1621 0.1041 0.0751 0.0144  -0.0530 -0.0182 61  ILE B CG1 
2320 C  CG2 . ILE B 42 ? 0.1570 0.1600 0.0562 0.0087  -0.0258 -0.0256 61  ILE B CG2 
2321 C  CD1 . ILE B 42 ? 0.1676 0.1118 0.0968 -0.0045 -0.0497 0.0135  61  ILE B CD1 
2333 N  N   . MET B 43 ? 0.1690 0.1287 0.1043 -0.0258 -0.0092 -0.0024 62  MET B N   
2334 C  CA  . MET B 43 ? 0.2033 0.1466 0.1039 -0.0322 -0.0344 0.0028  62  MET B CA  
2335 C  C   . MET B 43 ? 0.2385 0.1536 0.0973 -0.0346 -0.0289 -0.0093 62  MET B C   
2336 O  O   . MET B 43 ? 0.2894 0.1364 0.1268 -0.0683 -0.0220 -0.0108 62  MET B O   
2337 C  CB  . MET B 43 ? 0.1977 0.1786 0.1237 -0.0341 -0.0459 0.0112  62  MET B CB  
2338 C  CG  . MET B 43 ? 0.1743 0.1935 0.1332 -0.0481 -0.0457 -0.0090 62  MET B CG  
2339 S  SD  . MET B 43 ? 0.2511 0.2127 0.1496 -0.0594 -0.0588 -0.0028 62  MET B SD  
2340 C  CE  . MET B 43 ? 0.2793 0.2422 0.1690 -0.0900 -0.0645 0.0128  62  MET B CE  
2350 N  N   A THR B 44 ? 0.2364 0.1534 0.0824 -0.0285 -0.0145 -0.0075 63  THR B N   
2351 N  N   B THR B 44 ? 0.2391 0.1515 0.0841 -0.0258 -0.0180 -0.0043 63  THR B N   
2352 C  CA  A THR B 44 ? 0.2430 0.1657 0.0910 -0.0499 -0.0227 0.0088  63  THR B CA  
2353 C  CA  B THR B 44 ? 0.2439 0.1639 0.0939 -0.0436 -0.0204 0.0161  63  THR B CA  
2354 C  C   A THR B 44 ? 0.2589 0.1466 0.0916 -0.0455 -0.0458 -0.0100 63  THR B C   
2355 C  C   B THR B 44 ? 0.2496 0.1438 0.0978 -0.0483 -0.0429 0.0062  63  THR B C   
2356 O  O   A THR B 44 ? 0.2821 0.1677 0.0923 -0.0381 -0.0367 -0.0248 63  THR B O   
2357 O  O   B THR B 44 ? 0.2455 0.1427 0.1080 -0.0741 -0.0555 0.0047  63  THR B O   
2358 C  CB  A THR B 44 ? 0.2675 0.1687 0.0918 -0.0603 -0.0103 0.0187  63  THR B CB  
2359 C  CB  B THR B 44 ? 0.2574 0.1951 0.1026 -0.0558 -0.0100 0.0355  63  THR B CB  
2360 O  OG1 A THR B 44 ? 0.3053 0.1863 0.1055 -0.0544 -0.0171 0.0233  63  THR B OG1 
2361 O  OG1 B THR B 44 ? 0.2798 0.2348 0.0852 -0.0298 0.0173  0.0373  63  THR B OG1 
2362 C  CG2 A THR B 44 ? 0.2833 0.1810 0.1014 -0.0649 -0.0089 0.0113  63  THR B CG2 
2363 C  CG2 B THR B 44 ? 0.2615 0.1887 0.1227 -0.0665 -0.0032 0.0407  63  THR B CG2 
2378 N  N   . LYS B 45 ? 0.2532 0.1270 0.0994 -0.0190 -0.0587 0.0098  64  LYS B N   
2379 C  CA  . LYS B 45 ? 0.2835 0.1349 0.1034 -0.0011 -0.0291 0.0308  64  LYS B CA  
2380 C  C   . LYS B 45 ? 0.2893 0.1378 0.0894 -0.0053 -0.0427 0.0066  64  LYS B C   
2381 O  O   . LYS B 45 ? 0.3511 0.1467 0.1148 0.0498  -0.0570 0.0032  64  LYS B O   
2382 C  CB  . LYS B 45 ? 0.2724 0.1570 0.1119 0.0120  -0.0538 0.0236  64  LYS B CB  
2383 C  CG  . LYS B 45 ? 0.2776 0.2113 0.1408 0.0027  -0.0611 0.0107  64  LYS B CG  
2384 C  CD  . LYS B 45 ? 0.2706 0.2582 0.1603 -0.0341 -0.0589 0.0476  64  LYS B CD  
2385 C  CE  . LYS B 45 ? 0.2865 0.2949 0.1908 -0.0555 -0.0604 0.0866  64  LYS B CE  
2386 N  NZ  . LYS B 45 ? 0.2854 0.3292 0.2075 -0.0542 -0.0699 0.0846  64  LYS B NZ  
2400 N  N   . ARG B 46 ? 0.2572 0.1374 0.0988 -0.0383 -0.0173 -0.0031 65  ARG B N   
2401 C  CA  . ARG B 46 ? 0.2676 0.1204 0.1117 -0.0528 -0.0286 -0.0090 65  ARG B CA  
2402 C  C   . ARG B 46 ? 0.2572 0.1075 0.1061 -0.0404 -0.0454 0.0057  65  ARG B C   
2403 O  O   . ARG B 46 ? 0.3041 0.1074 0.1211 -0.0345 -0.0399 0.0062  65  ARG B O   
2404 C  CB  . ARG B 46 ? 0.2914 0.1673 0.1740 -0.0649 0.0028  -0.0086 65  ARG B CB  
2405 C  CG  . ARG B 46 ? 0.3173 0.1925 0.2111 -0.0710 0.0079  0.0204  65  ARG B CG  
2406 C  CD  . ARG B 46 ? 0.3130 0.2108 0.2620 -0.0965 0.0357  0.0130  65  ARG B CD  
2407 N  NE  . ARG B 46 ? 0.3372 0.2674 0.3201 -0.0994 0.0563  0.0101  65  ARG B NE  
2408 C  CZ  . ARG B 46 ? 0.3233 0.2781 0.3386 -0.0887 0.0570  -0.0025 65  ARG B CZ  
2409 N  NH1 . ARG B 46 ? 0.3138 0.2650 0.3531 -0.0677 0.0568  -0.0164 65  ARG B NH1 
2410 N  NH2 . ARG B 46 ? 0.3596 0.3185 0.3613 -0.0704 0.0372  0.0132  65  ARG B NH2 
2424 N  N   . LEU B 47 ? 0.2062 0.0972 0.0980 -0.0166 -0.0590 0.0089  66  LEU B N   
2425 C  CA  . LEU B 47 ? 0.1704 0.1237 0.0922 0.0012  -0.0678 -0.0081 66  LEU B CA  
2426 C  C   . LEU B 47 ? 0.1849 0.1532 0.1044 -0.0126 -0.0569 0.0007  66  LEU B C   
2427 O  O   . LEU B 47 ? 0.1997 0.1908 0.1183 -0.0038 -0.0468 -0.0137 66  LEU B O   
2428 C  CB  . LEU B 47 ? 0.1671 0.1296 0.1060 0.0034  -0.0746 0.0109  66  LEU B CB  
2429 C  CG  . LEU B 47 ? 0.1884 0.1564 0.1478 -0.0149 -0.0958 -0.0112 66  LEU B CG  
2430 C  CD1 . LEU B 47 ? 0.1849 0.1681 0.1939 -0.0282 -0.0930 -0.0263 66  LEU B CD1 
2431 C  CD2 . LEU B 47 ? 0.2555 0.1696 0.1595 -0.0202 -0.1132 -0.0003 66  LEU B CD2 
2443 N  N   . TYR B 48 ? 0.1909 0.1512 0.1032 -0.0241 -0.0343 0.0000  67  TYR B N   
2444 C  CA  . TYR B 48 ? 0.1874 0.1225 0.0836 -0.0157 -0.0545 -0.0177 67  TYR B CA  
2445 C  C   . TYR B 48 ? 0.1770 0.1251 0.0979 -0.0146 -0.0666 -0.0157 67  TYR B C   
2446 O  O   . TYR B 48 ? 0.1860 0.1349 0.0914 -0.0126 -0.0675 -0.0015 67  TYR B O   
2447 C  CB  . TYR B 48 ? 0.1833 0.1416 0.0912 -0.0119 -0.0663 -0.0079 67  TYR B CB  
2448 C  CG  . TYR B 48 ? 0.1970 0.1694 0.1218 -0.0172 -0.0374 -0.0217 67  TYR B CG  
2449 C  CD1 . TYR B 48 ? 0.1947 0.1737 0.1278 -0.0193 -0.0319 -0.0467 67  TYR B CD1 
2450 C  CD2 . TYR B 48 ? 0.2409 0.1946 0.1545 -0.0292 0.0000  -0.0304 67  TYR B CD2 
2451 C  CE1 . TYR B 48 ? 0.2062 0.1731 0.1244 -0.0403 -0.0050 -0.0413 67  TYR B CE1 
2452 C  CE2 . TYR B 48 ? 0.2627 0.1789 0.1598 -0.0470 0.0315  -0.0421 67  TYR B CE2 
2453 C  CZ  . TYR B 48 ? 0.2566 0.1931 0.1478 -0.0566 0.0114  -0.0343 67  TYR B CZ  
2454 O  OH  . TYR B 48 ? 0.2967 0.2162 0.1631 -0.0767 0.0034  -0.0679 67  TYR B OH  
2464 N  N   . ASP B 49 ? 0.1719 0.1337 0.0891 -0.0200 -0.0622 -0.0094 68  ASP B N   
2465 C  CA  . ASP B 49 ? 0.1715 0.1170 0.0801 -0.0187 -0.0563 0.0067  68  ASP B CA  
2466 C  C   . ASP B 49 ? 0.1739 0.1260 0.0866 -0.0250 -0.0586 0.0075  68  ASP B C   
2467 O  O   . ASP B 49 ? 0.1801 0.1039 0.1030 -0.0031 -0.0741 -0.0005 68  ASP B O   
2468 C  CB  . ASP B 49 ? 0.1668 0.1275 0.0743 -0.0147 -0.0546 0.0067  68  ASP B CB  
2469 C  CG  . ASP B 49 ? 0.1894 0.1207 0.0957 0.0080  -0.0222 0.0221  68  ASP B CG  
2470 O  OD1 . ASP B 49 ? 0.1969 0.1221 0.0991 0.0125  -0.0283 0.0054  68  ASP B OD1 
2471 O  OD2 . ASP B 49 ? 0.2125 0.1297 0.1144 -0.0026 -0.0020 0.0093  68  ASP B OD2 
2476 N  N   . GLU B 50 ? 0.1791 0.1471 0.0790 -0.0142 -0.0473 0.0044  69  GLU B N   
2477 C  CA  . GLU B 50 ? 0.1930 0.1851 0.0907 -0.0204 -0.0491 0.0006  69  GLU B CA  
2478 C  C   . GLU B 50 ? 0.1746 0.1529 0.1001 -0.0217 -0.0453 0.0008  69  GLU B C   
2479 O  O   . GLU B 50 ? 0.1649 0.1883 0.1274 -0.0135 -0.0269 -0.0073 69  GLU B O   
2480 C  CB  . GLU B 50 ? 0.2344 0.2329 0.1402 -0.0457 -0.0225 0.0007  69  GLU B CB  
2481 C  CG  . GLU B 50 ? 0.2524 0.2558 0.1843 -0.0186 0.0157  -0.0344 69  GLU B CG  
2482 C  CD  . GLU B 50 ? 0.2659 0.2925 0.2630 -0.0446 -0.0051 -0.0873 69  GLU B CD  
2483 O  OE1 . GLU B 50 ? 0.2874 0.3042 0.2762 -0.0448 0.0054  -0.1286 69  GLU B OE1 
2484 O  OE2 . GLU B 50 ? 0.3017 0.3289 0.3350 -0.0576 0.0000  -0.0729 69  GLU B OE2 
2491 N  N   A LYS B 51 ? 0.1724 0.1229 0.0905 -0.0221 -0.0378 0.0035  70  LYS B N   
2492 N  N   B LYS B 51 ? 0.1739 0.1257 0.0879 -0.0119 -0.0459 0.0056  70  LYS B N   
2493 C  CA  A LYS B 51 ? 0.1627 0.1205 0.0875 -0.0370 -0.0420 -0.0115 70  LYS B CA  
2494 C  CA  B LYS B 51 ? 0.1729 0.1340 0.0840 -0.0259 -0.0528 -0.0125 70  LYS B CA  
2495 C  C   A LYS B 51 ? 0.1392 0.1107 0.0829 -0.0231 -0.0508 -0.0166 70  LYS B C   
2496 C  C   B LYS B 51 ? 0.1532 0.1231 0.0782 0.0009  -0.0584 -0.0027 70  LYS B C   
2497 O  O   A LYS B 51 ? 0.1140 0.1058 0.0809 -0.0221 -0.0328 -0.0382 70  LYS B O   
2498 O  O   B LYS B 51 ? 0.1552 0.1291 0.0826 0.0251  -0.0585 -0.0042 70  LYS B O   
2499 C  CB  A LYS B 51 ? 0.1793 0.1195 0.0945 -0.0492 -0.0277 -0.0082 70  LYS B CB  
2500 C  CB  B LYS B 51 ? 0.1982 0.1503 0.1007 -0.0404 -0.0482 -0.0228 70  LYS B CB  
2501 C  CG  A LYS B 51 ? 0.2057 0.1366 0.1319 -0.0198 -0.0236 0.0123  70  LYS B CG  
2502 C  CG  B LYS B 51 ? 0.2135 0.1688 0.1386 -0.0453 -0.0556 -0.0120 70  LYS B CG  
2503 C  CD  A LYS B 51 ? 0.2404 0.1622 0.1597 -0.0323 -0.0178 0.0329  70  LYS B CD  
2504 C  CD  B LYS B 51 ? 0.2444 0.1758 0.1621 -0.0338 -0.0743 -0.0106 70  LYS B CD  
2505 C  CE  A LYS B 51 ? 0.2651 0.1922 0.1886 -0.0487 -0.0137 0.0346  70  LYS B CE  
2506 C  CE  B LYS B 51 ? 0.2679 0.1793 0.1848 -0.0425 -0.0878 -0.0230 70  LYS B CE  
2507 N  NZ  A LYS B 51 ? 0.3153 0.2250 0.2212 -0.0453 -0.0150 0.0276  70  LYS B NZ  
2508 N  NZ  B LYS B 51 ? 0.3124 0.2127 0.2245 -0.0482 -0.0948 -0.0127 70  LYS B NZ  
2535 N  N   . GLN B 52 ? 0.1381 0.1089 0.0724 -0.0253 -0.0507 0.0043  71  GLN B N   
2536 C  CA  . GLN B 52 ? 0.1418 0.1102 0.0744 -0.0186 -0.0537 0.0027  71  GLN B CA  
2537 C  C   . GLN B 52 ? 0.1130 0.1076 0.0667 -0.0125 -0.0464 -0.0072 71  GLN B C   
2538 O  O   . GLN B 52 ? 0.1170 0.1116 0.0780 -0.0087 -0.0457 0.0047  71  GLN B O   
2539 C  CB  . GLN B 52 ? 0.1621 0.1148 0.0819 -0.0183 -0.0455 0.0028  71  GLN B CB  
2540 C  CG  . GLN B 52 ? 0.1462 0.1295 0.0946 0.0086  -0.0520 0.0084  71  GLN B CG  
2541 C  CD  . GLN B 52 ? 0.1461 0.1065 0.1003 0.0046  -0.0563 0.0090  71  GLN B CD  
2542 O  OE1 . GLN B 52 ? 0.1501 0.1232 0.1060 0.0172  -0.0715 0.0021  71  GLN B OE1 
2543 N  NE2 . GLN B 52 ? 0.1695 0.0970 0.1209 0.0016  -0.0374 0.0176  71  GLN B NE2 
2552 N  N   . GLN B 53 ? 0.1383 0.1315 0.0809 0.0108  -0.0403 -0.0278 72  GLN B N   
2553 C  CA  . GLN B 53 ? 0.1305 0.0971 0.1073 0.0018  -0.0399 -0.0212 72  GLN B CA  
2554 C  C   . GLN B 53 ? 0.1247 0.1236 0.0938 -0.0029 -0.0623 -0.0119 72  GLN B C   
2555 O  O   . GLN B 53 ? 0.1676 0.1276 0.0987 -0.0172 -0.0509 -0.0057 72  GLN B O   
2556 C  CB  . GLN B 53 ? 0.1724 0.1204 0.1437 0.0155  -0.0215 -0.0208 72  GLN B CB  
2557 C  CG  . GLN B 53 ? 0.1783 0.1571 0.1872 -0.0126 0.0038  -0.0022 72  GLN B CG  
2558 C  CD  . GLN B 53 ? 0.2387 0.2081 0.2703 0.0083  0.0442  -0.0058 72  GLN B CD  
2559 O  OE1 . GLN B 53 ? 0.2698 0.2558 0.3250 0.0251  0.0784  -0.0027 72  GLN B OE1 
2560 N  NE2 . GLN B 53 ? 0.2317 0.2287 0.2877 -0.0257 0.0749  -0.0156 72  GLN B NE2 
2569 N  N   . HIS B 54 ? 0.1363 0.1277 0.0828 -0.0008 -0.0529 -0.0141 73  HIS B N   
2570 C  CA  . HIS B 54 ? 0.1172 0.1064 0.0847 0.0042  -0.0495 -0.0182 73  HIS B CA  
2571 C  C   . HIS B 54 ? 0.1400 0.1027 0.0680 0.0112  -0.0482 -0.0165 73  HIS B C   
2572 O  O   . HIS B 54 ? 0.1441 0.1137 0.1015 -0.0045 -0.0440 0.0062  73  HIS B O   
2573 C  CB  . HIS B 54 ? 0.1274 0.1309 0.1040 -0.0113 -0.0633 -0.0207 73  HIS B CB  
2574 C  CG  . HIS B 54 ? 0.1369 0.1124 0.1050 -0.0014 -0.0589 -0.0155 73  HIS B CG  
2575 N  ND1 . HIS B 54 ? 0.1588 0.1143 0.1133 -0.0048 -0.0694 0.0018  73  HIS B ND1 
2576 C  CD2 . HIS B 54 ? 0.1353 0.1182 0.1125 0.0068  -0.0712 -0.0151 73  HIS B CD2 
2577 C  CE1 . HIS B 54 ? 0.1314 0.1157 0.1121 0.0135  -0.0712 -0.0167 73  HIS B CE1 
2578 N  NE2 . HIS B 54 ? 0.1545 0.1318 0.1100 0.0054  -0.0756 -0.0106 73  HIS B NE2 
2586 N  N   . ILE B 55 ? 0.1279 0.0980 0.0690 -0.0004 -0.0512 0.0010  74  ILE B N   
2587 C  CA  . ILE B 55 ? 0.1397 0.0975 0.0695 -0.0054 -0.0318 0.0011  74  ILE B CA  
2588 C  C   . ILE B 55 ? 0.1395 0.1190 0.0587 -0.0131 -0.0339 -0.0059 74  ILE B C   
2589 O  O   . ILE B 55 ? 0.1513 0.1203 0.0845 -0.0173 -0.0513 0.0118  74  ILE B O   
2590 C  CB  . ILE B 55 ? 0.1471 0.0948 0.0718 -0.0021 -0.0361 -0.0075 74  ILE B CB  
2591 C  CG1 . ILE B 55 ? 0.1620 0.0968 0.0750 0.0065  -0.0211 -0.0175 74  ILE B CG1 
2592 C  CG2 . ILE B 55 ? 0.1858 0.1508 0.1112 0.0358  -0.0603 -0.0440 74  ILE B CG2 
2593 C  CD1 . ILE B 55 ? 0.2150 0.1194 0.0805 0.0009  -0.0301 0.0015  74  ILE B CD1 
2605 N  N   . VAL B 56 ? 0.1540 0.1251 0.0676 -0.0097 -0.0477 0.0033  75  VAL B N   
2606 C  CA  . VAL B 56 ? 0.1582 0.1210 0.0704 -0.0124 -0.0366 -0.0055 75  VAL B CA  
2607 C  C   . VAL B 56 ? 0.1494 0.1192 0.0836 -0.0309 -0.0552 -0.0028 75  VAL B C   
2608 O  O   . VAL B 56 ? 0.1753 0.1188 0.0954 0.0008  -0.0515 0.0079  75  VAL B O   
2609 C  CB  . VAL B 56 ? 0.1455 0.1591 0.0783 0.0085  -0.0546 -0.0183 75  VAL B CB  
2610 C  CG1 . VAL B 56 ? 0.1419 0.1859 0.0896 -0.0029 -0.0633 0.0028  75  VAL B CG1 
2611 C  CG2 . VAL B 56 ? 0.1385 0.1835 0.1001 -0.0014 -0.0454 -0.0185 75  VAL B CG2 
2621 N  N   . TYR B 57 ? 0.1596 0.1226 0.0998 -0.0312 -0.0537 0.0126  76  TYR B N   
2622 C  CA  . TYR B 57 ? 0.1792 0.1141 0.1019 -0.0151 -0.0710 0.0237  76  TYR B CA  
2623 C  C   . TYR B 57 ? 0.1780 0.1138 0.1079 -0.0120 -0.0725 0.0272  76  TYR B C   
2624 O  O   . TYR B 57 ? 0.1911 0.1554 0.1187 -0.0412 -0.0735 0.0234  76  TYR B O   
2625 C  CB  . TYR B 57 ? 0.2199 0.1138 0.1175 -0.0260 -0.0855 0.0190  76  TYR B CB  
2626 C  CG  . TYR B 57 ? 0.2544 0.1062 0.1397 -0.0312 -0.0695 0.0110  76  TYR B CG  
2627 C  CD1 . TYR B 57 ? 0.2620 0.1029 0.1572 -0.0090 -0.0602 0.0237  76  TYR B CD1 
2628 C  CD2 . TYR B 57 ? 0.2680 0.1116 0.1775 -0.0275 -0.0924 0.0042  76  TYR B CD2 
2629 C  CE1 . TYR B 57 ? 0.2631 0.1395 0.1795 -0.0011 -0.0691 -0.0064 76  TYR B CE1 
2630 C  CE2 . TYR B 57 ? 0.2732 0.1335 0.1862 -0.0045 -0.0821 -0.0112 76  TYR B CE2 
2631 C  CZ  . TYR B 57 ? 0.2524 0.1298 0.1751 0.0167  -0.0772 -0.0305 76  TYR B CZ  
2632 O  OH  . TYR B 57 ? 0.2345 0.1359 0.1945 0.0416  -0.0570 -0.0433 76  TYR B OH  
2642 N  N   . CYS B 58 ? 0.1709 0.1767 0.1161 -0.0214 -0.0741 -0.0039 77  CYS B N   
2643 C  CA  . CYS B 58 ? 0.1897 0.1861 0.1137 -0.0032 -0.0808 -0.0165 77  CYS B CA  
2644 C  C   . CYS B 58 ? 0.1962 0.1676 0.1026 -0.0018 -0.0743 -0.0111 77  CYS B C   
2645 O  O   . CYS B 58 ? 0.1819 0.1302 0.1217 -0.0015 -0.0858 -0.0036 77  CYS B O   
2646 C  CB  . CYS B 58 ? 0.1872 0.1807 0.1408 0.0303  -0.0899 -0.0339 77  CYS B CB  
2647 S  SG  . CYS B 58 ? 0.2035 0.1266 0.1546 0.0158  -0.1034 -0.0196 77  CYS B SG  
2653 N  N   . SER B 59 ? 0.2086 0.1724 0.1208 0.0077  -0.0784 -0.0064 78  SER B N   
2654 C  CA  . SER B 59 ? 0.2518 0.1526 0.1339 0.0254  -0.0946 -0.0139 78  SER B CA  
2655 C  C   . SER B 59 ? 0.3418 0.1819 0.1530 0.0339  -0.0924 -0.0186 78  SER B C   
2656 O  O   . SER B 59 ? 0.3468 0.2021 0.1632 0.0242  -0.1215 -0.0129 78  SER B O   
2657 C  CB  . SER B 59 ? 0.2436 0.1686 0.1673 0.0317  -0.0852 -0.0230 78  SER B CB  
2658 O  OG  . SER B 59 ? 0.2853 0.2262 0.2034 0.0418  -0.0834 -0.0455 78  SER B OG  
2664 N  N   . ASN B 60 ? 0.3687 0.1624 0.1415 0.0422  -0.0866 -0.0107 79  ASN B N   
2665 C  CA  . ASN B 60 ? 0.4635 0.2719 0.2059 0.0614  -0.0392 -0.0060 79  ASN B CA  
2666 C  C   . ASN B 60 ? 0.4588 0.2463 0.1791 0.0955  -0.0093 0.0186  79  ASN B C   
2667 O  O   . ASN B 60 ? 0.5464 0.2550 0.2246 0.1064  0.0067  0.0661  79  ASN B O   
2668 C  CB  . ASN B 60 ? 0.5307 0.3780 0.2724 0.0695  -0.0455 -0.0109 79  ASN B CB  
2669 C  CG  . ASN B 60 ? 0.5863 0.4407 0.3161 0.0634  -0.0422 -0.0388 79  ASN B CG  
2670 O  OD1 . ASN B 60 ? 0.6353 0.4604 0.3494 0.0442  -0.0350 -0.0428 79  ASN B OD1 
2671 N  ND2 . ASN B 60 ? 0.5803 0.4639 0.3313 0.1116  -0.0409 -0.0389 79  ASN B ND2 
2678 N  N   . ASP B 61 ? 0.3509 0.1832 0.1454 0.0541  -0.0518 0.0245  80  ASP B N   
2679 C  CA  . ASP B 61 ? 0.2622 0.1230 0.1158 0.0115  -0.0666 0.0112  80  ASP B CA  
2680 C  C   . ASP B 61 ? 0.2052 0.1431 0.0967 0.0135  -0.0633 0.0242  80  ASP B C   
2681 O  O   . ASP B 61 ? 0.1960 0.1851 0.0999 0.0132  -0.0507 0.0296  80  ASP B O   
2682 C  CB  . ASP B 61 ? 0.2326 0.1273 0.1235 -0.0323 -0.0699 -0.0045 80  ASP B CB  
2683 C  CG  . ASP B 61 ? 0.1930 0.1579 0.1263 -0.0345 -0.0806 0.0365  80  ASP B CG  
2684 O  OD1 . ASP B 61 ? 0.2341 0.2017 0.1432 -0.0568 -0.0392 0.0478  80  ASP B OD1 
2685 O  OD2 . ASP B 61 ? 0.1756 0.1441 0.1631 -0.0025 -0.0447 0.0310  80  ASP B OD2 
2691 N  N   . LEU B 62 ? 0.2039 0.1369 0.0946 -0.0021 -0.0687 0.0149  81  LEU B N   
2692 C  CA  . LEU B 62 ? 0.2325 0.1482 0.1135 -0.0199 -0.0746 0.0094  81  LEU B CA  
2693 C  C   . LEU B 62 ? 0.2000 0.1435 0.1094 -0.0138 -0.0764 0.0044  81  LEU B C   
2694 O  O   . LEU B 62 ? 0.2126 0.1640 0.1185 -0.0394 -0.0789 0.0025  81  LEU B O   
2695 C  CB  . LEU B 62 ? 0.3155 0.1399 0.1218 -0.0254 -0.0847 0.0160  81  LEU B CB  
2696 C  CG  . LEU B 62 ? 0.3923 0.1732 0.1472 -0.0100 -0.0937 0.0169  81  LEU B CG  
2697 C  CD1 . LEU B 62 ? 0.4296 0.2115 0.1745 -0.0572 -0.1224 0.0069  81  LEU B CD1 
2698 C  CD2 . LEU B 62 ? 0.4357 0.1674 0.1530 0.0260  -0.0836 0.0218  81  LEU B CD2 
2710 N  N   . LEU B 63 ? 0.1803 0.1346 0.0925 -0.0166 -0.0676 0.0138  82  LEU B N   
2711 C  CA  . LEU B 63 ? 0.1751 0.1349 0.0848 -0.0173 -0.0604 -0.0079 82  LEU B CA  
2712 C  C   . LEU B 63 ? 0.1797 0.1365 0.0958 -0.0207 -0.0629 0.0062  82  LEU B C   
2713 O  O   . LEU B 63 ? 0.1584 0.1193 0.1143 -0.0142 -0.0739 0.0119  82  LEU B O   
2714 C  CB  . LEU B 63 ? 0.1801 0.1363 0.0832 -0.0120 -0.0364 -0.0012 82  LEU B CB  
2715 C  CG  . LEU B 63 ? 0.1791 0.1513 0.1091 -0.0009 -0.0743 0.0092  82  LEU B CG  
2716 C  CD1 . LEU B 63 ? 0.1868 0.1594 0.1318 0.0018  -0.0608 0.0148  82  LEU B CD1 
2717 C  CD2 . LEU B 63 ? 0.1908 0.1756 0.1007 0.0066  -0.0727 0.0154  82  LEU B CD2 
2729 N  N   . GLY B 64 ? 0.1793 0.1076 0.1109 -0.0210 -0.0528 -0.0001 83  GLY B N   
2730 C  CA  . GLY B 64 ? 0.1723 0.1214 0.1297 0.0117  -0.0595 -0.0044 83  GLY B CA  
2731 C  C   . GLY B 64 ? 0.1748 0.1317 0.1196 -0.0058 -0.0603 0.0085  83  GLY B C   
2732 O  O   . GLY B 64 ? 0.1803 0.1474 0.1370 0.0067  -0.0442 0.0239  83  GLY B O   
2736 N  N   . ASP B 65 ? 0.1731 0.1386 0.1340 0.0009  -0.0878 0.0168  84  ASP B N   
2737 C  CA  . ASP B 65 ? 0.2039 0.1822 0.1541 -0.0139 -0.0897 -0.0043 84  ASP B CA  
2738 C  C   . ASP B 65 ? 0.2073 0.1892 0.1915 -0.0101 -0.0635 0.0003  84  ASP B C   
2739 O  O   . ASP B 65 ? 0.1924 0.2244 0.2463 -0.0146 -0.0423 0.0211  84  ASP B O   
2740 C  CB  . ASP B 65 ? 0.2451 0.2027 0.1645 0.0184  -0.1114 0.0188  84  ASP B CB  
2741 C  CG  . ASP B 65 ? 0.3265 0.2370 0.1914 0.0361  -0.1245 0.0080  84  ASP B CG  
2742 O  OD1 . ASP B 65 ? 0.3409 0.2312 0.2208 0.0582  -0.1222 0.0089  84  ASP B OD1 
2743 O  OD2 . ASP B 65 ? 0.4097 0.2738 0.2030 0.0365  -0.1214 0.0305  84  ASP B OD2 
2748 N  N   . LEU B 66 ? 0.1840 0.1218 0.1480 0.0082  -0.0706 -0.0018 85  LEU B N   
2749 C  CA  . LEU B 66 ? 0.2183 0.1356 0.1499 -0.0129 -0.0481 0.0059  85  LEU B CA  
2750 C  C   . LEU B 66 ? 0.2030 0.1195 0.1401 -0.0045 -0.0417 -0.0063 85  LEU B C   
2751 O  O   . LEU B 66 ? 0.1899 0.1398 0.1640 -0.0150 -0.0255 -0.0322 85  LEU B O   
2752 C  CB  . LEU B 66 ? 0.2622 0.1445 0.1734 -0.0170 -0.0329 0.0364  85  LEU B CB  
2753 C  CG  . LEU B 66 ? 0.3435 0.2067 0.2118 -0.0464 -0.0276 0.0529  85  LEU B CG  
2754 C  CD1 . LEU B 66 ? 0.3822 0.2373 0.2206 -0.0264 -0.0142 0.0447  85  LEU B CD1 
2755 C  CD2 . LEU B 66 ? 0.3904 0.2931 0.2322 -0.0392 -0.0189 0.0352  85  LEU B CD2 
2767 N  N   . PHE B 67 ? 0.1935 0.1131 0.1520 0.0056  -0.0385 0.0022  86  PHE B N   
2768 C  CA  . PHE B 67 ? 0.1647 0.1227 0.1299 0.0107  -0.0364 0.0282  86  PHE B CA  
2769 C  C   . PHE B 67 ? 0.1716 0.1462 0.1411 0.0037  -0.0426 0.0487  86  PHE B C   
2770 O  O   . PHE B 67 ? 0.2071 0.1853 0.1706 0.0425  -0.0038 0.0458  86  PHE B O   
2771 C  CB  . PHE B 67 ? 0.1652 0.1445 0.1096 0.0034  -0.0299 -0.0015 86  PHE B CB  
2772 C  CG  . PHE B 67 ? 0.1749 0.1156 0.1009 0.0119  -0.0563 -0.0115 86  PHE B CG  
2773 C  CD1 . PHE B 67 ? 0.1757 0.1210 0.1245 0.0209  -0.0614 -0.0010 86  PHE B CD1 
2774 C  CD2 . PHE B 67 ? 0.1464 0.1187 0.1423 0.0229  -0.0644 -0.0115 86  PHE B CD2 
2775 C  CE1 . PHE B 67 ? 0.1874 0.1112 0.1436 0.0120  -0.0656 -0.0121 86  PHE B CE1 
2776 C  CE2 . PHE B 67 ? 0.1565 0.1405 0.1518 0.0029  -0.0530 -0.0188 86  PHE B CE2 
2777 C  CZ  . PHE B 67 ? 0.1839 0.1212 0.1554 0.0081  -0.0399 -0.0127 86  PHE B CZ  
2787 N  N   . GLY B 68 ? 0.1734 0.1542 0.1642 -0.0124 -0.0617 0.0059  87  GLY B N   
2788 C  CA  . GLY B 68 ? 0.1563 0.1696 0.1730 -0.0118 -0.0637 0.0049  87  GLY B CA  
2789 C  C   . GLY B 68 ? 0.1487 0.1675 0.1709 -0.0124 -0.0437 -0.0138 87  GLY B C   
2790 O  O   . GLY B 68 ? 0.1509 0.2066 0.1869 0.0021  -0.0356 -0.0089 87  GLY B O   
2794 N  N   . VAL B 69 ? 0.1346 0.1805 0.1392 -0.0141 -0.0450 -0.0108 88  VAL B N   
2795 C  CA  . VAL B 69 ? 0.1470 0.1579 0.1239 -0.0124 -0.0467 -0.0105 88  VAL B CA  
2796 C  C   . VAL B 69 ? 0.1708 0.1276 0.1186 0.0195  -0.0570 -0.0171 88  VAL B C   
2797 O  O   . VAL B 69 ? 0.1761 0.1642 0.1265 0.0079  -0.0622 -0.0332 88  VAL B O   
2798 C  CB  . VAL B 69 ? 0.1591 0.1941 0.1574 -0.0076 -0.0499 -0.0012 88  VAL B CB  
2799 C  CG1 . VAL B 69 ? 0.2075 0.2456 0.1967 -0.0198 -0.0407 0.0278  88  VAL B CG1 
2800 C  CG2 . VAL B 69 ? 0.1942 0.2087 0.1554 0.0296  -0.0638 0.0058  88  VAL B CG2 
2810 N  N   . PRO B 70 ? 0.1640 0.1344 0.1195 0.0187  -0.0499 -0.0154 89  PRO B N   
2811 C  CA  . PRO B 70 ? 0.1648 0.1438 0.1373 0.0215  -0.0644 -0.0011 89  PRO B CA  
2812 C  C   . PRO B 70 ? 0.1828 0.1219 0.1217 0.0238  -0.0710 -0.0116 89  PRO B C   
2813 O  O   . PRO B 70 ? 0.1887 0.1227 0.0996 -0.0016 -0.0356 -0.0037 89  PRO B O   
2814 C  CB  . PRO B 70 ? 0.1795 0.1550 0.1570 0.0397  -0.0782 0.0064  89  PRO B CB  
2815 C  CG  . PRO B 70 ? 0.1815 0.1529 0.1577 0.0498  -0.0538 -0.0285 89  PRO B CG  
2816 C  CD  . PRO B 70 ? 0.1744 0.1509 0.1458 0.0307  -0.0555 -0.0376 89  PRO B CD  
2824 N  N   . SER B 71 ? 0.1868 0.1134 0.1173 0.0093  -0.0759 -0.0037 90  SER B N   
2825 C  CA  . SER B 71 ? 0.1807 0.1191 0.1033 -0.0067 -0.0711 0.0030  90  SER B CA  
2826 C  C   . SER B 71 ? 0.1586 0.1127 0.0998 0.0072  -0.0710 0.0037  90  SER B C   
2827 O  O   . SER B 71 ? 0.1843 0.1325 0.1381 0.0065  -0.0458 0.0059  90  SER B O   
2828 C  CB  . SER B 71 ? 0.1816 0.1294 0.1287 -0.0298 -0.0489 0.0065  90  SER B CB  
2829 O  OG  . SER B 71 ? 0.1871 0.1473 0.1556 0.0052  -0.0704 -0.0190 90  SER B OG  
2835 N  N   . PHE B 72 ? 0.1363 0.1104 0.0888 0.0079  -0.0486 0.0051  91  PHE B N   
2836 C  CA  . PHE B 72 ? 0.1621 0.1074 0.0723 0.0068  -0.0489 -0.0203 91  PHE B CA  
2837 C  C   . PHE B 72 ? 0.1597 0.1114 0.0643 -0.0093 -0.0317 -0.0140 91  PHE B C   
2838 O  O   . PHE B 72 ? 0.1564 0.1337 0.0710 -0.0013 -0.0488 0.0203  91  PHE B O   
2839 C  CB  . PHE B 72 ? 0.1590 0.0905 0.0981 0.0122  -0.0586 -0.0038 91  PHE B CB  
2840 C  CG  . PHE B 72 ? 0.1477 0.0958 0.0848 -0.0009 -0.0617 -0.0060 91  PHE B CG  
2841 C  CD1 . PHE B 72 ? 0.1485 0.1282 0.1055 -0.0042 -0.0558 -0.0151 91  PHE B CD1 
2842 C  CD2 . PHE B 72 ? 0.1542 0.1156 0.1042 0.0143  -0.0529 -0.0353 91  PHE B CD2 
2843 C  CE1 . PHE B 72 ? 0.1566 0.1297 0.1004 0.0048  -0.0493 -0.0123 91  PHE B CE1 
2844 C  CE2 . PHE B 72 ? 0.1616 0.1322 0.1143 0.0307  -0.0392 -0.0201 91  PHE B CE2 
2845 C  CZ  . PHE B 72 ? 0.1513 0.1319 0.1089 0.0207  -0.0389 -0.0410 91  PHE B CZ  
2855 N  N   . SER B 73 ? 0.1404 0.1105 0.0763 -0.0180 -0.0429 0.0123  92  SER B N   
2856 C  CA  . SER B 73 ? 0.1454 0.1068 0.0831 -0.0084 -0.0442 -0.0002 92  SER B CA  
2857 C  C   . SER B 73 ? 0.1117 0.1187 0.0901 -0.0046 -0.0584 -0.0095 92  SER B C   
2858 O  O   . SER B 73 ? 0.1421 0.1150 0.1002 -0.0133 -0.0463 -0.0018 92  SER B O   
2859 C  CB  . SER B 73 ? 0.1473 0.1198 0.0715 -0.0104 -0.0515 -0.0084 92  SER B CB  
2860 O  OG  . SER B 73 ? 0.1729 0.1090 0.0894 -0.0038 -0.0608 -0.0122 92  SER B OG  
2866 N  N   . VAL B 74 ? 0.1322 0.1063 0.1035 -0.0025 -0.0498 0.0091  93  VAL B N   
2867 C  CA  . VAL B 74 ? 0.1524 0.1063 0.0811 0.0169  -0.0543 -0.0126 93  VAL B CA  
2868 C  C   . VAL B 74 ? 0.1428 0.1055 0.1002 -0.0153 -0.0558 0.0005  93  VAL B C   
2869 O  O   . VAL B 74 ? 0.1864 0.0992 0.1390 -0.0067 -0.0445 -0.0111 93  VAL B O   
2870 C  CB  . VAL B 74 ? 0.1728 0.1154 0.0980 0.0431  -0.0425 -0.0318 93  VAL B CB  
2871 C  CG1 . VAL B 74 ? 0.2006 0.1539 0.1174 0.0222  -0.0466 -0.0161 93  VAL B CG1 
2872 C  CG2 . VAL B 74 ? 0.1621 0.1152 0.0956 -0.0149 -0.0431 0.0043  93  VAL B CG2 
2882 N  N   . LYS B 75 ? 0.1424 0.0862 0.1005 -0.0113 -0.0554 -0.0095 94  LYS B N   
2883 C  CA  . LYS B 75 ? 0.1209 0.1248 0.0893 0.0106  -0.0589 0.0104  94  LYS B CA  
2884 C  C   . LYS B 75 ? 0.1547 0.1018 0.0824 0.0025  -0.0606 0.0054  94  LYS B C   
2885 O  O   . LYS B 75 ? 0.1813 0.1300 0.1022 -0.0086 -0.0749 0.0079  94  LYS B O   
2886 C  CB  . LYS B 75 ? 0.1806 0.1399 0.1236 -0.0227 -0.0853 0.0115  94  LYS B CB  
2887 C  CG  . LYS B 75 ? 0.2170 0.1560 0.1594 -0.0292 -0.1060 0.0039  94  LYS B CG  
2888 C  CD  . LYS B 75 ? 0.2175 0.1753 0.1711 -0.0283 -0.1110 0.0011  94  LYS B CD  
2889 C  CE  . LYS B 75 ? 0.2122 0.2043 0.1791 -0.0157 -0.1130 -0.0084 94  LYS B CE  
2890 N  NZ  . LYS B 75 ? 0.1707 0.1944 0.1781 0.0196  -0.0760 0.0159  94  LYS B NZ  
2904 N  N   . GLU B 76 ? 0.1439 0.0924 0.0828 -0.0082 -0.0602 -0.0005 95  GLU B N   
2905 C  CA  . GLU B 76 ? 0.1264 0.1144 0.0857 0.0033  -0.0467 -0.0164 95  GLU B CA  
2906 C  C   . GLU B 76 ? 0.1463 0.1069 0.0898 -0.0080 -0.0584 -0.0181 95  GLU B C   
2907 O  O   . GLU B 76 ? 0.1540 0.0915 0.1077 0.0013  -0.0624 -0.0101 95  GLU B O   
2908 C  CB  . GLU B 76 ? 0.1164 0.1152 0.1023 -0.0264 -0.0283 -0.0173 95  GLU B CB  
2909 C  CG  . GLU B 76 ? 0.1418 0.1257 0.0979 -0.0072 -0.0443 -0.0121 95  GLU B CG  
2910 C  CD  . GLU B 76 ? 0.1477 0.1279 0.1101 -0.0041 -0.0159 -0.0258 95  GLU B CD  
2911 O  OE1 . GLU B 76 ? 0.1662 0.1506 0.1176 0.0086  -0.0042 0.0203  95  GLU B OE1 
2912 O  OE2 . GLU B 76 ? 0.1452 0.1773 0.1651 0.0184  -0.0075 0.0016  95  GLU B OE2 
2919 N  N   . HIS B 77 ? 0.1609 0.1033 0.0922 -0.0005 -0.0536 -0.0097 96  HIS B N   
2920 C  CA  . HIS B 77 ? 0.1431 0.1025 0.1081 0.0092  -0.0455 -0.0048 96  HIS B CA  
2921 C  C   . HIS B 77 ? 0.1409 0.1017 0.0821 -0.0051 -0.0501 0.0110  96  HIS B C   
2922 O  O   . HIS B 77 ? 0.1514 0.1129 0.0789 0.0002  -0.0586 -0.0046 96  HIS B O   
2923 C  CB  . HIS B 77 ? 0.1471 0.1028 0.1744 0.0073  -0.0603 0.0166  96  HIS B CB  
2924 C  CG  . HIS B 77 ? 0.1597 0.1391 0.2563 0.0174  -0.0805 0.0096  96  HIS B CG  
2925 N  ND1 . HIS B 77 ? 0.2014 0.1885 0.3215 0.0013  -0.0727 0.0408  96  HIS B ND1 
2926 C  CD2 . HIS B 77 ? 0.1709 0.1363 0.2719 -0.0133 -0.0702 -0.0303 96  HIS B CD2 
2927 C  CE1 . HIS B 77 ? 0.2193 0.1810 0.3264 -0.0283 -0.0740 0.0194  96  HIS B CE1 
2928 N  NE2 . HIS B 77 ? 0.2159 0.1602 0.3106 -0.0075 -0.0636 -0.0153 96  HIS B NE2 
2936 N  N   . ARG B 78 ? 0.1567 0.1108 0.1018 -0.0129 -0.0531 -0.0088 97  ARG B N   
2937 C  CA  . ARG B 78 ? 0.1511 0.1028 0.0999 0.0090  -0.0486 -0.0131 97  ARG B CA  
2938 C  C   . ARG B 78 ? 0.1627 0.1047 0.0909 0.0182  -0.0585 -0.0007 97  ARG B C   
2939 O  O   . ARG B 78 ? 0.1569 0.1188 0.0749 -0.0055 -0.0534 -0.0130 97  ARG B O   
2940 C  CB  . ARG B 78 ? 0.1762 0.1118 0.1024 -0.0190 -0.0479 -0.0194 97  ARG B CB  
2941 C  CG  . ARG B 78 ? 0.1769 0.1096 0.1058 -0.0196 -0.0368 -0.0059 97  ARG B CG  
2942 C  CD  . ARG B 78 ? 0.1926 0.1733 0.1470 -0.0397 -0.0510 0.0001  97  ARG B CD  
2943 N  NE  . ARG B 78 ? 0.1885 0.1681 0.1666 -0.0284 -0.0575 -0.0096 97  ARG B NE  
2944 C  CZ  . ARG B 78 ? 0.1992 0.1652 0.2174 -0.0027 -0.0583 -0.0138 97  ARG B CZ  
2945 N  NH1 . ARG B 78 ? 0.2309 0.1907 0.2116 0.0243  -0.0594 0.0172  97  ARG B NH1 
2946 N  NH2 . ARG B 78 ? 0.2068 0.1735 0.2699 -0.0389 -0.0688 0.0050  97  ARG B NH2 
2960 N  N   . LYS B 79 ? 0.1751 0.0969 0.0899 -0.0114 -0.0624 0.0201  98  LYS B N   
2961 C  CA  . LYS B 79 ? 0.1565 0.1014 0.1024 -0.0263 -0.0597 0.0118  98  LYS B CA  
2962 C  C   . LYS B 79 ? 0.1471 0.0967 0.1141 -0.0006 -0.0764 0.0031  98  LYS B C   
2963 O  O   . LYS B 79 ? 0.1586 0.0953 0.1225 -0.0035 -0.0809 -0.0080 98  LYS B O   
2964 C  CB  . LYS B 79 ? 0.1750 0.0962 0.1385 -0.0116 -0.0830 -0.0165 98  LYS B CB  
2965 C  CG  . LYS B 79 ? 0.2094 0.1106 0.1627 0.0166  -0.0785 -0.0294 98  LYS B CG  
2966 C  CD  . LYS B 79 ? 0.2197 0.1164 0.1622 -0.0009 -0.0732 -0.0281 98  LYS B CD  
2967 C  CE  . LYS B 79 ? 0.2036 0.1424 0.1789 -0.0121 -0.0641 -0.0454 98  LYS B CE  
2968 N  NZ  . LYS B 79 ? 0.1519 0.1482 0.1760 -0.0028 -0.0454 -0.0522 98  LYS B NZ  
2982 N  N   . ILE B 80 ? 0.1360 0.1062 0.1012 -0.0146 -0.0608 -0.0196 99  ILE B N   
2983 C  CA  . ILE B 80 ? 0.1648 0.0792 0.1098 -0.0100 -0.0575 -0.0084 99  ILE B CA  
2984 C  C   . ILE B 80 ? 0.1321 0.0771 0.1013 -0.0137 -0.0638 0.0130  99  ILE B C   
2985 O  O   . ILE B 80 ? 0.1342 0.1205 0.1044 -0.0162 -0.0615 0.0064  99  ILE B O   
2986 C  CB  . ILE B 80 ? 0.1660 0.1022 0.1089 -0.0226 -0.0544 0.0157  99  ILE B CB  
2987 C  CG1 . ILE B 80 ? 0.1820 0.1218 0.1384 -0.0211 -0.0873 0.0071  99  ILE B CG1 
2988 C  CG2 . ILE B 80 ? 0.1833 0.1368 0.0982 -0.0201 -0.0649 0.0257  99  ILE B CG2 
2989 C  CD1 . ILE B 80 ? 0.1522 0.1221 0.1654 -0.0148 -0.0705 -0.0090 99  ILE B CD1 
3001 N  N   . TYR B 81 ? 0.1294 0.0778 0.1065 0.0014  -0.0642 0.0177  100 TYR B N   
3002 C  CA  . TYR B 81 ? 0.1453 0.0776 0.0836 -0.0094 -0.0598 -0.0025 100 TYR B CA  
3003 C  C   . TYR B 81 ? 0.1601 0.0947 0.0584 -0.0061 -0.0390 -0.0032 100 TYR B C   
3004 O  O   . TYR B 81 ? 0.1628 0.1026 0.0768 -0.0094 -0.0571 0.0074  100 TYR B O   
3005 C  CB  . TYR B 81 ? 0.1476 0.0917 0.0952 -0.0021 -0.0555 -0.0122 100 TYR B CB  
3006 C  CG  . TYR B 81 ? 0.1326 0.1141 0.1501 -0.0082 -0.0514 -0.0229 100 TYR B CG  
3007 C  CD1 . TYR B 81 ? 0.1307 0.1492 0.2318 0.0148  -0.0587 -0.0490 100 TYR B CD1 
3008 C  CD2 . TYR B 81 ? 0.1737 0.2074 0.2283 0.0105  -0.0389 -0.0887 100 TYR B CD2 
3009 C  CE1 . TYR B 81 ? 0.1418 0.1667 0.2388 0.0207  -0.0688 -0.0376 100 TYR B CE1 
3010 C  CE2 . TYR B 81 ? 0.1797 0.2132 0.2451 0.0398  -0.0396 -0.0768 100 TYR B CE2 
3011 C  CZ  . TYR B 81 ? 0.1538 0.1783 0.2099 0.0497  -0.0428 -0.0127 100 TYR B CZ  
3012 O  OH  . TYR B 81 ? 0.2001 0.2000 0.2167 0.0244  -0.0166 0.0426  100 TYR B OH  
3022 N  N   . THR B 82 ? 0.1510 0.1056 0.0677 -0.0172 -0.0434 -0.0069 101 THR B N   
3023 C  CA  . THR B 82 ? 0.1446 0.1255 0.0781 -0.0185 -0.0519 -0.0112 101 THR B CA  
3024 C  C   . THR B 82 ? 0.1368 0.1305 0.0758 -0.0213 -0.0514 0.0042  101 THR B C   
3025 O  O   . THR B 82 ? 0.1402 0.1266 0.0823 -0.0193 -0.0557 -0.0103 101 THR B O   
3026 C  CB  . THR B 82 ? 0.1663 0.1785 0.0954 0.0067  -0.0585 0.0047  101 THR B CB  
3027 O  OG1 . THR B 82 ? 0.1648 0.1775 0.1093 -0.0108 -0.0453 0.0086  101 THR B OG1 
3028 C  CG2 . THR B 82 ? 0.1606 0.2019 0.0931 0.0120  -0.0507 0.0410  101 THR B CG2 
3036 N  N   A MET B 83 ? 0.1230 0.1340 0.0835 -0.0081 -0.0567 0.0154  102 MET B N   
3037 N  N   B MET B 83 ? 0.1326 0.1263 0.0739 -0.0110 -0.0535 0.0080  102 MET B N   
3038 C  CA  A MET B 83 ? 0.1355 0.1129 0.0834 -0.0043 -0.0580 0.0122  102 MET B CA  
3039 C  CA  B MET B 83 ? 0.1388 0.1190 0.0795 0.0008  -0.0476 0.0049  102 MET B CA  
3040 C  C   A MET B 83 ? 0.1265 0.0977 0.0819 0.0057  -0.0527 0.0193  102 MET B C   
3041 C  C   B MET B 83 ? 0.1232 0.0923 0.0689 0.0113  -0.0434 0.0146  102 MET B C   
3042 O  O   A MET B 83 ? 0.1429 0.0921 0.0922 -0.0162 -0.0648 0.0059  102 MET B O   
3043 O  O   B MET B 83 ? 0.0961 0.0704 0.0610 0.0063  -0.0267 0.0280  102 MET B O   
3044 C  CB  A MET B 83 ? 0.1674 0.1178 0.0823 -0.0153 -0.0600 -0.0018 102 MET B CB  
3045 C  CB  B MET B 83 ? 0.1643 0.1396 0.0933 -0.0104 -0.0510 -0.0094 102 MET B CB  
3046 C  CG  A MET B 83 ? 0.1821 0.1456 0.0991 0.0141  -0.0536 0.0097  102 MET B CG  
3047 C  CG  B MET B 83 ? 0.1863 0.1581 0.1181 0.0020  -0.0463 -0.0166 102 MET B CG  
3048 S  SD  A MET B 83 ? 0.1859 0.1652 0.1002 0.0386  -0.0451 0.0007  102 MET B SD  
3049 S  SD  B MET B 83 ? 0.2075 0.1771 0.1403 0.0147  -0.0451 -0.0245 102 MET B SD  
3050 C  CE  A MET B 83 ? 0.2048 0.1780 0.1552 0.0187  -0.0210 0.0176  102 MET B CE  
3051 C  CE  B MET B 83 ? 0.1978 0.1834 0.1386 0.0181  -0.0354 -0.0129 102 MET B CE  
3070 N  N   . ILE B 84 ? 0.1265 0.1060 0.0729 0.0129  -0.0387 -0.0128 103 ILE B N   
3071 C  CA  . ILE B 84 ? 0.1180 0.1039 0.0802 -0.0133 -0.0338 0.0056  103 ILE B CA  
3072 C  C   . ILE B 84 ? 0.1270 0.1158 0.0809 -0.0067 -0.0456 -0.0025 103 ILE B C   
3073 O  O   . ILE B 84 ? 0.1540 0.1053 0.0791 -0.0120 -0.0539 0.0048  103 ILE B O   
3074 C  CB  . ILE B 84 ? 0.1164 0.1186 0.0918 -0.0010 -0.0281 -0.0048 103 ILE B CB  
3075 C  CG1 . ILE B 84 ? 0.1277 0.1153 0.1011 -0.0050 -0.0493 -0.0054 103 ILE B CG1 
3076 C  CG2 . ILE B 84 ? 0.1426 0.1422 0.1192 0.0119  -0.0178 -0.0066 103 ILE B CG2 
3077 C  CD1 . ILE B 84 ? 0.1303 0.1279 0.1005 -0.0124 -0.0434 -0.0119 103 ILE B CD1 
3089 N  N   . TYR B 85 ? 0.1608 0.1211 0.0840 -0.0193 -0.0389 -0.0145 104 TYR B N   
3090 C  CA  . TYR B 85 ? 0.1296 0.1103 0.0802 0.0000  -0.0503 0.0132  104 TYR B CA  
3091 C  C   . TYR B 85 ? 0.1519 0.1012 0.0644 -0.0053 -0.0456 0.0058  104 TYR B C   
3092 O  O   . TYR B 85 ? 0.1306 0.1275 0.0840 -0.0058 -0.0567 -0.0173 104 TYR B O   
3093 C  CB  . TYR B 85 ? 0.1401 0.1183 0.0987 -0.0026 -0.0640 0.0222  104 TYR B CB  
3094 C  CG  . TYR B 85 ? 0.1526 0.0870 0.0871 -0.0130 -0.0601 -0.0057 104 TYR B CG  
3095 C  CD1 . TYR B 85 ? 0.1466 0.1151 0.1166 0.0120  -0.0765 -0.0152 104 TYR B CD1 
3096 C  CD2 . TYR B 85 ? 0.1596 0.1148 0.0989 0.0003  -0.0569 -0.0031 104 TYR B CD2 
3097 C  CE1 . TYR B 85 ? 0.1780 0.0807 0.1269 -0.0041 -0.0779 0.0040  104 TYR B CE1 
3098 C  CE2 . TYR B 85 ? 0.1608 0.1151 0.1142 0.0058  -0.0587 0.0130  104 TYR B CE2 
3099 C  CZ  . TYR B 85 ? 0.1657 0.0890 0.1215 -0.0001 -0.0713 0.0189  104 TYR B CZ  
3100 O  OH  . TYR B 85 ? 0.1877 0.1210 0.1474 0.0124  -0.0883 0.0185  104 TYR B OH  
3110 N  N   . ARG B 86 ? 0.1458 0.0979 0.0831 -0.0080 -0.0514 0.0035  105 ARG B N   
3111 C  CA  . ARG B 86 ? 0.1270 0.1258 0.0793 -0.0021 -0.0519 0.0127  105 ARG B CA  
3112 C  C   . ARG B 86 ? 0.1423 0.1133 0.0933 0.0139  -0.0588 -0.0138 105 ARG B C   
3113 O  O   . ARG B 86 ? 0.1545 0.1683 0.0903 0.0046  -0.0657 -0.0048 105 ARG B O   
3114 C  CB  . ARG B 86 ? 0.1467 0.1452 0.0754 0.0127  -0.0443 -0.0157 105 ARG B CB  
3115 C  CG  . ARG B 86 ? 0.1443 0.1307 0.0757 -0.0025 -0.0493 -0.0260 105 ARG B CG  
3116 C  CD  . ARG B 86 ? 0.1755 0.1581 0.0594 0.0060  -0.0269 -0.0104 105 ARG B CD  
3117 N  NE  . ARG B 86 ? 0.1695 0.1463 0.0591 0.0030  -0.0077 -0.0350 105 ARG B NE  
3118 C  CZ  . ARG B 86 ? 0.1701 0.1318 0.0885 0.0258  0.0010  -0.0249 105 ARG B CZ  
3119 N  NH1 . ARG B 86 ? 0.2369 0.1587 0.1257 0.0190  -0.0255 0.0068  105 ARG B NH1 
3120 N  NH2 . ARG B 86 ? 0.1827 0.1143 0.1032 0.0176  -0.0227 -0.0206 105 ARG B NH2 
3134 N  N   . ASN B 87 ? 0.1405 0.1103 0.0748 0.0007  -0.0472 -0.0164 106 ASN B N   
3135 C  CA  . ASN B 87 ? 0.1760 0.1071 0.0779 -0.0056 -0.0432 -0.0169 106 ASN B CA  
3136 C  C   . ASN B 87 ? 0.1876 0.1045 0.0794 -0.0071 -0.0567 -0.0083 106 ASN B C   
3137 O  O   . ASN B 87 ? 0.2063 0.1191 0.0721 -0.0037 -0.0351 0.0101  106 ASN B O   
3138 C  CB  . ASN B 87 ? 0.2076 0.1131 0.0691 0.0051  -0.0332 0.0074  106 ASN B CB  
3139 C  CG  . ASN B 87 ? 0.1959 0.1063 0.1055 0.0019  -0.0651 -0.0090 106 ASN B CG  
3140 O  OD1 . ASN B 87 ? 0.2247 0.1291 0.1281 0.0230  -0.0922 -0.0034 106 ASN B OD1 
3141 N  ND2 . ASN B 87 ? 0.2220 0.1261 0.0875 -0.0240 -0.0555 -0.0046 106 ASN B ND2 
3148 N  N   . LEU B 88 ? 0.1747 0.0766 0.0858 0.0017  -0.0472 0.0086  107 LEU B N   
3149 C  CA  . LEU B 88 ? 0.1562 0.0853 0.0847 -0.0113 -0.0573 0.0005  107 LEU B CA  
3150 C  C   . LEU B 88 ? 0.1642 0.0842 0.0551 0.0061  -0.0305 0.0049  107 LEU B C   
3151 O  O   . LEU B 88 ? 0.1715 0.1279 0.0735 0.0019  -0.0284 -0.0076 107 LEU B O   
3152 C  CB  . LEU B 88 ? 0.1485 0.1188 0.0804 0.0122  -0.0370 -0.0410 107 LEU B CB  
3153 C  CG  . LEU B 88 ? 0.1713 0.1199 0.0701 0.0236  -0.0351 -0.0242 107 LEU B CG  
3154 C  CD1 . LEU B 88 ? 0.1822 0.1684 0.0780 0.0339  -0.0491 0.0083  107 LEU B CD1 
3155 C  CD2 . LEU B 88 ? 0.1668 0.1121 0.0968 0.0267  -0.0638 -0.0321 107 LEU B CD2 
3167 N  N   . VAL B 89 ? 0.1798 0.0693 0.0720 0.0126  -0.0393 -0.0010 108 VAL B N   
3168 C  CA  . VAL B 89 ? 0.1640 0.1045 0.0801 0.0085  -0.0541 0.0122  108 VAL B CA  
3169 C  C   . VAL B 89 ? 0.1769 0.1049 0.0680 0.0009  -0.0475 -0.0042 108 VAL B C   
3170 O  O   . VAL B 89 ? 0.1903 0.1122 0.0812 0.0056  -0.0433 0.0266  108 VAL B O   
3171 C  CB  . VAL B 89 ? 0.1693 0.1371 0.1154 -0.0187 -0.0494 0.0062  108 VAL B CB  
3172 C  CG1 . VAL B 89 ? 0.1548 0.1867 0.1361 0.0087  -0.0485 0.0119  108 VAL B CG1 
3173 C  CG2 . VAL B 89 ? 0.2023 0.1359 0.1343 -0.0087 -0.0829 0.0009  108 VAL B CG2 
3183 N  N   . VAL B 90 ? 0.1661 0.1133 0.0728 -0.0086 -0.0399 0.0018  109 VAL B N   
3184 C  CA  . VAL B 90 ? 0.1454 0.1277 0.1180 -0.0319 -0.0451 0.0120  109 VAL B CA  
3185 C  C   . VAL B 90 ? 0.1862 0.1298 0.1808 -0.0046 -0.0590 -0.0250 109 VAL B C   
3186 O  O   . VAL B 90 ? 0.2151 0.1414 0.2666 0.0001  -0.0716 -0.0708 109 VAL B O   
3187 C  CB  . VAL B 90 ? 0.1817 0.1684 0.1342 -0.0433 -0.0318 0.0664  109 VAL B CB  
3188 C  CG1 . VAL B 90 ? 0.2317 0.1979 0.1797 0.0000  -0.0136 0.0764  109 VAL B CG1 
3189 C  CG2 . VAL B 90 ? 0.1998 0.2421 0.1165 -0.0585 -0.0137 0.0476  109 VAL B CG2 
3199 N  N   . VAL B 91 ? 0.1956 0.1264 0.1965 -0.0058 -0.0411 -0.0095 110 VAL B N   
3200 C  CA  . VAL B 91 ? 0.2432 0.1563 0.2458 0.0300  -0.0587 -0.0078 110 VAL B CA  
3201 C  C   . VAL B 91 ? 0.2852 0.2313 0.3241 0.0509  -0.0797 0.0260  110 VAL B C   
3202 O  O   . VAL B 91 ? 0.3004 0.2851 0.3293 0.0821  -0.1121 0.0596  110 VAL B O   
3203 C  CB  . VAL B 91 ? 0.2715 0.1468 0.2252 0.0347  -0.0619 -0.0447 110 VAL B CB  
3204 C  CG1 . VAL B 91 ? 0.2880 0.1920 0.2386 0.0404  -0.0592 -0.0341 110 VAL B CG1 
3205 C  CG2 . VAL B 91 ? 0.2930 0.1935 0.2188 -0.0239 -0.0648 -0.0552 110 VAL B CG2 
3215 N  N   . ASN B 92 ? 0.3465 0.2515 0.4004 0.0396  -0.0627 0.0022  111 ASN B N   
3216 C  CA  . ASN B 92 ? 0.4223 0.3148 0.4746 0.0064  -0.0480 -0.0277 111 ASN B CA  
3217 C  C   . ASN B 92 ? 0.5007 0.3538 0.4969 0.0117  -0.0564 -0.0571 111 ASN B C   
3218 O  O   . ASN B 92 ? 0.5537 0.4090 0.5267 -0.0001 -0.0574 -0.0621 111 ASN B O   
3219 C  CB  . ASN B 92 ? 0.4432 0.3226 0.5149 -0.0302 -0.0385 -0.0332 111 ASN B CB  
3220 C  CG  . ASN B 92 ? 0.4822 0.3660 0.5675 -0.0187 -0.0360 -0.0119 111 ASN B CG  
3221 O  OD1 . ASN B 92 ? 0.5046 0.3918 0.5810 0.0127  -0.0331 -0.0046 111 ASN B OD1 
3222 N  ND2 . ASN B 92 ? 0.5065 0.4040 0.5860 -0.0132 -0.0370 -0.0012 111 ASN B ND2 
3229 O  O3  . NUT C .  ? 0.1522 0.1770 0.1232 -0.0275 -0.0465 -0.0452 201 NUT A O3  
3230 C  C25 . NUT C .  ? 0.1602 0.1572 0.1167 -0.0293 -0.0220 -0.0426 201 NUT A C25 
3231 N  N2  . NUT C .  ? 0.1867 0.2188 0.1628 -0.0381 -0.0345 -0.0346 201 NUT A N2  
3232 C  C29 . NUT C .  ? 0.2213 0.2570 0.1815 -0.0055 -0.0540 -0.0166 201 NUT A C29 
3233 C  C28 . NUT C .  ? 0.3030 0.3141 0.2173 -0.0175 -0.0328 -0.0199 201 NUT A C28 
3234 O  O2  . NUT C .  ? 0.3311 0.3281 0.2384 -0.0094 -0.0202 -0.0550 201 NUT A O2  
3235 N  N3  . NUT C .  ? 0.3182 0.3467 0.2443 -0.0317 -0.0464 -0.0086 201 NUT A N3  
3236 C  C27 . NUT C .  ? 0.2966 0.3280 0.2367 -0.0553 -0.0336 -0.0038 201 NUT A C27 
3237 C  C26 . NUT C .  ? 0.2373 0.2680 0.2031 -0.0739 -0.0270 -0.0309 201 NUT A C26 
3238 N  N1  . NUT C .  ? 0.1672 0.1458 0.1222 -0.0436 -0.0211 -0.0413 201 NUT A N1  
3239 C  C10 . NUT C .  ? 0.2112 0.1693 0.1408 -0.0458 -0.0196 -0.0233 201 NUT A C10 
3240 C  C9  . NUT C .  ? 0.1555 0.1694 0.1306 -0.0195 -0.0048 -0.0287 201 NUT A C9  
3241 C  C3  . NUT C .  ? 0.1626 0.1839 0.1317 -0.0155 -0.0018 -0.0436 201 NUT A C3  
3242 C  C2  . NUT C .  ? 0.1772 0.2094 0.1297 -0.0080 0.0031  -0.0512 201 NUT A C2  
3243 C  C5  . NUT C .  ? 0.1650 0.1440 0.1173 -0.0113 -0.0370 -0.0293 201 NUT A C5  
3244 O  O1  . NUT C .  ? 0.1753 0.1316 0.1078 -0.0058 -0.0553 -0.0099 201 NUT A O1  
3245 C  C6  . NUT C .  ? 0.1708 0.0971 0.0921 0.0135  -0.0629 -0.0232 201 NUT A C6  
3246 C  C8  . NUT C .  ? 0.1686 0.1080 0.0996 -0.0155 -0.0452 -0.0144 201 NUT A C8  
3247 C  C7  . NUT C .  ? 0.1777 0.1309 0.1093 -0.0113 -0.0603 -0.0394 201 NUT A C7  
3248 C  C4  . NUT C .  ? 0.1670 0.1746 0.1694 0.0086  -0.0253 -0.0443 201 NUT A C4  
3249 C  C1  . NUT C .  ? 0.1932 0.1925 0.1622 0.0024  -0.0310 -0.0543 201 NUT A C1  
3250 O  O   . NUT C .  ? 0.2212 0.2467 0.1905 -0.0008 -0.0017 -0.0709 201 NUT A O   
3251 C  C   . NUT C .  ? 0.2284 0.2770 0.2023 -0.0287 -0.0071 -0.0462 201 NUT A C   
3252 C  C18 . NUT C .  ? 0.2124 0.1477 0.1097 -0.0195 -0.0553 -0.0118 201 NUT A C18 
3253 C  C19 . NUT C .  ? 0.2081 0.1267 0.1028 -0.0227 -0.0614 0.0119  201 NUT A C19 
3254 C  C24 . NUT C .  ? 0.1931 0.1352 0.0921 -0.0152 -0.0420 -0.0039 201 NUT A C24 
3255 C  C23 . NUT C .  ? 0.1719 0.1110 0.0945 -0.0010 -0.0559 -0.0001 201 NUT A C23 
3256 C  C22 . NUT C .  ? 0.1565 0.1227 0.0955 -0.0006 -0.0379 0.0014  201 NUT A C22 
3257 CL CL1 . NUT C .  ? 0.1803 0.1246 0.1075 0.0058  -0.0668 -0.0018 201 NUT A CL1 
3258 C  C21 . NUT C .  ? 0.1744 0.1028 0.0866 0.0092  -0.0405 0.0068  201 NUT A C21 
3259 C  C20 . NUT C .  ? 0.1695 0.1201 0.1098 0.0098  -0.0394 0.0061  201 NUT A C20 
3260 C  C11 . NUT C .  ? 0.2289 0.1453 0.1199 -0.0279 -0.0453 0.0151  201 NUT A C11 
3261 N  N   . NUT C .  ? 0.2283 0.1530 0.1162 -0.0411 -0.0092 -0.0085 201 NUT A N   
3262 C  C12 . NUT C .  ? 0.2610 0.1371 0.1118 -0.0346 -0.0570 0.0272  201 NUT A C12 
3263 C  C17 . NUT C .  ? 0.2932 0.1567 0.1119 -0.0299 -0.0713 0.0113  201 NUT A C17 
3264 C  C16 . NUT C .  ? 0.3013 0.1734 0.1292 -0.0083 -0.0650 0.0196  201 NUT A C16 
3265 C  C15 . NUT C .  ? 0.2728 0.1562 0.1030 -0.0130 -0.0695 0.0194  201 NUT A C15 
3266 CL CL  . NUT C .  ? 0.3100 0.1882 0.1470 -0.0276 -0.1085 0.0185  201 NUT A CL  
3267 C  C14 . NUT C .  ? 0.2729 0.1319 0.0884 -0.0222 -0.0397 0.0159  201 NUT A C14 
3268 C  C13 . NUT C .  ? 0.2715 0.1122 0.1137 -0.0182 -0.0535 -0.0014 201 NUT A C13 
3299 S  S   . SO4 D .  ? 0.2234 0.1683 0.1840 -0.0150 -0.0752 -0.0273 202 SO4 A S   
3300 O  O1  . SO4 D .  ? 0.2489 0.1646 0.1988 -0.0184 -0.0617 -0.0579 202 SO4 A O1  
3301 O  O2  . SO4 D .  ? 0.2217 0.1420 0.1676 -0.0050 -0.0329 -0.0167 202 SO4 A O2  
3302 O  O3  . SO4 D .  ? 0.2508 0.1668 0.1801 -0.0247 -0.1030 -0.0312 202 SO4 A O3  
3303 O  O4  . SO4 D .  ? 0.1862 0.2091 0.2271 0.0050  -0.0761 -0.0250 202 SO4 A O4  
3304 CL CL  . CL  E .  ? 0.2588 0.1811 0.1110 -0.0805 -0.0066 -0.0378 203 CL  A CL  
3305 I  I   . IOD F .  ? 0.2503 0.1400 0.1955 -0.0029 -0.0995 0.0333  204 IOD A I   
3306 O  O3  . NUT G .  ? 0.1699 0.1591 0.1250 0.0265  -0.0420 -0.0341 201 NUT B O3  
3307 C  C25 . NUT G .  ? 0.1782 0.1533 0.1211 0.0105  -0.0661 -0.0243 201 NUT B C25 
3308 N  N2  . NUT G .  ? 0.2068 0.2126 0.1414 0.0322  -0.0672 -0.0281 201 NUT B N2  
3309 C  C29 . NUT G .  ? 0.2465 0.2513 0.1749 0.0019  -0.0527 -0.0451 201 NUT B C29 
3310 C  C28 . NUT G .  ? 0.3204 0.3212 0.1958 0.0206  -0.0610 -0.0419 201 NUT B C28 
3311 O  O2  . NUT G .  ? 0.3407 0.3401 0.2100 -0.0007 -0.0696 -0.0714 201 NUT B O2  
3312 N  N3  . NUT G .  ? 0.3463 0.3523 0.1988 0.0422  -0.0376 -0.0205 201 NUT B N3  
3313 C  C27 . NUT G .  ? 0.3180 0.3279 0.1965 0.0617  -0.0606 -0.0176 201 NUT B C27 
3314 C  C26 . NUT G .  ? 0.2446 0.2625 0.1565 0.0661  -0.0588 -0.0427 201 NUT B C26 
3315 N  N1  . NUT G .  ? 0.1872 0.1476 0.1285 0.0162  -0.0865 -0.0152 201 NUT B N1  
3316 C  C10 . NUT G .  ? 0.2031 0.1525 0.1409 0.0379  -0.0838 -0.0063 201 NUT B C10 
3317 C  C9  . NUT G .  ? 0.1702 0.1658 0.1301 0.0176  -0.0852 -0.0137 201 NUT B C9  
3318 C  C3  . NUT G .  ? 0.1921 0.1884 0.1504 0.0189  -0.0730 -0.0219 201 NUT B C3  
3319 C  C2  . NUT G .  ? 0.1887 0.2125 0.1644 -0.0244 -0.0564 -0.0341 201 NUT B C2  
3320 C  C5  . NUT G .  ? 0.1538 0.1374 0.1142 0.0143  -0.0710 -0.0209 201 NUT B C5  
3321 O  O1  . NUT G .  ? 0.1847 0.1455 0.0884 0.0069  -0.0476 -0.0178 201 NUT B O1  
3322 C  C6  . NUT G .  ? 0.1775 0.1248 0.0713 -0.0104 -0.0182 -0.0176 201 NUT B C6  
3323 C  C8  . NUT G .  ? 0.1860 0.1342 0.0963 0.0103  -0.0185 -0.0151 201 NUT B C8  
3324 C  C7  . NUT G .  ? 0.1461 0.1385 0.0867 -0.0054 -0.0333 -0.0290 201 NUT B C7  
3325 C  C4  . NUT G .  ? 0.1644 0.1631 0.1584 -0.0216 -0.0619 -0.0023 201 NUT B C4  
3326 C  C1  . NUT G .  ? 0.1759 0.1836 0.1676 -0.0316 -0.0573 -0.0380 201 NUT B C1  
3327 O  O   . NUT G .  ? 0.2000 0.2227 0.2005 -0.0194 -0.0924 -0.0522 201 NUT B O   
3328 C  C   . NUT G .  ? 0.2216 0.2576 0.2167 0.0159  -0.0998 -0.0114 201 NUT B C   
3329 C  C18 . NUT G .  ? 0.1734 0.1285 0.1108 0.0111  -0.0547 0.0035  201 NUT B C18 
3330 C  C19 . NUT G .  ? 0.1663 0.1303 0.1092 0.0326  -0.0587 0.0064  201 NUT B C19 
3331 C  C24 . NUT G .  ? 0.1518 0.1380 0.0939 0.0031  -0.0411 -0.0071 201 NUT B C24 
3332 C  C23 . NUT G .  ? 0.1713 0.1290 0.0927 -0.0101 -0.0676 0.0134  201 NUT B C23 
3333 C  C22 . NUT G .  ? 0.1559 0.1295 0.0883 0.0113  -0.0609 0.0098  201 NUT B C22 
3334 CL CL1 . NUT G .  ? 0.1742 0.1279 0.1084 -0.0032 -0.0499 0.0060  201 NUT B CL1 
3335 C  C21 . NUT G .  ? 0.1673 0.1236 0.0872 0.0036  -0.0570 0.0077  201 NUT B C21 
3336 C  C20 . NUT G .  ? 0.1553 0.1294 0.1121 0.0118  -0.0542 0.0102  201 NUT B C20 
3337 C  C11 . NUT G .  ? 0.2034 0.1564 0.1308 0.0328  -0.0847 0.0124  201 NUT B C11 
3338 N  N   . NUT G .  ? 0.2227 0.1485 0.1232 0.0358  -0.0854 -0.0154 201 NUT B N   
3339 C  C12 . NUT G .  ? 0.2369 0.1636 0.1296 0.0478  -0.0798 0.0145  201 NUT B C12 
3340 C  C17 . NUT G .  ? 0.2621 0.1510 0.1328 0.0373  -0.0576 0.0042  201 NUT B C17 
3341 C  C16 . NUT G .  ? 0.2681 0.1585 0.1351 0.0274  -0.0462 0.0037  201 NUT B C16 
3342 C  C15 . NUT G .  ? 0.2459 0.1731 0.1059 0.0250  -0.0454 -0.0010 201 NUT B C15 
3343 CL CL  . NUT G .  ? 0.2820 0.1906 0.1403 0.0356  0.0010  0.0156  201 NUT B CL  
3344 C  C14 . NUT G .  ? 0.2327 0.1615 0.0917 0.0323  -0.0539 0.0200  201 NUT B C14 
3345 C  C13 . NUT G .  ? 0.2449 0.1671 0.1184 0.0319  -0.0711 -0.0131 201 NUT B C13 
3376 S  S   . SO4 H .  ? 0.2073 0.1791 0.1875 -0.0177 -0.0355 0.0403  202 SO4 B S   
3377 O  O1  . SO4 H .  ? 0.1970 0.1594 0.1845 0.0025  -0.0366 0.0119  202 SO4 B O1  
3378 O  O2  . SO4 H .  ? 0.2296 0.1553 0.1956 -0.0196 -0.0449 0.0542  202 SO4 B O2  
3379 O  O3  . SO4 H .  ? 0.2064 0.2068 0.2601 -0.0044 -0.0109 0.0263  202 SO4 B O3  
3380 O  O4  . SO4 H .  ? 0.2660 0.1733 0.1705 -0.0181 -0.0231 0.0331  202 SO4 B O4  
3381 CL CL  . CL  I .  ? 0.2480 0.1789 0.1218 0.0673  -0.0817 -0.0241 203 CL  B CL  
3382 I  I   . IOD J .  ? 0.2172 0.1424 0.1965 0.0052  -0.0093 0.0369  204 IOD B I   
3383 I  I   . IOD K .  ? 0.1841 0.1761 0.5945 -0.0080 -0.1013 0.0623  205 IOD B I   
3384 I  I   . IOD L .  ? 0.1536 0.1629 0.5992 0.0031  0.0206  0.0679  206 IOD B I   
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'ASN B 79 HAS WRONG CHIRALITY AT ATOM CA' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  20  20  PRO PRO A . n 
A 1 2  ALA 2  21  21  ALA ALA A . n 
A 1 3  SER 3  22  22  SER SER A . n 
A 1 4  GLU 4  23  23  GLU GLU A . n 
A 1 5  GLN 5  24  24  GLN GLN A . n 
A 1 6  GLU 6  25  25  GLU GLU A . n 
A 1 7  THR 7  26  26  THR THR A . n 
A 1 8  LEU 8  27  27  LEU LEU A . n 
A 1 9  VAL 9  28  28  VAL VAL A . n 
A 1 10 ARG 10 29  29  ARG ARG A . n 
A 1 11 PRO 11 30  30  PRO PRO A . n 
A 1 12 LYS 12 31  31  LYS LYS A . n 
A 1 13 PRO 13 32  32  PRO PRO A . n 
A 1 14 LEU 14 33  33  LEU LEU A . n 
A 1 15 LEU 15 34  34  LEU LEU A . n 
A 1 16 LEU 16 35  35  LEU LEU A . n 
A 1 17 LYS 17 36  36  LYS LYS A . n 
A 1 18 LEU 18 37  37  LEU LEU A . n 
A 1 19 LEU 19 38  38  LEU LEU A . n 
A 1 20 LYS 20 39  39  LYS LYS A . n 
A 1 21 SER 21 40  40  SER SER A . n 
A 1 22 VAL 22 41  41  VAL VAL A . n 
A 1 23 GLY 23 42  42  GLY GLY A . n 
A 1 24 ALA 24 43  43  ALA ALA A . n 
A 1 25 GLN 25 44  44  GLN GLN A . n 
A 1 26 LYS 26 45  45  LYS LYS A . n 
A 1 27 ASP 27 46  46  ASP ASP A . n 
A 1 28 THR 28 47  47  THR THR A . n 
A 1 29 TYR 29 48  48  TYR TYR A . n 
A 1 30 THR 30 49  49  THR THR A . n 
A 1 31 MET 31 50  50  MET MET A . n 
A 1 32 LYS 32 51  51  LYS LYS A . n 
A 1 33 GLU 33 52  52  GLU GLU A . n 
A 1 34 VAL 34 53  53  VAL VAL A . n 
A 1 35 LEU 35 54  54  LEU LEU A . n 
A 1 36 PHE 36 55  55  PHE PHE A . n 
A 1 37 TYR 37 56  56  TYR TYR A . n 
A 1 38 LEU 38 57  57  LEU LEU A . n 
A 1 39 GLY 39 58  58  GLY GLY A . n 
A 1 40 GLN 40 59  59  GLN GLN A . n 
A 1 41 TYR 41 60  60  TYR TYR A . n 
A 1 42 ILE 42 61  61  ILE ILE A . n 
A 1 43 MET 43 62  62  MET MET A . n 
A 1 44 THR 44 63  63  THR THR A . n 
A 1 45 LYS 45 64  64  LYS LYS A . n 
A 1 46 ARG 46 65  65  ARG ARG A . n 
A 1 47 LEU 47 66  66  LEU LEU A . n 
A 1 48 TYR 48 67  67  TYR TYR A . n 
A 1 49 ASP 49 68  68  ASP ASP A . n 
A 1 50 GLU 50 69  69  GLU GLU A . n 
A 1 51 LYS 51 70  70  LYS LYS A . n 
A 1 52 GLN 52 71  71  GLN GLN A . n 
A 1 53 GLN 53 72  72  GLN GLN A . n 
A 1 54 HIS 54 73  73  HIS HIS A . n 
A 1 55 ILE 55 74  74  ILE ILE A . n 
A 1 56 VAL 56 75  75  VAL VAL A . n 
A 1 57 TYR 57 76  76  TYR TYR A . n 
A 1 58 CYS 58 77  77  CYS CYS A . n 
A 1 59 SER 59 78  78  SER SER A . n 
A 1 60 ASN 60 79  79  ASN ASN A . n 
A 1 61 ASP 61 80  80  ASP ASP A . n 
A 1 62 LEU 62 81  81  LEU LEU A . n 
A 1 63 LEU 63 82  82  LEU LEU A . n 
A 1 64 GLY 64 83  83  GLY GLY A . n 
A 1 65 ASP 65 84  84  ASP ASP A . n 
A 1 66 LEU 66 85  85  LEU LEU A . n 
A 1 67 PHE 67 86  86  PHE PHE A . n 
A 1 68 GLY 68 87  87  GLY GLY A . n 
A 1 69 VAL 69 88  88  VAL VAL A . n 
A 1 70 PRO 70 89  89  PRO PRO A . n 
A 1 71 SER 71 90  90  SER SER A . n 
A 1 72 PHE 72 91  91  PHE PHE A . n 
A 1 73 SER 73 92  92  SER SER A . n 
A 1 74 VAL 74 93  93  VAL VAL A . n 
A 1 75 LYS 75 94  94  LYS LYS A . n 
A 1 76 GLU 76 95  95  GLU GLU A . n 
A 1 77 HIS 77 96  96  HIS HIS A . n 
A 1 78 ARG 78 97  97  ARG ARG A . n 
A 1 79 LYS 79 98  98  LYS LYS A . n 
A 1 80 ILE 80 99  99  ILE ILE A . n 
A 1 81 TYR 81 100 100 TYR TYR A . n 
A 1 82 THR 82 101 101 THR THR A . n 
A 1 83 MET 83 102 102 MET MET A . n 
A 1 84 ILE 84 103 103 ILE ILE A . n 
A 1 85 TYR 85 104 104 TYR TYR A . n 
A 1 86 ARG 86 105 105 ARG ARG A . n 
A 1 87 ASN 87 106 106 ASN ASN A . n 
A 1 88 LEU 88 107 107 LEU LEU A . n 
A 1 89 VAL 89 108 108 VAL VAL A . n 
A 1 90 VAL 90 109 109 VAL VAL A . n 
A 1 91 VAL 91 110 110 VAL VAL A . n 
A 1 92 ASN 92 111 111 ASN ASN A . n 
B 1 1  PRO 1  20  20  PRO PRO B . n 
B 1 2  ALA 2  21  21  ALA ALA B . n 
B 1 3  SER 3  22  22  SER SER B . n 
B 1 4  GLU 4  23  23  GLU GLU B . n 
B 1 5  GLN 5  24  24  GLN GLN B . n 
B 1 6  GLU 6  25  25  GLU GLU B . n 
B 1 7  THR 7  26  26  THR THR B . n 
B 1 8  LEU 8  27  27  LEU LEU B . n 
B 1 9  VAL 9  28  28  VAL VAL B . n 
B 1 10 ARG 10 29  29  ARG ARG B . n 
B 1 11 PRO 11 30  30  PRO PRO B . n 
B 1 12 LYS 12 31  31  LYS LYS B . n 
B 1 13 PRO 13 32  32  PRO PRO B . n 
B 1 14 LEU 14 33  33  LEU LEU B . n 
B 1 15 LEU 15 34  34  LEU LEU B . n 
B 1 16 LEU 16 35  35  LEU LEU B . n 
B 1 17 LYS 17 36  36  LYS LYS B . n 
B 1 18 LEU 18 37  37  LEU LEU B . n 
B 1 19 LEU 19 38  38  LEU LEU B . n 
B 1 20 LYS 20 39  39  LYS LYS B . n 
B 1 21 SER 21 40  40  SER SER B . n 
B 1 22 VAL 22 41  41  VAL VAL B . n 
B 1 23 GLY 23 42  42  GLY GLY B . n 
B 1 24 ALA 24 43  43  ALA ALA B . n 
B 1 25 GLN 25 44  44  GLN GLN B . n 
B 1 26 LYS 26 45  45  LYS LYS B . n 
B 1 27 ASP 27 46  46  ASP ASP B . n 
B 1 28 THR 28 47  47  THR THR B . n 
B 1 29 TYR 29 48  48  TYR TYR B . n 
B 1 30 THR 30 49  49  THR THR B . n 
B 1 31 MET 31 50  50  MET MET B . n 
B 1 32 LYS 32 51  51  LYS LYS B . n 
B 1 33 GLU 33 52  52  GLU GLU B . n 
B 1 34 VAL 34 53  53  VAL VAL B . n 
B 1 35 LEU 35 54  54  LEU LEU B . n 
B 1 36 PHE 36 55  55  PHE PHE B . n 
B 1 37 TYR 37 56  56  TYR TYR B . n 
B 1 38 LEU 38 57  57  LEU LEU B . n 
B 1 39 GLY 39 58  58  GLY GLY B . n 
B 1 40 GLN 40 59  59  GLN GLN B . n 
B 1 41 TYR 41 60  60  TYR TYR B . n 
B 1 42 ILE 42 61  61  ILE ILE B . n 
B 1 43 MET 43 62  62  MET MET B . n 
B 1 44 THR 44 63  63  THR THR B . n 
B 1 45 LYS 45 64  64  LYS LYS B . n 
B 1 46 ARG 46 65  65  ARG ARG B . n 
B 1 47 LEU 47 66  66  LEU LEU B . n 
B 1 48 TYR 48 67  67  TYR TYR B . n 
B 1 49 ASP 49 68  68  ASP ASP B . n 
B 1 50 GLU 50 69  69  GLU GLU B . n 
B 1 51 LYS 51 70  70  LYS LYS B . n 
B 1 52 GLN 52 71  71  GLN GLN B . n 
B 1 53 GLN 53 72  72  GLN GLN B . n 
B 1 54 HIS 54 73  73  HIS HIS B . n 
B 1 55 ILE 55 74  74  ILE ILE B . n 
B 1 56 VAL 56 75  75  VAL VAL B . n 
B 1 57 TYR 57 76  76  TYR TYR B . n 
B 1 58 CYS 58 77  77  CYS CYS B . n 
B 1 59 SER 59 78  78  SER SER B . n 
B 1 60 ASN 60 79  79  ASN ASN B . n 
B 1 61 ASP 61 80  80  ASP ASP B . n 
B 1 62 LEU 62 81  81  LEU LEU B . n 
B 1 63 LEU 63 82  82  LEU LEU B . n 
B 1 64 GLY 64 83  83  GLY GLY B . n 
B 1 65 ASP 65 84  84  ASP ASP B . n 
B 1 66 LEU 66 85  85  LEU LEU B . n 
B 1 67 PHE 67 86  86  PHE PHE B . n 
B 1 68 GLY 68 87  87  GLY GLY B . n 
B 1 69 VAL 69 88  88  VAL VAL B . n 
B 1 70 PRO 70 89  89  PRO PRO B . n 
B 1 71 SER 71 90  90  SER SER B . n 
B 1 72 PHE 72 91  91  PHE PHE B . n 
B 1 73 SER 73 92  92  SER SER B . n 
B 1 74 VAL 74 93  93  VAL VAL B . n 
B 1 75 LYS 75 94  94  LYS LYS B . n 
B 1 76 GLU 76 95  95  GLU GLU B . n 
B 1 77 HIS 77 96  96  HIS HIS B . n 
B 1 78 ARG 78 97  97  ARG ARG B . n 
B 1 79 LYS 79 98  98  LYS LYS B . n 
B 1 80 ILE 80 99  99  ILE ILE B . n 
B 1 81 TYR 81 100 100 TYR TYR B . n 
B 1 82 THR 82 101 101 THR THR B . n 
B 1 83 MET 83 102 102 MET MET B . n 
B 1 84 ILE 84 103 103 ILE ILE B . n 
B 1 85 TYR 85 104 104 TYR TYR B . n 
B 1 86 ARG 86 105 105 ARG ARG B . n 
B 1 87 ASN 87 106 106 ASN ASN B . n 
B 1 88 LEU 88 107 107 LEU LEU B . n 
B 1 89 VAL 89 108 108 VAL VAL B . n 
B 1 90 VAL 90 109 109 VAL VAL B . n 
B 1 91 VAL 91 110 110 VAL VAL B . n 
B 1 92 ASN 92 111 111 ASN ASN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NUT 1  201 203 NUT NUT A . 
D 3 SO4 1  202 1   SO4 SO4 A . 
E 4 CL  1  203 4   CL  CL  A . 
F 5 IOD 1  204 1   IOD IOD A . 
G 2 NUT 1  201 204 NUT NUT B . 
H 3 SO4 1  202 1   SO4 SO4 B . 
I 4 CL  1  203 5   CL  CL  B . 
J 5 IOD 1  204 2   IOD IOD B . 
K 5 IOD 1  205 3   IOD IOD B . 
L 5 IOD 1  206 4   IOD IOD B . 
M 6 HOH 1  301 68  HOH HOH A . 
M 6 HOH 2  302 162 HOH HOH A . 
M 6 HOH 3  303 29  HOH HOH A . 
M 6 HOH 4  304 150 HOH HOH A . 
M 6 HOH 5  305 120 HOH HOH A . 
M 6 HOH 6  306 67  HOH HOH A . 
M 6 HOH 7  307 92  HOH HOH A . 
M 6 HOH 8  308 17  HOH HOH A . 
M 6 HOH 9  309 93  HOH HOH A . 
M 6 HOH 10 310 139 HOH HOH A . 
M 6 HOH 11 311 100 HOH HOH A . 
M 6 HOH 12 312 57  HOH HOH A . 
M 6 HOH 13 313 9   HOH HOH A . 
M 6 HOH 14 314 14  HOH HOH A . 
M 6 HOH 15 315 76  HOH HOH A . 
M 6 HOH 16 316 8   HOH HOH A . 
M 6 HOH 17 317 1   HOH HOH A . 
M 6 HOH 18 318 22  HOH HOH A . 
M 6 HOH 19 319 36  HOH HOH A . 
M 6 HOH 20 320 50  HOH HOH A . 
M 6 HOH 21 321 66  HOH HOH A . 
M 6 HOH 22 322 45  HOH HOH A . 
M 6 HOH 23 323 21  HOH HOH A . 
M 6 HOH 24 324 96  HOH HOH A . 
M 6 HOH 25 325 18  HOH HOH A . 
M 6 HOH 26 326 44  HOH HOH A . 
M 6 HOH 27 327 80  HOH HOH A . 
M 6 HOH 28 328 127 HOH HOH A . 
M 6 HOH 29 329 101 HOH HOH A . 
M 6 HOH 30 330 115 HOH HOH A . 
M 6 HOH 31 331 75  HOH HOH A . 
M 6 HOH 32 332 37  HOH HOH A . 
M 6 HOH 33 333 38  HOH HOH A . 
M 6 HOH 34 334 84  HOH HOH A . 
M 6 HOH 35 335 97  HOH HOH A . 
M 6 HOH 36 336 131 HOH HOH A . 
M 6 HOH 37 337 6   HOH HOH A . 
M 6 HOH 38 338 78  HOH HOH A . 
M 6 HOH 39 339 88  HOH HOH A . 
M 6 HOH 40 340 164 HOH HOH A . 
M 6 HOH 41 341 4   HOH HOH A . 
M 6 HOH 42 342 70  HOH HOH A . 
M 6 HOH 43 343 140 HOH HOH A . 
M 6 HOH 44 344 163 HOH HOH A . 
M 6 HOH 45 345 114 HOH HOH A . 
M 6 HOH 46 346 154 HOH HOH A . 
M 6 HOH 47 347 109 HOH HOH A . 
M 6 HOH 48 348 13  HOH HOH A . 
M 6 HOH 49 349 125 HOH HOH A . 
M 6 HOH 50 350 24  HOH HOH A . 
M 6 HOH 51 351 43  HOH HOH A . 
M 6 HOH 52 352 59  HOH HOH A . 
M 6 HOH 53 353 27  HOH HOH A . 
M 6 HOH 54 354 103 HOH HOH A . 
M 6 HOH 55 355 28  HOH HOH A . 
M 6 HOH 56 356 106 HOH HOH A . 
M 6 HOH 57 357 105 HOH HOH A . 
M 6 HOH 58 358 11  HOH HOH A . 
M 6 HOH 59 359 124 HOH HOH A . 
M 6 HOH 60 360 111 HOH HOH A . 
M 6 HOH 61 361 112 HOH HOH A . 
M 6 HOH 62 362 52  HOH HOH A . 
M 6 HOH 63 363 171 HOH HOH A . 
M 6 HOH 64 364 104 HOH HOH A . 
M 6 HOH 65 365 107 HOH HOH A . 
M 6 HOH 66 366 26  HOH HOH A . 
M 6 HOH 67 367 129 HOH HOH A . 
M 6 HOH 68 368 130 HOH HOH A . 
M 6 HOH 69 369 136 HOH HOH A . 
M 6 HOH 70 370 147 HOH HOH A . 
M 6 HOH 71 371 160 HOH HOH A . 
M 6 HOH 72 372 128 HOH HOH A . 
M 6 HOH 73 373 145 HOH HOH A . 
M 6 HOH 74 374 35  HOH HOH A . 
M 6 HOH 75 375 151 HOH HOH A . 
M 6 HOH 76 376 165 HOH HOH A . 
M 6 HOH 77 377 172 HOH HOH A . 
M 6 HOH 78 378 146 HOH HOH A . 
M 6 HOH 79 379 63  HOH HOH A . 
M 6 HOH 80 380 31  HOH HOH A . 
M 6 HOH 81 381 71  HOH HOH A . 
M 6 HOH 82 382 133 HOH HOH A . 
M 6 HOH 83 383 60  HOH HOH A . 
M 6 HOH 84 384 148 HOH HOH A . 
M 6 HOH 85 385 170 HOH HOH A . 
M 6 HOH 86 386 113 HOH HOH A . 
M 6 HOH 87 387 86  HOH HOH A . 
N 6 HOH 1  301 126 HOH HOH B . 
N 6 HOH 2  302 16  HOH HOH B . 
N 6 HOH 3  303 74  HOH HOH B . 
N 6 HOH 4  304 168 HOH HOH B . 
N 6 HOH 5  305 119 HOH HOH B . 
N 6 HOH 6  306 62  HOH HOH B . 
N 6 HOH 7  307 33  HOH HOH B . 
N 6 HOH 8  308 85  HOH HOH B . 
N 6 HOH 9  309 49  HOH HOH B . 
N 6 HOH 10 310 40  HOH HOH B . 
N 6 HOH 11 311 12  HOH HOH B . 
N 6 HOH 12 312 110 HOH HOH B . 
N 6 HOH 13 313 91  HOH HOH B . 
N 6 HOH 14 314 7   HOH HOH B . 
N 6 HOH 15 315 42  HOH HOH B . 
N 6 HOH 16 316 19  HOH HOH B . 
N 6 HOH 17 317 118 HOH HOH B . 
N 6 HOH 18 318 3   HOH HOH B . 
N 6 HOH 19 319 157 HOH HOH B . 
N 6 HOH 20 320 51  HOH HOH B . 
N 6 HOH 21 321 95  HOH HOH B . 
N 6 HOH 22 322 30  HOH HOH B . 
N 6 HOH 23 323 72  HOH HOH B . 
N 6 HOH 24 324 61  HOH HOH B . 
N 6 HOH 25 325 169 HOH HOH B . 
N 6 HOH 26 326 47  HOH HOH B . 
N 6 HOH 27 327 20  HOH HOH B . 
N 6 HOH 28 328 123 HOH HOH B . 
N 6 HOH 29 329 79  HOH HOH B . 
N 6 HOH 30 330 46  HOH HOH B . 
N 6 HOH 31 331 99  HOH HOH B . 
N 6 HOH 32 332 98  HOH HOH B . 
N 6 HOH 33 333 90  HOH HOH B . 
N 6 HOH 34 334 132 HOH HOH B . 
N 6 HOH 35 335 81  HOH HOH B . 
N 6 HOH 36 336 83  HOH HOH B . 
N 6 HOH 37 337 77  HOH HOH B . 
N 6 HOH 38 338 69  HOH HOH B . 
N 6 HOH 39 339 5   HOH HOH B . 
N 6 HOH 40 340 73  HOH HOH B . 
N 6 HOH 41 341 159 HOH HOH B . 
N 6 HOH 42 342 2   HOH HOH B . 
N 6 HOH 43 343 161 HOH HOH B . 
N 6 HOH 44 344 116 HOH HOH B . 
N 6 HOH 45 345 108 HOH HOH B . 
N 6 HOH 46 346 64  HOH HOH B . 
N 6 HOH 47 347 23  HOH HOH B . 
N 6 HOH 48 348 155 HOH HOH B . 
N 6 HOH 49 349 122 HOH HOH B . 
N 6 HOH 50 350 15  HOH HOH B . 
N 6 HOH 51 351 25  HOH HOH B . 
N 6 HOH 52 352 55  HOH HOH B . 
N 6 HOH 53 353 48  HOH HOH B . 
N 6 HOH 54 354 39  HOH HOH B . 
N 6 HOH 55 355 153 HOH HOH B . 
N 6 HOH 56 356 54  HOH HOH B . 
N 6 HOH 57 357 144 HOH HOH B . 
N 6 HOH 58 358 53  HOH HOH B . 
N 6 HOH 59 359 143 HOH HOH B . 
N 6 HOH 60 360 102 HOH HOH B . 
N 6 HOH 61 361 152 HOH HOH B . 
N 6 HOH 62 362 158 HOH HOH B . 
N 6 HOH 63 363 89  HOH HOH B . 
N 6 HOH 64 364 10  HOH HOH B . 
N 6 HOH 65 365 32  HOH HOH B . 
N 6 HOH 66 366 135 HOH HOH B . 
N 6 HOH 67 367 137 HOH HOH B . 
N 6 HOH 68 368 94  HOH HOH B . 
N 6 HOH 69 369 142 HOH HOH B . 
N 6 HOH 70 370 141 HOH HOH B . 
N 6 HOH 71 371 82  HOH HOH B . 
N 6 HOH 72 372 149 HOH HOH B . 
N 6 HOH 73 373 138 HOH HOH B . 
N 6 HOH 74 374 41  HOH HOH B . 
N 6 HOH 75 375 56  HOH HOH B . 
N 6 HOH 76 376 117 HOH HOH B . 
N 6 HOH 77 377 34  HOH HOH B . 
N 6 HOH 78 378 156 HOH HOH B . 
N 6 HOH 79 379 65  HOH HOH B . 
N 6 HOH 80 380 167 HOH HOH B . 
N 6 HOH 81 381 58  HOH HOH B . 
N 6 HOH 82 382 166 HOH HOH B . 
N 6 HOH 83 383 121 HOH HOH B . 
N 6 HOH 84 384 87  HOH HOH B . 
N 6 HOH 85 385 134 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,M     
2 1 B,G,H,I,J,K,L,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2016-06-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        3 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? .        4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .        5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O B HOH 319 ? ? O B HOH 380 ? ? 2.05 
2 1 O B HOH 366 ? ? O B HOH 382 ? ? 2.06 
3 1 O B HOH 357 ? ? O B HOH 366 ? ? 2.08 
4 1 O A HOH 382 ? ? O A HOH 386 ? ? 2.12 
5 1 O B HOH 360 ? ? O B HOH 368 ? ? 2.14 
6 1 O A HOH 377 ? ? O A HOH 384 ? ? 2.15 
7 1 O A HOH 375 ? ? O A HOH 377 ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     362 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     380 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              2.11 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A GLU 52 ? ? CG A GLU 52 ? ? 1.397 1.517 -0.120 0.019 N 
2 1 CB B GLU 52 ? ? CG B GLU 52 ? ? 1.389 1.517 -0.128 0.019 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 71 ? ? -156.77 77.13 
2 1 ASN A 79 ? ? 53.13   9.00  
3 1 GLN B 71 ? ? -159.28 76.17 
4 1 ASN B 79 ? ? -89.27  30.38 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    ASN 
_pdbx_validate_chiral.auth_seq_id     79 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
FEBS                                               Switzerland ? 1 
'Lichtenberg program of the Volkswagen Foundation' Switzerland ? 2 
'Japan Society for the Promotion of Science'       ?           ? 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
'4-({(4S,5R)-4,5-bis(4-chlorophenyl)-2-[4-methoxy-2-(propan-2-yloxy)phenyl]-4,5-dihydro-1H-imidazol-1-yl}carbonyl)piperazin-2-one' 
NUT 
3 'SULFATE ION' SO4 
4 'CHLORIDE ION' CL  
5 'IODIDE ION' IOD 
6 water HOH 
#