data_5C5B
# 
_entry.id   5C5B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5C5B         
WWPDB D_1000210655 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5C5B 
_pdbx_database_status.recvd_initial_deposition_date   2015-06-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, Y.J.' 1 
'Chen, B.'   2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Crystal Structure of Human APPL BAR-PH Heterodimer' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, Y.J.' 1 
primary 'Chen, B.'   2 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   92.650 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5C5B 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     146.924 
_cell.length_a_esd                 ? 
_cell.length_b                     88.542 
_cell.length_b_esd                 ? 
_cell.length_c                     147.388 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5C5B 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DCC-interacting protein 13-alpha' 42966.359 2  ? ? 'BAR-PH domain, UNP residues 5-375' ? 
2 polymer     man 'DCC-interacting protein 13-beta'  42434.359 2  ? ? 'UNP residues 1-375'                ? 
3 non-polymer nat GLYCEROL                           92.094    3  ? ? ?                                   ? 
4 water       nat water                              18.015    23 ? ? ?                                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Dip13-alpha,Adapter protein containing PH domain,PTB domain and leucine zipper motif 1' 
2 'Dip13-beta,Adapter protein containing PH domain,PTB domain and leucine zipper motif 2'  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDE
VMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVK
YEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREM
DSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGG
LAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISK
;
;GSHMDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDE
VMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVK
YEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREM
DSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGG
LAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISK
;
A,C ? 
2 'polypeptide(L)' no no 
;MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSKQLLAYEKQNFALGKGDE
EVISTLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVK
TEVGKEVAAARRKQHLSSLQYYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVEL
EAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQPRGAVAGG
LIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESRKENEEWICAINNISR
;
;MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSKQLLAYEKQNFALGKGDE
EVISTLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVK
TEVGKEVAAARRKQHLSSLQYYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVEL
EAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQPRGAVAGG
LIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESRKENEEWICAINNISR
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ASP n 
1 6   LYS n 
1 7   LEU n 
1 8   PRO n 
1 9   ILE n 
1 10  GLU n 
1 11  GLU n 
1 12  THR n 
1 13  LEU n 
1 14  GLU n 
1 15  ASP n 
1 16  SER n 
1 17  PRO n 
1 18  GLN n 
1 19  THR n 
1 20  ARG n 
1 21  SER n 
1 22  LEU n 
1 23  LEU n 
1 24  GLY n 
1 25  VAL n 
1 26  PHE n 
1 27  GLU n 
1 28  GLU n 
1 29  ASP n 
1 30  ALA n 
1 31  THR n 
1 32  ALA n 
1 33  ILE n 
1 34  SER n 
1 35  ASN n 
1 36  TYR n 
1 37  MET n 
1 38  ASN n 
1 39  GLN n 
1 40  LEU n 
1 41  TYR n 
1 42  GLN n 
1 43  ALA n 
1 44  MET n 
1 45  HIS n 
1 46  ARG n 
1 47  ILE n 
1 48  TYR n 
1 49  ASP n 
1 50  ALA n 
1 51  GLN n 
1 52  ASN n 
1 53  GLU n 
1 54  LEU n 
1 55  SER n 
1 56  ALA n 
1 57  ALA n 
1 58  THR n 
1 59  HIS n 
1 60  LEU n 
1 61  THR n 
1 62  SER n 
1 63  LYS n 
1 64  LEU n 
1 65  LEU n 
1 66  LYS n 
1 67  GLU n 
1 68  TYR n 
1 69  GLU n 
1 70  LYS n 
1 71  GLN n 
1 72  ARG n 
1 73  PHE n 
1 74  PRO n 
1 75  LEU n 
1 76  GLY n 
1 77  GLY n 
1 78  ASP n 
1 79  ASP n 
1 80  GLU n 
1 81  VAL n 
1 82  MET n 
1 83  SER n 
1 84  SER n 
1 85  THR n 
1 86  LEU n 
1 87  GLN n 
1 88  GLN n 
1 89  PHE n 
1 90  SER n 
1 91  LYS n 
1 92  VAL n 
1 93  ILE n 
1 94  ASP n 
1 95  GLU n 
1 96  LEU n 
1 97  SER n 
1 98  SER n 
1 99  CYS n 
1 100 HIS n 
1 101 ALA n 
1 102 VAL n 
1 103 LEU n 
1 104 SER n 
1 105 THR n 
1 106 GLN n 
1 107 LEU n 
1 108 ALA n 
1 109 ASP n 
1 110 ALA n 
1 111 MET n 
1 112 MET n 
1 113 PHE n 
1 114 PRO n 
1 115 ILE n 
1 116 THR n 
1 117 GLN n 
1 118 PHE n 
1 119 LYS n 
1 120 GLU n 
1 121 ARG n 
1 122 ASP n 
1 123 LEU n 
1 124 LYS n 
1 125 GLU n 
1 126 ILE n 
1 127 LEU n 
1 128 THR n 
1 129 LEU n 
1 130 LYS n 
1 131 GLU n 
1 132 VAL n 
1 133 PHE n 
1 134 GLN n 
1 135 ILE n 
1 136 ALA n 
1 137 SER n 
1 138 ASN n 
1 139 ASP n 
1 140 HIS n 
1 141 ASP n 
1 142 ALA n 
1 143 ALA n 
1 144 ILE n 
1 145 ASN n 
1 146 ARG n 
1 147 TYR n 
1 148 SER n 
1 149 ARG n 
1 150 LEU n 
1 151 SER n 
1 152 LYS n 
1 153 LYS n 
1 154 ARG n 
1 155 GLU n 
1 156 ASN n 
1 157 ASP n 
1 158 LYS n 
1 159 VAL n 
1 160 LYS n 
1 161 TYR n 
1 162 GLU n 
1 163 VAL n 
1 164 THR n 
1 165 GLU n 
1 166 ASP n 
1 167 VAL n 
1 168 TYR n 
1 169 THR n 
1 170 SER n 
1 171 ARG n 
1 172 LYS n 
1 173 LYS n 
1 174 GLN n 
1 175 HIS n 
1 176 GLN n 
1 177 THR n 
1 178 MET n 
1 179 MET n 
1 180 HIS n 
1 181 TYR n 
1 182 PHE n 
1 183 CYS n 
1 184 ALA n 
1 185 LEU n 
1 186 ASN n 
1 187 THR n 
1 188 LEU n 
1 189 GLN n 
1 190 TYR n 
1 191 LYS n 
1 192 LYS n 
1 193 LYS n 
1 194 ILE n 
1 195 ALA n 
1 196 LEU n 
1 197 LEU n 
1 198 GLU n 
1 199 PRO n 
1 200 LEU n 
1 201 LEU n 
1 202 GLY n 
1 203 TYR n 
1 204 MET n 
1 205 GLN n 
1 206 ALA n 
1 207 GLN n 
1 208 ILE n 
1 209 SER n 
1 210 PHE n 
1 211 PHE n 
1 212 LYS n 
1 213 MET n 
1 214 GLY n 
1 215 SER n 
1 216 GLU n 
1 217 ASN n 
1 218 LEU n 
1 219 ASN n 
1 220 GLU n 
1 221 GLN n 
1 222 LEU n 
1 223 GLU n 
1 224 GLU n 
1 225 PHE n 
1 226 LEU n 
1 227 ALA n 
1 228 ASN n 
1 229 ILE n 
1 230 GLY n 
1 231 THR n 
1 232 SER n 
1 233 VAL n 
1 234 GLN n 
1 235 ASN n 
1 236 VAL n 
1 237 ARG n 
1 238 ARG n 
1 239 GLU n 
1 240 MET n 
1 241 ASP n 
1 242 SER n 
1 243 ASP n 
1 244 ILE n 
1 245 GLU n 
1 246 THR n 
1 247 MET n 
1 248 GLN n 
1 249 GLN n 
1 250 THR n 
1 251 ILE n 
1 252 GLU n 
1 253 ASP n 
1 254 LEU n 
1 255 GLU n 
1 256 VAL n 
1 257 ALA n 
1 258 SER n 
1 259 ASP n 
1 260 PRO n 
1 261 LEU n 
1 262 TYR n 
1 263 VAL n 
1 264 PRO n 
1 265 ASP n 
1 266 PRO n 
1 267 ASP n 
1 268 PRO n 
1 269 THR n 
1 270 LYS n 
1 271 PHE n 
1 272 PRO n 
1 273 VAL n 
1 274 ASN n 
1 275 ARG n 
1 276 ASN n 
1 277 LEU n 
1 278 THR n 
1 279 ARG n 
1 280 LYS n 
1 281 ALA n 
1 282 GLY n 
1 283 TYR n 
1 284 LEU n 
1 285 ASN n 
1 286 ALA n 
1 287 ARG n 
1 288 ASN n 
1 289 LYS n 
1 290 THR n 
1 291 GLY n 
1 292 LEU n 
1 293 VAL n 
1 294 SER n 
1 295 SER n 
1 296 THR n 
1 297 TRP n 
1 298 ASP n 
1 299 ARG n 
1 300 GLN n 
1 301 PHE n 
1 302 TYR n 
1 303 PHE n 
1 304 THR n 
1 305 GLN n 
1 306 GLY n 
1 307 GLY n 
1 308 ASN n 
1 309 LEU n 
1 310 MET n 
1 311 SER n 
1 312 GLN n 
1 313 ALA n 
1 314 ARG n 
1 315 GLY n 
1 316 ASP n 
1 317 VAL n 
1 318 ALA n 
1 319 GLY n 
1 320 GLY n 
1 321 LEU n 
1 322 ALA n 
1 323 MET n 
1 324 ASP n 
1 325 ILE n 
1 326 ASP n 
1 327 ASN n 
1 328 CYS n 
1 329 SER n 
1 330 VAL n 
1 331 MET n 
1 332 ALA n 
1 333 VAL n 
1 334 ASP n 
1 335 CYS n 
1 336 GLU n 
1 337 ASP n 
1 338 ARG n 
1 339 ARG n 
1 340 TYR n 
1 341 CYS n 
1 342 PHE n 
1 343 GLN n 
1 344 ILE n 
1 345 THR n 
1 346 SER n 
1 347 PHE n 
1 348 ASP n 
1 349 GLY n 
1 350 LYS n 
1 351 LYS n 
1 352 SER n 
1 353 SER n 
1 354 ILE n 
1 355 LEU n 
1 356 GLN n 
1 357 ALA n 
1 358 GLU n 
1 359 SER n 
1 360 LYS n 
1 361 LYS n 
1 362 ASP n 
1 363 HIS n 
1 364 GLU n 
1 365 GLU n 
1 366 TRP n 
1 367 ILE n 
1 368 CYS n 
1 369 THR n 
1 370 ILE n 
1 371 ASN n 
1 372 ASN n 
1 373 ILE n 
1 374 SER n 
1 375 LYS n 
2 1   MET n 
2 2   PRO n 
2 3   ALA n 
2 4   VAL n 
2 5   ASP n 
2 6   LYS n 
2 7   LEU n 
2 8   LEU n 
2 9   LEU n 
2 10  GLU n 
2 11  GLU n 
2 12  ALA n 
2 13  LEU n 
2 14  GLN n 
2 15  ASP n 
2 16  SER n 
2 17  PRO n 
2 18  GLN n 
2 19  THR n 
2 20  ARG n 
2 21  SER n 
2 22  LEU n 
2 23  LEU n 
2 24  SER n 
2 25  VAL n 
2 26  PHE n 
2 27  GLU n 
2 28  GLU n 
2 29  ASP n 
2 30  ALA n 
2 31  GLY n 
2 32  THR n 
2 33  LEU n 
2 34  THR n 
2 35  ASP n 
2 36  TYR n 
2 37  THR n 
2 38  ASN n 
2 39  GLN n 
2 40  LEU n 
2 41  LEU n 
2 42  GLN n 
2 43  ALA n 
2 44  MET n 
2 45  GLN n 
2 46  ARG n 
2 47  VAL n 
2 48  TYR n 
2 49  GLY n 
2 50  ALA n 
2 51  GLN n 
2 52  ASN n 
2 53  GLU n 
2 54  MET n 
2 55  CYS n 
2 56  LEU n 
2 57  ALA n 
2 58  THR n 
2 59  GLN n 
2 60  GLN n 
2 61  LEU n 
2 62  SER n 
2 63  LYS n 
2 64  GLN n 
2 65  LEU n 
2 66  LEU n 
2 67  ALA n 
2 68  TYR n 
2 69  GLU n 
2 70  LYS n 
2 71  GLN n 
2 72  ASN n 
2 73  PHE n 
2 74  ALA n 
2 75  LEU n 
2 76  GLY n 
2 77  LYS n 
2 78  GLY n 
2 79  ASP n 
2 80  GLU n 
2 81  GLU n 
2 82  VAL n 
2 83  ILE n 
2 84  SER n 
2 85  THR n 
2 86  LEU n 
2 87  HIS n 
2 88  TYR n 
2 89  PHE n 
2 90  SER n 
2 91  LYS n 
2 92  VAL n 
2 93  VAL n 
2 94  ASP n 
2 95  GLU n 
2 96  LEU n 
2 97  ASN n 
2 98  LEU n 
2 99  LEU n 
2 100 HIS n 
2 101 THR n 
2 102 GLU n 
2 103 LEU n 
2 104 ALA n 
2 105 LYS n 
2 106 GLN n 
2 107 LEU n 
2 108 ALA n 
2 109 ASP n 
2 110 THR n 
2 111 MET n 
2 112 VAL n 
2 113 LEU n 
2 114 PRO n 
2 115 ILE n 
2 116 ILE n 
2 117 GLN n 
2 118 PHE n 
2 119 ARG n 
2 120 GLU n 
2 121 LYS n 
2 122 ASP n 
2 123 LEU n 
2 124 THR n 
2 125 GLU n 
2 126 VAL n 
2 127 SER n 
2 128 THR n 
2 129 LEU n 
2 130 LYS n 
2 131 ASP n 
2 132 LEU n 
2 133 PHE n 
2 134 GLY n 
2 135 LEU n 
2 136 ALA n 
2 137 SER n 
2 138 ASN n 
2 139 GLU n 
2 140 HIS n 
2 141 ASP n 
2 142 LEU n 
2 143 SER n 
2 144 MET n 
2 145 ALA n 
2 146 LYS n 
2 147 TYR n 
2 148 SER n 
2 149 ARG n 
2 150 LEU n 
2 151 PRO n 
2 152 LYS n 
2 153 LYS n 
2 154 LYS n 
2 155 GLU n 
2 156 ASN n 
2 157 GLU n 
2 158 LYS n 
2 159 VAL n 
2 160 LYS n 
2 161 THR n 
2 162 GLU n 
2 163 VAL n 
2 164 GLY n 
2 165 LYS n 
2 166 GLU n 
2 167 VAL n 
2 168 ALA n 
2 169 ALA n 
2 170 ALA n 
2 171 ARG n 
2 172 ARG n 
2 173 LYS n 
2 174 GLN n 
2 175 HIS n 
2 176 LEU n 
2 177 SER n 
2 178 SER n 
2 179 LEU n 
2 180 GLN n 
2 181 TYR n 
2 182 TYR n 
2 183 CYS n 
2 184 ALA n 
2 185 LEU n 
2 186 ASN n 
2 187 ALA n 
2 188 LEU n 
2 189 GLN n 
2 190 TYR n 
2 191 ARG n 
2 192 LYS n 
2 193 GLN n 
2 194 MET n 
2 195 ALA n 
2 196 MET n 
2 197 MET n 
2 198 GLU n 
2 199 PRO n 
2 200 MET n 
2 201 ILE n 
2 202 GLY n 
2 203 PHE n 
2 204 ALA n 
2 205 HIS n 
2 206 GLY n 
2 207 GLN n 
2 208 ILE n 
2 209 ASN n 
2 210 PHE n 
2 211 PHE n 
2 212 LYS n 
2 213 LYS n 
2 214 GLY n 
2 215 ALA n 
2 216 GLU n 
2 217 MET n 
2 218 PHE n 
2 219 SER n 
2 220 LYS n 
2 221 ARG n 
2 222 MET n 
2 223 ASP n 
2 224 SER n 
2 225 PHE n 
2 226 LEU n 
2 227 SER n 
2 228 SER n 
2 229 VAL n 
2 230 ALA n 
2 231 ASP n 
2 232 MET n 
2 233 VAL n 
2 234 GLN n 
2 235 SER n 
2 236 ILE n 
2 237 GLN n 
2 238 VAL n 
2 239 GLU n 
2 240 LEU n 
2 241 GLU n 
2 242 ALA n 
2 243 GLU n 
2 244 ALA n 
2 245 GLU n 
2 246 LYS n 
2 247 MET n 
2 248 ARG n 
2 249 VAL n 
2 250 SER n 
2 251 GLN n 
2 252 GLN n 
2 253 GLU n 
2 254 LEU n 
2 255 LEU n 
2 256 SER n 
2 257 VAL n 
2 258 ASP n 
2 259 GLU n 
2 260 SER n 
2 261 VAL n 
2 262 TYR n 
2 263 THR n 
2 264 PRO n 
2 265 ASP n 
2 266 SER n 
2 267 ASP n 
2 268 VAL n 
2 269 ALA n 
2 270 ALA n 
2 271 PRO n 
2 272 GLN n 
2 273 ILE n 
2 274 ASN n 
2 275 ARG n 
2 276 ASN n 
2 277 LEU n 
2 278 ILE n 
2 279 GLN n 
2 280 LYS n 
2 281 ALA n 
2 282 GLY n 
2 283 TYR n 
2 284 LEU n 
2 285 ASN n 
2 286 LEU n 
2 287 ARG n 
2 288 ASN n 
2 289 LYS n 
2 290 THR n 
2 291 GLY n 
2 292 LEU n 
2 293 VAL n 
2 294 THR n 
2 295 THR n 
2 296 THR n 
2 297 TRP n 
2 298 GLU n 
2 299 ARG n 
2 300 LEU n 
2 301 TYR n 
2 302 PHE n 
2 303 PHE n 
2 304 THR n 
2 305 GLN n 
2 306 GLY n 
2 307 GLY n 
2 308 ASN n 
2 309 LEU n 
2 310 MET n 
2 311 CYS n 
2 312 GLN n 
2 313 PRO n 
2 314 ARG n 
2 315 GLY n 
2 316 ALA n 
2 317 VAL n 
2 318 ALA n 
2 319 GLY n 
2 320 GLY n 
2 321 LEU n 
2 322 ILE n 
2 323 GLN n 
2 324 ASP n 
2 325 LEU n 
2 326 ASP n 
2 327 ASN n 
2 328 CYS n 
2 329 SER n 
2 330 VAL n 
2 331 MET n 
2 332 ALA n 
2 333 VAL n 
2 334 ASP n 
2 335 CYS n 
2 336 GLU n 
2 337 ASP n 
2 338 ARG n 
2 339 ARG n 
2 340 TYR n 
2 341 CYS n 
2 342 PHE n 
2 343 GLN n 
2 344 ILE n 
2 345 THR n 
2 346 THR n 
2 347 PRO n 
2 348 ASN n 
2 349 GLY n 
2 350 LYS n 
2 351 SER n 
2 352 GLY n 
2 353 ILE n 
2 354 ILE n 
2 355 LEU n 
2 356 GLN n 
2 357 ALA n 
2 358 GLU n 
2 359 SER n 
2 360 ARG n 
2 361 LYS n 
2 362 GLU n 
2 363 ASN n 
2 364 GLU n 
2 365 GLU n 
2 366 TRP n 
2 367 ILE n 
2 368 CYS n 
2 369 ALA n 
2 370 ILE n 
2 371 ASN n 
2 372 ASN n 
2 373 ILE n 
2 374 SER n 
2 375 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 375 Human ? 'APPL1, APPL, DIP13A, KIAA1428' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET21a ? ? 
2 1 sample 'Biological sequence' 1 375 Human ? 'APPL2, DIP13B'                 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28a ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DP13A_HUMAN Q9UKG1 ? 1 
;DKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDEVMSS
TLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVT
EDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDI
ETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMD
IDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISK
;
5 
2 UNP DP13B_HUMAN Q8NEU8 ? 2 
;MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSKQLLAYEKQNFALGKGDE
EVISTLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVK
TEVGKEVAAARRKQHLSSLQYYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVEL
EAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQPRGAVAGG
LIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESRKENEEWICAINNISR
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5C5B A 5 ? 375 ? Q9UKG1 5 ? 375 ? 5 375 
2 2 5C5B B 1 ? 375 ? Q8NEU8 1 ? 375 ? 1 375 
3 1 5C5B C 5 ? 375 ? Q9UKG1 5 ? 375 ? 5 375 
4 2 5C5B D 1 ? 375 ? Q8NEU8 1 ? 375 ? 1 375 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5C5B GLY A 1 ? UNP Q9UKG1 ? ? 'expression tag' 1 1 
1 5C5B SER A 2 ? UNP Q9UKG1 ? ? 'expression tag' 2 2 
1 5C5B HIS A 3 ? UNP Q9UKG1 ? ? 'expression tag' 3 3 
1 5C5B MET A 4 ? UNP Q9UKG1 ? ? 'expression tag' 4 4 
3 5C5B GLY C 1 ? UNP Q9UKG1 ? ? 'expression tag' 1 5 
3 5C5B SER C 2 ? UNP Q9UKG1 ? ? 'expression tag' 2 6 
3 5C5B HIS C 3 ? UNP Q9UKG1 ? ? 'expression tag' 3 7 
3 5C5B MET C 4 ? UNP Q9UKG1 ? ? 'expression tag' 4 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5C5B 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.80 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.13 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M disodium hydrogen phosphate, 18% (w/v) PEG3350, 100 mM HEPES, and 1 mM DTT' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-225' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2009-12-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9791 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9791 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5C5B 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       46308 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.8 
_reflns.pdbx_Rmerge_I_obs                0.112 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.89 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.72 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        90.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                166.140 
_refine.B_iso_mean                               68.2411 
_refine.B_iso_min                                21.880 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5C5B 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.9000 
_refine.ls_d_res_low                             49.0770 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     41553 
_refine.ls_number_reflns_R_free                  2155 
_refine.ls_number_reflns_R_work                  39398 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.5600 
_refine.ls_percent_reflns_R_free                 5.1900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2135 
_refine.ls_R_factor_R_free                       0.2682 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2104 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.0000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.7000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 33.4900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4000 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.9000 
_refine_hist.d_res_low                        49.0770 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             23 
_refine_hist.number_atoms_total               11349 
_refine_hist.pdbx_number_residues_total       1457 
_refine_hist.pdbx_B_iso_mean_ligand           85.76 
_refine_hist.pdbx_B_iso_mean_solvent          48.21 
_refine_hist.pdbx_number_atoms_protein        11308 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  ? 11494 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.971  ? 15537 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.038  ? 1775  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 2030  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 15.402 ? 4236  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 3172 5.837 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 TORSIONAL C 3172 5.837 ? ? ? ? ? 
3 'X-RAY DIFFRACTION' 2 1 TORSIONAL B 3243 5.837 ? ? ? ? ? 
4 'X-RAY DIFFRACTION' 2 2 TORSIONAL D 3243 5.837 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9000 2.9675  2717 . 145 2572 96.0000  . . . 0.3449 . 0.2951 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 2.9675 3.0417  2774 . 156 2618 99.0000  . . . 0.3596 . 0.2946 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.0417 3.1239  2732 . 156 2576 99.0000  . . . 0.3478 . 0.2821 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.1239 3.2158  2769 . 161 2608 99.0000  . . . 0.3826 . 0.2610 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.2158 3.3196  2766 . 145 2621 99.0000  . . . 0.3541 . 0.2556 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.3196 3.4382  2794 . 125 2669 99.0000  . . . 0.3106 . 0.2448 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.4382 3.5758  2784 . 140 2644 99.0000  . . . 0.2956 . 0.2364 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.5758 3.7385  2775 . 141 2634 99.0000  . . . 0.2890 . 0.2218 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.7385 3.9355  2757 . 129 2628 99.0000  . . . 0.3153 . 0.2098 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.9355 4.1820  2773 . 138 2635 99.0000  . . . 0.2466 . 0.1977 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 4.1820 4.5047  2785 . 151 2634 99.0000  . . . 0.2433 . 0.1812 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 4.5047 4.9576  2769 . 132 2637 99.0000  . . . 0.2382 . 0.1786 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 4.9576 5.6741  2796 . 151 2645 99.0000  . . . 0.2365 . 0.1894 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 5.6741 7.1452  2829 . 143 2686 100.0000 . . . 0.2416 . 0.2070 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 7.1452 49.0837 2733 . 142 2591 94.0000  . . . 0.1786 . 0.1608 . . . . . . 15 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 'chain A' 
1 2 'chain C' 
2 1 'chain B' 
2 2 'chain D' 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 4 A 375 'chain A' ? ? ? ? ? ? ? ? 
1 2 1 ? C 4 C 375 'chain C' ? ? ? ? ? ? ? ? 
2 1 1 ? B 5 B 374 'chain B' ? ? ? ? ? ? ? ? 
2 2 1 ? D 5 D 375 'chain D' ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                     5C5B 
_struct.title                        'Crystal Structure of Human APPL BAR-PH Heterodimer' 
_struct.pdbx_descriptor              'DCC-interacting protein 13-alpha, DCC-interacting protein 13-beta' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5C5B 
_struct_keywords.text            'heterodimer, PROTEIN TRANSPORT' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 8   ? THR A 12  ? PRO A 8   THR A 12  5 ? 5  
HELX_P HELX_P2  AA2 SER A 16  ? GLU A 69  ? SER A 16  GLU A 69  1 ? 54 
HELX_P HELX_P3  AA3 VAL A 81  ? MET A 111 ? VAL A 81  MET A 111 1 ? 31 
HELX_P HELX_P4  AA4 MET A 111 ? ARG A 121 ? MET A 111 ARG A 121 1 ? 11 
HELX_P HELX_P5  AA5 ARG A 121 ? ARG A 149 ? ARG A 121 ARG A 149 1 ? 29 
HELX_P HELX_P6  AA6 ASN A 156 ? ASN A 217 ? ASN A 156 ASN A 217 1 ? 62 
HELX_P HELX_P7  AA7 ASN A 217 ? SER A 258 ? ASN A 217 SER A 258 1 ? 42 
HELX_P HELX_P8  AA8 SER A 359 ? SER A 374 ? SER A 359 SER A 374 1 ? 16 
HELX_P HELX_P9  AA9 LEU B 8   ? ALA B 12  ? LEU B 8   ALA B 12  5 ? 5  
HELX_P HELX_P10 AB1 SER B 16  ? GLN B 71  ? SER B 16  GLN B 71  1 ? 56 
HELX_P HELX_P11 AB2 ASP B 79  ? MET B 111 ? ASP B 79  MET B 111 1 ? 33 
HELX_P HELX_P12 AB3 MET B 111 ? ARG B 149 ? MET B 111 ARG B 149 1 ? 39 
HELX_P HELX_P13 AB4 ASN B 156 ? PHE B 218 ? ASN B 156 PHE B 218 1 ? 63 
HELX_P HELX_P14 AB5 SER B 219 ? LEU B 255 ? SER B 219 LEU B 255 1 ? 37 
HELX_P HELX_P15 AB6 ASP B 258 ? TYR B 262 ? ASP B 258 TYR B 262 5 ? 5  
HELX_P HELX_P16 AB7 ASP B 265 ? ALA B 270 ? ASP B 265 ALA B 270 5 ? 6  
HELX_P HELX_P17 AB8 SER B 359 ? SER B 374 ? SER B 359 SER B 374 1 ? 16 
HELX_P HELX_P18 AB9 PRO C 8   ? THR C 12  ? PRO C 8   THR C 12  5 ? 5  
HELX_P HELX_P19 AC1 SER C 16  ? GLN C 71  ? SER C 16  GLN C 71  1 ? 56 
HELX_P HELX_P20 AC2 VAL C 81  ? MET C 111 ? VAL C 81  MET C 111 1 ? 31 
HELX_P HELX_P21 AC3 MET C 111 ? ARG C 121 ? MET C 111 ARG C 121 1 ? 11 
HELX_P HELX_P22 AC4 ARG C 121 ? ARG C 149 ? ARG C 121 ARG C 149 1 ? 29 
HELX_P HELX_P23 AC5 ASN C 156 ? GLU C 216 ? ASN C 156 GLU C 216 1 ? 61 
HELX_P HELX_P24 AC6 ASN C 217 ? SER C 258 ? ASN C 217 SER C 258 1 ? 42 
HELX_P HELX_P25 AC7 SER C 359 ? SER C 374 ? SER C 359 SER C 374 1 ? 16 
HELX_P HELX_P26 AC8 LEU D 8   ? ALA D 12  ? LEU D 8   ALA D 12  5 ? 5  
HELX_P HELX_P27 AC9 SER D 16  ? GLN D 71  ? SER D 16  GLN D 71  1 ? 56 
HELX_P HELX_P28 AD1 ASP D 79  ? MET D 111 ? ASP D 79  MET D 111 1 ? 33 
HELX_P HELX_P29 AD2 MET D 111 ? ARG D 149 ? MET D 111 ARG D 149 1 ? 39 
HELX_P HELX_P30 AD3 ASN D 156 ? PHE D 218 ? ASN D 156 PHE D 218 1 ? 63 
HELX_P HELX_P31 AD4 SER D 219 ? LEU D 255 ? SER D 219 LEU D 255 1 ? 37 
HELX_P HELX_P32 AD5 ASP D 258 ? TYR D 262 ? ASP D 258 TYR D 262 5 ? 5  
HELX_P HELX_P33 AD6 ASP D 265 ? ALA D 270 ? ASP D 265 ALA D 270 5 ? 6  
HELX_P HELX_P34 AD7 SER D 359 ? ARG D 375 ? SER D 359 ARG D 375 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 7 ? 
AA3 ? 7 ? 
AA4 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 320 ? ASP A 324 ? GLY A 320 ASP A 324 
AA1 2 ASN A 308 ? GLN A 312 ? ASN A 308 GLN A 312 
AA1 3 THR A 296 ? GLN A 305 ? THR A 296 GLN A 305 
AA1 4 ALA A 281 ? ASN A 288 ? ALA A 281 ASN A 288 
AA1 5 ILE A 354 ? GLN A 356 ? ILE A 354 GLN A 356 
AA1 6 CYS A 341 ? SER A 346 ? CYS A 341 SER A 346 
AA1 7 CYS A 328 ? ALA A 332 ? CYS A 328 ALA A 332 
AA2 1 GLY B 320 ? ASP B 324 ? GLY B 320 ASP B 324 
AA2 2 ASN B 308 ? GLN B 312 ? ASN B 308 GLN B 312 
AA2 3 THR B 296 ? GLN B 305 ? THR B 296 GLN B 305 
AA2 4 ALA B 281 ? ASN B 288 ? ALA B 281 ASN B 288 
AA2 5 SER B 351 ? GLN B 356 ? SER B 351 GLN B 356 
AA2 6 CYS B 341 ? THR B 345 ? CYS B 341 THR B 345 
AA2 7 SER B 329 ? VAL B 333 ? SER B 329 VAL B 333 
AA3 1 GLY C 320 ? ASP C 324 ? GLY C 320 ASP C 324 
AA3 2 ASN C 308 ? GLN C 312 ? ASN C 308 GLN C 312 
AA3 3 TRP C 297 ? GLN C 305 ? TRP C 297 GLN C 305 
AA3 4 ALA C 281 ? ARG C 287 ? ALA C 281 ARG C 287 
AA3 5 LEU C 355 ? GLN C 356 ? LEU C 355 GLN C 356 
AA3 6 CYS C 341 ? SER C 346 ? CYS C 341 SER C 346 
AA3 7 CYS C 328 ? ALA C 332 ? CYS C 328 ALA C 332 
AA4 1 GLY D 320 ? ASP D 324 ? GLY D 320 ASP D 324 
AA4 2 ASN D 308 ? GLN D 312 ? ASN D 308 GLN D 312 
AA4 3 THR D 295 ? GLN D 305 ? THR D 295 GLN D 305 
AA4 4 ALA D 281 ? LYS D 289 ? ALA D 281 LYS D 289 
AA4 5 SER D 351 ? GLN D 356 ? SER D 351 GLN D 356 
AA4 6 ARG D 338 ? THR D 345 ? ARG D 338 THR D 345 
AA4 7 SER D 329 ? CYS D 335 ? SER D 329 CYS D 335 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O MET A 323 ? O MET A 323 N LEU A 309 ? N LEU A 309 
AA1 2 3 O GLN A 312 ? O GLN A 312 N PHE A 301 ? N PHE A 301 
AA1 3 4 O TYR A 302 ? O TYR A 302 N GLY A 282 ? N GLY A 282 
AA1 4 5 N ASN A 285 ? N ASN A 285 O GLN A 356 ? O GLN A 356 
AA1 5 6 O LEU A 355 ? O LEU A 355 N PHE A 342 ? N PHE A 342 
AA1 6 7 O THR A 345 ? O THR A 345 N SER A 329 ? N SER A 329 
AA2 1 2 O GLY B 320 ? O GLY B 320 N CYS B 311 ? N CYS B 311 
AA2 2 3 O MET B 310 ? O MET B 310 N PHE B 303 ? N PHE B 303 
AA2 3 4 O THR B 296 ? O THR B 296 N ASN B 288 ? N ASN B 288 
AA2 4 5 N ARG B 287 ? N ARG B 287 O ILE B 354 ? O ILE B 354 
AA2 5 6 O LEU B 355 ? O LEU B 355 N PHE B 342 ? N PHE B 342 
AA2 6 7 O GLN B 343 ? O GLN B 343 N MET B 331 ? N MET B 331 
AA3 1 2 O MET C 323 ? O MET C 323 N LEU C 309 ? N LEU C 309 
AA3 2 3 O MET C 310 ? O MET C 310 N PHE C 303 ? N PHE C 303 
AA3 3 4 O TYR C 302 ? O TYR C 302 N GLY C 282 ? N GLY C 282 
AA3 4 5 N ASN C 285 ? N ASN C 285 O GLN C 356 ? O GLN C 356 
AA3 5 6 O LEU C 355 ? O LEU C 355 N PHE C 342 ? N PHE C 342 
AA3 6 7 O THR C 345 ? O THR C 345 N SER C 329 ? N SER C 329 
AA4 1 2 O GLY D 320 ? O GLY D 320 N CYS D 311 ? N CYS D 311 
AA4 2 3 O ASN D 308 ? O ASN D 308 N GLN D 305 ? N GLN D 305 
AA4 3 4 O GLU D 298 ? O GLU D 298 N LEU D 286 ? N LEU D 286 
AA4 4 5 N ARG D 287 ? N ARG D 287 O ILE D 354 ? O ILE D 354 
AA4 5 6 O LEU D 355 ? O LEU D 355 N PHE D 342 ? N PHE D 342 
AA4 6 7 O GLN D 343 ? O GLN D 343 N MET D 331 ? N MET D 331 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GOL 401 ? 3 'binding site for residue GOL A 401' 
AC2 Software B GOL 401 ? 3 'binding site for residue GOL B 401' 
AC3 Software D GOL 401 ? 4 'binding site for residue GOL D 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ARG A 154 ? ARG A 154 . ? 1_555 ? 
2  AC1 3 TYR C 41  ? TYR C 41  . ? 4_546 ? 
3  AC1 3 HIS C 45  ? HIS C 45  . ? 4_546 ? 
4  AC2 3 HIS A 59  ? HIS A 59  . ? 4_545 ? 
5  AC2 3 LYS A 63  ? LYS A 63  . ? 4_545 ? 
6  AC2 3 ARG B 149 ? ARG B 149 . ? 1_555 ? 
7  AC3 4 HIS C 59  ? HIS C 59  . ? 4_545 ? 
8  AC3 4 LYS C 63  ? LYS C 63  . ? 4_545 ? 
9  AC3 4 LYS D 146 ? LYS D 146 . ? 1_555 ? 
10 AC3 4 ARG D 149 ? ARG D 149 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5C5B 
_atom_sites.fract_transf_matrix[1][1]   0.006806 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000315 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011294 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006792 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 4   ? -0.378  -37.878 63.092  1.00 82.71  ? 4   MET A N   1 
ATOM   2     C CA  . MET A 1 4   ? 0.913   -37.488 63.646  1.00 88.73  ? 4   MET A CA  1 
ATOM   3     C C   . MET A 1 4   ? 0.935   -37.630 65.164  1.00 79.03  ? 4   MET A C   1 
ATOM   4     O O   . MET A 1 4   ? 0.130   -37.015 65.864  1.00 76.40  ? 4   MET A O   1 
ATOM   5     C CB  . MET A 1 4   ? 1.251   -36.049 63.250  1.00 72.71  ? 4   MET A CB  1 
ATOM   6     N N   . ASP A 1 5   ? 1.855   -38.445 65.669  1.00 88.61  ? 5   ASP A N   1 
ATOM   7     C CA  . ASP A 1 5   ? 2.034   -38.588 67.109  1.00 82.28  ? 5   ASP A CA  1 
ATOM   8     C C   . ASP A 1 5   ? 3.281   -37.826 67.542  1.00 76.46  ? 5   ASP A C   1 
ATOM   9     O O   . ASP A 1 5   ? 4.002   -37.288 66.702  1.00 70.25  ? 5   ASP A O   1 
ATOM   10    C CB  . ASP A 1 5   ? 2.142   -40.064 67.499  1.00 60.33  ? 5   ASP A CB  1 
ATOM   11    N N   . LYS A 1 6   ? 3.540   -37.775 68.845  1.00 65.19  ? 6   LYS A N   1 
ATOM   12    C CA  . LYS A 1 6   ? 4.635   -36.947 69.342  1.00 66.76  ? 6   LYS A CA  1 
ATOM   13    C C   . LYS A 1 6   ? 5.285   -37.467 70.621  1.00 72.73  ? 6   LYS A C   1 
ATOM   14    O O   . LYS A 1 6   ? 4.685   -38.232 71.378  1.00 66.96  ? 6   LYS A O   1 
ATOM   15    C CB  . LYS A 1 6   ? 4.137   -35.519 69.576  1.00 47.96  ? 6   LYS A CB  1 
ATOM   16    N N   . LEU A 1 7   ? 6.524   -37.037 70.843  1.00 65.84  ? 7   LEU A N   1 
ATOM   17    C CA  . LEU A 1 7   ? 7.267   -37.357 72.056  1.00 58.96  ? 7   LEU A CA  1 
ATOM   18    C C   . LEU A 1 7   ? 7.087   -36.271 73.119  1.00 72.60  ? 7   LEU A C   1 
ATOM   19    O O   . LEU A 1 7   ? 6.954   -35.092 72.789  1.00 67.65  ? 7   LEU A O   1 
ATOM   20    C CB  . LEU A 1 7   ? 8.750   -37.557 71.737  1.00 53.08  ? 7   LEU A CB  1 
ATOM   21    C CG  . LEU A 1 7   ? 9.077   -38.862 71.010  1.00 56.69  ? 7   LEU A CG  1 
ATOM   22    C CD1 . LEU A 1 7   ? 10.335  -38.713 70.171  1.00 56.42  ? 7   LEU A CD1 1 
ATOM   23    C CD2 . LEU A 1 7   ? 9.221   -40.006 72.003  1.00 44.93  ? 7   LEU A CD2 1 
ATOM   24    N N   . PRO A 1 8   ? 7.085   -36.672 74.401  1.00 78.16  ? 8   PRO A N   1 
ATOM   25    C CA  . PRO A 1 8   ? 6.937   -35.779 75.557  1.00 68.62  ? 8   PRO A CA  1 
ATOM   26    C C   . PRO A 1 8   ? 8.239   -35.098 75.978  1.00 62.36  ? 8   PRO A C   1 
ATOM   27    O O   . PRO A 1 8   ? 8.956   -35.612 76.836  1.00 74.28  ? 8   PRO A O   1 
ATOM   28    C CB  . PRO A 1 8   ? 6.442   -36.715 76.657  1.00 80.32  ? 8   PRO A CB  1 
ATOM   29    C CG  . PRO A 1 8   ? 7.004   -38.037 76.300  1.00 70.83  ? 8   PRO A CG  1 
ATOM   30    C CD  . PRO A 1 8   ? 7.081   -38.090 74.800  1.00 74.02  ? 8   PRO A CD  1 
ATOM   31    N N   . ILE A 1 9   ? 8.539   -33.956 75.370  1.00 60.75  ? 9   ILE A N   1 
ATOM   32    C CA  . ILE A 1 9   ? 9.765   -33.222 75.674  1.00 70.43  ? 9   ILE A CA  1 
ATOM   33    C C   . ILE A 1 9   ? 9.909   -32.813 77.148  1.00 75.25  ? 9   ILE A C   1 
ATOM   34    O O   . ILE A 1 9   ? 11.017  -32.527 77.600  1.00 84.07  ? 9   ILE A O   1 
ATOM   35    C CB  . ILE A 1 9   ? 9.892   -31.943 74.804  1.00 69.95  ? 9   ILE A CB  1 
ATOM   36    C CG1 . ILE A 1 9   ? 8.516   -31.361 74.469  1.00 73.22  ? 9   ILE A CG1 1 
ATOM   37    C CG2 . ILE A 1 9   ? 10.668  -32.231 73.524  1.00 72.38  ? 9   ILE A CG2 1 
ATOM   38    C CD1 . ILE A 1 9   ? 7.849   -30.622 75.612  1.00 71.81  ? 9   ILE A CD1 1 
ATOM   39    N N   . GLU A 1 10  ? 8.810   -32.778 77.897  1.00 75.16  ? 10  GLU A N   1 
ATOM   40    C CA  . GLU A 1 10  ? 8.878   -32.289 79.273  1.00 75.32  ? 10  GLU A CA  1 
ATOM   41    C C   . GLU A 1 10  ? 9.443   -33.294 80.296  1.00 80.06  ? 10  GLU A C   1 
ATOM   42    O O   . GLU A 1 10  ? 9.927   -32.879 81.355  1.00 84.73  ? 10  GLU A O   1 
ATOM   43    C CB  . GLU A 1 10  ? 7.479   -31.839 79.722  1.00 71.88  ? 10  GLU A CB  1 
ATOM   44    C CG  . GLU A 1 10  ? 7.455   -31.140 81.072  1.00 118.01 ? 10  GLU A CG  1 
ATOM   45    C CD  . GLU A 1 10  ? 6.070   -30.706 81.507  1.00 137.17 ? 10  GLU A CD  1 
ATOM   46    O OE1 . GLU A 1 10  ? 5.309   -30.161 80.678  1.00 142.95 ? 10  GLU A OE1 1 
ATOM   47    O OE2 . GLU A 1 10  ? 5.746   -30.918 82.694  1.00 121.42 ? 10  GLU A OE2 1 
ATOM   48    N N   . GLU A 1 11  ? 9.429   -34.590 79.974  1.00 69.79  ? 11  GLU A N   1 
ATOM   49    C CA  . GLU A 1 11  ? 10.010  -35.600 80.868  1.00 85.89  ? 11  GLU A CA  1 
ATOM   50    C C   . GLU A 1 11  ? 11.407  -36.001 80.362  1.00 65.93  ? 11  GLU A C   1 
ATOM   51    O O   . GLU A 1 11  ? 11.981  -37.000 80.804  1.00 68.91  ? 11  GLU A O   1 
ATOM   52    C CB  . GLU A 1 11  ? 9.046   -36.800 81.041  1.00 103.19 ? 11  GLU A CB  1 
ATOM   53    C CG  . GLU A 1 11  ? 9.554   -38.010 81.833  1.00 108.79 ? 11  GLU A CG  1 
ATOM   54    C CD  . GLU A 1 11  ? 8.607   -38.382 82.981  1.00 127.25 ? 11  GLU A CD  1 
ATOM   55    O OE1 . GLU A 1 11  ? 7.462   -38.816 82.720  1.00 132.94 ? 11  GLU A OE1 1 
ATOM   56    O OE2 . GLU A 1 11  ? 8.992   -38.178 84.154  1.00 138.64 ? 11  GLU A OE2 1 
ATOM   57    N N   . THR A 1 12  ? 11.975  -35.201 79.459  1.00 63.27  ? 12  THR A N   1 
ATOM   58    C CA  . THR A 1 12  ? 13.329  -35.474 78.996  1.00 67.61  ? 12  THR A CA  1 
ATOM   59    C C   . THR A 1 12  ? 14.318  -35.344 80.145  1.00 66.53  ? 12  THR A C   1 
ATOM   60    O O   . THR A 1 12  ? 15.347  -36.022 80.161  1.00 73.13  ? 12  THR A O   1 
ATOM   61    C CB  . THR A 1 12  ? 13.764  -34.537 77.847  1.00 66.56  ? 12  THR A CB  1 
ATOM   62    O OG1 . THR A 1 12  ? 13.581  -33.163 78.220  1.00 68.76  ? 12  THR A OG1 1 
ATOM   63    C CG2 . THR A 1 12  ? 12.971  -34.817 76.591  1.00 61.03  ? 12  THR A CG2 1 
ATOM   64    N N   . LEU A 1 13  ? 13.992  -34.491 81.109  1.00 59.57  ? 13  LEU A N   1 
ATOM   65    C CA  . LEU A 1 13  ? 14.862  -34.268 82.253  1.00 54.88  ? 13  LEU A CA  1 
ATOM   66    C C   . LEU A 1 13  ? 14.899  -35.477 83.205  1.00 57.37  ? 13  LEU A C   1 
ATOM   67    O O   . LEU A 1 13  ? 15.972  -35.876 83.671  1.00 66.00  ? 13  LEU A O   1 
ATOM   68    C CB  . LEU A 1 13  ? 14.417  -33.013 83.005  1.00 51.58  ? 13  LEU A CB  1 
ATOM   69    C CG  . LEU A 1 13  ? 15.243  -32.634 84.232  1.00 56.02  ? 13  LEU A CG  1 
ATOM   70    C CD1 . LEU A 1 13  ? 16.690  -32.360 83.844  1.00 46.91  ? 13  LEU A CD1 1 
ATOM   71    C CD2 . LEU A 1 13  ? 14.625  -31.431 84.926  1.00 42.16  ? 13  LEU A CD2 1 
ATOM   72    N N   . GLU A 1 14  ? 13.728  -36.050 83.486  1.00 56.71  ? 14  GLU A N   1 
ATOM   73    C CA  . GLU A 1 14  ? 13.601  -37.210 84.377  1.00 56.29  ? 14  GLU A CA  1 
ATOM   74    C C   . GLU A 1 14  ? 14.273  -38.462 83.815  1.00 63.43  ? 14  GLU A C   1 
ATOM   75    O O   . GLU A 1 14  ? 14.873  -39.242 84.560  1.00 69.70  ? 14  GLU A O   1 
ATOM   76    C CB  . GLU A 1 14  ? 12.118  -37.505 84.655  1.00 73.26  ? 14  GLU A CB  1 
ATOM   77    C CG  . GLU A 1 14  ? 11.844  -38.704 85.590  1.00 77.45  ? 14  GLU A CG  1 
ATOM   78    C CD  . GLU A 1 14  ? 12.077  -38.400 87.067  1.00 85.73  ? 14  GLU A CD  1 
ATOM   79    O OE1 . GLU A 1 14  ? 12.549  -37.289 87.385  1.00 89.99  ? 14  GLU A OE1 1 
ATOM   80    O OE2 . GLU A 1 14  ? 11.797  -39.281 87.910  1.00 74.34  ? 14  GLU A OE2 1 
ATOM   81    N N   . ASP A 1 15  ? 14.172  -38.632 82.498  1.00 67.31  ? 15  ASP A N   1 
ATOM   82    C CA  . ASP A 1 15  ? 14.806  -39.738 81.784  1.00 66.94  ? 15  ASP A CA  1 
ATOM   83    C C   . ASP A 1 15  ? 14.295  -41.100 82.267  1.00 53.89  ? 15  ASP A C   1 
ATOM   84    O O   . ASP A 1 15  ? 15.072  -42.030 82.466  1.00 53.69  ? 15  ASP A O   1 
ATOM   85    C CB  . ASP A 1 15  ? 16.333  -39.654 81.929  1.00 77.91  ? 15  ASP A CB  1 
ATOM   86    C CG  . ASP A 1 15  ? 17.066  -40.531 80.934  1.00 87.24  ? 15  ASP A CG  1 
ATOM   87    O OD1 . ASP A 1 15  ? 16.530  -40.759 79.830  1.00 76.58  ? 15  ASP A OD1 1 
ATOM   88    O OD2 . ASP A 1 15  ? 18.178  -40.995 81.262  1.00 81.41  ? 15  ASP A OD2 1 
ATOM   89    N N   . SER A 1 16  ? 12.983  -41.207 82.459  1.00 60.89  ? 16  SER A N   1 
ATOM   90    C CA  . SER A 1 16  ? 12.356  -42.470 82.852  1.00 48.93  ? 16  SER A CA  1 
ATOM   91    C C   . SER A 1 16  ? 12.519  -43.548 81.777  1.00 56.58  ? 16  SER A C   1 
ATOM   92    O O   . SER A 1 16  ? 12.604  -43.234 80.589  1.00 64.65  ? 16  SER A O   1 
ATOM   93    C CB  . SER A 1 16  ? 10.869  -42.256 83.153  1.00 51.35  ? 16  SER A CB  1 
ATOM   94    O OG  . SER A 1 16  ? 10.176  -43.492 83.233  1.00 64.64  ? 16  SER A OG  1 
ATOM   95    N N   . PRO A 1 17  ? 12.580  -44.825 82.194  1.00 53.88  ? 17  PRO A N   1 
ATOM   96    C CA  . PRO A 1 17  ? 12.605  -45.955 81.258  1.00 60.88  ? 17  PRO A CA  1 
ATOM   97    C C   . PRO A 1 17  ? 11.378  -45.984 80.352  1.00 53.74  ? 17  PRO A C   1 
ATOM   98    O O   . PRO A 1 17  ? 11.458  -46.509 79.244  1.00 55.88  ? 17  PRO A O   1 
ATOM   99    C CB  . PRO A 1 17  ? 12.631  -47.173 82.182  1.00 52.34  ? 17  PRO A CB  1 
ATOM   100   C CG  . PRO A 1 17  ? 13.304  -46.683 83.399  1.00 43.09  ? 17  PRO A CG  1 
ATOM   101   C CD  . PRO A 1 17  ? 12.816  -45.269 83.577  1.00 41.31  ? 17  PRO A CD  1 
ATOM   102   N N   . GLN A 1 18  ? 10.258  -45.447 80.830  1.00 53.44  ? 18  GLN A N   1 
ATOM   103   C CA  . GLN A 1 18  ? 9.067   -45.308 80.000  1.00 59.46  ? 18  GLN A CA  1 
ATOM   104   C C   . GLN A 1 18  ? 9.342   -44.381 78.826  1.00 54.79  ? 18  GLN A C   1 
ATOM   105   O O   . GLN A 1 18  ? 9.047   -44.709 77.676  1.00 63.74  ? 18  GLN A O   1 
ATOM   106   C CB  . GLN A 1 18  ? 7.890   -44.770 80.812  1.00 50.89  ? 18  GLN A CB  1 
ATOM   107   C CG  . GLN A 1 18  ? 6.593   -44.712 80.021  1.00 68.73  ? 18  GLN A CG  1 
ATOM   108   C CD  . GLN A 1 18  ? 5.363   -44.689 80.900  1.00 99.03  ? 18  GLN A CD  1 
ATOM   109   O OE1 . GLN A 1 18  ? 5.378   -44.130 81.996  1.00 106.29 ? 18  GLN A OE1 1 
ATOM   110   N NE2 . GLN A 1 18  ? 4.281   -45.290 80.417  1.00 100.38 ? 18  GLN A NE2 1 
ATOM   111   N N   . THR A 1 19  ? 9.904   -43.216 79.134  1.00 43.67  ? 19  THR A N   1 
ATOM   112   C CA  . THR A 1 19  ? 10.277  -42.234 78.123  1.00 59.12  ? 19  THR A CA  1 
ATOM   113   C C   . THR A 1 19  ? 11.238  -42.855 77.115  1.00 49.02  ? 19  THR A C   1 
ATOM   114   O O   . THR A 1 19  ? 11.112  -42.653 75.905  1.00 48.23  ? 19  THR A O   1 
ATOM   115   C CB  . THR A 1 19  ? 10.925  -40.988 78.760  1.00 53.27  ? 19  THR A CB  1 
ATOM   116   O OG1 . THR A 1 19  ? 10.056  -40.458 79.768  1.00 51.42  ? 19  THR A OG1 1 
ATOM   117   C CG2 . THR A 1 19  ? 11.193  -39.920 77.708  1.00 52.32  ? 19  THR A CG2 1 
ATOM   118   N N   . ARG A 1 20  ? 12.191  -43.622 77.634  1.00 40.61  ? 20  ARG A N   1 
ATOM   119   C CA  . ARG A 1 20  ? 13.148  -44.346 76.809  1.00 46.16  ? 20  ARG A CA  1 
ATOM   120   C C   . ARG A 1 20  ? 12.441  -45.345 75.896  1.00 42.39  ? 20  ARG A C   1 
ATOM   121   O O   . ARG A 1 20  ? 12.846  -45.548 74.754  1.00 63.16  ? 20  ARG A O   1 
ATOM   122   C CB  . ARG A 1 20  ? 14.161  -45.079 77.693  1.00 56.67  ? 20  ARG A CB  1 
ATOM   123   C CG  . ARG A 1 20  ? 15.224  -44.186 78.314  1.00 56.45  ? 20  ARG A CG  1 
ATOM   124   C CD  . ARG A 1 20  ? 16.016  -43.420 77.271  1.00 68.20  ? 20  ARG A CD  1 
ATOM   125   N NE  . ARG A 1 20  ? 17.089  -42.641 77.883  1.00 81.28  ? 20  ARG A NE  1 
ATOM   126   C CZ  . ARG A 1 20  ? 18.339  -43.071 78.019  1.00 68.73  ? 20  ARG A CZ  1 
ATOM   127   N NH1 . ARG A 1 20  ? 18.680  -44.274 77.579  1.00 63.36  ? 20  ARG A NH1 1 
ATOM   128   N NH2 . ARG A 1 20  ? 19.250  -42.296 78.593  1.00 53.41  ? 20  ARG A NH2 1 
ATOM   129   N N   . SER A 1 21  ? 11.391  -45.974 76.416  1.00 49.31  ? 21  SER A N   1 
ATOM   130   C CA  . SER A 1 21  ? 10.598  -46.931 75.650  1.00 56.10  ? 21  SER A CA  1 
ATOM   131   C C   . SER A 1 21  ? 9.861   -46.259 74.496  1.00 47.84  ? 21  SER A C   1 
ATOM   132   O O   . SER A 1 21  ? 9.885   -46.748 73.363  1.00 52.82  ? 21  SER A O   1 
ATOM   133   C CB  . SER A 1 21  ? 9.597   -47.647 76.561  1.00 40.46  ? 21  SER A CB  1 
ATOM   134   O OG  . SER A 1 21  ? 10.262  -48.393 77.565  1.00 69.63  ? 21  SER A OG  1 
ATOM   135   N N   . LEU A 1 22  ? 9.200   -45.144 74.796  1.00 38.21  ? 22  LEU A N   1 
ATOM   136   C CA  . LEU A 1 22  ? 8.493   -44.368 73.782  1.00 47.93  ? 22  LEU A CA  1 
ATOM   137   C C   . LEU A 1 22  ? 9.456   -43.908 72.692  1.00 53.72  ? 22  LEU A C   1 
ATOM   138   O O   . LEU A 1 22  ? 9.166   -44.016 71.489  1.00 51.04  ? 22  LEU A O   1 
ATOM   139   C CB  . LEU A 1 22  ? 7.793   -43.169 74.423  1.00 42.04  ? 22  LEU A CB  1 
ATOM   140   C CG  . LEU A 1 22  ? 6.774   -42.404 73.576  1.00 74.22  ? 22  LEU A CG  1 
ATOM   141   C CD1 . LEU A 1 22  ? 5.856   -43.359 72.831  1.00 64.35  ? 22  LEU A CD1 1 
ATOM   142   C CD2 . LEU A 1 22  ? 5.965   -41.468 74.456  1.00 68.52  ? 22  LEU A CD2 1 
ATOM   143   N N   . LEU A 1 23  ? 10.605  -43.398 73.127  1.00 50.37  ? 23  LEU A N   1 
ATOM   144   C CA  . LEU A 1 23  ? 11.671  -43.022 72.209  1.00 37.81  ? 23  LEU A CA  1 
ATOM   145   C C   . LEU A 1 23  ? 12.064  -44.208 71.342  1.00 40.39  ? 23  LEU A C   1 
ATOM   146   O O   . LEU A 1 23  ? 12.268  -44.055 70.149  1.00 40.89  ? 23  LEU A O   1 
ATOM   147   C CB  . LEU A 1 23  ? 12.892  -42.494 72.964  1.00 47.77  ? 23  LEU A CB  1 
ATOM   148   C CG  . LEU A 1 23  ? 14.120  -42.257 72.080  1.00 40.34  ? 23  LEU A CG  1 
ATOM   149   C CD1 . LEU A 1 23  ? 13.815  -41.203 71.031  1.00 38.92  ? 23  LEU A CD1 1 
ATOM   150   C CD2 . LEU A 1 23  ? 15.327  -41.853 72.907  1.00 37.33  ? 23  LEU A CD2 1 
ATOM   151   N N   . GLY A 1 24  ? 12.173  -45.386 71.951  1.00 42.13  ? 24  GLY A N   1 
ATOM   152   C CA  . GLY A 1 24  ? 12.499  -46.600 71.222  1.00 36.42  ? 24  GLY A CA  1 
ATOM   153   C C   . GLY A 1 24  ? 11.485  -46.925 70.142  1.00 52.71  ? 24  GLY A C   1 
ATOM   154   O O   . GLY A 1 24  ? 11.846  -47.341 69.036  1.00 64.19  ? 24  GLY A O   1 
ATOM   155   N N   . VAL A 1 25  ? 10.209  -46.730 70.465  1.00 53.39  ? 25  VAL A N   1 
ATOM   156   C CA  . VAL A 1 25  ? 9.133   -46.907 69.496  1.00 60.35  ? 25  VAL A CA  1 
ATOM   157   C C   . VAL A 1 25  ? 9.328   -45.964 68.310  1.00 58.83  ? 25  VAL A C   1 
ATOM   158   O O   . VAL A 1 25  ? 9.310   -46.388 67.144  1.00 55.07  ? 25  VAL A O   1 
ATOM   159   C CB  . VAL A 1 25  ? 7.751   -46.655 70.139  1.00 50.78  ? 25  VAL A CB  1 
ATOM   160   C CG1 . VAL A 1 25  ? 6.680   -46.502 69.072  1.00 53.67  ? 25  VAL A CG1 1 
ATOM   161   C CG2 . VAL A 1 25  ? 7.398   -47.778 71.102  1.00 52.33  ? 25  VAL A CG2 1 
ATOM   162   N N   . PHE A 1 26  ? 9.536   -44.686 68.618  1.00 51.97  ? 26  PHE A N   1 
ATOM   163   C CA  . PHE A 1 26  ? 9.784   -43.686 67.582  1.00 46.66  ? 26  PHE A CA  1 
ATOM   164   C C   . PHE A 1 26  ? 11.015  -44.001 66.730  1.00 55.34  ? 26  PHE A C   1 
ATOM   165   O O   . PHE A 1 26  ? 11.020  -43.750 65.527  1.00 56.97  ? 26  PHE A O   1 
ATOM   166   C CB  . PHE A 1 26  ? 9.931   -42.299 68.208  1.00 47.02  ? 26  PHE A CB  1 
ATOM   167   C CG  . PHE A 1 26  ? 8.629   -41.575 68.381  1.00 62.51  ? 26  PHE A CG  1 
ATOM   168   C CD1 . PHE A 1 26  ? 7.749   -41.929 69.390  1.00 59.53  ? 26  PHE A CD1 1 
ATOM   169   C CD2 . PHE A 1 26  ? 8.284   -40.537 67.531  1.00 60.93  ? 26  PHE A CD2 1 
ATOM   170   C CE1 . PHE A 1 26  ? 6.549   -41.262 69.548  1.00 58.97  ? 26  PHE A CE1 1 
ATOM   171   C CE2 . PHE A 1 26  ? 7.087   -39.865 67.684  1.00 63.00  ? 26  PHE A CE2 1 
ATOM   172   C CZ  . PHE A 1 26  ? 6.218   -40.228 68.693  1.00 59.23  ? 26  PHE A CZ  1 
ATOM   173   N N   . GLU A 1 27  ? 12.056  -44.539 67.359  1.00 55.61  ? 27  GLU A N   1 
ATOM   174   C CA  . GLU A 1 27  ? 13.278  -44.924 66.660  1.00 47.86  ? 27  GLU A CA  1 
ATOM   175   C C   . GLU A 1 27  ? 13.017  -46.071 65.696  1.00 57.91  ? 27  GLU A C   1 
ATOM   176   O O   . GLU A 1 27  ? 13.520  -46.073 64.570  1.00 60.56  ? 27  GLU A O   1 
ATOM   177   C CB  . GLU A 1 27  ? 14.376  -45.314 67.653  1.00 39.72  ? 27  GLU A CB  1 
ATOM   178   C CG  . GLU A 1 27  ? 14.884  -44.168 68.516  1.00 49.95  ? 27  GLU A CG  1 
ATOM   179   C CD  . GLU A 1 27  ? 16.208  -44.485 69.186  1.00 58.51  ? 27  GLU A CD  1 
ATOM   180   O OE1 . GLU A 1 27  ? 16.281  -44.422 70.431  1.00 71.50  ? 27  GLU A OE1 1 
ATOM   181   O OE2 . GLU A 1 27  ? 17.178  -44.791 68.464  1.00 78.20  ? 27  GLU A OE2 1 
ATOM   182   N N   . GLU A 1 28  ? 12.239  -47.050 66.149  1.00 54.48  ? 28  GLU A N   1 
ATOM   183   C CA  . GLU A 1 28  ? 11.828  -48.156 65.291  1.00 61.83  ? 28  GLU A CA  1 
ATOM   184   C C   . GLU A 1 28  ? 11.097  -47.614 64.068  1.00 58.55  ? 28  GLU A C   1 
ATOM   185   O O   . GLU A 1 28  ? 11.398  -47.984 62.921  1.00 53.90  ? 28  GLU A O   1 
ATOM   186   C CB  . GLU A 1 28  ? 10.938  -49.134 66.060  1.00 65.69  ? 28  GLU A CB  1 
ATOM   187   C CG  . GLU A 1 28  ? 11.661  -50.383 66.537  1.00 77.10  ? 28  GLU A CG  1 
ATOM   188   C CD  . GLU A 1 28  ? 10.726  -51.382 67.192  1.00 107.98 ? 28  GLU A CD  1 
ATOM   189   O OE1 . GLU A 1 28  ? 9.861   -51.942 66.486  1.00 101.30 ? 28  GLU A OE1 1 
ATOM   190   O OE2 . GLU A 1 28  ? 10.857  -51.607 68.414  1.00 119.27 ? 28  GLU A OE2 1 
ATOM   191   N N   . ASP A 1 29  ? 10.138  -46.726 64.320  1.00 50.42  ? 29  ASP A N   1 
ATOM   192   C CA  . ASP A 1 29  ? 9.369   -46.123 63.239  1.00 56.48  ? 29  ASP A CA  1 
ATOM   193   C C   . ASP A 1 29  ? 10.266  -45.373 62.257  1.00 57.84  ? 29  ASP A C   1 
ATOM   194   O O   . ASP A 1 29  ? 10.097  -45.489 61.046  1.00 58.36  ? 29  ASP A O   1 
ATOM   195   C CB  . ASP A 1 29  ? 8.307   -45.177 63.796  1.00 58.04  ? 29  ASP A CB  1 
ATOM   196   C CG  . ASP A 1 29  ? 7.757   -44.237 62.741  1.00 86.19  ? 29  ASP A CG  1 
ATOM   197   O OD1 . ASP A 1 29  ? 6.983   -44.696 61.875  1.00 82.55  ? 29  ASP A OD1 1 
ATOM   198   O OD2 . ASP A 1 29  ? 8.091   -43.034 62.788  1.00 88.22  ? 29  ASP A OD2 1 
ATOM   199   N N   . ALA A 1 30  ? 11.225  -44.619 62.784  1.00 51.06  ? 30  ALA A N   1 
ATOM   200   C CA  . ALA A 1 30  ? 12.141  -43.845 61.953  1.00 45.25  ? 30  ALA A CA  1 
ATOM   201   C C   . ALA A 1 30  ? 13.024  -44.760 61.111  1.00 45.65  ? 30  ALA A C   1 
ATOM   202   O O   . ALA A 1 30  ? 13.387  -44.426 59.983  1.00 45.27  ? 30  ALA A O   1 
ATOM   203   C CB  . ALA A 1 30  ? 12.994  -42.929 62.815  1.00 40.98  ? 30  ALA A CB  1 
ATOM   204   N N   . THR A 1 31  ? 13.369  -45.915 61.671  1.00 48.71  ? 31  THR A N   1 
ATOM   205   C CA  . THR A 1 31  ? 14.129  -46.920 60.940  1.00 53.75  ? 31  THR A CA  1 
ATOM   206   C C   . THR A 1 31  ? 13.318  -47.446 59.758  1.00 54.65  ? 31  THR A C   1 
ATOM   207   O O   . THR A 1 31  ? 13.809  -47.486 58.622  1.00 59.02  ? 31  THR A O   1 
ATOM   208   C CB  . THR A 1 31  ? 14.537  -48.091 61.852  1.00 52.11  ? 31  THR A CB  1 
ATOM   209   O OG1 . THR A 1 31  ? 15.407  -47.612 62.884  1.00 51.94  ? 31  THR A OG1 1 
ATOM   210   C CG2 . THR A 1 31  ? 15.255  -49.166 61.052  1.00 46.84  ? 31  THR A CG2 1 
ATOM   211   N N   . ALA A 1 32  ? 12.076  -47.844 60.029  1.00 56.82  ? 32  ALA A N   1 
ATOM   212   C CA  . ALA A 1 32  ? 11.190  -48.332 58.972  1.00 54.22  ? 32  ALA A CA  1 
ATOM   213   C C   . ALA A 1 32  ? 11.004  -47.282 57.873  1.00 52.95  ? 32  ALA A C   1 
ATOM   214   O O   . ALA A 1 32  ? 11.050  -47.596 56.672  1.00 49.65  ? 32  ALA A O   1 
ATOM   215   C CB  . ALA A 1 32  ? 9.844   -48.731 59.556  1.00 51.14  ? 32  ALA A CB  1 
ATOM   216   N N   . ILE A 1 33  ? 10.813  -46.035 58.298  1.00 43.62  ? 33  ILE A N   1 
ATOM   217   C CA  . ILE A 1 33  ? 10.726  -44.900 57.386  1.00 38.56  ? 33  ILE A CA  1 
ATOM   218   C C   . ILE A 1 33  ? 11.957  -44.836 56.498  1.00 48.29  ? 33  ILE A C   1 
ATOM   219   O O   . ILE A 1 33  ? 11.845  -44.742 55.279  1.00 53.98  ? 33  ILE A O   1 
ATOM   220   C CB  . ILE A 1 33  ? 10.589  -43.562 58.138  1.00 49.64  ? 33  ILE A CB  1 
ATOM   221   C CG1 . ILE A 1 33  ? 9.237   -43.469 58.841  1.00 60.25  ? 33  ILE A CG1 1 
ATOM   222   C CG2 . ILE A 1 33  ? 10.751  -42.392 57.181  1.00 46.87  ? 33  ILE A CG2 1 
ATOM   223   C CD1 . ILE A 1 33  ? 9.183   -42.375 59.879  1.00 60.08  ? 33  ILE A CD1 1 
ATOM   224   N N   . SER A 1 34  ? 13.130  -44.891 57.122  1.00 53.36  ? 34  SER A N   1 
ATOM   225   C CA  . SER A 1 34  ? 14.392  -44.811 56.398  1.00 55.75  ? 34  SER A CA  1 
ATOM   226   C C   . SER A 1 34  ? 14.487  -45.904 55.338  1.00 54.47  ? 34  SER A C   1 
ATOM   227   O O   . SER A 1 34  ? 14.881  -45.641 54.198  1.00 57.69  ? 34  SER A O   1 
ATOM   228   C CB  . SER A 1 34  ? 15.573  -44.910 57.366  1.00 49.29  ? 34  SER A CB  1 
ATOM   229   O OG  . SER A 1 34  ? 16.807  -44.818 56.676  1.00 73.99  ? 34  SER A OG  1 
ATOM   230   N N   . ASN A 1 35  ? 14.110  -47.124 55.712  1.00 44.94  ? 35  ASN A N   1 
ATOM   231   C CA  . ASN A 1 35  ? 14.122  -48.239 54.768  1.00 49.91  ? 35  ASN A CA  1 
ATOM   232   C C   . ASN A 1 35  ? 13.211  -48.001 53.564  1.00 54.86  ? 35  ASN A C   1 
ATOM   233   O O   . ASN A 1 35  ? 13.660  -48.061 52.406  1.00 60.04  ? 35  ASN A O   1 
ATOM   234   C CB  . ASN A 1 35  ? 13.720  -49.536 55.472  1.00 39.10  ? 35  ASN A CB  1 
ATOM   235   C CG  . ASN A 1 35  ? 14.807  -50.062 56.386  1.00 65.26  ? 35  ASN A CG  1 
ATOM   236   O OD1 . ASN A 1 35  ? 15.979  -50.107 56.012  1.00 60.44  ? 35  ASN A OD1 1 
ATOM   237   N ND2 . ASN A 1 35  ? 14.423  -50.465 57.592  1.00 80.89  ? 35  ASN A ND2 1 
ATOM   238   N N   . TYR A 1 36  ? 11.936  -47.725 53.836  1.00 56.04  ? 36  TYR A N   1 
ATOM   239   C CA  . TYR A 1 36  ? 10.977  -47.512 52.754  1.00 50.03  ? 36  TYR A CA  1 
ATOM   240   C C   . TYR A 1 36  ? 11.394  -46.369 51.840  1.00 55.58  ? 36  TYR A C   1 
ATOM   241   O O   . TYR A 1 36  ? 11.334  -46.490 50.621  1.00 50.40  ? 36  TYR A O   1 
ATOM   242   C CB  . TYR A 1 36  ? 9.580   -47.230 53.297  1.00 37.20  ? 36  TYR A CB  1 
ATOM   243   C CG  . TYR A 1 36  ? 8.559   -47.003 52.203  1.00 45.09  ? 36  TYR A CG  1 
ATOM   244   C CD1 . TYR A 1 36  ? 8.007   -48.074 51.513  1.00 40.16  ? 36  TYR A CD1 1 
ATOM   245   C CD2 . TYR A 1 36  ? 8.154   -45.720 51.853  1.00 51.23  ? 36  TYR A CD2 1 
ATOM   246   C CE1 . TYR A 1 36  ? 7.078   -47.876 50.509  1.00 55.33  ? 36  TYR A CE1 1 
ATOM   247   C CE2 . TYR A 1 36  ? 7.225   -45.512 50.850  1.00 45.13  ? 36  TYR A CE2 1 
ATOM   248   C CZ  . TYR A 1 36  ? 6.691   -46.594 50.181  1.00 61.50  ? 36  TYR A CZ  1 
ATOM   249   O OH  . TYR A 1 36  ? 5.766   -46.394 49.182  1.00 61.98  ? 36  TYR A OH  1 
ATOM   250   N N   . MET A 1 37  ? 11.803  -45.257 52.440  1.00 55.51  ? 37  MET A N   1 
ATOM   251   C CA  . MET A 1 37  ? 12.226  -44.087 51.684  1.00 47.36  ? 37  MET A CA  1 
ATOM   252   C C   . MET A 1 37  ? 13.458  -44.394 50.847  1.00 50.27  ? 37  MET A C   1 
ATOM   253   O O   . MET A 1 37  ? 13.632  -43.843 49.760  1.00 50.89  ? 37  MET A O   1 
ATOM   254   C CB  . MET A 1 37  ? 12.505  -42.913 52.623  1.00 47.87  ? 37  MET A CB  1 
ATOM   255   C CG  . MET A 1 37  ? 11.261  -42.366 53.297  1.00 61.23  ? 37  MET A CG  1 
ATOM   256   S SD  . MET A 1 37  ? 10.003  -41.870 52.108  1.00 59.73  ? 37  MET A SD  1 
ATOM   257   C CE  . MET A 1 37  ? 10.881  -40.609 51.190  1.00 59.69  ? 37  MET A CE  1 
ATOM   258   N N   . ASN A 1 38  ? 14.308  -45.281 51.353  1.00 58.01  ? 38  ASN A N   1 
ATOM   259   C CA  . ASN A 1 38  ? 15.491  -45.687 50.609  1.00 60.64  ? 38  ASN A CA  1 
ATOM   260   C C   . ASN A 1 38  ? 15.117  -46.501 49.372  1.00 55.60  ? 38  ASN A C   1 
ATOM   261   O O   . ASN A 1 38  ? 15.640  -46.261 48.277  1.00 64.94  ? 38  ASN A O   1 
ATOM   262   C CB  . ASN A 1 38  ? 16.431  -46.492 51.508  1.00 56.04  ? 38  ASN A CB  1 
ATOM   263   C CG  . ASN A 1 38  ? 17.891  -46.253 51.187  1.00 66.91  ? 38  ASN A CG  1 
ATOM   264   O OD1 . ASN A 1 38  ? 18.262  -46.070 50.028  1.00 85.68  ? 38  ASN A OD1 1 
ATOM   265   N ND2 . ASN A 1 38  ? 18.729  -46.245 52.217  1.00 88.39  ? 38  ASN A ND2 1 
ATOM   266   N N   . GLN A 1 39  ? 14.193  -47.444 49.537  1.00 52.73  ? 39  GLN A N   1 
ATOM   267   C CA  . GLN A 1 39  ? 13.748  -48.241 48.394  1.00 58.49  ? 39  GLN A CA  1 
ATOM   268   C C   . GLN A 1 39  ? 12.966  -47.396 47.383  1.00 50.39  ? 39  GLN A C   1 
ATOM   269   O O   . GLN A 1 39  ? 13.051  -47.616 46.168  1.00 48.70  ? 39  GLN A O   1 
ATOM   270   C CB  . GLN A 1 39  ? 12.913  -49.434 48.861  1.00 57.04  ? 39  GLN A CB  1 
ATOM   271   C CG  . GLN A 1 39  ? 13.747  -50.683 49.105  1.00 53.69  ? 39  GLN A CG  1 
ATOM   272   C CD  . GLN A 1 39  ? 12.940  -51.832 49.671  1.00 81.75  ? 39  GLN A CD  1 
ATOM   273   O OE1 . GLN A 1 39  ? 11.823  -51.645 50.153  1.00 92.63  ? 39  GLN A OE1 1 
ATOM   274   N NE2 . GLN A 1 39  ? 13.503  -53.034 49.614  1.00 80.56  ? 39  GLN A NE2 1 
ATOM   275   N N   . LEU A 1 40  ? 12.217  -46.422 47.891  1.00 42.35  ? 40  LEU A N   1 
ATOM   276   C CA  . LEU A 1 40  ? 11.489  -45.488 47.042  1.00 46.87  ? 40  LEU A CA  1 
ATOM   277   C C   . LEU A 1 40  ? 12.481  -44.672 46.227  1.00 43.42  ? 40  LEU A C   1 
ATOM   278   O O   . LEU A 1 40  ? 12.278  -44.439 45.031  1.00 43.53  ? 40  LEU A O   1 
ATOM   279   C CB  . LEU A 1 40  ? 10.595  -44.568 47.877  1.00 35.91  ? 40  LEU A CB  1 
ATOM   280   C CG  . LEU A 1 40  ? 9.605   -43.716 47.079  1.00 48.65  ? 40  LEU A CG  1 
ATOM   281   C CD1 . LEU A 1 40  ? 8.605   -44.595 46.339  1.00 31.83  ? 40  LEU A CD1 1 
ATOM   282   C CD2 . LEU A 1 40  ? 8.890   -42.718 47.978  1.00 37.06  ? 40  LEU A CD2 1 
ATOM   283   N N   . TYR A 1 41  ? 13.553  -44.242 46.887  1.00 51.97  ? 41  TYR A N   1 
ATOM   284   C CA  . TYR A 1 41  ? 14.637  -43.540 46.213  1.00 52.56  ? 41  TYR A CA  1 
ATOM   285   C C   . TYR A 1 41  ? 15.225  -44.407 45.111  1.00 45.32  ? 41  TYR A C   1 
ATOM   286   O O   . TYR A 1 41  ? 15.532  -43.914 44.028  1.00 41.74  ? 41  TYR A O   1 
ATOM   287   C CB  . TYR A 1 41  ? 15.732  -43.133 47.202  1.00 39.77  ? 41  TYR A CB  1 
ATOM   288   C CG  . TYR A 1 41  ? 16.992  -42.634 46.526  1.00 45.61  ? 41  TYR A CG  1 
ATOM   289   C CD1 . TYR A 1 41  ? 17.106  -41.312 46.116  1.00 54.47  ? 41  TYR A CD1 1 
ATOM   290   C CD2 . TYR A 1 41  ? 18.067  -43.485 46.298  1.00 47.48  ? 41  TYR A CD2 1 
ATOM   291   C CE1 . TYR A 1 41  ? 18.253  -40.854 45.494  1.00 54.95  ? 41  TYR A CE1 1 
ATOM   292   C CE2 . TYR A 1 41  ? 19.216  -43.036 45.677  1.00 50.67  ? 41  TYR A CE2 1 
ATOM   293   C CZ  . TYR A 1 41  ? 19.304  -41.720 45.278  1.00 57.74  ? 41  TYR A CZ  1 
ATOM   294   O OH  . TYR A 1 41  ? 20.449  -41.269 44.660  1.00 74.48  ? 41  TYR A OH  1 
ATOM   295   N N   . GLN A 1 42  ? 15.388  -45.696 45.396  1.00 35.75  ? 42  GLN A N   1 
ATOM   296   C CA  . GLN A 1 42  ? 15.897  -46.628 44.395  1.00 48.19  ? 42  GLN A CA  1 
ATOM   297   C C   . GLN A 1 42  ? 14.987  -46.664 43.165  1.00 43.85  ? 42  GLN A C   1 
ATOM   298   O O   . GLN A 1 42  ? 15.456  -46.537 42.027  1.00 47.77  ? 42  GLN A O   1 
ATOM   299   C CB  . GLN A 1 42  ? 16.047  -48.030 44.992  1.00 43.09  ? 42  GLN A CB  1 
ATOM   300   C CG  . GLN A 1 42  ? 17.142  -48.134 46.044  1.00 51.79  ? 42  GLN A CG  1 
ATOM   301   C CD  . GLN A 1 42  ? 17.217  -49.508 46.681  1.00 67.43  ? 42  GLN A CD  1 
ATOM   302   O OE1 . GLN A 1 42  ? 16.524  -50.437 46.265  1.00 69.72  ? 42  GLN A OE1 1 
ATOM   303   N NE2 . GLN A 1 42  ? 18.063  -49.644 47.697  1.00 61.69  ? 42  GLN A NE2 1 
ATOM   304   N N   . ALA A 1 43  ? 13.687  -46.824 43.401  1.00 42.05  ? 43  ALA A N   1 
ATOM   305   C CA  . ALA A 1 43  ? 12.713  -46.877 42.312  1.00 43.08  ? 43  ALA A CA  1 
ATOM   306   C C   . ALA A 1 43  ? 12.724  -45.601 41.463  1.00 41.08  ? 43  ALA A C   1 
ATOM   307   O O   . ALA A 1 43  ? 12.789  -45.659 40.226  1.00 42.44  ? 43  ALA A O   1 
ATOM   308   C CB  . ALA A 1 43  ? 11.321  -47.126 42.867  1.00 40.41  ? 43  ALA A CB  1 
ATOM   309   N N   . MET A 1 44  ? 12.675  -44.452 42.132  1.00 34.53  ? 44  MET A N   1 
ATOM   310   C CA  . MET A 1 44  ? 12.622  -43.170 41.434  1.00 38.41  ? 44  MET A CA  1 
ATOM   311   C C   . MET A 1 44  ? 13.912  -42.910 40.663  1.00 51.51  ? 44  MET A C   1 
ATOM   312   O O   . MET A 1 44  ? 13.891  -42.338 39.569  1.00 53.97  ? 44  MET A O   1 
ATOM   313   C CB  . MET A 1 44  ? 12.359  -42.031 42.421  1.00 39.01  ? 44  MET A CB  1 
ATOM   314   C CG  . MET A 1 44  ? 10.973  -42.057 43.049  1.00 51.45  ? 44  MET A CG  1 
ATOM   315   S SD  . MET A 1 44  ? 10.704  -40.690 44.195  1.00 78.12  ? 44  MET A SD  1 
ATOM   316   C CE  . MET A 1 44  ? 8.990   -40.951 44.644  1.00 70.17  ? 44  MET A CE  1 
ATOM   317   N N   . HIS A 1 45  ? 15.031  -43.339 41.237  1.00 52.78  ? 45  HIS A N   1 
ATOM   318   C CA  . HIS A 1 45  ? 16.323  -43.216 40.576  1.00 44.56  ? 45  HIS A CA  1 
ATOM   319   C C   . HIS A 1 45  ? 16.325  -44.049 39.303  1.00 48.50  ? 45  HIS A C   1 
ATOM   320   O O   . HIS A 1 45  ? 16.816  -43.607 38.262  1.00 53.19  ? 45  HIS A O   1 
ATOM   321   C CB  . HIS A 1 45  ? 17.458  -43.655 41.504  1.00 47.68  ? 45  HIS A CB  1 
ATOM   322   C CG  . HIS A 1 45  ? 18.817  -43.571 40.881  1.00 62.19  ? 45  HIS A CG  1 
ATOM   323   N ND1 . HIS A 1 45  ? 19.705  -42.557 41.168  1.00 52.58  ? 45  HIS A ND1 1 
ATOM   324   C CD2 . HIS A 1 45  ? 19.438  -44.370 39.981  1.00 50.09  ? 45  HIS A CD2 1 
ATOM   325   C CE1 . HIS A 1 45  ? 20.816  -42.738 40.475  1.00 73.21  ? 45  HIS A CE1 1 
ATOM   326   N NE2 . HIS A 1 45  ? 20.679  -43.831 39.747  1.00 57.31  ? 45  HIS A NE2 1 
ATOM   327   N N   . ARG A 1 46  ? 15.778  -45.259 39.394  1.00 42.00  ? 46  ARG A N   1 
ATOM   328   C CA  . ARG A 1 46  ? 15.665  -46.125 38.225  1.00 43.88  ? 46  ARG A CA  1 
ATOM   329   C C   . ARG A 1 46  ? 14.833  -45.462 37.128  1.00 44.30  ? 46  ARG A C   1 
ATOM   330   O O   . ARG A 1 46  ? 15.205  -45.493 35.950  1.00 46.30  ? 46  ARG A O   1 
ATOM   331   C CB  . ARG A 1 46  ? 15.057  -47.475 38.605  1.00 34.38  ? 46  ARG A CB  1 
ATOM   332   C CG  . ARG A 1 46  ? 14.880  -48.412 37.425  1.00 29.36  ? 46  ARG A CG  1 
ATOM   333   C CD  . ARG A 1 46  ? 14.802  -49.857 37.873  1.00 36.97  ? 46  ARG A CD  1 
ATOM   334   N NE  . ARG A 1 46  ? 14.840  -50.776 36.741  1.00 46.93  ? 46  ARG A NE  1 
ATOM   335   C CZ  . ARG A 1 46  ? 14.739  -52.096 36.848  1.00 51.04  ? 46  ARG A CZ  1 
ATOM   336   N NH1 . ARG A 1 46  ? 14.596  -52.656 38.042  1.00 59.12  ? 46  ARG A NH1 1 
ATOM   337   N NH2 . ARG A 1 46  ? 14.784  -52.858 35.764  1.00 53.70  ? 46  ARG A NH2 1 
ATOM   338   N N   . ILE A 1 47  ? 13.712  -44.862 37.522  1.00 46.52  ? 47  ILE A N   1 
ATOM   339   C CA  . ILE A 1 47  ? 12.889  -44.093 36.589  1.00 46.08  ? 47  ILE A CA  1 
ATOM   340   C C   . ILE A 1 47  ? 13.709  -42.997 35.901  1.00 51.86  ? 47  ILE A C   1 
ATOM   341   O O   . ILE A 1 47  ? 13.651  -42.825 34.676  1.00 53.33  ? 47  ILE A O   1 
ATOM   342   C CB  . ILE A 1 47  ? 11.683  -43.446 37.303  1.00 46.51  ? 47  ILE A CB  1 
ATOM   343   C CG1 . ILE A 1 47  ? 10.755  -44.523 37.873  1.00 48.37  ? 47  ILE A CG1 1 
ATOM   344   C CG2 . ILE A 1 47  ? 10.931  -42.517 36.357  1.00 39.40  ? 47  ILE A CG2 1 
ATOM   345   C CD1 . ILE A 1 47  ? 9.720   -45.030 36.892  1.00 57.31  ? 47  ILE A CD1 1 
ATOM   346   N N   . TYR A 1 48  ? 14.483  -42.275 36.705  1.00 52.56  ? 48  TYR A N   1 
ATOM   347   C CA  . TYR A 1 48  ? 15.300  -41.163 36.227  1.00 52.61  ? 48  TYR A CA  1 
ATOM   348   C C   . TYR A 1 48  ? 16.313  -41.617 35.172  1.00 50.53  ? 48  TYR A C   1 
ATOM   349   O O   . TYR A 1 48  ? 16.390  -41.051 34.066  1.00 45.38  ? 48  TYR A O   1 
ATOM   350   C CB  . TYR A 1 48  ? 16.017  -40.514 37.415  1.00 43.35  ? 48  TYR A CB  1 
ATOM   351   C CG  . TYR A 1 48  ? 16.834  -39.293 37.075  1.00 55.59  ? 48  TYR A CG  1 
ATOM   352   C CD1 . TYR A 1 48  ? 16.230  -38.146 36.578  1.00 57.69  ? 48  TYR A CD1 1 
ATOM   353   C CD2 . TYR A 1 48  ? 18.210  -39.280 37.265  1.00 64.96  ? 48  TYR A CD2 1 
ATOM   354   C CE1 . TYR A 1 48  ? 16.973  -37.026 36.270  1.00 70.04  ? 48  TYR A CE1 1 
ATOM   355   C CE2 . TYR A 1 48  ? 18.963  -38.163 36.960  1.00 51.98  ? 48  TYR A CE2 1 
ATOM   356   C CZ  . TYR A 1 48  ? 18.339  -37.038 36.464  1.00 73.05  ? 48  TYR A CZ  1 
ATOM   357   O OH  . TYR A 1 48  ? 19.082  -35.921 36.158  1.00 69.22  ? 48  TYR A OH  1 
ATOM   358   N N   . ASP A 1 49  ? 17.073  -42.653 35.519  1.00 47.66  ? 49  ASP A N   1 
ATOM   359   C CA  . ASP A 1 49  ? 18.059  -43.229 34.612  1.00 49.40  ? 49  ASP A CA  1 
ATOM   360   C C   . ASP A 1 49  ? 17.404  -43.722 33.330  1.00 47.82  ? 49  ASP A C   1 
ATOM   361   O O   . ASP A 1 49  ? 17.958  -43.565 32.243  1.00 61.40  ? 49  ASP A O   1 
ATOM   362   C CB  . ASP A 1 49  ? 18.810  -44.380 35.286  1.00 58.20  ? 49  ASP A CB  1 
ATOM   363   C CG  . ASP A 1 49  ? 19.925  -43.898 36.190  1.00 66.80  ? 49  ASP A CG  1 
ATOM   364   O OD1 . ASP A 1 49  ? 20.222  -42.685 36.176  1.00 68.91  ? 49  ASP A OD1 1 
ATOM   365   O OD2 . ASP A 1 49  ? 20.512  -44.735 36.909  1.00 66.45  ? 49  ASP A OD2 1 
ATOM   366   N N   . ALA A 1 50  ? 16.225  -44.322 33.465  1.00 49.45  ? 50  ALA A N   1 
ATOM   367   C CA  . ALA A 1 50  ? 15.476  -44.790 32.305  1.00 48.10  ? 50  ALA A CA  1 
ATOM   368   C C   . ALA A 1 50  ? 15.132  -43.641 31.354  1.00 40.90  ? 50  ALA A C   1 
ATOM   369   O O   . ALA A 1 50  ? 15.345  -43.744 30.144  1.00 47.31  ? 50  ALA A O   1 
ATOM   370   C CB  . ALA A 1 50  ? 14.216  -45.509 32.750  1.00 36.09  ? 50  ALA A CB  1 
ATOM   371   N N   . GLN A 1 51  ? 14.603  -42.550 31.906  1.00 44.48  ? 51  GLN A N   1 
ATOM   372   C CA  . GLN A 1 51  ? 14.225  -41.388 31.100  1.00 36.97  ? 51  GLN A CA  1 
ATOM   373   C C   . GLN A 1 51  ? 15.434  -40.789 30.370  1.00 45.91  ? 51  GLN A C   1 
ATOM   374   O O   . GLN A 1 51  ? 15.395  -40.560 29.142  1.00 59.12  ? 51  GLN A O   1 
ATOM   375   C CB  . GLN A 1 51  ? 13.558  -40.330 31.984  1.00 37.31  ? 51  GLN A CB  1 
ATOM   376   C CG  . GLN A 1 51  ? 12.937  -39.166 31.226  1.00 45.67  ? 51  GLN A CG  1 
ATOM   377   C CD  . GLN A 1 51  ? 11.798  -39.590 30.319  1.00 62.14  ? 51  GLN A CD  1 
ATOM   378   O OE1 . GLN A 1 51  ? 11.640  -39.065 29.217  1.00 65.07  ? 51  GLN A OE1 1 
ATOM   379   N NE2 . GLN A 1 51  ? 10.990  -40.535 30.784  1.00 59.78  ? 51  GLN A NE2 1 
ATOM   380   N N   . ASN A 1 52  ? 16.506  -40.545 31.125  1.00 45.86  ? 52  ASN A N   1 
ATOM   381   C CA  . ASN A 1 52  ? 17.755  -40.067 30.528  1.00 41.02  ? 52  ASN A CA  1 
ATOM   382   C C   . ASN A 1 52  ? 18.237  -40.983 29.407  1.00 45.55  ? 52  ASN A C   1 
ATOM   383   O O   . ASN A 1 52  ? 18.667  -40.516 28.347  1.00 43.40  ? 52  ASN A O   1 
ATOM   384   C CB  . ASN A 1 52  ? 18.848  -39.931 31.590  1.00 42.61  ? 52  ASN A CB  1 
ATOM   385   C CG  . ASN A 1 52  ? 18.759  -38.627 32.355  1.00 66.61  ? 52  ASN A CG  1 
ATOM   386   O OD1 . ASN A 1 52  ? 18.441  -37.582 31.787  1.00 69.46  ? 52  ASN A OD1 1 
ATOM   387   N ND2 . ASN A 1 52  ? 19.046  -38.678 33.650  1.00 66.92  ? 52  ASN A ND2 1 
ATOM   388   N N   . GLU A 1 53  ? 18.147  -42.287 29.646  1.00 34.89  ? 53  GLU A N   1 
ATOM   389   C CA  . GLU A 1 53  ? 18.555  -43.278 28.660  1.00 42.21  ? 53  GLU A CA  1 
ATOM   390   C C   . GLU A 1 53  ? 17.715  -43.169 27.391  1.00 57.66  ? 53  GLU A C   1 
ATOM   391   O O   . GLU A 1 53  ? 18.236  -43.299 26.281  1.00 54.17  ? 53  GLU A O   1 
ATOM   392   C CB  . GLU A 1 53  ? 18.449  -44.689 29.245  1.00 32.60  ? 53  GLU A CB  1 
ATOM   393   C CG  . GLU A 1 53  ? 18.984  -45.780 28.334  1.00 58.36  ? 53  GLU A CG  1 
ATOM   394   C CD  . GLU A 1 53  ? 20.268  -45.378 27.633  1.00 87.83  ? 53  GLU A CD  1 
ATOM   395   O OE1 . GLU A 1 53  ? 21.234  -44.993 28.327  1.00 108.21 ? 53  GLU A OE1 1 
ATOM   396   O OE2 . GLU A 1 53  ? 20.307  -45.442 26.386  1.00 74.17  ? 53  GLU A OE2 1 
ATOM   397   N N   . LEU A 1 54  ? 16.417  -42.928 27.560  1.00 52.48  ? 54  LEU A N   1 
ATOM   398   C CA  . LEU A 1 54  ? 15.526  -42.712 26.423  1.00 55.88  ? 54  LEU A CA  1 
ATOM   399   C C   . LEU A 1 54  ? 15.973  -41.523 25.579  1.00 50.93  ? 54  LEU A C   1 
ATOM   400   O O   . LEU A 1 54  ? 16.155  -41.650 24.358  1.00 52.93  ? 54  LEU A O   1 
ATOM   401   C CB  . LEU A 1 54  ? 14.086  -42.504 26.899  1.00 62.51  ? 54  LEU A CB  1 
ATOM   402   C CG  . LEU A 1 54  ? 13.302  -43.761 27.276  1.00 57.36  ? 54  LEU A CG  1 
ATOM   403   C CD1 . LEU A 1 54  ? 11.993  -43.391 27.947  1.00 52.89  ? 54  LEU A CD1 1 
ATOM   404   C CD2 . LEU A 1 54  ? 13.044  -44.605 26.037  1.00 49.50  ? 54  LEU A CD2 1 
ATOM   405   N N   . SER A 1 55  ? 16.159  -40.375 26.229  1.00 44.86  ? 55  SER A N   1 
ATOM   406   C CA  . SER A 1 55  ? 16.587  -39.175 25.507  1.00 45.26  ? 55  SER A CA  1 
ATOM   407   C C   . SER A 1 55  ? 17.907  -39.413 24.769  1.00 44.46  ? 55  SER A C   1 
ATOM   408   O O   . SER A 1 55  ? 18.059  -39.045 23.596  1.00 52.10  ? 55  SER A O   1 
ATOM   409   C CB  . SER A 1 55  ? 16.727  -37.988 26.461  1.00 44.31  ? 55  SER A CB  1 
ATOM   410   O OG  . SER A 1 55  ? 17.706  -38.241 27.451  1.00 73.27  ? 55  SER A OG  1 
ATOM   411   N N   . ALA A 1 56  ? 18.846  -40.052 25.462  1.00 43.40  ? 56  ALA A N   1 
ATOM   412   C CA  . ALA A 1 56  ? 20.151  -40.370 24.891  1.00 41.55  ? 56  ALA A CA  1 
ATOM   413   C C   . ALA A 1 56  ? 20.036  -41.241 23.639  1.00 52.54  ? 56  ALA A C   1 
ATOM   414   O O   . ALA A 1 56  ? 20.622  -40.926 22.601  1.00 50.45  ? 56  ALA A O   1 
ATOM   415   C CB  . ALA A 1 56  ? 21.024  -41.056 25.930  1.00 30.63  ? 56  ALA A CB  1 
ATOM   416   N N   . ALA A 1 57  ? 19.284  -42.334 23.746  1.00 44.36  ? 57  ALA A N   1 
ATOM   417   C CA  . ALA A 1 57  ? 19.110  -43.265 22.634  1.00 42.98  ? 57  ALA A CA  1 
ATOM   418   C C   . ALA A 1 57  ? 18.478  -42.573 21.429  1.00 54.40  ? 57  ALA A C   1 
ATOM   419   O O   . ALA A 1 57  ? 18.916  -42.759 20.283  1.00 52.12  ? 57  ALA A O   1 
ATOM   420   C CB  . ALA A 1 57  ? 18.265  -44.454 23.068  1.00 40.81  ? 57  ALA A CB  1 
ATOM   421   N N   . THR A 1 58  ? 17.449  -41.773 21.697  1.00 52.26  ? 58  THR A N   1 
ATOM   422   C CA  . THR A 1 58  ? 16.769  -41.025 20.645  1.00 60.09  ? 58  THR A CA  1 
ATOM   423   C C   . THR A 1 58  ? 17.748  -40.107 19.907  1.00 52.91  ? 58  THR A C   1 
ATOM   424   O O   . THR A 1 58  ? 17.845  -40.129 18.665  1.00 58.67  ? 58  THR A O   1 
ATOM   425   C CB  . THR A 1 58  ? 15.615  -40.185 21.228  1.00 48.28  ? 58  THR A CB  1 
ATOM   426   O OG1 . THR A 1 58  ? 14.932  -40.941 22.235  1.00 55.01  ? 58  THR A OG1 1 
ATOM   427   C CG2 . THR A 1 58  ? 14.633  -39.794 20.144  1.00 74.46  ? 58  THR A CG2 1 
ATOM   428   N N   . HIS A 1 59  ? 18.493  -39.323 20.684  1.00 55.01  ? 59  HIS A N   1 
ATOM   429   C CA  . HIS A 1 59  ? 19.493  -38.417 20.127  1.00 59.91  ? 59  HIS A CA  1 
ATOM   430   C C   . HIS A 1 59  ? 20.524  -39.162 19.277  1.00 62.49  ? 59  HIS A C   1 
ATOM   431   O O   . HIS A 1 59  ? 20.887  -38.714 18.184  1.00 56.97  ? 59  HIS A O   1 
ATOM   432   C CB  . HIS A 1 59  ? 20.199  -37.650 21.247  1.00 60.10  ? 59  HIS A CB  1 
ATOM   433   C CG  . HIS A 1 59  ? 21.151  -36.606 20.754  1.00 63.39  ? 59  HIS A CG  1 
ATOM   434   N ND1 . HIS A 1 59  ? 20.730  -35.418 20.198  1.00 68.93  ? 59  HIS A ND1 1 
ATOM   435   C CD2 . HIS A 1 59  ? 22.505  -36.575 20.729  1.00 63.20  ? 59  HIS A CD2 1 
ATOM   436   C CE1 . HIS A 1 59  ? 21.783  -34.698 19.854  1.00 88.09  ? 59  HIS A CE1 1 
ATOM   437   N NE2 . HIS A 1 59  ? 22.872  -35.377 20.165  1.00 86.54  ? 59  HIS A NE2 1 
ATOM   438   N N   . LEU A 1 60  ? 20.987  -40.300 19.787  1.00 49.38  ? 60  LEU A N   1 
ATOM   439   C CA  . LEU A 1 60  ? 21.995  -41.104 19.103  1.00 45.39  ? 60  LEU A CA  1 
ATOM   440   C C   . LEU A 1 60  ? 21.499  -41.601 17.746  1.00 67.77  ? 60  LEU A C   1 
ATOM   441   O O   . LEU A 1 60  ? 22.208  -41.500 16.728  1.00 75.07  ? 60  LEU A O   1 
ATOM   442   C CB  . LEU A 1 60  ? 22.400  -42.291 19.978  1.00 46.37  ? 60  LEU A CB  1 
ATOM   443   C CG  . LEU A 1 60  ? 23.894  -42.602 20.057  1.00 80.89  ? 60  LEU A CG  1 
ATOM   444   C CD1 . LEU A 1 60  ? 24.589  -41.626 20.996  1.00 53.12  ? 60  LEU A CD1 1 
ATOM   445   C CD2 . LEU A 1 60  ? 24.123  -44.038 20.498  1.00 81.23  ? 60  LEU A CD2 1 
ATOM   446   N N   . THR A 1 61  ? 20.269  -42.114 17.731  1.00 56.07  ? 61  THR A N   1 
ATOM   447   C CA  . THR A 1 61  ? 19.648  -42.552 16.483  1.00 56.18  ? 61  THR A CA  1 
ATOM   448   C C   . THR A 1 61  ? 19.591  -41.402 15.480  1.00 71.05  ? 61  THR A C   1 
ATOM   449   O O   . THR A 1 61  ? 19.983  -41.556 14.307  1.00 74.48  ? 61  THR A O   1 
ATOM   450   C CB  . THR A 1 61  ? 18.220  -43.089 16.712  1.00 42.67  ? 61  THR A CB  1 
ATOM   451   O OG1 . THR A 1 61  ? 18.281  -44.443 17.178  1.00 67.72  ? 61  THR A OG1 1 
ATOM   452   C CG2 . THR A 1 61  ? 17.424  -43.044 15.419  1.00 56.20  ? 61  THR A CG2 1 
ATOM   453   N N   . SER A 1 62  ? 19.119  -40.249 15.952  1.00 51.48  ? 62  SER A N   1 
ATOM   454   C CA  . SER A 1 62  ? 19.076  -39.047 15.119  1.00 58.08  ? 62  SER A CA  1 
ATOM   455   C C   . SER A 1 62  ? 20.423  -38.724 14.481  1.00 67.04  ? 62  SER A C   1 
ATOM   456   O O   . SER A 1 62  ? 20.514  -38.461 13.277  1.00 76.38  ? 62  SER A O   1 
ATOM   457   C CB  . SER A 1 62  ? 18.620  -37.843 15.931  1.00 52.91  ? 62  SER A CB  1 
ATOM   458   O OG  . SER A 1 62  ? 18.689  -36.678 15.131  1.00 79.42  ? 62  SER A OG  1 
ATOM   459   N N   . LYS A 1 63  ? 21.464  -38.740 15.306  1.00 68.68  ? 63  LYS A N   1 
ATOM   460   C CA  . LYS A 1 63  ? 22.816  -38.436 14.854  1.00 71.67  ? 63  LYS A CA  1 
ATOM   461   C C   . LYS A 1 63  ? 23.257  -39.399 13.748  1.00 75.32  ? 63  LYS A C   1 
ATOM   462   O O   . LYS A 1 63  ? 23.815  -38.983 12.700  1.00 84.50  ? 63  LYS A O   1 
ATOM   463   C CB  . LYS A 1 63  ? 23.765  -38.499 16.054  1.00 65.05  ? 63  LYS A CB  1 
ATOM   464   C CG  . LYS A 1 63  ? 25.206  -38.131 15.782  1.00 88.72  ? 63  LYS A CG  1 
ATOM   465   C CD  . LYS A 1 63  ? 26.015  -38.210 17.068  1.00 87.15  ? 63  LYS A CD  1 
ATOM   466   C CE  . LYS A 1 63  ? 27.500  -38.076 16.796  1.00 110.88 ? 63  LYS A CE  1 
ATOM   467   N NZ  . LYS A 1 63  ? 27.835  -36.759 16.189  1.00 113.24 ? 63  LYS A NZ  1 
ATOM   468   N N   . LEU A 1 64  ? 22.935  -40.675 13.959  1.00 64.96  ? 64  LEU A N   1 
ATOM   469   C CA  . LEU A 1 64  ? 23.235  -41.704 12.972  1.00 61.98  ? 64  LEU A CA  1 
ATOM   470   C C   . LEU A 1 64  ? 22.587  -41.378 11.637  1.00 66.85  ? 64  LEU A C   1 
ATOM   471   O O   . LEU A 1 64  ? 23.242  -41.420 10.590  1.00 83.54  ? 64  LEU A O   1 
ATOM   472   C CB  . LEU A 1 64  ? 22.759  -43.073 13.456  1.00 70.97  ? 64  LEU A CB  1 
ATOM   473   C CG  . LEU A 1 64  ? 23.084  -44.196 12.473  1.00 78.72  ? 64  LEU A CG  1 
ATOM   474   C CD1 . LEU A 1 64  ? 24.579  -44.245 12.219  1.00 72.04  ? 64  LEU A CD1 1 
ATOM   475   C CD2 . LEU A 1 64  ? 22.572  -45.531 12.982  1.00 73.31  ? 64  LEU A CD2 1 
ATOM   476   N N   . LEU A 1 65  ? 21.308  -41.022 11.680  1.00 67.42  ? 65  LEU A N   1 
ATOM   477   C CA  . LEU A 1 65  ? 20.619  -40.608 10.463  1.00 77.62  ? 65  LEU A CA  1 
ATOM   478   C C   . LEU A 1 65  ? 21.360  -39.458 9.766   1.00 91.05  ? 65  LEU A C   1 
ATOM   479   O O   . LEU A 1 65  ? 21.763  -39.544 8.566   1.00 107.86 ? 65  LEU A O   1 
ATOM   480   C CB  . LEU A 1 65  ? 19.190  -40.164 10.793  1.00 74.01  ? 65  LEU A CB  1 
ATOM   481   C CG  . LEU A 1 65  ? 18.247  -41.170 11.456  1.00 74.20  ? 65  LEU A CG  1 
ATOM   482   C CD1 . LEU A 1 65  ? 16.920  -40.507 11.790  1.00 63.88  ? 65  LEU A CD1 1 
ATOM   483   C CD2 . LEU A 1 65  ? 18.036  -42.368 10.552  1.00 52.19  ? 65  LEU A CD2 1 
ATOM   484   N N   . LYS A 1 66  ? 21.617  -38.415 10.557  1.00 81.26  ? 66  LYS A N   1 
ATOM   485   C CA  . LYS A 1 66  ? 22.168  -37.183 10.011  1.00 86.26  ? 66  LYS A CA  1 
ATOM   486   C C   . LYS A 1 66  ? 23.547  -37.301 9.406   1.00 107.48 ? 66  LYS A C   1 
ATOM   487   O O   . LYS A 1 66  ? 23.910  -36.455 8.591   1.00 109.58 ? 66  LYS A O   1 
ATOM   488   C CB  . LYS A 1 66  ? 22.209  -36.084 11.077  1.00 75.85  ? 66  LYS A CB  1 
ATOM   489   C CG  . LYS A 1 66  ? 20.868  -35.584 11.529  1.00 91.44  ? 66  LYS A CG  1 
ATOM   490   C CD  . LYS A 1 66  ? 21.045  -34.492 12.558  1.00 95.92  ? 66  LYS A CD  1 
ATOM   491   C CE  . LYS A 1 66  ? 19.708  -33.960 13.012  1.00 93.63  ? 66  LYS A CE  1 
ATOM   492   N NZ  . LYS A 1 66  ? 19.875  -32.889 14.024  1.00 94.31  ? 66  LYS A NZ  1 
ATOM   493   N N   . GLU A 1 67  ? 24.333  -38.310 9.759   1.00 103.03 ? 67  GLU A N   1 
ATOM   494   C CA  . GLU A 1 67  ? 25.548  -38.443 8.962   1.00 103.01 ? 67  GLU A CA  1 
ATOM   495   C C   . GLU A 1 67  ? 25.353  -39.647 8.014   1.00 94.81  ? 67  GLU A C   1 
ATOM   496   O O   . GLU A 1 67  ? 26.261  -40.002 7.224   1.00 92.44  ? 67  GLU A O   1 
ATOM   497   C CB  . GLU A 1 67  ? 26.825  -38.534 9.822   1.00 105.47 ? 67  GLU A CB  1 
ATOM   498   C CG  . GLU A 1 67  ? 28.088  -38.749 8.983   1.00 132.93 ? 67  GLU A CG  1 
ATOM   499   C CD  . GLU A 1 67  ? 29.371  -38.383 9.703   1.00 130.59 ? 67  GLU A CD  1 
ATOM   500   O OE1 . GLU A 1 67  ? 29.331  -38.139 10.926  1.00 125.08 ? 67  GLU A OE1 1 
ATOM   501   O OE2 . GLU A 1 67  ? 30.417  -38.273 9.024   1.00 121.61 ? 67  GLU A OE2 1 
ATOM   502   N N   . TYR A 1 68  ? 24.166  -40.258 8.042   1.00 94.09  ? 68  TYR A N   1 
ATOM   503   C CA  . TYR A 1 68  ? 23.927  -41.279 7.042   1.00 94.33  ? 68  TYR A CA  1 
ATOM   504   C C   . TYR A 1 68  ? 23.356  -40.804 5.697   1.00 98.78  ? 68  TYR A C   1 
ATOM   505   O O   . TYR A 1 68  ? 23.385  -41.578 4.737   1.00 106.17 ? 68  TYR A O   1 
ATOM   506   C CB  . TYR A 1 68  ? 22.997  -42.318 7.641   1.00 101.27 ? 68  TYR A CB  1 
ATOM   507   N N   . GLU A 1 69  ? 22.845  -39.573 5.591   1.00 98.98  ? 69  GLU A N   1 
ATOM   508   C CA  . GLU A 1 69  ? 22.661  -39.042 4.215   1.00 118.94 ? 69  GLU A CA  1 
ATOM   509   C C   . GLU A 1 69  ? 23.964  -38.454 3.651   1.00 116.55 ? 69  GLU A C   1 
ATOM   510   O O   . GLU A 1 69  ? 24.147  -38.369 2.425   1.00 115.42 ? 69  GLU A O   1 
ATOM   511   C CB  . GLU A 1 69  ? 21.560  -37.976 4.096   1.00 116.86 ? 69  GLU A CB  1 
ATOM   512   C CG  . GLU A 1 69  ? 21.321  -37.093 5.281   1.00 113.80 ? 69  GLU A CG  1 
ATOM   513   C CD  . GLU A 1 69  ? 20.412  -37.751 6.288   1.00 133.28 ? 69  GLU A CD  1 
ATOM   514   O OE1 . GLU A 1 69  ? 20.456  -38.993 6.411   1.00 132.42 ? 69  GLU A OE1 1 
ATOM   515   O OE2 . GLU A 1 69  ? 19.597  -37.030 6.901   1.00 141.88 ? 69  GLU A OE2 1 
ATOM   516   N N   . LYS A 1 70  ? 24.850  -38.019 4.542   1.00 102.61 ? 70  LYS A N   1 
ATOM   517   C CA  . LYS A 1 70  ? 26.190  -37.607 4.142   1.00 103.87 ? 70  LYS A CA  1 
ATOM   518   C C   . LYS A 1 70  ? 26.992  -38.756 3.524   1.00 98.45  ? 70  LYS A C   1 
ATOM   519   O O   . LYS A 1 70  ? 28.097  -39.064 3.979   1.00 83.37  ? 70  LYS A O   1 
ATOM   520   C CB  . LYS A 1 70  ? 26.939  -37.029 5.338   1.00 94.48  ? 70  LYS A CB  1 
ATOM   521   N N   . GLU A 1 80  ? 17.584  -39.954 -3.592  1.00 81.67  ? 80  GLU A N   1 
ATOM   522   C CA  . GLU A 1 80  ? 16.989  -38.632 -3.825  1.00 103.69 ? 80  GLU A CA  1 
ATOM   523   C C   . GLU A 1 80  ? 15.843  -38.308 -2.865  1.00 113.52 ? 80  GLU A C   1 
ATOM   524   O O   . GLU A 1 80  ? 15.977  -37.460 -1.974  1.00 109.13 ? 80  GLU A O   1 
ATOM   525   C CB  . GLU A 1 80  ? 16.497  -38.542 -5.267  1.00 107.07 ? 80  GLU A CB  1 
ATOM   526   N N   . VAL A 1 81  ? 14.728  -39.003 -3.063  1.00 116.55 ? 81  VAL A N   1 
ATOM   527   C CA  . VAL A 1 81  ? 13.612  -39.063 -2.116  1.00 109.73 ? 81  VAL A CA  1 
ATOM   528   C C   . VAL A 1 81  ? 14.064  -39.292 -0.657  1.00 109.61 ? 81  VAL A C   1 
ATOM   529   O O   . VAL A 1 81  ? 13.755  -38.525 0.288   1.00 109.04 ? 81  VAL A O   1 
ATOM   530   C CB  . VAL A 1 81  ? 12.641  -40.188 -2.572  1.00 92.79  ? 81  VAL A CB  1 
ATOM   531   C CG1 . VAL A 1 81  ? 13.437  -41.360 -3.198  1.00 97.58  ? 81  VAL A CG1 1 
ATOM   532   C CG2 . VAL A 1 81  ? 11.775  -40.685 -1.431  1.00 101.73 ? 81  VAL A CG2 1 
ATOM   533   N N   . MET A 1 82  ? 14.846  -40.349 -0.516  1.00 107.43 ? 82  MET A N   1 
ATOM   534   C CA  . MET A 1 82  ? 15.175  -40.961 0.757   1.00 106.98 ? 82  MET A CA  1 
ATOM   535   C C   . MET A 1 82  ? 15.925  -40.009 1.690   1.00 103.76 ? 82  MET A C   1 
ATOM   536   O O   . MET A 1 82  ? 15.784  -40.076 2.910   1.00 105.14 ? 82  MET A O   1 
ATOM   537   C CB  . MET A 1 82  ? 15.952  -42.235 0.468   1.00 99.03  ? 82  MET A CB  1 
ATOM   538   C CG  . MET A 1 82  ? 16.216  -43.162 1.600   1.00 101.81 ? 82  MET A CG  1 
ATOM   539   S SD  . MET A 1 82  ? 16.989  -44.579 0.810   1.00 122.71 ? 82  MET A SD  1 
ATOM   540   C CE  . MET A 1 82  ? 17.273  -45.614 2.227   1.00 105.83 ? 82  MET A CE  1 
ATOM   541   N N   . SER A 1 83  ? 16.724  -39.122 1.108   1.00 106.15 ? 83  SER A N   1 
ATOM   542   C CA  . SER A 1 83  ? 17.510  -38.179 1.893   1.00 112.61 ? 83  SER A CA  1 
ATOM   543   C C   . SER A 1 83  ? 16.646  -37.156 2.625   1.00 105.61 ? 83  SER A C   1 
ATOM   544   O O   . SER A 1 83  ? 16.763  -37.002 3.842   1.00 116.62 ? 83  SER A O   1 
ATOM   545   C CB  . SER A 1 83  ? 18.498  -37.449 0.980   1.00 110.82 ? 83  SER A CB  1 
ATOM   546   O OG  . SER A 1 83  ? 18.947  -38.304 -0.053  1.00 106.95 ? 83  SER A OG  1 
ATOM   547   N N   . SER A 1 84  ? 15.696  -36.556 1.914   1.00 82.08  ? 84  SER A N   1 
ATOM   548   C CA  . SER A 1 84  ? 14.750  -35.658 2.559   1.00 97.17  ? 84  SER A CA  1 
ATOM   549   C C   . SER A 1 84  ? 13.855  -36.402 3.539   1.00 103.38 ? 84  SER A C   1 
ATOM   550   O O   . SER A 1 84  ? 13.549  -35.871 4.615   1.00 97.90  ? 84  SER A O   1 
ATOM   551   C CB  . SER A 1 84  ? 13.901  -34.934 1.512   1.00 85.48  ? 84  SER A CB  1 
ATOM   552   O OG  . SER A 1 84  ? 12.684  -34.476 2.074   1.00 95.74  ? 84  SER A OG  1 
ATOM   553   N N   . THR A 1 85  ? 13.461  -37.632 3.207   1.00 94.71  ? 85  THR A N   1 
ATOM   554   C CA  . THR A 1 85  ? 12.604  -38.363 4.143   1.00 85.74  ? 85  THR A CA  1 
ATOM   555   C C   . THR A 1 85  ? 13.358  -38.599 5.457   1.00 90.97  ? 85  THR A C   1 
ATOM   556   O O   . THR A 1 85  ? 12.818  -38.399 6.554   1.00 92.45  ? 85  THR A O   1 
ATOM   557   C CB  . THR A 1 85  ? 12.121  -39.707 3.570   1.00 84.94  ? 85  THR A CB  1 
ATOM   558   O OG1 . THR A 1 85  ? 13.246  -40.558 3.320   1.00 89.60  ? 85  THR A OG1 1 
ATOM   559   C CG2 . THR A 1 85  ? 11.350  -39.489 2.277   1.00 91.06  ? 85  THR A CG2 1 
ATOM   560   N N   . LEU A 1 86  ? 14.621  -38.996 5.328   1.00 91.53  ? 86  LEU A N   1 
ATOM   561   C CA  . LEU A 1 86  ? 15.490  -39.238 6.475   1.00 91.56  ? 86  LEU A CA  1 
ATOM   562   C C   . LEU A 1 86  ? 15.821  -37.986 7.289   1.00 94.45  ? 86  LEU A C   1 
ATOM   563   O O   . LEU A 1 86  ? 16.061  -38.088 8.490   1.00 87.71  ? 86  LEU A O   1 
ATOM   564   C CB  . LEU A 1 86  ? 16.789  -39.916 6.021   1.00 81.21  ? 86  LEU A CB  1 
ATOM   565   C CG  . LEU A 1 86  ? 16.819  -41.448 6.134   1.00 78.96  ? 86  LEU A CG  1 
ATOM   566   C CD1 . LEU A 1 86  ? 15.760  -42.111 5.264   1.00 96.38  ? 86  LEU A CD1 1 
ATOM   567   C CD2 . LEU A 1 86  ? 18.203  -42.002 5.811   1.00 82.78  ? 86  LEU A CD2 1 
ATOM   568   N N   . GLN A 1 87  ? 15.854  -36.810 6.665   1.00 89.05  ? 87  GLN A N   1 
ATOM   569   C CA  . GLN A 1 87  ? 16.071  -35.603 7.470   1.00 86.49  ? 87  GLN A CA  1 
ATOM   570   C C   . GLN A 1 87  ? 14.774  -35.143 8.161   1.00 83.07  ? 87  GLN A C   1 
ATOM   571   O O   . GLN A 1 87  ? 14.825  -34.578 9.260   1.00 100.93 ? 87  GLN A O   1 
ATOM   572   C CB  . GLN A 1 87  ? 16.673  -34.459 6.637   1.00 93.77  ? 87  GLN A CB  1 
ATOM   573   C CG  . GLN A 1 87  ? 17.661  -34.904 5.575   1.00 110.10 ? 87  GLN A CG  1 
ATOM   574   C CD  . GLN A 1 87  ? 18.157  -33.748 4.724   1.00 119.55 ? 87  GLN A CD  1 
ATOM   575   O OE1 . GLN A 1 87  ? 17.406  -32.818 4.419   1.00 114.89 ? 87  GLN A OE1 1 
ATOM   576   N NE2 . GLN A 1 87  ? 19.423  -33.807 4.328   1.00 116.03 ? 87  GLN A NE2 1 
ATOM   577   N N   . GLN A 1 88  ? 13.619  -35.360 7.531   1.00 75.71  ? 88  GLN A N   1 
ATOM   578   C CA  . GLN A 1 88  ? 12.361  -35.133 8.249   1.00 78.45  ? 88  GLN A CA  1 
ATOM   579   C C   . GLN A 1 88  ? 12.313  -36.031 9.483   1.00 75.45  ? 88  GLN A C   1 
ATOM   580   O O   . GLN A 1 88  ? 11.971  -35.591 10.592  1.00 69.18  ? 88  GLN A O   1 
ATOM   581   C CB  . GLN A 1 88  ? 11.141  -35.404 7.366   1.00 76.48  ? 88  GLN A CB  1 
ATOM   582   C CG  . GLN A 1 88  ? 11.090  -34.617 6.076   1.00 86.13  ? 88  GLN A CG  1 
ATOM   583   C CD  . GLN A 1 88  ? 10.168  -35.257 5.057   1.00 98.45  ? 88  GLN A CD  1 
ATOM   584   O OE1 . GLN A 1 88  ? 9.247   -35.996 5.412   1.00 92.09  ? 88  GLN A OE1 1 
ATOM   585   N NE2 . GLN A 1 88  ? 10.410  -34.979 3.783   1.00 95.03  ? 88  GLN A NE2 1 
ATOM   586   N N   . PHE A 1 89  ? 12.691  -37.290 9.277   1.00 73.77  ? 89  PHE A N   1 
ATOM   587   C CA  . PHE A 1 89  ? 12.694  -38.284 10.344  1.00 67.67  ? 89  PHE A CA  1 
ATOM   588   C C   . PHE A 1 89  ? 13.683  -37.901 11.441  1.00 72.09  ? 89  PHE A C   1 
ATOM   589   O O   . PHE A 1 89  ? 13.388  -38.031 12.632  1.00 83.25  ? 89  PHE A O   1 
ATOM   590   C CB  . PHE A 1 89  ? 13.026  -39.665 9.780   1.00 70.18  ? 89  PHE A CB  1 
ATOM   591   C CG  . PHE A 1 89  ? 12.841  -40.783 10.764  1.00 67.13  ? 89  PHE A CG  1 
ATOM   592   C CD1 . PHE A 1 89  ? 11.659  -40.911 11.473  1.00 69.19  ? 89  PHE A CD1 1 
ATOM   593   C CD2 . PHE A 1 89  ? 13.841  -41.719 10.965  1.00 75.92  ? 89  PHE A CD2 1 
ATOM   594   C CE1 . PHE A 1 89  ? 11.482  -41.943 12.373  1.00 65.09  ? 89  PHE A CE1 1 
ATOM   595   C CE2 . PHE A 1 89  ? 13.670  -42.755 11.863  1.00 68.54  ? 89  PHE A CE2 1 
ATOM   596   C CZ  . PHE A 1 89  ? 12.487  -42.867 12.567  1.00 54.09  ? 89  PHE A CZ  1 
ATOM   597   N N   . SER A 1 90  ? 14.860  -37.435 11.038  1.00 76.33  ? 90  SER A N   1 
ATOM   598   C CA  . SER A 1 90  ? 15.860  -37.006 12.004  1.00 80.92  ? 90  SER A CA  1 
ATOM   599   C C   . SER A 1 90  ? 15.319  -35.836 12.819  1.00 72.64  ? 90  SER A C   1 
ATOM   600   O O   . SER A 1 90  ? 15.509  -35.772 14.036  1.00 81.03  ? 90  SER A O   1 
ATOM   601   C CB  . SER A 1 90  ? 17.166  -36.619 11.300  1.00 80.13  ? 90  SER A CB  1 
ATOM   602   O OG  . SER A 1 90  ? 17.026  -35.410 10.573  1.00 82.63  ? 90  SER A OG  1 
ATOM   603   N N   . LYS A 1 91  ? 14.565  -34.960 12.161  1.00 53.58  ? 91  LYS A N   1 
ATOM   604   C CA  . LYS A 1 91  ? 14.063  -33.759 12.820  1.00 70.28  ? 91  LYS A CA  1 
ATOM   605   C C   . LYS A 1 91  ? 13.000  -34.110 13.870  1.00 81.14  ? 91  LYS A C   1 
ATOM   606   O O   . LYS A 1 91  ? 13.062  -33.640 15.027  1.00 86.68  ? 91  LYS A O   1 
ATOM   607   C CB  . LYS A 1 91  ? 13.483  -32.792 11.776  1.00 71.73  ? 91  LYS A CB  1 
ATOM   608   C CG  . LYS A 1 91  ? 12.158  -32.164 12.179  1.00 93.48  ? 91  LYS A CG  1 
ATOM   609   C CD  . LYS A 1 91  ? 11.749  -31.017 11.277  1.00 103.04 ? 91  LYS A CD  1 
ATOM   610   C CE  . LYS A 1 91  ? 10.334  -30.584 11.613  1.00 96.39  ? 91  LYS A CE  1 
ATOM   611   N NZ  . LYS A 1 91  ? 9.387   -31.727 11.460  1.00 90.02  ? 91  LYS A NZ  1 
ATOM   612   N N   . VAL A 1 92  ? 12.063  -34.979 13.493  1.00 64.76  ? 92  VAL A N   1 
ATOM   613   C CA  . VAL A 1 92  ? 11.005  -35.363 14.422  1.00 72.40  ? 92  VAL A CA  1 
ATOM   614   C C   . VAL A 1 92  ? 11.596  -36.172 15.577  1.00 78.82  ? 92  VAL A C   1 
ATOM   615   O O   . VAL A 1 92  ? 11.169  -36.028 16.733  1.00 76.43  ? 92  VAL A O   1 
ATOM   616   C CB  . VAL A 1 92  ? 9.868   -36.160 13.726  1.00 51.62  ? 92  VAL A CB  1 
ATOM   617   C CG1 . VAL A 1 92  ? 9.176   -35.294 12.684  1.00 85.98  ? 92  VAL A CG1 1 
ATOM   618   C CG2 . VAL A 1 92  ? 10.383  -37.447 13.105  1.00 50.07  ? 92  VAL A CG2 1 
ATOM   619   N N   . ILE A 1 93  ? 12.592  -37.001 15.273  1.00 67.03  ? 93  ILE A N   1 
ATOM   620   C CA  . ILE A 1 93  ? 13.259  -37.770 16.314  1.00 59.89  ? 93  ILE A CA  1 
ATOM   621   C C   . ILE A 1 93  ? 13.974  -36.864 17.313  1.00 67.70  ? 93  ILE A C   1 
ATOM   622   O O   . ILE A 1 93  ? 13.948  -37.126 18.517  1.00 82.90  ? 93  ILE A O   1 
ATOM   623   C CB  . ILE A 1 93  ? 14.261  -38.772 15.707  1.00 58.68  ? 93  ILE A CB  1 
ATOM   624   C CG1 . ILE A 1 93  ? 13.533  -40.043 15.277  1.00 59.72  ? 93  ILE A CG1 1 
ATOM   625   C CG2 . ILE A 1 93  ? 15.344  -39.142 16.702  1.00 65.64  ? 93  ILE A CG2 1 
ATOM   626   C CD1 . ILE A 1 93  ? 14.465  -41.113 14.782  1.00 68.44  ? 93  ILE A CD1 1 
ATOM   627   N N   . ASP A 1 94  ? 14.557  -35.770 16.829  1.00 63.22  ? 94  ASP A N   1 
ATOM   628   C CA  . ASP A 1 94  ? 15.225  -34.830 17.728  1.00 69.36  ? 94  ASP A CA  1 
ATOM   629   C C   . ASP A 1 94  ? 14.231  -34.051 18.578  1.00 75.60  ? 94  ASP A C   1 
ATOM   630   O O   . ASP A 1 94  ? 14.552  -33.660 19.707  1.00 75.11  ? 94  ASP A O   1 
ATOM   631   C CB  . ASP A 1 94  ? 16.108  -33.834 16.976  1.00 71.58  ? 94  ASP A CB  1 
ATOM   632   C CG  . ASP A 1 94  ? 17.451  -34.411 16.595  1.00 94.94  ? 94  ASP A CG  1 
ATOM   633   O OD1 . ASP A 1 94  ? 18.404  -34.248 17.382  1.00 98.79  ? 94  ASP A OD1 1 
ATOM   634   O OD2 . ASP A 1 94  ? 17.571  -34.971 15.494  1.00 97.59  ? 94  ASP A OD2 1 
ATOM   635   N N   . GLU A 1 95  ? 13.046  -33.782 18.035  1.00 70.16  ? 95  GLU A N   1 
ATOM   636   C CA  . GLU A 1 95  ? 12.043  -33.128 18.860  1.00 74.12  ? 95  GLU A CA  1 
ATOM   637   C C   . GLU A 1 95  ? 11.522  -34.070 19.949  1.00 68.74  ? 95  GLU A C   1 
ATOM   638   O O   . GLU A 1 95  ? 11.275  -33.645 21.089  1.00 73.70  ? 95  GLU A O   1 
ATOM   639   C CB  . GLU A 1 95  ? 10.891  -32.615 18.005  1.00 71.55  ? 95  GLU A CB  1 
ATOM   640   C CG  . GLU A 1 95  ? 10.468  -31.207 18.394  1.00 85.44  ? 95  GLU A CG  1 
ATOM   641   C CD  . GLU A 1 95  ? 9.565   -30.550 17.376  1.00 122.18 ? 95  GLU A CD  1 
ATOM   642   O OE1 . GLU A 1 95  ? 8.338   -30.505 17.610  1.00 123.84 ? 95  GLU A OE1 1 
ATOM   643   O OE2 . GLU A 1 95  ? 10.077  -30.070 16.344  1.00 132.40 ? 95  GLU A OE2 1 
ATOM   644   N N   . LEU A 1 96  ? 11.377  -35.349 19.608  1.00 56.41  ? 96  LEU A N   1 
ATOM   645   C CA  . LEU A 1 96  ? 11.035  -36.351 20.615  1.00 57.02  ? 96  LEU A CA  1 
ATOM   646   C C   . LEU A 1 96  ? 12.109  -36.413 21.703  1.00 67.21  ? 96  LEU A C   1 
ATOM   647   O O   . LEU A 1 96  ? 11.805  -36.425 22.903  1.00 66.12  ? 96  LEU A O   1 
ATOM   648   C CB  . LEU A 1 96  ? 10.848  -37.727 19.976  1.00 44.92  ? 96  LEU A CB  1 
ATOM   649   C CG  . LEU A 1 96  ? 10.689  -38.873 20.978  1.00 57.07  ? 96  LEU A CG  1 
ATOM   650   C CD1 . LEU A 1 96  ? 9.423   -38.707 21.804  1.00 69.44  ? 96  LEU A CD1 1 
ATOM   651   C CD2 . LEU A 1 96  ? 10.692  -40.215 20.273  1.00 45.18  ? 96  LEU A CD2 1 
ATOM   652   N N   . SER A 1 97  ? 13.365  -36.451 21.267  1.00 59.73  ? 97  SER A N   1 
ATOM   653   C CA  . SER A 1 97  ? 14.509  -36.460 22.171  1.00 54.34  ? 97  SER A CA  1 
ATOM   654   C C   . SER A 1 97  ? 14.489  -35.248 23.094  1.00 72.35  ? 97  SER A C   1 
ATOM   655   O O   . SER A 1 97  ? 14.809  -35.353 24.278  1.00 74.86  ? 97  SER A O   1 
ATOM   656   C CB  . SER A 1 97  ? 15.818  -36.492 21.378  1.00 63.24  ? 97  SER A CB  1 
ATOM   657   O OG  . SER A 1 97  ? 16.938  -36.520 22.246  1.00 66.15  ? 97  SER A OG  1 
ATOM   658   N N   . SER A 1 98  ? 14.119  -34.098 22.537  1.00 66.55  ? 98  SER A N   1 
ATOM   659   C CA  . SER A 1 98  ? 13.963  -32.874 23.314  1.00 64.83  ? 98  SER A CA  1 
ATOM   660   C C   . SER A 1 98  ? 12.898  -33.052 24.391  1.00 73.49  ? 98  SER A C   1 
ATOM   661   O O   . SER A 1 98  ? 13.084  -32.633 25.540  1.00 76.38  ? 98  SER A O   1 
ATOM   662   C CB  . SER A 1 98  ? 13.604  -31.701 22.399  1.00 74.01  ? 98  SER A CB  1 
ATOM   663   O OG  . SER A 1 98  ? 13.127  -30.595 23.145  1.00 79.43  ? 98  SER A OG  1 
ATOM   664   N N   . CYS A 1 99  ? 11.783  -33.675 24.013  1.00 64.20  ? 99  CYS A N   1 
ATOM   665   C CA  . CYS A 1 99  ? 10.715  -33.964 24.968  1.00 58.35  ? 99  CYS A CA  1 
ATOM   666   C C   . CYS A 1 99  ? 11.236  -34.806 26.135  1.00 57.13  ? 99  CYS A C   1 
ATOM   667   O O   . CYS A 1 99  ? 11.066  -34.445 27.309  1.00 61.42  ? 99  CYS A O   1 
ATOM   668   C CB  . CYS A 1 99  ? 9.555   -34.683 24.278  1.00 53.46  ? 99  CYS A CB  1 
ATOM   669   S SG  . CYS A 1 99  ? 8.401   -33.588 23.421  1.00 81.42  ? 99  CYS A SG  1 
ATOM   670   N N   . HIS A 1 100 ? 11.878  -35.925 25.809  1.00 50.18  ? 100 HIS A N   1 
ATOM   671   C CA  . HIS A 1 100 ? 12.436  -36.798 26.838  1.00 60.18  ? 100 HIS A CA  1 
ATOM   672   C C   . HIS A 1 100 ? 13.456  -36.066 27.712  1.00 61.14  ? 100 HIS A C   1 
ATOM   673   O O   . HIS A 1 100 ? 13.560  -36.328 28.911  1.00 54.35  ? 100 HIS A O   1 
ATOM   674   C CB  . HIS A 1 100 ? 13.082  -38.032 26.205  1.00 55.71  ? 100 HIS A CB  1 
ATOM   675   C CG  . HIS A 1 100 ? 12.097  -39.035 25.689  1.00 49.12  ? 100 HIS A CG  1 
ATOM   676   N ND1 . HIS A 1 100 ? 11.217  -39.702 26.511  1.00 49.72  ? 100 HIS A ND1 1 
ATOM   677   C CD2 . HIS A 1 100 ? 11.863  -39.491 24.436  1.00 61.94  ? 100 HIS A CD2 1 
ATOM   678   C CE1 . HIS A 1 100 ? 10.476  -40.523 25.786  1.00 52.73  ? 100 HIS A CE1 1 
ATOM   679   N NE2 . HIS A 1 100 ? 10.849  -40.414 24.524  1.00 71.48  ? 100 HIS A NE2 1 
ATOM   680   N N   . ALA A 1 101 ? 14.197  -35.143 27.107  1.00 62.24  ? 101 ALA A N   1 
ATOM   681   C CA  . ALA A 1 101 ? 15.197  -34.366 27.833  1.00 58.48  ? 101 ALA A CA  1 
ATOM   682   C C   . ALA A 1 101 ? 14.566  -33.426 28.860  1.00 55.08  ? 101 ALA A C   1 
ATOM   683   O O   . ALA A 1 101 ? 14.980  -33.401 30.025  1.00 66.33  ? 101 ALA A O   1 
ATOM   684   C CB  . ALA A 1 101 ? 16.055  -33.576 26.857  1.00 56.36  ? 101 ALA A CB  1 
ATOM   685   N N   . VAL A 1 102 ? 13.566  -32.657 28.434  1.00 47.17  ? 102 VAL A N   1 
ATOM   686   C CA  . VAL A 1 102 ? 12.923  -31.713 29.344  1.00 55.92  ? 102 VAL A CA  1 
ATOM   687   C C   . VAL A 1 102 ? 12.208  -32.485 30.457  1.00 56.00  ? 102 VAL A C   1 
ATOM   688   O O   . VAL A 1 102 ? 12.179  -32.044 31.618  1.00 49.15  ? 102 VAL A O   1 
ATOM   689   C CB  . VAL A 1 102 ? 11.943  -30.756 28.606  1.00 43.81  ? 102 VAL A CB  1 
ATOM   690   C CG1 . VAL A 1 102 ? 10.709  -31.485 28.112  1.00 63.43  ? 102 VAL A CG1 1 
ATOM   691   C CG2 . VAL A 1 102 ? 11.547  -29.599 29.510  1.00 63.71  ? 102 VAL A CG2 1 
ATOM   692   N N   . LEU A 1 103 ? 11.661  -33.651 30.112  1.00 52.55  ? 103 LEU A N   1 
ATOM   693   C CA  . LEU A 1 103 ? 11.054  -34.509 31.123  1.00 52.66  ? 103 LEU A CA  1 
ATOM   694   C C   . LEU A 1 103 ? 12.113  -34.976 32.117  1.00 54.72  ? 103 LEU A C   1 
ATOM   695   O O   . LEU A 1 103 ? 11.853  -35.048 33.315  1.00 55.92  ? 103 LEU A O   1 
ATOM   696   C CB  . LEU A 1 103 ? 10.359  -35.714 30.486  1.00 52.18  ? 103 LEU A CB  1 
ATOM   697   C CG  . LEU A 1 103 ? 9.720   -36.685 31.485  1.00 52.00  ? 103 LEU A CG  1 
ATOM   698   C CD1 . LEU A 1 103 ? 8.830   -35.938 32.468  1.00 39.80  ? 103 LEU A CD1 1 
ATOM   699   C CD2 . LEU A 1 103 ? 8.932   -37.769 30.773  1.00 61.23  ? 103 LEU A CD2 1 
ATOM   700   N N   . SER A 1 104 ? 13.304  -35.290 31.616  1.00 55.15  ? 104 SER A N   1 
ATOM   701   C CA  . SER A 1 104 ? 14.409  -35.705 32.476  1.00 51.05  ? 104 SER A CA  1 
ATOM   702   C C   . SER A 1 104 ? 14.781  -34.610 33.468  1.00 54.90  ? 104 SER A C   1 
ATOM   703   O O   . SER A 1 104 ? 14.931  -34.871 34.662  1.00 40.71  ? 104 SER A O   1 
ATOM   704   C CB  . SER A 1 104 ? 15.633  -36.088 31.644  1.00 49.59  ? 104 SER A CB  1 
ATOM   705   O OG  . SER A 1 104 ? 15.523  -37.407 31.141  1.00 65.15  ? 104 SER A OG  1 
ATOM   706   N N   . THR A 1 105 ? 14.937  -33.388 32.968  1.00 54.19  ? 105 THR A N   1 
ATOM   707   C CA  . THR A 1 105 ? 15.335  -32.268 33.817  1.00 62.08  ? 105 THR A CA  1 
ATOM   708   C C   . THR A 1 105 ? 14.279  -31.990 34.889  1.00 48.19  ? 105 THR A C   1 
ATOM   709   O O   . THR A 1 105 ? 14.598  -31.829 36.083  1.00 61.68  ? 105 THR A O   1 
ATOM   710   C CB  . THR A 1 105 ? 15.571  -30.994 32.979  1.00 59.79  ? 105 THR A CB  1 
ATOM   711   O OG1 . THR A 1 105 ? 16.622  -31.233 32.033  1.00 59.72  ? 105 THR A OG1 1 
ATOM   712   C CG2 . THR A 1 105 ? 15.956  -29.822 33.870  1.00 59.52  ? 105 THR A CG2 1 
ATOM   713   N N   . GLN A 1 106 ? 13.017  -31.974 34.465  1.00 60.35  ? 106 GLN A N   1 
ATOM   714   C CA  . GLN A 1 106 ? 11.924  -31.730 35.400  1.00 48.56  ? 106 GLN A CA  1 
ATOM   715   C C   . GLN A 1 106 ? 11.805  -32.858 36.421  1.00 55.50  ? 106 GLN A C   1 
ATOM   716   O O   . GLN A 1 106 ? 11.413  -32.626 37.561  1.00 66.08  ? 106 GLN A O   1 
ATOM   717   C CB  . GLN A 1 106 ? 10.600  -31.548 34.657  1.00 51.07  ? 106 GLN A CB  1 
ATOM   718   C CG  . GLN A 1 106 ? 9.602   -30.670 35.400  1.00 81.49  ? 106 GLN A CG  1 
ATOM   719   C CD  . GLN A 1 106 ? 8.303   -30.473 34.642  1.00 100.68 ? 106 GLN A CD  1 
ATOM   720   O OE1 . GLN A 1 106 ? 8.188   -30.841 33.471  1.00 89.24  ? 106 GLN A OE1 1 
ATOM   721   N NE2 . GLN A 1 106 ? 7.296   -29.942 35.328  1.00 86.84  ? 106 GLN A NE2 1 
ATOM   722   N N   . LEU A 1 107 ? 12.144  -34.077 36.014  1.00 56.34  ? 107 LEU A N   1 
ATOM   723   C CA  . LEU A 1 107 ? 12.226  -35.186 36.956  1.00 44.49  ? 107 LEU A CA  1 
ATOM   724   C C   . LEU A 1 107 ? 13.323  -34.946 37.980  1.00 50.77  ? 107 LEU A C   1 
ATOM   725   O O   . LEU A 1 107 ? 13.121  -35.148 39.177  1.00 56.81  ? 107 LEU A O   1 
ATOM   726   C CB  . LEU A 1 107 ? 12.476  -36.511 36.232  1.00 47.60  ? 107 LEU A CB  1 
ATOM   727   C CG  . LEU A 1 107 ? 11.252  -37.187 35.615  1.00 46.55  ? 107 LEU A CG  1 
ATOM   728   C CD1 . LEU A 1 107 ? 11.631  -38.530 35.014  1.00 47.23  ? 107 LEU A CD1 1 
ATOM   729   C CD2 . LEU A 1 107 ? 10.161  -37.343 36.659  1.00 50.54  ? 107 LEU A CD2 1 
ATOM   730   N N   . ALA A 1 108 ? 14.484  -34.511 37.499  1.00 64.30  ? 108 ALA A N   1 
ATOM   731   C CA  . ALA A 1 108 ? 15.631  -34.271 38.363  1.00 56.17  ? 108 ALA A CA  1 
ATOM   732   C C   . ALA A 1 108 ? 15.319  -33.260 39.450  1.00 63.48  ? 108 ALA A C   1 
ATOM   733   O O   . ALA A 1 108 ? 15.626  -33.486 40.619  1.00 72.10  ? 108 ALA A O   1 
ATOM   734   C CB  . ALA A 1 108 ? 16.819  -33.798 37.538  1.00 49.37  ? 108 ALA A CB  1 
ATOM   735   N N   . ASP A 1 109 ? 14.702  -32.145 39.071  1.00 54.65  ? 109 ASP A N   1 
ATOM   736   C CA  . ASP A 1 109 ? 14.419  -31.101 40.057  1.00 68.68  ? 109 ASP A CA  1 
ATOM   737   C C   . ASP A 1 109 ? 13.142  -31.311 40.880  1.00 78.18  ? 109 ASP A C   1 
ATOM   738   O O   . ASP A 1 109 ? 13.127  -31.023 42.077  1.00 71.35  ? 109 ASP A O   1 
ATOM   739   C CB  . ASP A 1 109 ? 14.392  -29.735 39.375  1.00 66.93  ? 109 ASP A CB  1 
ATOM   740   C CG  . ASP A 1 109 ? 15.735  -29.369 38.776  1.00 84.85  ? 109 ASP A CG  1 
ATOM   741   O OD1 . ASP A 1 109 ? 16.765  -29.680 39.412  1.00 94.37  ? 109 ASP A OD1 1 
ATOM   742   O OD2 . ASP A 1 109 ? 15.769  -28.765 37.684  1.00 88.75  ? 109 ASP A OD2 1 
ATOM   743   N N   . ALA A 1 110 ? 12.073  -31.782 40.246  1.00 73.07  ? 110 ALA A N   1 
ATOM   744   C CA  . ALA A 1 110 ? 10.798  -31.953 40.943  1.00 50.48  ? 110 ALA A CA  1 
ATOM   745   C C   . ALA A 1 110 ? 10.679  -33.279 41.706  1.00 57.25  ? 110 ALA A C   1 
ATOM   746   O O   . ALA A 1 110 ? 9.979   -33.353 42.715  1.00 70.86  ? 110 ALA A O   1 
ATOM   747   C CB  . ALA A 1 110 ? 9.646   -31.817 39.966  1.00 58.97  ? 110 ALA A CB  1 
ATOM   748   N N   . MET A 1 111 ? 11.341  -34.328 41.221  1.00 43.56  ? 111 MET A N   1 
ATOM   749   C CA  . MET A 1 111 ? 11.183  -35.659 41.811  1.00 43.45  ? 111 MET A CA  1 
ATOM   750   C C   . MET A 1 111 ? 12.402  -36.096 42.623  1.00 51.65  ? 111 MET A C   1 
ATOM   751   O O   . MET A 1 111 ? 12.294  -36.352 43.823  1.00 52.29  ? 111 MET A O   1 
ATOM   752   C CB  . MET A 1 111 ? 10.879  -36.698 40.729  1.00 38.16  ? 111 MET A CB  1 
ATOM   753   C CG  . MET A 1 111 ? 10.784  -38.125 41.256  1.00 37.97  ? 111 MET A CG  1 
ATOM   754   S SD  . MET A 1 111 ? 10.758  -39.376 39.955  1.00 43.97  ? 111 MET A SD  1 
ATOM   755   C CE  . MET A 1 111 ? 12.426  -39.251 39.318  1.00 61.11  ? 111 MET A CE  1 
ATOM   756   N N   . MET A 1 112 ? 13.551  -36.202 41.963  1.00 60.65  ? 112 MET A N   1 
ATOM   757   C CA  . MET A 1 112 ? 14.755  -36.733 42.594  1.00 51.33  ? 112 MET A CA  1 
ATOM   758   C C   . MET A 1 112 ? 15.263  -35.842 43.723  1.00 50.13  ? 112 MET A C   1 
ATOM   759   O O   . MET A 1 112 ? 15.700  -36.337 44.764  1.00 57.76  ? 112 MET A O   1 
ATOM   760   C CB  . MET A 1 112 ? 15.863  -36.923 41.556  1.00 34.94  ? 112 MET A CB  1 
ATOM   761   C CG  . MET A 1 112 ? 15.622  -38.061 40.582  1.00 53.09  ? 112 MET A CG  1 
ATOM   762   S SD  . MET A 1 112 ? 15.432  -39.656 41.403  1.00 63.55  ? 112 MET A SD  1 
ATOM   763   C CE  . MET A 1 112 ? 16.969  -39.756 42.315  1.00 63.52  ? 112 MET A CE  1 
ATOM   764   N N   . PHE A 1 113 ? 15.199  -34.530 43.519  1.00 49.29  ? 113 PHE A N   1 
ATOM   765   C CA  . PHE A 1 113 ? 15.737  -33.584 44.494  1.00 51.25  ? 113 PHE A CA  1 
ATOM   766   C C   . PHE A 1 113 ? 15.022  -33.630 45.855  1.00 58.32  ? 113 PHE A C   1 
ATOM   767   O O   . PHE A 1 113 ? 15.694  -33.656 46.885  1.00 65.75  ? 113 PHE A O   1 
ATOM   768   C CB  . PHE A 1 113 ? 15.707  -32.156 43.934  1.00 47.23  ? 113 PHE A CB  1 
ATOM   769   C CG  . PHE A 1 113 ? 16.233  -31.123 44.890  1.00 64.41  ? 113 PHE A CG  1 
ATOM   770   C CD1 . PHE A 1 113 ? 17.593  -31.019 45.137  1.00 66.86  ? 113 PHE A CD1 1 
ATOM   771   C CD2 . PHE A 1 113 ? 15.370  -30.259 45.545  1.00 69.61  ? 113 PHE A CD2 1 
ATOM   772   C CE1 . PHE A 1 113 ? 18.083  -30.072 46.018  1.00 63.30  ? 113 PHE A CE1 1 
ATOM   773   C CE2 . PHE A 1 113 ? 15.854  -29.310 46.427  1.00 71.61  ? 113 PHE A CE2 1 
ATOM   774   C CZ  . PHE A 1 113 ? 17.212  -29.216 46.663  1.00 72.61  ? 113 PHE A CZ  1 
ATOM   775   N N   . PRO A 1 114 ? 13.671  -33.622 45.877  1.00 56.26  ? 114 PRO A N   1 
ATOM   776   C CA  . PRO A 1 114 ? 13.028  -33.680 47.197  1.00 49.39  ? 114 PRO A CA  1 
ATOM   777   C C   . PRO A 1 114 ? 13.368  -34.932 48.012  1.00 59.76  ? 114 PRO A C   1 
ATOM   778   O O   . PRO A 1 114 ? 13.675  -34.812 49.201  1.00 64.74  ? 114 PRO A O   1 
ATOM   779   C CB  . PRO A 1 114 ? 11.535  -33.657 46.855  1.00 47.07  ? 114 PRO A CB  1 
ATOM   780   C CG  . PRO A 1 114 ? 11.466  -32.934 45.569  1.00 54.76  ? 114 PRO A CG  1 
ATOM   781   C CD  . PRO A 1 114 ? 12.679  -33.380 44.811  1.00 60.11  ? 114 PRO A CD  1 
ATOM   782   N N   . ILE A 1 115 ? 13.323  -36.107 47.391  1.00 44.60  ? 115 ILE A N   1 
ATOM   783   C CA  . ILE A 1 115 ? 13.597  -37.344 48.118  1.00 55.71  ? 115 ILE A CA  1 
ATOM   784   C C   . ILE A 1 115 ? 15.079  -37.436 48.495  1.00 59.36  ? 115 ILE A C   1 
ATOM   785   O O   . ILE A 1 115 ? 15.430  -37.933 49.579  1.00 62.61  ? 115 ILE A O   1 
ATOM   786   C CB  . ILE A 1 115 ? 13.155  -38.594 47.306  1.00 38.14  ? 115 ILE A CB  1 
ATOM   787   C CG1 . ILE A 1 115 ? 13.121  -39.831 48.207  1.00 42.86  ? 115 ILE A CG1 1 
ATOM   788   C CG2 . ILE A 1 115 ? 14.045  -38.826 46.090  1.00 55.53  ? 115 ILE A CG2 1 
ATOM   789   C CD1 . ILE A 1 115 ? 12.386  -41.006 47.601  1.00 49.86  ? 115 ILE A CD1 1 
ATOM   790   N N   . THR A 1 116 ? 15.943  -36.918 47.623  1.00 57.60  ? 116 THR A N   1 
ATOM   791   C CA  . THR A 1 116 ? 17.373  -36.907 47.896  1.00 55.74  ? 116 THR A CA  1 
ATOM   792   C C   . THR A 1 116 ? 17.675  -36.022 49.094  1.00 56.13  ? 116 THR A C   1 
ATOM   793   O O   . THR A 1 116 ? 18.453  -36.399 49.960  1.00 60.76  ? 116 THR A O   1 
ATOM   794   C CB  . THR A 1 116 ? 18.188  -36.420 46.686  1.00 52.86  ? 116 THR A CB  1 
ATOM   795   O OG1 . THR A 1 116 ? 17.993  -37.320 45.588  1.00 61.38  ? 116 THR A OG1 1 
ATOM   796   C CG2 . THR A 1 116 ? 19.669  -36.368 47.027  1.00 34.67  ? 116 THR A CG2 1 
ATOM   797   N N   . GLN A 1 117 ? 17.061  -34.844 49.141  1.00 57.21  ? 117 GLN A N   1 
ATOM   798   C CA  . GLN A 1 117 ? 17.238  -33.963 50.289  1.00 55.80  ? 117 GLN A CA  1 
ATOM   799   C C   . GLN A 1 117 ? 16.605  -34.557 51.541  1.00 59.86  ? 117 GLN A C   1 
ATOM   800   O O   . GLN A 1 117 ? 17.070  -34.300 52.649  1.00 71.21  ? 117 GLN A O   1 
ATOM   801   C CB  . GLN A 1 117 ? 16.668  -32.567 50.022  1.00 57.79  ? 117 GLN A CB  1 
ATOM   802   C CG  . GLN A 1 117 ? 17.745  -31.542 49.684  1.00 86.16  ? 117 GLN A CG  1 
ATOM   803   C CD  . GLN A 1 117 ? 17.535  -30.207 50.380  1.00 95.92  ? 117 GLN A CD  1 
ATOM   804   O OE1 . GLN A 1 117 ? 16.452  -29.922 50.892  1.00 89.47  ? 117 GLN A OE1 1 
ATOM   805   N NE2 . GLN A 1 117 ? 18.583  -29.390 50.418  1.00 89.88  ? 117 GLN A NE2 1 
ATOM   806   N N   . PHE A 1 118 ? 15.546  -35.347 51.382  1.00 56.36  ? 118 PHE A N   1 
ATOM   807   C CA  . PHE A 1 118 ? 14.971  -36.000 52.551  1.00 57.40  ? 118 PHE A CA  1 
ATOM   808   C C   . PHE A 1 118 ? 15.947  -37.017 53.138  1.00 61.13  ? 118 PHE A C   1 
ATOM   809   O O   . PHE A 1 118 ? 16.067  -37.122 54.358  1.00 74.18  ? 118 PHE A O   1 
ATOM   810   C CB  . PHE A 1 118 ? 13.643  -36.684 52.226  1.00 60.19  ? 118 PHE A CB  1 
ATOM   811   C CG  . PHE A 1 118 ? 12.995  -37.332 53.422  1.00 52.12  ? 118 PHE A CG  1 
ATOM   812   C CD1 . PHE A 1 118 ? 12.475  -36.558 54.448  1.00 55.26  ? 118 PHE A CD1 1 
ATOM   813   C CD2 . PHE A 1 118 ? 12.919  -38.711 53.527  1.00 46.84  ? 118 PHE A CD2 1 
ATOM   814   C CE1 . PHE A 1 118 ? 11.883  -37.149 55.552  1.00 51.21  ? 118 PHE A CE1 1 
ATOM   815   C CE2 . PHE A 1 118 ? 12.329  -39.307 54.629  1.00 44.01  ? 118 PHE A CE2 1 
ATOM   816   C CZ  . PHE A 1 118 ? 11.811  -38.525 55.641  1.00 48.25  ? 118 PHE A CZ  1 
ATOM   817   N N   . LYS A 1 119 ? 16.646  -37.766 52.286  1.00 47.81  ? 119 LYS A N   1 
ATOM   818   C CA  . LYS A 1 119 ? 17.551  -38.792 52.807  1.00 59.10  ? 119 LYS A CA  1 
ATOM   819   C C   . LYS A 1 119 ? 18.934  -38.245 53.192  1.00 58.85  ? 119 LYS A C   1 
ATOM   820   O O   . LYS A 1 119 ? 19.605  -38.798 54.068  1.00 61.29  ? 119 LYS A O   1 
ATOM   821   C CB  . LYS A 1 119 ? 17.717  -39.923 51.780  1.00 54.56  ? 119 LYS A CB  1 
ATOM   822   C CG  . LYS A 1 119 ? 18.704  -41.020 52.194  1.00 87.95  ? 119 LYS A CG  1 
ATOM   823   C CD  . LYS A 1 119 ? 18.036  -42.123 53.003  1.00 100.48 ? 119 LYS A CD  1 
ATOM   824   C CE  . LYS A 1 119 ? 19.046  -42.929 53.813  1.00 80.22  ? 119 LYS A CE  1 
ATOM   825   N NZ  . LYS A 1 119 ? 18.386  -43.926 54.704  1.00 85.47  ? 119 LYS A NZ  1 
ATOM   826   N N   . GLU A 1 120 ? 19.348  -37.146 52.566  1.00 58.19  ? 120 GLU A N   1 
ATOM   827   C CA  . GLU A 1 120 ? 20.662  -36.570 52.840  1.00 66.92  ? 120 GLU A CA  1 
ATOM   828   C C   . GLU A 1 120 ? 20.677  -35.398 53.818  1.00 58.24  ? 120 GLU A C   1 
ATOM   829   O O   . GLU A 1 120 ? 21.742  -34.993 54.282  1.00 55.04  ? 120 GLU A O   1 
ATOM   830   C CB  . GLU A 1 120 ? 21.303  -36.118 51.525  1.00 70.93  ? 120 GLU A CB  1 
ATOM   831   C CG  . GLU A 1 120 ? 21.728  -37.257 50.617  1.00 70.01  ? 120 GLU A CG  1 
ATOM   832   C CD  . GLU A 1 120 ? 22.606  -38.272 51.320  1.00 94.34  ? 120 GLU A CD  1 
ATOM   833   O OE1 . GLU A 1 120 ? 23.501  -37.860 52.088  1.00 105.67 ? 120 GLU A OE1 1 
ATOM   834   O OE2 . GLU A 1 120 ? 22.397  -39.484 51.107  1.00 99.31  ? 120 GLU A OE2 1 
ATOM   835   N N   . ARG A 1 121 ? 19.509  -34.850 54.130  1.00 54.65  ? 121 ARG A N   1 
ATOM   836   C CA  . ARG A 1 121 ? 19.431  -33.772 55.109  1.00 58.10  ? 121 ARG A CA  1 
ATOM   837   C C   . ARG A 1 121 ? 18.735  -34.241 56.377  1.00 58.28  ? 121 ARG A C   1 
ATOM   838   O O   . ARG A 1 121 ? 19.321  -34.250 57.458  1.00 69.36  ? 121 ARG A O   1 
ATOM   839   C CB  . ARG A 1 121 ? 18.711  -32.552 54.525  1.00 56.35  ? 121 ARG A CB  1 
ATOM   840   C CG  . ARG A 1 121 ? 18.612  -31.365 55.474  1.00 75.50  ? 121 ARG A CG  1 
ATOM   841   C CD  . ARG A 1 121 ? 17.819  -30.218 54.859  1.00 76.81  ? 121 ARG A CD  1 
ATOM   842   N NE  . ARG A 1 121 ? 16.447  -30.603 54.537  1.00 101.71 ? 121 ARG A NE  1 
ATOM   843   C CZ  . ARG A 1 121 ? 15.546  -29.784 54.002  1.00 105.16 ? 121 ARG A CZ  1 
ATOM   844   N NH1 . ARG A 1 121 ? 15.869  -28.527 53.727  1.00 99.95  ? 121 ARG A NH1 1 
ATOM   845   N NH2 . ARG A 1 121 ? 14.321  -30.220 53.744  1.00 90.92  ? 121 ARG A NH2 1 
ATOM   846   N N   . ASP A 1 122 ? 17.475  -34.632 56.225  1.00 67.00  ? 122 ASP A N   1 
ATOM   847   C CA  . ASP A 1 122 ? 16.603  -34.908 57.357  1.00 60.40  ? 122 ASP A CA  1 
ATOM   848   C C   . ASP A 1 122 ? 16.903  -36.232 58.059  1.00 64.53  ? 122 ASP A C   1 
ATOM   849   O O   . ASP A 1 122 ? 17.073  -36.263 59.278  1.00 72.04  ? 122 ASP A O   1 
ATOM   850   C CB  . ASP A 1 122 ? 15.148  -34.892 56.885  1.00 61.57  ? 122 ASP A CB  1 
ATOM   851   C CG  . ASP A 1 122 ? 14.804  -33.632 56.113  1.00 86.49  ? 122 ASP A CG  1 
ATOM   852   O OD1 . ASP A 1 122 ? 14.905  -32.530 56.694  1.00 84.99  ? 122 ASP A OD1 1 
ATOM   853   O OD2 . ASP A 1 122 ? 14.444  -33.742 54.921  1.00 82.64  ? 122 ASP A OD2 1 
ATOM   854   N N   . LEU A 1 123 ? 16.970  -37.321 57.297  1.00 63.19  ? 123 LEU A N   1 
ATOM   855   C CA  . LEU A 1 123 ? 17.285  -38.631 57.865  1.00 56.05  ? 123 LEU A CA  1 
ATOM   856   C C   . LEU A 1 123 ? 18.678  -38.650 58.485  1.00 59.74  ? 123 LEU A C   1 
ATOM   857   O O   . LEU A 1 123 ? 18.879  -39.180 59.585  1.00 69.53  ? 123 LEU A O   1 
ATOM   858   C CB  . LEU A 1 123 ? 17.162  -39.724 56.801  1.00 52.02  ? 123 LEU A CB  1 
ATOM   859   C CG  . LEU A 1 123 ? 15.728  -40.114 56.438  1.00 63.32  ? 123 LEU A CG  1 
ATOM   860   C CD1 . LEU A 1 123 ? 15.706  -41.279 55.462  1.00 58.06  ? 123 LEU A CD1 1 
ATOM   861   C CD2 . LEU A 1 123 ? 14.932  -40.448 57.694  1.00 50.83  ? 123 LEU A CD2 1 
ATOM   862   N N   . LYS A 1 124 ? 19.634  -38.054 57.781  1.00 64.22  ? 124 LYS A N   1 
ATOM   863   C CA  . LYS A 1 124 ? 21.002  -37.976 58.275  1.00 63.31  ? 124 LYS A CA  1 
ATOM   864   C C   . LYS A 1 124 ? 21.092  -37.143 59.549  1.00 62.43  ? 124 LYS A C   1 
ATOM   865   O O   . LYS A 1 124 ? 21.834  -37.493 60.462  1.00 67.17  ? 124 LYS A O   1 
ATOM   866   C CB  . LYS A 1 124 ? 21.931  -37.401 57.205  1.00 54.27  ? 124 LYS A CB  1 
ATOM   867   C CG  . LYS A 1 124 ? 22.320  -38.405 56.142  1.00 76.07  ? 124 LYS A CG  1 
ATOM   868   C CD  . LYS A 1 124 ? 23.020  -39.598 56.772  1.00 71.28  ? 124 LYS A CD  1 
ATOM   869   C CE  . LYS A 1 124 ? 23.432  -40.628 55.735  1.00 76.82  ? 124 LYS A CE  1 
ATOM   870   N NZ  . LYS A 1 124 ? 24.184  -41.756 56.357  1.00 59.52  ? 124 LYS A NZ  1 
ATOM   871   N N   . GLU A 1 125 ? 20.352  -36.039 59.612  1.00 53.16  ? 125 GLU A N   1 
ATOM   872   C CA  . GLU A 1 125 ? 20.317  -35.243 60.836  1.00 57.16  ? 125 GLU A CA  1 
ATOM   873   C C   . GLU A 1 125 ? 19.691  -36.045 61.984  1.00 66.12  ? 125 GLU A C   1 
ATOM   874   O O   . GLU A 1 125 ? 20.149  -35.958 63.124  1.00 64.06  ? 125 GLU A O   1 
ATOM   875   C CB  . GLU A 1 125 ? 19.561  -33.925 60.628  1.00 50.51  ? 125 GLU A CB  1 
ATOM   876   C CG  . GLU A 1 125 ? 18.953  -33.362 61.910  1.00 75.97  ? 125 GLU A CG  1 
ATOM   877   C CD  . GLU A 1 125 ? 18.178  -32.076 61.686  1.00 92.03  ? 125 GLU A CD  1 
ATOM   878   O OE1 . GLU A 1 125 ? 17.483  -31.961 60.655  1.00 95.44  ? 125 GLU A OE1 1 
ATOM   879   O OE2 . GLU A 1 125 ? 18.259  -31.179 62.554  1.00 75.72  ? 125 GLU A OE2 1 
ATOM   880   N N   . ILE A 1 126 ? 18.640  -36.809 61.689  1.00 65.67  ? 126 ILE A N   1 
ATOM   881   C CA  . ILE A 1 126 ? 18.027  -37.673 62.694  1.00 57.03  ? 126 ILE A CA  1 
ATOM   882   C C   . ILE A 1 126 ? 19.059  -38.644 63.263  1.00 52.77  ? 126 ILE A C   1 
ATOM   883   O O   . ILE A 1 126 ? 19.196  -38.776 64.483  1.00 52.13  ? 126 ILE A O   1 
ATOM   884   C CB  . ILE A 1 126 ? 16.839  -38.468 62.117  1.00 55.83  ? 126 ILE A CB  1 
ATOM   885   C CG1 . ILE A 1 126 ? 15.652  -37.540 61.859  1.00 47.62  ? 126 ILE A CG1 1 
ATOM   886   C CG2 . ILE A 1 126 ? 16.418  -39.580 63.070  1.00 51.60  ? 126 ILE A CG2 1 
ATOM   887   C CD1 . ILE A 1 126 ? 14.979  -37.055 63.120  1.00 47.46  ? 126 ILE A CD1 1 
ATOM   888   N N   . LEU A 1 127 ? 19.788  -39.316 62.376  1.00 52.63  ? 127 LEU A N   1 
ATOM   889   C CA  . LEU A 1 127 ? 20.811  -40.273 62.794  1.00 59.04  ? 127 LEU A CA  1 
ATOM   890   C C   . LEU A 1 127 ? 21.908  -39.583 63.615  1.00 48.47  ? 127 LEU A C   1 
ATOM   891   O O   . LEU A 1 127 ? 22.391  -40.120 64.623  1.00 51.94  ? 127 LEU A O   1 
ATOM   892   C CB  . LEU A 1 127 ? 21.408  -40.968 61.568  1.00 45.88  ? 127 LEU A CB  1 
ATOM   893   C CG  . LEU A 1 127 ? 22.099  -42.316 61.771  1.00 61.37  ? 127 LEU A CG  1 
ATOM   894   C CD1 . LEU A 1 127 ? 21.796  -43.247 60.604  1.00 60.12  ? 127 LEU A CD1 1 
ATOM   895   C CD2 . LEU A 1 127 ? 23.598  -42.130 61.930  1.00 70.43  ? 127 LEU A CD2 1 
ATOM   896   N N   . THR A 1 128 ? 22.277  -38.380 63.181  1.00 44.75  ? 128 THR A N   1 
ATOM   897   C CA  . THR A 1 128 ? 23.291  -37.574 63.854  1.00 44.09  ? 128 THR A CA  1 
ATOM   898   C C   . THR A 1 128 ? 22.898  -37.241 65.291  1.00 57.42  ? 128 THR A C   1 
ATOM   899   O O   . THR A 1 128 ? 23.621  -37.569 66.235  1.00 53.10  ? 128 THR A O   1 
ATOM   900   C CB  . THR A 1 128 ? 23.544  -36.257 63.094  1.00 54.65  ? 128 THR A CB  1 
ATOM   901   O OG1 . THR A 1 128 ? 24.107  -36.542 61.808  1.00 64.98  ? 128 THR A OG1 1 
ATOM   902   C CG2 . THR A 1 128 ? 24.494  -35.360 63.875  1.00 45.21  ? 128 THR A CG2 1 
ATOM   903   N N   . LEU A 1 129 ? 21.745  -36.596 65.445  1.00 57.32  ? 129 LEU A N   1 
ATOM   904   C CA  . LEU A 1 129 ? 21.227  -36.229 66.759  1.00 45.41  ? 129 LEU A CA  1 
ATOM   905   C C   . LEU A 1 129 ? 21.033  -37.464 67.629  1.00 46.40  ? 129 LEU A C   1 
ATOM   906   O O   . LEU A 1 129 ? 21.250  -37.421 68.842  1.00 44.55  ? 129 LEU A O   1 
ATOM   907   C CB  . LEU A 1 129 ? 19.908  -35.458 66.635  1.00 37.40  ? 129 LEU A CB  1 
ATOM   908   C CG  . LEU A 1 129 ? 19.966  -33.942 66.418  1.00 40.13  ? 129 LEU A CG  1 
ATOM   909   C CD1 . LEU A 1 129 ? 20.622  -33.574 65.101  1.00 68.99  ? 129 LEU A CD1 1 
ATOM   910   C CD2 . LEU A 1 129 ? 18.568  -33.342 66.503  1.00 47.05  ? 129 LEU A CD2 1 
ATOM   911   N N   . LYS A 1 130 ? 20.623  -38.561 66.999  1.00 38.02  ? 130 LYS A N   1 
ATOM   912   C CA  . LYS A 1 130 ? 20.485  -39.832 67.696  1.00 40.68  ? 130 LYS A CA  1 
ATOM   913   C C   . LYS A 1 130 ? 21.795  -40.272 68.335  1.00 51.47  ? 130 LYS A C   1 
ATOM   914   O O   . LYS A 1 130 ? 21.837  -40.579 69.528  1.00 67.53  ? 130 LYS A O   1 
ATOM   915   C CB  . LYS A 1 130 ? 19.991  -40.916 66.732  1.00 45.39  ? 130 LYS A CB  1 
ATOM   916   C CG  . LYS A 1 130 ? 20.111  -42.330 67.276  1.00 51.13  ? 130 LYS A CG  1 
ATOM   917   C CD  . LYS A 1 130 ? 19.586  -43.345 66.274  1.00 58.63  ? 130 LYS A CD  1 
ATOM   918   C CE  . LYS A 1 130 ? 19.828  -44.767 66.748  1.00 57.75  ? 130 LYS A CE  1 
ATOM   919   N NZ  . LYS A 1 130 ? 19.146  -45.755 65.868  1.00 88.48  ? 130 LYS A NZ  1 
ATOM   920   N N   . GLU A 1 131 ? 22.866  -40.288 67.549  1.00 60.11  ? 131 GLU A N   1 
ATOM   921   C CA  . GLU A 1 131 ? 24.133  -40.803 68.058  1.00 70.09  ? 131 GLU A CA  1 
ATOM   922   C C   . GLU A 1 131 ? 24.779  -39.826 69.044  1.00 55.04  ? 131 GLU A C   1 
ATOM   923   O O   . GLU A 1 131 ? 25.490  -40.239 69.971  1.00 44.78  ? 131 GLU A O   1 
ATOM   924   C CB  . GLU A 1 131 ? 25.082  -41.134 66.908  1.00 59.09  ? 131 GLU A CB  1 
ATOM   925   C CG  . GLU A 1 131 ? 24.590  -42.319 66.094  1.00 97.95  ? 131 GLU A CG  1 
ATOM   926   C CD  . GLU A 1 131 ? 24.871  -43.647 66.773  1.00 117.66 ? 131 GLU A CD  1 
ATOM   927   O OE1 . GLU A 1 131 ? 25.655  -43.667 67.746  1.00 119.70 ? 131 GLU A OE1 1 
ATOM   928   O OE2 . GLU A 1 131 ? 24.293  -44.668 66.344  1.00 113.11 ? 131 GLU A OE2 1 
ATOM   929   N N   . VAL A 1 132 ? 24.533  -38.535 68.837  1.00 51.61  ? 132 VAL A N   1 
ATOM   930   C CA  . VAL A 1 132 ? 24.982  -37.517 69.778  1.00 45.61  ? 132 VAL A CA  1 
ATOM   931   C C   . VAL A 1 132 ? 24.311  -37.754 71.130  1.00 54.54  ? 132 VAL A C   1 
ATOM   932   O O   . VAL A 1 132 ? 24.963  -37.722 72.181  1.00 53.94  ? 132 VAL A O   1 
ATOM   933   C CB  . VAL A 1 132 ? 24.662  -36.093 69.279  1.00 36.88  ? 132 VAL A CB  1 
ATOM   934   C CG1 . VAL A 1 132 ? 24.906  -35.072 70.375  1.00 45.40  ? 132 VAL A CG1 1 
ATOM   935   C CG2 . VAL A 1 132 ? 25.489  -35.760 68.045  1.00 51.46  ? 132 VAL A CG2 1 
ATOM   936   N N   . PHE A 1 133 ? 23.005  -38.009 71.089  1.00 51.57  ? 133 PHE A N   1 
ATOM   937   C CA  . PHE A 1 133 ? 22.245  -38.320 72.294  1.00 34.75  ? 133 PHE A CA  1 
ATOM   938   C C   . PHE A 1 133 ? 22.763  -39.584 72.973  1.00 39.02  ? 133 PHE A C   1 
ATOM   939   O O   . PHE A 1 133 ? 22.868  -39.631 74.198  1.00 48.90  ? 133 PHE A O   1 
ATOM   940   C CB  . PHE A 1 133 ? 20.756  -38.476 71.974  1.00 41.06  ? 133 PHE A CB  1 
ATOM   941   C CG  . PHE A 1 133 ? 19.988  -39.225 73.027  1.00 45.77  ? 133 PHE A CG  1 
ATOM   942   C CD1 . PHE A 1 133 ? 19.799  -38.679 74.287  1.00 52.39  ? 133 PHE A CD1 1 
ATOM   943   C CD2 . PHE A 1 133 ? 19.456  -40.476 72.759  1.00 52.44  ? 133 PHE A CD2 1 
ATOM   944   C CE1 . PHE A 1 133 ? 19.099  -39.368 75.259  1.00 39.90  ? 133 PHE A CE1 1 
ATOM   945   C CE2 . PHE A 1 133 ? 18.751  -41.168 73.728  1.00 57.18  ? 133 PHE A CE2 1 
ATOM   946   C CZ  . PHE A 1 133 ? 18.572  -40.613 74.978  1.00 41.61  ? 133 PHE A CZ  1 
ATOM   947   N N   . GLN A 1 134 ? 23.081  -40.604 72.179  1.00 44.13  ? 134 GLN A N   1 
ATOM   948   C CA  . GLN A 1 134 ? 23.625  -41.847 72.725  1.00 58.12  ? 134 GLN A CA  1 
ATOM   949   C C   . GLN A 1 134 ? 24.939  -41.600 73.468  1.00 56.97  ? 134 GLN A C   1 
ATOM   950   O O   . GLN A 1 134 ? 25.130  -42.073 74.598  1.00 55.04  ? 134 GLN A O   1 
ATOM   951   C CB  . GLN A 1 134 ? 23.844  -42.873 71.609  1.00 56.49  ? 134 GLN A CB  1 
ATOM   952   C CG  . GLN A 1 134 ? 22.573  -43.329 70.907  1.00 67.07  ? 134 GLN A CG  1 
ATOM   953   C CD  . GLN A 1 134 ? 22.599  -44.804 70.550  1.00 90.53  ? 134 GLN A CD  1 
ATOM   954   O OE1 . GLN A 1 134 ? 23.059  -45.636 71.332  1.00 93.65  ? 134 GLN A OE1 1 
ATOM   955   N NE2 . GLN A 1 134 ? 22.108  -45.134 69.360  1.00 85.71  ? 134 GLN A NE2 1 
ATOM   956   N N   . ILE A 1 135 ? 25.834  -40.845 72.834  1.00 50.25  ? 135 ILE A N   1 
ATOM   957   C CA  . ILE A 1 135 ? 27.119  -40.510 73.443  1.00 44.12  ? 135 ILE A CA  1 
ATOM   958   C C   . ILE A 1 135 ? 26.939  -39.728 74.746  1.00 54.11  ? 135 ILE A C   1 
ATOM   959   O O   . ILE A 1 135 ? 27.549  -40.058 75.771  1.00 43.75  ? 135 ILE A O   1 
ATOM   960   C CB  . ILE A 1 135 ? 28.003  -39.696 72.477  1.00 39.61  ? 135 ILE A CB  1 
ATOM   961   C CG1 . ILE A 1 135 ? 28.503  -40.588 71.339  1.00 33.83  ? 135 ILE A CG1 1 
ATOM   962   C CG2 . ILE A 1 135 ? 29.184  -39.084 73.212  1.00 40.14  ? 135 ILE A CG2 1 
ATOM   963   N N   . ALA A 1 136 ? 26.088  -38.705 74.704  1.00 47.04  ? 136 ALA A N   1 
ATOM   964   C CA  . ALA A 1 136 ? 25.800  -37.899 75.888  1.00 42.08  ? 136 ALA A CA  1 
ATOM   965   C C   . ALA A 1 136 ? 25.242  -38.756 77.023  1.00 51.43  ? 136 ALA A C   1 
ATOM   966   O O   . ALA A 1 136 ? 25.586  -38.563 78.194  1.00 47.95  ? 136 ALA A O   1 
ATOM   967   C CB  . ALA A 1 136 ? 24.828  -36.781 75.543  1.00 50.93  ? 136 ALA A CB  1 
ATOM   968   N N   . SER A 1 137 ? 24.383  -39.704 76.663  1.00 40.64  ? 137 SER A N   1 
ATOM   969   C CA  . SER A 1 137 ? 23.802  -40.630 77.627  1.00 50.56  ? 137 SER A CA  1 
ATOM   970   C C   . SER A 1 137 ? 24.885  -41.470 78.299  1.00 46.76  ? 137 SER A C   1 
ATOM   971   O O   . SER A 1 137 ? 24.924  -41.577 79.528  1.00 52.98  ? 137 SER A O   1 
ATOM   972   C CB  . SER A 1 137 ? 22.772  -41.535 76.948  1.00 51.30  ? 137 SER A CB  1 
ATOM   973   O OG  . SER A 1 137 ? 22.523  -42.697 77.719  1.00 48.14  ? 137 SER A OG  1 
ATOM   974   N N   . ASN A 1 138 ? 25.764  -42.056 77.489  1.00 43.66  ? 138 ASN A N   1 
ATOM   975   C CA  . ASN A 1 138 ? 26.862  -42.860 78.024  1.00 54.77  ? 138 ASN A CA  1 
ATOM   976   C C   . ASN A 1 138 ? 27.750  -42.049 78.970  1.00 48.54  ? 138 ASN A C   1 
ATOM   977   O O   . ASN A 1 138 ? 28.126  -42.516 80.058  1.00 50.05  ? 138 ASN A O   1 
ATOM   978   C CB  . ASN A 1 138 ? 27.702  -43.439 76.885  1.00 45.98  ? 138 ASN A CB  1 
ATOM   979   C CG  . ASN A 1 138 ? 26.956  -44.489 76.087  1.00 50.10  ? 138 ASN A CG  1 
ATOM   980   O OD1 . ASN A 1 138 ? 25.967  -45.054 76.554  1.00 57.05  ? 138 ASN A OD1 1 
ATOM   981   N ND2 . ASN A 1 138 ? 27.425  -44.755 74.873  1.00 55.47  ? 138 ASN A ND2 1 
ATOM   982   N N   . ASP A 1 139 ? 28.065  -40.825 78.554  1.00 43.30  ? 139 ASP A N   1 
ATOM   983   C CA  . ASP A 1 139 ? 28.886  -39.934 79.365  1.00 44.90  ? 139 ASP A CA  1 
ATOM   984   C C   . ASP A 1 139 ? 28.222  -39.624 80.704  1.00 50.96  ? 139 ASP A C   1 
ATOM   985   O O   . ASP A 1 139 ? 28.885  -39.635 81.745  1.00 50.48  ? 139 ASP A O   1 
ATOM   986   C CB  . ASP A 1 139 ? 29.188  -38.639 78.607  1.00 49.37  ? 139 ASP A CB  1 
ATOM   987   C CG  . ASP A 1 139 ? 30.158  -38.851 77.460  1.00 64.08  ? 139 ASP A CG  1 
ATOM   988   O OD1 . ASP A 1 139 ? 30.859  -39.885 77.458  1.00 55.81  ? 139 ASP A OD1 1 
ATOM   989   O OD2 . ASP A 1 139 ? 30.226  -37.982 76.565  1.00 68.28  ? 139 ASP A OD2 1 
ATOM   990   N N   . HIS A 1 140 ? 26.919  -39.353 80.682  1.00 50.94  ? 140 HIS A N   1 
ATOM   991   C CA  . HIS A 1 140 ? 26.195  -39.110 81.927  1.00 40.44  ? 140 HIS A CA  1 
ATOM   992   C C   . HIS A 1 140 ? 26.205  -40.336 82.831  1.00 34.59  ? 140 HIS A C   1 
ATOM   993   O O   . HIS A 1 140 ? 26.335  -40.213 84.052  1.00 31.67  ? 140 HIS A O   1 
ATOM   994   C CB  . HIS A 1 140 ? 24.751  -38.691 81.661  1.00 47.42  ? 140 HIS A CB  1 
ATOM   995   C CG  . HIS A 1 140 ? 23.953  -38.486 82.910  1.00 50.87  ? 140 HIS A CG  1 
ATOM   996   N ND1 . HIS A 1 140 ? 22.990  -39.376 83.333  1.00 54.37  ? 140 HIS A ND1 1 
ATOM   997   C CD2 . HIS A 1 140 ? 23.996  -37.507 83.846  1.00 52.85  ? 140 HIS A CD2 1 
ATOM   998   C CE1 . HIS A 1 140 ? 22.463  -38.947 84.466  1.00 51.30  ? 140 HIS A CE1 1 
ATOM   999   N NE2 . HIS A 1 140 ? 23.056  -37.815 84.798  1.00 57.95  ? 140 HIS A NE2 1 
ATOM   1000  N N   . ASP A 1 141 ? 26.055  -41.512 82.227  1.00 38.17  ? 141 ASP A N   1 
ATOM   1001  C CA  . ASP A 1 141 ? 26.096  -42.763 82.976  1.00 32.03  ? 141 ASP A CA  1 
ATOM   1002  C C   . ASP A 1 141 ? 27.411  -42.859 83.740  1.00 38.36  ? 141 ASP A C   1 
ATOM   1003  O O   . ASP A 1 141 ? 27.427  -43.044 84.966  1.00 48.98  ? 141 ASP A O   1 
ATOM   1004  C CB  . ASP A 1 141 ? 25.935  -43.963 82.039  1.00 32.18  ? 141 ASP A CB  1 
ATOM   1005  C CG  . ASP A 1 141 ? 24.560  -44.027 81.400  1.00 52.51  ? 141 ASP A CG  1 
ATOM   1006  O OD1 . ASP A 1 141 ? 23.602  -43.475 81.981  1.00 63.44  ? 141 ASP A OD1 1 
ATOM   1007  O OD2 . ASP A 1 141 ? 24.438  -44.632 80.313  1.00 63.85  ? 141 ASP A OD2 1 
ATOM   1008  N N   . ALA A 1 142 ? 28.512  -42.712 83.005  1.00 48.94  ? 142 ALA A N   1 
ATOM   1009  C CA  . ALA A 1 142 ? 29.843  -42.709 83.607  1.00 45.10  ? 142 ALA A CA  1 
ATOM   1010  C C   . ALA A 1 142 ? 29.947  -41.692 84.749  1.00 49.84  ? 142 ALA A C   1 
ATOM   1011  O O   . ALA A 1 142 ? 30.415  -42.015 85.851  1.00 51.42  ? 142 ALA A O   1 
ATOM   1012  C CB  . ALA A 1 142 ? 30.894  -42.422 82.547  1.00 26.25  ? 142 ALA A CB  1 
ATOM   1013  N N   . ALA A 1 143 ? 29.492  -40.471 84.478  1.00 37.43  ? 143 ALA A N   1 
ATOM   1014  C CA  . ALA A 1 143 ? 29.588  -39.376 85.439  1.00 40.86  ? 143 ALA A CA  1 
ATOM   1015  C C   . ALA A 1 143 ? 28.876  -39.687 86.755  1.00 51.01  ? 143 ALA A C   1 
ATOM   1016  O O   . ALA A 1 143 ? 29.459  -39.542 87.836  1.00 45.46  ? 143 ALA A O   1 
ATOM   1017  C CB  . ALA A 1 143 ? 29.029  -38.098 84.831  1.00 34.78  ? 143 ALA A CB  1 
ATOM   1018  N N   . ILE A 1 144 ? 27.626  -40.132 86.666  1.00 48.61  ? 144 ILE A N   1 
ATOM   1019  C CA  . ILE A 1 144 ? 26.852  -40.408 87.871  1.00 46.49  ? 144 ILE A CA  1 
ATOM   1020  C C   . ILE A 1 144 ? 27.362  -41.665 88.576  1.00 40.72  ? 144 ILE A C   1 
ATOM   1021  O O   . ILE A 1 144 ? 27.187  -41.810 89.786  1.00 46.74  ? 144 ILE A O   1 
ATOM   1022  C CB  . ILE A 1 144 ? 25.339  -40.552 87.569  1.00 51.17  ? 144 ILE A CB  1 
ATOM   1023  C CG1 . ILE A 1 144 ? 24.520  -40.391 88.854  1.00 49.21  ? 144 ILE A CG1 1 
ATOM   1024  C CG2 . ILE A 1 144 ? 25.035  -41.877 86.886  1.00 36.70  ? 144 ILE A CG2 1 
ATOM   1025  N N   . ASN A 1 145 ? 28.004  -42.568 87.836  1.00 45.34  ? 145 ASN A N   1 
ATOM   1026  C CA  . ASN A 1 145 ? 28.625  -43.720 88.486  1.00 52.10  ? 145 ASN A CA  1 
ATOM   1027  C C   . ASN A 1 145 ? 29.827  -43.294 89.326  1.00 53.37  ? 145 ASN A C   1 
ATOM   1028  O O   . ASN A 1 145 ? 29.998  -43.750 90.468  1.00 46.45  ? 145 ASN A O   1 
ATOM   1029  C CB  . ASN A 1 145 ? 29.042  -44.770 87.454  1.00 33.37  ? 145 ASN A CB  1 
ATOM   1030  C CG  . ASN A 1 145 ? 27.853  -45.429 86.784  1.00 72.47  ? 145 ASN A CG  1 
ATOM   1031  O OD1 . ASN A 1 145 ? 26.777  -45.537 87.373  1.00 77.91  ? 145 ASN A OD1 1 
ATOM   1032  N ND2 . ASN A 1 145 ? 28.042  -45.875 85.547  1.00 85.82  ? 145 ASN A ND2 1 
ATOM   1033  N N   . ARG A 1 146 ? 30.640  -42.393 88.779  1.00 47.79  ? 146 ARG A N   1 
ATOM   1034  C CA  . ARG A 1 146 ? 31.782  -41.885 89.530  1.00 53.42  ? 146 ARG A CA  1 
ATOM   1035  C C   . ARG A 1 146 ? 31.305  -41.022 90.695  1.00 49.23  ? 146 ARG A C   1 
ATOM   1036  O O   . ARG A 1 146 ? 31.999  -40.894 91.704  1.00 54.98  ? 146 ARG A O   1 
ATOM   1037  C CB  . ARG A 1 146 ? 32.738  -41.097 88.630  1.00 41.65  ? 146 ARG A CB  1 
ATOM   1038  C CG  . ARG A 1 146 ? 34.074  -41.798 88.412  1.00 63.86  ? 146 ARG A CG  1 
ATOM   1039  C CD  . ARG A 1 146 ? 34.570  -41.672 86.979  1.00 96.99  ? 146 ARG A CD  1 
ATOM   1040  N NE  . ARG A 1 146 ? 35.829  -42.389 86.783  1.00 129.61 ? 146 ARG A NE  1 
ATOM   1041  C CZ  . ARG A 1 146 ? 36.602  -42.271 85.708  1.00 122.73 ? 146 ARG A CZ  1 
ATOM   1042  N NH1 . ARG A 1 146 ? 37.729  -42.965 85.621  1.00 93.03  ? 146 ARG A NH1 1 
ATOM   1043  N NH2 . ARG A 1 146 ? 36.249  -41.461 84.719  1.00 116.68 ? 146 ARG A NH2 1 
ATOM   1044  N N   . TYR A 1 147 ? 30.124  -40.426 90.549  1.00 47.49  ? 147 TYR A N   1 
ATOM   1045  C CA  . TYR A 1 147 ? 29.526  -39.665 91.642  1.00 49.33  ? 147 TYR A CA  1 
ATOM   1046  C C   . TYR A 1 147 ? 29.086  -40.593 92.768  1.00 51.13  ? 147 TYR A C   1 
ATOM   1047  O O   . TYR A 1 147 ? 29.294  -40.302 93.947  1.00 50.11  ? 147 TYR A O   1 
ATOM   1048  C CB  . TYR A 1 147 ? 28.338  -38.843 91.149  1.00 34.80  ? 147 TYR A CB  1 
ATOM   1049  C CG  . TYR A 1 147 ? 27.697  -38.003 92.231  1.00 40.92  ? 147 TYR A CG  1 
ATOM   1050  C CD1 . TYR A 1 147 ? 28.239  -36.779 92.598  1.00 41.11  ? 147 TYR A CD1 1 
ATOM   1051  C CD2 . TYR A 1 147 ? 26.550  -38.435 92.885  1.00 46.10  ? 147 TYR A CD2 1 
ATOM   1052  C CE1 . TYR A 1 147 ? 27.656  -36.008 93.587  1.00 48.89  ? 147 TYR A CE1 1 
ATOM   1053  C CE2 . TYR A 1 147 ? 25.961  -37.673 93.873  1.00 32.79  ? 147 TYR A CE2 1 
ATOM   1054  C CZ  . TYR A 1 147 ? 26.518  -36.460 94.221  1.00 49.51  ? 147 TYR A CZ  1 
ATOM   1055  O OH  . TYR A 1 147 ? 25.932  -35.698 95.207  1.00 61.94  ? 147 TYR A OH  1 
ATOM   1056  N N   . SER A 1 148 ? 28.461  -41.704 92.393  1.00 45.86  ? 148 SER A N   1 
ATOM   1057  C CA  . SER A 1 148 ? 28.039  -42.709 93.357  1.00 45.23  ? 148 SER A CA  1 
ATOM   1058  C C   . SER A 1 148 ? 29.229  -43.295 94.105  1.00 38.69  ? 148 SER A C   1 
ATOM   1059  O O   . SER A 1 148 ? 29.138  -43.586 95.298  1.00 42.36  ? 148 SER A O   1 
ATOM   1060  C CB  . SER A 1 148 ? 27.259  -43.824 92.661  1.00 51.91  ? 148 SER A CB  1 
ATOM   1061  O OG  . SER A 1 148 ? 26.060  -43.327 92.094  1.00 61.38  ? 148 SER A OG  1 
ATOM   1062  N N   . ARG A 1 149 ? 30.344  -43.468 93.402  1.00 48.00  ? 149 ARG A N   1 
ATOM   1063  C CA  . ARG A 1 149 ? 31.529  -44.073 94.007  1.00 38.82  ? 149 ARG A CA  1 
ATOM   1064  C C   . ARG A 1 149 ? 32.270  -43.170 94.997  1.00 36.01  ? 149 ARG A C   1 
ATOM   1065  O O   . ARG A 1 149 ? 33.227  -43.612 95.630  1.00 43.47  ? 149 ARG A O   1 
ATOM   1066  C CB  . ARG A 1 149 ? 32.497  -44.540 92.921  1.00 28.35  ? 149 ARG A CB  1 
ATOM   1067  C CG  . ARG A 1 149 ? 32.144  -45.904 92.358  1.00 25.23  ? 149 ARG A CG  1 
ATOM   1068  C CD  . ARG A 1 149 ? 33.167  -46.378 91.345  1.00 58.89  ? 149 ARG A CD  1 
ATOM   1069  N NE  . ARG A 1 149 ? 32.815  -47.685 90.797  1.00 71.47  ? 149 ARG A NE  1 
ATOM   1070  N N   . LEU A 1 150 ? 31.847  -41.914 95.119  1.00 41.74  ? 150 LEU A N   1 
ATOM   1071  C CA  . LEU A 1 150 ? 32.452  -40.992 96.083  1.00 44.48  ? 150 LEU A CA  1 
ATOM   1072  C C   . LEU A 1 150 ? 32.474  -41.574 97.500  1.00 44.08  ? 150 LEU A C   1 
ATOM   1073  O O   . LEU A 1 150 ? 31.529  -42.240 97.917  1.00 54.37  ? 150 LEU A O   1 
ATOM   1074  C CB  . LEU A 1 150 ? 31.702  -39.657 96.091  1.00 45.01  ? 150 LEU A CB  1 
ATOM   1075  C CG  . LEU A 1 150 ? 32.013  -38.635 94.993  1.00 48.37  ? 150 LEU A CG  1 
ATOM   1076  C CD1 . LEU A 1 150 ? 31.284  -37.322 95.253  1.00 56.62  ? 150 LEU A CD1 1 
ATOM   1077  C CD2 . LEU A 1 150 ? 33.508  -38.398 94.874  1.00 57.31  ? 150 LEU A CD2 1 
ATOM   1078  N N   . SER A 1 151 ? 33.551  -41.301 98.234  1.00 65.42  ? 151 SER A N   1 
ATOM   1079  C CA  . SER A 1 151 ? 33.729  -41.802 99.599  1.00 65.01  ? 151 SER A CA  1 
ATOM   1080  C C   . SER A 1 151 ? 32.989  -40.944 100.617 1.00 59.78  ? 151 SER A C   1 
ATOM   1081  O O   . SER A 1 151 ? 33.094  -39.726 100.586 1.00 61.62  ? 151 SER A O   1 
ATOM   1082  C CB  . SER A 1 151 ? 35.215  -41.850 99.944  1.00 66.65  ? 151 SER A CB  1 
ATOM   1083  O OG  . SER A 1 151 ? 35.416  -42.086 101.326 1.00 79.34  ? 151 SER A OG  1 
ATOM   1084  N N   . LYS A 1 152 ? 32.256  -41.574 101.531 1.00 54.31  ? 152 LYS A N   1 
ATOM   1085  C CA  . LYS A 1 152 ? 31.448  -40.812 102.483 1.00 66.13  ? 152 LYS A CA  1 
ATOM   1086  C C   . LYS A 1 152 ? 32.209  -40.161 103.647 1.00 76.27  ? 152 LYS A C   1 
ATOM   1087  O O   . LYS A 1 152 ? 32.040  -38.968 103.896 1.00 74.97  ? 152 LYS A O   1 
ATOM   1088  C CB  . LYS A 1 152 ? 30.332  -41.690 103.055 1.00 49.43  ? 152 LYS A CB  1 
ATOM   1089  C CG  . LYS A 1 152 ? 29.445  -40.936 104.044 1.00 35.75  ? 152 LYS A CG  1 
ATOM   1090  C CD  . LYS A 1 152 ? 28.749  -41.867 105.024 1.00 45.59  ? 152 LYS A CD  1 
ATOM   1091  C CE  . LYS A 1 152 ? 27.417  -41.290 105.493 1.00 49.34  ? 152 LYS A CE  1 
ATOM   1092  N NZ  . LYS A 1 152 ? 26.797  -42.113 106.574 1.00 68.37  ? 152 LYS A NZ  1 
ATOM   1093  N N   . LYS A 1 153 ? 33.029  -40.923 104.364 1.00 72.14  ? 153 LYS A N   1 
ATOM   1094  C CA  . LYS A 1 153 ? 33.582  -40.424 105.624 1.00 85.15  ? 153 LYS A CA  1 
ATOM   1095  C C   . LYS A 1 153 ? 34.813  -39.539 105.421 1.00 86.69  ? 153 LYS A C   1 
ATOM   1096  O O   . LYS A 1 153 ? 35.008  -38.558 106.140 1.00 84.95  ? 153 LYS A O   1 
ATOM   1097  C CB  . LYS A 1 153 ? 33.909  -41.590 106.563 1.00 68.44  ? 153 LYS A CB  1 
ATOM   1098  C CG  . LYS A 1 153 ? 35.209  -42.320 106.259 1.00 85.03  ? 153 LYS A CG  1 
ATOM   1099  C CD  . LYS A 1 153 ? 35.526  -43.355 107.321 1.00 109.37 ? 153 LYS A CD  1 
ATOM   1100  C CE  . LYS A 1 153 ? 34.262  -43.923 107.937 1.00 95.57  ? 153 LYS A CE  1 
ATOM   1101  N NZ  . LYS A 1 153 ? 34.576  -44.732 109.140 1.00 77.78  ? 153 LYS A NZ  1 
ATOM   1102  N N   . ARG A 1 154 ? 35.639  -39.888 104.442 1.00 73.91  ? 154 ARG A N   1 
ATOM   1103  C CA  . ARG A 1 154 ? 36.743  -39.034 104.047 1.00 90.21  ? 154 ARG A CA  1 
ATOM   1104  C C   . ARG A 1 154 ? 36.443  -38.362 102.726 1.00 80.63  ? 154 ARG A C   1 
ATOM   1105  O O   . ARG A 1 154 ? 36.596  -38.958 101.659 1.00 82.33  ? 154 ARG A O   1 
ATOM   1106  C CB  . ARG A 1 154 ? 38.022  -39.851 103.921 1.00 100.96 ? 154 ARG A CB  1 
ATOM   1107  C CG  . ARG A 1 154 ? 38.480  -40.528 105.191 1.00 112.56 ? 154 ARG A CG  1 
ATOM   1108  C CD  . ARG A 1 154 ? 39.664  -41.387 104.858 1.00 118.41 ? 154 ARG A CD  1 
ATOM   1109  N NE  . ARG A 1 154 ? 40.718  -40.605 104.226 1.00 136.43 ? 154 ARG A NE  1 
ATOM   1110  C CZ  . ARG A 1 154 ? 41.794  -41.115 103.643 1.00 126.00 ? 154 ARG A CZ  1 
ATOM   1111  N NH1 . ARG A 1 154 ? 42.688  -40.305 103.091 1.00 112.11 ? 154 ARG A NH1 1 
ATOM   1112  N NH2 . ARG A 1 154 ? 41.981  -42.421 103.623 1.00 125.64 ? 154 ARG A NH2 1 
ATOM   1113  N N   . GLU A 1 155 ? 36.041  -37.103 102.796 1.00 88.06  ? 155 GLU A N   1 
ATOM   1114  C CA  . GLU A 1 155 ? 35.735  -36.379 101.580 1.00 105.59 ? 155 GLU A CA  1 
ATOM   1115  C C   . GLU A 1 155 ? 36.713  -35.256 101.278 1.00 111.54 ? 155 GLU A C   1 
ATOM   1116  O O   . GLU A 1 155 ? 36.962  -34.372 102.099 1.00 110.94 ? 155 GLU A O   1 
ATOM   1117  C CB  . GLU A 1 155 ? 34.303  -35.850 101.650 1.00 100.68 ? 155 GLU A CB  1 
ATOM   1118  C CG  . GLU A 1 155 ? 33.326  -36.714 100.864 1.00 94.92  ? 155 GLU A CG  1 
ATOM   1119  C CD  . GLU A 1 155 ? 31.918  -36.720 101.436 1.00 95.56  ? 155 GLU A CD  1 
ATOM   1120  O OE1 . GLU A 1 155 ? 31.458  -35.663 101.914 1.00 114.95 ? 155 GLU A OE1 1 
ATOM   1121  O OE2 . GLU A 1 155 ? 31.255  -37.776 101.373 1.00 97.35  ? 155 GLU A OE2 1 
ATOM   1122  N N   . ASN A 1 156 ? 37.248  -35.311 100.066 1.00 107.95 ? 156 ASN A N   1 
ATOM   1123  C CA  . ASN A 1 156 ? 38.117  -34.282 99.533  1.00 90.46  ? 156 ASN A CA  1 
ATOM   1124  C C   . ASN A 1 156 ? 37.226  -33.414 98.662  1.00 91.81  ? 156 ASN A C   1 
ATOM   1125  O O   . ASN A 1 156 ? 36.702  -33.874 97.649  1.00 99.42  ? 156 ASN A O   1 
ATOM   1126  C CB  . ASN A 1 156 ? 39.287  -34.915 98.763  1.00 78.68  ? 156 ASN A CB  1 
ATOM   1127  C CG  . ASN A 1 156 ? 39.971  -33.957 97.798  1.00 98.10  ? 156 ASN A CG  1 
ATOM   1128  O OD1 . ASN A 1 156 ? 39.843  -32.736 97.896  1.00 94.09  ? 156 ASN A OD1 1 
ATOM   1129  N ND2 . ASN A 1 156 ? 40.712  -34.523 96.852  1.00 111.20 ? 156 ASN A ND2 1 
ATOM   1130  N N   . ASP A 1 157 ? 37.042  -32.164 99.068  1.00 87.16  ? 157 ASP A N   1 
ATOM   1131  C CA  . ASP A 1 157 ? 36.094  -31.283 98.399  1.00 98.53  ? 157 ASP A CA  1 
ATOM   1132  C C   . ASP A 1 157 ? 36.475  -31.021 96.947  1.00 98.67  ? 157 ASP A C   1 
ATOM   1133  O O   . ASP A 1 157 ? 35.605  -30.780 96.115  1.00 85.98  ? 157 ASP A O   1 
ATOM   1134  C CB  . ASP A 1 157 ? 35.963  -29.966 99.164  1.00 96.41  ? 157 ASP A CB  1 
ATOM   1135  C CG  . ASP A 1 157 ? 35.247  -30.135 100.491 1.00 94.16  ? 157 ASP A CG  1 
ATOM   1136  O OD1 . ASP A 1 157 ? 35.130  -31.287 100.960 1.00 93.41  ? 157 ASP A OD1 1 
ATOM   1137  O OD2 . ASP A 1 157 ? 34.799  -29.120 101.063 1.00 105.75 ? 157 ASP A OD2 1 
ATOM   1138  N N   . LYS A 1 158 ? 37.769  -31.057 96.646  1.00 93.89  ? 158 LYS A N   1 
ATOM   1139  C CA  . LYS A 1 158 ? 38.232  -30.855 95.277  1.00 85.93  ? 158 LYS A CA  1 
ATOM   1140  C C   . LYS A 1 158 ? 37.704  -31.932 94.326  1.00 87.80  ? 158 LYS A C   1 
ATOM   1141  O O   . LYS A 1 158 ? 36.963  -31.630 93.383  1.00 96.88  ? 158 LYS A O   1 
ATOM   1142  C CB  . LYS A 1 158 ? 39.761  -30.826 95.230  1.00 84.11  ? 158 LYS A CB  1 
ATOM   1143  N N   . VAL A 1 159 ? 38.076  -33.185 94.583  1.00 79.82  ? 159 VAL A N   1 
ATOM   1144  C CA  . VAL A 1 159 ? 37.654  -34.297 93.734  1.00 87.31  ? 159 VAL A CA  1 
ATOM   1145  C C   . VAL A 1 159 ? 36.129  -34.426 93.721  1.00 82.79  ? 159 VAL A C   1 
ATOM   1146  O O   . VAL A 1 159 ? 35.529  -34.706 92.680  1.00 89.87  ? 159 VAL A O   1 
ATOM   1147  C CB  . VAL A 1 159 ? 38.309  -35.639 94.173  1.00 68.92  ? 159 VAL A CB  1 
ATOM   1148  C CG1 . VAL A 1 159 ? 37.926  -36.016 95.597  1.00 80.68  ? 159 VAL A CG1 1 
ATOM   1149  C CG2 . VAL A 1 159 ? 37.958  -36.755 93.197  1.00 77.65  ? 159 VAL A CG2 1 
ATOM   1150  N N   . LYS A 1 160 ? 35.509  -34.193 94.875  1.00 66.99  ? 160 LYS A N   1 
ATOM   1151  C CA  . LYS A 1 160 ? 34.060  -34.263 95.002  1.00 80.19  ? 160 LYS A CA  1 
ATOM   1152  C C   . LYS A 1 160 ? 33.379  -33.230 94.113  1.00 75.78  ? 160 LYS A C   1 
ATOM   1153  O O   . LYS A 1 160 ? 32.408  -33.537 93.426  1.00 85.23  ? 160 LYS A O   1 
ATOM   1154  C CB  . LYS A 1 160 ? 33.639  -34.062 96.459  1.00 71.72  ? 160 LYS A CB  1 
ATOM   1155  C CG  . LYS A 1 160 ? 32.160  -33.772 96.642  1.00 53.06  ? 160 LYS A CG  1 
ATOM   1156  C CD  . LYS A 1 160 ? 31.837  -33.467 98.092  1.00 65.67  ? 160 LYS A CD  1 
ATOM   1157  C CE  . LYS A 1 160 ? 30.344  -33.279 98.295  1.00 80.82  ? 160 LYS A CE  1 
ATOM   1158  N NZ  . LYS A 1 160 ? 30.016  -32.985 99.716  1.00 97.47  ? 160 LYS A NZ  1 
ATOM   1159  N N   . TYR A 1 161 ? 33.894  -32.004 94.134  1.00 66.10  ? 161 TYR A N   1 
ATOM   1160  C CA  . TYR A 1 161 ? 33.347  -30.927 93.318  1.00 74.35  ? 161 TYR A CA  1 
ATOM   1161  C C   . TYR A 1 161 ? 33.536  -31.214 91.830  1.00 77.55  ? 161 TYR A C   1 
ATOM   1162  O O   . TYR A 1 161 ? 32.611  -31.025 91.030  1.00 77.93  ? 161 TYR A O   1 
ATOM   1163  C CB  . TYR A 1 161 ? 33.996  -29.590 93.686  1.00 70.69  ? 161 TYR A CB  1 
ATOM   1164  C CG  . TYR A 1 161 ? 33.587  -28.447 92.789  1.00 96.48  ? 161 TYR A CG  1 
ATOM   1165  C CD1 . TYR A 1 161 ? 32.373  -27.800 92.971  1.00 108.17 ? 161 TYR A CD1 1 
ATOM   1166  C CD2 . TYR A 1 161 ? 34.413  -28.014 91.759  1.00 91.07  ? 161 TYR A CD2 1 
ATOM   1167  C CE1 . TYR A 1 161 ? 31.990  -26.755 92.155  1.00 104.58 ? 161 TYR A CE1 1 
ATOM   1168  C CE2 . TYR A 1 161 ? 34.038  -26.968 90.935  1.00 91.16  ? 161 TYR A CE2 1 
ATOM   1169  C CZ  . TYR A 1 161 ? 32.825  -26.343 91.139  1.00 96.53  ? 161 TYR A CZ  1 
ATOM   1170  O OH  . TYR A 1 161 ? 32.442  -25.302 90.326  1.00 104.07 ? 161 TYR A OH  1 
ATOM   1171  N N   . GLU A 1 162 ? 34.729  -31.686 91.470  1.00 80.12  ? 162 GLU A N   1 
ATOM   1172  C CA  . GLU A 1 162 ? 35.037  -32.021 90.082  1.00 85.78  ? 162 GLU A CA  1 
ATOM   1173  C C   . GLU A 1 162 ? 34.064  -33.070 89.552  1.00 84.27  ? 162 GLU A C   1 
ATOM   1174  O O   . GLU A 1 162 ? 33.475  -32.906 88.479  1.00 76.09  ? 162 GLU A O   1 
ATOM   1175  C CB  . GLU A 1 162 ? 36.472  -32.538 89.958  1.00 77.28  ? 162 GLU A CB  1 
ATOM   1176  C CG  . GLU A 1 162 ? 37.542  -31.507 90.262  1.00 90.17  ? 162 GLU A CG  1 
ATOM   1177  C CD  . GLU A 1 162 ? 38.948  -32.047 90.073  1.00 106.79 ? 162 GLU A CD  1 
ATOM   1178  O OE1 . GLU A 1 162 ? 39.138  -32.924 89.204  1.00 125.57 ? 162 GLU A OE1 1 
ATOM   1179  O OE2 . GLU A 1 162 ? 39.859  -31.600 90.801  1.00 109.54 ? 162 GLU A OE2 1 
ATOM   1180  N N   . VAL A 1 163 ? 33.887  -34.139 90.322  1.00 72.73  ? 163 VAL A N   1 
ATOM   1181  C CA  . VAL A 1 163 ? 32.970  -35.207 89.943  1.00 71.94  ? 163 VAL A CA  1 
ATOM   1182  C C   . VAL A 1 163 ? 31.531  -34.697 89.863  1.00 61.94  ? 163 VAL A C   1 
ATOM   1183  O O   . VAL A 1 163 ? 30.799  -35.000 88.911  1.00 48.92  ? 163 VAL A O   1 
ATOM   1184  C CB  . VAL A 1 163 ? 33.036  -36.387 90.935  1.00 58.29  ? 163 VAL A CB  1 
ATOM   1185  C CG1 . VAL A 1 163 ? 31.957  -37.393 90.620  1.00 67.42  ? 163 VAL A CG1 1 
ATOM   1186  C CG2 . VAL A 1 163 ? 34.401  -37.051 90.887  1.00 42.25  ? 163 VAL A CG2 1 
ATOM   1187  N N   . THR A 1 164 ? 31.142  -33.901 90.854  1.00 53.49  ? 164 THR A N   1 
ATOM   1188  C CA  . THR A 1 164 ? 29.802  -33.328 90.908  1.00 58.41  ? 164 THR A CA  1 
ATOM   1189  C C   . THR A 1 164 ? 29.443  -32.501 89.679  1.00 62.41  ? 164 THR A C   1 
ATOM   1190  O O   . THR A 1 164 ? 28.362  -32.661 89.112  1.00 67.43  ? 164 THR A O   1 
ATOM   1191  C CB  . THR A 1 164 ? 29.636  -32.425 92.150  1.00 54.14  ? 164 THR A CB  1 
ATOM   1192  O OG1 . THR A 1 164 ? 29.972  -33.160 93.333  1.00 50.12  ? 164 THR A OG1 1 
ATOM   1193  C CG2 . THR A 1 164 ? 28.207  -31.917 92.257  1.00 55.52  ? 164 THR A CG2 1 
ATOM   1194  N N   . GLU A 1 165 ? 30.348  -31.623 89.254  1.00 67.31  ? 165 GLU A N   1 
ATOM   1195  C CA  . GLU A 1 165 ? 30.022  -30.727 88.149  1.00 77.91  ? 165 GLU A CA  1 
ATOM   1196  C C   . GLU A 1 165 ? 30.340  -31.401 86.799  1.00 73.53  ? 165 GLU A C   1 
ATOM   1197  O O   . GLU A 1 165 ? 29.873  -30.948 85.745  1.00 73.88  ? 165 GLU A O   1 
ATOM   1198  C CB  . GLU A 1 165 ? 30.746  -29.377 88.335  1.00 81.72  ? 165 GLU A CB  1 
ATOM   1199  C CG  . GLU A 1 165 ? 30.938  -28.512 87.092  1.00 91.40  ? 165 GLU A CG  1 
ATOM   1200  C CD  . GLU A 1 165 ? 32.330  -28.620 86.496  1.00 110.45 ? 165 GLU A CD  1 
ATOM   1201  O OE1 . GLU A 1 165 ? 33.267  -29.015 87.223  1.00 105.82 ? 165 GLU A OE1 1 
ATOM   1202  O OE2 . GLU A 1 165 ? 32.488  -28.306 85.297  1.00 111.27 ? 165 GLU A OE2 1 
ATOM   1203  N N   . ASP A 1 166 ? 31.096  -32.500 86.827  1.00 64.60  ? 166 ASP A N   1 
ATOM   1204  C CA  . ASP A 1 166 ? 31.124  -33.388 85.665  1.00 58.57  ? 166 ASP A CA  1 
ATOM   1205  C C   . ASP A 1 166 ? 29.735  -33.991 85.470  1.00 62.86  ? 166 ASP A C   1 
ATOM   1206  O O   . ASP A 1 166 ? 29.225  -34.065 84.344  1.00 59.99  ? 166 ASP A O   1 
ATOM   1207  C CB  . ASP A 1 166 ? 32.167  -34.492 85.816  1.00 60.21  ? 166 ASP A CB  1 
ATOM   1208  C CG  . ASP A 1 166 ? 33.392  -34.262 84.948  1.00 85.34  ? 166 ASP A CG  1 
ATOM   1209  O OD1 . ASP A 1 166 ? 33.677  -33.092 84.610  1.00 88.74  ? 166 ASP A OD1 1 
ATOM   1210  O OD2 . ASP A 1 166 ? 34.055  -35.259 84.583  1.00 89.65  ? 166 ASP A OD2 1 
ATOM   1211  N N   . VAL A 1 167 ? 29.131  -34.421 86.575  1.00 56.71  ? 167 VAL A N   1 
ATOM   1212  C CA  . VAL A 1 167 ? 27.768  -34.939 86.547  1.00 48.85  ? 167 VAL A CA  1 
ATOM   1213  C C   . VAL A 1 167 ? 26.825  -33.863 86.027  1.00 55.13  ? 167 VAL A C   1 
ATOM   1214  O O   . VAL A 1 167 ? 25.968  -34.132 85.187  1.00 54.39  ? 167 VAL A O   1 
ATOM   1215  C CB  . VAL A 1 167 ? 27.302  -35.407 87.939  1.00 50.59  ? 167 VAL A CB  1 
ATOM   1216  C CG1 . VAL A 1 167 ? 25.794  -35.644 87.957  1.00 37.08  ? 167 VAL A CG1 1 
ATOM   1217  C CG2 . VAL A 1 167 ? 28.052  -36.656 88.352  1.00 50.86  ? 167 VAL A CG2 1 
ATOM   1218  N N   . TYR A 1 168 ? 26.995  -32.645 86.531  1.00 50.26  ? 168 TYR A N   1 
ATOM   1219  C CA  . TYR A 1 168 ? 26.198  -31.511 86.076  1.00 56.40  ? 168 TYR A CA  1 
ATOM   1220  C C   . TYR A 1 168 ? 26.292  -31.313 84.564  1.00 67.17  ? 168 TYR A C   1 
ATOM   1221  O O   . TYR A 1 168 ? 25.273  -31.199 83.875  1.00 64.33  ? 168 TYR A O   1 
ATOM   1222  C CB  . TYR A 1 168 ? 26.629  -30.231 86.800  1.00 57.68  ? 168 TYR A CB  1 
ATOM   1223  C CG  . TYR A 1 168 ? 26.416  -28.970 85.992  1.00 65.22  ? 168 TYR A CG  1 
ATOM   1224  C CD1 . TYR A 1 168 ? 25.170  -28.362 85.944  1.00 73.10  ? 168 TYR A CD1 1 
ATOM   1225  C CD2 . TYR A 1 168 ? 27.467  -28.363 85.313  1.00 69.76  ? 168 TYR A CD2 1 
ATOM   1226  C CE1 . TYR A 1 168 ? 24.964  -27.214 85.210  1.00 81.35  ? 168 TYR A CE1 1 
ATOM   1227  C CE2 . TYR A 1 168 ? 27.272  -27.205 84.583  1.00 74.83  ? 168 TYR A CE2 1 
ATOM   1228  C CZ  . TYR A 1 168 ? 26.018  -26.632 84.540  1.00 71.95  ? 168 TYR A CZ  1 
ATOM   1229  O OH  . TYR A 1 168 ? 25.807  -25.479 83.820  1.00 77.73  ? 168 TYR A OH  1 
ATOM   1230  N N   . THR A 1 169 ? 27.522  -31.277 84.059  1.00 56.40  ? 169 THR A N   1 
ATOM   1231  C CA  . THR A 1 169 ? 27.775  -31.060 82.640  1.00 55.95  ? 169 THR A CA  1 
ATOM   1232  C C   . THR A 1 169 ? 27.148  -32.145 81.768  1.00 57.15  ? 169 THR A C   1 
ATOM   1233  O O   . THR A 1 169 ? 26.389  -31.852 80.835  1.00 53.38  ? 169 THR A O   1 
ATOM   1234  C CB  . THR A 1 169 ? 29.288  -31.007 82.355  1.00 61.34  ? 169 THR A CB  1 
ATOM   1235  O OG1 . THR A 1 169 ? 29.841  -29.814 82.925  1.00 54.72  ? 169 THR A OG1 1 
ATOM   1236  C CG2 . THR A 1 169 ? 29.557  -31.024 80.857  1.00 60.25  ? 169 THR A CG2 1 
ATOM   1237  N N   . SER A 1 170 ? 27.464  -33.397 82.086  1.00 46.86  ? 170 SER A N   1 
ATOM   1238  C CA  . SER A 1 170 ? 26.960  -34.529 81.317  1.00 42.72  ? 170 SER A CA  1 
ATOM   1239  C C   . SER A 1 170 ? 25.434  -34.606 81.361  1.00 56.08  ? 170 SER A C   1 
ATOM   1240  O O   . SER A 1 170 ? 24.794  -34.928 80.362  1.00 67.55  ? 170 SER A O   1 
ATOM   1241  C CB  . SER A 1 170 ? 27.568  -35.834 81.828  1.00 35.83  ? 170 SER A CB  1 
ATOM   1242  O OG  . SER A 1 170 ? 27.113  -36.129 83.135  1.00 61.78  ? 170 SER A OG  1 
ATOM   1243  N N   . ARG A 1 171 ? 24.859  -34.310 82.523  1.00 49.60  ? 171 ARG A N   1 
ATOM   1244  C CA  . ARG A 1 171 ? 23.410  -34.341 82.687  1.00 56.63  ? 171 ARG A CA  1 
ATOM   1245  C C   . ARG A 1 171 ? 22.741  -33.263 81.843  1.00 60.72  ? 171 ARG A C   1 
ATOM   1246  O O   . ARG A 1 171 ? 21.744  -33.524 81.160  1.00 64.71  ? 171 ARG A O   1 
ATOM   1247  C CB  . ARG A 1 171 ? 23.029  -34.160 84.159  1.00 61.90  ? 171 ARG A CB  1 
ATOM   1248  C CG  . ARG A 1 171 ? 21.557  -34.395 84.458  1.00 53.30  ? 171 ARG A CG  1 
ATOM   1249  C CD  . ARG A 1 171 ? 21.299  -34.490 85.955  1.00 51.34  ? 171 ARG A CD  1 
ATOM   1250  N NE  . ARG A 1 171 ? 21.850  -35.709 86.538  1.00 51.61  ? 171 ARG A NE  1 
ATOM   1251  C CZ  . ARG A 1 171 ? 21.815  -35.998 87.835  1.00 64.73  ? 171 ARG A CZ  1 
ATOM   1252  N NH1 . ARG A 1 171 ? 21.251  -35.155 88.690  1.00 58.75  ? 171 ARG A NH1 1 
ATOM   1253  N NH2 . ARG A 1 171 ? 22.341  -37.132 88.278  1.00 57.15  ? 171 ARG A NH2 1 
ATOM   1254  N N   . LYS A 1 172 ? 23.296  -32.055 81.891  1.00 45.95  ? 172 LYS A N   1 
ATOM   1255  C CA  . LYS A 1 172 ? 22.780  -30.953 81.088  1.00 59.55  ? 172 LYS A CA  1 
ATOM   1256  C C   . LYS A 1 172 ? 22.838  -31.283 79.596  1.00 63.04  ? 172 LYS A C   1 
ATOM   1257  O O   . LYS A 1 172 ? 21.851  -31.097 78.871  1.00 58.29  ? 172 LYS A O   1 
ATOM   1258  C CB  . LYS A 1 172 ? 23.546  -29.662 81.376  1.00 61.19  ? 172 LYS A CB  1 
ATOM   1259  C CG  . LYS A 1 172 ? 22.753  -28.411 81.032  1.00 62.50  ? 172 LYS A CG  1 
ATOM   1260  C CD  . LYS A 1 172 ? 23.582  -27.147 81.151  1.00 69.43  ? 172 LYS A CD  1 
ATOM   1261  C CE  . LYS A 1 172 ? 22.711  -25.914 80.963  1.00 68.20  ? 172 LYS A CE  1 
ATOM   1262  N NZ  . LYS A 1 172 ? 21.885  -25.990 79.725  1.00 65.91  ? 172 LYS A NZ  1 
ATOM   1263  N N   . LYS A 1 173 ? 23.988  -31.777 79.139  1.00 65.64  ? 173 LYS A N   1 
ATOM   1264  C CA  . LYS A 1 173 ? 24.120  -32.141 77.731  1.00 58.36  ? 173 LYS A CA  1 
ATOM   1265  C C   . LYS A 1 173 ? 23.152  -33.254 77.350  1.00 61.98  ? 173 LYS A C   1 
ATOM   1266  O O   . LYS A 1 173 ? 22.604  -33.248 76.250  1.00 67.21  ? 173 LYS A O   1 
ATOM   1267  C CB  . LYS A 1 173 ? 25.546  -32.570 77.383  1.00 43.31  ? 173 LYS A CB  1 
ATOM   1268  C CG  . LYS A 1 173 ? 25.847  -32.387 75.899  1.00 67.35  ? 173 LYS A CG  1 
ATOM   1269  C CD  . LYS A 1 173 ? 27.066  -33.164 75.437  1.00 78.73  ? 173 LYS A CD  1 
ATOM   1270  C CE  . LYS A 1 173 ? 27.257  -33.005 73.934  1.00 62.80  ? 173 LYS A CE  1 
ATOM   1271  N NZ  . LYS A 1 173 ? 28.308  -33.907 73.390  1.00 82.94  ? 173 LYS A NZ  1 
ATOM   1272  N N   . GLN A 1 174 ? 22.945  -34.209 78.252  1.00 58.26  ? 174 GLN A N   1 
ATOM   1273  C CA  . GLN A 1 174 ? 21.991  -35.282 77.996  1.00 49.40  ? 174 GLN A CA  1 
ATOM   1274  C C   . GLN A 1 174 ? 20.596  -34.707 77.801  1.00 53.54  ? 174 GLN A C   1 
ATOM   1275  O O   . GLN A 1 174 ? 19.876  -35.109 76.885  1.00 53.94  ? 174 GLN A O   1 
ATOM   1276  C CB  . GLN A 1 174 ? 21.979  -36.306 79.132  1.00 48.45  ? 174 GLN A CB  1 
ATOM   1277  C CG  . GLN A 1 174 ? 21.169  -37.553 78.799  1.00 48.48  ? 174 GLN A CG  1 
ATOM   1278  C CD  . GLN A 1 174 ? 21.123  -38.552 79.937  1.00 56.02  ? 174 GLN A CD  1 
ATOM   1279  O OE1 . GLN A 1 174 ? 21.283  -39.754 79.730  1.00 60.04  ? 174 GLN A OE1 1 
ATOM   1280  N NE2 . GLN A 1 174 ? 20.893  -38.058 81.148  1.00 66.07  ? 174 GLN A NE2 1 
ATOM   1281  N N   . HIS A 1 175 ? 20.219  -33.768 78.666  1.00 53.64  ? 175 HIS A N   1 
ATOM   1282  C CA  . HIS A 1 175 ? 18.917  -33.118 78.556  1.00 57.50  ? 175 HIS A CA  1 
ATOM   1283  C C   . HIS A 1 175 ? 18.764  -32.416 77.210  1.00 63.08  ? 175 HIS A C   1 
ATOM   1284  O O   . HIS A 1 175 ? 17.772  -32.621 76.497  1.00 69.55  ? 175 HIS A O   1 
ATOM   1285  C CB  . HIS A 1 175 ? 18.716  -32.115 79.694  1.00 51.56  ? 175 HIS A CB  1 
ATOM   1286  C CG  . HIS A 1 175 ? 17.302  -31.647 79.842  1.00 53.17  ? 175 HIS A CG  1 
ATOM   1287  N ND1 . HIS A 1 175 ? 16.969  -30.470 80.477  1.00 47.74  ? 175 HIS A ND1 1 
ATOM   1288  C CD2 . HIS A 1 175 ? 16.134  -32.199 79.436  1.00 55.05  ? 175 HIS A CD2 1 
ATOM   1289  C CE1 . HIS A 1 175 ? 15.656  -30.318 80.456  1.00 44.27  ? 175 HIS A CE1 1 
ATOM   1290  N NE2 . HIS A 1 175 ? 15.126  -31.352 79.831  1.00 59.25  ? 175 HIS A NE2 1 
ATOM   1291  N N   . GLN A 1 176 ? 19.757  -31.604 76.856  1.00 68.55  ? 176 GLN A N   1 
ATOM   1292  C CA  . GLN A 1 176 ? 19.688  -30.834 75.619  1.00 68.73  ? 176 GLN A CA  1 
ATOM   1293  C C   . GLN A 1 176 ? 19.612  -31.745 74.394  1.00 59.34  ? 176 GLN A C   1 
ATOM   1294  O O   . GLN A 1 176 ? 18.713  -31.601 73.564  1.00 61.09  ? 176 GLN A O   1 
ATOM   1295  C CB  . GLN A 1 176 ? 20.890  -29.890 75.499  1.00 65.97  ? 176 GLN A CB  1 
ATOM   1296  C CG  . GLN A 1 176 ? 20.800  -28.648 76.380  1.00 72.42  ? 176 GLN A CG  1 
ATOM   1297  C CD  . GLN A 1 176 ? 22.043  -27.780 76.300  1.00 84.48  ? 176 GLN A CD  1 
ATOM   1298  O OE1 . GLN A 1 176 ? 22.626  -27.412 77.320  1.00 85.17  ? 176 GLN A OE1 1 
ATOM   1299  N NE2 . GLN A 1 176 ? 22.452  -27.446 75.081  1.00 109.12 ? 176 GLN A NE2 1 
ATOM   1300  N N   . THR A 1 177 ? 20.534  -32.700 74.305  1.00 54.85  ? 177 THR A N   1 
ATOM   1301  C CA  . THR A 1 177 ? 20.592  -33.611 73.164  1.00 55.06  ? 177 THR A CA  1 
ATOM   1302  C C   . THR A 1 177 ? 19.325  -34.449 73.041  1.00 43.79  ? 177 THR A C   1 
ATOM   1303  O O   . THR A 1 177 ? 18.811  -34.649 71.937  1.00 58.85  ? 177 THR A O   1 
ATOM   1304  C CB  . THR A 1 177 ? 21.810  -34.550 73.252  1.00 44.60  ? 177 THR A CB  1 
ATOM   1305  O OG1 . THR A 1 177 ? 21.772  -35.274 74.488  1.00 63.39  ? 177 THR A OG1 1 
ATOM   1306  C CG2 . THR A 1 177 ? 23.101  -33.752 73.177  1.00 42.27  ? 177 THR A CG2 1 
ATOM   1307  N N   . MET A 1 178 ? 18.817  -34.929 74.173  1.00 54.62  ? 178 MET A N   1 
ATOM   1308  C CA  . MET A 1 178 ? 17.586  -35.708 74.159  1.00 58.57  ? 178 MET A CA  1 
ATOM   1309  C C   . MET A 1 178 ? 16.445  -34.843 73.644  1.00 56.32  ? 178 MET A C   1 
ATOM   1310  O O   . MET A 1 178 ? 15.594  -35.315 72.888  1.00 62.90  ? 178 MET A O   1 
ATOM   1311  C CB  . MET A 1 178 ? 17.243  -36.253 75.547  1.00 54.30  ? 178 MET A CB  1 
ATOM   1312  C CG  . MET A 1 178 ? 16.198  -37.363 75.519  1.00 53.57  ? 178 MET A CG  1 
ATOM   1313  S SD  . MET A 1 178 ? 15.782  -38.046 77.138  1.00 61.72  ? 178 MET A SD  1 
ATOM   1314  C CE  . MET A 1 178 ? 17.366  -37.987 77.970  1.00 79.81  ? 178 MET A CE  1 
ATOM   1315  N N   . MET A 1 179 ? 16.430  -33.576 74.051  1.00 54.12  ? 179 MET A N   1 
ATOM   1316  C CA  . MET A 1 179 ? 15.385  -32.667 73.589  1.00 54.49  ? 179 MET A CA  1 
ATOM   1317  C C   . MET A 1 179 ? 15.457  -32.375 72.093  1.00 63.63  ? 179 MET A C   1 
ATOM   1318  O O   . MET A 1 179 ? 14.424  -32.372 71.418  1.00 59.06  ? 179 MET A O   1 
ATOM   1319  C CB  . MET A 1 179 ? 15.421  -31.358 74.377  1.00 59.41  ? 179 MET A CB  1 
ATOM   1320  C CG  . MET A 1 179 ? 14.307  -31.280 75.404  1.00 84.44  ? 179 MET A CG  1 
ATOM   1321  S SD  . MET A 1 179 ? 13.986  -29.633 76.054  1.00 103.51 ? 179 MET A SD  1 
ATOM   1322  C CE  . MET A 1 179 ? 15.519  -29.302 76.915  1.00 68.39  ? 179 MET A CE  1 
ATOM   1323  N N   . HIS A 1 180 ? 16.658  -32.122 71.574  1.00 63.38  ? 180 HIS A N   1 
ATOM   1324  C CA  . HIS A 1 180 ? 16.803  -31.886 70.138  1.00 56.52  ? 180 HIS A CA  1 
ATOM   1325  C C   . HIS A 1 180 ? 16.377  -33.118 69.361  1.00 55.02  ? 180 HIS A C   1 
ATOM   1326  O O   . HIS A 1 180 ? 15.702  -33.013 68.339  1.00 61.51  ? 180 HIS A O   1 
ATOM   1327  C CB  . HIS A 1 180 ? 18.234  -31.519 69.738  1.00 65.32  ? 180 HIS A CB  1 
ATOM   1328  C CG  . HIS A 1 180 ? 18.778  -30.300 70.414  1.00 82.24  ? 180 HIS A CG  1 
ATOM   1329  N ND1 . HIS A 1 180 ? 19.093  -30.268 71.758  1.00 91.97  ? 180 HIS A ND1 1 
ATOM   1330  C CD2 . HIS A 1 180 ? 19.042  -29.061 69.941  1.00 94.16  ? 180 HIS A CD2 1 
ATOM   1331  C CE1 . HIS A 1 180 ? 19.547  -29.069 72.073  1.00 86.75  ? 180 HIS A CE1 1 
ATOM   1332  N NE2 . HIS A 1 180 ? 19.518  -28.313 70.991  1.00 90.58  ? 180 HIS A NE2 1 
ATOM   1333  N N   . TYR A 1 181 ? 16.793  -34.281 69.849  1.00 43.87  ? 181 TYR A N   1 
ATOM   1334  C CA  . TYR A 1 181 ? 16.406  -35.558 69.259  1.00 44.79  ? 181 TYR A CA  1 
ATOM   1335  C C   . TYR A 1 181 ? 14.882  -35.683 69.189  1.00 58.50  ? 181 TYR A C   1 
ATOM   1336  O O   . TYR A 1 181 ? 14.312  -36.003 68.138  1.00 51.71  ? 181 TYR A O   1 
ATOM   1337  C CB  . TYR A 1 181 ? 17.009  -36.709 70.068  1.00 33.06  ? 181 TYR A CB  1 
ATOM   1338  C CG  . TYR A 1 181 ? 16.957  -38.058 69.391  1.00 33.21  ? 181 TYR A CG  1 
ATOM   1339  C CD1 . TYR A 1 181 ? 16.743  -38.167 68.025  1.00 36.48  ? 181 TYR A CD1 1 
ATOM   1340  C CD2 . TYR A 1 181 ? 17.126  -39.224 70.124  1.00 33.15  ? 181 TYR A CD2 1 
ATOM   1341  C CE1 . TYR A 1 181 ? 16.697  -39.402 67.406  1.00 49.85  ? 181 TYR A CE1 1 
ATOM   1342  C CE2 . TYR A 1 181 ? 17.081  -40.462 69.517  1.00 34.13  ? 181 TYR A CE2 1 
ATOM   1343  C CZ  . TYR A 1 181 ? 16.865  -40.546 68.158  1.00 46.70  ? 181 TYR A CZ  1 
ATOM   1344  O OH  . TYR A 1 181 ? 16.821  -41.778 67.549  1.00 60.21  ? 181 TYR A OH  1 
ATOM   1345  N N   . PHE A 1 182 ? 14.235  -35.419 70.321  1.00 47.85  ? 182 PHE A N   1 
ATOM   1346  C CA  . PHE A 1 182 ? 12.781  -35.502 70.434  1.00 55.50  ? 182 PHE A CA  1 
ATOM   1347  C C   . PHE A 1 182 ? 12.071  -34.566 69.457  1.00 59.56  ? 182 PHE A C   1 
ATOM   1348  O O   . PHE A 1 182 ? 11.151  -34.979 68.748  1.00 57.20  ? 182 PHE A O   1 
ATOM   1349  C CB  . PHE A 1 182 ? 12.339  -35.193 71.867  1.00 50.17  ? 182 PHE A CB  1 
ATOM   1350  C CG  . PHE A 1 182 ? 12.405  -36.378 72.792  1.00 48.49  ? 182 PHE A CG  1 
ATOM   1351  C CD1 . PHE A 1 182 ? 13.286  -37.420 72.549  1.00 54.39  ? 182 PHE A CD1 1 
ATOM   1352  C CD2 . PHE A 1 182 ? 11.578  -36.455 73.899  1.00 58.50  ? 182 PHE A CD2 1 
ATOM   1353  C CE1 . PHE A 1 182 ? 13.347  -38.510 73.397  1.00 53.02  ? 182 PHE A CE1 1 
ATOM   1354  C CE2 . PHE A 1 182 ? 11.634  -37.543 74.752  1.00 49.75  ? 182 PHE A CE2 1 
ATOM   1355  C CZ  . PHE A 1 182 ? 12.519  -38.571 74.500  1.00 45.18  ? 182 PHE A CZ  1 
ATOM   1356  N N   . CYS A 1 183 ? 12.501  -33.307 69.430  1.00 61.59  ? 183 CYS A N   1 
ATOM   1357  C CA  . CYS A 1 183 ? 11.915  -32.310 68.537  1.00 59.16  ? 183 CYS A CA  1 
ATOM   1358  C C   . CYS A 1 183 ? 12.098  -32.710 67.077  1.00 54.33  ? 183 CYS A C   1 
ATOM   1359  O O   . CYS A 1 183 ? 11.192  -32.553 66.258  1.00 60.94  ? 183 CYS A O   1 
ATOM   1360  C CB  . CYS A 1 183 ? 12.534  -30.933 68.784  1.00 53.91  ? 183 CYS A CB  1 
ATOM   1361  S SG  . CYS A 1 183 ? 12.055  -30.169 70.352  1.00 92.05  ? 183 CYS A SG  1 
ATOM   1362  N N   . ALA A 1 184 ? 13.285  -33.222 66.766  1.00 54.64  ? 184 ALA A N   1 
ATOM   1363  C CA  . ALA A 1 184 ? 13.609  -33.690 65.424  1.00 43.11  ? 184 ALA A CA  1 
ATOM   1364  C C   . ALA A 1 184 ? 12.679  -34.814 64.988  1.00 53.52  ? 184 ALA A C   1 
ATOM   1365  O O   . ALA A 1 184 ? 12.212  -34.831 63.852  1.00 61.26  ? 184 ALA A O   1 
ATOM   1366  C CB  . ALA A 1 184 ? 15.055  -34.148 65.359  1.00 39.30  ? 184 ALA A CB  1 
ATOM   1367  N N   . LEU A 1 185 ? 12.430  -35.763 65.886  1.00 51.45  ? 185 LEU A N   1 
ATOM   1368  C CA  . LEU A 1 185 ? 11.523  -36.869 65.584  1.00 43.62  ? 185 LEU A CA  1 
ATOM   1369  C C   . LEU A 1 185 ? 10.072  -36.403 65.429  1.00 57.60  ? 185 LEU A C   1 
ATOM   1370  O O   . LEU A 1 185 ? 9.355   -36.850 64.523  1.00 65.84  ? 185 LEU A O   1 
ATOM   1371  C CB  . LEU A 1 185 ? 11.623  -37.940 66.669  1.00 52.62  ? 185 LEU A CB  1 
ATOM   1372  C CG  . LEU A 1 185 ? 12.925  -38.741 66.628  1.00 48.41  ? 185 LEU A CG  1 
ATOM   1373  C CD1 . LEU A 1 185 ? 13.151  -39.492 67.927  1.00 43.25  ? 185 LEU A CD1 1 
ATOM   1374  C CD2 . LEU A 1 185 ? 12.917  -39.699 65.447  1.00 57.66  ? 185 LEU A CD2 1 
ATOM   1375  N N   . ASN A 1 186 ? 9.648   -35.495 66.304  1.00 53.75  ? 186 ASN A N   1 
ATOM   1376  C CA  . ASN A 1 186 ? 8.290   -34.966 66.247  1.00 50.44  ? 186 ASN A CA  1 
ATOM   1377  C C   . ASN A 1 186 ? 8.048   -34.213 64.947  1.00 63.94  ? 186 ASN A C   1 
ATOM   1378  O O   . ASN A 1 186 ? 6.979   -34.319 64.347  1.00 72.99  ? 186 ASN A O   1 
ATOM   1379  C CB  . ASN A 1 186 ? 8.010   -34.051 67.441  1.00 64.17  ? 186 ASN A CB  1 
ATOM   1380  C CG  . ASN A 1 186 ? 7.956   -34.804 68.754  1.00 59.00  ? 186 ASN A CG  1 
ATOM   1381  O OD1 . ASN A 1 186 ? 7.796   -36.025 68.777  1.00 58.49  ? 186 ASN A OD1 1 
ATOM   1382  N ND2 . ASN A 1 186 ? 8.083   -34.078 69.859  1.00 57.32  ? 186 ASN A ND2 1 
ATOM   1383  N N   . THR A 1 187 ? 9.049   -33.452 64.519  1.00 67.41  ? 187 THR A N   1 
ATOM   1384  C CA  . THR A 1 187 ? 8.989   -32.765 63.236  1.00 57.20  ? 187 THR A CA  1 
ATOM   1385  C C   . THR A 1 187 ? 9.010   -33.778 62.093  1.00 53.39  ? 187 THR A C   1 
ATOM   1386  O O   . THR A 1 187 ? 8.299   -33.621 61.099  1.00 59.18  ? 187 THR A O   1 
ATOM   1387  C CB  . THR A 1 187 ? 10.157  -31.771 63.076  1.00 50.12  ? 187 THR A CB  1 
ATOM   1388  O OG1 . THR A 1 187 ? 10.050  -30.743 64.068  1.00 61.22  ? 187 THR A OG1 1 
ATOM   1389  C CG2 . THR A 1 187 ? 10.141  -31.137 61.695  1.00 59.15  ? 187 THR A CG2 1 
ATOM   1390  N N   . LEU A 1 188 ? 9.824   -34.820 62.249  1.00 49.03  ? 188 LEU A N   1 
ATOM   1391  C CA  . LEU A 1 188 ? 9.908   -35.903 61.272  1.00 56.15  ? 188 LEU A CA  1 
ATOM   1392  C C   . LEU A 1 188 ? 8.551   -36.542 61.017  1.00 59.39  ? 188 LEU A C   1 
ATOM   1393  O O   . LEU A 1 188 ? 8.261   -36.970 59.898  1.00 67.28  ? 188 LEU A O   1 
ATOM   1394  C CB  . LEU A 1 188 ? 10.901  -36.975 61.729  1.00 52.95  ? 188 LEU A CB  1 
ATOM   1395  C CG  . LEU A 1 188 ? 11.096  -38.138 60.749  1.00 42.95  ? 188 LEU A CG  1 
ATOM   1396  C CD1 . LEU A 1 188 ? 11.897  -37.691 59.535  1.00 53.63  ? 188 LEU A CD1 1 
ATOM   1397  C CD2 . LEU A 1 188 ? 11.753  -39.333 61.423  1.00 40.01  ? 188 LEU A CD2 1 
ATOM   1398  N N   . GLN A 1 189 ? 7.725   -36.610 62.058  1.00 58.42  ? 189 GLN A N   1 
ATOM   1399  C CA  . GLN A 1 189 ? 6.378   -37.158 61.917  1.00 61.86  ? 189 GLN A CA  1 
ATOM   1400  C C   . GLN A 1 189 ? 5.578   -36.463 60.813  1.00 71.27  ? 189 GLN A C   1 
ATOM   1401  O O   . GLN A 1 189 ? 4.798   -37.105 60.109  1.00 73.55  ? 189 GLN A O   1 
ATOM   1402  C CB  . GLN A 1 189 ? 5.626   -37.073 63.245  1.00 67.02  ? 189 GLN A CB  1 
ATOM   1403  C CG  . GLN A 1 189 ? 6.263   -37.888 64.360  1.00 69.29  ? 189 GLN A CG  1 
ATOM   1404  C CD  . GLN A 1 189 ? 6.734   -39.252 63.889  1.00 63.24  ? 189 GLN A CD  1 
ATOM   1405  O OE1 . GLN A 1 189 ? 5.982   -40.004 63.267  1.00 62.78  ? 189 GLN A OE1 1 
ATOM   1406  N NE2 . GLN A 1 189 ? 7.988   -39.578 64.183  1.00 54.04  ? 189 GLN A NE2 1 
ATOM   1407  N N   . TYR A 1 190 ? 5.768   -35.155 60.665  1.00 77.58  ? 190 TYR A N   1 
ATOM   1408  C CA  . TYR A 1 190 ? 5.149   -34.424 59.563  1.00 65.06  ? 190 TYR A CA  1 
ATOM   1409  C C   . TYR A 1 190 ? 5.950   -34.553 58.269  1.00 56.59  ? 190 TYR A C   1 
ATOM   1410  O O   . TYR A 1 190 ? 5.380   -34.736 57.194  1.00 73.82  ? 190 TYR A O   1 
ATOM   1411  C CB  . TYR A 1 190 ? 4.985   -32.944 59.912  1.00 61.71  ? 190 TYR A CB  1 
ATOM   1412  C CG  . TYR A 1 190 ? 4.131   -32.664 61.126  1.00 81.25  ? 190 TYR A CG  1 
ATOM   1413  C CD1 . TYR A 1 190 ? 2.752   -32.811 61.077  1.00 66.14  ? 190 TYR A CD1 1 
ATOM   1414  C CD2 . TYR A 1 190 ? 4.703   -32.232 62.315  1.00 74.13  ? 190 TYR A CD2 1 
ATOM   1415  C CE1 . TYR A 1 190 ? 1.966   -32.548 62.182  1.00 89.00  ? 190 TYR A CE1 1 
ATOM   1416  C CE2 . TYR A 1 190 ? 3.925   -31.966 63.426  1.00 87.08  ? 190 TYR A CE2 1 
ATOM   1417  C CZ  . TYR A 1 190 ? 2.557   -32.126 63.354  1.00 103.99 ? 190 TYR A CZ  1 
ATOM   1418  O OH  . TYR A 1 190 ? 1.777   -31.863 64.456  1.00 92.30  ? 190 TYR A OH  1 
ATOM   1419  N N   . LYS A 1 191 ? 7.272   -34.454 58.381  1.00 65.02  ? 191 LYS A N   1 
ATOM   1420  C CA  . LYS A 1 191 ? 8.149   -34.462 57.212  1.00 56.32  ? 191 LYS A CA  1 
ATOM   1421  C C   . LYS A 1 191 ? 8.071   -35.737 56.376  1.00 59.90  ? 191 LYS A C   1 
ATOM   1422  O O   . LYS A 1 191 ? 8.321   -35.699 55.174  1.00 68.58  ? 191 LYS A O   1 
ATOM   1423  C CB  . LYS A 1 191 ? 9.605   -34.241 57.635  1.00 63.96  ? 191 LYS A CB  1 
ATOM   1424  C CG  . LYS A 1 191 ? 10.021  -32.783 57.741  1.00 62.80  ? 191 LYS A CG  1 
ATOM   1425  C CD  . LYS A 1 191 ? 11.505  -32.662 58.045  1.00 58.66  ? 191 LYS A CD  1 
ATOM   1426  C CE  . LYS A 1 191 ? 11.963  -31.216 58.007  1.00 58.55  ? 191 LYS A CE  1 
ATOM   1427  N NZ  . LYS A 1 191 ? 13.447  -31.113 58.064  1.00 92.32  ? 191 LYS A NZ  1 
ATOM   1428  N N   . LYS A 1 192 ? 7.718   -36.856 56.998  1.00 53.76  ? 192 LYS A N   1 
ATOM   1429  C CA  . LYS A 1 192 ? 7.660   -38.125 56.277  1.00 55.58  ? 192 LYS A CA  1 
ATOM   1430  C C   . LYS A 1 192 ? 6.508   -38.123 55.284  1.00 60.98  ? 192 LYS A C   1 
ATOM   1431  O O   . LYS A 1 192 ? 6.617   -38.663 54.183  1.00 65.96  ? 192 LYS A O   1 
ATOM   1432  C CB  . LYS A 1 192 ? 7.547   -39.298 57.255  1.00 65.64  ? 192 LYS A CB  1 
ATOM   1433  C CG  . LYS A 1 192 ? 6.341   -39.258 58.173  1.00 76.47  ? 192 LYS A CG  1 
ATOM   1434  C CD  . LYS A 1 192 ? 6.277   -40.510 59.026  1.00 84.76  ? 192 LYS A CD  1 
ATOM   1435  C CE  . LYS A 1 192 ? 5.116   -40.461 60.000  1.00 88.21  ? 192 LYS A CE  1 
ATOM   1436  N NZ  . LYS A 1 192 ? 5.041   -41.697 60.827  1.00 78.29  ? 192 LYS A NZ  1 
ATOM   1437  N N   . LYS A 1 193 ? 5.413   -37.486 55.672  1.00 56.83  ? 193 LYS A N   1 
ATOM   1438  C CA  . LYS A 1 193 ? 4.240   -37.422 54.822  1.00 64.09  ? 193 LYS A CA  1 
ATOM   1439  C C   . LYS A 1 193 ? 4.558   -36.683 53.550  1.00 56.29  ? 193 LYS A C   1 
ATOM   1440  O O   . LYS A 1 193 ? 4.323   -37.170 52.436  1.00 56.31  ? 193 LYS A O   1 
ATOM   1441  C CB  . LYS A 1 193 ? 3.103   -36.730 55.548  1.00 66.69  ? 193 LYS A CB  1 
ATOM   1442  C CG  . LYS A 1 193 ? 2.509   -37.600 56.591  1.00 78.31  ? 193 LYS A CG  1 
ATOM   1443  C CD  . LYS A 1 193 ? 2.452   -39.001 56.053  1.00 90.39  ? 193 LYS A CD  1 
ATOM   1444  C CE  . LYS A 1 193 ? 1.973   -39.925 57.107  1.00 86.20  ? 193 LYS A CE  1 
ATOM   1445  N NZ  . LYS A 1 193 ? 0.544   -40.102 56.752  1.00 104.86 ? 193 LYS A NZ  1 
ATOM   1446  N N   . ILE A 1 194 ? 5.113   -35.498 53.749  1.00 40.58  ? 194 ILE A N   1 
ATOM   1447  C CA  . ILE A 1 194 ? 5.546   -34.644 52.672  1.00 57.51  ? 194 ILE A CA  1 
ATOM   1448  C C   . ILE A 1 194 ? 6.609   -35.355 51.843  1.00 56.38  ? 194 ILE A C   1 
ATOM   1449  O O   . ILE A 1 194 ? 6.616   -35.257 50.617  1.00 50.17  ? 194 ILE A O   1 
ATOM   1450  C CB  . ILE A 1 194 ? 6.093   -33.318 53.219  1.00 55.82  ? 194 ILE A CB  1 
ATOM   1451  C CG1 . ILE A 1 194 ? 4.988   -32.557 53.959  1.00 44.61  ? 194 ILE A CG1 1 
ATOM   1452  C CG2 . ILE A 1 194 ? 6.672   -32.477 52.102  1.00 64.25  ? 194 ILE A CG2 1 
ATOM   1453  C CD1 . ILE A 1 194 ? 5.470   -31.304 54.651  1.00 62.39  ? 194 ILE A CD1 1 
ATOM   1454  N N   . ALA A 1 195 ? 7.501   -36.078 52.518  1.00 58.95  ? 195 ALA A N   1 
ATOM   1455  C CA  . ALA A 1 195 ? 8.562   -36.815 51.835  1.00 54.19  ? 195 ALA A CA  1 
ATOM   1456  C C   . ALA A 1 195 ? 8.007   -37.875 50.892  1.00 54.54  ? 195 ALA A C   1 
ATOM   1457  O O   . ALA A 1 195 ? 8.590   -38.142 49.843  1.00 69.38  ? 195 ALA A O   1 
ATOM   1458  C CB  . ALA A 1 195 ? 9.498   -37.458 52.845  1.00 52.68  ? 195 ALA A CB  1 
ATOM   1459  N N   . LEU A 1 196 ? 6.898   -38.497 51.274  1.00 55.63  ? 196 LEU A N   1 
ATOM   1460  C CA  . LEU A 1 196 ? 6.245   -39.456 50.390  1.00 58.65  ? 196 LEU A CA  1 
ATOM   1461  C C   . LEU A 1 196 ? 5.506   -38.769 49.245  1.00 68.99  ? 196 LEU A C   1 
ATOM   1462  O O   . LEU A 1 196 ? 5.610   -39.186 48.091  1.00 75.02  ? 196 LEU A O   1 
ATOM   1463  C CB  . LEU A 1 196 ? 5.270   -40.345 51.166  1.00 54.03  ? 196 LEU A CB  1 
ATOM   1464  C CG  . LEU A 1 196 ? 5.796   -41.668 51.732  1.00 63.25  ? 196 LEU A CG  1 
ATOM   1465  C CD1 . LEU A 1 196 ? 6.649   -41.467 52.968  1.00 75.10  ? 196 LEU A CD1 1 
ATOM   1466  C CD2 . LEU A 1 196 ? 4.640   -42.594 52.039  1.00 74.31  ? 196 LEU A CD2 1 
ATOM   1467  N N   . LEU A 1 197 ? 4.765   -37.714 49.567  1.00 51.06  ? 197 LEU A N   1 
ATOM   1468  C CA  . LEU A 1 197 ? 3.842   -37.124 48.599  1.00 51.83  ? 197 LEU A CA  1 
ATOM   1469  C C   . LEU A 1 197 ? 4.485   -36.201 47.558  1.00 46.08  ? 197 LEU A C   1 
ATOM   1470  O O   . LEU A 1 197 ? 4.150   -36.273 46.376  1.00 56.23  ? 197 LEU A O   1 
ATOM   1471  C CB  . LEU A 1 197 ? 2.744   -36.364 49.343  1.00 52.62  ? 197 LEU A CB  1 
ATOM   1472  C CG  . LEU A 1 197 ? 1.875   -37.256 50.230  1.00 61.42  ? 197 LEU A CG  1 
ATOM   1473  C CD1 . LEU A 1 197 ? 0.861   -36.435 51.014  1.00 54.79  ? 197 LEU A CD1 1 
ATOM   1474  C CD2 . LEU A 1 197 ? 1.189   -38.327 49.398  1.00 52.33  ? 197 LEU A CD2 1 
ATOM   1475  N N   . GLU A 1 198 ? 5.398   -35.338 47.991  1.00 44.16  ? 198 GLU A N   1 
ATOM   1476  C CA  . GLU A 1 198 ? 5.948   -34.297 47.119  1.00 54.81  ? 198 GLU A CA  1 
ATOM   1477  C C   . GLU A 1 198 ? 6.702   -34.814 45.872  1.00 67.04  ? 198 GLU A C   1 
ATOM   1478  O O   . GLU A 1 198 ? 6.462   -34.319 44.765  1.00 57.58  ? 198 GLU A O   1 
ATOM   1479  C CB  . GLU A 1 198 ? 6.862   -33.372 47.936  1.00 62.55  ? 198 GLU A CB  1 
ATOM   1480  C CG  . GLU A 1 198 ? 7.135   -32.024 47.288  1.00 87.74  ? 198 GLU A CG  1 
ATOM   1481  C CD  . GLU A 1 198 ? 8.165   -31.210 48.049  1.00 100.43 ? 198 GLU A CD  1 
ATOM   1482  O OE1 . GLU A 1 198 ? 8.967   -31.810 48.796  1.00 92.13  ? 198 GLU A OE1 1 
ATOM   1483  O OE2 . GLU A 1 198 ? 8.172   -29.970 47.903  1.00 115.63 ? 198 GLU A OE2 1 
ATOM   1484  N N   . PRO A 1 199 ? 7.607   -35.804 46.032  1.00 60.81  ? 199 PRO A N   1 
ATOM   1485  C CA  . PRO A 1 199 ? 8.291   -36.296 44.827  1.00 62.05  ? 199 PRO A CA  1 
ATOM   1486  C C   . PRO A 1 199 ? 7.362   -36.977 43.820  1.00 60.47  ? 199 PRO A C   1 
ATOM   1487  O O   . PRO A 1 199 ? 7.566   -36.823 42.617  1.00 53.32  ? 199 PRO A O   1 
ATOM   1488  C CB  . PRO A 1 199 ? 9.308   -37.303 45.382  1.00 60.15  ? 199 PRO A CB  1 
ATOM   1489  C CG  . PRO A 1 199 ? 8.805   -37.667 46.724  1.00 56.85  ? 199 PRO A CG  1 
ATOM   1490  C CD  . PRO A 1 199 ? 8.134   -36.445 47.250  1.00 55.76  ? 199 PRO A CD  1 
ATOM   1491  N N   . LEU A 1 200 ? 6.378   -37.730 44.304  1.00 62.27  ? 200 LEU A N   1 
ATOM   1492  C CA  . LEU A 1 200 ? 5.410   -38.390 43.429  1.00 53.24  ? 200 LEU A CA  1 
ATOM   1493  C C   . LEU A 1 200 ? 4.549   -37.361 42.708  1.00 50.73  ? 200 LEU A C   1 
ATOM   1494  O O   . LEU A 1 200 ? 4.190   -37.530 41.538  1.00 50.47  ? 200 LEU A O   1 
ATOM   1495  C CB  . LEU A 1 200 ? 4.525   -39.343 44.231  1.00 57.06  ? 200 LEU A CB  1 
ATOM   1496  C CG  . LEU A 1 200 ? 5.027   -40.777 44.385  1.00 70.26  ? 200 LEU A CG  1 
ATOM   1497  C CD1 . LEU A 1 200 ? 4.242   -41.491 45.471  1.00 71.22  ? 200 LEU A CD1 1 
ATOM   1498  C CD2 . LEU A 1 200 ? 4.919   -41.518 43.062  1.00 56.28  ? 200 LEU A CD2 1 
ATOM   1499  N N   . LEU A 1 201 ? 4.231   -36.290 43.425  1.00 50.03  ? 201 LEU A N   1 
ATOM   1500  C CA  . LEU A 1 201 ? 3.448   -35.192 42.885  1.00 53.11  ? 201 LEU A CA  1 
ATOM   1501  C C   . LEU A 1 201 ? 4.236   -34.545 41.752  1.00 51.05  ? 201 LEU A C   1 
ATOM   1502  O O   . LEU A 1 201 ? 3.687   -34.216 40.692  1.00 65.77  ? 201 LEU A O   1 
ATOM   1503  C CB  . LEU A 1 201 ? 3.133   -34.184 43.993  1.00 57.23  ? 201 LEU A CB  1 
ATOM   1504  C CG  . LEU A 1 201 ? 2.216   -32.995 43.722  1.00 77.37  ? 201 LEU A CG  1 
ATOM   1505  C CD1 . LEU A 1 201 ? 0.783   -33.468 43.582  1.00 77.20  ? 201 LEU A CD1 1 
ATOM   1506  C CD2 . LEU A 1 201 ? 2.338   -31.978 44.846  1.00 55.62  ? 201 LEU A CD2 1 
ATOM   1507  N N   . GLY A 1 202 ? 5.539   -34.395 41.981  1.00 59.65  ? 202 GLY A N   1 
ATOM   1508  C CA  . GLY A 1 202 ? 6.448   -33.882 40.973  1.00 41.82  ? 202 GLY A CA  1 
ATOM   1509  C C   . GLY A 1 202 ? 6.541   -34.783 39.755  1.00 50.50  ? 202 GLY A C   1 
ATOM   1510  O O   . GLY A 1 202 ? 6.561   -34.301 38.624  1.00 58.31  ? 202 GLY A O   1 
ATOM   1511  N N   . TYR A 1 203 ? 6.611   -36.090 39.992  1.00 42.48  ? 203 TYR A N   1 
ATOM   1512  C CA  . TYR A 1 203 ? 6.664   -37.082 38.920  1.00 45.49  ? 203 TYR A CA  1 
ATOM   1513  C C   . TYR A 1 203 ? 5.432   -36.962 38.030  1.00 53.31  ? 203 TYR A C   1 
ATOM   1514  O O   . TYR A 1 203 ? 5.534   -36.879 36.802  1.00 54.65  ? 203 TYR A O   1 
ATOM   1515  C CB  . TYR A 1 203 ? 6.767   -38.495 39.504  1.00 38.81  ? 203 TYR A CB  1 
ATOM   1516  C CG  . TYR A 1 203 ? 6.737   -39.610 38.478  1.00 49.43  ? 203 TYR A CG  1 
ATOM   1517  C CD1 . TYR A 1 203 ? 7.802   -39.806 37.607  1.00 55.61  ? 203 TYR A CD1 1 
ATOM   1518  C CD2 . TYR A 1 203 ? 5.651   -40.471 38.386  1.00 47.47  ? 203 TYR A CD2 1 
ATOM   1519  C CE1 . TYR A 1 203 ? 7.785   -40.823 36.671  1.00 55.32  ? 203 TYR A CE1 1 
ATOM   1520  C CE2 . TYR A 1 203 ? 5.625   -41.493 37.451  1.00 50.46  ? 203 TYR A CE2 1 
ATOM   1521  C CZ  . TYR A 1 203 ? 6.695   -41.664 36.596  1.00 56.90  ? 203 TYR A CZ  1 
ATOM   1522  O OH  . TYR A 1 203 ? 6.678   -42.677 35.663  1.00 46.13  ? 203 TYR A OH  1 
ATOM   1523  N N   . MET A 1 204 ? 4.266   -36.946 38.667  1.00 66.60  ? 204 MET A N   1 
ATOM   1524  C CA  . MET A 1 204 ? 2.998   -36.839 37.955  1.00 60.17  ? 204 MET A CA  1 
ATOM   1525  C C   . MET A 1 204 ? 2.886   -35.537 37.163  1.00 57.60  ? 204 MET A C   1 
ATOM   1526  O O   . MET A 1 204 ? 2.467   -35.546 36.000  1.00 61.46  ? 204 MET A O   1 
ATOM   1527  C CB  . MET A 1 204 ? 1.832   -36.969 38.934  1.00 59.71  ? 204 MET A CB  1 
ATOM   1528  C CG  . MET A 1 204 ? 1.712   -38.349 39.558  1.00 53.26  ? 204 MET A CG  1 
ATOM   1529  S SD  . MET A 1 204 ? 1.692   -39.646 38.304  1.00 67.35  ? 204 MET A SD  1 
ATOM   1530  C CE  . MET A 1 204 ? 1.608   -41.112 39.328  1.00 70.24  ? 204 MET A CE  1 
ATOM   1531  N N   . GLN A 1 205 ? 3.271   -34.421 37.776  1.00 48.55  ? 205 GLN A N   1 
ATOM   1532  C CA  . GLN A 1 205 ? 3.160   -33.137 37.087  1.00 67.80  ? 205 GLN A CA  1 
ATOM   1533  C C   . GLN A 1 205 ? 4.151   -33.040 35.927  1.00 66.74  ? 205 GLN A C   1 
ATOM   1534  O O   . GLN A 1 205 ? 3.866   -32.422 34.890  1.00 70.19  ? 205 GLN A O   1 
ATOM   1535  C CB  . GLN A 1 205 ? 3.399   -31.988 38.070  1.00 53.72  ? 205 GLN A CB  1 
ATOM   1536  C CG  . GLN A 1 205 ? 2.138   -31.371 38.652  1.00 72.26  ? 205 GLN A CG  1 
ATOM   1537  C CD  . GLN A 1 205 ? 1.350   -30.574 37.630  1.00 85.38  ? 205 GLN A CD  1 
ATOM   1538  O OE1 . GLN A 1 205 ? 1.826   -30.310 36.526  1.00 86.07  ? 205 GLN A OE1 1 
ATOM   1539  N NE2 . GLN A 1 205 ? 0.138   -30.177 38.000  1.00 90.62  ? 205 GLN A NE2 1 
ATOM   1540  N N   . ALA A 1 206 ? 5.296   -33.695 36.096  1.00 59.02  ? 206 ALA A N   1 
ATOM   1541  C CA  . ALA A 1 206 ? 6.270   -33.846 35.024  1.00 56.98  ? 206 ALA A CA  1 
ATOM   1542  C C   . ALA A 1 206 ? 5.680   -34.620 33.854  1.00 58.74  ? 206 ALA A C   1 
ATOM   1543  O O   . ALA A 1 206 ? 5.844   -34.233 32.696  1.00 55.72  ? 206 ALA A O   1 
ATOM   1544  C CB  . ALA A 1 206 ? 7.523   -34.534 35.541  1.00 60.41  ? 206 ALA A CB  1 
ATOM   1545  N N   . GLN A 1 207 ? 4.994   -35.718 34.164  1.00 59.56  ? 207 GLN A N   1 
ATOM   1546  C CA  . GLN A 1 207 ? 4.330   -36.513 33.136  1.00 57.40  ? 207 GLN A CA  1 
ATOM   1547  C C   . GLN A 1 207 ? 3.289   -35.679 32.393  1.00 55.69  ? 207 GLN A C   1 
ATOM   1548  O O   . GLN A 1 207 ? 3.178   -35.758 31.168  1.00 57.89  ? 207 GLN A O   1 
ATOM   1549  C CB  . GLN A 1 207 ? 3.676   -37.755 33.746  1.00 51.78  ? 207 GLN A CB  1 
ATOM   1550  C CG  . GLN A 1 207 ? 4.664   -38.783 34.277  1.00 54.69  ? 207 GLN A CG  1 
ATOM   1551  C CD  . GLN A 1 207 ? 5.641   -39.261 33.220  1.00 52.08  ? 207 GLN A CD  1 
ATOM   1552  O OE1 . GLN A 1 207 ? 5.257   -39.554 32.088  1.00 60.48  ? 207 GLN A OE1 1 
ATOM   1553  N NE2 . GLN A 1 207 ? 6.914   -39.347 33.588  1.00 65.62  ? 207 GLN A NE2 1 
ATOM   1554  N N   . ILE A 1 208 ? 2.530   -34.882 33.141  1.00 49.79  ? 208 ILE A N   1 
ATOM   1555  C CA  . ILE A 1 208 ? 1.526   -34.002 32.544  1.00 53.37  ? 208 ILE A CA  1 
ATOM   1556  C C   . ILE A 1 208 ? 2.155   -33.027 31.545  1.00 60.40  ? 208 ILE A C   1 
ATOM   1557  O O   . ILE A 1 208 ? 1.724   -32.940 30.382  1.00 67.65  ? 208 ILE A O   1 
ATOM   1558  C CB  . ILE A 1 208 ? 0.765   -33.201 33.619  1.00 56.47  ? 208 ILE A CB  1 
ATOM   1559  C CG1 . ILE A 1 208 ? -0.212  -34.109 34.365  1.00 58.86  ? 208 ILE A CG1 1 
ATOM   1560  C CG2 . ILE A 1 208 ? 0.019   -32.033 32.992  1.00 46.57  ? 208 ILE A CG2 1 
ATOM   1561  C CD1 . ILE A 1 208 ? -1.072  -33.381 35.369  1.00 63.25  ? 208 ILE A CD1 1 
ATOM   1562  N N   . SER A 1 209 ? 3.184   -32.311 31.998  1.00 49.93  ? 209 SER A N   1 
ATOM   1563  C CA  . SER A 1 209 ? 3.870   -31.345 31.142  1.00 55.59  ? 209 SER A CA  1 
ATOM   1564  C C   . SER A 1 209 ? 4.442   -32.023 29.894  1.00 63.76  ? 209 SER A C   1 
ATOM   1565  O O   . SER A 1 209 ? 4.339   -31.501 28.772  1.00 59.32  ? 209 SER A O   1 
ATOM   1566  C CB  . SER A 1 209 ? 4.984   -30.643 31.923  1.00 54.50  ? 209 SER A CB  1 
ATOM   1567  O OG  . SER A 1 209 ? 6.200   -31.366 31.835  1.00 73.29  ? 209 SER A OG  1 
ATOM   1568  N N   . PHE A 1 210 ? 5.019   -33.202 30.107  1.00 55.52  ? 210 PHE A N   1 
ATOM   1569  C CA  . PHE A 1 210 ? 5.586   -34.021 29.041  1.00 60.14  ? 210 PHE A CA  1 
ATOM   1570  C C   . PHE A 1 210 ? 4.560   -34.342 27.957  1.00 58.61  ? 210 PHE A C   1 
ATOM   1571  O O   . PHE A 1 210 ? 4.751   -34.021 26.772  1.00 75.96  ? 210 PHE A O   1 
ATOM   1572  C CB  . PHE A 1 210 ? 6.147   -35.316 29.641  1.00 54.07  ? 210 PHE A CB  1 
ATOM   1573  C CG  . PHE A 1 210 ? 6.641   -36.306 28.623  1.00 45.86  ? 210 PHE A CG  1 
ATOM   1574  C CD1 . PHE A 1 210 ? 7.755   -36.031 27.848  1.00 57.97  ? 210 PHE A CD1 1 
ATOM   1575  C CD2 . PHE A 1 210 ? 6.007   -37.529 28.466  1.00 44.60  ? 210 PHE A CD2 1 
ATOM   1576  C CE1 . PHE A 1 210 ? 8.215   -36.948 26.919  1.00 55.72  ? 210 PHE A CE1 1 
ATOM   1577  C CE2 . PHE A 1 210 ? 6.462   -38.451 27.540  1.00 47.35  ? 210 PHE A CE2 1 
ATOM   1578  C CZ  . PHE A 1 210 ? 7.568   -38.160 26.767  1.00 44.43  ? 210 PHE A CZ  1 
ATOM   1579  N N   . PHE A 1 211 ? 3.459   -34.958 28.374  1.00 61.95  ? 211 PHE A N   1 
ATOM   1580  C CA  . PHE A 1 211 ? 2.448   -35.397 27.425  1.00 66.86  ? 211 PHE A CA  1 
ATOM   1581  C C   . PHE A 1 211 ? 1.709   -34.242 26.772  1.00 65.84  ? 211 PHE A C   1 
ATOM   1582  O O   . PHE A 1 211 ? 1.168   -34.410 25.686  1.00 68.79  ? 211 PHE A O   1 
ATOM   1583  C CB  . PHE A 1 211 ? 1.446   -36.335 28.096  1.00 49.42  ? 211 PHE A CB  1 
ATOM   1584  C CG  . PHE A 1 211 ? 1.958   -37.733 28.273  1.00 51.69  ? 211 PHE A CG  1 
ATOM   1585  C CD1 . PHE A 1 211 ? 2.254   -38.520 27.171  1.00 49.35  ? 211 PHE A CD1 1 
ATOM   1586  C CD2 . PHE A 1 211 ? 2.135   -38.264 29.537  1.00 46.80  ? 211 PHE A CD2 1 
ATOM   1587  C CE1 . PHE A 1 211 ? 2.727   -39.809 27.330  1.00 53.11  ? 211 PHE A CE1 1 
ATOM   1588  C CE2 . PHE A 1 211 ? 2.604   -39.552 29.703  1.00 47.59  ? 211 PHE A CE2 1 
ATOM   1589  C CZ  . PHE A 1 211 ? 2.901   -40.326 28.597  1.00 44.30  ? 211 PHE A CZ  1 
ATOM   1590  N N   . LYS A 1 212 ? 1.702   -33.069 27.402  1.00 57.13  ? 212 LYS A N   1 
ATOM   1591  C CA  . LYS A 1 212 ? 1.046   -31.920 26.780  1.00 67.53  ? 212 LYS A CA  1 
ATOM   1592  C C   . LYS A 1 212 ? 1.944   -31.328 25.680  1.00 65.35  ? 212 LYS A C   1 
ATOM   1593  O O   . LYS A 1 212 ? 1.492   -31.044 24.536  1.00 80.62  ? 212 LYS A O   1 
ATOM   1594  C CB  . LYS A 1 212 ? 0.714   -30.870 27.845  1.00 57.20  ? 212 LYS A CB  1 
ATOM   1595  C CG  . LYS A 1 212 ? 0.695   -29.438 27.352  1.00 70.12  ? 212 LYS A CG  1 
ATOM   1596  C CD  . LYS A 1 212 ? 0.039   -28.520 28.371  1.00 69.41  ? 212 LYS A CD  1 
ATOM   1597  C CE  . LYS A 1 212 ? -0.455  -27.248 27.712  1.00 74.19  ? 212 LYS A CE  1 
ATOM   1598  N NZ  . LYS A 1 212 ? -0.617  -27.437 26.245  1.00 77.98  ? 212 LYS A NZ  1 
ATOM   1599  N N   . MET A 1 213 ? 3.229   -31.212 26.021  1.00 59.75  ? 213 MET A N   1 
ATOM   1600  C CA  . MET A 1 213 ? 4.255   -30.746 25.092  1.00 75.49  ? 213 MET A CA  1 
ATOM   1601  C C   . MET A 1 213 ? 4.258   -31.587 23.823  1.00 84.66  ? 213 MET A C   1 
ATOM   1602  O O   . MET A 1 213 ? 4.119   -31.070 22.692  1.00 95.74  ? 213 MET A O   1 
ATOM   1603  C CB  . MET A 1 213 ? 5.627   -30.813 25.767  1.00 65.06  ? 213 MET A CB  1 
ATOM   1604  C CG  . MET A 1 213 ? 6.788   -30.341 24.916  1.00 60.86  ? 213 MET A CG  1 
ATOM   1605  S SD  . MET A 1 213 ? 8.315   -30.201 25.866  1.00 74.75  ? 213 MET A SD  1 
ATOM   1606  C CE  . MET A 1 213 ? 9.540   -30.382 24.571  1.00 60.16  ? 213 MET A CE  1 
ATOM   1607  N N   . GLY A 1 214 ? 4.354   -32.896 24.039  1.00 70.55  ? 214 GLY A N   1 
ATOM   1608  C CA  . GLY A 1 214 ? 4.318   -33.853 22.955  1.00 72.90  ? 214 GLY A CA  1 
ATOM   1609  C C   . GLY A 1 214 ? 3.015   -33.775 22.190  1.00 73.12  ? 214 GLY A C   1 
ATOM   1610  O O   . GLY A 1 214 ? 3.026   -33.687 20.951  1.00 81.44  ? 214 GLY A O   1 
ATOM   1611  N N   . SER A 1 215 ? 1.912   -33.734 22.941  1.00 83.35  ? 215 SER A N   1 
ATOM   1612  C CA  . SER A 1 215 ? 0.559   -33.632 22.393  1.00 82.78  ? 215 SER A CA  1 
ATOM   1613  C C   . SER A 1 215 ? 0.381   -32.596 21.298  1.00 87.73  ? 215 SER A C   1 
ATOM   1614  O O   . SER A 1 215 ? 0.002   -32.965 20.189  1.00 99.79  ? 215 SER A O   1 
ATOM   1615  C CB  . SER A 1 215 ? -0.461  -33.330 23.500  1.00 87.85  ? 215 SER A CB  1 
ATOM   1616  O OG  . SER A 1 215 ? -0.405  -31.972 23.900  1.00 94.10  ? 215 SER A OG  1 
ATOM   1617  N N   . GLU A 1 216 ? 0.598   -31.308 21.572  1.00 97.25  ? 216 GLU A N   1 
ATOM   1618  C CA  . GLU A 1 216 ? 0.441   -30.374 20.431  1.00 106.82 ? 216 GLU A CA  1 
ATOM   1619  C C   . GLU A 1 216 ? 1.682   -29.813 19.724  1.00 101.97 ? 216 GLU A C   1 
ATOM   1620  O O   . GLU A 1 216 ? 1.524   -28.950 18.834  1.00 111.66 ? 216 GLU A O   1 
ATOM   1621  C CB  . GLU A 1 216 ? -0.454  -29.184 20.818  1.00 121.94 ? 216 GLU A CB  1 
ATOM   1622  C CG  . GLU A 1 216 ? -1.823  -29.643 21.256  1.00 123.51 ? 216 GLU A CG  1 
ATOM   1623  C CD  . GLU A 1 216 ? -2.826  -28.501 21.374  1.00 128.02 ? 216 GLU A CD  1 
ATOM   1624  O OE1 . GLU A 1 216 ? -2.538  -27.369 20.906  1.00 146.79 ? 216 GLU A OE1 1 
ATOM   1625  O OE2 . GLU A 1 216 ? -3.930  -28.753 21.903  1.00 130.38 ? 216 GLU A OE2 1 
ATOM   1626  N N   . ASN A 1 217 ? 2.887   -30.264 20.082  1.00 98.20  ? 217 ASN A N   1 
ATOM   1627  C CA  . ASN A 1 217 ? 4.005   -30.027 19.177  1.00 98.79  ? 217 ASN A CA  1 
ATOM   1628  C C   . ASN A 1 217 ? 4.490   -31.257 18.388  1.00 83.17  ? 217 ASN A C   1 
ATOM   1629  O O   . ASN A 1 217 ? 4.508   -31.233 17.157  1.00 74.75  ? 217 ASN A O   1 
ATOM   1630  C CB  . ASN A 1 217 ? 5.160   -29.396 19.954  1.00 107.64 ? 217 ASN A CB  1 
ATOM   1631  C CG  . ASN A 1 217 ? 4.697   -28.271 20.861  1.00 111.30 ? 217 ASN A CG  1 
ATOM   1632  O OD1 . ASN A 1 217 ? 3.611   -27.729 20.675  1.00 115.05 ? 217 ASN A OD1 1 
ATOM   1633  N ND2 . ASN A 1 217 ? 5.551   -27.862 21.796  1.00 97.68  ? 217 ASN A ND2 1 
ATOM   1634  N N   . LEU A 1 218 ? 4.924   -32.305 19.086  1.00 91.61  ? 218 LEU A N   1 
ATOM   1635  C CA  . LEU A 1 218 ? 5.442   -33.505 18.420  1.00 76.96  ? 218 LEU A CA  1 
ATOM   1636  C C   . LEU A 1 218 ? 4.429   -34.154 17.472  1.00 74.77  ? 218 LEU A C   1 
ATOM   1637  O O   . LEU A 1 218 ? 4.777   -34.650 16.391  1.00 79.01  ? 218 LEU A O   1 
ATOM   1638  C CB  . LEU A 1 218 ? 5.903   -34.520 19.465  1.00 74.55  ? 218 LEU A CB  1 
ATOM   1639  C CG  . LEU A 1 218 ? 6.780   -35.663 18.951  1.00 65.47  ? 218 LEU A CG  1 
ATOM   1640  C CD1 . LEU A 1 218 ? 8.171   -35.160 18.577  1.00 76.25  ? 218 LEU A CD1 1 
ATOM   1641  C CD2 . LEU A 1 218 ? 6.872   -36.795 19.967  1.00 64.37  ? 218 LEU A CD2 1 
ATOM   1642  N N   . ASN A 1 219 ? 3.172   -34.131 17.888  1.00 73.52  ? 219 ASN A N   1 
ATOM   1643  C CA  . ASN A 1 219 ? 2.108   -34.828 17.186  1.00 87.81  ? 219 ASN A CA  1 
ATOM   1644  C C   . ASN A 1 219 ? 1.794   -34.280 15.794  1.00 89.13  ? 219 ASN A C   1 
ATOM   1645  O O   . ASN A 1 219 ? 1.511   -35.048 14.869  1.00 68.73  ? 219 ASN A O   1 
ATOM   1646  C CB  . ASN A 1 219 ? 0.855   -34.793 18.050  1.00 82.16  ? 219 ASN A CB  1 
ATOM   1647  C CG  . ASN A 1 219 ? -0.157  -35.839 17.663  1.00 94.75  ? 219 ASN A CG  1 
ATOM   1648  O OD1 . ASN A 1 219 ? -0.065  -36.996 18.074  1.00 111.82 ? 219 ASN A OD1 1 
ATOM   1649  N ND2 . ASN A 1 219 ? -1.142  -35.435 16.876  1.00 120.09 ? 219 ASN A ND2 1 
ATOM   1650  N N   . GLU A 1 220 ? 1.864   -32.960 15.641  1.00 80.94  ? 220 GLU A N   1 
ATOM   1651  C CA  . GLU A 1 220 ? 1.657   -32.313 14.341  1.00 79.86  ? 220 GLU A CA  1 
ATOM   1652  C C   . GLU A 1 220 ? 2.636   -32.829 13.289  1.00 86.68  ? 220 GLU A C   1 
ATOM   1653  O O   . GLU A 1 220 ? 2.236   -33.317 12.224  1.00 87.70  ? 220 GLU A O   1 
ATOM   1654  C CB  . GLU A 1 220 ? 1.794   -30.791 14.466  1.00 65.30  ? 220 GLU A CB  1 
ATOM   1655  N N   . GLN A 1 221 ? 3.923   -32.702 13.595  1.00 78.07  ? 221 GLN A N   1 
ATOM   1656  C CA  . GLN A 1 221 ? 4.987   -33.078 12.672  1.00 77.13  ? 221 GLN A CA  1 
ATOM   1657  C C   . GLN A 1 221 ? 5.021   -34.577 12.455  1.00 81.48  ? 221 GLN A C   1 
ATOM   1658  O O   . GLN A 1 221 ? 5.391   -35.034 11.381  1.00 101.16 ? 221 GLN A O   1 
ATOM   1659  C CB  . GLN A 1 221 ? 6.337   -32.610 13.204  1.00 66.46  ? 221 GLN A CB  1 
ATOM   1660  C CG  . GLN A 1 221 ? 6.279   -31.213 13.749  1.00 91.32  ? 221 GLN A CG  1 
ATOM   1661  C CD  . GLN A 1 221 ? 7.476   -30.871 14.603  1.00 111.20 ? 221 GLN A CD  1 
ATOM   1662  O OE1 . GLN A 1 221 ? 8.570   -31.407 14.416  1.00 111.71 ? 221 GLN A OE1 1 
ATOM   1663  N NE2 . GLN A 1 221 ? 7.272   -29.973 15.560  1.00 115.98 ? 221 GLN A NE2 1 
ATOM   1664  N N   . LEU A 1 222 ? 4.684   -35.344 13.489  1.00 67.35  ? 222 LEU A N   1 
ATOM   1665  C CA  . LEU A 1 222 ? 4.581   -36.786 13.311  1.00 70.81  ? 222 LEU A CA  1 
ATOM   1666  C C   . LEU A 1 222 ? 3.470   -37.114 12.313  1.00 72.27  ? 222 LEU A C   1 
ATOM   1667  O O   . LEU A 1 222 ? 3.610   -38.021 11.484  1.00 91.13  ? 222 LEU A O   1 
ATOM   1668  C CB  . LEU A 1 222 ? 4.321   -37.485 14.641  1.00 61.00  ? 222 LEU A CB  1 
ATOM   1669  C CG  . LEU A 1 222 ? 5.543   -37.707 15.527  1.00 63.40  ? 222 LEU A CG  1 
ATOM   1670  C CD1 . LEU A 1 222 ? 5.122   -38.238 16.892  1.00 57.03  ? 222 LEU A CD1 1 
ATOM   1671  C CD2 . LEU A 1 222 ? 6.523   -38.653 14.851  1.00 59.77  ? 222 LEU A CD2 1 
ATOM   1672  N N   . GLU A 1 223 ? 2.375   -36.360 12.383  1.00 85.63  ? 223 GLU A N   1 
ATOM   1673  C CA  . GLU A 1 223 ? 1.263   -36.554 11.456  1.00 85.67  ? 223 GLU A CA  1 
ATOM   1674  C C   . GLU A 1 223 ? 1.672   -36.236 10.019  1.00 79.42  ? 223 GLU A C   1 
ATOM   1675  O O   . GLU A 1 223 ? 1.474   -37.051 9.112   1.00 88.05  ? 223 GLU A O   1 
ATOM   1676  C CB  . GLU A 1 223 ? 0.064   -35.694 11.864  1.00 75.06  ? 223 GLU A CB  1 
ATOM   1677  N N   . GLU A 1 224 ? 2.241   -35.049 9.817   1.00 71.33  ? 224 GLU A N   1 
ATOM   1678  C CA  . GLU A 1 224 ? 2.659   -34.622 8.481   1.00 78.54  ? 224 GLU A CA  1 
ATOM   1679  C C   . GLU A 1 224 ? 3.727   -35.555 7.900   1.00 86.02  ? 224 GLU A C   1 
ATOM   1680  O O   . GLU A 1 224 ? 3.699   -35.907 6.712   1.00 103.10 ? 224 GLU A O   1 
ATOM   1681  C CB  . GLU A 1 224 ? 3.172   -33.180 8.523   1.00 71.03  ? 224 GLU A CB  1 
ATOM   1682  C CG  . GLU A 1 224 ? 2.093   -32.163 8.876   1.00 100.01 ? 224 GLU A CG  1 
ATOM   1683  C CD  . GLU A 1 224 ? 2.614   -30.739 8.934   1.00 110.63 ? 224 GLU A CD  1 
ATOM   1684  O OE1 . GLU A 1 224 ? 3.847   -30.550 8.888   1.00 116.30 ? 224 GLU A OE1 1 
ATOM   1685  O OE2 . GLU A 1 224 ? 1.786   -29.807 9.022   1.00 94.66  ? 224 GLU A OE2 1 
ATOM   1686  N N   . PHE A 1 225 ? 4.668   -35.947 8.753   1.00 72.54  ? 225 PHE A N   1 
ATOM   1687  C CA  . PHE A 1 225 ? 5.714   -36.894 8.387   1.00 80.02  ? 225 PHE A CA  1 
ATOM   1688  C C   . PHE A 1 225 ? 5.091   -38.197 7.903   1.00 79.41  ? 225 PHE A C   1 
ATOM   1689  O O   . PHE A 1 225 ? 5.453   -38.708 6.839   1.00 93.90  ? 225 PHE A O   1 
ATOM   1690  C CB  . PHE A 1 225 ? 6.642   -37.142 9.580   1.00 76.69  ? 225 PHE A CB  1 
ATOM   1691  C CG  . PHE A 1 225 ? 7.579   -38.299 9.402   1.00 84.37  ? 225 PHE A CG  1 
ATOM   1692  C CD1 . PHE A 1 225 ? 8.797   -38.129 8.768   1.00 84.50  ? 225 PHE A CD1 1 
ATOM   1693  C CD2 . PHE A 1 225 ? 7.252   -39.552 9.894   1.00 73.68  ? 225 PHE A CD2 1 
ATOM   1694  C CE1 . PHE A 1 225 ? 9.663   -39.190 8.613   1.00 75.34  ? 225 PHE A CE1 1 
ATOM   1695  C CE2 . PHE A 1 225 ? 8.113   -40.617 9.740   1.00 76.81  ? 225 PHE A CE2 1 
ATOM   1696  C CZ  . PHE A 1 225 ? 9.319   -40.436 9.101   1.00 77.55  ? 225 PHE A CZ  1 
ATOM   1697  N N   . LEU A 1 226 ? 4.139   -38.717 8.675   1.00 58.64  ? 226 LEU A N   1 
ATOM   1698  C CA  . LEU A 1 226 ? 3.429   -39.933 8.289   1.00 72.11  ? 226 LEU A CA  1 
ATOM   1699  C C   . LEU A 1 226 ? 2.763   -39.759 6.929   1.00 86.49  ? 226 LEU A C   1 
ATOM   1700  O O   . LEU A 1 226 ? 2.791   -40.667 6.089   1.00 82.40  ? 226 LEU A O   1 
ATOM   1701  C CB  . LEU A 1 226 ? 2.387   -40.313 9.342   1.00 75.68  ? 226 LEU A CB  1 
ATOM   1702  C CG  . LEU A 1 226 ? 2.871   -41.252 10.446  1.00 79.89  ? 226 LEU A CG  1 
ATOM   1703  C CD1 . LEU A 1 226 ? 1.764   -41.525 11.451  1.00 78.72  ? 226 LEU A CD1 1 
ATOM   1704  C CD2 . LEU A 1 226 ? 3.379   -42.551 9.839   1.00 69.15  ? 226 LEU A CD2 1 
ATOM   1705  N N   . ALA A 1 227 ? 2.179   -38.582 6.718   1.00 81.66  ? 227 ALA A N   1 
ATOM   1706  C CA  . ALA A 1 227 ? 1.543   -38.257 5.446   1.00 80.21  ? 227 ALA A CA  1 
ATOM   1707  C C   . ALA A 1 227 ? 2.520   -38.392 4.279   1.00 89.63  ? 227 ALA A C   1 
ATOM   1708  O O   . ALA A 1 227 ? 2.243   -39.115 3.323   1.00 88.55  ? 227 ALA A O   1 
ATOM   1709  C CB  . ALA A 1 227 ? 0.958   -36.852 5.489   1.00 73.07  ? 227 ALA A CB  1 
ATOM   1710  N N   . ASN A 1 228 ? 3.655   -37.701 4.353   1.00 82.82  ? 228 ASN A N   1 
ATOM   1711  C CA  . ASN A 1 228 ? 4.644   -37.756 3.270   1.00 72.83  ? 228 ASN A CA  1 
ATOM   1712  C C   . ASN A 1 228 ? 5.210   -39.163 3.029   1.00 83.10  ? 228 ASN A C   1 
ATOM   1713  O O   . ASN A 1 228 ? 5.239   -39.670 1.886   1.00 98.11  ? 228 ASN A O   1 
ATOM   1714  C CB  . ASN A 1 228 ? 5.794   -36.789 3.561   1.00 64.37  ? 228 ASN A CB  1 
ATOM   1715  C CG  . ASN A 1 228 ? 5.318   -35.368 3.793   1.00 84.64  ? 228 ASN A CG  1 
ATOM   1716  O OD1 . ASN A 1 228 ? 4.118   -35.093 3.789   1.00 87.64  ? 228 ASN A OD1 1 
ATOM   1717  N ND2 . ASN A 1 228 ? 6.261   -34.455 3.997   1.00 88.03  ? 228 ASN A ND2 1 
ATOM   1718  N N   . ILE A 1 229 ? 5.645   -39.794 4.117   1.00 78.59  ? 229 ILE A N   1 
ATOM   1719  C CA  . ILE A 1 229 ? 6.288   -41.099 4.030   1.00 79.79  ? 229 ILE A CA  1 
ATOM   1720  C C   . ILE A 1 229 ? 5.332   -42.146 3.471   1.00 79.45  ? 229 ILE A C   1 
ATOM   1721  O O   . ILE A 1 229 ? 5.751   -43.028 2.727   1.00 78.37  ? 229 ILE A O   1 
ATOM   1722  C CB  . ILE A 1 229 ? 6.820   -41.564 5.399   1.00 81.98  ? 229 ILE A CB  1 
ATOM   1723  C CG1 . ILE A 1 229 ? 7.752   -40.506 5.985   1.00 86.50  ? 229 ILE A CG1 1 
ATOM   1724  C CG2 . ILE A 1 229 ? 7.570   -42.877 5.268   1.00 70.63  ? 229 ILE A CG2 1 
ATOM   1725  C CD1 . ILE A 1 229 ? 8.935   -40.193 5.112   1.00 85.19  ? 229 ILE A CD1 1 
ATOM   1726  N N   . GLY A 1 230 ? 4.051   -42.042 3.814   1.00 82.18  ? 230 GLY A N   1 
ATOM   1727  C CA  . GLY A 1 230 ? 3.062   -42.966 3.282   1.00 86.83  ? 230 GLY A CA  1 
ATOM   1728  C C   . GLY A 1 230 ? 3.019   -42.940 1.762   1.00 88.71  ? 230 GLY A C   1 
ATOM   1729  O O   . GLY A 1 230 ? 3.094   -43.987 1.104   1.00 86.62  ? 230 GLY A O   1 
ATOM   1730  N N   . THR A 1 231 ? 2.915   -41.734 1.207   1.00 87.08  ? 231 THR A N   1 
ATOM   1731  C CA  . THR A 1 231 ? 2.911   -41.536 -0.239  1.00 92.06  ? 231 THR A CA  1 
ATOM   1732  C C   . THR A 1 231 ? 4.165   -42.115 -0.875  1.00 96.63  ? 231 THR A C   1 
ATOM   1733  O O   . THR A 1 231 ? 4.091   -42.877 -1.852  1.00 97.43  ? 231 THR A O   1 
ATOM   1734  C CB  . THR A 1 231 ? 2.822   -40.043 -0.613  1.00 83.49  ? 231 THR A CB  1 
ATOM   1735  O OG1 . THR A 1 231 ? 4.086   -39.412 -0.374  1.00 80.49  ? 231 THR A OG1 1 
ATOM   1736  C CG2 . THR A 1 231 ? 1.753   -39.349 0.204   1.00 94.37  ? 231 THR A CG2 1 
ATOM   1737  N N   . SER A 1 232 ? 5.318   -41.754 -0.316  1.00 89.57  ? 232 SER A N   1 
ATOM   1738  C CA  . SER A 1 232 ? 6.586   -42.225 -0.869  1.00 74.21  ? 232 SER A CA  1 
ATOM   1739  C C   . SER A 1 232 ? 6.661   -43.759 -0.882  1.00 73.45  ? 232 SER A C   1 
ATOM   1740  O O   . SER A 1 232 ? 7.070   -44.364 -1.882  1.00 87.19  ? 232 SER A O   1 
ATOM   1741  C CB  . SER A 1 232 ? 7.758   -41.635 -0.091  1.00 84.15  ? 232 SER A CB  1 
ATOM   1742  O OG  . SER A 1 232 ? 7.660   -40.224 -0.009  1.00 93.74  ? 232 SER A OG  1 
ATOM   1743  N N   . VAL A 1 233 ? 6.257   -44.378 0.226   1.00 74.34  ? 233 VAL A N   1 
ATOM   1744  C CA  . VAL A 1 233 ? 6.264   -45.834 0.350   1.00 74.06  ? 233 VAL A CA  1 
ATOM   1745  C C   . VAL A 1 233 ? 5.341   -46.475 -0.683  1.00 82.55  ? 233 VAL A C   1 
ATOM   1746  O O   . VAL A 1 233 ? 5.681   -47.501 -1.284  1.00 88.85  ? 233 VAL A O   1 
ATOM   1747  C CB  . VAL A 1 233 ? 5.835   -46.288 1.764   1.00 70.38  ? 233 VAL A CB  1 
ATOM   1748  C CG1 . VAL A 1 233 ? 5.582   -47.789 1.800   1.00 57.73  ? 233 VAL A CG1 1 
ATOM   1749  C CG2 . VAL A 1 233 ? 6.889   -45.910 2.782   1.00 77.45  ? 233 VAL A CG2 1 
ATOM   1750  N N   . GLN A 1 234 ? 4.181   -45.862 -0.898  1.00 88.93  ? 234 GLN A N   1 
ATOM   1751  C CA  . GLN A 1 234 ? 3.269   -46.333 -1.936  1.00 89.71  ? 234 GLN A CA  1 
ATOM   1752  C C   . GLN A 1 234 ? 3.964   -46.328 -3.296  1.00 92.07  ? 234 GLN A C   1 
ATOM   1753  O O   . GLN A 1 234 ? 3.942   -47.329 -4.028  1.00 81.23  ? 234 GLN A O   1 
ATOM   1754  C CB  . GLN A 1 234 ? 2.007   -45.470 -1.980  1.00 77.97  ? 234 GLN A CB  1 
ATOM   1755  N N   . ASN A 1 235 ? 4.593   -45.199 -3.618  1.00 83.23  ? 235 ASN A N   1 
ATOM   1756  C CA  . ASN A 1 235 ? 5.305   -45.052 -4.887  1.00 84.50  ? 235 ASN A CA  1 
ATOM   1757  C C   . ASN A 1 235 ? 6.381   -46.117 -5.109  1.00 94.37  ? 235 ASN A C   1 
ATOM   1758  O O   . ASN A 1 235 ? 6.359   -46.835 -6.122  1.00 105.63 ? 235 ASN A O   1 
ATOM   1759  C CB  . ASN A 1 235 ? 5.936   -43.662 -4.977  1.00 79.33  ? 235 ASN A CB  1 
ATOM   1760  C CG  . ASN A 1 235 ? 4.906   -42.552 -4.931  1.00 91.86  ? 235 ASN A CG  1 
ATOM   1761  O OD1 . ASN A 1 235 ? 3.710   -42.805 -4.784  1.00 101.38 ? 235 ASN A OD1 1 
ATOM   1762  N ND2 . ASN A 1 235 ? 5.365   -41.313 -5.060  1.00 88.05  ? 235 ASN A ND2 1 
ATOM   1763  N N   . VAL A 1 236 ? 7.320   -46.219 -4.167  1.00 89.18  ? 236 VAL A N   1 
ATOM   1764  C CA  . VAL A 1 236 ? 8.398   -47.198 -4.296  1.00 87.03  ? 236 VAL A CA  1 
ATOM   1765  C C   . VAL A 1 236 ? 7.832   -48.615 -4.392  1.00 85.81  ? 236 VAL A C   1 
ATOM   1766  O O   . VAL A 1 236 ? 8.337   -49.431 -5.163  1.00 94.59  ? 236 VAL A O   1 
ATOM   1767  C CB  . VAL A 1 236 ? 9.426   -47.117 -3.138  1.00 74.19  ? 236 VAL A CB  1 
ATOM   1768  C CG1 . VAL A 1 236 ? 10.292  -45.875 -3.280  1.00 63.30  ? 236 VAL A CG1 1 
ATOM   1769  C CG2 . VAL A 1 236 ? 8.747   -47.144 -1.791  1.00 93.70  ? 236 VAL A CG2 1 
ATOM   1770  N N   . ARG A 1 237 ? 6.793   -48.905 -3.609  1.00 85.16  ? 237 ARG A N   1 
ATOM   1771  C CA  . ARG A 1 237 ? 6.137   -50.209 -3.673  1.00 89.85  ? 237 ARG A CA  1 
ATOM   1772  C C   . ARG A 1 237 ? 5.680   -50.517 -5.097  1.00 103.93 ? 237 ARG A C   1 
ATOM   1773  O O   . ARG A 1 237 ? 6.099   -51.520 -5.693  1.00 103.33 ? 237 ARG A O   1 
ATOM   1774  C CB  . ARG A 1 237 ? 4.943   -50.263 -2.716  1.00 78.97  ? 237 ARG A CB  1 
ATOM   1775  N N   . ARG A 1 238 ? 4.845   -49.634 -5.644  1.00 105.68 ? 238 ARG A N   1 
ATOM   1776  C CA  . ARG A 1 238 ? 4.313   -49.813 -6.994  1.00 105.63 ? 238 ARG A CA  1 
ATOM   1777  C C   . ARG A 1 238 ? 5.428   -50.022 -8.019  1.00 102.30 ? 238 ARG A C   1 
ATOM   1778  O O   . ARG A 1 238 ? 5.416   -51.001 -8.777  1.00 110.24 ? 238 ARG A O   1 
ATOM   1779  C CB  . ARG A 1 238 ? 3.454   -48.613 -7.396  1.00 94.60  ? 238 ARG A CB  1 
ATOM   1780  N N   . GLU A 1 239 ? 6.393   -49.106 -8.033  1.00 89.54  ? 239 GLU A N   1 
ATOM   1781  C CA  . GLU A 1 239 ? 7.455   -49.144 -9.037  1.00 96.64  ? 239 GLU A CA  1 
ATOM   1782  C C   . GLU A 1 239 ? 8.303   -50.418 -8.902  1.00 93.75  ? 239 GLU A C   1 
ATOM   1783  O O   . GLU A 1 239 ? 8.797   -50.981 -9.902  1.00 97.96  ? 239 GLU A O   1 
ATOM   1784  C CB  . GLU A 1 239 ? 8.329   -47.891 -8.920  1.00 86.46  ? 239 GLU A CB  1 
ATOM   1785  C CG  . GLU A 1 239 ? 9.412   -47.765 -9.980  1.00 88.66  ? 239 GLU A CG  1 
ATOM   1786  C CD  . GLU A 1 239 ? 10.191  -46.467 -9.868  1.00 109.81 ? 239 GLU A CD  1 
ATOM   1787  O OE1 . GLU A 1 239 ? 9.910   -45.680 -8.940  1.00 87.85  ? 239 GLU A OE1 1 
ATOM   1788  O OE2 . GLU A 1 239 ? 11.083  -46.234 -10.712 1.00 126.35 ? 239 GLU A OE2 1 
ATOM   1789  N N   . MET A 1 240 ? 8.390   -50.926 -7.675  1.00 89.52  ? 240 MET A N   1 
ATOM   1790  C CA  . MET A 1 240 ? 9.211   -52.102 -7.416  1.00 91.18  ? 240 MET A CA  1 
ATOM   1791  C C   . MET A 1 240 ? 8.507   -53.411 -7.755  1.00 94.23  ? 240 MET A C   1 
ATOM   1792  O O   . MET A 1 240 ? 9.158   -54.351 -8.219  1.00 89.61  ? 240 MET A O   1 
ATOM   1793  C CB  . MET A 1 240 ? 9.629   -52.122 -5.942  1.00 95.25  ? 240 MET A CB  1 
ATOM   1794  C CG  . MET A 1 240 ? 10.120  -53.473 -5.443  1.00 90.88  ? 240 MET A CG  1 
ATOM   1795  S SD  . MET A 1 240 ? 10.597  -53.491 -3.706  1.00 103.93 ? 240 MET A SD  1 
ATOM   1796  C CE  . MET A 1 240 ? 10.259  -55.204 -3.304  1.00 90.72  ? 240 MET A CE  1 
ATOM   1797  N N   . ASP A 1 241 ? 7.180   -53.461 -7.658  1.00 97.21  ? 241 ASP A N   1 
ATOM   1798  C CA  . ASP A 1 241 ? 6.521   -54.670 -8.152  1.00 104.25 ? 241 ASP A CA  1 
ATOM   1799  C C   . ASP A 1 241 ? 6.317   -54.609 -9.654  1.00 103.09 ? 241 ASP A C   1 
ATOM   1800  O O   . ASP A 1 241 ? 6.200   -55.648 -10.300 1.00 101.39 ? 241 ASP A O   1 
ATOM   1801  C CB  . ASP A 1 241 ? 5.163   -54.904 -7.478  1.00 112.89 ? 241 ASP A CB  1 
ATOM   1802  C CG  . ASP A 1 241 ? 5.243   -54.904 -5.969  1.00 113.39 ? 241 ASP A CG  1 
ATOM   1803  O OD1 . ASP A 1 241 ? 5.621   -55.943 -5.389  1.00 113.87 ? 241 ASP A OD1 1 
ATOM   1804  O OD2 . ASP A 1 241 ? 4.897   -53.873 -5.361  1.00 109.94 ? 241 ASP A OD2 1 
ATOM   1805  N N   . SER A 1 242 ? 6.332   -53.404 -10.220 1.00 102.99 ? 242 SER A N   1 
ATOM   1806  C CA  . SER A 1 242 ? 6.455   -53.256 -11.669 1.00 88.14  ? 242 SER A CA  1 
ATOM   1807  C C   . SER A 1 242 ? 7.734   -53.886 -12.232 1.00 101.09 ? 242 SER A C   1 
ATOM   1808  O O   . SER A 1 242 ? 7.704   -54.831 -13.067 1.00 98.00  ? 242 SER A O   1 
ATOM   1809  C CB  . SER A 1 242 ? 6.399   -51.766 -12.036 1.00 86.14  ? 242 SER A CB  1 
ATOM   1810  O OG  . SER A 1 242 ? 7.047   -51.504 -13.269 1.00 99.00  ? 242 SER A OG  1 
ATOM   1811  N N   . ASP A 1 243 ? 8.866   -53.387 -11.738 1.00 109.92 ? 243 ASP A N   1 
ATOM   1812  C CA  . ASP A 1 243 ? 10.138  -53.775 -12.336 1.00 104.21 ? 243 ASP A CA  1 
ATOM   1813  C C   . ASP A 1 243 ? 10.601  -55.156 -11.874 1.00 94.90  ? 243 ASP A C   1 
ATOM   1814  O O   . ASP A 1 243 ? 11.344  -55.820 -12.598 1.00 83.85  ? 243 ASP A O   1 
ATOM   1815  C CB  . ASP A 1 243 ? 11.202  -52.709 -12.073 1.00 94.11  ? 243 ASP A CB  1 
ATOM   1816  C CG  . ASP A 1 243 ? 10.980  -51.466 -12.913 1.00 110.83 ? 243 ASP A CG  1 
ATOM   1817  O OD1 . ASP A 1 243 ? 10.024  -51.456 -13.718 1.00 120.21 ? 243 ASP A OD1 1 
ATOM   1818  O OD2 . ASP A 1 243 ? 11.775  -50.512 -12.799 1.00 93.84  ? 243 ASP A OD2 1 
ATOM   1819  N N   . ILE A 1 244 ? 10.126  -55.618 -10.717 1.00 90.57  ? 244 ILE A N   1 
ATOM   1820  C CA  . ILE A 1 244 ? 10.314  -57.027 -10.400 1.00 87.27  ? 244 ILE A CA  1 
ATOM   1821  C C   . ILE A 1 244 ? 9.454   -57.862 -11.347 1.00 95.05  ? 244 ILE A C   1 
ATOM   1822  O O   . ILE A 1 244 ? 9.910   -58.910 -11.864 1.00 82.34  ? 244 ILE A O   1 
ATOM   1823  C CB  . ILE A 1 244 ? 9.940   -57.383 -8.945  1.00 78.69  ? 244 ILE A CB  1 
ATOM   1824  C CG1 . ILE A 1 244 ? 10.943  -56.777 -7.971  1.00 76.41  ? 244 ILE A CG1 1 
ATOM   1825  C CG2 . ILE A 1 244 ? 9.964   -58.884 -8.752  1.00 81.74  ? 244 ILE A CG2 1 
ATOM   1826  C CD1 . ILE A 1 244 ? 12.349  -57.186 -8.258  1.00 81.81  ? 244 ILE A CD1 1 
ATOM   1827  N N   . GLU A 1 245 ? 8.237   -57.375 -11.618 1.00 112.77 ? 245 GLU A N   1 
ATOM   1828  C CA  . GLU A 1 245 ? 7.328   -58.114 -12.488 1.00 107.29 ? 245 GLU A CA  1 
ATOM   1829  C C   . GLU A 1 245 ? 7.928   -58.425 -13.857 1.00 101.23 ? 245 GLU A C   1 
ATOM   1830  O O   . GLU A 1 245 ? 7.972   -59.601 -14.223 1.00 102.79 ? 245 GLU A O   1 
ATOM   1831  C CB  . GLU A 1 245 ? 6.002   -57.350 -12.665 1.00 90.98  ? 245 GLU A CB  1 
ATOM   1832  N N   . THR A 1 246 ? 8.415   -57.424 -14.603 1.00 87.94  ? 246 THR A N   1 
ATOM   1833  C CA  . THR A 1 246 ? 8.966   -57.764 -15.932 1.00 90.43  ? 246 THR A CA  1 
ATOM   1834  C C   . THR A 1 246 ? 10.478  -58.105 -15.872 1.00 92.89  ? 246 THR A C   1 
ATOM   1835  O O   . THR A 1 246 ? 11.012  -58.593 -16.879 1.00 109.50 ? 246 THR A O   1 
ATOM   1836  C CB  . THR A 1 246 ? 8.755   -56.653 -17.020 1.00 120.80 ? 246 THR A CB  1 
ATOM   1837  O OG1 . THR A 1 246 ? 9.407   -57.059 -18.237 1.00 126.01 ? 246 THR A OG1 1 
ATOM   1838  C CG2 . THR A 1 246 ? 9.327   -55.356 -16.565 1.00 105.02 ? 246 THR A CG2 1 
ATOM   1839  N N   . MET A 1 247 ? 11.176  -57.851 -14.754 1.00 101.59 ? 247 MET A N   1 
ATOM   1840  C CA  . MET A 1 247 ? 12.539  -58.383 -14.669 1.00 93.47  ? 247 MET A CA  1 
ATOM   1841  C C   . MET A 1 247 ? 12.512  -59.914 -14.579 1.00 89.90  ? 247 MET A C   1 
ATOM   1842  O O   . MET A 1 247 ? 13.419  -60.594 -15.087 1.00 83.03  ? 247 MET A O   1 
ATOM   1843  C CB  . MET A 1 247 ? 13.326  -57.857 -13.473 1.00 92.07  ? 247 MET A CB  1 
ATOM   1844  C CG  . MET A 1 247 ? 14.085  -56.558 -13.708 1.00 93.46  ? 247 MET A CG  1 
ATOM   1845  S SD  . MET A 1 247 ? 15.419  -56.324 -12.506 1.00 89.65  ? 247 MET A SD  1 
ATOM   1846  C CE  . MET A 1 247 ? 14.545  -55.699 -11.076 1.00 94.03  ? 247 MET A CE  1 
ATOM   1847  N N   . GLN A 1 248 ? 11.494  -60.453 -13.906 1.00 97.10  ? 248 GLN A N   1 
ATOM   1848  C CA  . GLN A 1 248 ? 11.436  -61.897 -13.692 1.00 95.43  ? 248 GLN A CA  1 
ATOM   1849  C C   . GLN A 1 248 ? 11.383  -62.696 -14.996 1.00 104.42 ? 248 GLN A C   1 
ATOM   1850  O O   . GLN A 1 248 ? 12.144  -63.664 -15.191 1.00 110.85 ? 248 GLN A O   1 
ATOM   1851  C CB  . GLN A 1 248 ? 10.214  -62.234 -12.824 1.00 66.83  ? 248 GLN A CB  1 
ATOM   1852  N N   . GLN A 1 249 ? 10.514  -62.290 -15.912 1.00 93.33  ? 249 GLN A N   1 
ATOM   1853  C CA  . GLN A 1 249 ? 10.499  -62.982 -17.191 1.00 98.72  ? 249 GLN A CA  1 
ATOM   1854  C C   . GLN A 1 249 ? 11.241  -62.246 -18.346 1.00 94.20  ? 249 GLN A C   1 
ATOM   1855  O O   . GLN A 1 249 ? 11.199  -62.716 -19.501 1.00 94.68  ? 249 GLN A O   1 
ATOM   1856  C CB  . GLN A 1 249 ? 9.061   -63.373 -17.557 1.00 114.10 ? 249 GLN A CB  1 
ATOM   1857  C CG  . GLN A 1 249 ? 8.240   -63.714 -16.300 1.00 118.04 ? 249 GLN A CG  1 
ATOM   1858  C CD  . GLN A 1 249 ? 7.453   -65.010 -16.460 1.00 122.33 ? 249 GLN A CD  1 
ATOM   1859  O OE1 . GLN A 1 249 ? 6.218   -65.037 -16.485 1.00 130.41 ? 249 GLN A OE1 1 
ATOM   1860  N NE2 . GLN A 1 249 ? 8.193   -66.105 -16.598 1.00 120.06 ? 249 GLN A NE2 1 
ATOM   1861  N N   . THR A 1 250 ? 11.870  -61.097 -18.067 1.00 100.13 ? 250 THR A N   1 
ATOM   1862  C CA  . THR A 1 250 ? 12.944  -60.648 -18.945 1.00 78.64  ? 250 THR A CA  1 
ATOM   1863  C C   . THR A 1 250 ? 14.007  -61.732 -18.750 1.00 75.10  ? 250 THR A C   1 
ATOM   1864  O O   . THR A 1 250 ? 14.652  -62.194 -19.702 1.00 74.43  ? 250 THR A O   1 
ATOM   1865  C CB  . THR A 1 250 ? 13.499  -59.269 -18.565 1.00 72.39  ? 250 THR A CB  1 
ATOM   1866  O OG1 . THR A 1 250 ? 12.419  -58.335 -18.436 1.00 96.61  ? 250 THR A OG1 1 
ATOM   1867  C CG2 . THR A 1 250 ? 14.505  -58.766 -19.599 1.00 51.27  ? 250 THR A CG2 1 
ATOM   1868  N N   . ILE A 1 251 ? 14.193  -62.107 -17.485 1.00 84.40  ? 251 ILE A N   1 
ATOM   1869  C CA  . ILE A 1 251 ? 15.038  -63.232 -17.141 1.00 83.60  ? 251 ILE A CA  1 
ATOM   1870  C C   . ILE A 1 251 ? 14.531  -64.498 -17.826 1.00 82.85  ? 251 ILE A C   1 
ATOM   1871  O O   . ILE A 1 251 ? 15.321  -65.233 -18.412 1.00 86.13  ? 251 ILE A O   1 
ATOM   1872  C CB  . ILE A 1 251 ? 15.096  -63.464 -15.618 1.00 82.47  ? 251 ILE A CB  1 
ATOM   1873  C CG1 . ILE A 1 251 ? 15.950  -62.398 -14.935 1.00 84.04  ? 251 ILE A CG1 1 
ATOM   1874  C CG2 . ILE A 1 251 ? 15.687  -64.832 -15.307 1.00 72.77  ? 251 ILE A CG2 1 
ATOM   1875  C CD1 . ILE A 1 251 ? 16.167  -62.653 -13.460 1.00 78.14  ? 251 ILE A CD1 1 
ATOM   1876  N N   . GLU A 1 252 ? 13.223  -64.752 -17.777 1.00 88.90  ? 252 GLU A N   1 
ATOM   1877  C CA  . GLU A 1 252 ? 12.714  -65.991 -18.377 1.00 96.82  ? 252 GLU A CA  1 
ATOM   1878  C C   . GLU A 1 252 ? 12.956  -66.067 -19.887 1.00 89.41  ? 252 GLU A C   1 
ATOM   1879  O O   . GLU A 1 252 ? 13.334  -67.127 -20.391 1.00 94.06  ? 252 GLU A O   1 
ATOM   1880  C CB  . GLU A 1 252 ? 11.221  -66.168 -18.103 1.00 100.05 ? 252 GLU A CB  1 
ATOM   1881  N N   . ASP A 1 253 ? 12.779  -64.955 -20.604 1.00 96.46  ? 253 ASP A N   1 
ATOM   1882  C CA  . ASP A 1 253 ? 13.020  -64.960 -22.053 1.00 97.52  ? 253 ASP A CA  1 
ATOM   1883  C C   . ASP A 1 253 ? 14.510  -64.984 -22.385 1.00 90.21  ? 253 ASP A C   1 
ATOM   1884  O O   . ASP A 1 253 ? 14.917  -65.542 -23.407 1.00 88.21  ? 253 ASP A O   1 
ATOM   1885  C CB  . ASP A 1 253 ? 12.371  -63.753 -22.736 1.00 91.32  ? 253 ASP A CB  1 
ATOM   1886  C CG  . ASP A 1 253 ? 10.950  -63.518 -22.283 1.00 100.51 ? 253 ASP A CG  1 
ATOM   1887  O OD1 . ASP A 1 253 ? 10.355  -64.441 -21.688 1.00 117.19 ? 253 ASP A OD1 1 
ATOM   1888  O OD2 . ASP A 1 253 ? 10.425  -62.410 -22.523 1.00 99.70  ? 253 ASP A OD2 1 
ATOM   1889  N N   . LEU A 1 254 ? 15.320  -64.364 -21.533 1.00 100.82 ? 254 LEU A N   1 
ATOM   1890  C CA  . LEU A 1 254 ? 16.764  -64.422 -21.711 1.00 82.79  ? 254 LEU A CA  1 
ATOM   1891  C C   . LEU A 1 254 ? 17.263  -65.851 -21.516 1.00 87.68  ? 254 LEU A C   1 
ATOM   1892  O O   . LEU A 1 254 ? 18.150  -66.306 -22.231 1.00 82.67  ? 254 LEU A O   1 
ATOM   1893  C CB  . LEU A 1 254 ? 17.471  -63.474 -20.743 1.00 75.96  ? 254 LEU A CB  1 
ATOM   1894  C CG  . LEU A 1 254 ? 17.611  -62.035 -21.235 1.00 72.20  ? 254 LEU A CG  1 
ATOM   1895  C CD1 . LEU A 1 254 ? 18.228  -61.168 -20.155 1.00 65.88  ? 254 LEU A CD1 1 
ATOM   1896  C CD2 . LEU A 1 254 ? 18.438  -61.987 -22.510 1.00 55.68  ? 254 LEU A CD2 1 
ATOM   1897  N N   . GLU A 1 255 ? 16.689  -66.556 -20.548 1.00 93.82  ? 255 GLU A N   1 
ATOM   1898  C CA  . GLU A 1 255 ? 17.025  -67.956 -20.317 1.00 101.25 ? 255 GLU A CA  1 
ATOM   1899  C C   . GLU A 1 255 ? 16.524  -68.838 -21.458 1.00 103.54 ? 255 GLU A C   1 
ATOM   1900  O O   . GLU A 1 255 ? 17.179  -69.812 -21.831 1.00 100.13 ? 255 GLU A O   1 
ATOM   1901  C CB  . GLU A 1 255 ? 16.453  -68.438 -18.980 1.00 91.14  ? 255 GLU A CB  1 
ATOM   1902  C CG  . GLU A 1 255 ? 17.023  -67.714 -17.765 1.00 98.25  ? 255 GLU A CG  1 
ATOM   1903  C CD  . GLU A 1 255 ? 16.551  -68.305 -16.448 1.00 112.49 ? 255 GLU A CD  1 
ATOM   1904  O OE1 . GLU A 1 255 ? 15.720  -69.237 -16.475 1.00 120.96 ? 255 GLU A OE1 1 
ATOM   1905  O OE2 . GLU A 1 255 ? 17.012  -67.836 -15.386 1.00 106.90 ? 255 GLU A OE2 1 
ATOM   1906  N N   . VAL A 1 256 ? 15.361  -68.495 -22.007 1.00 104.79 ? 256 VAL A N   1 
ATOM   1907  C CA  . VAL A 1 256 ? 14.810  -69.219 -23.152 1.00 102.60 ? 256 VAL A CA  1 
ATOM   1908  C C   . VAL A 1 256 ? 15.686  -69.085 -24.398 1.00 100.80 ? 256 VAL A C   1 
ATOM   1909  O O   . VAL A 1 256 ? 16.003  -70.076 -25.057 1.00 109.47 ? 256 VAL A O   1 
ATOM   1910  C CB  . VAL A 1 256 ? 13.379  -68.731 -23.488 1.00 99.40  ? 256 VAL A CB  1 
ATOM   1911  C CG1 . VAL A 1 256 ? 12.993  -69.110 -24.912 1.00 85.41  ? 256 VAL A CG1 1 
ATOM   1912  C CG2 . VAL A 1 256 ? 12.377  -69.298 -22.495 1.00 102.90 ? 256 VAL A CG2 1 
ATOM   1913  N N   . ALA A 1 257 ? 16.090  -67.856 -24.702 1.00 91.61  ? 257 ALA A N   1 
ATOM   1914  C CA  . ALA A 1 257 ? 16.784  -67.558 -25.951 1.00 89.29  ? 257 ALA A CA  1 
ATOM   1915  C C   . ALA A 1 257 ? 18.269  -67.918 -25.929 1.00 96.34  ? 257 ALA A C   1 
ATOM   1916  O O   . ALA A 1 257 ? 18.848  -68.226 -26.968 1.00 85.24  ? 257 ALA A O   1 
ATOM   1917  C CB  . ALA A 1 257 ? 16.613  -66.086 -26.298 1.00 77.68  ? 257 ALA A CB  1 
ATOM   1918  N N   . SER A 1 258 ? 18.884  -67.874 -24.751 1.00 101.48 ? 258 SER A N   1 
ATOM   1919  C CA  . SER A 1 258 ? 20.333  -68.042 -24.639 1.00 87.96  ? 258 SER A CA  1 
ATOM   1920  C C   . SER A 1 258 ? 20.804  -69.490 -24.779 1.00 94.35  ? 258 SER A C   1 
ATOM   1921  O O   . SER A 1 258 ? 22.008  -69.747 -24.820 1.00 92.59  ? 258 SER A O   1 
ATOM   1922  C CB  . SER A 1 258 ? 20.827  -67.475 -23.307 1.00 87.91  ? 258 SER A CB  1 
ATOM   1923  O OG  . SER A 1 258 ? 20.303  -66.177 -23.082 1.00 86.82  ? 258 SER A OG  1 
ATOM   1924  N N   . ASP A 1 259 ? 19.866  -70.430 -24.853 1.00 100.16 ? 259 ASP A N   1 
ATOM   1925  C CA  . ASP A 1 259 ? 20.206  -71.853 -24.788 1.00 102.06 ? 259 ASP A CA  1 
ATOM   1926  C C   . ASP A 1 259 ? 21.010  -72.397 -25.980 1.00 96.98  ? 259 ASP A C   1 
ATOM   1927  O O   . ASP A 1 259 ? 21.868  -73.260 -25.792 1.00 89.16  ? 259 ASP A O   1 
ATOM   1928  C CB  . ASP A 1 259 ? 18.933  -72.691 -24.627 1.00 96.98  ? 259 ASP A CB  1 
ATOM   1929  C CG  . ASP A 1 259 ? 19.177  -73.973 -23.857 1.00 113.19 ? 259 ASP A CG  1 
ATOM   1930  O OD1 . ASP A 1 259 ? 19.731  -73.897 -22.741 1.00 109.58 ? 259 ASP A OD1 1 
ATOM   1931  O OD2 . ASP A 1 259 ? 18.821  -75.056 -24.369 1.00 105.74 ? 259 ASP A OD2 1 
ATOM   1932  N N   . PRO A 1 260 ? 20.743  -71.911 -27.206 1.00 90.90  ? 260 PRO A N   1 
ATOM   1933  C CA  . PRO A 1 260 ? 21.672  -72.325 -28.264 1.00 86.03  ? 260 PRO A CA  1 
ATOM   1934  C C   . PRO A 1 260 ? 23.055  -71.674 -28.184 1.00 86.30  ? 260 PRO A C   1 
ATOM   1935  O O   . PRO A 1 260 ? 24.014  -72.241 -28.702 1.00 88.78  ? 260 PRO A O   1 
ATOM   1936  C CB  . PRO A 1 260 ? 20.949  -71.898 -29.548 1.00 86.37  ? 260 PRO A CB  1 
ATOM   1937  C CG  . PRO A 1 260 ? 20.022  -70.815 -29.122 1.00 85.73  ? 260 PRO A CG  1 
ATOM   1938  C CD  . PRO A 1 260 ? 19.565  -71.216 -27.756 1.00 82.25  ? 260 PRO A CD  1 
ATOM   1939  N N   . LEU A 1 261 ? 23.159  -70.510 -27.550 1.00 84.51  ? 261 LEU A N   1 
ATOM   1940  C CA  . LEU A 1 261 ? 24.402  -69.739 -27.576 1.00 89.72  ? 261 LEU A CA  1 
ATOM   1941  C C   . LEU A 1 261 ? 25.490  -70.245 -26.626 1.00 87.81  ? 261 LEU A C   1 
ATOM   1942  O O   . LEU A 1 261 ? 26.641  -69.818 -26.722 1.00 93.40  ? 261 LEU A O   1 
ATOM   1943  C CB  . LEU A 1 261 ? 24.118  -68.264 -27.279 1.00 80.25  ? 261 LEU A CB  1 
ATOM   1944  C CG  . LEU A 1 261 ? 23.297  -67.501 -28.325 1.00 91.18  ? 261 LEU A CG  1 
ATOM   1945  C CD1 . LEU A 1 261 ? 21.806  -67.590 -28.041 1.00 80.28  ? 261 LEU A CD1 1 
ATOM   1946  C CD2 . LEU A 1 261 ? 23.748  -66.050 -28.412 1.00 104.74 ? 261 LEU A CD2 1 
ATOM   1947  N N   . TYR A 1 262 ? 25.140  -71.148 -25.714 1.00 75.98  ? 262 TYR A N   1 
ATOM   1948  C CA  . TYR A 1 262 ? 26.110  -71.629 -24.731 1.00 77.03  ? 262 TYR A CA  1 
ATOM   1949  C C   . TYR A 1 262 ? 27.199  -72.525 -25.324 1.00 71.07  ? 262 TYR A C   1 
ATOM   1950  O O   . TYR A 1 262 ? 28.293  -72.612 -24.768 1.00 65.20  ? 262 TYR A O   1 
ATOM   1951  C CB  . TYR A 1 262 ? 25.403  -72.377 -23.598 1.00 73.33  ? 262 TYR A CB  1 
ATOM   1952  C CG  . TYR A 1 262 ? 24.422  -71.533 -22.816 1.00 76.73  ? 262 TYR A CG  1 
ATOM   1953  C CD1 . TYR A 1 262 ? 24.839  -70.386 -22.154 1.00 72.14  ? 262 TYR A CD1 1 
ATOM   1954  C CD2 . TYR A 1 262 ? 23.088  -71.900 -22.714 1.00 81.39  ? 262 TYR A CD2 1 
ATOM   1955  C CE1 . TYR A 1 262 ? 23.948  -69.613 -21.433 1.00 78.70  ? 262 TYR A CE1 1 
ATOM   1956  C CE2 . TYR A 1 262 ? 22.191  -71.136 -21.991 1.00 79.14  ? 262 TYR A CE2 1 
ATOM   1957  C CZ  . TYR A 1 262 ? 22.626  -69.995 -21.352 1.00 82.10  ? 262 TYR A CZ  1 
ATOM   1958  O OH  . TYR A 1 262 ? 21.735  -69.233 -20.632 1.00 80.58  ? 262 TYR A OH  1 
ATOM   1959  N N   . VAL A 1 263 ? 26.904  -73.193 -26.436 1.00 75.76  ? 263 VAL A N   1 
ATOM   1960  C CA  . VAL A 1 263 ? 27.910  -74.016 -27.106 1.00 74.78  ? 263 VAL A CA  1 
ATOM   1961  C C   . VAL A 1 263 ? 29.093  -73.161 -27.578 1.00 72.72  ? 263 VAL A C   1 
ATOM   1962  O O   . VAL A 1 263 ? 28.922  -72.210 -28.342 1.00 82.99  ? 263 VAL A O   1 
ATOM   1963  C CB  . VAL A 1 263 ? 27.309  -74.814 -28.294 1.00 88.80  ? 263 VAL A CB  1 
ATOM   1964  C CG1 . VAL A 1 263 ? 26.354  -75.882 -27.782 1.00 88.45  ? 263 VAL A CG1 1 
ATOM   1965  C CG2 . VAL A 1 263 ? 26.597  -73.898 -29.277 1.00 83.53  ? 263 VAL A CG2 1 
ATOM   1966  N N   . PRO A 1 264 ? 30.300  -73.485 -27.086 1.00 61.72  ? 264 PRO A N   1 
ATOM   1967  C CA  . PRO A 1 264 ? 31.546  -72.765 -27.384 1.00 69.16  ? 264 PRO A CA  1 
ATOM   1968  C C   . PRO A 1 264 ? 31.838  -72.637 -28.877 1.00 85.85  ? 264 PRO A C   1 
ATOM   1969  O O   . PRO A 1 264 ? 32.188  -71.552 -29.340 1.00 91.87  ? 264 PRO A O   1 
ATOM   1970  C CB  . PRO A 1 264 ? 32.624  -73.618 -26.701 1.00 73.15  ? 264 PRO A CB  1 
ATOM   1971  C CG  . PRO A 1 264 ? 31.968  -74.917 -26.376 1.00 78.24  ? 264 PRO A CG  1 
ATOM   1972  C CD  . PRO A 1 264 ? 30.525  -74.620 -26.178 1.00 70.03  ? 264 PRO A CD  1 
ATOM   1973  N N   . ASP A 1 265 ? 31.698  -73.734 -29.613 1.00 82.53  ? 265 ASP A N   1 
ATOM   1974  C CA  . ASP A 1 265 ? 31.978  -73.736 -31.044 1.00 81.79  ? 265 ASP A CA  1 
ATOM   1975  C C   . ASP A 1 265 ? 30.721  -74.075 -31.829 1.00 83.76  ? 265 ASP A C   1 
ATOM   1976  O O   . ASP A 1 265 ? 30.507  -75.231 -32.193 1.00 87.93  ? 265 ASP A O   1 
ATOM   1977  C CB  . ASP A 1 265 ? 33.092  -74.729 -31.385 1.00 80.11  ? 265 ASP A CB  1 
ATOM   1978  C CG  . ASP A 1 265 ? 33.818  -74.377 -32.673 1.00 78.71  ? 265 ASP A CG  1 
ATOM   1979  O OD1 . ASP A 1 265 ? 33.208  -73.727 -33.550 1.00 87.91  ? 265 ASP A OD1 1 
ATOM   1980  O OD2 . ASP A 1 265 ? 34.999  -74.758 -32.813 1.00 68.79  ? 265 ASP A OD2 1 
ATOM   1981  N N   . PRO A 1 266 ? 29.883  -73.062 -32.091 1.00 91.38  ? 266 PRO A N   1 
ATOM   1982  C CA  . PRO A 1 266 ? 28.600  -73.265 -32.765 1.00 90.80  ? 266 PRO A CA  1 
ATOM   1983  C C   . PRO A 1 266 ? 28.831  -73.816 -34.163 1.00 87.38  ? 266 PRO A C   1 
ATOM   1984  O O   . PRO A 1 266 ? 29.834  -73.471 -34.787 1.00 101.12 ? 266 PRO A O   1 
ATOM   1985  C CB  . PRO A 1 266 ? 27.994  -71.860 -32.806 1.00 92.39  ? 266 PRO A CB  1 
ATOM   1986  C CG  . PRO A 1 266 ? 29.173  -70.950 -32.787 1.00 87.15  ? 266 PRO A CG  1 
ATOM   1987  C CD  . PRO A 1 266 ? 30.197  -71.632 -31.922 1.00 92.65  ? 266 PRO A CD  1 
ATOM   1988  N N   . ASP A 1 267 ? 27.927  -74.661 -34.643 1.00 88.30  ? 267 ASP A N   1 
ATOM   1989  C CA  . ASP A 1 267 ? 28.092  -75.269 -35.953 1.00 105.77 ? 267 ASP A CA  1 
ATOM   1990  C C   . ASP A 1 267 ? 27.581  -74.267 -36.987 1.00 111.68 ? 267 ASP A C   1 
ATOM   1991  O O   . ASP A 1 267 ? 26.565  -73.606 -36.763 1.00 97.65  ? 267 ASP A O   1 
ATOM   1992  C CB  . ASP A 1 267 ? 27.324  -76.600 -36.002 1.00 113.47 ? 267 ASP A CB  1 
ATOM   1993  C CG  . ASP A 1 267 ? 27.058  -77.091 -37.415 1.00 118.96 ? 267 ASP A CG  1 
ATOM   1994  O OD1 . ASP A 1 267 ? 28.001  -77.567 -38.082 1.00 124.70 ? 267 ASP A OD1 1 
ATOM   1995  O OD2 . ASP A 1 267 ? 25.893  -76.998 -37.858 1.00 95.68  ? 267 ASP A OD2 1 
ATOM   1996  N N   . PRO A 1 268 ? 28.296  -74.142 -38.119 1.00 109.49 ? 268 PRO A N   1 
ATOM   1997  C CA  . PRO A 1 268 ? 28.110  -73.106 -39.145 1.00 100.29 ? 268 PRO A CA  1 
ATOM   1998  C C   . PRO A 1 268 ? 26.665  -72.860 -39.593 1.00 95.00  ? 268 PRO A C   1 
ATOM   1999  O O   . PRO A 1 268 ? 26.334  -71.731 -39.957 1.00 97.60  ? 268 PRO A O   1 
ATOM   2000  C CB  . PRO A 1 268 ? 28.965  -73.624 -40.300 1.00 107.17 ? 268 PRO A CB  1 
ATOM   2001  C CG  . PRO A 1 268 ? 30.106  -74.298 -39.607 1.00 106.87 ? 268 PRO A CG  1 
ATOM   2002  C CD  . PRO A 1 268 ? 29.534  -74.910 -38.351 1.00 87.53  ? 268 PRO A CD  1 
ATOM   2003  N N   . THR A 1 269 ? 25.824  -73.887 -39.585 1.00 106.67 ? 269 THR A N   1 
ATOM   2004  C CA  . THR A 1 269 ? 24.442  -73.714 -40.018 1.00 117.22 ? 269 THR A CA  1 
ATOM   2005  C C   . THR A 1 269 ? 23.620  -72.971 -38.957 1.00 112.99 ? 269 THR A C   1 
ATOM   2006  O O   . THR A 1 269 ? 22.719  -72.194 -39.285 1.00 112.53 ? 269 THR A O   1 
ATOM   2007  C CB  . THR A 1 269 ? 23.780  -75.076 -40.318 1.00 120.80 ? 269 THR A CB  1 
ATOM   2008  O OG1 . THR A 1 269 ? 24.328  -75.618 -41.525 1.00 119.60 ? 269 THR A OG1 1 
ATOM   2009  C CG2 . THR A 1 269 ? 22.274  -74.923 -40.508 1.00 109.41 ? 269 THR A CG2 1 
ATOM   2010  N N   . LYS A 1 270 ? 23.982  -73.156 -37.690 1.00 115.32 ? 270 LYS A N   1 
ATOM   2011  C CA  . LYS A 1 270 ? 23.276  -72.501 -36.592 1.00 115.67 ? 270 LYS A CA  1 
ATOM   2012  C C   . LYS A 1 270 ? 23.479  -70.995 -36.633 1.00 113.08 ? 270 LYS A C   1 
ATOM   2013  O O   . LYS A 1 270 ? 22.516  -70.232 -36.708 1.00 99.45  ? 270 LYS A O   1 
ATOM   2014  C CB  . LYS A 1 270 ? 23.740  -73.053 -35.241 1.00 96.50  ? 270 LYS A CB  1 
ATOM   2015  N N   . PHE A 1 271 ? 24.736  -70.569 -36.584 1.00 104.54 ? 271 PHE A N   1 
ATOM   2016  C CA  . PHE A 1 271 ? 25.055  -69.149 -36.570 1.00 91.95  ? 271 PHE A CA  1 
ATOM   2017  C C   . PHE A 1 271 ? 26.123  -68.816 -37.608 1.00 87.46  ? 271 PHE A C   1 
ATOM   2018  O O   . PHE A 1 271 ? 27.317  -68.938 -37.336 1.00 88.34  ? 271 PHE A O   1 
ATOM   2019  C CB  . PHE A 1 271 ? 25.510  -68.734 -35.174 1.00 86.90  ? 271 PHE A CB  1 
ATOM   2020  C CG  . PHE A 1 271 ? 24.484  -68.996 -34.113 1.00 78.71  ? 271 PHE A CG  1 
ATOM   2021  C CD1 . PHE A 1 271 ? 23.364  -68.190 -33.996 1.00 79.40  ? 271 PHE A CD1 1 
ATOM   2022  C CD2 . PHE A 1 271 ? 24.626  -70.067 -33.247 1.00 78.72  ? 271 PHE A CD2 1 
ATOM   2023  C CE1 . PHE A 1 271 ? 22.413  -68.439 -33.025 1.00 84.98  ? 271 PHE A CE1 1 
ATOM   2024  C CE2 . PHE A 1 271 ? 23.680  -70.321 -32.274 1.00 84.64  ? 271 PHE A CE2 1 
ATOM   2025  C CZ  . PHE A 1 271 ? 22.572  -69.506 -32.162 1.00 88.52  ? 271 PHE A CZ  1 
ATOM   2026  N N   . PRO A 1 272 ? 25.693  -68.396 -38.808 1.00 82.62  ? 272 PRO A N   1 
ATOM   2027  C CA  . PRO A 1 272 ? 26.620  -68.171 -39.922 1.00 72.01  ? 272 PRO A CA  1 
ATOM   2028  C C   . PRO A 1 272 ? 27.541  -66.975 -39.696 1.00 71.07  ? 272 PRO A C   1 
ATOM   2029  O O   . PRO A 1 272 ? 27.247  -66.103 -38.879 1.00 65.05  ? 272 PRO A O   1 
ATOM   2030  C CB  . PRO A 1 272 ? 25.683  -67.920 -41.105 1.00 63.46  ? 272 PRO A CB  1 
ATOM   2031  C CG  . PRO A 1 272 ? 24.464  -67.330 -40.486 1.00 80.27  ? 272 PRO A CG  1 
ATOM   2032  C CD  . PRO A 1 272 ? 24.311  -68.018 -39.154 1.00 74.89  ? 272 PRO A CD  1 
ATOM   2033  N N   . VAL A 1 273 ? 28.650  -66.948 -40.428 1.00 58.52  ? 273 VAL A N   1 
ATOM   2034  C CA  . VAL A 1 273 ? 29.616  -65.862 -40.334 1.00 53.32  ? 273 VAL A CA  1 
ATOM   2035  C C   . VAL A 1 273 ? 29.107  -64.600 -41.021 1.00 53.62  ? 273 VAL A C   1 
ATOM   2036  O O   . VAL A 1 273 ? 28.717  -64.633 -42.188 1.00 56.02  ? 273 VAL A O   1 
ATOM   2037  C CB  . VAL A 1 273 ? 30.971  -66.263 -40.955 1.00 57.70  ? 273 VAL A CB  1 
ATOM   2038  C CG1 . VAL A 1 273 ? 31.877  -65.049 -41.105 1.00 48.69  ? 273 VAL A CG1 1 
ATOM   2039  C CG2 . VAL A 1 273 ? 31.642  -67.339 -40.116 1.00 44.35  ? 273 VAL A CG2 1 
ATOM   2040  N N   . ASN A 1 274 ? 29.111  -63.489 -40.291 1.00 54.73  ? 274 ASN A N   1 
ATOM   2041  C CA  . ASN A 1 274 ? 28.724  -62.208 -40.863 1.00 46.21  ? 274 ASN A CA  1 
ATOM   2042  C C   . ASN A 1 274 ? 29.960  -61.507 -41.406 1.00 52.37  ? 274 ASN A C   1 
ATOM   2043  O O   . ASN A 1 274 ? 30.844  -61.101 -40.651 1.00 61.62  ? 274 ASN A O   1 
ATOM   2044  C CB  . ASN A 1 274 ? 28.021  -61.335 -39.822 1.00 54.97  ? 274 ASN A CB  1 
ATOM   2045  C CG  . ASN A 1 274 ? 27.289  -60.157 -40.442 1.00 61.14  ? 274 ASN A CG  1 
ATOM   2046  O OD1 . ASN A 1 274 ? 27.619  -59.711 -41.542 1.00 62.81  ? 274 ASN A OD1 1 
ATOM   2047  N ND2 . ASN A 1 274 ? 26.288  -59.647 -39.734 1.00 62.18  ? 274 ASN A ND2 1 
ATOM   2048  N N   . ARG A 1 275 ? 30.015  -61.370 -42.725 1.00 52.49  ? 275 ARG A N   1 
ATOM   2049  C CA  . ARG A 1 275 ? 31.196  -60.835 -43.386 1.00 53.72  ? 275 ARG A CA  1 
ATOM   2050  C C   . ARG A 1 275 ? 31.072  -59.336 -43.629 1.00 52.87  ? 275 ARG A C   1 
ATOM   2051  O O   . ARG A 1 275 ? 31.956  -58.713 -44.217 1.00 56.87  ? 275 ARG A O   1 
ATOM   2052  C CB  . ARG A 1 275 ? 31.419  -61.580 -44.705 1.00 47.24  ? 275 ARG A CB  1 
ATOM   2053  C CG  . ARG A 1 275 ? 31.615  -63.080 -44.520 1.00 63.62  ? 275 ARG A CG  1 
ATOM   2054  C CD  . ARG A 1 275 ? 31.856  -63.803 -45.836 1.00 60.82  ? 275 ARG A CD  1 
ATOM   2055  N NE  . ARG A 1 275 ? 30.909  -63.388 -46.868 1.00 80.74  ? 275 ARG A NE  1 
ATOM   2056  C CZ  . ARG A 1 275 ? 30.772  -63.992 -48.044 1.00 93.35  ? 275 ARG A CZ  1 
ATOM   2057  N NH1 . ARG A 1 275 ? 31.521  -65.046 -48.342 1.00 93.63  ? 275 ARG A NH1 1 
ATOM   2058  N NH2 . ARG A 1 275 ? 29.883  -63.546 -48.921 1.00 105.17 ? 275 ARG A NH2 1 
ATOM   2059  N N   . ASN A 1 276 ? 29.961  -58.768 -43.173 1.00 48.82  ? 276 ASN A N   1 
ATOM   2060  C CA  . ASN A 1 276 ? 29.691  -57.344 -43.330 1.00 60.78  ? 276 ASN A CA  1 
ATOM   2061  C C   . ASN A 1 276 ? 29.936  -56.484 -42.085 1.00 51.18  ? 276 ASN A C   1 
ATOM   2062  O O   . ASN A 1 276 ? 29.610  -55.297 -42.084 1.00 49.72  ? 276 ASN A O   1 
ATOM   2063  C CB  . ASN A 1 276 ? 28.256  -57.152 -43.818 1.00 58.12  ? 276 ASN A CB  1 
ATOM   2064  C CG  . ASN A 1 276 ? 28.019  -57.787 -45.175 1.00 61.47  ? 276 ASN A CG  1 
ATOM   2065  O OD1 . ASN A 1 276 ? 28.427  -57.248 -46.204 1.00 59.08  ? 276 ASN A OD1 1 
ATOM   2066  N ND2 . ASN A 1 276 ? 27.367  -58.944 -45.183 1.00 70.40  ? 276 ASN A ND2 1 
ATOM   2067  N N   . LEU A 1 277 ? 30.496  -57.070 -41.030 1.00 42.08  ? 277 LEU A N   1 
ATOM   2068  C CA  . LEU A 1 277 ? 30.650  -56.351 -39.763 1.00 44.03  ? 277 LEU A CA  1 
ATOM   2069  C C   . LEU A 1 277 ? 31.684  -55.227 -39.838 1.00 44.89  ? 277 LEU A C   1 
ATOM   2070  O O   . LEU A 1 277 ? 32.839  -55.456 -40.194 1.00 40.69  ? 277 LEU A O   1 
ATOM   2071  C CB  . LEU A 1 277 ? 31.047  -57.321 -38.645 1.00 39.38  ? 277 LEU A CB  1 
ATOM   2072  C CG  . LEU A 1 277 ? 30.163  -58.538 -38.377 1.00 41.45  ? 277 LEU A CG  1 
ATOM   2073  C CD1 . LEU A 1 277 ? 30.793  -59.413 -37.305 1.00 42.95  ? 277 LEU A CD1 1 
ATOM   2074  C CD2 . LEU A 1 277 ? 28.770  -58.100 -37.962 1.00 31.32  ? 277 LEU A CD2 1 
ATOM   2075  N N   . THR A 1 278 ? 31.258  -54.012 -39.502 1.00 44.55  ? 278 THR A N   1 
ATOM   2076  C CA  . THR A 1 278 ? 32.158  -52.861 -39.452 1.00 40.11  ? 278 THR A CA  1 
ATOM   2077  C C   . THR A 1 278 ? 32.677  -52.632 -38.036 1.00 43.55  ? 278 THR A C   1 
ATOM   2078  O O   . THR A 1 278 ? 33.533  -51.777 -37.800 1.00 54.57  ? 278 THR A O   1 
ATOM   2079  C CB  . THR A 1 278 ? 31.460  -51.580 -39.946 1.00 55.95  ? 278 THR A CB  1 
ATOM   2080  O OG1 . THR A 1 278 ? 30.255  -51.371 -39.198 1.00 62.74  ? 278 THR A OG1 1 
ATOM   2081  C CG2 . THR A 1 278 ? 31.113  -51.701 -41.420 1.00 48.08  ? 278 THR A CG2 1 
ATOM   2082  N N   . ARG A 1 279 ? 32.133  -53.405 -37.103 1.00 44.18  ? 279 ARG A N   1 
ATOM   2083  C CA  . ARG A 1 279 ? 32.423  -53.272 -35.683 1.00 39.73  ? 279 ARG A CA  1 
ATOM   2084  C C   . ARG A 1 279 ? 32.353  -54.643 -35.017 1.00 49.97  ? 279 ARG A C   1 
ATOM   2085  O O   . ARG A 1 279 ? 31.403  -55.388 -35.246 1.00 55.35  ? 279 ARG A O   1 
ATOM   2086  C CB  . ARG A 1 279 ? 31.431  -52.306 -35.033 1.00 48.19  ? 279 ARG A CB  1 
ATOM   2087  C CG  . ARG A 1 279 ? 31.362  -52.395 -33.522 1.00 66.39  ? 279 ARG A CG  1 
ATOM   2088  C CD  . ARG A 1 279 ? 30.075  -51.773 -33.017 1.00 91.85  ? 279 ARG A CD  1 
ATOM   2089  N NE  . ARG A 1 279 ? 29.596  -52.417 -31.800 1.00 116.41 ? 279 ARG A NE  1 
ATOM   2090  C CZ  . ARG A 1 279 ? 28.629  -51.927 -31.034 1.00 120.97 ? 279 ARG A CZ  1 
ATOM   2091  N NH1 . ARG A 1 279 ? 28.035  -50.791 -31.370 1.00 100.91 ? 279 ARG A NH1 1 
ATOM   2092  N NH2 . ARG A 1 279 ? 28.248  -52.575 -29.942 1.00 118.31 ? 279 ARG A NH2 1 
ATOM   2093  N N   . LYS A 1 280 ? 33.336  -54.983 -34.189 1.00 53.42  ? 280 LYS A N   1 
ATOM   2094  C CA  . LYS A 1 280 ? 33.281  -56.259 -33.480 1.00 43.78  ? 280 LYS A CA  1 
ATOM   2095  C C   . LYS A 1 280 ? 33.888  -56.190 -32.082 1.00 37.27  ? 280 LYS A C   1 
ATOM   2096  O O   . LYS A 1 280 ? 34.855  -55.468 -31.845 1.00 46.80  ? 280 LYS A O   1 
ATOM   2097  C CB  . LYS A 1 280 ? 33.978  -57.353 -34.293 1.00 40.73  ? 280 LYS A CB  1 
ATOM   2098  C CG  . LYS A 1 280 ? 33.526  -58.757 -33.920 1.00 41.90  ? 280 LYS A CG  1 
ATOM   2099  C CD  . LYS A 1 280 ? 34.542  -59.809 -34.321 1.00 53.14  ? 280 LYS A CD  1 
ATOM   2100  C CE  . LYS A 1 280 ? 34.258  -61.126 -33.617 1.00 45.48  ? 280 LYS A CE  1 
ATOM   2101  N NZ  . LYS A 1 280 ? 32.837  -61.540 -33.763 1.00 59.00  ? 280 LYS A NZ  1 
ATOM   2102  N N   . ALA A 1 281 ? 33.307  -56.954 -31.161 1.00 57.88  ? 281 ALA A N   1 
ATOM   2103  C CA  . ALA A 1 281 ? 33.781  -57.012 -29.783 1.00 50.46  ? 281 ALA A CA  1 
ATOM   2104  C C   . ALA A 1 281 ? 33.607  -58.410 -29.199 1.00 45.37  ? 281 ALA A C   1 
ATOM   2105  O O   . ALA A 1 281 ? 32.582  -59.057 -29.413 1.00 62.23  ? 281 ALA A O   1 
ATOM   2106  C CB  . ALA A 1 281 ? 33.049  -55.992 -28.930 1.00 45.99  ? 281 ALA A CB  1 
ATOM   2107  N N   . GLY A 1 282 ? 34.609  -58.873 -28.461 1.00 44.20  ? 282 GLY A N   1 
ATOM   2108  C CA  . GLY A 1 282 ? 34.524  -60.157 -27.790 1.00 48.68  ? 282 GLY A CA  1 
ATOM   2109  C C   . GLY A 1 282 ? 35.805  -60.509 -27.062 1.00 48.33  ? 282 GLY A C   1 
ATOM   2110  O O   . GLY A 1 282 ? 36.799  -59.789 -27.156 1.00 47.38  ? 282 GLY A O   1 
ATOM   2111  N N   . TYR A 1 283 ? 35.788  -61.623 -26.338 1.00 44.05  ? 283 TYR A N   1 
ATOM   2112  C CA  . TYR A 1 283 ? 36.967  -62.059 -25.602 1.00 35.67  ? 283 TYR A CA  1 
ATOM   2113  C C   . TYR A 1 283 ? 37.914  -62.862 -26.479 1.00 47.69  ? 283 TYR A C   1 
ATOM   2114  O O   . TYR A 1 283 ? 37.492  -63.713 -27.262 1.00 50.58  ? 283 TYR A O   1 
ATOM   2115  C CB  . TYR A 1 283 ? 36.573  -62.886 -24.377 1.00 49.32  ? 283 TYR A CB  1 
ATOM   2116  C CG  . TYR A 1 283 ? 36.147  -62.060 -23.186 1.00 48.48  ? 283 TYR A CG  1 
ATOM   2117  C CD1 . TYR A 1 283 ? 37.091  -61.522 -22.319 1.00 45.62  ? 283 TYR A CD1 1 
ATOM   2118  C CD2 . TYR A 1 283 ? 34.806  -61.819 -22.926 1.00 34.59  ? 283 TYR A CD2 1 
ATOM   2119  C CE1 . TYR A 1 283 ? 36.710  -60.768 -21.228 1.00 42.86  ? 283 TYR A CE1 1 
ATOM   2120  C CE2 . TYR A 1 283 ? 34.416  -61.066 -21.837 1.00 43.23  ? 283 TYR A CE2 1 
ATOM   2121  C CZ  . TYR A 1 283 ? 35.372  -60.543 -20.992 1.00 50.93  ? 283 TYR A CZ  1 
ATOM   2122  O OH  . TYR A 1 283 ? 34.984  -59.792 -19.907 1.00 56.16  ? 283 TYR A OH  1 
ATOM   2123  N N   . LEU A 1 284 ? 39.203  -62.584 -26.327 1.00 40.09  ? 284 LEU A N   1 
ATOM   2124  C CA  . LEU A 1 284 ? 40.243  -63.287 -27.059 1.00 44.47  ? 284 LEU A CA  1 
ATOM   2125  C C   . LEU A 1 284 ? 41.418  -63.554 -26.134 1.00 58.54  ? 284 LEU A C   1 
ATOM   2126  O O   . LEU A 1 284 ? 41.595  -62.864 -25.130 1.00 49.98  ? 284 LEU A O   1 
ATOM   2127  C CB  . LEU A 1 284 ? 40.704  -62.472 -28.270 1.00 50.57  ? 284 LEU A CB  1 
ATOM   2128  C CG  . LEU A 1 284 ? 39.686  -62.174 -29.370 1.00 44.18  ? 284 LEU A CG  1 
ATOM   2129  C CD1 . LEU A 1 284 ? 40.295  -61.266 -30.424 1.00 43.85  ? 284 LEU A CD1 1 
ATOM   2130  C CD2 . LEU A 1 284 ? 39.193  -63.462 -29.997 1.00 42.99  ? 284 LEU A CD2 1 
ATOM   2131  N N   . ASN A 1 285 ? 42.218  -64.558 -26.468 1.00 67.34  ? 285 ASN A N   1 
ATOM   2132  C CA  . ASN A 1 285 ? 43.438  -64.813 -25.719 1.00 57.19  ? 285 ASN A CA  1 
ATOM   2133  C C   . ASN A 1 285 ? 44.635  -64.306 -26.500 1.00 56.55  ? 285 ASN A C   1 
ATOM   2134  O O   . ASN A 1 285 ? 44.716  -64.491 -27.714 1.00 63.70  ? 285 ASN A O   1 
ATOM   2135  C CB  . ASN A 1 285 ? 43.598  -66.304 -25.418 1.00 52.88  ? 285 ASN A CB  1 
ATOM   2136  C CG  . ASN A 1 285 ? 42.416  -66.879 -24.669 1.00 58.29  ? 285 ASN A CG  1 
ATOM   2137  O OD1 . ASN A 1 285 ? 41.984  -66.333 -23.655 1.00 61.65  ? 285 ASN A OD1 1 
ATOM   2138  N ND2 . ASN A 1 285 ? 41.890  -67.995 -25.160 1.00 65.90  ? 285 ASN A ND2 1 
ATOM   2139  N N   . ALA A 1 286 ? 45.566  -63.666 -25.806 1.00 50.22  ? 286 ALA A N   1 
ATOM   2140  C CA  . ALA A 1 286 ? 46.718  -63.089 -26.475 1.00 50.35  ? 286 ALA A CA  1 
ATOM   2141  C C   . ALA A 1 286 ? 47.996  -63.639 -25.876 1.00 62.34  ? 286 ALA A C   1 
ATOM   2142  O O   . ALA A 1 286 ? 48.199  -63.587 -24.662 1.00 65.55  ? 286 ALA A O   1 
ATOM   2143  C CB  . ALA A 1 286 ? 46.693  -61.577 -26.371 1.00 45.02  ? 286 ALA A CB  1 
ATOM   2144  N N   . ARG A 1 287 ? 48.855  -64.175 -26.732 1.00 52.38  ? 287 ARG A N   1 
ATOM   2145  C CA  . ARG A 1 287 ? 50.127  -64.695 -26.272 1.00 50.50  ? 287 ARG A CA  1 
ATOM   2146  C C   . ARG A 1 287 ? 51.163  -63.585 -26.174 1.00 70.93  ? 287 ARG A C   1 
ATOM   2147  O O   . ARG A 1 287 ? 51.472  -62.923 -27.163 1.00 72.76  ? 287 ARG A O   1 
ATOM   2148  C CB  . ARG A 1 287 ? 50.630  -65.799 -27.198 1.00 68.74  ? 287 ARG A CB  1 
ATOM   2149  C CG  . ARG A 1 287 ? 51.942  -66.399 -26.737 1.00 99.44  ? 287 ARG A CG  1 
ATOM   2150  C CD  . ARG A 1 287 ? 52.374  -67.555 -27.613 1.00 91.28  ? 287 ARG A CD  1 
ATOM   2151  N NE  . ARG A 1 287 ? 52.730  -67.137 -28.964 1.00 100.61 ? 287 ARG A NE  1 
ATOM   2152  C CZ  . ARG A 1 287 ? 53.929  -66.676 -29.300 1.00 114.35 ? 287 ARG A CZ  1 
ATOM   2153  N NH1 . ARG A 1 287 ? 54.183  -66.321 -30.551 1.00 129.11 ? 287 ARG A NH1 1 
ATOM   2154  N NH2 . ARG A 1 287 ? 54.878  -66.570 -28.379 1.00 114.55 ? 287 ARG A NH2 1 
ATOM   2155  N N   . ASN A 1 288 ? 51.699  -63.391 -24.976 1.00 79.49  ? 288 ASN A N   1 
ATOM   2156  C CA  . ASN A 1 288 ? 52.753  -62.412 -24.760 1.00 91.71  ? 288 ASN A CA  1 
ATOM   2157  C C   . ASN A 1 288 ? 53.853  -63.041 -23.917 1.00 87.28  ? 288 ASN A C   1 
ATOM   2158  O O   . ASN A 1 288 ? 53.625  -63.429 -22.770 1.00 93.26  ? 288 ASN A O   1 
ATOM   2159  C CB  . ASN A 1 288 ? 52.202  -61.143 -24.103 1.00 90.71  ? 288 ASN A CB  1 
ATOM   2160  C CG  . ASN A 1 288 ? 51.219  -61.437 -22.990 1.00 90.37  ? 288 ASN A CG  1 
ATOM   2161  O OD1 . ASN A 1 288 ? 50.535  -62.460 -23.004 1.00 89.25  ? 288 ASN A OD1 1 
ATOM   2162  N ND2 . ASN A 1 288 ? 51.135  -60.533 -22.021 1.00 107.95 ? 288 ASN A ND2 1 
ATOM   2163  N N   . LYS A 1 289 ? 55.043  -63.145 -24.502 1.00 90.08  ? 289 LYS A N   1 
ATOM   2164  C CA  . LYS A 1 289 ? 56.157  -63.870 -23.896 1.00 95.18  ? 289 LYS A CA  1 
ATOM   2165  C C   . LYS A 1 289 ? 56.543  -63.325 -22.524 1.00 88.50  ? 289 LYS A C   1 
ATOM   2166  O O   . LYS A 1 289 ? 56.652  -64.080 -21.557 1.00 79.45  ? 289 LYS A O   1 
ATOM   2167  C CB  . LYS A 1 289 ? 57.372  -63.837 -24.826 1.00 77.57  ? 289 LYS A CB  1 
ATOM   2168  N N   . SER A 1 295 ? 55.777  -67.102 -21.559 1.00 80.93  ? 295 SER A N   1 
ATOM   2169  C CA  . SER A 1 295 ? 54.808  -67.064 -22.649 1.00 85.69  ? 295 SER A CA  1 
ATOM   2170  C C   . SER A 1 295 ? 53.456  -67.619 -22.214 1.00 81.69  ? 295 SER A C   1 
ATOM   2171  O O   . SER A 1 295 ? 53.176  -68.806 -22.390 1.00 80.31  ? 295 SER A O   1 
ATOM   2172  C CB  . SER A 1 295 ? 55.323  -67.844 -23.859 1.00 94.57  ? 295 SER A CB  1 
ATOM   2173  O OG  . SER A 1 295 ? 54.246  -68.318 -24.651 1.00 87.73  ? 295 SER A OG  1 
ATOM   2174  N N   . THR A 1 296 ? 52.619  -66.757 -21.648 1.00 77.32  ? 296 THR A N   1 
ATOM   2175  C CA  . THR A 1 296 ? 51.292  -67.171 -21.214 1.00 92.02  ? 296 THR A CA  1 
ATOM   2176  C C   . THR A 1 296 ? 50.246  -66.708 -22.219 1.00 74.64  ? 296 THR A C   1 
ATOM   2177  O O   . THR A 1 296 ? 50.568  -66.030 -23.194 1.00 72.69  ? 296 THR A O   1 
ATOM   2178  C CB  . THR A 1 296 ? 50.942  -66.604 -19.824 1.00 81.18  ? 296 THR A CB  1 
ATOM   2179  O OG1 . THR A 1 296 ? 50.686  -65.197 -19.928 1.00 80.70  ? 296 THR A OG1 1 
ATOM   2180  C CG2 . THR A 1 296 ? 52.082  -66.840 -18.846 1.00 75.16  ? 296 THR A CG2 1 
ATOM   2181  N N   . TRP A 1 297 ? 48.993  -67.077 -21.979 1.00 78.50  ? 297 TRP A N   1 
ATOM   2182  C CA  . TRP A 1 297 ? 47.896  -66.634 -22.828 1.00 74.54  ? 297 TRP A CA  1 
ATOM   2183  C C   . TRP A 1 297 ? 46.823  -65.992 -21.955 1.00 75.00  ? 297 TRP A C   1 
ATOM   2184  O O   . TRP A 1 297 ? 46.148  -66.676 -21.187 1.00 76.31  ? 297 TRP A O   1 
ATOM   2185  C CB  . TRP A 1 297 ? 47.315  -67.808 -23.620 1.00 70.38  ? 297 TRP A CB  1 
ATOM   2186  C CG  . TRP A 1 297 ? 48.237  -68.361 -24.673 1.00 74.05  ? 297 TRP A CG  1 
ATOM   2187  C CD1 . TRP A 1 297 ? 49.378  -69.082 -24.463 1.00 70.89  ? 297 TRP A CD1 1 
ATOM   2188  C CD2 . TRP A 1 297 ? 48.088  -68.255 -26.095 1.00 76.82  ? 297 TRP A CD2 1 
ATOM   2189  N NE1 . TRP A 1 297 ? 49.950  -69.425 -25.663 1.00 55.29  ? 297 TRP A NE1 1 
ATOM   2190  C CE2 . TRP A 1 297 ? 49.178  -68.929 -26.682 1.00 70.50  ? 297 TRP A CE2 1 
ATOM   2191  C CE3 . TRP A 1 297 ? 47.142  -67.652 -26.930 1.00 73.62  ? 297 TRP A CE3 1 
ATOM   2192  C CZ2 . TRP A 1 297 ? 49.347  -69.020 -28.063 1.00 74.30  ? 297 TRP A CZ2 1 
ATOM   2193  C CZ3 . TRP A 1 297 ? 47.313  -67.742 -28.302 1.00 78.19  ? 297 TRP A CZ3 1 
ATOM   2194  C CH2 . TRP A 1 297 ? 48.407  -68.419 -28.854 1.00 67.16  ? 297 TRP A CH2 1 
ATOM   2195  N N   . ASP A 1 298 ? 46.661  -64.680 -22.085 1.00 72.97  ? 298 ASP A N   1 
ATOM   2196  C CA  . ASP A 1 298 ? 45.742  -63.937 -21.228 1.00 73.97  ? 298 ASP A CA  1 
ATOM   2197  C C   . ASP A 1 298 ? 44.430  -63.611 -21.931 1.00 53.67  ? 298 ASP A C   1 
ATOM   2198  O O   . ASP A 1 298 ? 44.422  -63.061 -23.031 1.00 54.97  ? 298 ASP A O   1 
ATOM   2199  C CB  . ASP A 1 298 ? 46.402  -62.649 -20.732 1.00 83.59  ? 298 ASP A CB  1 
ATOM   2200  C CG  . ASP A 1 298 ? 47.793  -62.883 -20.179 1.00 90.97  ? 298 ASP A CG  1 
ATOM   2201  O OD1 . ASP A 1 298 ? 48.715  -63.146 -20.978 1.00 84.11  ? 298 ASP A OD1 1 
ATOM   2202  O OD2 . ASP A 1 298 ? 47.965  -62.805 -18.944 1.00 90.34  ? 298 ASP A OD2 1 
ATOM   2203  N N   . ARG A 1 299 ? 43.323  -63.949 -21.279 1.00 59.28  ? 299 ARG A N   1 
ATOM   2204  C CA  . ARG A 1 299 ? 42.002  -63.620 -21.796 1.00 50.81  ? 299 ARG A CA  1 
ATOM   2205  C C   . ARG A 1 299 ? 41.672  -62.157 -21.524 1.00 51.93  ? 299 ARG A C   1 
ATOM   2206  O O   . ARG A 1 299 ? 41.717  -61.699 -20.383 1.00 55.46  ? 299 ARG A O   1 
ATOM   2207  C CB  . ARG A 1 299 ? 40.942  -64.533 -21.175 1.00 44.29  ? 299 ARG A CB  1 
ATOM   2208  C CG  . ARG A 1 299 ? 39.514  -64.253 -21.622 1.00 36.91  ? 299 ARG A CG  1 
ATOM   2209  C CD  . ARG A 1 299 ? 38.630  -65.465 -21.364 1.00 42.03  ? 299 ARG A CD  1 
ATOM   2210  N NE  . ARG A 1 299 ? 37.257  -65.274 -21.823 1.00 42.57  ? 299 ARG A NE  1 
ATOM   2211  C CZ  . ARG A 1 299 ? 36.269  -64.826 -21.055 1.00 53.83  ? 299 ARG A CZ  1 
ATOM   2212  N NH1 . ARG A 1 299 ? 36.498  -64.521 -19.785 1.00 62.42  ? 299 ARG A NH1 1 
ATOM   2213  N NH2 . ARG A 1 299 ? 35.049  -64.687 -21.555 1.00 53.38  ? 299 ARG A NH2 1 
ATOM   2214  N N   . GLN A 1 300 ? 41.342  -61.432 -22.586 1.00 54.39  ? 300 GLN A N   1 
ATOM   2215  C CA  . GLN A 1 300 ? 40.975  -60.026 -22.482 1.00 47.19  ? 300 GLN A CA  1 
ATOM   2216  C C   . GLN A 1 300 ? 39.835  -59.723 -23.442 1.00 46.76  ? 300 GLN A C   1 
ATOM   2217  O O   . GLN A 1 300 ? 39.593  -60.473 -24.386 1.00 57.42  ? 300 GLN A O   1 
ATOM   2218  C CB  . GLN A 1 300 ? 42.175  -59.127 -22.786 1.00 50.00  ? 300 GLN A CB  1 
ATOM   2219  C CG  . GLN A 1 300 ? 43.251  -59.120 -21.710 1.00 71.54  ? 300 GLN A CG  1 
ATOM   2220  C CD  . GLN A 1 300 ? 44.264  -58.009 -21.909 1.00 68.10  ? 300 GLN A CD  1 
ATOM   2221  O OE1 . GLN A 1 300 ? 44.136  -57.194 -22.822 1.00 66.86  ? 300 GLN A OE1 1 
ATOM   2222  N NE2 . GLN A 1 300 ? 45.280  -57.975 -21.055 1.00 71.16  ? 300 GLN A NE2 1 
ATOM   2223  N N   . PHE A 1 301 ? 39.133  -58.623 -23.201 1.00 51.66  ? 301 PHE A N   1 
ATOM   2224  C CA  . PHE A 1 301 ? 38.044  -58.219 -24.079 1.00 48.39  ? 301 PHE A CA  1 
ATOM   2225  C C   . PHE A 1 301 ? 38.534  -57.266 -25.162 1.00 50.29  ? 301 PHE A C   1 
ATOM   2226  O O   . PHE A 1 301 ? 38.960  -56.149 -24.871 1.00 47.83  ? 301 PHE A O   1 
ATOM   2227  C CB  . PHE A 1 301 ? 36.927  -57.569 -23.267 1.00 39.71  ? 301 PHE A CB  1 
ATOM   2228  C CG  . PHE A 1 301 ? 35.690  -57.266 -24.061 1.00 36.65  ? 301 PHE A CG  1 
ATOM   2229  C CD1 . PHE A 1 301 ? 34.763  -58.258 -24.329 1.00 33.74  ? 301 PHE A CD1 1 
ATOM   2230  C CD2 . PHE A 1 301 ? 35.445  -55.984 -24.524 1.00 49.06  ? 301 PHE A CD2 1 
ATOM   2231  C CE1 . PHE A 1 301 ? 33.620  -57.980 -25.053 1.00 42.67  ? 301 PHE A CE1 1 
ATOM   2232  C CE2 . PHE A 1 301 ? 34.305  -55.701 -25.248 1.00 44.48  ? 301 PHE A CE2 1 
ATOM   2233  C CZ  . PHE A 1 301 ? 33.391  -56.700 -25.512 1.00 43.07  ? 301 PHE A CZ  1 
ATOM   2234  N N   . TYR A 1 302 ? 38.460  -57.709 -26.412 1.00 53.39  ? 302 TYR A N   1 
ATOM   2235  C CA  . TYR A 1 302 ? 38.871  -56.884 -27.540 1.00 57.08  ? 302 TYR A CA  1 
ATOM   2236  C C   . TYR A 1 302 ? 37.659  -56.263 -28.218 1.00 53.67  ? 302 TYR A C   1 
ATOM   2237  O O   . TYR A 1 302 ? 36.609  -56.894 -28.327 1.00 47.57  ? 302 TYR A O   1 
ATOM   2238  C CB  . TYR A 1 302 ? 39.678  -57.707 -28.548 1.00 40.88  ? 302 TYR A CB  1 
ATOM   2239  C CG  . TYR A 1 302 ? 41.083  -58.023 -28.092 1.00 42.55  ? 302 TYR A CG  1 
ATOM   2240  C CD1 . TYR A 1 302 ? 41.324  -59.024 -27.160 1.00 44.11  ? 302 TYR A CD1 1 
ATOM   2241  C CD2 . TYR A 1 302 ? 42.171  -57.323 -28.597 1.00 43.71  ? 302 TYR A CD2 1 
ATOM   2242  C CE1 . TYR A 1 302 ? 42.608  -59.314 -26.740 1.00 39.48  ? 302 TYR A CE1 1 
ATOM   2243  C CE2 . TYR A 1 302 ? 43.458  -57.608 -28.186 1.00 36.99  ? 302 TYR A CE2 1 
ATOM   2244  C CZ  . TYR A 1 302 ? 43.670  -58.604 -27.256 1.00 49.12  ? 302 TYR A CZ  1 
ATOM   2245  O OH  . TYR A 1 302 ? 44.950  -58.890 -26.842 1.00 68.59  ? 302 TYR A OH  1 
ATOM   2246  N N   . PHE A 1 303 ? 37.804  -55.019 -28.660 1.00 41.53  ? 303 PHE A N   1 
ATOM   2247  C CA  . PHE A 1 303 ? 36.733  -54.341 -29.378 1.00 48.38  ? 303 PHE A CA  1 
ATOM   2248  C C   . PHE A 1 303 ? 37.301  -53.296 -30.326 1.00 47.59  ? 303 PHE A C   1 
ATOM   2249  O O   . PHE A 1 303 ? 38.316  -52.665 -30.030 1.00 44.27  ? 303 PHE A O   1 
ATOM   2250  C CB  . PHE A 1 303 ? 35.748  -53.687 -28.404 1.00 47.21  ? 303 PHE A CB  1 
ATOM   2251  C CG  . PHE A 1 303 ? 36.373  -52.669 -27.489 1.00 48.99  ? 303 PHE A CG  1 
ATOM   2252  C CD1 . PHE A 1 303 ? 37.029  -53.061 -26.332 1.00 47.88  ? 303 PHE A CD1 1 
ATOM   2253  C CD2 . PHE A 1 303 ? 36.291  -51.317 -27.780 1.00 51.17  ? 303 PHE A CD2 1 
ATOM   2254  C CE1 . PHE A 1 303 ? 37.599  -52.124 -25.489 1.00 48.31  ? 303 PHE A CE1 1 
ATOM   2255  C CE2 . PHE A 1 303 ? 36.858  -50.375 -26.941 1.00 51.85  ? 303 PHE A CE2 1 
ATOM   2256  C CZ  . PHE A 1 303 ? 37.511  -50.779 -25.794 1.00 53.25  ? 303 PHE A CZ  1 
ATOM   2257  N N   . THR A 1 304 ? 36.647  -53.117 -31.469 1.00 50.12  ? 304 THR A N   1 
ATOM   2258  C CA  . THR A 1 304 ? 37.064  -52.097 -32.418 1.00 48.88  ? 304 THR A CA  1 
ATOM   2259  C C   . THR A 1 304 ? 36.437  -50.749 -32.086 1.00 57.65  ? 304 THR A C   1 
ATOM   2260  O O   . THR A 1 304 ? 35.238  -50.657 -31.824 1.00 69.33  ? 304 THR A O   1 
ATOM   2261  C CB  . THR A 1 304 ? 36.691  -52.480 -33.863 1.00 50.90  ? 304 THR A CB  1 
ATOM   2262  O OG1 . THR A 1 304 ? 35.275  -52.356 -34.044 1.00 59.08  ? 304 THR A OG1 1 
ATOM   2263  C CG2 . THR A 1 304 ? 37.116  -53.909 -34.162 1.00 45.50  ? 304 THR A CG2 1 
ATOM   2264  N N   . GLN A 1 305 ? 37.258  -49.705 -32.099 1.00 61.11  ? 305 GLN A N   1 
ATOM   2265  C CA  . GLN A 1 305 ? 36.772  -48.341 -31.936 1.00 59.79  ? 305 GLN A CA  1 
ATOM   2266  C C   . GLN A 1 305 ? 37.493  -47.429 -32.918 1.00 55.11  ? 305 GLN A C   1 
ATOM   2267  O O   . GLN A 1 305 ? 38.708  -47.251 -32.835 1.00 59.83  ? 305 GLN A O   1 
ATOM   2268  C CB  . GLN A 1 305 ? 36.969  -47.847 -30.502 1.00 63.31  ? 305 GLN A CB  1 
ATOM   2269  C CG  . GLN A 1 305 ? 35.736  -47.174 -29.918 1.00 67.38  ? 305 GLN A CG  1 
ATOM   2270  C CD  . GLN A 1 305 ? 35.942  -46.695 -28.495 1.00 84.68  ? 305 GLN A CD  1 
ATOM   2271  O OE1 . GLN A 1 305 ? 37.052  -46.740 -27.966 1.00 87.26  ? 305 GLN A OE1 1 
ATOM   2272  N NE2 . GLN A 1 305 ? 34.869  -46.225 -27.869 1.00 103.67 ? 305 GLN A NE2 1 
ATOM   2273  N N   . GLY A 1 306 ? 36.736  -46.847 -33.841 1.00 52.02  ? 306 GLY A N   1 
ATOM   2274  C CA  . GLY A 1 306 ? 37.321  -46.114 -34.946 1.00 60.65  ? 306 GLY A CA  1 
ATOM   2275  C C   . GLY A 1 306 ? 38.195  -47.033 -35.775 1.00 63.52  ? 306 GLY A C   1 
ATOM   2276  O O   . GLY A 1 306 ? 37.752  -48.093 -36.218 1.00 64.84  ? 306 GLY A O   1 
ATOM   2277  N N   . GLY A 1 307 ? 39.444  -46.630 -35.978 1.00 50.99  ? 307 GLY A N   1 
ATOM   2278  C CA  . GLY A 1 307 ? 40.387  -47.428 -36.737 1.00 64.54  ? 307 GLY A CA  1 
ATOM   2279  C C   . GLY A 1 307 ? 41.353  -48.153 -35.824 1.00 51.49  ? 307 GLY A C   1 
ATOM   2280  O O   . GLY A 1 307 ? 42.447  -48.537 -36.235 1.00 59.48  ? 307 GLY A O   1 
ATOM   2281  N N   . ASN A 1 308 ? 40.945  -48.333 -34.574 1.00 62.28  ? 308 ASN A N   1 
ATOM   2282  C CA  . ASN A 1 308 ? 41.793  -48.983 -33.587 1.00 58.13  ? 308 ASN A CA  1 
ATOM   2283  C C   . ASN A 1 308 ? 41.192  -50.266 -33.031 1.00 51.99  ? 308 ASN A C   1 
ATOM   2284  O O   . ASN A 1 308 ? 39.977  -50.380 -32.864 1.00 46.11  ? 308 ASN A O   1 
ATOM   2285  C CB  . ASN A 1 308 ? 42.085  -48.022 -32.433 1.00 50.19  ? 308 ASN A CB  1 
ATOM   2286  C CG  . ASN A 1 308 ? 42.832  -46.783 -32.880 1.00 60.80  ? 308 ASN A CG  1 
ATOM   2287  O OD1 . ASN A 1 308 ? 43.768  -46.862 -33.675 1.00 68.68  ? 308 ASN A OD1 1 
ATOM   2288  N ND2 . ASN A 1 308 ? 42.419  -45.628 -32.372 1.00 80.46  ? 308 ASN A ND2 1 
ATOM   2289  N N   . LEU A 1 309 ? 42.058  -51.231 -32.749 1.00 52.42  ? 309 LEU A N   1 
ATOM   2290  C CA  . LEU A 1 309 ? 41.677  -52.408 -31.988 1.00 57.25  ? 309 LEU A CA  1 
ATOM   2291  C C   . LEU A 1 309 ? 42.098  -52.188 -30.543 1.00 41.06  ? 309 LEU A C   1 
ATOM   2292  O O   . LEU A 1 309 ? 43.291  -52.070 -30.244 1.00 44.72  ? 309 LEU A O   1 
ATOM   2293  C CB  . LEU A 1 309 ? 42.318  -53.676 -32.554 1.00 57.86  ? 309 LEU A CB  1 
ATOM   2294  C CG  . LEU A 1 309 ? 41.979  -54.958 -31.790 1.00 45.74  ? 309 LEU A CG  1 
ATOM   2295  C CD1 . LEU A 1 309 ? 40.473  -55.186 -31.769 1.00 34.42  ? 309 LEU A CD1 1 
ATOM   2296  C CD2 . LEU A 1 309 ? 42.701  -56.154 -32.390 1.00 40.95  ? 309 LEU A CD2 1 
ATOM   2297  N N   . MET A 1 310 ? 41.102  -52.105 -29.666 1.00 46.93  ? 310 MET A N   1 
ATOM   2298  C CA  . MET A 1 310 ? 41.308  -51.841 -28.248 1.00 56.46  ? 310 MET A CA  1 
ATOM   2299  C C   . MET A 1 310 ? 41.092  -53.109 -27.432 1.00 46.32  ? 310 MET A C   1 
ATOM   2300  O O   . MET A 1 310 ? 40.300  -53.968 -27.815 1.00 41.80  ? 310 MET A O   1 
ATOM   2301  C CB  . MET A 1 310 ? 40.357  -50.744 -27.766 1.00 53.33  ? 310 MET A CB  1 
ATOM   2302  C CG  . MET A 1 310 ? 40.345  -49.491 -28.627 1.00 48.73  ? 310 MET A CG  1 
ATOM   2303  S SD  . MET A 1 310 ? 41.867  -48.537 -28.500 1.00 74.72  ? 310 MET A SD  1 
ATOM   2304  C CE  . MET A 1 310 ? 41.802  -48.020 -26.786 1.00 66.91  ? 310 MET A CE  1 
ATOM   2305  N N   . SER A 1 311 ? 41.789  -53.225 -26.307 1.00 50.59  ? 311 SER A N   1 
ATOM   2306  C CA  . SER A 1 311 ? 41.580  -54.364 -25.421 1.00 53.81  ? 311 SER A CA  1 
ATOM   2307  C C   . SER A 1 311 ? 41.512  -53.942 -23.960 1.00 55.34  ? 311 SER A C   1 
ATOM   2308  O O   . SER A 1 311 ? 42.131  -52.960 -23.550 1.00 58.58  ? 311 SER A O   1 
ATOM   2309  C CB  . SER A 1 311 ? 42.691  -55.398 -25.607 1.00 52.25  ? 311 SER A CB  1 
ATOM   2310  O OG  . SER A 1 311 ? 43.940  -54.890 -25.174 1.00 64.52  ? 311 SER A OG  1 
ATOM   2311  N N   . GLN A 1 312 ? 40.748  -54.700 -23.182 1.00 56.91  ? 312 GLN A N   1 
ATOM   2312  C CA  . GLN A 1 312 ? 40.586  -54.436 -21.760 1.00 50.96  ? 312 GLN A CA  1 
ATOM   2313  C C   . GLN A 1 312 ? 40.496  -55.747 -20.990 1.00 47.46  ? 312 GLN A C   1 
ATOM   2314  O O   . GLN A 1 312 ? 39.658  -56.595 -21.297 1.00 39.95  ? 312 GLN A O   1 
ATOM   2315  C CB  . GLN A 1 312 ? 39.337  -53.583 -21.523 1.00 54.50  ? 312 GLN A CB  1 
ATOM   2316  C CG  . GLN A 1 312 ? 39.154  -53.091 -20.099 1.00 68.93  ? 312 GLN A CG  1 
ATOM   2317  C CD  . GLN A 1 312 ? 37.818  -52.398 -19.899 1.00 74.17  ? 312 GLN A CD  1 
ATOM   2318  O OE1 . GLN A 1 312 ? 37.086  -52.151 -20.857 1.00 72.68  ? 312 GLN A OE1 1 
ATOM   2319  N NE2 . GLN A 1 312 ? 37.496  -52.080 -18.650 1.00 72.75  ? 312 GLN A NE2 1 
ATOM   2320  N N   . ALA A 1 313 ? 41.362  -55.918 -19.998 1.00 64.57  ? 313 ALA A N   1 
ATOM   2321  C CA  . ALA A 1 313 ? 41.279  -57.084 -19.130 1.00 53.66  ? 313 ALA A CA  1 
ATOM   2322  C C   . ALA A 1 313 ? 40.011  -57.001 -18.294 1.00 54.81  ? 313 ALA A C   1 
ATOM   2323  O O   . ALA A 1 313 ? 39.681  -55.938 -17.767 1.00 54.42  ? 313 ALA A O   1 
ATOM   2324  C CB  . ALA A 1 313 ? 42.505  -57.181 -18.238 1.00 54.02  ? 313 ALA A CB  1 
ATOM   2325  N N   . ARG A 1 314 ? 39.293  -58.113 -18.178 1.00 63.29  ? 314 ARG A N   1 
ATOM   2326  C CA  . ARG A 1 314 ? 38.103  -58.131 -17.340 1.00 61.21  ? 314 ARG A CA  1 
ATOM   2327  C C   . ARG A 1 314 ? 38.535  -58.006 -15.887 1.00 67.87  ? 314 ARG A C   1 
ATOM   2328  O O   . ARG A 1 314 ? 39.415  -58.730 -15.425 1.00 87.96  ? 314 ARG A O   1 
ATOM   2329  C CB  . ARG A 1 314 ? 37.275  -59.397 -17.576 1.00 65.19  ? 314 ARG A CB  1 
ATOM   2330  C CG  . ARG A 1 314 ? 35.928  -59.392 -16.861 1.00 65.45  ? 314 ARG A CG  1 
ATOM   2331  C CD  . ARG A 1 314 ? 35.382  -60.797 -16.650 1.00 69.40  ? 314 ARG A CD  1 
ATOM   2332  N NE  . ARG A 1 314 ? 36.319  -61.678 -15.963 1.00 83.40  ? 314 ARG A NE  1 
ATOM   2333  C CZ  . ARG A 1 314 ? 36.126  -62.982 -15.798 1.00 70.65  ? 314 ARG A CZ  1 
ATOM   2334  N NH1 . ARG A 1 314 ? 37.028  -63.714 -15.159 1.00 71.29  ? 314 ARG A NH1 1 
ATOM   2335  N NH2 . ARG A 1 314 ? 35.030  -63.557 -16.275 1.00 67.53  ? 314 ARG A NH2 1 
ATOM   2336  N N   . GLY A 1 315 ? 37.902  -57.087 -15.170 1.00 69.57  ? 315 GLY A N   1 
ATOM   2337  C CA  . GLY A 1 315 ? 38.303  -56.765 -13.816 1.00 91.41  ? 315 GLY A CA  1 
ATOM   2338  C C   . GLY A 1 315 ? 39.411  -55.727 -13.766 1.00 100.05 ? 315 GLY A C   1 
ATOM   2339  O O   . GLY A 1 315 ? 40.183  -55.675 -12.811 1.00 99.17  ? 315 GLY A O   1 
ATOM   2340  N N   . ASP A 1 316 ? 39.467  -54.893 -14.803 1.00 94.12  ? 316 ASP A N   1 
ATOM   2341  C CA  . ASP A 1 316 ? 40.247  -53.662 -14.782 1.00 81.93  ? 316 ASP A CA  1 
ATOM   2342  C C   . ASP A 1 316 ? 39.292  -52.547 -15.198 1.00 91.68  ? 316 ASP A C   1 
ATOM   2343  O O   . ASP A 1 316 ? 38.273  -52.811 -15.837 1.00 79.69  ? 316 ASP A O   1 
ATOM   2344  C CB  . ASP A 1 316 ? 41.450  -53.724 -15.736 1.00 77.67  ? 316 ASP A CB  1 
ATOM   2345  C CG  . ASP A 1 316 ? 42.618  -54.528 -15.182 1.00 101.84 ? 316 ASP A CG  1 
ATOM   2346  O OD1 . ASP A 1 316 ? 42.473  -55.158 -14.118 1.00 98.18  ? 316 ASP A OD1 1 
ATOM   2347  O OD2 . ASP A 1 316 ? 43.691  -54.526 -15.825 1.00 97.94  ? 316 ASP A OD2 1 
ATOM   2348  N N   . VAL A 1 317 ? 39.633  -51.307 -14.859 1.00 100.69 ? 317 VAL A N   1 
ATOM   2349  C CA  . VAL A 1 317 ? 38.667  -50.210 -14.901 1.00 102.53 ? 317 VAL A CA  1 
ATOM   2350  C C   . VAL A 1 317 ? 38.646  -49.534 -16.283 1.00 111.69 ? 317 VAL A C   1 
ATOM   2351  O O   . VAL A 1 317 ? 37.664  -48.879 -16.648 1.00 103.56 ? 317 VAL A O   1 
ATOM   2352  C CB  . VAL A 1 317 ? 38.966  -49.177 -13.761 1.00 93.05  ? 317 VAL A CB  1 
ATOM   2353  C CG1 . VAL A 1 317 ? 40.445  -48.824 -13.712 1.00 92.23  ? 317 VAL A CG1 1 
ATOM   2354  C CG2 . VAL A 1 317 ? 38.078  -47.933 -13.856 1.00 98.01  ? 317 VAL A CG2 1 
ATOM   2355  N N   . ALA A 1 318 ? 39.702  -49.727 -17.074 1.00 103.33 ? 318 ALA A N   1 
ATOM   2356  C CA  . ALA A 1 318 ? 39.736  -49.132 -18.411 1.00 88.01  ? 318 ALA A CA  1 
ATOM   2357  C C   . ALA A 1 318 ? 40.588  -49.910 -19.420 1.00 91.87  ? 318 ALA A C   1 
ATOM   2358  O O   . ALA A 1 318 ? 41.461  -50.696 -19.051 1.00 85.64  ? 318 ALA A O   1 
ATOM   2359  C CB  . ALA A 1 318 ? 40.233  -47.701 -18.324 1.00 83.74  ? 318 ALA A CB  1 
ATOM   2360  N N   . GLY A 1 319 ? 40.342  -49.643 -20.700 1.00 99.91  ? 319 GLY A N   1 
ATOM   2361  C CA  . GLY A 1 319 ? 41.037  -50.309 -21.788 1.00 96.37  ? 319 GLY A CA  1 
ATOM   2362  C C   . GLY A 1 319 ? 42.390  -49.742 -22.171 1.00 79.05  ? 319 GLY A C   1 
ATOM   2363  O O   . GLY A 1 319 ? 42.976  -48.943 -21.443 1.00 88.25  ? 319 GLY A O   1 
ATOM   2364  N N   . GLY A 1 320 ? 42.877  -50.160 -23.335 1.00 76.23  ? 320 GLY A N   1 
ATOM   2365  C CA  . GLY A 1 320 ? 44.153  -49.703 -23.852 1.00 87.12  ? 320 GLY A CA  1 
ATOM   2366  C C   . GLY A 1 320 ? 44.285  -50.006 -25.331 1.00 78.96  ? 320 GLY A C   1 
ATOM   2367  O O   . GLY A 1 320 ? 43.625  -50.909 -25.847 1.00 72.57  ? 320 GLY A O   1 
ATOM   2368  N N   . LEU A 1 321 ? 45.134  -49.248 -26.017 1.00 79.96  ? 321 LEU A N   1 
ATOM   2369  C CA  . LEU A 1 321 ? 45.371  -49.468 -27.437 1.00 86.00  ? 321 LEU A CA  1 
ATOM   2370  C C   . LEU A 1 321 ? 46.114  -50.779 -27.655 1.00 80.80  ? 321 LEU A C   1 
ATOM   2371  O O   . LEU A 1 321 ? 47.193  -50.993 -27.102 1.00 77.02  ? 321 LEU A O   1 
ATOM   2372  C CB  . LEU A 1 321 ? 46.156  -48.293 -28.039 1.00 84.13  ? 321 LEU A CB  1 
ATOM   2373  C CG  . LEU A 1 321 ? 46.289  -48.125 -29.562 1.00 64.41  ? 321 LEU A CG  1 
ATOM   2374  C CD1 . LEU A 1 321 ? 47.282  -49.100 -30.190 1.00 58.70  ? 321 LEU A CD1 1 
ATOM   2375  C CD2 . LEU A 1 321 ? 44.935  -48.254 -30.236 1.00 54.65  ? 321 LEU A CD2 1 
ATOM   2376  N N   . ALA A 1 322 ? 45.527  -51.653 -28.464 1.00 69.11  ? 322 ALA A N   1 
ATOM   2377  C CA  . ALA A 1 322 ? 46.179  -52.897 -28.838 1.00 65.47  ? 322 ALA A CA  1 
ATOM   2378  C C   . ALA A 1 322 ? 46.858  -52.715 -30.188 1.00 75.91  ? 322 ALA A C   1 
ATOM   2379  O O   . ALA A 1 322 ? 48.076  -52.855 -30.297 1.00 82.84  ? 322 ALA A O   1 
ATOM   2380  C CB  . ALA A 1 322 ? 45.184  -54.050 -28.876 1.00 60.26  ? 322 ALA A CB  1 
ATOM   2381  N N   . MET A 1 323 ? 46.076  -52.400 -31.217 1.00 70.16  ? 323 MET A N   1 
ATOM   2382  C CA  . MET A 1 323 ? 46.659  -52.186 -32.544 1.00 45.14  ? 323 MET A CA  1 
ATOM   2383  C C   . MET A 1 323 ? 46.000  -51.056 -33.323 1.00 50.77  ? 323 MET A C   1 
ATOM   2384  O O   . MET A 1 323 ? 44.861  -50.688 -33.055 1.00 64.77  ? 323 MET A O   1 
ATOM   2385  C CB  . MET A 1 323 ? 46.593  -53.473 -33.366 1.00 40.25  ? 323 MET A CB  1 
ATOM   2386  C CG  . MET A 1 323 ? 47.818  -54.349 -33.215 1.00 57.07  ? 323 MET A CG  1 
ATOM   2387  S SD  . MET A 1 323 ? 49.295  -53.664 -33.993 1.00 84.60  ? 323 MET A SD  1 
ATOM   2388  C CE  . MET A 1 323 ? 48.998  -54.062 -35.714 1.00 46.02  ? 323 MET A CE  1 
ATOM   2389  N N   . ASP A 1 324 ? 46.728  -50.503 -34.288 1.00 61.65  ? 324 ASP A N   1 
ATOM   2390  C CA  . ASP A 1 324 ? 46.133  -49.553 -35.217 1.00 64.37  ? 324 ASP A CA  1 
ATOM   2391  C C   . ASP A 1 324 ? 45.818  -50.297 -36.509 1.00 64.24  ? 324 ASP A C   1 
ATOM   2392  O O   . ASP A 1 324 ? 46.710  -50.610 -37.299 1.00 66.01  ? 324 ASP A O   1 
ATOM   2393  C CB  . ASP A 1 324 ? 47.078  -48.377 -35.470 1.00 61.74  ? 324 ASP A CB  1 
ATOM   2394  C CG  . ASP A 1 324 ? 46.445  -47.288 -36.309 1.00 75.64  ? 324 ASP A CG  1 
ATOM   2395  O OD1 . ASP A 1 324 ? 45.225  -47.061 -36.168 1.00 80.09  ? 324 ASP A OD1 1 
ATOM   2396  O OD2 . ASP A 1 324 ? 47.170  -46.654 -37.106 1.00 76.18  ? 324 ASP A OD2 1 
ATOM   2397  N N   . ILE A 1 325 ? 44.534  -50.573 -36.712 1.00 57.78  ? 325 ILE A N   1 
ATOM   2398  C CA  . ILE A 1 325 ? 44.087  -51.443 -37.794 1.00 50.51  ? 325 ILE A CA  1 
ATOM   2399  C C   . ILE A 1 325 ? 43.560  -50.729 -39.039 1.00 54.63  ? 325 ILE A C   1 
ATOM   2400  O O   . ILE A 1 325 ? 42.993  -51.376 -39.916 1.00 68.50  ? 325 ILE A O   1 
ATOM   2401  C CB  . ILE A 1 325 ? 43.002  -52.423 -37.297 1.00 44.86  ? 325 ILE A CB  1 
ATOM   2402  C CG1 . ILE A 1 325 ? 41.821  -51.666 -36.690 1.00 55.47  ? 325 ILE A CG1 1 
ATOM   2403  C CG2 . ILE A 1 325 ? 43.590  -53.397 -36.287 1.00 45.81  ? 325 ILE A CG2 1 
ATOM   2404  C CD1 . ILE A 1 325 ? 40.558  -52.494 -36.604 1.00 47.93  ? 325 ILE A CD1 1 
ATOM   2405  N N   . ASP A 1 326 ? 43.719  -49.411 -39.125 1.00 50.77  ? 326 ASP A N   1 
ATOM   2406  C CA  . ASP A 1 326 ? 43.091  -48.683 -40.225 1.00 73.76  ? 326 ASP A CA  1 
ATOM   2407  C C   . ASP A 1 326 ? 43.858  -48.880 -41.529 1.00 63.85  ? 326 ASP A C   1 
ATOM   2408  O O   . ASP A 1 326 ? 43.305  -48.712 -42.616 1.00 63.49  ? 326 ASP A O   1 
ATOM   2409  C CB  . ASP A 1 326 ? 42.986  -47.190 -39.899 1.00 84.61  ? 326 ASP A CB  1 
ATOM   2410  C CG  . ASP A 1 326 ? 44.330  -46.486 -39.932 1.00 76.26  ? 326 ASP A CG  1 
ATOM   2411  O OD1 . ASP A 1 326 ? 44.957  -46.349 -38.863 1.00 75.09  ? 326 ASP A OD1 1 
ATOM   2412  O OD2 . ASP A 1 326 ? 44.760  -46.066 -41.027 1.00 98.40  ? 326 ASP A OD2 1 
ATOM   2413  N N   . ASN A 1 327 ? 45.133  -49.236 -41.417 1.00 62.94  ? 327 ASN A N   1 
ATOM   2414  C CA  . ASN A 1 327 ? 45.899  -49.701 -42.565 1.00 59.11  ? 327 ASN A CA  1 
ATOM   2415  C C   . ASN A 1 327 ? 46.713  -50.916 -42.139 1.00 57.28  ? 327 ASN A C   1 
ATOM   2416  O O   . ASN A 1 327 ? 47.708  -50.775 -41.427 1.00 74.90  ? 327 ASN A O   1 
ATOM   2417  C CB  . ASN A 1 327 ? 46.805  -48.584 -43.091 1.00 56.04  ? 327 ASN A CB  1 
ATOM   2418  C CG  . ASN A 1 327 ? 47.514  -48.954 -44.380 1.00 59.67  ? 327 ASN A CG  1 
ATOM   2419  O OD1 . ASN A 1 327 ? 47.319  -50.041 -44.925 1.00 61.99  ? 327 ASN A OD1 1 
ATOM   2420  N ND2 . ASN A 1 327 ? 48.341  -48.042 -44.879 1.00 68.68  ? 327 ASN A ND2 1 
ATOM   2421  N N   . CYS A 1 328 ? 46.310  -52.100 -42.592 1.00 46.12  ? 328 CYS A N   1 
ATOM   2422  C CA  . CYS A 1 328 ? 46.960  -53.330 -42.148 1.00 42.87  ? 328 CYS A CA  1 
ATOM   2423  C C   . CYS A 1 328 ? 46.550  -54.572 -42.932 1.00 50.42  ? 328 CYS A C   1 
ATOM   2424  O O   . CYS A 1 328 ? 45.740  -54.511 -43.859 1.00 64.41  ? 328 CYS A O   1 
ATOM   2425  C CB  . CYS A 1 328 ? 46.675  -53.570 -40.662 1.00 53.64  ? 328 CYS A CB  1 
ATOM   2426  S SG  . CYS A 1 328 ? 44.961  -54.014 -40.297 1.00 61.13  ? 328 CYS A SG  1 
ATOM   2427  N N   . SER A 1 329 ? 47.127  -55.700 -42.533 1.00 39.60  ? 329 SER A N   1 
ATOM   2428  C CA  . SER A 1 329 ? 46.728  -57.014 -43.014 1.00 48.20  ? 329 SER A CA  1 
ATOM   2429  C C   . SER A 1 329 ? 46.495  -57.922 -41.814 1.00 46.73  ? 329 SER A C   1 
ATOM   2430  O O   . SER A 1 329 ? 46.959  -57.628 -40.718 1.00 54.22  ? 329 SER A O   1 
ATOM   2431  C CB  . SER A 1 329 ? 47.794  -57.603 -43.940 1.00 54.25  ? 329 SER A CB  1 
ATOM   2432  O OG  . SER A 1 329 ? 47.474  -58.933 -44.308 1.00 87.51  ? 329 SER A OG  1 
ATOM   2433  N N   . VAL A 1 330 ? 45.761  -59.010 -42.008 1.00 42.27  ? 330 VAL A N   1 
ATOM   2434  C CA  . VAL A 1 330 ? 45.496  -59.940 -40.914 1.00 45.92  ? 330 VAL A CA  1 
ATOM   2435  C C   . VAL A 1 330 ? 45.367  -61.353 -41.470 1.00 48.89  ? 330 VAL A C   1 
ATOM   2436  O O   . VAL A 1 330 ? 44.767  -61.552 -42.526 1.00 60.13  ? 330 VAL A O   1 
ATOM   2437  C CB  . VAL A 1 330 ? 44.219  -59.545 -40.130 1.00 50.60  ? 330 VAL A CB  1 
ATOM   2438  C CG1 . VAL A 1 330 ? 43.054  -59.306 -41.081 1.00 47.06  ? 330 VAL A CG1 1 
ATOM   2439  C CG2 . VAL A 1 330 ? 43.865  -60.602 -39.092 1.00 54.02  ? 330 VAL A CG2 1 
ATOM   2440  N N   . MET A 1 331 ? 45.934  -62.336 -40.777 1.00 51.59  ? 331 MET A N   1 
ATOM   2441  C CA  . MET A 1 331 ? 45.851  -63.707 -41.274 1.00 57.40  ? 331 MET A CA  1 
ATOM   2442  C C   . MET A 1 331 ? 45.765  -64.746 -40.164 1.00 56.63  ? 331 MET A C   1 
ATOM   2443  O O   . MET A 1 331 ? 46.168  -64.496 -39.028 1.00 65.94  ? 331 MET A O   1 
ATOM   2444  C CB  . MET A 1 331 ? 47.049  -64.025 -42.174 1.00 67.80  ? 331 MET A CB  1 
ATOM   2445  C CG  . MET A 1 331 ? 48.323  -64.379 -41.423 1.00 60.34  ? 331 MET A CG  1 
ATOM   2446  S SD  . MET A 1 331 ? 49.709  -64.706 -42.530 1.00 76.41  ? 331 MET A SD  1 
ATOM   2447  C CE  . MET A 1 331 ? 50.989  -65.137 -41.353 1.00 61.00  ? 331 MET A CE  1 
ATOM   2448  N N   . ALA A 1 332 ? 45.227  -65.912 -40.509 1.00 48.51  ? 332 ALA A N   1 
ATOM   2449  C CA  . ALA A 1 332 ? 45.216  -67.050 -39.602 1.00 55.51  ? 332 ALA A CA  1 
ATOM   2450  C C   . ALA A 1 332 ? 46.649  -67.505 -39.370 1.00 58.03  ? 332 ALA A C   1 
ATOM   2451  O O   . ALA A 1 332 ? 47.466  -67.506 -40.291 1.00 57.63  ? 332 ALA A O   1 
ATOM   2452  C CB  . ALA A 1 332 ? 44.371  -68.182 -40.160 1.00 43.71  ? 332 ALA A CB  1 
ATOM   2453  N N   . VAL A 1 333 ? 46.953  -67.888 -38.135 1.00 61.99  ? 333 VAL A N   1 
ATOM   2454  C CA  . VAL A 1 333 ? 48.315  -68.239 -37.759 1.00 62.15  ? 333 VAL A CA  1 
ATOM   2455  C C   . VAL A 1 333 ? 48.317  -69.515 -36.925 1.00 53.17  ? 333 VAL A C   1 
ATOM   2456  O O   . VAL A 1 333 ? 47.420  -69.732 -36.111 1.00 61.86  ? 333 VAL A O   1 
ATOM   2457  C CB  . VAL A 1 333 ? 48.986  -67.079 -36.973 1.00 63.61  ? 333 VAL A CB  1 
ATOM   2458  C CG1 . VAL A 1 333 ? 50.223  -67.551 -36.223 1.00 73.58  ? 333 VAL A CG1 1 
ATOM   2459  C CG2 . VAL A 1 333 ? 49.337  -65.934 -37.912 1.00 66.64  ? 333 VAL A CG2 1 
ATOM   2460  N N   . ASP A 1 334 ? 49.317  -70.366 -37.137 1.00 60.78  ? 334 ASP A N   1 
ATOM   2461  C CA  . ASP A 1 334 ? 49.499  -71.531 -36.286 1.00 59.75  ? 334 ASP A CA  1 
ATOM   2462  C C   . ASP A 1 334 ? 50.491  -71.206 -35.179 1.00 62.31  ? 334 ASP A C   1 
ATOM   2463  O O   . ASP A 1 334 ? 51.641  -70.859 -35.449 1.00 65.34  ? 334 ASP A O   1 
ATOM   2464  C CB  . ASP A 1 334 ? 50.003  -72.725 -37.101 1.00 55.29  ? 334 ASP A CB  1 
ATOM   2465  C CG  . ASP A 1 334 ? 48.935  -73.314 -37.997 1.00 84.43  ? 334 ASP A CG  1 
ATOM   2466  O OD1 . ASP A 1 334 ? 47.815  -73.560 -37.507 1.00 91.15  ? 334 ASP A OD1 1 
ATOM   2467  O OD2 . ASP A 1 334 ? 49.220  -73.538 -39.193 1.00 93.55  ? 334 ASP A OD2 1 
ATOM   2468  N N   . CYS A 1 335 ? 50.044  -71.306 -33.933 1.00 56.40  ? 335 CYS A N   1 
ATOM   2469  C CA  . CYS A 1 335 ? 50.926  -71.060 -32.800 1.00 59.73  ? 335 CYS A CA  1 
ATOM   2470  C C   . CYS A 1 335 ? 50.601  -71.974 -31.624 1.00 75.35  ? 335 CYS A C   1 
ATOM   2471  O O   . CYS A 1 335 ? 49.447  -72.060 -31.201 1.00 65.83  ? 335 CYS A O   1 
ATOM   2472  C CB  . CYS A 1 335 ? 50.834  -69.595 -32.369 1.00 59.85  ? 335 CYS A CB  1 
ATOM   2473  S SG  . CYS A 1 335 ? 51.671  -69.218 -30.815 1.00 79.96  ? 335 CYS A SG  1 
ATOM   2474  N N   . GLU A 1 336 ? 51.624  -72.648 -31.101 1.00 78.97  ? 336 GLU A N   1 
ATOM   2475  C CA  . GLU A 1 336 ? 51.504  -73.455 -29.885 1.00 58.13  ? 336 GLU A CA  1 
ATOM   2476  C C   . GLU A 1 336 ? 50.395  -74.507 -29.962 1.00 77.31  ? 336 GLU A C   1 
ATOM   2477  O O   . GLU A 1 336 ? 49.813  -74.879 -28.943 1.00 69.60  ? 336 GLU A O   1 
ATOM   2478  C CB  . GLU A 1 336 ? 51.282  -72.544 -28.676 1.00 64.58  ? 336 GLU A CB  1 
ATOM   2479  C CG  . GLU A 1 336 ? 52.516  -71.752 -28.276 1.00 56.96  ? 336 GLU A CG  1 
ATOM   2480  C CD  . GLU A 1 336 ? 52.404  -71.164 -26.884 1.00 82.22  ? 336 GLU A CD  1 
ATOM   2481  O OE1 . GLU A 1 336 ? 51.454  -71.526 -26.159 1.00 79.86  ? 336 GLU A OE1 1 
ATOM   2482  O OE2 . GLU A 1 336 ? 53.275  -70.351 -26.509 1.00 78.51  ? 336 GLU A OE2 1 
ATOM   2483  N N   . ASP A 1 337 ? 50.111  -74.963 -31.180 1.00 77.23  ? 337 ASP A N   1 
ATOM   2484  C CA  . ASP A 1 337 ? 49.102  -75.988 -31.460 1.00 86.01  ? 337 ASP A CA  1 
ATOM   2485  C C   . ASP A 1 337 ? 47.688  -75.529 -31.073 1.00 84.07  ? 337 ASP A C   1 
ATOM   2486  O O   . ASP A 1 337 ? 46.788  -76.345 -30.871 1.00 78.47  ? 337 ASP A O   1 
ATOM   2487  C CB  . ASP A 1 337 ? 49.461  -77.295 -30.737 1.00 79.88  ? 337 ASP A CB  1 
ATOM   2488  C CG  . ASP A 1 337 ? 48.702  -78.498 -31.276 1.00 94.49  ? 337 ASP A CG  1 
ATOM   2489  O OD1 . ASP A 1 337 ? 47.985  -78.354 -32.288 1.00 89.27  ? 337 ASP A OD1 1 
ATOM   2490  O OD2 . ASP A 1 337 ? 48.826  -79.590 -30.683 1.00 98.64  ? 337 ASP A OD2 1 
ATOM   2491  N N   . ARG A 1 338 ? 47.505  -74.219 -30.945 1.00 72.69  ? 338 ARG A N   1 
ATOM   2492  C CA  . ARG A 1 338 ? 46.237  -73.667 -30.472 1.00 68.48  ? 338 ARG A CA  1 
ATOM   2493  C C   . ARG A 1 338 ? 45.237  -73.518 -31.616 1.00 58.98  ? 338 ARG A C   1 
ATOM   2494  O O   . ARG A 1 338 ? 45.626  -73.379 -32.775 1.00 66.79  ? 338 ARG A O   1 
ATOM   2495  C CB  . ARG A 1 338 ? 46.441  -72.327 -29.767 1.00 69.85  ? 338 ARG A CB  1 
ATOM   2496  C CG  . ARG A 1 338 ? 47.308  -72.403 -28.524 1.00 62.70  ? 338 ARG A CG  1 
ATOM   2497  C CD  . ARG A 1 338 ? 46.628  -71.682 -27.369 1.00 63.60  ? 338 ARG A CD  1 
ATOM   2498  N NE  . ARG A 1 338 ? 47.337  -71.843 -26.104 1.00 76.31  ? 338 ARG A NE  1 
ATOM   2499  C CZ  . ARG A 1 338 ? 46.831  -71.514 -24.919 1.00 65.82  ? 338 ARG A CZ  1 
ATOM   2500  N NH1 . ARG A 1 338 ? 45.607  -71.011 -24.837 1.00 53.81  ? 338 ARG A NH1 1 
ATOM   2501  N NH2 . ARG A 1 338 ? 47.546  -71.691 -23.817 1.00 75.77  ? 338 ARG A NH2 1 
ATOM   2502  N N   . ARG A 1 339 ? 43.950  -73.549 -31.286 1.00 68.98  ? 339 ARG A N   1 
ATOM   2503  C CA  . ARG A 1 339 ? 42.898  -73.440 -32.291 1.00 58.30  ? 339 ARG A CA  1 
ATOM   2504  C C   . ARG A 1 339 ? 42.424  -72.012 -32.502 1.00 58.21  ? 339 ARG A C   1 
ATOM   2505  O O   . ARG A 1 339 ? 42.280  -71.256 -31.545 1.00 68.27  ? 339 ARG A O   1 
ATOM   2506  C CB  . ARG A 1 339 ? 41.688  -74.286 -31.913 1.00 61.31  ? 339 ARG A CB  1 
ATOM   2507  C CG  . ARG A 1 339 ? 41.920  -75.759 -32.009 1.00 62.49  ? 339 ARG A CG  1 
ATOM   2508  C CD  . ARG A 1 339 ? 40.627  -76.513 -31.850 1.00 51.12  ? 339 ARG A CD  1 
ATOM   2509  N NE  . ARG A 1 339 ? 39.623  -75.846 -31.034 1.00 77.81  ? 339 ARG A NE  1 
ATOM   2510  C CZ  . ARG A 1 339 ? 38.316  -75.984 -31.237 1.00 77.53  ? 339 ARG A CZ  1 
ATOM   2511  N NH1 . ARG A 1 339 ? 37.445  -75.357 -30.458 1.00 80.55  ? 339 ARG A NH1 1 
ATOM   2512  N NH2 . ARG A 1 339 ? 37.882  -76.753 -32.227 1.00 68.79  ? 339 ARG A NH2 1 
ATOM   2513  N N   . TYR A 1 340 ? 42.187  -71.660 -33.762 1.00 65.69  ? 340 TYR A N   1 
ATOM   2514  C CA  . TYR A 1 340 ? 41.588  -70.377 -34.116 1.00 52.71  ? 340 TYR A CA  1 
ATOM   2515  C C   . TYR A 1 340 ? 42.458  -69.186 -33.727 1.00 53.06  ? 340 TYR A C   1 
ATOM   2516  O O   . TYR A 1 340 ? 41.965  -68.206 -33.168 1.00 45.99  ? 340 TYR A O   1 
ATOM   2517  C CB  . TYR A 1 340 ? 40.209  -70.248 -33.462 1.00 58.87  ? 340 TYR A CB  1 
ATOM   2518  C CG  . TYR A 1 340 ? 39.265  -71.380 -33.799 1.00 66.94  ? 340 TYR A CG  1 
ATOM   2519  C CD1 . TYR A 1 340 ? 39.223  -71.917 -35.079 1.00 60.18  ? 340 TYR A CD1 1 
ATOM   2520  C CD2 . TYR A 1 340 ? 38.428  -71.923 -32.833 1.00 62.77  ? 340 TYR A CD2 1 
ATOM   2521  C CE1 . TYR A 1 340 ? 38.363  -72.952 -35.391 1.00 63.37  ? 340 TYR A CE1 1 
ATOM   2522  C CE2 . TYR A 1 340 ? 37.566  -72.961 -33.135 1.00 64.82  ? 340 TYR A CE2 1 
ATOM   2523  C CZ  . TYR A 1 340 ? 37.537  -73.471 -34.416 1.00 78.07  ? 340 TYR A CZ  1 
ATOM   2524  O OH  . TYR A 1 340 ? 36.681  -74.504 -34.724 1.00 77.84  ? 340 TYR A OH  1 
ATOM   2525  N N   . CYS A 1 341 ? 43.751  -69.278 -34.016 1.00 52.77  ? 341 CYS A N   1 
ATOM   2526  C CA  . CYS A 1 341 ? 44.666  -68.165 -33.793 1.00 48.80  ? 341 CYS A CA  1 
ATOM   2527  C C   . CYS A 1 341 ? 44.795  -67.289 -35.035 1.00 55.89  ? 341 CYS A C   1 
ATOM   2528  O O   . CYS A 1 341 ? 44.754  -67.785 -36.160 1.00 60.52  ? 341 CYS A O   1 
ATOM   2529  C CB  . CYS A 1 341 ? 46.044  -68.677 -33.373 1.00 49.58  ? 341 CYS A CB  1 
ATOM   2530  S SG  . CYS A 1 341 ? 46.078  -69.470 -31.755 1.00 78.33  ? 341 CYS A SG  1 
ATOM   2531  N N   . PHE A 1 342 ? 44.943  -65.983 -34.828 1.00 50.60  ? 342 PHE A N   1 
ATOM   2532  C CA  . PHE A 1 342 ? 45.191  -65.068 -35.937 1.00 51.16  ? 342 PHE A CA  1 
ATOM   2533  C C   . PHE A 1 342 ? 46.100  -63.925 -35.497 1.00 54.18  ? 342 PHE A C   1 
ATOM   2534  O O   . PHE A 1 342 ? 46.262  -63.674 -34.302 1.00 47.32  ? 342 PHE A O   1 
ATOM   2535  C CB  . PHE A 1 342 ? 43.875  -64.517 -36.499 1.00 45.65  ? 342 PHE A CB  1 
ATOM   2536  C CG  . PHE A 1 342 ? 43.160  -63.564 -35.576 1.00 45.71  ? 342 PHE A CG  1 
ATOM   2537  C CD1 . PHE A 1 342 ? 43.387  -62.198 -35.656 1.00 53.95  ? 342 PHE A CD1 1 
ATOM   2538  C CD2 . PHE A 1 342 ? 42.243  -64.032 -34.651 1.00 46.04  ? 342 PHE A CD2 1 
ATOM   2539  C CE1 . PHE A 1 342 ? 42.726  -61.320 -34.816 1.00 47.03  ? 342 PHE A CE1 1 
ATOM   2540  C CE2 . PHE A 1 342 ? 41.578  -63.158 -33.809 1.00 44.62  ? 342 PHE A CE2 1 
ATOM   2541  C CZ  . PHE A 1 342 ? 41.820  -61.800 -33.893 1.00 40.85  ? 342 PHE A CZ  1 
ATOM   2542  N N   . GLN A 1 343 ? 46.686  -63.233 -36.468 1.00 53.89  ? 343 GLN A N   1 
ATOM   2543  C CA  . GLN A 1 343 ? 47.611  -62.146 -36.170 1.00 49.54  ? 343 GLN A CA  1 
ATOM   2544  C C   . GLN A 1 343 ? 47.480  -60.997 -37.169 1.00 54.32  ? 343 GLN A C   1 
ATOM   2545  O O   . GLN A 1 343 ? 47.153  -61.204 -38.345 1.00 59.37  ? 343 GLN A O   1 
ATOM   2546  C CB  . GLN A 1 343 ? 49.052  -62.664 -36.149 1.00 49.29  ? 343 GLN A CB  1 
ATOM   2547  C CG  . GLN A 1 343 ? 50.032  -61.753 -35.423 1.00 60.57  ? 343 GLN A CG  1 
ATOM   2548  C CD  . GLN A 1 343 ? 51.477  -62.180 -35.602 1.00 54.30  ? 343 GLN A CD  1 
ATOM   2549  O OE1 . GLN A 1 343 ? 51.792  -63.008 -36.457 1.00 53.10  ? 343 GLN A OE1 1 
ATOM   2550  N NE2 . GLN A 1 343 ? 52.365  -61.612 -34.794 1.00 49.19  ? 343 GLN A NE2 1 
ATOM   2551  N N   . ILE A 1 344 ? 47.734  -59.787 -36.678 1.00 46.43  ? 344 ILE A N   1 
ATOM   2552  C CA  . ILE A 1 344 ? 47.672  -58.578 -37.488 1.00 40.24  ? 344 ILE A CA  1 
ATOM   2553  C C   . ILE A 1 344 ? 49.078  -58.068 -37.796 1.00 47.13  ? 344 ILE A C   1 
ATOM   2554  O O   . ILE A 1 344 ? 49.989  -58.201 -36.982 1.00 57.21  ? 344 ILE A O   1 
ATOM   2555  C CB  . ILE A 1 344 ? 46.866  -57.464 -36.774 1.00 37.20  ? 344 ILE A CB  1 
ATOM   2556  C CG1 . ILE A 1 344 ? 45.530  -58.007 -36.263 1.00 36.06  ? 344 ILE A CG1 1 
ATOM   2557  C CG2 . ILE A 1 344 ? 46.633  -56.275 -37.694 1.00 30.95  ? 344 ILE A CG2 1 
ATOM   2558  C CD1 . ILE A 1 344 ? 44.742  -57.003 -35.449 1.00 32.97  ? 344 ILE A CD1 1 
ATOM   2559  N N   . THR A 1 345 ? 49.242  -57.490 -38.981 1.00 53.76  ? 345 THR A N   1 
ATOM   2560  C CA  . THR A 1 345 ? 50.508  -56.912 -39.407 1.00 46.16  ? 345 THR A CA  1 
ATOM   2561  C C   . THR A 1 345 ? 50.253  -55.523 -39.979 1.00 43.58  ? 345 THR A C   1 
ATOM   2562  O O   . THR A 1 345 ? 49.551  -55.376 -40.978 1.00 43.64  ? 345 THR A O   1 
ATOM   2563  C CB  . THR A 1 345 ? 51.214  -57.785 -40.464 1.00 54.15  ? 345 THR A CB  1 
ATOM   2564  O OG1 . THR A 1 345 ? 51.323  -59.132 -39.986 1.00 51.13  ? 345 THR A OG1 1 
ATOM   2565  C CG2 . THR A 1 345 ? 52.605  -57.243 -40.761 1.00 49.14  ? 345 THR A CG2 1 
ATOM   2566  N N   . SER A 1 346 ? 50.815  -54.507 -39.334 1.00 46.70  ? 346 SER A N   1 
ATOM   2567  C CA  . SER A 1 346 ? 50.734  -53.141 -39.839 1.00 47.51  ? 346 SER A CA  1 
ATOM   2568  C C   . SER A 1 346 ? 51.449  -53.025 -41.179 1.00 54.23  ? 346 SER A C   1 
ATOM   2569  O O   . SER A 1 346 ? 52.305  -53.849 -41.504 1.00 67.32  ? 346 SER A O   1 
ATOM   2570  C CB  . SER A 1 346 ? 51.333  -52.159 -38.830 1.00 56.48  ? 346 SER A CB  1 
ATOM   2571  O OG  . SER A 1 346 ? 51.357  -50.840 -39.348 1.00 62.38  ? 346 SER A OG  1 
ATOM   2572  N N   . PHE A 1 347 ? 51.098  -52.008 -41.961 1.00 55.15  ? 347 PHE A N   1 
ATOM   2573  C CA  . PHE A 1 347 ? 51.797  -51.757 -43.217 1.00 57.24  ? 347 PHE A CA  1 
ATOM   2574  C C   . PHE A 1 347 ? 53.228  -51.329 -42.905 1.00 57.67  ? 347 PHE A C   1 
ATOM   2575  O O   . PHE A 1 347 ? 54.104  -51.365 -43.768 1.00 52.83  ? 347 PHE A O   1 
ATOM   2576  C CB  . PHE A 1 347 ? 51.079  -50.690 -44.047 1.00 38.46  ? 347 PHE A CB  1 
ATOM   2577  C CG  . PHE A 1 347 ? 51.389  -49.282 -43.628 1.00 55.84  ? 347 PHE A CG  1 
ATOM   2578  C CD1 . PHE A 1 347 ? 50.861  -48.755 -42.461 1.00 57.32  ? 347 PHE A CD1 1 
ATOM   2579  C CD2 . PHE A 1 347 ? 52.201  -48.478 -44.412 1.00 47.40  ? 347 PHE A CD2 1 
ATOM   2580  C CE1 . PHE A 1 347 ? 51.147  -47.457 -42.078 1.00 47.46  ? 347 PHE A CE1 1 
ATOM   2581  C CE2 . PHE A 1 347 ? 52.489  -47.181 -44.036 1.00 58.09  ? 347 PHE A CE2 1 
ATOM   2582  C CZ  . PHE A 1 347 ? 51.961  -46.669 -42.868 1.00 56.53  ? 347 PHE A CZ  1 
ATOM   2583  N N   . ASP A 1 348 ? 53.443  -50.923 -41.657 1.00 59.39  ? 348 ASP A N   1 
ATOM   2584  C CA  . ASP A 1 348 ? 54.771  -50.656 -41.120 1.00 48.17  ? 348 ASP A CA  1 
ATOM   2585  C C   . ASP A 1 348 ? 55.598  -51.933 -41.065 1.00 50.70  ? 348 ASP A C   1 
ATOM   2586  O O   . ASP A 1 348 ? 56.817  -51.907 -41.233 1.00 54.31  ? 348 ASP A O   1 
ATOM   2587  C CB  . ASP A 1 348 ? 54.673  -50.053 -39.717 1.00 59.04  ? 348 ASP A CB  1 
ATOM   2588  C CG  . ASP A 1 348 ? 54.153  -48.636 -39.726 1.00 66.69  ? 348 ASP A CG  1 
ATOM   2589  O OD1 . ASP A 1 348 ? 54.088  -48.031 -40.817 1.00 78.32  ? 348 ASP A OD1 1 
ATOM   2590  O OD2 . ASP A 1 348 ? 53.807  -48.124 -38.641 1.00 57.74  ? 348 ASP A OD2 1 
ATOM   2591  N N   . GLY A 1 349 ? 54.921  -53.050 -40.818 1.00 50.76  ? 349 GLY A N   1 
ATOM   2592  C CA  . GLY A 1 349 ? 55.586  -54.308 -40.535 1.00 54.62  ? 349 GLY A CA  1 
ATOM   2593  C C   . GLY A 1 349 ? 55.409  -54.684 -39.077 1.00 48.06  ? 349 GLY A C   1 
ATOM   2594  O O   . GLY A 1 349 ? 55.728  -55.801 -38.668 1.00 53.98  ? 349 GLY A O   1 
ATOM   2595  N N   . LYS A 1 350 ? 54.899  -53.741 -38.290 1.00 48.32  ? 350 LYS A N   1 
ATOM   2596  C CA  . LYS A 1 350 ? 54.602  -53.988 -36.885 1.00 46.53  ? 350 LYS A CA  1 
ATOM   2597  C C   . LYS A 1 350 ? 53.498  -55.030 -36.758 1.00 39.43  ? 350 LYS A C   1 
ATOM   2598  O O   . LYS A 1 350 ? 52.456  -54.921 -37.403 1.00 48.88  ? 350 LYS A O   1 
ATOM   2599  C CB  . LYS A 1 350 ? 54.194  -52.692 -36.180 1.00 56.77  ? 350 LYS A CB  1 
ATOM   2600  C CG  . LYS A 1 350 ? 53.724  -52.890 -34.747 1.00 45.80  ? 350 LYS A CG  1 
ATOM   2601  C CD  . LYS A 1 350 ? 53.477  -51.561 -34.050 1.00 60.23  ? 350 LYS A CD  1 
ATOM   2602  C CE  . LYS A 1 350 ? 52.949  -51.770 -32.638 1.00 80.05  ? 350 LYS A CE  1 
ATOM   2603  N NZ  . LYS A 1 350 ? 52.390  -50.518 -32.059 1.00 98.35  ? 350 LYS A NZ  1 
ATOM   2604  N N   . LYS A 1 351 ? 53.728  -56.039 -35.924 1.00 33.92  ? 351 LYS A N   1 
ATOM   2605  C CA  . LYS A 1 351 ? 52.766  -57.122 -35.760 1.00 41.21  ? 351 LYS A CA  1 
ATOM   2606  C C   . LYS A 1 351 ? 52.082  -57.082 -34.400 1.00 49.95  ? 351 LYS A C   1 
ATOM   2607  O O   . LYS A 1 351 ? 52.650  -56.606 -33.417 1.00 52.51  ? 351 LYS A O   1 
ATOM   2608  C CB  . LYS A 1 351 ? 53.447  -58.480 -35.946 1.00 39.39  ? 351 LYS A CB  1 
ATOM   2609  C CG  . LYS A 1 351 ? 54.138  -58.669 -37.285 1.00 47.11  ? 351 LYS A CG  1 
ATOM   2610  C CD  . LYS A 1 351 ? 54.341  -60.148 -37.577 1.00 53.76  ? 351 LYS A CD  1 
ATOM   2611  C CE  . LYS A 1 351 ? 55.018  -60.364 -38.919 1.00 63.81  ? 351 LYS A CE  1 
ATOM   2612  N NZ  . LYS A 1 351 ? 56.501  -60.361 -38.790 1.00 74.15  ? 351 LYS A NZ  1 
ATOM   2613  N N   . SER A 1 352 ? 50.853  -57.585 -34.353 1.00 51.88  ? 352 SER A N   1 
ATOM   2614  C CA  . SER A 1 352 ? 50.115  -57.674 -33.103 1.00 47.55  ? 352 SER A CA  1 
ATOM   2615  C C   . SER A 1 352 ? 50.511  -58.920 -32.331 1.00 51.71  ? 352 SER A C   1 
ATOM   2616  O O   . SER A 1 352 ? 51.301  -59.734 -32.809 1.00 52.37  ? 352 SER A O   1 
ATOM   2617  C CB  . SER A 1 352 ? 48.610  -57.697 -33.372 1.00 46.22  ? 352 SER A CB  1 
ATOM   2618  O OG  . SER A 1 352 ? 48.250  -58.827 -34.148 1.00 40.41  ? 352 SER A OG  1 
ATOM   2619  N N   . SER A 1 353 ? 49.958  -59.067 -31.134 1.00 44.51  ? 353 SER A N   1 
ATOM   2620  C CA  . SER A 1 353 ? 50.038  -60.329 -30.418 1.00 50.20  ? 353 SER A CA  1 
ATOM   2621  C C   . SER A 1 353 ? 49.237  -61.370 -31.184 1.00 56.86  ? 353 SER A C   1 
ATOM   2622  O O   . SER A 1 353 ? 48.276  -61.029 -31.873 1.00 62.18  ? 353 SER A O   1 
ATOM   2623  C CB  . SER A 1 353 ? 49.514  -60.182 -28.990 1.00 40.03  ? 353 SER A CB  1 
ATOM   2624  O OG  . SER A 1 353 ? 50.326  -59.295 -28.242 1.00 60.56  ? 353 SER A OG  1 
ATOM   2625  N N   . ILE A 1 354 ? 49.626  -62.635 -31.081 1.00 51.77  ? 354 ILE A N   1 
ATOM   2626  C CA  . ILE A 1 354 ? 48.802  -63.686 -31.658 1.00 53.67  ? 354 ILE A CA  1 
ATOM   2627  C C   . ILE A 1 354 ? 47.540  -63.851 -30.823 1.00 59.77  ? 354 ILE A C   1 
ATOM   2628  O O   . ILE A 1 354 ? 47.598  -64.029 -29.606 1.00 60.25  ? 354 ILE A O   1 
ATOM   2629  C CB  . ILE A 1 354 ? 49.557  -65.016 -31.776 1.00 51.60  ? 354 ILE A CB  1 
ATOM   2630  C CG1 . ILE A 1 354 ? 50.589  -64.907 -32.898 1.00 53.04  ? 354 ILE A CG1 1 
ATOM   2631  C CG2 . ILE A 1 354 ? 48.599  -66.137 -32.122 1.00 67.88  ? 354 ILE A CG2 1 
ATOM   2632  C CD1 . ILE A 1 354 ? 51.885  -65.606 -32.626 1.00 70.73  ? 354 ILE A CD1 1 
ATOM   2633  N N   . LEU A 1 355 ? 46.399  -63.781 -31.499 1.00 61.70  ? 355 LEU A N   1 
ATOM   2634  C CA  . LEU A 1 355 ? 45.109  -63.729 -30.832 1.00 39.11  ? 355 LEU A CA  1 
ATOM   2635  C C   . LEU A 1 355 ? 44.297  -64.982 -31.117 1.00 45.47  ? 355 LEU A C   1 
ATOM   2636  O O   . LEU A 1 355 ? 44.214  -65.430 -32.259 1.00 62.86  ? 355 LEU A O   1 
ATOM   2637  C CB  . LEU A 1 355 ? 44.339  -62.486 -31.281 1.00 42.21  ? 355 LEU A CB  1 
ATOM   2638  C CG  . LEU A 1 355 ? 45.052  -61.150 -31.062 1.00 37.63  ? 355 LEU A CG  1 
ATOM   2639  C CD1 . LEU A 1 355 ? 44.285  -60.012 -31.713 1.00 33.65  ? 355 LEU A CD1 1 
ATOM   2640  C CD2 . LEU A 1 355 ? 45.250  -60.883 -29.582 1.00 46.80  ? 355 LEU A CD2 1 
ATOM   2641  N N   . GLN A 1 356 ? 43.696  -65.541 -30.073 1.00 45.13  ? 356 GLN A N   1 
ATOM   2642  C CA  . GLN A 1 356 ? 42.959  -66.791 -30.193 1.00 49.97  ? 356 GLN A CA  1 
ATOM   2643  C C   . GLN A 1 356 ? 41.470  -66.601 -29.940 1.00 52.24  ? 356 GLN A C   1 
ATOM   2644  O O   . GLN A 1 356 ? 41.075  -66.086 -28.894 1.00 52.42  ? 356 GLN A O   1 
ATOM   2645  C CB  . GLN A 1 356 ? 43.513  -67.833 -29.221 1.00 50.86  ? 356 GLN A CB  1 
ATOM   2646  C CG  . GLN A 1 356 ? 42.875  -69.199 -29.371 1.00 45.27  ? 356 GLN A CG  1 
ATOM   2647  C CD  . GLN A 1 356 ? 43.014  -70.056 -28.131 1.00 47.00  ? 356 GLN A CD  1 
ATOM   2648  O OE1 . GLN A 1 356 ? 43.963  -69.907 -27.364 1.00 58.94  ? 356 GLN A OE1 1 
ATOM   2649  N NE2 . GLN A 1 356 ? 42.066  -70.963 -27.930 1.00 75.33  ? 356 GLN A NE2 1 
ATOM   2650  N N   . ALA A 1 357 ? 40.643  -67.015 -30.895 1.00 50.41  ? 357 ALA A N   1 
ATOM   2651  C CA  . ALA A 1 357 ? 39.204  -66.977 -30.679 1.00 41.45  ? 357 ALA A CA  1 
ATOM   2652  C C   . ALA A 1 357 ? 38.725  -68.304 -30.106 1.00 57.99  ? 357 ALA A C   1 
ATOM   2653  O O   . ALA A 1 357 ? 39.487  -69.268 -30.023 1.00 53.28  ? 357 ALA A O   1 
ATOM   2654  C CB  . ALA A 1 357 ? 38.476  -66.660 -31.975 1.00 50.02  ? 357 ALA A CB  1 
ATOM   2655  N N   . GLU A 1 358 ? 37.456  -68.350 -29.720 1.00 64.55  ? 358 GLU A N   1 
ATOM   2656  C CA  . GLU A 1 358 ? 36.893  -69.545 -29.107 1.00 59.24  ? 358 GLU A CA  1 
ATOM   2657  C C   . GLU A 1 358 ? 36.162  -70.420 -30.122 1.00 66.69  ? 358 GLU A C   1 
ATOM   2658  O O   . GLU A 1 358 ? 35.817  -71.567 -29.836 1.00 67.13  ? 358 GLU A O   1 
ATOM   2659  C CB  . GLU A 1 358 ? 35.955  -69.149 -27.966 1.00 66.01  ? 358 GLU A CB  1 
ATOM   2660  C CG  . GLU A 1 358 ? 35.622  -70.277 -27.009 1.00 76.93  ? 358 GLU A CG  1 
ATOM   2661  C CD  . GLU A 1 358 ? 34.471  -69.929 -26.095 1.00 93.21  ? 358 GLU A CD  1 
ATOM   2662  O OE1 . GLU A 1 358 ? 33.425  -69.473 -26.604 1.00 94.07  ? 358 GLU A OE1 1 
ATOM   2663  O OE2 . GLU A 1 358 ? 34.612  -70.103 -24.865 1.00 80.97  ? 358 GLU A OE2 1 
ATOM   2664  N N   . SER A 1 359 ? 35.947  -69.883 -31.317 1.00 61.68  ? 359 SER A N   1 
ATOM   2665  C CA  . SER A 1 359 ? 35.131  -70.561 -32.316 1.00 54.92  ? 359 SER A CA  1 
ATOM   2666  C C   . SER A 1 359 ? 35.572  -70.207 -33.732 1.00 59.42  ? 359 SER A C   1 
ATOM   2667  O O   . SER A 1 359 ? 36.262  -69.213 -33.948 1.00 56.40  ? 359 SER A O   1 
ATOM   2668  C CB  . SER A 1 359 ? 33.651  -70.217 -32.116 1.00 53.75  ? 359 SER A CB  1 
ATOM   2669  O OG  . SER A 1 359 ? 33.326  -68.964 -32.695 1.00 49.51  ? 359 SER A OG  1 
ATOM   2670  N N   . LYS A 1 360 ? 35.167  -71.033 -34.691 1.00 62.33  ? 360 LYS A N   1 
ATOM   2671  C CA  . LYS A 1 360 ? 35.488  -70.826 -36.096 1.00 64.29  ? 360 LYS A CA  1 
ATOM   2672  C C   . LYS A 1 360 ? 34.802  -69.553 -36.594 1.00 56.60  ? 360 LYS A C   1 
ATOM   2673  O O   . LYS A 1 360 ? 35.373  -68.757 -37.355 1.00 63.06  ? 360 LYS A O   1 
ATOM   2674  C CB  . LYS A 1 360 ? 35.026  -72.049 -36.894 1.00 67.76  ? 360 LYS A CB  1 
ATOM   2675  C CG  . LYS A 1 360 ? 34.957  -71.913 -38.400 1.00 68.12  ? 360 LYS A CG  1 
ATOM   2676  C CD  . LYS A 1 360 ? 34.507  -73.249 -38.982 1.00 74.99  ? 360 LYS A CD  1 
ATOM   2677  C CE  . LYS A 1 360 ? 35.182  -73.578 -40.298 1.00 95.95  ? 360 LYS A CE  1 
ATOM   2678  N NZ  . LYS A 1 360 ? 35.644  -74.997 -40.313 1.00 111.29 ? 360 LYS A NZ  1 
ATOM   2679  N N   . LYS A 1 361 ? 33.582  -69.353 -36.103 1.00 47.55  ? 361 LYS A N   1 
ATOM   2680  C CA  . LYS A 1 361 ? 32.785  -68.174 -36.420 1.00 49.07  ? 361 LYS A CA  1 
ATOM   2681  C C   . LYS A 1 361 ? 33.482  -66.891 -35.992 1.00 50.35  ? 361 LYS A C   1 
ATOM   2682  O O   . LYS A 1 361 ? 33.600  -65.959 -36.778 1.00 48.91  ? 361 LYS A O   1 
ATOM   2683  C CB  . LYS A 1 361 ? 31.409  -68.269 -35.759 1.00 54.98  ? 361 LYS A CB  1 
ATOM   2684  C CG  . LYS A 1 361 ? 30.607  -66.981 -35.789 1.00 58.29  ? 361 LYS A CG  1 
ATOM   2685  C CD  . LYS A 1 361 ? 29.205  -67.206 -35.245 1.00 69.64  ? 361 LYS A CD  1 
ATOM   2686  C CE  . LYS A 1 361 ? 28.478  -65.893 -35.009 1.00 78.86  ? 361 LYS A CE  1 
ATOM   2687  N NZ  . LYS A 1 361 ? 28.409  -65.062 -36.240 1.00 76.82  ? 361 LYS A NZ  1 
ATOM   2688  N N   . ASP A 1 362 ? 33.952  -66.849 -34.750 1.00 54.96  ? 362 ASP A N   1 
ATOM   2689  C CA  . ASP A 1 362 ? 34.641  -65.666 -34.242 1.00 51.78  ? 362 ASP A CA  1 
ATOM   2690  C C   . ASP A 1 362 ? 36.003  -65.477 -34.898 1.00 56.17  ? 362 ASP A C   1 
ATOM   2691  O O   . ASP A 1 362 ? 36.465  -64.354 -35.060 1.00 58.34  ? 362 ASP A O   1 
ATOM   2692  C CB  . ASP A 1 362 ? 34.799  -65.744 -32.723 1.00 52.17  ? 362 ASP A CB  1 
ATOM   2693  C CG  . ASP A 1 362 ? 33.559  -65.280 -31.986 1.00 64.02  ? 362 ASP A CG  1 
ATOM   2694  O OD1 . ASP A 1 362 ? 32.667  -64.697 -32.639 1.00 61.11  ? 362 ASP A OD1 1 
ATOM   2695  O OD2 . ASP A 1 362 ? 33.475  -65.496 -30.758 1.00 73.13  ? 362 ASP A OD2 1 
ATOM   2696  N N   . HIS A 1 363 ? 36.650  -66.580 -35.256 1.00 53.78  ? 363 HIS A N   1 
ATOM   2697  C CA  . HIS A 1 363 ? 37.924  -66.524 -35.963 1.00 49.05  ? 363 HIS A CA  1 
ATOM   2698  C C   . HIS A 1 363 ? 37.759  -65.781 -37.288 1.00 53.27  ? 363 HIS A C   1 
ATOM   2699  O O   . HIS A 1 363 ? 38.387  -64.727 -37.531 1.00 52.60  ? 363 HIS A O   1 
ATOM   2700  C CB  . HIS A 1 363 ? 38.463  -67.937 -36.198 1.00 41.35  ? 363 HIS A CB  1 
ATOM   2701  C CG  . HIS A 1 363 ? 39.844  -67.974 -36.773 1.00 43.72  ? 363 HIS A CG  1 
ATOM   2702  N ND1 . HIS A 1 363 ? 40.117  -68.478 -38.026 1.00 49.82  ? 363 HIS A ND1 1 
ATOM   2703  C CD2 . HIS A 1 363 ? 41.033  -67.570 -36.264 1.00 48.79  ? 363 HIS A CD2 1 
ATOM   2704  C CE1 . HIS A 1 363 ? 41.412  -68.383 -38.265 1.00 52.56  ? 363 HIS A CE1 1 
ATOM   2705  N NE2 . HIS A 1 363 ? 41.991  -67.835 -37.211 1.00 49.35  ? 363 HIS A NE2 1 
ATOM   2706  N N   . GLU A 1 364 ? 36.869  -66.308 -38.127 1.00 51.71  ? 364 GLU A N   1 
ATOM   2707  C CA  . GLU A 1 364 ? 36.701  -65.746 -39.458 1.00 55.86  ? 364 GLU A CA  1 
ATOM   2708  C C   . GLU A 1 364 ? 36.015  -64.391 -39.416 1.00 50.56  ? 364 GLU A C   1 
ATOM   2709  O O   . GLU A 1 364 ? 36.267  -63.549 -40.271 1.00 59.40  ? 364 GLU A O   1 
ATOM   2710  C CB  . GLU A 1 364 ? 35.895  -66.688 -40.355 1.00 70.88  ? 364 GLU A CB  1 
ATOM   2711  C CG  . GLU A 1 364 ? 36.513  -68.052 -40.585 1.00 75.96  ? 364 GLU A CG  1 
ATOM   2712  C CD  . GLU A 1 364 ? 35.668  -68.911 -41.503 1.00 87.00  ? 364 GLU A CD  1 
ATOM   2713  O OE1 . GLU A 1 364 ? 34.540  -68.488 -41.832 1.00 88.42  ? 364 GLU A OE1 1 
ATOM   2714  O OE2 . GLU A 1 364 ? 36.128  -70.004 -41.895 1.00 95.01  ? 364 GLU A OE2 1 
ATOM   2715  N N   . GLU A 1 365 ? 35.172  -64.168 -38.412 1.00 56.00  ? 365 GLU A N   1 
ATOM   2716  C CA  . GLU A 1 365 ? 34.557  -62.856 -38.225 1.00 43.57  ? 365 GLU A CA  1 
ATOM   2717  C C   . GLU A 1 365 ? 35.555  -61.794 -37.780 1.00 50.54  ? 365 GLU A C   1 
ATOM   2718  O O   . GLU A 1 365 ? 35.443  -60.644 -38.183 1.00 45.14  ? 365 GLU A O   1 
ATOM   2719  C CB  . GLU A 1 365 ? 33.402  -62.929 -37.227 1.00 51.31  ? 365 GLU A CB  1 
ATOM   2720  C CG  . GLU A 1 365 ? 32.078  -63.302 -37.870 1.00 51.03  ? 365 GLU A CG  1 
ATOM   2721  C CD  . GLU A 1 365 ? 30.904  -63.151 -36.926 1.00 68.30  ? 365 GLU A CD  1 
ATOM   2722  O OE1 . GLU A 1 365 ? 31.130  -63.086 -35.700 1.00 70.77  ? 365 GLU A OE1 1 
ATOM   2723  O OE2 . GLU A 1 365 ? 29.755  -63.091 -37.413 1.00 68.82  ? 365 GLU A OE2 1 
ATOM   2724  N N   . TRP A 1 366 ? 36.509  -62.166 -36.932 1.00 47.49  ? 366 TRP A N   1 
ATOM   2725  C CA  . TRP A 1 366 ? 37.552  -61.230 -36.523 1.00 46.92  ? 366 TRP A CA  1 
ATOM   2726  C C   . TRP A 1 366 ? 38.423  -60.862 -37.716 1.00 47.96  ? 366 TRP A C   1 
ATOM   2727  O O   . TRP A 1 366 ? 38.643  -59.674 -37.997 1.00 42.02  ? 366 TRP A O   1 
ATOM   2728  C CB  . TRP A 1 366 ? 38.415  -61.809 -35.398 1.00 48.22  ? 366 TRP A CB  1 
ATOM   2729  C CG  . TRP A 1 366 ? 37.912  -61.486 -34.021 1.00 48.17  ? 366 TRP A CG  1 
ATOM   2730  C CD1 . TRP A 1 366 ? 37.458  -62.369 -33.085 1.00 39.34  ? 366 TRP A CD1 1 
ATOM   2731  C CD2 . TRP A 1 366 ? 37.810  -60.186 -33.427 1.00 36.77  ? 366 TRP A CD2 1 
ATOM   2732  N NE1 . TRP A 1 366 ? 37.080  -61.701 -31.947 1.00 39.22  ? 366 TRP A NE1 1 
ATOM   2733  C CE2 . TRP A 1 366 ? 37.286  -60.357 -32.131 1.00 43.28  ? 366 TRP A CE2 1 
ATOM   2734  C CE3 . TRP A 1 366 ? 38.108  -58.891 -33.867 1.00 29.45  ? 366 TRP A CE3 1 
ATOM   2735  C CZ2 . TRP A 1 366 ? 37.055  -59.288 -31.268 1.00 40.84  ? 366 TRP A CZ2 1 
ATOM   2736  C CZ3 . TRP A 1 366 ? 37.880  -57.830 -33.010 1.00 37.51  ? 366 TRP A CZ3 1 
ATOM   2737  C CH2 . TRP A 1 366 ? 37.359  -58.034 -31.725 1.00 48.09  ? 366 TRP A CH2 1 
ATOM   2738  N N   . ILE A 1 367 ? 38.909  -61.884 -38.420 1.00 40.29  ? 367 ILE A N   1 
ATOM   2739  C CA  . ILE A 1 367 ? 39.738  -61.646 -39.601 1.00 47.95  ? 367 ILE A CA  1 
ATOM   2740  C C   . ILE A 1 367 ? 39.007  -60.758 -40.612 1.00 48.44  ? 367 ILE A C   1 
ATOM   2741  O O   . ILE A 1 367 ? 39.532  -59.729 -41.067 1.00 45.30  ? 367 ILE A O   1 
ATOM   2742  C CB  . ILE A 1 367 ? 40.145  -62.968 -40.276 1.00 48.36  ? 367 ILE A CB  1 
ATOM   2743  C CG1 . ILE A 1 367 ? 41.042  -63.784 -39.343 1.00 44.66  ? 367 ILE A CG1 1 
ATOM   2744  C CG2 . ILE A 1 367 ? 40.853  -62.700 -41.593 1.00 37.82  ? 367 ILE A CG2 1 
ATOM   2745  C CD1 . ILE A 1 367 ? 41.348  -65.175 -39.848 1.00 52.47  ? 367 ILE A CD1 1 
ATOM   2746  N N   . CYS A 1 368 ? 37.780  -61.156 -40.933 1.00 48.89  ? 368 CYS A N   1 
ATOM   2747  C CA  . CYS A 1 368 ? 36.965  -60.466 -41.924 1.00 48.84  ? 368 CYS A CA  1 
ATOM   2748  C C   . CYS A 1 368 ? 36.641  -59.033 -41.512 1.00 46.70  ? 368 CYS A C   1 
ATOM   2749  O O   . CYS A 1 368 ? 36.654  -58.129 -42.343 1.00 46.84  ? 368 CYS A O   1 
ATOM   2750  C CB  . CYS A 1 368 ? 35.670  -61.240 -42.170 1.00 44.29  ? 368 CYS A CB  1 
ATOM   2751  S SG  . CYS A 1 368 ? 34.653  -60.588 -43.496 1.00 64.56  ? 368 CYS A SG  1 
ATOM   2752  N N   . THR A 1 369 ? 36.334  -58.837 -40.233 1.00 39.11  ? 369 THR A N   1 
ATOM   2753  C CA  . THR A 1 369 ? 35.997  -57.515 -39.711 1.00 36.71  ? 369 THR A CA  1 
ATOM   2754  C C   . THR A 1 369 ? 37.191  -56.576 -39.786 1.00 38.84  ? 369 THR A C   1 
ATOM   2755  O O   . THR A 1 369 ? 37.058  -55.421 -40.199 1.00 38.48  ? 369 THR A O   1 
ATOM   2756  C CB  . THR A 1 369 ? 35.510  -57.583 -38.251 1.00 27.80  ? 369 THR A CB  1 
ATOM   2757  O OG1 . THR A 1 369 ? 34.349  -58.419 -38.170 1.00 43.97  ? 369 THR A OG1 1 
ATOM   2758  C CG2 . THR A 1 369 ? 35.173  -56.195 -37.729 1.00 36.79  ? 369 THR A CG2 1 
ATOM   2759  N N   . ILE A 1 370 ? 38.358  -57.073 -39.385 1.00 37.78  ? 370 ILE A N   1 
ATOM   2760  C CA  . ILE A 1 370 ? 39.569  -56.265 -39.452 1.00 36.63  ? 370 ILE A CA  1 
ATOM   2761  C C   . ILE A 1 370 ? 39.863  -55.903 -40.907 1.00 37.19  ? 370 ILE A C   1 
ATOM   2762  O O   . ILE A 1 370 ? 40.237  -54.765 -41.214 1.00 43.77  ? 370 ILE A O   1 
ATOM   2763  C CB  . ILE A 1 370 ? 40.773  -56.995 -38.827 1.00 47.49  ? 370 ILE A CB  1 
ATOM   2764  C CG1 . ILE A 1 370 ? 40.568  -57.151 -37.319 1.00 34.75  ? 370 ILE A CG1 1 
ATOM   2765  C CG2 . ILE A 1 370 ? 42.068  -56.245 -39.109 1.00 40.82  ? 370 ILE A CG2 1 
ATOM   2766  C CD1 . ILE A 1 370 ? 41.480  -58.171 -36.681 1.00 42.60  ? 370 ILE A CD1 1 
ATOM   2767  N N   . ASN A 1 371 ? 39.663  -56.864 -41.806 1.00 46.20  ? 371 ASN A N   1 
ATOM   2768  C CA  . ASN A 1 371 ? 39.785  -56.586 -43.235 1.00 46.53  ? 371 ASN A CA  1 
ATOM   2769  C C   . ASN A 1 371 ? 38.805  -55.518 -43.731 1.00 45.42  ? 371 ASN A C   1 
ATOM   2770  O O   . ASN A 1 371 ? 39.165  -54.676 -44.555 1.00 55.45  ? 371 ASN A O   1 
ATOM   2771  C CB  . ASN A 1 371 ? 39.600  -57.872 -44.042 1.00 47.17  ? 371 ASN A CB  1 
ATOM   2772  C CG  . ASN A 1 371 ? 40.828  -58.759 -44.010 1.00 46.56  ? 371 ASN A CG  1 
ATOM   2773  O OD1 . ASN A 1 371 ? 41.950  -58.289 -44.194 1.00 56.68  ? 371 ASN A OD1 1 
ATOM   2774  N ND2 . ASN A 1 371 ? 40.621  -60.049 -43.776 1.00 47.09  ? 371 ASN A ND2 1 
ATOM   2775  N N   . ASN A 1 372 ? 37.574  -55.552 -43.230 1.00 43.70  ? 372 ASN A N   1 
ATOM   2776  C CA  . ASN A 1 372 ? 36.568  -54.555 -43.590 1.00 42.91  ? 372 ASN A CA  1 
ATOM   2777  C C   . ASN A 1 372 ? 36.925  -53.160 -43.095 1.00 38.02  ? 372 ASN A C   1 
ATOM   2778  O O   . ASN A 1 372 ? 36.667  -52.165 -43.773 1.00 44.29  ? 372 ASN A O   1 
ATOM   2779  C CB  . ASN A 1 372 ? 35.195  -54.953 -43.046 1.00 32.72  ? 372 ASN A CB  1 
ATOM   2780  C CG  . ASN A 1 372 ? 34.635  -56.187 -43.722 1.00 53.52  ? 372 ASN A CG  1 
ATOM   2781  O OD1 . ASN A 1 372 ? 35.178  -56.660 -44.720 1.00 50.98  ? 372 ASN A OD1 1 
ATOM   2782  N ND2 . ASN A 1 372 ? 33.539  -56.711 -43.185 1.00 42.47  ? 372 ASN A ND2 1 
ATOM   2783  N N   . ILE A 1 373 ? 37.509  -53.093 -41.903 1.00 46.25  ? 373 ILE A N   1 
ATOM   2784  C CA  . ILE A 1 373 ? 37.885  -51.814 -41.314 1.00 43.18  ? 373 ILE A CA  1 
ATOM   2785  C C   . ILE A 1 373 ? 39.116  -51.218 -42.002 1.00 48.64  ? 373 ILE A C   1 
ATOM   2786  O O   . ILE A 1 373 ? 39.165  -50.013 -42.254 1.00 49.20  ? 373 ILE A O   1 
ATOM   2787  C CB  . ILE A 1 373 ? 38.140  -51.949 -39.797 1.00 36.69  ? 373 ILE A CB  1 
ATOM   2788  C CG1 . ILE A 1 373 ? 36.842  -52.331 -39.082 1.00 41.94  ? 373 ILE A CG1 1 
ATOM   2789  C CG2 . ILE A 1 373 ? 38.685  -50.651 -39.221 1.00 32.44  ? 373 ILE A CG2 1 
ATOM   2790  C CD1 . ILE A 1 373 ? 36.977  -52.463 -37.582 1.00 41.68  ? 373 ILE A CD1 1 
ATOM   2791  N N   . SER A 1 374 ? 40.099  -52.055 -42.325 1.00 40.67  ? 374 SER A N   1 
ATOM   2792  C CA  . SER A 1 374 ? 41.317  -51.560 -42.969 1.00 39.86  ? 374 SER A CA  1 
ATOM   2793  C C   . SER A 1 374 ? 41.110  -51.300 -44.460 1.00 47.67  ? 374 SER A C   1 
ATOM   2794  O O   . SER A 1 374 ? 40.043  -51.575 -45.006 1.00 53.50  ? 374 SER A O   1 
ATOM   2795  C CB  . SER A 1 374 ? 42.469  -52.548 -42.775 1.00 49.29  ? 374 SER A CB  1 
ATOM   2796  O OG  . SER A 1 374 ? 43.595  -52.172 -43.551 1.00 47.04  ? 374 SER A OG  1 
ATOM   2797  N N   . LYS A 1 375 ? 42.143  -50.772 -45.112 1.00 53.91  ? 375 LYS A N   1 
ATOM   2798  C CA  . LYS A 1 375 ? 42.091  -50.475 -46.541 1.00 52.29  ? 375 LYS A CA  1 
ATOM   2799  C C   . LYS A 1 375 ? 41.902  -51.740 -47.373 1.00 53.23  ? 375 LYS A C   1 
ATOM   2800  O O   . LYS A 1 375 ? 41.714  -51.674 -48.589 1.00 50.31  ? 375 LYS A O   1 
ATOM   2801  C CB  . LYS A 1 375 ? 43.362  -49.747 -46.983 1.00 46.35  ? 375 LYS A CB  1 
ATOM   2802  C CG  . LYS A 1 375 ? 43.632  -48.455 -46.229 1.00 69.52  ? 375 LYS A CG  1 
ATOM   2803  C CD  . LYS A 1 375 ? 44.816  -47.705 -46.820 1.00 71.58  ? 375 LYS A CD  1 
ATOM   2804  C CE  . LYS A 1 375 ? 45.227  -46.535 -45.938 1.00 84.23  ? 375 LYS A CE  1 
ATOM   2805  N NZ  . LYS A 1 375 ? 44.080  -45.990 -45.158 1.00 67.20  ? 375 LYS A NZ  1 
ATOM   2806  N N   . ASP B 2 5   ? 22.198  -45.807 -12.349 1.00 115.94 ? 5   ASP B N   1 
ATOM   2807  C CA  . ASP B 2 5   ? 21.681  -46.638 -13.429 1.00 108.50 ? 5   ASP B CA  1 
ATOM   2808  C C   . ASP B 2 5   ? 21.171  -47.977 -12.906 1.00 109.78 ? 5   ASP B C   1 
ATOM   2809  O O   . ASP B 2 5   ? 20.983  -48.156 -11.703 1.00 98.07  ? 5   ASP B O   1 
ATOM   2810  C CB  . ASP B 2 5   ? 22.761  -46.868 -14.489 1.00 72.44  ? 5   ASP B CB  1 
ATOM   2811  N N   . LYS B 2 6   ? 20.942  -48.910 -13.823 1.00 95.23  ? 6   LYS B N   1 
ATOM   2812  C CA  . LYS B 2 6   ? 20.525  -50.261 -13.469 1.00 72.69  ? 6   LYS B CA  1 
ATOM   2813  C C   . LYS B 2 6   ? 21.440  -51.274 -14.145 1.00 70.99  ? 6   LYS B C   1 
ATOM   2814  O O   . LYS B 2 6   ? 22.090  -50.960 -15.142 1.00 71.82  ? 6   LYS B O   1 
ATOM   2815  C CB  . LYS B 2 6   ? 19.069  -50.508 -13.871 1.00 50.83  ? 6   LYS B CB  1 
ATOM   2816  C CG  . LYS B 2 6   ? 18.061  -49.642 -13.132 1.00 48.16  ? 6   LYS B CG  1 
ATOM   2817  N N   . LEU B 2 7   ? 21.490  -52.487 -13.606 1.00 53.52  ? 7   LEU B N   1 
ATOM   2818  C CA  . LEU B 2 7   ? 22.219  -53.560 -14.265 1.00 62.55  ? 7   LEU B CA  1 
ATOM   2819  C C   . LEU B 2 7   ? 21.386  -54.110 -15.415 1.00 77.74  ? 7   LEU B C   1 
ATOM   2820  O O   . LEU B 2 7   ? 20.201  -54.398 -15.250 1.00 76.54  ? 7   LEU B O   1 
ATOM   2821  C CB  . LEU B 2 7   ? 22.564  -54.677 -13.278 1.00 61.19  ? 7   LEU B CB  1 
ATOM   2822  C CG  . LEU B 2 7   ? 23.580  -54.362 -12.179 1.00 57.45  ? 7   LEU B CG  1 
ATOM   2823  C CD1 . LEU B 2 7   ? 23.587  -55.467 -11.138 1.00 51.00  ? 7   LEU B CD1 1 
ATOM   2824  C CD2 . LEU B 2 7   ? 24.969  -54.172 -12.767 1.00 62.17  ? 7   LEU B CD2 1 
ATOM   2825  N N   . LEU B 2 8   ? 22.009  -54.258 -16.579 1.00 64.93  ? 8   LEU B N   1 
ATOM   2826  C CA  . LEU B 2 8   ? 21.307  -54.779 -17.744 1.00 64.28  ? 8   LEU B CA  1 
ATOM   2827  C C   . LEU B 2 8   ? 21.454  -56.291 -17.816 1.00 62.77  ? 8   LEU B C   1 
ATOM   2828  O O   . LEU B 2 8   ? 22.556  -56.812 -17.982 1.00 70.26  ? 8   LEU B O   1 
ATOM   2829  C CB  . LEU B 2 8   ? 21.829  -54.124 -19.024 1.00 65.71  ? 8   LEU B CB  1 
ATOM   2830  C CG  . LEU B 2 8   ? 21.554  -52.623 -19.125 1.00 58.57  ? 8   LEU B CG  1 
ATOM   2831  C CD1 . LEU B 2 8   ? 22.141  -52.042 -20.401 1.00 46.55  ? 8   LEU B CD1 1 
ATOM   2832  C CD2 . LEU B 2 8   ? 20.058  -52.360 -19.046 1.00 56.15  ? 8   LEU B CD2 1 
ATOM   2833  N N   . LEU B 2 9   ? 20.333  -56.991 -17.683 1.00 60.91  ? 9   LEU B N   1 
ATOM   2834  C CA  . LEU B 2 9   ? 20.332  -58.448 -17.713 1.00 62.68  ? 9   LEU B CA  1 
ATOM   2835  C C   . LEU B 2 9   ? 20.738  -59.021 -19.070 1.00 73.67  ? 9   LEU B C   1 
ATOM   2836  O O   . LEU B 2 9   ? 21.336  -60.091 -19.138 1.00 64.42  ? 9   LEU B O   1 
ATOM   2837  C CB  . LEU B 2 9   ? 18.950  -58.978 -17.324 1.00 61.08  ? 9   LEU B CB  1 
ATOM   2838  C CG  . LEU B 2 9   ? 18.424  -58.637 -15.928 1.00 58.06  ? 9   LEU B CG  1 
ATOM   2839  C CD1 . LEU B 2 9   ? 16.962  -59.023 -15.805 1.00 66.37  ? 9   LEU B CD1 1 
ATOM   2840  C CD2 . LEU B 2 9   ? 19.244  -59.349 -14.869 1.00 68.41  ? 9   LEU B CD2 1 
ATOM   2841  N N   . GLU B 2 10  ? 20.402  -58.316 -20.147 1.00 74.69  ? 10  GLU B N   1 
ATOM   2842  C CA  . GLU B 2 10  ? 20.695  -58.802 -21.495 1.00 76.93  ? 10  GLU B CA  1 
ATOM   2843  C C   . GLU B 2 10  ? 22.186  -58.704 -21.832 1.00 74.88  ? 10  GLU B C   1 
ATOM   2844  O O   . GLU B 2 10  ? 22.658  -59.327 -22.788 1.00 76.18  ? 10  GLU B O   1 
ATOM   2845  C CB  . GLU B 2 10  ? 19.861  -58.048 -22.535 1.00 81.74  ? 10  GLU B CB  1 
ATOM   2846  C CG  . GLU B 2 10  ? 19.973  -56.540 -22.498 1.00 89.80  ? 10  GLU B CG  1 
ATOM   2847  C CD  . GLU B 2 10  ? 19.788  -55.924 -23.874 1.00 121.99 ? 10  GLU B CD  1 
ATOM   2848  O OE1 . GLU B 2 10  ? 19.271  -56.622 -24.772 1.00 123.30 ? 10  GLU B OE1 1 
ATOM   2849  O OE2 . GLU B 2 10  ? 20.146  -54.741 -24.058 1.00 118.60 ? 10  GLU B OE2 1 
ATOM   2850  N N   . GLU B 2 11  ? 22.914  -57.903 -21.059 1.00 68.54  ? 11  GLU B N   1 
ATOM   2851  C CA  . GLU B 2 11  ? 24.356  -57.768 -21.233 1.00 74.17  ? 11  GLU B CA  1 
ATOM   2852  C C   . GLU B 2 11  ? 25.130  -58.704 -20.318 1.00 60.33  ? 11  GLU B C   1 
ATOM   2853  O O   . GLU B 2 11  ? 26.361  -58.707 -20.322 1.00 57.30  ? 11  GLU B O   1 
ATOM   2854  C CB  . GLU B 2 11  ? 24.795  -56.327 -20.989 1.00 68.63  ? 11  GLU B CB  1 
ATOM   2855  C CG  . GLU B 2 11  ? 24.693  -55.432 -22.209 1.00 84.13  ? 11  GLU B CG  1 
ATOM   2856  C CD  . GLU B 2 11  ? 25.234  -56.107 -23.457 1.00 109.49 ? 11  GLU B CD  1 
ATOM   2857  O OE1 . GLU B 2 11  ? 26.375  -56.610 -23.408 1.00 121.46 ? 11  GLU B OE1 1 
ATOM   2858  O OE2 . GLU B 2 11  ? 24.534  -56.117 -24.490 1.00 107.29 ? 11  GLU B OE2 1 
ATOM   2859  N N   . ALA B 2 12  ? 24.402  -59.497 -19.539 1.00 68.83  ? 12  ALA B N   1 
ATOM   2860  C CA  . ALA B 2 12  ? 25.013  -60.399 -18.571 1.00 65.25  ? 12  ALA B CA  1 
ATOM   2861  C C   . ALA B 2 12  ? 25.820  -61.492 -19.265 1.00 59.71  ? 12  ALA B C   1 
ATOM   2862  O O   . ALA B 2 12  ? 26.952  -61.779 -18.878 1.00 65.32  ? 12  ALA B O   1 
ATOM   2863  C CB  . ALA B 2 12  ? 23.951  -61.014 -17.674 1.00 50.88  ? 12  ALA B CB  1 
ATOM   2864  N N   . LEU B 2 13  ? 25.220  -62.108 -20.280 1.00 60.11  ? 13  LEU B N   1 
ATOM   2865  C CA  . LEU B 2 13  ? 25.835  -63.227 -20.986 1.00 60.83  ? 13  LEU B CA  1 
ATOM   2866  C C   . LEU B 2 13  ? 27.174  -62.855 -21.623 1.00 63.90  ? 13  LEU B C   1 
ATOM   2867  O O   . LEU B 2 13  ? 28.129  -63.632 -21.559 1.00 53.30  ? 13  LEU B O   1 
ATOM   2868  C CB  . LEU B 2 13  ? 24.882  -63.763 -22.058 1.00 59.73  ? 13  LEU B CB  1 
ATOM   2869  C CG  . LEU B 2 13  ? 25.382  -64.927 -22.918 1.00 59.80  ? 13  LEU B CG  1 
ATOM   2870  C CD1 . LEU B 2 13  ? 25.821  -66.093 -22.045 1.00 65.75  ? 13  LEU B CD1 1 
ATOM   2871  C CD2 . LEU B 2 13  ? 24.307  -65.365 -23.902 1.00 68.50  ? 13  LEU B CD2 1 
ATOM   2872  N N   . GLN B 2 14  ? 27.242  -61.674 -22.235 1.00 63.23  ? 14  GLN B N   1 
ATOM   2873  C CA  . GLN B 2 14  ? 28.479  -61.206 -22.862 1.00 53.59  ? 14  GLN B CA  1 
ATOM   2874  C C   . GLN B 2 14  ? 29.591  -61.070 -21.824 1.00 60.84  ? 14  GLN B C   1 
ATOM   2875  O O   . GLN B 2 14  ? 30.744  -61.420 -22.087 1.00 52.07  ? 14  GLN B O   1 
ATOM   2876  C CB  . GLN B 2 14  ? 28.274  -59.866 -23.580 1.00 49.05  ? 14  GLN B CB  1 
ATOM   2877  C CG  . GLN B 2 14  ? 29.553  -59.343 -24.235 1.00 60.66  ? 14  GLN B CG  1 
ATOM   2878  C CD  . GLN B 2 14  ? 29.384  -58.005 -24.936 1.00 70.02  ? 14  GLN B CD  1 
ATOM   2879  O OE1 . GLN B 2 14  ? 28.747  -57.093 -24.415 1.00 61.85  ? 14  GLN B OE1 1 
ATOM   2880  N NE2 . GLN B 2 14  ? 29.944  -57.892 -26.135 1.00 74.14  ? 14  GLN B NE2 1 
ATOM   2881  N N   . ASP B 2 15  ? 29.227  -60.550 -20.654 1.00 41.31  ? 15  ASP B N   1 
ATOM   2882  C CA  . ASP B 2 15  ? 30.133  -60.419 -19.513 1.00 48.85  ? 15  ASP B CA  1 
ATOM   2883  C C   . ASP B 2 15  ? 31.362  -59.570 -19.843 1.00 49.76  ? 15  ASP B C   1 
ATOM   2884  O O   . ASP B 2 15  ? 32.498  -59.980 -19.599 1.00 44.40  ? 15  ASP B O   1 
ATOM   2885  C CB  . ASP B 2 15  ? 30.564  -61.803 -19.011 1.00 58.54  ? 15  ASP B CB  1 
ATOM   2886  C CG  . ASP B 2 15  ? 31.131  -61.766 -17.603 1.00 81.70  ? 15  ASP B CG  1 
ATOM   2887  O OD1 . ASP B 2 15  ? 30.365  -61.482 -16.657 1.00 78.76  ? 15  ASP B OD1 1 
ATOM   2888  O OD2 . ASP B 2 15  ? 32.343  -62.027 -17.442 1.00 80.53  ? 15  ASP B OD2 1 
ATOM   2889  N N   . SER B 2 16  ? 31.123  -58.385 -20.397 1.00 53.25  ? 16  SER B N   1 
ATOM   2890  C CA  . SER B 2 16  ? 32.192  -57.444 -20.715 1.00 47.78  ? 16  SER B CA  1 
ATOM   2891  C C   . SER B 2 16  ? 32.741  -56.800 -19.440 1.00 52.53  ? 16  SER B C   1 
ATOM   2892  O O   . SER B 2 16  ? 32.042  -56.734 -18.430 1.00 58.12  ? 16  SER B O   1 
ATOM   2893  C CB  . SER B 2 16  ? 31.685  -56.373 -21.686 1.00 55.36  ? 16  SER B CB  1 
ATOM   2894  O OG  . SER B 2 16  ? 30.515  -55.745 -21.193 1.00 70.49  ? 16  SER B OG  1 
ATOM   2895  N N   . PRO B 2 17  ? 34.000  -56.330 -19.479 1.00 55.75  ? 17  PRO B N   1 
ATOM   2896  C CA  . PRO B 2 17  ? 34.626  -55.703 -18.307 1.00 48.05  ? 17  PRO B CA  1 
ATOM   2897  C C   . PRO B 2 17  ? 33.887  -54.458 -17.818 1.00 47.74  ? 17  PRO B C   1 
ATOM   2898  O O   . PRO B 2 17  ? 33.988  -54.106 -16.643 1.00 64.10  ? 17  PRO B O   1 
ATOM   2899  C CB  . PRO B 2 17  ? 36.024  -55.333 -18.813 1.00 44.03  ? 17  PRO B CB  1 
ATOM   2900  C CG  . PRO B 2 17  ? 36.285  -56.283 -19.922 1.00 51.26  ? 17  PRO B CG  1 
ATOM   2901  C CD  . PRO B 2 17  ? 34.958  -56.496 -20.585 1.00 49.63  ? 17  PRO B CD  1 
ATOM   2902  N N   . GLN B 2 18  ? 33.153  -53.807 -18.713 1.00 51.46  ? 18  GLN B N   1 
ATOM   2903  C CA  . GLN B 2 18  ? 32.338  -52.653 -18.352 1.00 64.31  ? 18  GLN B CA  1 
ATOM   2904  C C   . GLN B 2 18  ? 31.165  -53.093 -17.476 1.00 65.64  ? 18  GLN B C   1 
ATOM   2905  O O   . GLN B 2 18  ? 30.861  -52.474 -16.442 1.00 69.70  ? 18  GLN B O   1 
ATOM   2906  C CB  . GLN B 2 18  ? 31.850  -51.945 -19.619 1.00 60.11  ? 18  GLN B CB  1 
ATOM   2907  C CG  . GLN B 2 18  ? 30.493  -51.276 -19.509 1.00 84.15  ? 18  GLN B CG  1 
ATOM   2908  C CD  . GLN B 2 18  ? 29.970  -50.822 -20.859 1.00 97.29  ? 18  GLN B CD  1 
ATOM   2909  O OE1 . GLN B 2 18  ? 30.612  -50.033 -21.553 1.00 106.96 ? 18  GLN B OE1 1 
ATOM   2910  N NE2 . GLN B 2 18  ? 28.804  -51.329 -21.243 1.00 91.16  ? 18  GLN B NE2 1 
ATOM   2911  N N   . THR B 2 19  ? 30.522  -54.180 -17.895 1.00 54.97  ? 19  THR B N   1 
ATOM   2912  C CA  . THR B 2 19  ? 29.460  -54.808 -17.122 1.00 57.49  ? 19  THR B CA  1 
ATOM   2913  C C   . THR B 2 19  ? 29.977  -55.176 -15.735 1.00 58.51  ? 19  THR B C   1 
ATOM   2914  O O   . THR B 2 19  ? 29.318  -54.922 -14.724 1.00 61.57  ? 19  THR B O   1 
ATOM   2915  C CB  . THR B 2 19  ? 28.924  -56.069 -17.828 1.00 39.98  ? 19  THR B CB  1 
ATOM   2916  O OG1 . THR B 2 19  ? 28.371  -55.708 -19.100 1.00 59.25  ? 19  THR B OG1 1 
ATOM   2917  C CG2 . THR B 2 19  ? 27.852  -56.745 -16.987 1.00 44.89  ? 19  THR B CG2 1 
ATOM   2918  N N   . ARG B 2 20  ? 31.168  -55.767 -15.700 1.00 49.58  ? 20  ARG B N   1 
ATOM   2919  C CA  . ARG B 2 20  ? 31.823  -56.119 -14.447 1.00 43.27  ? 20  ARG B CA  1 
ATOM   2920  C C   . ARG B 2 20  ? 32.097  -54.886 -13.594 1.00 56.33  ? 20  ARG B C   1 
ATOM   2921  O O   . ARG B 2 20  ? 32.063  -54.956 -12.369 1.00 68.99  ? 20  ARG B O   1 
ATOM   2922  C CB  . ARG B 2 20  ? 33.128  -56.872 -14.710 1.00 52.13  ? 20  ARG B CB  1 
ATOM   2923  C CG  . ARG B 2 20  ? 32.948  -58.361 -14.961 1.00 63.05  ? 20  ARG B CG  1 
ATOM   2924  C CD  . ARG B 2 20  ? 31.919  -58.967 -14.019 1.00 51.46  ? 20  ARG B CD  1 
ATOM   2925  N NE  . ARG B 2 20  ? 31.682  -60.378 -14.310 1.00 60.46  ? 20  ARG B NE  1 
ATOM   2926  C CZ  . ARG B 2 20  ? 32.355  -61.378 -13.751 1.00 66.27  ? 20  ARG B CZ  1 
ATOM   2927  N NH1 . ARG B 2 20  ? 33.305  -61.124 -12.861 1.00 61.34  ? 20  ARG B NH1 1 
ATOM   2928  N NH2 . ARG B 2 20  ? 32.076  -62.633 -14.077 1.00 60.53  ? 20  ARG B NH2 1 
ATOM   2929  N N   . SER B 2 21  ? 32.390  -53.763 -14.245 1.00 46.25  ? 21  SER B N   1 
ATOM   2930  C CA  . SER B 2 21  ? 32.649  -52.516 -13.533 1.00 50.24  ? 21  SER B CA  1 
ATOM   2931  C C   . SER B 2 21  ? 31.387  -52.025 -12.825 1.00 54.90  ? 21  SER B C   1 
ATOM   2932  O O   . SER B 2 21  ? 31.412  -51.701 -11.627 1.00 59.57  ? 21  SER B O   1 
ATOM   2933  C CB  . SER B 2 21  ? 33.172  -51.446 -14.492 1.00 48.47  ? 21  SER B CB  1 
ATOM   2934  O OG  . SER B 2 21  ? 34.516  -51.706 -14.859 1.00 58.44  ? 21  SER B OG  1 
ATOM   2935  N N   . LEU B 2 22  ? 30.279  -51.989 -13.564 1.00 44.81  ? 22  LEU B N   1 
ATOM   2936  C CA  . LEU B 2 22  ? 29.009  -51.547 -12.989 1.00 59.93  ? 22  LEU B CA  1 
ATOM   2937  C C   . LEU B 2 22  ? 28.579  -52.489 -11.864 1.00 66.30  ? 22  LEU B C   1 
ATOM   2938  O O   . LEU B 2 22  ? 28.083  -52.056 -10.807 1.00 74.74  ? 22  LEU B O   1 
ATOM   2939  C CB  . LEU B 2 22  ? 27.926  -51.476 -14.068 1.00 66.70  ? 22  LEU B CB  1 
ATOM   2940  C CG  . LEU B 2 22  ? 28.125  -50.424 -15.161 1.00 87.27  ? 22  LEU B CG  1 
ATOM   2941  C CD1 . LEU B 2 22  ? 27.111  -50.603 -16.282 1.00 75.47  ? 22  LEU B CD1 1 
ATOM   2942  C CD2 . LEU B 2 22  ? 28.036  -49.023 -14.571 1.00 92.65  ? 22  LEU B CD2 1 
ATOM   2943  N N   . LEU B 2 23  ? 28.805  -53.780 -12.090 1.00 60.68  ? 23  LEU B N   1 
ATOM   2944  C CA  . LEU B 2 23  ? 28.534  -54.796 -11.084 1.00 60.29  ? 23  LEU B CA  1 
ATOM   2945  C C   . LEU B 2 23  ? 29.342  -54.533 -9.821  1.00 66.58  ? 23  LEU B C   1 
ATOM   2946  O O   . LEU B 2 23  ? 28.817  -54.615 -8.716  1.00 57.32  ? 23  LEU B O   1 
ATOM   2947  C CB  . LEU B 2 23  ? 28.847  -56.191 -11.627 1.00 56.14  ? 23  LEU B CB  1 
ATOM   2948  C CG  . LEU B 2 23  ? 28.633  -57.341 -10.642 1.00 48.76  ? 23  LEU B CG  1 
ATOM   2949  C CD1 . LEU B 2 23  ? 27.204  -57.351 -10.127 1.00 44.60  ? 23  LEU B CD1 1 
ATOM   2950  C CD2 . LEU B 2 23  ? 28.982  -58.670 -11.288 1.00 55.01  ? 23  LEU B CD2 1 
ATOM   2951  N N   . SER B 2 24  ? 30.619  -54.210 -9.998  1.00 64.09  ? 24  SER B N   1 
ATOM   2952  C CA  . SER B 2 24  ? 31.508  -53.918 -8.880  1.00 65.46  ? 24  SER B CA  1 
ATOM   2953  C C   . SER B 2 24  ? 31.025  -52.711 -8.084  1.00 63.42  ? 24  SER B C   1 
ATOM   2954  O O   . SER B 2 24  ? 31.103  -52.701 -6.855  1.00 83.85  ? 24  SER B O   1 
ATOM   2955  C CB  . SER B 2 24  ? 32.937  -53.685 -9.377  1.00 57.03  ? 24  SER B CB  1 
ATOM   2956  O OG  . SER B 2 24  ? 33.074  -52.400 -9.957  1.00 60.97  ? 24  SER B OG  1 
ATOM   2957  N N   . VAL B 2 25  ? 30.534  -51.692 -8.786  1.00 44.32  ? 25  VAL B N   1 
ATOM   2958  C CA  . VAL B 2 25  ? 29.962  -50.525 -8.115  1.00 59.78  ? 25  VAL B CA  1 
ATOM   2959  C C   . VAL B 2 25  ? 28.781  -50.940 -7.225  1.00 71.78  ? 25  VAL B C   1 
ATOM   2960  O O   . VAL B 2 25  ? 28.730  -50.630 -6.005  1.00 70.89  ? 25  VAL B O   1 
ATOM   2961  C CB  . VAL B 2 25  ? 29.500  -49.470 -9.143  1.00 46.29  ? 25  VAL B CB  1 
ATOM   2962  C CG1 . VAL B 2 25  ? 28.648  -48.402 -8.477  1.00 50.06  ? 25  VAL B CG1 1 
ATOM   2963  C CG2 . VAL B 2 25  ? 30.703  -48.846 -9.841  1.00 42.43  ? 25  VAL B CG2 1 
ATOM   2964  N N   . PHE B 2 26  ? 27.854  -51.673 -7.845  1.00 63.83  ? 26  PHE B N   1 
ATOM   2965  C CA  . PHE B 2 26  ? 26.686  -52.204 -7.143  1.00 59.19  ? 26  PHE B CA  1 
ATOM   2966  C C   . PHE B 2 26  ? 27.077  -52.993 -5.894  1.00 62.06  ? 26  PHE B C   1 
ATOM   2967  O O   . PHE B 2 26  ? 26.489  -52.813 -4.825  1.00 72.45  ? 26  PHE B O   1 
ATOM   2968  C CB  . PHE B 2 26  ? 25.862  -53.092 -8.079  1.00 47.43  ? 26  PHE B CB  1 
ATOM   2969  C CG  . PHE B 2 26  ? 24.775  -52.359 -8.812  1.00 43.45  ? 26  PHE B CG  1 
ATOM   2970  C CD1 . PHE B 2 26  ? 25.066  -51.575 -9.916  1.00 55.30  ? 26  PHE B CD1 1 
ATOM   2971  C CD2 . PHE B 2 26  ? 23.459  -52.457 -8.395  1.00 50.39  ? 26  PHE B CD2 1 
ATOM   2972  C CE1 . PHE B 2 26  ? 24.064  -50.901 -10.589 1.00 63.73  ? 26  PHE B CE1 1 
ATOM   2973  C CE2 . PHE B 2 26  ? 22.453  -51.786 -9.062  1.00 65.52  ? 26  PHE B CE2 1 
ATOM   2974  C CZ  . PHE B 2 26  ? 22.755  -51.008 -10.162 1.00 76.53  ? 26  PHE B CZ  1 
ATOM   2975  N N   . GLU B 2 27  ? 28.086  -53.848 -6.034  1.00 67.22  ? 27  GLU B N   1 
ATOM   2976  C CA  . GLU B 2 27  ? 28.586  -54.655 -4.925  1.00 69.29  ? 27  GLU B CA  1 
ATOM   2977  C C   . GLU B 2 27  ? 29.147  -53.783 -3.805  1.00 70.70  ? 27  GLU B C   1 
ATOM   2978  O O   . GLU B 2 27  ? 28.861  -54.004 -2.620  1.00 66.97  ? 27  GLU B O   1 
ATOM   2979  C CB  . GLU B 2 27  ? 29.670  -55.623 -5.411  1.00 63.72  ? 27  GLU B CB  1 
ATOM   2980  C CG  . GLU B 2 27  ? 29.189  -56.685 -6.385  1.00 68.96  ? 27  GLU B CG  1 
ATOM   2981  C CD  . GLU B 2 27  ? 30.306  -57.607 -6.840  1.00 82.40  ? 27  GLU B CD  1 
ATOM   2982  O OE1 . GLU B 2 27  ? 31.487  -57.206 -6.756  1.00 90.73  ? 27  GLU B OE1 1 
ATOM   2983  O OE2 . GLU B 2 27  ? 30.003  -58.734 -7.285  1.00 81.77  ? 27  GLU B OE2 1 
ATOM   2984  N N   . GLU B 2 28  ? 29.934  -52.783 -4.189  1.00 62.53  ? 28  GLU B N   1 
ATOM   2985  C CA  . GLU B 2 28  ? 30.581  -51.914 -3.216  1.00 69.54  ? 28  GLU B CA  1 
ATOM   2986  C C   . GLU B 2 28  ? 29.562  -51.165 -2.342  1.00 71.29  ? 28  GLU B C   1 
ATOM   2987  O O   . GLU B 2 28  ? 29.691  -51.161 -1.103  1.00 87.88  ? 28  GLU B O   1 
ATOM   2988  C CB  . GLU B 2 28  ? 31.514  -50.936 -3.941  1.00 66.95  ? 28  GLU B CB  1 
ATOM   2989  C CG  . GLU B 2 28  ? 32.290  -50.005 -3.036  1.00 72.48  ? 28  GLU B CG  1 
ATOM   2990  C CD  . GLU B 2 28  ? 32.814  -48.787 -3.772  1.00 106.79 ? 28  GLU B CD  1 
ATOM   2991  O OE1 . GLU B 2 28  ? 32.850  -48.808 -5.023  1.00 117.61 ? 28  GLU B OE1 1 
ATOM   2992  O OE2 . GLU B 2 28  ? 33.154  -47.792 -3.100  1.00 105.22 ? 28  GLU B OE2 1 
ATOM   2993  N N   . ASP B 2 29  ? 28.513  -50.587 -2.936  1.00 61.30  ? 29  ASP B N   1 
ATOM   2994  C CA  . ASP B 2 29  ? 27.597  -49.847 -2.049  1.00 84.53  ? 29  ASP B CA  1 
ATOM   2995  C C   . ASP B 2 29  ? 26.498  -50.778 -1.510  1.00 76.47  ? 29  ASP B C   1 
ATOM   2996  O O   . ASP B 2 29  ? 25.688  -50.383 -0.661  1.00 77.85  ? 29  ASP B O   1 
ATOM   2997  C CB  . ASP B 2 29  ? 27.026  -48.570 -2.733  1.00 83.47  ? 29  ASP B CB  1 
ATOM   2998  C CG  . ASP B 2 29  ? 25.784  -48.805 -3.609  1.00 104.02 ? 29  ASP B CG  1 
ATOM   2999  O OD1 . ASP B 2 29  ? 24.979  -49.729 -3.388  1.00 104.25 ? 29  ASP B OD1 1 
ATOM   3000  O OD2 . ASP B 2 29  ? 25.602  -47.997 -4.543  1.00 132.73 ? 29  ASP B OD2 1 
ATOM   3001  N N   . ALA B 2 30  ? 26.474  -52.012 -2.009  1.00 67.59  ? 30  ALA B N   1 
ATOM   3002  C CA  . ALA B 2 30  ? 25.760  -53.077 -1.318  1.00 62.40  ? 30  ALA B CA  1 
ATOM   3003  C C   . ALA B 2 30  ? 26.412  -53.309 0.045   1.00 64.00  ? 30  ALA B C   1 
ATOM   3004  O O   . ALA B 2 30  ? 25.725  -53.401 1.073   1.00 63.55  ? 30  ALA B O   1 
ATOM   3005  C CB  . ALA B 2 30  ? 25.762  -54.349 -2.135  1.00 52.70  ? 30  ALA B CB  1 
ATOM   3006  N N   . GLY B 2 31  ? 27.740  -53.410 0.043   1.00 51.13  ? 31  GLY B N   1 
ATOM   3007  C CA  . GLY B 2 31  ? 28.493  -53.548 1.278   1.00 53.58  ? 31  GLY B CA  1 
ATOM   3008  C C   . GLY B 2 31  ? 28.266  -52.356 2.192   1.00 73.80  ? 31  GLY B C   1 
ATOM   3009  O O   . GLY B 2 31  ? 28.010  -52.514 3.402   1.00 71.48  ? 31  GLY B O   1 
ATOM   3010  N N   . THR B 2 32  ? 28.351  -51.160 1.608   1.00 59.38  ? 32  THR B N   1 
ATOM   3011  C CA  . THR B 2 32  ? 28.072  -49.933 2.357   1.00 67.88  ? 32  THR B CA  1 
ATOM   3012  C C   . THR B 2 32  ? 26.702  -49.998 3.041   1.00 71.94  ? 32  THR B C   1 
ATOM   3013  O O   . THR B 2 32  ? 26.567  -49.722 4.247   1.00 71.46  ? 32  THR B O   1 
ATOM   3014  C CB  . THR B 2 32  ? 28.118  -48.689 1.444   1.00 63.57  ? 32  THR B CB  1 
ATOM   3015  O OG1 . THR B 2 32  ? 29.476  -48.391 1.101   1.00 84.84  ? 32  THR B OG1 1 
ATOM   3016  C CG2 . THR B 2 32  ? 27.503  -47.483 2.145   1.00 66.23  ? 32  THR B CG2 1 
ATOM   3017  N N   . LEU B 2 33  ? 25.695  -50.384 2.261   1.00 77.73  ? 33  LEU B N   1 
ATOM   3018  C CA  . LEU B 2 33  ? 24.338  -50.555 2.767   1.00 59.71  ? 33  LEU B CA  1 
ATOM   3019  C C   . LEU B 2 33  ? 24.298  -51.518 3.949   1.00 64.81  ? 33  LEU B C   1 
ATOM   3020  O O   . LEU B 2 33  ? 23.673  -51.227 4.966   1.00 65.88  ? 33  LEU B O   1 
ATOM   3021  C CB  . LEU B 2 33  ? 23.413  -51.051 1.652   1.00 51.22  ? 33  LEU B CB  1 
ATOM   3022  C CG  . LEU B 2 33  ? 22.067  -51.643 2.072   1.00 69.66  ? 33  LEU B CG  1 
ATOM   3023  C CD1 . LEU B 2 33  ? 21.091  -50.539 2.440   1.00 69.75  ? 33  LEU B CD1 1 
ATOM   3024  C CD2 . LEU B 2 33  ? 21.498  -52.518 0.966   1.00 61.51  ? 33  LEU B CD2 1 
ATOM   3025  N N   . THR B 2 34  ? 24.971  -52.658 3.812   1.00 61.69  ? 34  THR B N   1 
ATOM   3026  C CA  . THR B 2 34  ? 25.009  -53.654 4.883   1.00 64.69  ? 34  THR B CA  1 
ATOM   3027  C C   . THR B 2 34  ? 25.558  -53.066 6.182   1.00 64.71  ? 34  THR B C   1 
ATOM   3028  O O   . THR B 2 34  ? 24.959  -53.225 7.257   1.00 55.58  ? 34  THR B O   1 
ATOM   3029  C CB  . THR B 2 34  ? 25.864  -54.873 4.490   1.00 62.38  ? 34  THR B CB  1 
ATOM   3030  O OG1 . THR B 2 34  ? 25.313  -55.489 3.320   1.00 75.25  ? 34  THR B OG1 1 
ATOM   3031  C CG2 . THR B 2 34  ? 25.898  -55.889 5.622   1.00 72.38  ? 34  THR B CG2 1 
ATOM   3032  N N   . ASP B 2 35  ? 26.685  -52.367 6.074   1.00 74.28  ? 35  ASP B N   1 
ATOM   3033  C CA  . ASP B 2 35  ? 27.299  -51.755 7.249   1.00 71.60  ? 35  ASP B CA  1 
ATOM   3034  C C   . ASP B 2 35  ? 26.344  -50.768 7.924   1.00 66.62  ? 35  ASP B C   1 
ATOM   3035  O O   . ASP B 2 35  ? 26.139  -50.806 9.157   1.00 71.40  ? 35  ASP B O   1 
ATOM   3036  C CB  . ASP B 2 35  ? 28.601  -51.051 6.862   1.00 72.11  ? 35  ASP B CB  1 
ATOM   3037  C CG  . ASP B 2 35  ? 29.707  -52.027 6.505   1.00 89.34  ? 35  ASP B CG  1 
ATOM   3038  O OD1 . ASP B 2 35  ? 29.515  -53.244 6.711   1.00 84.46  ? 35  ASP B OD1 1 
ATOM   3039  O OD2 . ASP B 2 35  ? 30.765  -51.577 6.017   1.00 98.14  ? 35  ASP B OD2 1 
ATOM   3040  N N   . TYR B 2 36  ? 25.736  -49.899 7.118   1.00 66.13  ? 36  TYR B N   1 
ATOM   3041  C CA  . TYR B 2 36  ? 24.804  -48.929 7.681   1.00 68.19  ? 36  TYR B CA  1 
ATOM   3042  C C   . TYR B 2 36  ? 23.590  -49.590 8.338   1.00 65.87  ? 36  TYR B C   1 
ATOM   3043  O O   . TYR B 2 36  ? 23.103  -49.114 9.364   1.00 66.07  ? 36  TYR B O   1 
ATOM   3044  C CB  . TYR B 2 36  ? 24.325  -47.939 6.623   1.00 66.65  ? 36  TYR B CB  1 
ATOM   3045  C CG  . TYR B 2 36  ? 23.357  -46.946 7.212   1.00 85.72  ? 36  TYR B CG  1 
ATOM   3046  C CD1 . TYR B 2 36  ? 23.653  -46.286 8.397   1.00 84.45  ? 36  TYR B CD1 1 
ATOM   3047  C CD2 . TYR B 2 36  ? 22.129  -46.705 6.614   1.00 104.05 ? 36  TYR B CD2 1 
ATOM   3048  C CE1 . TYR B 2 36  ? 22.763  -45.399 8.959   1.00 104.98 ? 36  TYR B CE1 1 
ATOM   3049  C CE2 . TYR B 2 36  ? 21.232  -45.812 7.166   1.00 104.58 ? 36  TYR B CE2 1 
ATOM   3050  C CZ  . TYR B 2 36  ? 21.553  -45.164 8.340   1.00 108.49 ? 36  TYR B CZ  1 
ATOM   3051  O OH  . TYR B 2 36  ? 20.668  -44.269 8.895   1.00 108.53 ? 36  TYR B OH  1 
ATOM   3052  N N   . THR B 2 37  ? 23.102  -50.681 7.752   1.00 67.89  ? 37  THR B N   1 
ATOM   3053  C CA  . THR B 2 37  ? 21.962  -51.391 8.329   1.00 56.16  ? 37  THR B CA  1 
ATOM   3054  C C   . THR B 2 37  ? 22.355  -52.011 9.672   1.00 71.49  ? 37  THR B C   1 
ATOM   3055  O O   . THR B 2 37  ? 21.537  -52.065 10.590  1.00 74.88  ? 37  THR B O   1 
ATOM   3056  C CB  . THR B 2 37  ? 21.410  -52.474 7.391   1.00 57.71  ? 37  THR B CB  1 
ATOM   3057  O OG1 . THR B 2 37  ? 22.456  -53.388 7.047   1.00 85.64  ? 37  THR B OG1 1 
ATOM   3058  C CG2 . THR B 2 37  ? 20.858  -51.848 6.128   1.00 66.15  ? 37  THR B CG2 1 
ATOM   3059  N N   . ASN B 2 38  ? 23.600  -52.472 9.788   1.00 66.62  ? 38  ASN B N   1 
ATOM   3060  C CA  . ASN B 2 38  ? 24.112  -52.937 11.079  1.00 58.79  ? 38  ASN B CA  1 
ATOM   3061  C C   . ASN B 2 38  ? 24.085  -51.842 12.138  1.00 67.87  ? 38  ASN B C   1 
ATOM   3062  O O   . ASN B 2 38  ? 23.562  -52.037 13.254  1.00 71.84  ? 38  ASN B O   1 
ATOM   3063  C CB  . ASN B 2 38  ? 25.552  -53.461 10.916  1.00 94.17  ? 38  ASN B CB  1 
ATOM   3064  C CG  . ASN B 2 38  ? 25.635  -54.974 10.932  1.00 117.87 ? 38  ASN B CG  1 
ATOM   3065  O OD1 . ASN B 2 38  ? 24.775  -55.634 11.512  1.00 109.18 ? 38  ASN B OD1 1 
ATOM   3066  N ND2 . ASN B 2 38  ? 26.618  -55.533 10.233  1.00 110.46 ? 38  ASN B ND2 1 
ATOM   3067  N N   . GLN B 2 39  ? 24.613  -50.678 11.771  1.00 74.17  ? 39  GLN B N   1 
ATOM   3068  C CA  . GLN B 2 39  ? 24.637  -49.545 12.691  1.00 67.14  ? 39  GLN B CA  1 
ATOM   3069  C C   . GLN B 2 39  ? 23.221  -49.171 13.135  1.00 68.47  ? 39  GLN B C   1 
ATOM   3070  O O   . GLN B 2 39  ? 22.937  -49.031 14.337  1.00 76.82  ? 39  GLN B O   1 
ATOM   3071  C CB  . GLN B 2 39  ? 25.333  -48.356 12.036  1.00 63.29  ? 39  GLN B CB  1 
ATOM   3072  C CG  . GLN B 2 39  ? 26.810  -48.596 11.775  1.00 73.59  ? 39  GLN B CG  1 
ATOM   3073  C CD  . GLN B 2 39  ? 27.538  -47.337 11.369  1.00 95.00  ? 39  GLN B CD  1 
ATOM   3074  O OE1 . GLN B 2 39  ? 27.202  -46.240 11.814  1.00 94.57  ? 39  GLN B OE1 1 
ATOM   3075  N NE2 . GLN B 2 39  ? 28.537  -47.486 10.509  1.00 88.72  ? 39  GLN B NE2 1 
ATOM   3076  N N   . LEU B 2 40  ? 22.338  -49.029 12.150  1.00 59.15  ? 40  LEU B N   1 
ATOM   3077  C CA  . LEU B 2 40  ? 20.943  -48.678 12.388  1.00 58.62  ? 40  LEU B CA  1 
ATOM   3078  C C   . LEU B 2 40  ? 20.282  -49.688 13.317  1.00 63.49  ? 40  LEU B C   1 
ATOM   3079  O O   . LEU B 2 40  ? 19.514  -49.315 14.200  1.00 57.10  ? 40  LEU B O   1 
ATOM   3080  C CB  . LEU B 2 40  ? 20.174  -48.596 11.069  1.00 70.41  ? 40  LEU B CB  1 
ATOM   3081  C CG  . LEU B 2 40  ? 18.781  -47.972 11.154  1.00 66.94  ? 40  LEU B CG  1 
ATOM   3082  C CD1 . LEU B 2 40  ? 18.869  -46.581 11.763  1.00 63.18  ? 40  LEU B CD1 1 
ATOM   3083  C CD2 . LEU B 2 40  ? 18.121  -47.921 9.784   1.00 70.84  ? 40  LEU B CD2 1 
ATOM   3084  N N   . LEU B 2 41  ? 20.582  -50.966 13.104  1.00 64.94  ? 41  LEU B N   1 
ATOM   3085  C CA  . LEU B 2 41  ? 20.079  -52.029 13.965  1.00 60.86  ? 41  LEU B CA  1 
ATOM   3086  C C   . LEU B 2 41  ? 20.509  -51.826 15.412  1.00 67.51  ? 41  LEU B C   1 
ATOM   3087  O O   . LEU B 2 41  ? 19.698  -51.968 16.333  1.00 56.82  ? 41  LEU B O   1 
ATOM   3088  C CB  . LEU B 2 41  ? 20.560  -53.393 13.470  1.00 54.21  ? 41  LEU B CB  1 
ATOM   3089  C CG  . LEU B 2 41  ? 20.379  -54.532 14.475  1.00 83.87  ? 41  LEU B CG  1 
ATOM   3090  C CD1 . LEU B 2 41  ? 18.917  -54.893 14.600  1.00 70.49  ? 41  LEU B CD1 1 
ATOM   3091  C CD2 . LEU B 2 41  ? 21.202  -55.745 14.072  1.00 79.98  ? 41  LEU B CD2 1 
ATOM   3092  N N   . GLN B 2 42  ? 21.782  -51.495 15.613  1.00 62.45  ? 42  GLN B N   1 
ATOM   3093  C CA  . GLN B 2 42  ? 22.255  -51.224 16.968  1.00 58.72  ? 42  GLN B CA  1 
ATOM   3094  C C   . GLN B 2 42  ? 21.487  -50.061 17.604  1.00 60.10  ? 42  GLN B C   1 
ATOM   3095  O O   . GLN B 2 42  ? 21.031  -50.157 18.754  1.00 65.54  ? 42  GLN B O   1 
ATOM   3096  C CB  . GLN B 2 42  ? 23.758  -50.942 16.968  1.00 62.06  ? 42  GLN B CB  1 
ATOM   3097  C CG  . GLN B 2 42  ? 24.586  -52.060 16.352  1.00 60.81  ? 42  GLN B CG  1 
ATOM   3098  C CD  . GLN B 2 42  ? 26.050  -51.696 16.207  1.00 89.41  ? 42  GLN B CD  1 
ATOM   3099  O OE1 . GLN B 2 42  ? 26.628  -51.042 17.075  1.00 97.37  ? 42  GLN B OE1 1 
ATOM   3100  N NE2 . GLN B 2 42  ? 26.660  -52.127 15.108  1.00 95.85  ? 42  GLN B NE2 1 
ATOM   3101  N N   . ALA B 2 43  ? 21.326  -48.976 16.848  1.00 51.08  ? 43  ALA B N   1 
ATOM   3102  C CA  . ALA B 2 43  ? 20.578  -47.818 17.344  1.00 50.29  ? 43  ALA B CA  1 
ATOM   3103  C C   . ALA B 2 43  ? 19.140  -48.176 17.746  1.00 62.37  ? 43  ALA B C   1 
ATOM   3104  O O   . ALA B 2 43  ? 18.682  -47.836 18.849  1.00 57.50  ? 43  ALA B O   1 
ATOM   3105  C CB  . ALA B 2 43  ? 20.569  -46.714 16.296  1.00 33.18  ? 43  ALA B CB  1 
ATOM   3106  N N   . MET B 2 44  ? 18.442  -48.872 16.852  1.00 63.53  ? 44  MET B N   1 
ATOM   3107  C CA  . MET B 2 44  ? 17.067  -49.298 17.098  1.00 63.50  ? 44  MET B CA  1 
ATOM   3108  C C   . MET B 2 44  ? 16.963  -50.163 18.344  1.00 60.64  ? 44  MET B C   1 
ATOM   3109  O O   . MET B 2 44  ? 16.105  -49.933 19.195  1.00 51.79  ? 44  MET B O   1 
ATOM   3110  C CB  . MET B 2 44  ? 16.511  -50.056 15.891  1.00 67.00  ? 44  MET B CB  1 
ATOM   3111  C CG  . MET B 2 44  ? 16.385  -49.225 14.621  1.00 75.53  ? 44  MET B CG  1 
ATOM   3112  S SD  . MET B 2 44  ? 15.437  -47.706 14.829  1.00 103.86 ? 44  MET B SD  1 
ATOM   3113  C CE  . MET B 2 44  ? 16.750  -46.493 14.917  1.00 90.19  ? 44  MET B CE  1 
ATOM   3114  N N   . GLN B 2 45  ? 17.831  -51.165 18.439  1.00 59.62  ? 45  GLN B N   1 
ATOM   3115  C CA  . GLN B 2 45  ? 17.839  -52.048 19.599  1.00 63.69  ? 45  GLN B CA  1 
ATOM   3116  C C   . GLN B 2 45  ? 18.102  -51.280 20.893  1.00 54.36  ? 45  GLN B C   1 
ATOM   3117  O O   . GLN B 2 45  ? 17.575  -51.640 21.948  1.00 54.83  ? 45  GLN B O   1 
ATOM   3118  C CB  . GLN B 2 45  ? 18.856  -53.174 19.417  1.00 49.29  ? 45  GLN B CB  1 
ATOM   3119  C CG  . GLN B 2 45  ? 18.281  -54.392 18.702  1.00 65.19  ? 45  GLN B CG  1 
ATOM   3120  C CD  . GLN B 2 45  ? 19.351  -55.332 18.191  1.00 89.55  ? 45  GLN B CD  1 
ATOM   3121  O OE1 . GLN B 2 45  ? 20.541  -55.107 18.404  1.00 114.84 ? 45  GLN B OE1 1 
ATOM   3122  N NE2 . GLN B 2 45  ? 18.930  -56.412 17.541  1.00 83.89  ? 45  GLN B NE2 1 
ATOM   3123  N N   . ARG B 2 46  ? 18.905  -50.221 20.820  1.00 51.46  ? 46  ARG B N   1 
ATOM   3124  C CA  . ARG B 2 46  ? 19.117  -49.393 22.004  1.00 51.56  ? 46  ARG B CA  1 
ATOM   3125  C C   . ARG B 2 46  ? 17.850  -48.617 22.375  1.00 51.41  ? 46  ARG B C   1 
ATOM   3126  O O   . ARG B 2 46  ? 17.509  -48.505 23.557  1.00 57.29  ? 46  ARG B O   1 
ATOM   3127  C CB  . ARG B 2 46  ? 20.286  -48.429 21.797  1.00 38.86  ? 46  ARG B CB  1 
ATOM   3128  C CG  . ARG B 2 46  ? 21.603  -48.952 22.344  1.00 52.40  ? 46  ARG B CG  1 
ATOM   3129  C CD  . ARG B 2 46  ? 22.590  -47.827 22.601  1.00 73.95  ? 46  ARG B CD  1 
ATOM   3130  N NE  . ARG B 2 46  ? 22.014  -46.776 23.435  1.00 64.33  ? 46  ARG B NE  1 
ATOM   3131  C CZ  . ARG B 2 46  ? 22.668  -45.683 23.817  1.00 71.62  ? 46  ARG B CZ  1 
ATOM   3132  N NH1 . ARG B 2 46  ? 23.928  -45.501 23.450  1.00 89.12  ? 46  ARG B NH1 1 
ATOM   3133  N NH2 . ARG B 2 46  ? 22.065  -44.777 24.574  1.00 71.94  ? 46  ARG B NH2 1 
ATOM   3134  N N   . VAL B 2 47  ? 17.146  -48.096 21.372  1.00 56.83  ? 47  VAL B N   1 
ATOM   3135  C CA  . VAL B 2 47  ? 15.887  -47.395 21.634  1.00 57.44  ? 47  VAL B CA  1 
ATOM   3136  C C   . VAL B 2 47  ? 14.848  -48.324 22.276  1.00 58.39  ? 47  VAL B C   1 
ATOM   3137  O O   . VAL B 2 47  ? 14.249  -47.998 23.314  1.00 53.87  ? 47  VAL B O   1 
ATOM   3138  C CB  . VAL B 2 47  ? 15.299  -46.792 20.342  1.00 43.05  ? 47  VAL B CB  1 
ATOM   3139  C CG1 . VAL B 2 47  ? 13.866  -46.334 20.572  1.00 55.38  ? 47  VAL B CG1 1 
ATOM   3140  C CG2 . VAL B 2 47  ? 16.160  -45.636 19.856  1.00 38.42  ? 47  VAL B CG2 1 
ATOM   3141  N N   . TYR B 2 48  ? 14.653  -49.487 21.660  1.00 51.51  ? 48  TYR B N   1 
ATOM   3142  C CA  . TYR B 2 48  ? 13.742  -50.500 22.182  1.00 53.75  ? 48  TYR B CA  1 
ATOM   3143  C C   . TYR B 2 48  ? 14.109  -50.919 23.602  1.00 55.74  ? 48  TYR B C   1 
ATOM   3144  O O   . TYR B 2 48  ? 13.243  -50.993 24.477  1.00 58.36  ? 48  TYR B O   1 
ATOM   3145  C CB  . TYR B 2 48  ? 13.728  -51.727 21.268  1.00 43.53  ? 48  TYR B CB  1 
ATOM   3146  C CG  . TYR B 2 48  ? 13.101  -52.945 21.908  1.00 61.70  ? 48  TYR B CG  1 
ATOM   3147  C CD1 . TYR B 2 48  ? 11.729  -53.019 22.116  1.00 57.93  ? 48  TYR B CD1 1 
ATOM   3148  C CD2 . TYR B 2 48  ? 13.884  -54.018 22.314  1.00 65.90  ? 48  TYR B CD2 1 
ATOM   3149  C CE1 . TYR B 2 48  ? 11.156  -54.131 22.706  1.00 66.89  ? 48  TYR B CE1 1 
ATOM   3150  C CE2 . TYR B 2 48  ? 13.320  -55.132 22.904  1.00 79.59  ? 48  TYR B CE2 1 
ATOM   3151  C CZ  . TYR B 2 48  ? 11.956  -55.184 23.098  1.00 77.56  ? 48  TYR B CZ  1 
ATOM   3152  O OH  . TYR B 2 48  ? 11.394  -56.294 23.686  1.00 83.68  ? 48  TYR B OH  1 
ATOM   3153  N N   . GLY B 2 49  ? 15.391  -51.197 23.820  1.00 45.65  ? 49  GLY B N   1 
ATOM   3154  C CA  . GLY B 2 49  ? 15.881  -51.561 25.137  1.00 38.87  ? 49  GLY B CA  1 
ATOM   3155  C C   . GLY B 2 49  ? 15.573  -50.496 26.172  1.00 47.53  ? 49  GLY B C   1 
ATOM   3156  O O   . GLY B 2 49  ? 15.168  -50.803 27.297  1.00 47.92  ? 49  GLY B O   1 
ATOM   3157  N N   . ALA B 2 50  ? 15.753  -49.238 25.781  1.00 43.59  ? 50  ALA B N   1 
ATOM   3158  C CA  . ALA B 2 50  ? 15.480  -48.113 26.666  1.00 36.71  ? 50  ALA B CA  1 
ATOM   3159  C C   . ALA B 2 50  ? 14.002  -48.061 27.050  1.00 52.38  ? 50  ALA B C   1 
ATOM   3160  O O   . ALA B 2 50  ? 13.660  -47.907 28.230  1.00 62.75  ? 50  ALA B O   1 
ATOM   3161  C CB  . ALA B 2 50  ? 15.907  -46.809 26.009  1.00 34.66  ? 50  ALA B CB  1 
ATOM   3162  N N   . GLN B 2 51  ? 13.131  -48.202 26.053  1.00 53.11  ? 51  GLN B N   1 
ATOM   3163  C CA  . GLN B 2 51  ? 11.692  -48.216 26.306  1.00 44.88  ? 51  GLN B CA  1 
ATOM   3164  C C   . GLN B 2 51  ? 11.325  -49.344 27.271  1.00 44.02  ? 51  GLN B C   1 
ATOM   3165  O O   . GLN B 2 51  ? 10.565  -49.150 28.229  1.00 63.54  ? 51  GLN B O   1 
ATOM   3166  C CB  . GLN B 2 51  ? 10.918  -48.372 24.996  1.00 47.06  ? 51  GLN B CB  1 
ATOM   3167  C CG  . GLN B 2 51  ? 9.500   -47.842 25.057  1.00 49.96  ? 51  GLN B CG  1 
ATOM   3168  C CD  . GLN B 2 51  ? 9.458   -46.341 25.253  1.00 56.91  ? 51  GLN B CD  1 
ATOM   3169  O OE1 . GLN B 2 51  ? 8.771   -45.836 26.141  1.00 53.97  ? 51  GLN B OE1 1 
ATOM   3170  N NE2 . GLN B 2 51  ? 10.197  -45.616 24.420  1.00 55.86  ? 51  GLN B NE2 1 
ATOM   3171  N N   . ASN B 2 52  ? 11.883  -50.522 27.011  1.00 45.16  ? 52  ASN B N   1 
ATOM   3172  C CA  . ASN B 2 52  ? 11.684  -51.684 27.868  1.00 46.55  ? 52  ASN B CA  1 
ATOM   3173  C C   . ASN B 2 52  ? 12.100  -51.461 29.321  1.00 58.81  ? 52  ASN B C   1 
ATOM   3174  O O   . ASN B 2 52  ? 11.379  -51.830 30.258  1.00 68.22  ? 52  ASN B O   1 
ATOM   3175  C CB  . ASN B 2 52  ? 12.455  -52.878 27.300  1.00 49.23  ? 52  ASN B CB  1 
ATOM   3176  C CG  . ASN B 2 52  ? 12.087  -54.184 27.971  1.00 68.17  ? 52  ASN B CG  1 
ATOM   3177  O OD1 . ASN B 2 52  ? 10.960  -54.663 27.850  1.00 90.34  ? 52  ASN B OD1 1 
ATOM   3178  N ND2 . ASN B 2 52  ? 13.041  -54.768 28.688  1.00 74.50  ? 52  ASN B ND2 1 
ATOM   3179  N N   . GLU B 2 53  ? 13.263  -50.849 29.515  1.00 55.19  ? 53  GLU B N   1 
ATOM   3180  C CA  . GLU B 2 53  ? 13.739  -50.616 30.868  1.00 61.68  ? 53  GLU B CA  1 
ATOM   3181  C C   . GLU B 2 53  ? 12.881  -49.542 31.546  1.00 63.26  ? 53  GLU B C   1 
ATOM   3182  O O   . GLU B 2 53  ? 12.745  -49.537 32.769  1.00 70.76  ? 53  GLU B O   1 
ATOM   3183  C CB  . GLU B 2 53  ? 15.216  -50.220 30.872  1.00 56.20  ? 53  GLU B CB  1 
ATOM   3184  C CG  . GLU B 2 53  ? 15.813  -50.202 32.264  1.00 86.94  ? 53  GLU B CG  1 
ATOM   3185  C CD  . GLU B 2 53  ? 16.180  -51.604 32.723  1.00 86.17  ? 53  GLU B CD  1 
ATOM   3186  O OE1 . GLU B 2 53  ? 16.590  -52.411 31.861  1.00 83.45  ? 53  GLU B OE1 1 
ATOM   3187  O OE2 . GLU B 2 53  ? 16.037  -51.907 33.927  1.00 73.92  ? 53  GLU B OE2 1 
ATOM   3188  N N   . MET B 2 54  ? 12.320  -48.624 30.760  1.00 53.98  ? 54  MET B N   1 
ATOM   3189  C CA  . MET B 2 54  ? 11.345  -47.683 31.309  1.00 46.75  ? 54  MET B CA  1 
ATOM   3190  C C   . MET B 2 54  ? 10.102  -48.426 31.802  1.00 56.08  ? 54  MET B C   1 
ATOM   3191  O O   . MET B 2 54  ? 9.530   -48.087 32.850  1.00 44.10  ? 54  MET B O   1 
ATOM   3192  C CB  . MET B 2 54  ? 10.950  -46.633 30.270  1.00 38.14  ? 54  MET B CB  1 
ATOM   3193  C CG  . MET B 2 54  ? 9.867   -45.669 30.745  1.00 55.14  ? 54  MET B CG  1 
ATOM   3194  S SD  . MET B 2 54  ? 10.190  -44.914 32.355  1.00 62.67  ? 54  MET B SD  1 
ATOM   3195  C CE  . MET B 2 54  ? 11.335  -43.612 31.915  1.00 45.95  ? 54  MET B CE  1 
ATOM   3196  N N   . CYS B 2 55  ? 9.687   -49.435 31.038  1.00 56.43  ? 55  CYS B N   1 
ATOM   3197  C CA  . CYS B 2 55  ? 8.578   -50.292 31.447  1.00 55.86  ? 55  CYS B CA  1 
ATOM   3198  C C   . CYS B 2 55  ? 8.873   -50.934 32.798  1.00 49.12  ? 55  CYS B C   1 
ATOM   3199  O O   . CYS B 2 55  ? 8.075   -50.831 33.737  1.00 50.51  ? 55  CYS B O   1 
ATOM   3200  C CB  . CYS B 2 55  ? 8.313   -51.372 30.398  1.00 54.11  ? 55  CYS B CB  1 
ATOM   3201  S SG  . CYS B 2 55  ? 7.706   -50.746 28.824  1.00 61.53  ? 55  CYS B SG  1 
ATOM   3202  N N   . LEU B 2 56  ? 10.029  -51.589 32.891  1.00 50.32  ? 56  LEU B N   1 
ATOM   3203  C CA  . LEU B 2 56  ? 10.443  -52.237 34.135  1.00 49.06  ? 56  LEU B CA  1 
ATOM   3204  C C   . LEU B 2 56  ? 10.508  -51.252 35.302  1.00 47.73  ? 56  LEU B C   1 
ATOM   3205  O O   . LEU B 2 56  ? 10.103  -51.571 36.422  1.00 55.64  ? 56  LEU B O   1 
ATOM   3206  C CB  . LEU B 2 56  ? 11.802  -52.916 33.960  1.00 47.60  ? 56  LEU B CB  1 
ATOM   3207  C CG  . LEU B 2 56  ? 11.838  -54.147 33.055  1.00 46.36  ? 56  LEU B CG  1 
ATOM   3208  C CD1 . LEU B 2 56  ? 13.261  -54.664 32.901  1.00 39.37  ? 56  LEU B CD1 1 
ATOM   3209  C CD2 . LEU B 2 56  ? 10.923  -55.232 33.599  1.00 47.58  ? 56  LEU B CD2 1 
ATOM   3210  N N   . ALA B 2 57  ? 11.019  -50.056 35.026  1.00 47.24  ? 57  ALA B N   1 
ATOM   3211  C CA  . ALA B 2 57  ? 11.152  -49.007 36.031  1.00 37.91  ? 57  ALA B CA  1 
ATOM   3212  C C   . ALA B 2 57  ? 9.794   -48.617 36.598  1.00 41.39  ? 57  ALA B C   1 
ATOM   3213  O O   . ALA B 2 57  ? 9.608   -48.584 37.817  1.00 55.55  ? 57  ALA B O   1 
ATOM   3214  C CB  . ALA B 2 57  ? 11.849  -47.791 35.443  1.00 35.54  ? 57  ALA B CB  1 
ATOM   3215  N N   . THR B 2 58  ? 8.851   -48.306 35.712  1.00 41.28  ? 58  THR B N   1 
ATOM   3216  C CA  . THR B 2 58  ? 7.507   -47.940 36.149  1.00 47.27  ? 58  THR B CA  1 
ATOM   3217  C C   . THR B 2 58  ? 6.851   -49.088 36.916  1.00 47.36  ? 58  THR B C   1 
ATOM   3218  O O   . THR B 2 58  ? 6.180   -48.862 37.926  1.00 53.98  ? 58  THR B O   1 
ATOM   3219  C CB  . THR B 2 58  ? 6.613   -47.529 34.966  1.00 41.78  ? 58  THR B CB  1 
ATOM   3220  O OG1 . THR B 2 58  ? 6.636   -48.554 33.965  1.00 61.84  ? 58  THR B OG1 1 
ATOM   3221  C CG2 . THR B 2 58  ? 7.113   -46.228 34.356  1.00 52.49  ? 58  THR B CG2 1 
ATOM   3222  N N   . GLN B 2 59  ? 7.051   -50.315 36.440  1.00 35.88  ? 59  GLN B N   1 
ATOM   3223  C CA  . GLN B 2 59  ? 6.539   -51.489 37.143  1.00 41.04  ? 59  GLN B CA  1 
ATOM   3224  C C   . GLN B 2 59  ? 7.049   -51.535 38.584  1.00 50.58  ? 59  GLN B C   1 
ATOM   3225  O O   . GLN B 2 59  ? 6.269   -51.710 39.531  1.00 57.93  ? 59  GLN B O   1 
ATOM   3226  C CB  . GLN B 2 59  ? 6.935   -52.770 36.406  1.00 45.30  ? 59  GLN B CB  1 
ATOM   3227  C CG  . GLN B 2 59  ? 6.905   -54.020 37.273  1.00 52.42  ? 59  GLN B CG  1 
ATOM   3228  C CD  . GLN B 2 59  ? 7.175   -55.286 36.485  1.00 62.29  ? 59  GLN B CD  1 
ATOM   3229  O OE1 . GLN B 2 59  ? 7.879   -55.266 35.475  1.00 62.93  ? 59  GLN B OE1 1 
ATOM   3230  N NE2 . GLN B 2 59  ? 6.616   -56.400 36.945  1.00 73.42  ? 59  GLN B NE2 1 
ATOM   3231  N N   . GLN B 2 60  ? 8.357   -51.350 38.743  1.00 49.42  ? 60  GLN B N   1 
ATOM   3232  C CA  . GLN B 2 60  ? 8.972   -51.337 40.065  1.00 51.67  ? 60  GLN B CA  1 
ATOM   3233  C C   . GLN B 2 60  ? 8.401   -50.224 40.935  1.00 44.79  ? 60  GLN B C   1 
ATOM   3234  O O   . GLN B 2 60  ? 8.105   -50.444 42.106  1.00 45.25  ? 60  GLN B O   1 
ATOM   3235  C CB  . GLN B 2 60  ? 10.491  -51.191 39.963  1.00 45.75  ? 60  GLN B CB  1 
ATOM   3236  C CG  . GLN B 2 60  ? 11.174  -51.080 41.319  1.00 40.68  ? 60  GLN B CG  1 
ATOM   3237  C CD  . GLN B 2 60  ? 12.685  -51.112 41.225  1.00 43.12  ? 60  GLN B CD  1 
ATOM   3238  O OE1 . GLN B 2 60  ? 13.251  -51.714 40.313  1.00 49.60  ? 60  GLN B OE1 1 
ATOM   3239  N NE2 . GLN B 2 60  ? 13.350  -50.462 42.174  1.00 54.76  ? 60  GLN B NE2 1 
ATOM   3240  N N   . LEU B 2 61  ? 8.266   -49.029 40.364  1.00 41.51  ? 61  LEU B N   1 
ATOM   3241  C CA  . LEU B 2 61  ? 7.712   -47.891 41.095  1.00 43.11  ? 61  LEU B CA  1 
ATOM   3242  C C   . LEU B 2 61  ? 6.323   -48.221 41.629  1.00 51.24  ? 61  LEU B C   1 
ATOM   3243  O O   . LEU B 2 61  ? 6.019   -47.973 42.800  1.00 52.25  ? 61  LEU B O   1 
ATOM   3244  C CB  . LEU B 2 61  ? 7.648   -46.650 40.204  1.00 44.65  ? 61  LEU B CB  1 
ATOM   3245  C CG  . LEU B 2 61  ? 6.955   -45.432 40.820  1.00 40.57  ? 61  LEU B CG  1 
ATOM   3246  C CD1 . LEU B 2 61  ? 7.663   -44.996 42.095  1.00 36.20  ? 61  LEU B CD1 1 
ATOM   3247  C CD2 . LEU B 2 61  ? 6.880   -44.285 39.822  1.00 44.66  ? 61  LEU B CD2 1 
ATOM   3248  N N   . SER B 2 62  ? 5.489   -48.783 40.759  1.00 57.27  ? 62  SER B N   1 
ATOM   3249  C CA  . SER B 2 62  ? 4.133   -49.171 41.128  1.00 51.15  ? 62  SER B CA  1 
ATOM   3250  C C   . SER B 2 62  ? 4.149   -50.183 42.268  1.00 62.16  ? 62  SER B C   1 
ATOM   3251  O O   . SER B 2 62  ? 3.400   -50.048 43.237  1.00 54.44  ? 62  SER B O   1 
ATOM   3252  C CB  . SER B 2 62  ? 3.392   -49.749 39.922  1.00 50.42  ? 62  SER B CB  1 
ATOM   3253  O OG  . SER B 2 62  ? 2.059   -50.085 40.262  1.00 61.78  ? 62  SER B OG  1 
ATOM   3254  N N   . LYS B 2 63  ? 5.001   -51.197 42.144  1.00 53.65  ? 63  LYS B N   1 
ATOM   3255  C CA  . LYS B 2 63  ? 5.092   -52.238 43.164  1.00 45.74  ? 63  LYS B CA  1 
ATOM   3256  C C   . LYS B 2 63  ? 5.538   -51.649 44.504  1.00 56.63  ? 63  LYS B C   1 
ATOM   3257  O O   . LYS B 2 63  ? 5.074   -52.065 45.566  1.00 53.56  ? 63  LYS B O   1 
ATOM   3258  C CB  . LYS B 2 63  ? 6.055   -53.340 42.716  1.00 42.49  ? 63  LYS B CB  1 
ATOM   3259  C CG  . LYS B 2 63  ? 6.210   -54.485 43.702  1.00 48.72  ? 63  LYS B CG  1 
ATOM   3260  C CD  . LYS B 2 63  ? 6.881   -55.680 43.043  1.00 72.01  ? 63  LYS B CD  1 
ATOM   3261  C CE  . LYS B 2 63  ? 7.181   -56.779 44.049  1.00 93.34  ? 63  LYS B CE  1 
ATOM   3262  N NZ  . LYS B 2 63  ? 8.222   -57.717 43.545  1.00 73.95  ? 63  LYS B NZ  1 
ATOM   3263  N N   . GLN B 2 64  ? 6.436   -50.671 44.436  1.00 60.30  ? 64  GLN B N   1 
ATOM   3264  C CA  . GLN B 2 64  ? 6.939   -49.972 45.614  1.00 51.00  ? 64  GLN B CA  1 
ATOM   3265  C C   . GLN B 2 64  ? 5.870   -49.137 46.313  1.00 49.29  ? 64  GLN B C   1 
ATOM   3266  O O   . GLN B 2 64  ? 5.777   -49.146 47.541  1.00 52.26  ? 64  GLN B O   1 
ATOM   3267  C CB  . GLN B 2 64  ? 8.124   -49.080 45.228  1.00 46.77  ? 64  GLN B CB  1 
ATOM   3268  C CG  . GLN B 2 64  ? 8.908   -48.525 46.411  1.00 47.73  ? 64  GLN B CG  1 
ATOM   3269  C CD  . GLN B 2 64  ? 9.399   -49.603 47.361  1.00 58.85  ? 64  GLN B CD  1 
ATOM   3270  O OE1 . GLN B 2 64  ? 9.763   -50.702 46.943  1.00 69.83  ? 64  GLN B OE1 1 
ATOM   3271  N NE2 . GLN B 2 64  ? 9.410   -49.289 48.651  1.00 63.26  ? 64  GLN B NE2 1 
ATOM   3272  N N   . LEU B 2 65  ? 5.078   -48.405 45.535  1.00 41.51  ? 65  LEU B N   1 
ATOM   3273  C CA  . LEU B 2 65  ? 4.016   -47.573 46.098  1.00 53.18  ? 65  LEU B CA  1 
ATOM   3274  C C   . LEU B 2 65  ? 3.000   -48.410 46.876  1.00 60.93  ? 65  LEU B C   1 
ATOM   3275  O O   . LEU B 2 65  ? 2.485   -47.982 47.910  1.00 54.31  ? 65  LEU B O   1 
ATOM   3276  C CB  . LEU B 2 65  ? 3.311   -46.785 44.992  1.00 52.44  ? 65  LEU B CB  1 
ATOM   3277  C CG  . LEU B 2 65  ? 4.171   -45.754 44.260  1.00 54.25  ? 65  LEU B CG  1 
ATOM   3278  C CD1 . LEU B 2 65  ? 3.306   -44.810 43.441  1.00 38.04  ? 65  LEU B CD1 1 
ATOM   3279  C CD2 . LEU B 2 65  ? 5.032   -44.983 45.246  1.00 45.32  ? 65  LEU B CD2 1 
ATOM   3280  N N   . LEU B 2 66  ? 2.714   -49.601 46.357  1.00 59.77  ? 66  LEU B N   1 
ATOM   3281  C CA  . LEU B 2 66  ? 1.809   -50.553 46.996  1.00 56.98  ? 66  LEU B CA  1 
ATOM   3282  C C   . LEU B 2 66  ? 2.397   -51.166 48.264  1.00 66.74  ? 66  LEU B C   1 
ATOM   3283  O O   . LEU B 2 66  ? 1.660   -51.609 49.144  1.00 76.85  ? 66  LEU B O   1 
ATOM   3284  C CB  . LEU B 2 66  ? 1.413   -51.659 46.019  1.00 59.08  ? 66  LEU B CB  1 
ATOM   3285  C CG  . LEU B 2 66  ? 0.422   -51.232 44.936  1.00 57.47  ? 66  LEU B CG  1 
ATOM   3286  C CD1 . LEU B 2 66  ? 0.075   -52.414 44.047  1.00 59.73  ? 66  LEU B CD1 1 
ATOM   3287  C CD2 . LEU B 2 66  ? -0.830  -50.621 45.555  1.00 43.70  ? 66  LEU B CD2 1 
ATOM   3288  N N   . ALA B 2 67  ? 3.719   -51.280 48.313  1.00 59.84  ? 67  ALA B N   1 
ATOM   3289  C CA  . ALA B 2 67  ? 4.390   -51.884 49.461  1.00 68.62  ? 67  ALA B CA  1 
ATOM   3290  C C   . ALA B 2 67  ? 4.251   -51.066 50.756  1.00 62.74  ? 67  ALA B C   1 
ATOM   3291  O O   . ALA B 2 67  ? 4.437   -51.604 51.848  1.00 54.32  ? 67  ALA B O   1 
ATOM   3292  C CB  . ALA B 2 67  ? 5.859   -52.106 49.142  1.00 46.53  ? 67  ALA B CB  1 
ATOM   3293  N N   . TYR B 2 68  ? 3.925   -49.780 50.639  1.00 53.34  ? 68  TYR B N   1 
ATOM   3294  C CA  . TYR B 2 68  ? 3.791   -48.906 51.812  1.00 58.03  ? 68  TYR B CA  1 
ATOM   3295  C C   . TYR B 2 68  ? 2.747   -49.346 52.842  1.00 80.52  ? 68  TYR B C   1 
ATOM   3296  O O   . TYR B 2 68  ? 2.986   -49.273 54.044  1.00 83.93  ? 68  TYR B O   1 
ATOM   3297  C CB  . TYR B 2 68  ? 3.470   -47.477 51.364  1.00 56.26  ? 68  TYR B CB  1 
ATOM   3298  C CG  . TYR B 2 68  ? 3.285   -46.522 52.521  1.00 65.76  ? 68  TYR B CG  1 
ATOM   3299  C CD1 . TYR B 2 68  ? 4.377   -46.060 53.243  1.00 62.75  ? 68  TYR B CD1 1 
ATOM   3300  C CD2 . TYR B 2 68  ? 2.021   -46.078 52.886  1.00 74.87  ? 68  TYR B CD2 1 
ATOM   3301  C CE1 . TYR B 2 68  ? 4.215   -45.194 54.302  1.00 54.78  ? 68  TYR B CE1 1 
ATOM   3302  C CE2 . TYR B 2 68  ? 1.849   -45.207 53.943  1.00 69.68  ? 68  TYR B CE2 1 
ATOM   3303  C CZ  . TYR B 2 68  ? 2.950   -44.768 54.645  1.00 66.80  ? 68  TYR B CZ  1 
ATOM   3304  O OH  . TYR B 2 68  ? 2.782   -43.901 55.698  1.00 64.11  ? 68  TYR B OH  1 
ATOM   3305  N N   . GLU B 2 69  ? 1.571   -49.745 52.363  1.00 76.35  ? 69  GLU B N   1 
ATOM   3306  C CA  . GLU B 2 69  ? 0.499   -50.246 53.226  1.00 70.74  ? 69  GLU B CA  1 
ATOM   3307  C C   . GLU B 2 69  ? 0.872   -51.601 53.798  1.00 68.85  ? 69  GLU B C   1 
ATOM   3308  O O   . GLU B 2 69  ? 0.513   -51.931 54.939  1.00 93.46  ? 69  GLU B O   1 
ATOM   3309  C CB  . GLU B 2 69  ? -0.836  -50.375 52.466  1.00 80.52  ? 69  GLU B CB  1 
ATOM   3310  C CG  . GLU B 2 69  ? -1.303  -49.163 51.652  1.00 90.53  ? 69  GLU B CG  1 
ATOM   3311  C CD  . GLU B 2 69  ? -0.470  -48.825 50.415  1.00 113.46 ? 69  GLU B CD  1 
ATOM   3312  O OE1 . GLU B 2 69  ? 0.607   -49.420 50.209  1.00 108.54 ? 69  GLU B OE1 1 
ATOM   3313  O OE2 . GLU B 2 69  ? -0.885  -47.912 49.665  1.00 96.11  ? 69  GLU B OE2 1 
ATOM   3314  N N   . LYS B 2 70  ? 1.548   -52.401 52.973  1.00 71.78  ? 70  LYS B N   1 
ATOM   3315  C CA  . LYS B 2 70  ? 2.013   -53.712 53.385  1.00 74.24  ? 70  LYS B CA  1 
ATOM   3316  C C   . LYS B 2 70  ? 3.020   -53.523 54.499  1.00 73.47  ? 70  LYS B C   1 
ATOM   3317  O O   . LYS B 2 70  ? 3.294   -54.446 55.276  1.00 82.88  ? 70  LYS B O   1 
ATOM   3318  C CB  . LYS B 2 70  ? 2.643   -54.444 52.210  1.00 61.93  ? 70  LYS B CB  1 
ATOM   3319  N N   . GLN B 2 71  ? 3.585   -52.316 54.548  1.00 80.70  ? 71  GLN B N   1 
ATOM   3320  C CA  . GLN B 2 71  ? 4.430   -51.925 55.652  1.00 87.23  ? 71  GLN B CA  1 
ATOM   3321  C C   . GLN B 2 71  ? 3.618   -51.723 56.916  1.00 96.56  ? 71  GLN B C   1 
ATOM   3322  O O   . GLN B 2 71  ? 2.519   -51.164 56.929  1.00 89.40  ? 71  GLN B O   1 
ATOM   3323  C CB  . GLN B 2 71  ? 5.238   -50.662 55.328  1.00 73.47  ? 71  GLN B CB  1 
ATOM   3324  C CG  . GLN B 2 71  ? 6.378   -50.372 56.293  1.00 94.40  ? 71  GLN B CG  1 
ATOM   3325  C CD  . GLN B 2 71  ? 6.994   -49.027 56.025  1.00 88.87  ? 71  GLN B CD  1 
ATOM   3326  O OE1 . GLN B 2 71  ? 7.563   -48.809 54.963  1.00 86.33  ? 71  GLN B OE1 1 
ATOM   3327  N NE2 . GLN B 2 71  ? 6.810   -48.089 56.950  1.00 84.11  ? 71  GLN B NE2 1 
ATOM   3328  N N   . ASN B 2 72  ? 4.243   -52.196 57.978  1.00 97.51  ? 72  ASN B N   1 
ATOM   3329  C CA  . ASN B 2 72  ? 3.749   -52.238 59.334  1.00 110.55 ? 72  ASN B CA  1 
ATOM   3330  C C   . ASN B 2 72  ? 4.826   -51.588 60.165  1.00 101.74 ? 72  ASN B C   1 
ATOM   3331  O O   . ASN B 2 72  ? 5.923   -51.342 59.603  1.00 91.19  ? 72  ASN B O   1 
ATOM   3332  C CB  . ASN B 2 72  ? 3.392   -53.701 59.735  1.00 119.37 ? 72  ASN B CB  1 
ATOM   3333  C CG  . ASN B 2 72  ? 4.506   -54.707 59.401  1.00 124.32 ? 72  ASN B CG  1 
ATOM   3334  O OD1 . ASN B 2 72  ? 5.304   -54.458 58.481  1.00 124.88 ? 72  ASN B OD1 1 
ATOM   3335  N ND2 . ASN B 2 72  ? 4.575   -55.835 60.145  1.00 103.48 ? 72  ASN B ND2 1 
ATOM   3336  N N   . PHE B 2 73  ? 4.473   -51.102 61.357  1.00 102.03 ? 73  PHE B N   1 
ATOM   3337  C CA  . PHE B 2 73  ? 5.433   -51.050 62.471  1.00 115.99 ? 73  PHE B CA  1 
ATOM   3338  C C   . PHE B 2 73  ? 4.931   -50.077 63.543  1.00 113.79 ? 73  PHE B C   1 
ATOM   3339  O O   . PHE B 2 73  ? 3.817   -49.576 63.439  1.00 96.11  ? 73  PHE B O   1 
ATOM   3340  C CB  . PHE B 2 73  ? 6.876   -50.754 62.036  1.00 112.31 ? 73  PHE B CB  1 
ATOM   3341  C CG  . PHE B 2 73  ? 7.685   -51.985 61.780  1.00 125.49 ? 73  PHE B CG  1 
ATOM   3342  C CD1 . PHE B 2 73  ? 7.090   -53.238 61.511  1.00 121.56 ? 73  PHE B CD1 1 
ATOM   3343  C CD2 . PHE B 2 73  ? 9.027   -51.917 61.890  1.00 119.46 ? 73  PHE B CD2 1 
ATOM   3344  C CE1 . PHE B 2 73  ? 7.846   -54.362 61.324  1.00 126.56 ? 73  PHE B CE1 1 
ATOM   3345  C CE2 . PHE B 2 73  ? 9.790   -53.054 61.691  1.00 119.64 ? 73  PHE B CE2 1 
ATOM   3346  C CZ  . PHE B 2 73  ? 9.245   -54.248 61.403  1.00 129.87 ? 73  PHE B CZ  1 
ATOM   3347  N N   . ALA B 2 74  ? 5.761   -49.809 64.554  1.00 119.00 ? 74  ALA B N   1 
ATOM   3348  C CA  . ALA B 2 74  ? 5.375   -49.492 65.948  1.00 97.99  ? 74  ALA B CA  1 
ATOM   3349  C C   . ALA B 2 74  ? 4.443   -48.320 66.309  1.00 103.03 ? 74  ALA B C   1 
ATOM   3350  O O   . ALA B 2 74  ? 3.684   -48.445 67.276  1.00 114.09 ? 74  ALA B O   1 
ATOM   3351  C CB  . ALA B 2 74  ? 6.673   -49.303 66.751  1.00 104.84 ? 74  ALA B CB  1 
ATOM   3352  N N   . LEU B 2 75  ? 4.499   -47.189 65.609  1.00 79.53  ? 75  LEU B N   1 
ATOM   3353  C CA  . LEU B 2 75  ? 3.716   -46.039 66.075  1.00 99.11  ? 75  LEU B CA  1 
ATOM   3354  C C   . LEU B 2 75  ? 2.210   -46.285 66.047  1.00 113.88 ? 75  LEU B C   1 
ATOM   3355  O O   . LEU B 2 75  ? 1.505   -45.936 66.993  1.00 118.94 ? 75  LEU B O   1 
ATOM   3356  C CB  . LEU B 2 75  ? 4.029   -44.779 65.267  1.00 87.58  ? 75  LEU B CB  1 
ATOM   3357  C CG  . LEU B 2 75  ? 5.295   -44.025 65.661  1.00 76.60  ? 75  LEU B CG  1 
ATOM   3358  C CD1 . LEU B 2 75  ? 5.499   -42.831 64.748  1.00 84.52  ? 75  LEU B CD1 1 
ATOM   3359  C CD2 . LEU B 2 75  ? 5.207   -43.595 67.116  1.00 71.72  ? 75  LEU B CD2 1 
ATOM   3360  N N   . GLY B 2 76  ? 1.713   -46.881 64.971  1.00 120.31 ? 76  GLY B N   1 
ATOM   3361  C CA  . GLY B 2 76  ? 0.285   -47.103 64.845  1.00 94.76  ? 76  GLY B CA  1 
ATOM   3362  C C   . GLY B 2 76  ? -0.117  -47.523 63.450  1.00 102.63 ? 76  GLY B C   1 
ATOM   3363  O O   . GLY B 2 76  ? 0.677   -48.105 62.712  1.00 124.36 ? 76  GLY B O   1 
ATOM   3364  N N   . LYS B 2 77  ? -1.361  -47.232 63.090  1.00 98.96  ? 77  LYS B N   1 
ATOM   3365  C CA  . LYS B 2 77  ? -1.818  -47.475 61.734  1.00 115.61 ? 77  LYS B CA  1 
ATOM   3366  C C   . LYS B 2 77  ? -1.369  -46.307 60.882  1.00 109.11 ? 77  LYS B C   1 
ATOM   3367  O O   . LYS B 2 77  ? -1.590  -45.150 61.244  1.00 99.25  ? 77  LYS B O   1 
ATOM   3368  C CB  . LYS B 2 77  ? -3.338  -47.632 61.670  1.00 80.82  ? 77  LYS B CB  1 
ATOM   3369  N N   . GLY B 2 78  ? -0.724  -46.603 59.761  1.00 99.02  ? 78  GLY B N   1 
ATOM   3370  C CA  . GLY B 2 78  ? -0.322  -45.551 58.852  1.00 98.22  ? 78  GLY B CA  1 
ATOM   3371  C C   . GLY B 2 78  ? -1.565  -44.834 58.370  1.00 106.58 ? 78  GLY B C   1 
ATOM   3372  O O   . GLY B 2 78  ? -2.618  -45.459 58.185  1.00 125.26 ? 78  GLY B O   1 
ATOM   3373  N N   . ASP B 2 79  ? -1.438  -43.523 58.183  1.00 96.96  ? 79  ASP B N   1 
ATOM   3374  C CA  . ASP B 2 79  ? -2.536  -42.682 57.726  1.00 100.77 ? 79  ASP B CA  1 
ATOM   3375  C C   . ASP B 2 79  ? -3.071  -43.202 56.410  1.00 95.57  ? 79  ASP B C   1 
ATOM   3376  O O   . ASP B 2 79  ? -2.320  -43.671 55.563  1.00 99.31  ? 79  ASP B O   1 
ATOM   3377  C CB  . ASP B 2 79  ? -2.088  -41.224 57.580  1.00 95.42  ? 79  ASP B CB  1 
ATOM   3378  C CG  . ASP B 2 79  ? -3.248  -40.257 57.427  1.00 107.49 ? 79  ASP B CG  1 
ATOM   3379  O OD1 . ASP B 2 79  ? -4.347  -40.694 57.031  1.00 108.62 ? 79  ASP B OD1 1 
ATOM   3380  O OD2 . ASP B 2 79  ? -3.055  -39.050 57.689  1.00 103.48 ? 79  ASP B OD2 1 
ATOM   3381  N N   . GLU B 2 80  ? -4.377  -43.079 56.242  1.00 101.65 ? 80  GLU B N   1 
ATOM   3382  C CA  . GLU B 2 80  ? -5.059  -43.616 55.086  1.00 99.93  ? 80  GLU B CA  1 
ATOM   3383  C C   . GLU B 2 80  ? -5.219  -42.498 54.058  1.00 88.79  ? 80  GLU B C   1 
ATOM   3384  O O   . GLU B 2 80  ? -5.701  -42.719 52.945  1.00 90.59  ? 80  GLU B O   1 
ATOM   3385  C CB  . GLU B 2 80  ? -6.404  -44.211 55.511  1.00 96.07  ? 80  GLU B CB  1 
ATOM   3386  C CG  . GLU B 2 80  ? -6.262  -45.435 56.441  1.00 103.29 ? 80  GLU B CG  1 
ATOM   3387  C CD  . GLU B 2 80  ? -5.960  -45.081 57.899  1.00 121.84 ? 80  GLU B CD  1 
ATOM   3388  O OE1 . GLU B 2 80  ? -5.871  -43.881 58.236  1.00 136.20 ? 80  GLU B OE1 1 
ATOM   3389  O OE2 . GLU B 2 80  ? -5.780  -46.016 58.709  1.00 110.54 ? 80  GLU B OE2 1 
ATOM   3390  N N   . GLU B 2 81  ? -4.733  -41.313 54.421  1.00 87.93  ? 81  GLU B N   1 
ATOM   3391  C CA  . GLU B 2 81  ? -4.599  -40.199 53.487  1.00 84.40  ? 81  GLU B CA  1 
ATOM   3392  C C   . GLU B 2 81  ? -3.545  -40.492 52.433  1.00 86.97  ? 81  GLU B C   1 
ATOM   3393  O O   . GLU B 2 81  ? -3.806  -40.510 51.228  1.00 98.42  ? 81  GLU B O   1 
ATOM   3394  C CB  . GLU B 2 81  ? -4.153  -38.956 54.255  1.00 99.72  ? 81  GLU B CB  1 
ATOM   3395  C CG  . GLU B 2 81  ? -5.170  -37.908 54.642  1.00 108.75 ? 81  GLU B CG  1 
ATOM   3396  C CD  . GLU B 2 81  ? -4.584  -36.934 55.655  1.00 123.23 ? 81  GLU B CD  1 
ATOM   3397  O OE1 . GLU B 2 81  ? -3.347  -36.782 55.667  1.00 124.43 ? 81  GLU B OE1 1 
ATOM   3398  O OE2 . GLU B 2 81  ? -5.345  -36.321 56.430  1.00 108.27 ? 81  GLU B OE2 1 
ATOM   3399  N N   . VAL B 2 82  ? -2.361  -40.811 52.936  1.00 73.16  ? 82  VAL B N   1 
ATOM   3400  C CA  . VAL B 2 82  ? -1.208  -41.160 52.127  1.00 78.50  ? 82  VAL B CA  1 
ATOM   3401  C C   . VAL B 2 82  ? -1.344  -42.569 51.572  1.00 77.15  ? 82  VAL B C   1 
ATOM   3402  O O   . VAL B 2 82  ? -0.798  -42.880 50.524  1.00 75.70  ? 82  VAL B O   1 
ATOM   3403  C CB  . VAL B 2 82  ? 0.094   -41.001 52.929  1.00 67.56  ? 82  VAL B CB  1 
ATOM   3404  C CG1 . VAL B 2 82  ? 0.236   -39.565 53.407  1.00 59.25  ? 82  VAL B CG1 1 
ATOM   3405  C CG2 . VAL B 2 82  ? 0.102   -41.954 54.103  1.00 79.18  ? 82  VAL B CG2 1 
ATOM   3406  N N   . ILE B 2 83  ? -2.026  -43.437 52.308  1.00 55.34  ? 83  ILE B N   1 
ATOM   3407  C CA  . ILE B 2 83  ? -2.278  -44.782 51.823  1.00 68.26  ? 83  ILE B CA  1 
ATOM   3408  C C   . ILE B 2 83  ? -3.178  -44.714 50.589  1.00 77.08  ? 83  ILE B C   1 
ATOM   3409  O O   . ILE B 2 83  ? -2.877  -45.331 49.558  1.00 77.87  ? 83  ILE B O   1 
ATOM   3410  C CB  . ILE B 2 83  ? -2.913  -45.649 52.922  1.00 75.45  ? 83  ILE B CB  1 
ATOM   3411  C CG1 . ILE B 2 83  ? -1.821  -46.262 53.798  1.00 68.40  ? 83  ILE B CG1 1 
ATOM   3412  C CG2 . ILE B 2 83  ? -3.754  -46.741 52.323  1.00 87.80  ? 83  ILE B CG2 1 
ATOM   3413  C CD1 . ILE B 2 83  ? -2.349  -46.955 55.032  1.00 75.46  ? 83  ILE B CD1 1 
ATOM   3414  N N   . SER B 2 84  ? -4.247  -43.924 50.674  1.00 77.41  ? 84  SER B N   1 
ATOM   3415  C CA  . SER B 2 84  ? -5.140  -43.767 49.530  1.00 79.86  ? 84  SER B CA  1 
ATOM   3416  C C   . SER B 2 84  ? -4.428  -43.066 48.375  1.00 65.29  ? 84  SER B C   1 
ATOM   3417  O O   . SER B 2 84  ? -4.516  -43.509 47.224  1.00 71.75  ? 84  SER B O   1 
ATOM   3418  C CB  . SER B 2 84  ? -6.406  -42.997 49.924  1.00 78.69  ? 84  SER B CB  1 
ATOM   3419  O OG  . SER B 2 84  ? -6.114  -41.674 50.339  1.00 69.11  ? 84  SER B OG  1 
ATOM   3420  N N   . THR B 2 85  ? -3.703  -41.992 48.687  1.00 51.54  ? 85  THR B N   1 
ATOM   3421  C CA  . THR B 2 85  ? -2.957  -41.260 47.664  1.00 53.27  ? 85  THR B CA  1 
ATOM   3422  C C   . THR B 2 85  ? -1.958  -42.157 46.930  1.00 53.85  ? 85  THR B C   1 
ATOM   3423  O O   . THR B 2 85  ? -1.901  -42.157 45.701  1.00 64.22  ? 85  THR B O   1 
ATOM   3424  C CB  . THR B 2 85  ? -2.206  -40.056 48.263  1.00 49.89  ? 85  THR B CB  1 
ATOM   3425  O OG1 . THR B 2 85  ? -3.122  -39.229 48.992  1.00 59.57  ? 85  THR B OG1 1 
ATOM   3426  C CG2 . THR B 2 85  ? -1.568  -39.233 47.161  1.00 48.90  ? 85  THR B CG2 1 
ATOM   3427  N N   . LEU B 2 86  ? -1.175  -42.914 47.690  1.00 50.27  ? 86  LEU B N   1 
ATOM   3428  C CA  . LEU B 2 86  ? -0.187  -43.835 47.133  1.00 55.35  ? 86  LEU B CA  1 
ATOM   3429  C C   . LEU B 2 86  ? -0.828  -44.956 46.323  1.00 46.74  ? 86  LEU B C   1 
ATOM   3430  O O   . LEU B 2 86  ? -0.264  -45.413 45.331  1.00 57.21  ? 86  LEU B O   1 
ATOM   3431  C CB  . LEU B 2 86  ? 0.674   -44.440 48.242  1.00 59.16  ? 86  LEU B CB  1 
ATOM   3432  C CG  . LEU B 2 86  ? 2.013   -43.764 48.542  1.00 49.32  ? 86  LEU B CG  1 
ATOM   3433  C CD1 . LEU B 2 86  ? 1.855   -42.264 48.753  1.00 34.51  ? 86  LEU B CD1 1 
ATOM   3434  C CD2 . LEU B 2 86  ? 2.646   -44.410 49.751  1.00 52.90  ? 86  LEU B CD2 1 
ATOM   3435  N N   . HIS B 2 87  ? -1.997  -45.410 46.763  1.00 57.74  ? 87  HIS B N   1 
ATOM   3436  C CA  . HIS B 2 87  ? -2.725  -46.447 46.043  1.00 62.87  ? 87  HIS B CA  1 
ATOM   3437  C C   . HIS B 2 87  ? -3.132  -45.917 44.667  1.00 59.37  ? 87  HIS B C   1 
ATOM   3438  O O   . HIS B 2 87  ? -2.913  -46.565 43.627  1.00 53.69  ? 87  HIS B O   1 
ATOM   3439  C CB  . HIS B 2 87  ? -3.953  -46.882 46.848  1.00 61.64  ? 87  HIS B CB  1 
ATOM   3440  C CG  . HIS B 2 87  ? -4.497  -48.221 46.457  1.00 76.71  ? 87  HIS B CG  1 
ATOM   3441  N ND1 . HIS B 2 87  ? -3.954  -49.404 46.908  1.00 64.87  ? 87  HIS B ND1 1 
ATOM   3442  C CD2 . HIS B 2 87  ? -5.545  -48.563 45.670  1.00 75.25  ? 87  HIS B CD2 1 
ATOM   3443  C CE1 . HIS B 2 87  ? -4.638  -50.419 46.409  1.00 84.82  ? 87  HIS B CE1 1 
ATOM   3444  N NE2 . HIS B 2 87  ? -5.608  -49.936 45.655  1.00 87.06  ? 87  HIS B NE2 1 
ATOM   3445  N N   . TYR B 2 88  ? -3.693  -44.711 44.675  1.00 48.18  ? 88  TYR B N   1 
ATOM   3446  C CA  . TYR B 2 88  ? -4.102  -44.028 43.453  1.00 58.86  ? 88  TYR B CA  1 
ATOM   3447  C C   . TYR B 2 88  ? -2.920  -43.836 42.502  1.00 54.82  ? 88  TYR B C   1 
ATOM   3448  O O   . TYR B 2 88  ? -3.000  -44.159 41.308  1.00 54.83  ? 88  TYR B O   1 
ATOM   3449  C CB  . TYR B 2 88  ? -4.732  -42.678 43.800  1.00 54.90  ? 88  TYR B CB  1 
ATOM   3450  C CG  . TYR B 2 88  ? -5.437  -41.997 42.651  1.00 68.37  ? 88  TYR B CG  1 
ATOM   3451  C CD1 . TYR B 2 88  ? -6.681  -42.435 42.215  1.00 69.35  ? 88  TYR B CD1 1 
ATOM   3452  C CD2 . TYR B 2 88  ? -4.866  -40.908 42.010  1.00 66.74  ? 88  TYR B CD2 1 
ATOM   3453  C CE1 . TYR B 2 88  ? -7.332  -41.811 41.168  1.00 67.61  ? 88  TYR B CE1 1 
ATOM   3454  C CE2 . TYR B 2 88  ? -5.509  -40.275 40.964  1.00 71.48  ? 88  TYR B CE2 1 
ATOM   3455  C CZ  . TYR B 2 88  ? -6.741  -40.731 40.547  1.00 74.62  ? 88  TYR B CZ  1 
ATOM   3456  O OH  . TYR B 2 88  ? -7.385  -40.105 39.504  1.00 64.87  ? 88  TYR B OH  1 
ATOM   3457  N N   . PHE B 2 89  ? -1.822  -43.316 43.045  1.00 54.18  ? 89  PHE B N   1 
ATOM   3458  C CA  . PHE B 2 89  ? -0.598  -43.113 42.277  1.00 44.34  ? 89  PHE B CA  1 
ATOM   3459  C C   . PHE B 2 89  ? -0.077  -44.409 41.675  1.00 46.50  ? 89  PHE B C   1 
ATOM   3460  O O   . PHE B 2 89  ? 0.364   -44.426 40.530  1.00 50.49  ? 89  PHE B O   1 
ATOM   3461  C CB  . PHE B 2 89  ? 0.487   -42.480 43.149  1.00 39.74  ? 89  PHE B CB  1 
ATOM   3462  C CG  . PHE B 2 89  ? 0.347   -40.995 43.310  1.00 59.82  ? 89  PHE B CG  1 
ATOM   3463  C CD1 . PHE B 2 89  ? -0.339  -40.245 42.369  1.00 63.36  ? 89  PHE B CD1 1 
ATOM   3464  C CD2 . PHE B 2 89  ? 0.913   -40.347 44.395  1.00 61.68  ? 89  PHE B CD2 1 
ATOM   3465  C CE1 . PHE B 2 89  ? -0.466  -38.876 42.513  1.00 68.44  ? 89  PHE B CE1 1 
ATOM   3466  C CE2 . PHE B 2 89  ? 0.790   -38.978 44.543  1.00 58.11  ? 89  PHE B CE2 1 
ATOM   3467  C CZ  . PHE B 2 89  ? 0.099   -38.242 43.602  1.00 64.11  ? 89  PHE B CZ  1 
ATOM   3468  N N   . SER B 2 90  ? -0.126  -45.490 42.447  1.00 38.32  ? 90  SER B N   1 
ATOM   3469  C CA  . SER B 2 90  ? 0.299   -46.794 41.951  1.00 49.76  ? 90  SER B CA  1 
ATOM   3470  C C   . SER B 2 90  ? -0.560  -47.219 40.767  1.00 46.86  ? 90  SER B C   1 
ATOM   3471  O O   . SER B 2 90  ? -0.053  -47.777 39.789  1.00 56.22  ? 90  SER B O   1 
ATOM   3472  C CB  . SER B 2 90  ? 0.233   -47.847 43.058  1.00 44.89  ? 90  SER B CB  1 
ATOM   3473  O OG  . SER B 2 90  ? -1.077  -48.370 43.183  1.00 78.73  ? 90  SER B OG  1 
ATOM   3474  N N   . LYS B 2 91  ? -1.859  -46.941 40.853  1.00 49.61  ? 91  LYS B N   1 
ATOM   3475  C CA  . LYS B 2 91  ? -2.759  -47.230 39.737  1.00 52.12  ? 91  LYS B CA  1 
ATOM   3476  C C   . LYS B 2 91  ? -2.390  -46.441 38.472  1.00 52.12  ? 91  LYS B C   1 
ATOM   3477  O O   . LYS B 2 91  ? -2.274  -47.012 37.374  1.00 40.41  ? 91  LYS B O   1 
ATOM   3478  C CB  . LYS B 2 91  ? -4.207  -46.931 40.136  1.00 39.63  ? 91  LYS B CB  1 
ATOM   3479  N N   . VAL B 2 92  ? -2.195  -45.133 38.634  1.00 42.55  ? 92  VAL B N   1 
ATOM   3480  C CA  . VAL B 2 92  ? -1.784  -44.273 37.522  1.00 48.13  ? 92  VAL B CA  1 
ATOM   3481  C C   . VAL B 2 92  ? -0.483  -44.761 36.877  1.00 49.26  ? 92  VAL B C   1 
ATOM   3482  O O   . VAL B 2 92  ? -0.379  -44.863 35.649  1.00 49.42  ? 92  VAL B O   1 
ATOM   3483  C CB  . VAL B 2 92  ? -1.601  -42.814 37.981  1.00 53.29  ? 92  VAL B CB  1 
ATOM   3484  C CG1 . VAL B 2 92  ? -1.019  -41.970 36.854  1.00 39.99  ? 92  VAL B CG1 1 
ATOM   3485  C CG2 . VAL B 2 92  ? -2.926  -42.235 38.449  1.00 46.52  ? 92  VAL B CG2 1 
ATOM   3486  N N   . VAL B 2 93  ? 0.499   -45.063 37.720  1.00 50.73  ? 93  VAL B N   1 
ATOM   3487  C CA  . VAL B 2 93  ? 1.780   -45.594 37.270  1.00 43.17  ? 93  VAL B CA  1 
ATOM   3488  C C   . VAL B 2 93  ? 1.590   -46.901 36.503  1.00 45.04  ? 93  VAL B C   1 
ATOM   3489  O O   . VAL B 2 93  ? 2.281   -47.146 35.518  1.00 61.83  ? 93  VAL B O   1 
ATOM   3490  C CB  . VAL B 2 93  ? 2.746   -45.818 38.457  1.00 51.54  ? 93  VAL B CB  1 
ATOM   3491  C CG1 . VAL B 2 93  ? 3.968   -46.604 38.020  1.00 30.88  ? 93  VAL B CG1 1 
ATOM   3492  C CG2 . VAL B 2 93  ? 3.168   -44.485 39.052  1.00 36.83  ? 93  VAL B CG2 1 
ATOM   3493  N N   . ASP B 2 94  ? 0.654   -47.736 36.946  1.00 39.29  ? 94  ASP B N   1 
ATOM   3494  C CA  . ASP B 2 94  ? 0.333   -48.956 36.206  1.00 44.11  ? 94  ASP B CA  1 
ATOM   3495  C C   . ASP B 2 94  ? -0.206  -48.655 34.810  1.00 55.08  ? 94  ASP B C   1 
ATOM   3496  O O   . ASP B 2 94  ? 0.183   -49.301 33.833  1.00 41.91  ? 94  ASP B O   1 
ATOM   3497  C CB  . ASP B 2 94  ? -0.671  -49.812 36.978  1.00 44.71  ? 94  ASP B CB  1 
ATOM   3498  C CG  . ASP B 2 94  ? -0.026  -50.581 38.112  1.00 74.03  ? 94  ASP B CG  1 
ATOM   3499  O OD1 . ASP B 2 94  ? 1.115   -51.056 37.930  1.00 72.31  ? 94  ASP B OD1 1 
ATOM   3500  O OD2 . ASP B 2 94  ? -0.659  -50.715 39.181  1.00 85.14  ? 94  ASP B OD2 1 
ATOM   3501  N N   . GLU B 2 95  ? -1.111  -47.685 34.716  1.00 53.25  ? 95  GLU B N   1 
ATOM   3502  C CA  . GLU B 2 95  ? -1.642  -47.285 33.413  1.00 54.07  ? 95  GLU B CA  1 
ATOM   3503  C C   . GLU B 2 95  ? -0.533  -46.787 32.470  1.00 58.07  ? 95  GLU B C   1 
ATOM   3504  O O   . GLU B 2 95  ? -0.440  -47.210 31.301  1.00 61.82  ? 95  GLU B O   1 
ATOM   3505  C CB  . GLU B 2 95  ? -2.717  -46.211 33.590  1.00 48.77  ? 95  GLU B CB  1 
ATOM   3506  C CG  . GLU B 2 95  ? -4.035  -46.739 34.134  1.00 60.07  ? 95  GLU B CG  1 
ATOM   3507  C CD  . GLU B 2 95  ? -5.079  -45.652 34.309  1.00 103.75 ? 95  GLU B CD  1 
ATOM   3508  O OE1 . GLU B 2 95  ? -5.539  -45.101 33.286  1.00 79.39  ? 95  GLU B OE1 1 
ATOM   3509  O OE2 . GLU B 2 95  ? -5.444  -45.355 35.466  1.00 108.34 ? 95  GLU B OE2 1 
ATOM   3510  N N   . LEU B 2 96  ? 0.311   -45.898 32.992  1.00 54.57  ? 96  LEU B N   1 
ATOM   3511  C CA  . LEU B 2 96  ? 1.444   -45.371 32.235  1.00 54.10  ? 96  LEU B CA  1 
ATOM   3512  C C   . LEU B 2 96  ? 2.367   -46.500 31.790  1.00 36.49  ? 96  LEU B C   1 
ATOM   3513  O O   . LEU B 2 96  ? 2.878   -46.500 30.670  1.00 47.76  ? 96  LEU B O   1 
ATOM   3514  C CB  . LEU B 2 96  ? 2.220   -44.353 33.076  1.00 35.09  ? 96  LEU B CB  1 
ATOM   3515  C CG  . LEU B 2 96  ? 3.301   -43.537 32.366  1.00 49.45  ? 96  LEU B CG  1 
ATOM   3516  C CD1 . LEU B 2 96  ? 2.785   -43.006 31.039  1.00 56.20  ? 96  LEU B CD1 1 
ATOM   3517  C CD2 . LEU B 2 96  ? 3.775   -42.400 33.257  1.00 44.66  ? 96  LEU B CD2 1 
ATOM   3518  N N   . ASN B 2 97  ? 2.577   -47.455 32.686  1.00 33.82  ? 97  ASN B N   1 
ATOM   3519  C CA  . ASN B 2 97  ? 3.289   -48.680 32.372  1.00 39.51  ? 97  ASN B CA  1 
ATOM   3520  C C   . ASN B 2 97  ? 2.676   -49.410 31.184  1.00 52.59  ? 97  ASN B C   1 
ATOM   3521  O O   . ASN B 2 97  ? 3.396   -49.897 30.318  1.00 55.57  ? 97  ASN B O   1 
ATOM   3522  C CB  . ASN B 2 97  ? 3.330   -49.594 33.589  1.00 47.47  ? 97  ASN B CB  1 
ATOM   3523  C CG  . ASN B 2 97  ? 3.866   -50.976 33.259  1.00 53.21  ? 97  ASN B CG  1 
ATOM   3524  O OD1 . ASN B 2 97  ? 3.139   -51.840 32.767  1.00 80.30  ? 97  ASN B OD1 1 
ATOM   3525  N ND2 . ASN B 2 97  ? 5.154   -51.180 33.501  1.00 98.50  ? 97  ASN B ND2 1 
ATOM   3526  N N   . LEU B 2 98  ? 1.348   -49.502 31.153  1.00 55.61  ? 98  LEU B N   1 
ATOM   3527  C CA  . LEU B 2 98  ? 0.659   -50.150 30.035  1.00 52.05  ? 98  LEU B CA  1 
ATOM   3528  C C   . LEU B 2 98  ? 0.995   -49.438 28.729  1.00 52.26  ? 98  LEU B C   1 
ATOM   3529  O O   . LEU B 2 98  ? 1.371   -50.079 27.739  1.00 50.26  ? 98  LEU B O   1 
ATOM   3530  C CB  . LEU B 2 98  ? -0.857  -50.167 30.261  1.00 48.98  ? 98  LEU B CB  1 
ATOM   3531  C CG  . LEU B 2 98  ? -1.378  -51.139 31.323  1.00 49.21  ? 98  LEU B CG  1 
ATOM   3532  C CD1 . LEU B 2 98  ? -2.888  -51.033 31.462  1.00 61.12  ? 98  LEU B CD1 1 
ATOM   3533  C CD2 . LEU B 2 98  ? -0.971  -52.563 30.978  1.00 38.92  ? 98  LEU B CD2 1 
ATOM   3534  N N   . LEU B 2 99  ? 0.861   -48.114 28.736  1.00 38.39  ? 99  LEU B N   1 
ATOM   3535  C CA  . LEU B 2 99  ? 1.265   -47.308 27.578  1.00 35.33  ? 99  LEU B CA  1 
ATOM   3536  C C   . LEU B 2 99  ? 2.700   -47.588 27.121  1.00 50.18  ? 99  LEU B C   1 
ATOM   3537  O O   . LEU B 2 99  ? 2.945   -47.843 25.936  1.00 56.27  ? 99  LEU B O   1 
ATOM   3538  C CB  . LEU B 2 99  ? 1.103   -45.815 27.866  1.00 34.99  ? 99  LEU B CB  1 
ATOM   3539  C CG  . LEU B 2 99  ? -0.274  -45.197 27.611  1.00 60.55  ? 99  LEU B CG  1 
ATOM   3540  C CD1 . LEU B 2 99  ? -1.402  -45.967 28.279  1.00 63.84  ? 99  LEU B CD1 1 
ATOM   3541  C CD2 . LEU B 2 99  ? -0.275  -43.746 28.051  1.00 65.08  ? 99  LEU B CD2 1 
ATOM   3542  N N   . HIS B 2 100 ? 3.642   -47.534 28.059  1.00 51.42  ? 100 HIS B N   1 
ATOM   3543  C CA  . HIS B 2 100 ? 5.050   -47.764 27.745  1.00 56.00  ? 100 HIS B CA  1 
ATOM   3544  C C   . HIS B 2 100 ? 5.272   -49.148 27.144  1.00 56.33  ? 100 HIS B C   1 
ATOM   3545  O O   . HIS B 2 100 ? 6.063   -49.311 26.214  1.00 58.26  ? 100 HIS B O   1 
ATOM   3546  C CB  . HIS B 2 100 ? 5.916   -47.605 28.998  1.00 47.22  ? 100 HIS B CB  1 
ATOM   3547  C CG  . HIS B 2 100 ? 6.247   -46.184 29.332  1.00 46.62  ? 100 HIS B CG  1 
ATOM   3548  N ND1 . HIS B 2 100 ? 7.091   -45.415 28.561  1.00 52.60  ? 100 HIS B ND1 1 
ATOM   3549  C CD2 . HIS B 2 100 ? 5.861   -45.398 30.366  1.00 52.88  ? 100 HIS B CD2 1 
ATOM   3550  C CE1 . HIS B 2 100 ? 7.202   -44.212 29.099  1.00 57.27  ? 100 HIS B CE1 1 
ATOM   3551  N NE2 . HIS B 2 100 ? 6.467   -44.177 30.195  1.00 56.64  ? 100 HIS B NE2 1 
ATOM   3552  N N   . THR B 2 101 ? 4.574   -50.141 27.688  1.00 54.63  ? 101 THR B N   1 
ATOM   3553  C CA  . THR B 2 101 ? 4.665   -51.510 27.193  1.00 55.96  ? 101 THR B CA  1 
ATOM   3554  C C   . THR B 2 101 ? 4.180   -51.596 25.754  1.00 55.80  ? 101 THR B C   1 
ATOM   3555  O O   . THR B 2 101 ? 4.818   -52.230 24.906  1.00 63.25  ? 101 THR B O   1 
ATOM   3556  C CB  . THR B 2 101 ? 3.854   -52.483 28.064  1.00 44.39  ? 101 THR B CB  1 
ATOM   3557  O OG1 . THR B 2 101 ? 4.269   -52.361 29.429  1.00 55.76  ? 101 THR B OG1 1 
ATOM   3558  C CG2 . THR B 2 101 ? 4.069   -53.915 27.603  1.00 33.23  ? 101 THR B CG2 1 
ATOM   3559  N N   . GLU B 2 102 ? 3.053   -50.945 25.480  1.00 55.53  ? 102 GLU B N   1 
ATOM   3560  C CA  . GLU B 2 102 ? 2.495   -50.953 24.135  1.00 61.06  ? 102 GLU B CA  1 
ATOM   3561  C C   . GLU B 2 102 ? 3.447   -50.277 23.152  1.00 62.75  ? 102 GLU B C   1 
ATOM   3562  O O   . GLU B 2 102 ? 3.636   -50.757 22.031  1.00 60.88  ? 102 GLU B O   1 
ATOM   3563  C CB  . GLU B 2 102 ? 1.130   -50.258 24.115  1.00 53.85  ? 102 GLU B CB  1 
ATOM   3564  C CG  . GLU B 2 102 ? 0.482   -50.172 22.737  1.00 89.83  ? 102 GLU B CG  1 
ATOM   3565  C CD  . GLU B 2 102 ? 0.036   -51.522 22.199  1.00 104.90 ? 102 GLU B CD  1 
ATOM   3566  O OE1 . GLU B 2 102 ? -0.027  -52.493 22.982  1.00 110.59 ? 102 GLU B OE1 1 
ATOM   3567  O OE2 . GLU B 2 102 ? -0.256  -51.609 20.987  1.00 88.67  ? 102 GLU B OE2 1 
ATOM   3568  N N   . LEU B 2 103 ? 4.065   -49.181 23.583  1.00 57.76  ? 103 LEU B N   1 
ATOM   3569  C CA  . LEU B 2 103 ? 5.058   -48.500 22.756  1.00 52.01  ? 103 LEU B CA  1 
ATOM   3570  C C   . LEU B 2 103 ? 6.270   -49.391 22.483  1.00 48.62  ? 103 LEU B C   1 
ATOM   3571  O O   . LEU B 2 103 ? 6.778   -49.426 21.364  1.00 51.25  ? 103 LEU B O   1 
ATOM   3572  C CB  . LEU B 2 103 ? 5.503   -47.192 23.413  1.00 55.98  ? 103 LEU B CB  1 
ATOM   3573  C CG  . LEU B 2 103 ? 6.603   -46.405 22.695  1.00 43.47  ? 103 LEU B CG  1 
ATOM   3574  C CD1 . LEU B 2 103 ? 6.242   -46.181 21.235  1.00 45.84  ? 103 LEU B CD1 1 
ATOM   3575  C CD2 . LEU B 2 103 ? 6.846   -45.075 23.388  1.00 51.55  ? 103 LEU B CD2 1 
ATOM   3576  N N   . ALA B 2 104 ? 6.729   -50.103 23.508  1.00 48.45  ? 104 ALA B N   1 
ATOM   3577  C CA  . ALA B 2 104 ? 7.869   -51.005 23.370  1.00 47.21  ? 104 ALA B CA  1 
ATOM   3578  C C   . ALA B 2 104 ? 7.573   -52.118 22.369  1.00 53.82  ? 104 ALA B C   1 
ATOM   3579  O O   . ALA B 2 104 ? 8.411   -52.449 21.520  1.00 63.84  ? 104 ALA B O   1 
ATOM   3580  C CB  . ALA B 2 104 ? 8.246   -51.594 24.721  1.00 57.11  ? 104 ALA B CB  1 
ATOM   3581  N N   . LYS B 2 105 ? 6.372   -52.682 22.459  1.00 57.00  ? 105 LYS B N   1 
ATOM   3582  C CA  . LYS B 2 105 ? 5.988   -53.769 21.568  1.00 64.64  ? 105 LYS B CA  1 
ATOM   3583  C C   . LYS B 2 105 ? 5.808   -53.240 20.150  1.00 66.74  ? 105 LYS B C   1 
ATOM   3584  O O   . LYS B 2 105 ? 6.053   -53.950 19.174  1.00 60.15  ? 105 LYS B O   1 
ATOM   3585  C CB  . LYS B 2 105 ? 4.706   -54.445 22.055  1.00 70.53  ? 105 LYS B CB  1 
ATOM   3586  N N   . GLN B 2 106 ? 5.389   -51.982 20.046  1.00 67.02  ? 106 GLN B N   1 
ATOM   3587  C CA  . GLN B 2 106 ? 5.280   -51.319 18.751  1.00 49.79  ? 106 GLN B CA  1 
ATOM   3588  C C   . GLN B 2 106 ? 6.650   -51.126 18.112  1.00 58.53  ? 106 GLN B C   1 
ATOM   3589  O O   . GLN B 2 106 ? 6.814   -51.346 16.914  1.00 56.98  ? 106 GLN B O   1 
ATOM   3590  C CB  . GLN B 2 106 ? 4.565   -49.974 18.887  1.00 51.43  ? 106 GLN B CB  1 
ATOM   3591  C CG  . GLN B 2 106 ? 3.051   -50.081 18.858  1.00 65.36  ? 106 GLN B CG  1 
ATOM   3592  C CD  . GLN B 2 106 ? 2.543   -50.728 17.582  1.00 80.75  ? 106 GLN B CD  1 
ATOM   3593  O OE1 . GLN B 2 106 ? 2.111   -51.881 17.585  1.00 73.80  ? 106 GLN B OE1 1 
ATOM   3594  N NE2 . GLN B 2 106 ? 2.594   -49.985 16.482  1.00 85.86  ? 106 GLN B NE2 1 
ATOM   3595  N N   . LEU B 2 107 ? 7.627   -50.700 18.907  1.00 65.05  ? 107 LEU B N   1 
ATOM   3596  C CA  . LEU B 2 107 ? 8.986   -50.532 18.406  1.00 51.66  ? 107 LEU B CA  1 
ATOM   3597  C C   . LEU B 2 107 ? 9.543   -51.875 17.948  1.00 54.83  ? 107 LEU B C   1 
ATOM   3598  O O   . LEU B 2 107 ? 10.130  -51.984 16.869  1.00 68.72  ? 107 LEU B O   1 
ATOM   3599  C CB  . LEU B 2 107 ? 9.896   -49.932 19.483  1.00 54.77  ? 107 LEU B CB  1 
ATOM   3600  C CG  . LEU B 2 107 ? 9.548   -48.567 20.082  1.00 46.20  ? 107 LEU B CG  1 
ATOM   3601  C CD1 . LEU B 2 107 ? 10.571  -48.180 21.141  1.00 56.50  ? 107 LEU B CD1 1 
ATOM   3602  C CD2 . LEU B 2 107 ? 9.455   -47.495 19.010  1.00 52.53  ? 107 LEU B CD2 1 
ATOM   3603  N N   . ALA B 2 108 ? 9.314   -52.907 18.755  1.00 55.21  ? 108 ALA B N   1 
ATOM   3604  C CA  . ALA B 2 108 ? 9.827   -54.239 18.451  1.00 55.98  ? 108 ALA B CA  1 
ATOM   3605  C C   . ALA B 2 108 ? 9.212   -54.814 17.174  1.00 66.30  ? 108 ALA B C   1 
ATOM   3606  O O   . ALA B 2 108 ? 9.928   -55.309 16.303  1.00 66.03  ? 108 ALA B O   1 
ATOM   3607  C CB  . ALA B 2 108 ? 9.581   -55.176 19.622  1.00 64.96  ? 108 ALA B CB  1 
ATOM   3608  N N   . ASP B 2 109 ? 7.889   -54.751 17.071  1.00 67.84  ? 109 ASP B N   1 
ATOM   3609  C CA  . ASP B 2 109 ? 7.188   -55.317 15.924  1.00 69.67  ? 109 ASP B CA  1 
ATOM   3610  C C   . ASP B 2 109 ? 7.391   -54.505 14.649  1.00 67.41  ? 109 ASP B C   1 
ATOM   3611  O O   . ASP B 2 109 ? 7.794   -55.039 13.617  1.00 65.04  ? 109 ASP B O   1 
ATOM   3612  C CB  . ASP B 2 109 ? 5.689   -55.428 16.217  1.00 74.97  ? 109 ASP B CB  1 
ATOM   3613  C CG  . ASP B 2 109 ? 5.366   -56.526 17.211  1.00 94.97  ? 109 ASP B CG  1 
ATOM   3614  O OD1 . ASP B 2 109 ? 6.311   -57.154 17.737  1.00 79.74  ? 109 ASP B OD1 1 
ATOM   3615  O OD2 . ASP B 2 109 ? 4.166   -56.760 17.469  1.00 99.57  ? 109 ASP B OD2 1 
ATOM   3616  N N   . THR B 2 110 ? 7.106   -53.210 14.732  1.00 63.86  ? 110 THR B N   1 
ATOM   3617  C CA  . THR B 2 110 ? 7.007   -52.370 13.545  1.00 51.68  ? 110 THR B CA  1 
ATOM   3618  C C   . THR B 2 110 ? 8.269   -51.575 13.229  1.00 62.32  ? 110 THR B C   1 
ATOM   3619  O O   . THR B 2 110 ? 8.297   -50.833 12.247  1.00 76.58  ? 110 THR B O   1 
ATOM   3620  C CB  . THR B 2 110 ? 5.841   -51.372 13.674  1.00 60.88  ? 110 THR B CB  1 
ATOM   3621  O OG1 . THR B 2 110 ? 6.094   -50.473 14.760  1.00 66.62  ? 110 THR B OG1 1 
ATOM   3622  C CG2 . THR B 2 110 ? 4.534   -52.111 13.921  1.00 51.72  ? 110 THR B CG2 1 
ATOM   3623  N N   . MET B 2 111 ? 9.316   -51.719 14.037  1.00 73.48  ? 111 MET B N   1 
ATOM   3624  C CA  . MET B 2 111 ? 10.527  -50.948 13.775  1.00 75.56  ? 111 MET B CA  1 
ATOM   3625  C C   . MET B 2 111 ? 11.785  -51.805 13.740  1.00 67.96  ? 111 MET B C   1 
ATOM   3626  O O   . MET B 2 111 ? 12.410  -51.942 12.690  1.00 88.92  ? 111 MET B O   1 
ATOM   3627  C CB  . MET B 2 111 ? 10.688  -49.834 14.809  1.00 57.42  ? 111 MET B CB  1 
ATOM   3628  C CG  . MET B 2 111 ? 11.981  -49.050 14.675  1.00 52.13  ? 111 MET B CG  1 
ATOM   3629  S SD  . MET B 2 111 ? 11.998  -47.590 15.728  1.00 90.01  ? 111 MET B SD  1 
ATOM   3630  C CE  . MET B 2 111 ? 12.730  -48.260 17.219  1.00 67.79  ? 111 MET B CE  1 
ATOM   3631  N N   . VAL B 2 112 ? 12.151  -52.395 14.872  1.00 53.01  ? 112 VAL B N   1 
ATOM   3632  C CA  . VAL B 2 112 ? 13.391  -53.161 14.940  1.00 65.98  ? 112 VAL B CA  1 
ATOM   3633  C C   . VAL B 2 112 ? 13.411  -54.405 14.049  1.00 75.02  ? 112 VAL B C   1 
ATOM   3634  O O   . VAL B 2 112 ? 14.328  -54.581 13.250  1.00 83.56  ? 112 VAL B O   1 
ATOM   3635  C CB  . VAL B 2 112 ? 13.676  -53.608 16.388  1.00 61.06  ? 112 VAL B CB  1 
ATOM   3636  C CG1 . VAL B 2 112 ? 15.016  -54.322 16.470  1.00 52.37  ? 112 VAL B CG1 1 
ATOM   3637  C CG2 . VAL B 2 112 ? 13.635  -52.417 17.330  1.00 60.22  ? 112 VAL B CG2 1 
ATOM   3638  N N   . LEU B 2 113 ? 12.389  -55.247 14.164  1.00 73.80  ? 113 LEU B N   1 
ATOM   3639  C CA  . LEU B 2 113 ? 12.378  -56.527 13.454  1.00 89.94  ? 113 LEU B CA  1 
ATOM   3640  C C   . LEU B 2 113 ? 12.157  -56.420 11.930  1.00 89.92  ? 113 LEU B C   1 
ATOM   3641  O O   . LEU B 2 113 ? 12.592  -57.293 11.197  1.00 87.93  ? 113 LEU B O   1 
ATOM   3642  C CB  . LEU B 2 113 ? 11.348  -57.485 14.071  1.00 86.85  ? 113 LEU B CB  1 
ATOM   3643  C CG  . LEU B 2 113 ? 11.079  -58.797 13.308  1.00 94.48  ? 113 LEU B CG  1 
ATOM   3644  C CD1 . LEU B 2 113 ? 11.175  -59.983 14.262  1.00 92.14  ? 113 LEU B CD1 1 
ATOM   3645  C CD2 . LEU B 2 113 ? 9.739   -58.828 12.572  1.00 73.73  ? 113 LEU B CD2 1 
ATOM   3646  N N   . PRO B 2 114 ? 11.430  -55.396 11.445  1.00 83.41  ? 114 PRO B N   1 
ATOM   3647  C CA  . PRO B 2 114 ? 11.464  -55.257 9.981   1.00 78.74  ? 114 PRO B CA  1 
ATOM   3648  C C   . PRO B 2 114 ? 12.867  -55.007 9.407   1.00 77.08  ? 114 PRO B C   1 
ATOM   3649  O O   . PRO B 2 114 ? 13.243  -55.589 8.374   1.00 77.63  ? 114 PRO B O   1 
ATOM   3650  C CB  . PRO B 2 114 ? 10.558  -54.052 9.734   1.00 79.16  ? 114 PRO B CB  1 
ATOM   3651  C CG  . PRO B 2 114 ? 9.582   -54.103 10.861  1.00 79.16  ? 114 PRO B CG  1 
ATOM   3652  C CD  . PRO B 2 114 ? 10.419  -54.509 12.046  1.00 76.50  ? 114 PRO B CD  1 
ATOM   3653  N N   . ILE B 2 115 ? 13.645  -54.172 10.088  1.00 80.39  ? 115 ILE B N   1 
ATOM   3654  C CA  . ILE B 2 115 ? 15.016  -53.928 9.665   1.00 87.75  ? 115 ILE B CA  1 
ATOM   3655  C C   . ILE B 2 115 ? 15.782  -55.225 9.761   1.00 81.82  ? 115 ILE B C   1 
ATOM   3656  O O   . ILE B 2 115 ? 16.465  -55.619 8.817   1.00 96.88  ? 115 ILE B O   1 
ATOM   3657  C CB  . ILE B 2 115 ? 15.708  -52.862 10.525  1.00 67.05  ? 115 ILE B CB  1 
ATOM   3658  C CG1 . ILE B 2 115 ? 14.790  -51.654 10.678  1.00 84.61  ? 115 ILE B CG1 1 
ATOM   3659  C CG2 . ILE B 2 115 ? 17.047  -52.465 9.914   1.00 63.71  ? 115 ILE B CG2 1 
ATOM   3660  C CD1 . ILE B 2 115 ? 15.398  -50.490 11.399  1.00 78.09  ? 115 ILE B CD1 1 
ATOM   3661  N N   . ILE B 2 116 ? 15.599  -55.911 10.886  1.00 65.00  ? 116 ILE B N   1 
ATOM   3662  C CA  . ILE B 2 116 ? 16.240  -57.194 11.133  1.00 73.48  ? 116 ILE B CA  1 
ATOM   3663  C C   . ILE B 2 116 ? 15.951  -58.190 10.012  1.00 80.25  ? 116 ILE B C   1 
ATOM   3664  O O   . ILE B 2 116 ? 16.877  -58.789 9.473   1.00 80.90  ? 116 ILE B O   1 
ATOM   3665  C CB  . ILE B 2 116 ? 15.785  -57.815 12.470  1.00 71.00  ? 116 ILE B CB  1 
ATOM   3666  C CG1 . ILE B 2 116 ? 16.310  -57.006 13.652  1.00 78.25  ? 116 ILE B CG1 1 
ATOM   3667  C CG2 . ILE B 2 116 ? 16.287  -59.240 12.588  1.00 59.71  ? 116 ILE B CG2 1 
ATOM   3668  C CD1 . ILE B 2 116 ? 15.888  -57.551 15.002  1.00 91.59  ? 116 ILE B CD1 1 
ATOM   3669  N N   . GLN B 2 117 ? 14.678  -58.342 9.645   1.00 91.42  ? 117 GLN B N   1 
ATOM   3670  C CA  . GLN B 2 117 ? 14.278  -59.329 8.643   1.00 90.21  ? 117 GLN B CA  1 
ATOM   3671  C C   . GLN B 2 117 ? 14.840  -58.963 7.276   1.00 89.15  ? 117 GLN B C   1 
ATOM   3672  O O   . GLN B 2 117 ? 15.262  -59.848 6.491   1.00 89.71  ? 117 GLN B O   1 
ATOM   3673  C CB  . GLN B 2 117 ? 12.754  -59.520 8.605   1.00 84.47  ? 117 GLN B CB  1 
ATOM   3674  C CG  . GLN B 2 117 ? 11.875  -58.345 8.205   1.00 95.09  ? 117 GLN B CG  1 
ATOM   3675  C CD  . GLN B 2 117 ? 10.398  -58.717 8.269   1.00 105.95 ? 117 GLN B CD  1 
ATOM   3676  O OE1 . GLN B 2 117 ? 10.023  -59.684 8.933   1.00 105.99 ? 117 GLN B OE1 1 
ATOM   3677  N NE2 . GLN B 2 117 ? 9.559   -57.960 7.573   1.00 95.51  ? 117 GLN B NE2 1 
ATOM   3678  N N   . PHE B 2 118 ? 14.912  -57.656 7.036   1.00 72.52  ? 118 PHE B N   1 
ATOM   3679  C CA  . PHE B 2 118 ? 15.526  -57.144 5.828   1.00 71.14  ? 118 PHE B CA  1 
ATOM   3680  C C   . PHE B 2 118 ? 16.937  -57.689 5.755   1.00 67.49  ? 118 PHE B C   1 
ATOM   3681  O O   . PHE B 2 118 ? 17.312  -58.346 4.769   1.00 92.72  ? 118 PHE B O   1 
ATOM   3682  C CB  . PHE B 2 118 ? 15.536  -55.615 5.828   1.00 67.04  ? 118 PHE B CB  1 
ATOM   3683  C CG  . PHE B 2 118 ? 16.469  -55.017 4.818   1.00 60.23  ? 118 PHE B CG  1 
ATOM   3684  C CD1 . PHE B 2 118 ? 16.165  -55.066 3.470   1.00 89.64  ? 118 PHE B CD1 1 
ATOM   3685  C CD2 . PHE B 2 118 ? 17.639  -54.388 5.217   1.00 67.15  ? 118 PHE B CD2 1 
ATOM   3686  C CE1 . PHE B 2 118 ? 17.014  -54.516 2.536   1.00 77.03  ? 118 PHE B CE1 1 
ATOM   3687  C CE2 . PHE B 2 118 ? 18.494  -53.833 4.284   1.00 79.04  ? 118 PHE B CE2 1 
ATOM   3688  C CZ  . PHE B 2 118 ? 18.180  -53.898 2.942   1.00 76.20  ? 118 PHE B CZ  1 
ATOM   3689  N N   . ARG B 2 119 ? 17.693  -57.436 6.827   1.00 66.99  ? 119 ARG B N   1 
ATOM   3690  C CA  . ARG B 2 119 ? 19.058  -57.948 6.971   1.00 68.44  ? 119 ARG B CA  1 
ATOM   3691  C C   . ARG B 2 119 ? 19.226  -59.428 6.778   1.00 78.40  ? 119 ARG B C   1 
ATOM   3692  O O   . ARG B 2 119 ? 20.071  -59.847 5.981   1.00 88.72  ? 119 ARG B O   1 
ATOM   3693  C CB  . ARG B 2 119 ? 19.639  -57.673 8.351   1.00 83.62  ? 119 ARG B CB  1 
ATOM   3694  C CG  . ARG B 2 119 ? 19.192  -56.442 9.081   1.00 92.48  ? 119 ARG B CG  1 
ATOM   3695  C CD  . ARG B 2 119 ? 20.414  -55.846 9.672   1.00 99.98  ? 119 ARG B CD  1 
ATOM   3696  N NE  . ARG B 2 119 ? 21.149  -56.946 10.262  1.00 134.24 ? 119 ARG B NE  1 
ATOM   3697  C CZ  . ARG B 2 119 ? 22.469  -57.023 10.311  1.00 127.84 ? 119 ARG B CZ  1 
ATOM   3698  N NH1 . ARG B 2 119 ? 23.216  -56.082 9.749   1.00 111.75 ? 119 ARG B NH1 1 
ATOM   3699  N NH2 . ARG B 2 119 ? 23.047  -58.073 10.873  1.00 112.95 ? 119 ARG B NH2 1 
ATOM   3700  N N   . GLU B 2 120 ? 18.453  -60.226 7.518   1.00 88.48  ? 120 GLU B N   1 
ATOM   3701  C CA  . GLU B 2 120 ? 18.659  -61.657 7.422   1.00 94.14  ? 120 GLU B CA  1 
ATOM   3702  C C   . GLU B 2 120 ? 18.407  -62.053 5.990   1.00 100.35 ? 120 GLU B C   1 
ATOM   3703  O O   . GLU B 2 120 ? 19.362  -62.258 5.272   1.00 105.08 ? 120 GLU B O   1 
ATOM   3704  C CB  . GLU B 2 120 ? 17.744  -62.456 8.377   1.00 100.19 ? 120 GLU B CB  1 
ATOM   3705  C CG  . GLU B 2 120 ? 16.450  -61.747 8.640   1.00 112.71 ? 120 GLU B CG  1 
ATOM   3706  C CD  . GLU B 2 120 ? 15.622  -62.315 9.778   1.00 117.01 ? 120 GLU B CD  1 
ATOM   3707  O OE1 . GLU B 2 120 ? 15.292  -63.520 9.748   1.00 111.83 ? 120 GLU B OE1 1 
ATOM   3708  O OE2 . GLU B 2 120 ? 15.284  -61.550 10.703  1.00 119.41 ? 120 GLU B OE2 1 
ATOM   3709  N N   . LYS B 2 121 ? 17.178  -62.012 5.483   1.00 85.30  ? 121 LYS B N   1 
ATOM   3710  C CA  . LYS B 2 121 ? 17.072  -62.744 4.211   1.00 101.17 ? 121 LYS B CA  1 
ATOM   3711  C C   . LYS B 2 121 ? 17.136  -61.922 2.904   1.00 90.25  ? 121 LYS B C   1 
ATOM   3712  O O   . LYS B 2 121 ? 17.428  -62.529 1.856   1.00 97.78  ? 121 LYS B O   1 
ATOM   3713  C CB  . LYS B 2 121 ? 15.841  -63.671 4.203   1.00 108.56 ? 121 LYS B CB  1 
ATOM   3714  C CG  . LYS B 2 121 ? 16.368  -65.088 4.417   1.00 121.60 ? 121 LYS B CG  1 
ATOM   3715  C CD  . LYS B 2 121 ? 15.821  -66.188 3.532   1.00 119.10 ? 121 LYS B CD  1 
ATOM   3716  C CE  . LYS B 2 121 ? 16.507  -67.503 3.937   1.00 115.69 ? 121 LYS B CE  1 
ATOM   3717  N NZ  . LYS B 2 121 ? 16.128  -68.002 5.291   1.00 106.32 ? 121 LYS B NZ  1 
ATOM   3718  N N   . ASP B 2 122 ? 16.899  -60.604 2.918   1.00 85.39  ? 122 ASP B N   1 
ATOM   3719  C CA  . ASP B 2 122 ? 17.148  -59.873 1.682   1.00 76.26  ? 122 ASP B CA  1 
ATOM   3720  C C   . ASP B 2 122 ? 18.666  -59.738 1.476   1.00 76.11  ? 122 ASP B C   1 
ATOM   3721  O O   . ASP B 2 122 ? 19.212  -60.066 0.403   1.00 82.07  ? 122 ASP B O   1 
ATOM   3722  C CB  . ASP B 2 122 ? 16.476  -58.501 1.700   1.00 66.59  ? 122 ASP B CB  1 
ATOM   3723  C CG  . ASP B 2 122 ? 14.950  -58.588 1.693   1.00 89.21  ? 122 ASP B CG  1 
ATOM   3724  O OD1 . ASP B 2 122 ? 14.413  -59.510 1.033   1.00 97.09  ? 122 ASP B OD1 1 
ATOM   3725  O OD2 . ASP B 2 122 ? 14.285  -57.702 2.280   1.00 91.61  ? 122 ASP B OD2 1 
ATOM   3726  N N   . LEU B 2 123 ? 19.350  -59.257 2.510   1.00 58.33  ? 123 LEU B N   1 
ATOM   3727  C CA  . LEU B 2 123 ? 20.790  -59.052 2.416   1.00 56.76  ? 123 LEU B CA  1 
ATOM   3728  C C   . LEU B 2 123 ? 21.554  -60.367 2.286   1.00 64.08  ? 123 LEU B C   1 
ATOM   3729  O O   . LEU B 2 123 ? 22.464  -60.455 1.455   1.00 66.06  ? 123 LEU B O   1 
ATOM   3730  C CB  . LEU B 2 123 ? 21.305  -58.241 3.610   1.00 64.20  ? 123 LEU B CB  1 
ATOM   3731  C CG  . LEU B 2 123 ? 20.969  -56.745 3.556   1.00 67.60  ? 123 LEU B CG  1 
ATOM   3732  C CD1 . LEU B 2 123 ? 21.785  -55.979 4.586   1.00 69.82  ? 123 LEU B CD1 1 
ATOM   3733  C CD2 . LEU B 2 123 ? 21.200  -56.188 2.155   1.00 62.31  ? 123 LEU B CD2 1 
ATOM   3734  N N   . THR B 2 124 ? 21.188  -61.393 3.061   1.00 79.08  ? 124 THR B N   1 
ATOM   3735  C CA  . THR B 2 124 ? 21.878  -62.670 2.888   1.00 84.02  ? 124 THR B CA  1 
ATOM   3736  C C   . THR B 2 124 ? 21.519  -63.299 1.553   1.00 83.62  ? 124 THR B C   1 
ATOM   3737  O O   . THR B 2 124 ? 22.344  -64.002 0.986   1.00 85.98  ? 124 THR B O   1 
ATOM   3738  C CB  . THR B 2 124 ? 21.592  -63.706 4.003   1.00 102.59 ? 124 THR B CB  1 
ATOM   3739  O OG1 . THR B 2 124 ? 20.180  -63.922 4.120   1.00 89.47  ? 124 THR B OG1 1 
ATOM   3740  C CG2 . THR B 2 124 ? 22.172  -63.253 5.344   1.00 98.82  ? 124 THR B CG2 1 
ATOM   3741  N N   . GLU B 2 125 ? 20.299  -63.083 1.058   1.00 81.22  ? 125 GLU B N   1 
ATOM   3742  C CA  . GLU B 2 125 ? 19.975  -63.569 -0.285  1.00 91.94  ? 125 GLU B CA  1 
ATOM   3743  C C   . GLU B 2 125 ? 20.943  -62.971 -1.315  1.00 86.75  ? 125 GLU B C   1 
ATOM   3744  O O   . GLU B 2 125 ? 21.486  -63.686 -2.176  1.00 83.87  ? 125 GLU B O   1 
ATOM   3745  C CB  . GLU B 2 125 ? 18.540  -63.220 -0.662  1.00 83.53  ? 125 GLU B CB  1 
ATOM   3746  C CG  . GLU B 2 125 ? 17.817  -64.286 -1.460  1.00 88.37  ? 125 GLU B CG  1 
ATOM   3747  C CD  . GLU B 2 125 ? 17.723  -65.618 -0.718  1.00 125.72 ? 125 GLU B CD  1 
ATOM   3748  O OE1 . GLU B 2 125 ? 17.983  -65.668 0.507   1.00 120.41 ? 125 GLU B OE1 1 
ATOM   3749  O OE2 . GLU B 2 125 ? 17.372  -66.624 -1.365  1.00 130.15 ? 125 GLU B OE2 1 
ATOM   3750  N N   . VAL B 2 126 ? 21.139  -61.654 -1.231  1.00 75.73  ? 126 VAL B N   1 
ATOM   3751  C CA  . VAL B 2 126 ? 22.086  -60.980 -2.117  1.00 73.27  ? 126 VAL B CA  1 
ATOM   3752  C C   . VAL B 2 126 ? 23.485  -61.577 -1.967  1.00 73.23  ? 126 VAL B C   1 
ATOM   3753  O O   . VAL B 2 126 ? 24.145  -61.888 -2.962  1.00 78.09  ? 126 VAL B O   1 
ATOM   3754  C CB  . VAL B 2 126 ? 22.147  -59.460 -1.846  1.00 61.68  ? 126 VAL B CB  1 
ATOM   3755  C CG1 . VAL B 2 126 ? 23.338  -58.837 -2.560  1.00 70.86  ? 126 VAL B CG1 1 
ATOM   3756  C CG2 . VAL B 2 126 ? 20.848  -58.787 -2.278  1.00 48.84  ? 126 VAL B CG2 1 
ATOM   3757  N N   . SER B 2 127 ? 23.920  -61.754 -0.722  1.00 76.17  ? 127 SER B N   1 
ATOM   3758  C CA  . SER B 2 127 ? 25.229  -62.342 -0.441  1.00 72.22  ? 127 SER B CA  1 
ATOM   3759  C C   . SER B 2 127 ? 25.414  -63.718 -1.087  1.00 73.39  ? 127 SER B C   1 
ATOM   3760  O O   . SER B 2 127 ? 26.374  -63.946 -1.828  1.00 79.07  ? 127 SER B O   1 
ATOM   3761  C CB  . SER B 2 127 ? 25.442  -62.450 1.071   1.00 57.28  ? 127 SER B CB  1 
ATOM   3762  O OG  . SER B 2 127 ? 26.647  -63.132 1.369   1.00 86.51  ? 127 SER B OG  1 
ATOM   3763  N N   . THR B 2 128 ? 24.480  -64.623 -0.814  1.00 67.72  ? 128 THR B N   1 
ATOM   3764  C CA  . THR B 2 128 ? 24.540  -65.990 -1.319  1.00 64.79  ? 128 THR B CA  1 
ATOM   3765  C C   . THR B 2 128 ? 24.540  -66.024 -2.840  1.00 76.87  ? 128 THR B C   1 
ATOM   3766  O O   . THR B 2 128 ? 25.385  -66.687 -3.447  1.00 79.42  ? 128 THR B O   1 
ATOM   3767  C CB  . THR B 2 128 ? 23.364  -66.839 -0.799  1.00 82.19  ? 128 THR B CB  1 
ATOM   3768  O OG1 . THR B 2 128 ? 22.126  -66.209 -1.148  1.00 89.27  ? 128 THR B OG1 1 
ATOM   3769  C CG2 . THR B 2 128 ? 23.441  -66.994 0.713   1.00 79.78  ? 128 THR B CG2 1 
ATOM   3770  N N   . LEU B 2 129 ? 23.594  -65.313 -3.452  1.00 78.23  ? 129 LEU B N   1 
ATOM   3771  C CA  . LEU B 2 129 ? 23.542  -65.226 -4.910  1.00 74.12  ? 129 LEU B CA  1 
ATOM   3772  C C   . LEU B 2 129 ? 24.872  -64.717 -5.468  1.00 69.44  ? 129 LEU B C   1 
ATOM   3773  O O   . LEU B 2 129 ? 25.344  -65.184 -6.510  1.00 69.33  ? 129 LEU B O   1 
ATOM   3774  C CB  . LEU B 2 129 ? 22.393  -64.321 -5.359  1.00 67.00  ? 129 LEU B CB  1 
ATOM   3775  C CG  . LEU B 2 129 ? 20.987  -64.907 -5.208  1.00 63.93  ? 129 LEU B CG  1 
ATOM   3776  C CD1 . LEU B 2 129 ? 19.927  -63.849 -5.467  1.00 65.86  ? 129 LEU B CD1 1 
ATOM   3777  C CD2 . LEU B 2 129 ? 20.795  -66.099 -6.135  1.00 63.36  ? 129 LEU B CD2 1 
ATOM   3778  N N   . LYS B 2 130 ? 25.477  -63.770 -4.755  1.00 69.85  ? 130 LYS B N   1 
ATOM   3779  C CA  . LYS B 2 130 ? 26.788  -63.248 -5.126  1.00 54.66  ? 130 LYS B CA  1 
ATOM   3780  C C   . LYS B 2 130 ? 27.852  -64.343 -5.084  1.00 61.24  ? 130 LYS B C   1 
ATOM   3781  O O   . LYS B 2 130 ? 28.720  -64.410 -5.957  1.00 78.67  ? 130 LYS B O   1 
ATOM   3782  C CB  . LYS B 2 130 ? 27.191  -62.095 -4.205  1.00 58.85  ? 130 LYS B CB  1 
ATOM   3783  C CG  . LYS B 2 130 ? 28.601  -61.579 -4.438  1.00 47.82  ? 130 LYS B CG  1 
ATOM   3784  C CD  . LYS B 2 130 ? 28.975  -60.507 -3.428  1.00 42.97  ? 130 LYS B CD  1 
ATOM   3785  C CE  . LYS B 2 130 ? 30.360  -59.949 -3.711  1.00 60.55  ? 130 LYS B CE  1 
ATOM   3786  N NZ  . LYS B 2 130 ? 31.067  -59.541 -2.466  1.00 69.80  ? 130 LYS B NZ  1 
ATOM   3787  N N   . ASP B 2 131 ? 27.780  -65.209 -4.076  1.00 67.31  ? 131 ASP B N   1 
ATOM   3788  C CA  . ASP B 2 131 ? 28.791  -66.252 -3.929  1.00 76.27  ? 131 ASP B CA  1 
ATOM   3789  C C   . ASP B 2 131 ? 28.626  -67.361 -4.970  1.00 87.19  ? 131 ASP B C   1 
ATOM   3790  O O   . ASP B 2 131 ? 29.618  -67.926 -5.452  1.00 87.54  ? 131 ASP B O   1 
ATOM   3791  C CB  . ASP B 2 131 ? 28.743  -66.851 -2.520  1.00 77.73  ? 131 ASP B CB  1 
ATOM   3792  C CG  . ASP B 2 131 ? 29.345  -65.931 -1.470  1.00 106.82 ? 131 ASP B CG  1 
ATOM   3793  O OD1 . ASP B 2 131 ? 30.581  -65.964 -1.288  1.00 113.10 ? 131 ASP B OD1 1 
ATOM   3794  O OD2 . ASP B 2 131 ? 28.586  -65.185 -0.818  1.00 108.17 ? 131 ASP B OD2 1 
ATOM   3795  N N   . LEU B 2 132 ? 27.384  -67.634 -5.363  1.00 83.36  ? 132 LEU B N   1 
ATOM   3796  C CA  . LEU B 2 132 ? 27.143  -68.623 -6.410  1.00 77.65  ? 132 LEU B CA  1 
ATOM   3797  C C   . LEU B 2 132 ? 27.567  -68.067 -7.762  1.00 81.84  ? 132 LEU B C   1 
ATOM   3798  O O   . LEU B 2 132 ? 28.106  -68.794 -8.602  1.00 88.18  ? 132 LEU B O   1 
ATOM   3799  C CB  . LEU B 2 132 ? 25.672  -69.048 -6.449  1.00 83.50  ? 132 LEU B CB  1 
ATOM   3800  C CG  . LEU B 2 132 ? 24.994  -69.366 -5.114  1.00 89.69  ? 132 LEU B CG  1 
ATOM   3801  C CD1 . LEU B 2 132 ? 23.499  -69.566 -5.307  1.00 70.06  ? 132 LEU B CD1 1 
ATOM   3802  C CD2 . LEU B 2 132 ? 25.625  -70.589 -4.468  1.00 87.37  ? 132 LEU B CD2 1 
ATOM   3803  N N   . PHE B 2 133 ? 27.343  -66.771 -7.957  1.00 80.47  ? 133 PHE B N   1 
ATOM   3804  C CA  . PHE B 2 133 ? 27.827  -66.092 -9.152  1.00 68.57  ? 133 PHE B CA  1 
ATOM   3805  C C   . PHE B 2 133 ? 29.348  -66.155 -9.220  1.00 66.21  ? 133 PHE B C   1 
ATOM   3806  O O   . PHE B 2 133 ? 29.923  -66.376 -10.287 1.00 81.77  ? 133 PHE B O   1 
ATOM   3807  C CB  . PHE B 2 133 ? 27.361  -64.635 -9.176  1.00 63.00  ? 133 PHE B CB  1 
ATOM   3808  C CG  . PHE B 2 133 ? 28.114  -63.777 -10.153 1.00 69.42  ? 133 PHE B CG  1 
ATOM   3809  C CD1 . PHE B 2 133 ? 27.915  -63.916 -11.517 1.00 71.86  ? 133 PHE B CD1 1 
ATOM   3810  C CD2 . PHE B 2 133 ? 29.027  -62.836 -9.706  1.00 66.13  ? 133 PHE B CD2 1 
ATOM   3811  C CE1 . PHE B 2 133 ? 28.611  -63.129 -12.416 1.00 61.46  ? 133 PHE B CE1 1 
ATOM   3812  C CE2 . PHE B 2 133 ? 29.725  -62.048 -10.600 1.00 80.22  ? 133 PHE B CE2 1 
ATOM   3813  C CZ  . PHE B 2 133 ? 29.515  -62.194 -11.958 1.00 72.90  ? 133 PHE B CZ  1 
ATOM   3814  N N   . GLY B 2 134 ? 29.993  -65.962 -8.073  1.00 67.20  ? 134 GLY B N   1 
ATOM   3815  C CA  . GLY B 2 134 ? 31.440  -66.038 -7.987  1.00 69.32  ? 134 GLY B CA  1 
ATOM   3816  C C   . GLY B 2 134 ? 32.002  -67.403 -8.341  1.00 77.93  ? 134 GLY B C   1 
ATOM   3817  O O   . GLY B 2 134 ? 32.891  -67.516 -9.197  1.00 78.38  ? 134 GLY B O   1 
ATOM   3818  N N   . LEU B 2 135 ? 31.485  -68.446 -7.695  1.00 88.59  ? 135 LEU B N   1 
ATOM   3819  C CA  . LEU B 2 135 ? 31.987  -69.794 -7.955  1.00 91.38  ? 135 LEU B CA  1 
ATOM   3820  C C   . LEU B 2 135 ? 31.696  -70.224 -9.394  1.00 88.05  ? 135 LEU B C   1 
ATOM   3821  O O   . LEU B 2 135 ? 32.543  -70.847 -10.046 1.00 83.66  ? 135 LEU B O   1 
ATOM   3822  C CB  . LEU B 2 135 ? 31.403  -70.800 -6.952  1.00 85.99  ? 135 LEU B CB  1 
ATOM   3823  C CG  . LEU B 2 135 ? 29.894  -71.024 -6.813  1.00 99.21  ? 135 LEU B CG  1 
ATOM   3824  C CD1 . LEU B 2 135 ? 29.392  -72.097 -7.771  1.00 96.66  ? 135 LEU B CD1 1 
ATOM   3825  C CD2 . LEU B 2 135 ? 29.549  -71.388 -5.376  1.00 83.14  ? 135 LEU B CD2 1 
ATOM   3826  N N   . ALA B 2 136 ? 30.510  -69.878 -9.892  1.00 81.24  ? 136 ALA B N   1 
ATOM   3827  C CA  . ALA B 2 136 ? 30.157  -70.176 -11.277 1.00 74.16  ? 136 ALA B CA  1 
ATOM   3828  C C   . ALA B 2 136 ? 31.117  -69.483 -12.238 1.00 63.04  ? 136 ALA B C   1 
ATOM   3829  O O   . ALA B 2 136 ? 31.547  -70.070 -13.234 1.00 77.05  ? 136 ALA B O   1 
ATOM   3830  C CB  . ALA B 2 136 ? 28.725  -69.760 -11.567 1.00 69.85  ? 136 ALA B CB  1 
ATOM   3831  N N   . SER B 2 137 ? 31.451  -68.234 -11.927 1.00 61.41  ? 137 SER B N   1 
ATOM   3832  C CA  . SER B 2 137 ? 32.409  -67.471 -12.718 1.00 60.23  ? 137 SER B CA  1 
ATOM   3833  C C   . SER B 2 137 ? 33.772  -68.156 -12.764 1.00 69.61  ? 137 SER B C   1 
ATOM   3834  O O   . SER B 2 137 ? 34.335  -68.358 -13.844 1.00 79.78  ? 137 SER B O   1 
ATOM   3835  C CB  . SER B 2 137 ? 32.552  -66.053 -12.160 1.00 57.25  ? 137 SER B CB  1 
ATOM   3836  O OG  . SER B 2 137 ? 33.691  -65.404 -12.698 1.00 80.48  ? 137 SER B OG  1 
ATOM   3837  N N   . ASN B 2 138 ? 34.295  -68.518 -11.594 1.00 71.34  ? 138 ASN B N   1 
ATOM   3838  C CA  . ASN B 2 138 ? 35.576  -69.221 -11.516 1.00 69.39  ? 138 ASN B CA  1 
ATOM   3839  C C   . ASN B 2 138 ? 35.585  -70.511 -12.335 1.00 71.48  ? 138 ASN B C   1 
ATOM   3840  O O   . ASN B 2 138 ? 36.500  -70.754 -13.137 1.00 70.67  ? 138 ASN B O   1 
ATOM   3841  C CB  . ASN B 2 138 ? 35.921  -69.533 -10.059 1.00 77.26  ? 138 ASN B CB  1 
ATOM   3842  C CG  . ASN B 2 138 ? 36.331  -68.301 -9.280  1.00 84.23  ? 138 ASN B CG  1 
ATOM   3843  O OD1 . ASN B 2 138 ? 35.651  -67.892 -8.339  1.00 84.23  ? 138 ASN B OD1 1 
ATOM   3844  N ND2 . ASN B 2 138 ? 37.451  -67.701 -9.667  1.00 99.53  ? 138 ASN B ND2 1 
ATOM   3845  N N   . GLU B 2 139 ? 34.556  -71.329 -12.128 1.00 74.66  ? 139 GLU B N   1 
ATOM   3846  C CA  . GLU B 2 139 ? 34.416  -72.592 -12.844 1.00 76.59  ? 139 GLU B CA  1 
ATOM   3847  C C   . GLU B 2 139 ? 34.386  -72.386 -14.358 1.00 73.96  ? 139 GLU B C   1 
ATOM   3848  O O   . GLU B 2 139 ? 35.058  -73.104 -15.104 1.00 80.99  ? 139 GLU B O   1 
ATOM   3849  C CB  . GLU B 2 139 ? 33.158  -73.326 -12.377 1.00 73.02  ? 139 GLU B CB  1 
ATOM   3850  C CG  . GLU B 2 139 ? 33.299  -73.942 -10.993 1.00 90.31  ? 139 GLU B CG  1 
ATOM   3851  C CD  . GLU B 2 139 ? 31.975  -74.397 -10.413 1.00 107.87 ? 139 GLU B CD  1 
ATOM   3852  O OE1 . GLU B 2 139 ? 31.089  -74.800 -11.195 1.00 103.50 ? 139 GLU B OE1 1 
ATOM   3853  O OE2 . GLU B 2 139 ? 31.822  -74.352 -9.174  1.00 107.27 ? 139 GLU B OE2 1 
ATOM   3854  N N   . HIS B 2 140 ? 33.607  -71.404 -14.806 1.00 67.52  ? 140 HIS B N   1 
ATOM   3855  C CA  . HIS B 2 140 ? 33.532  -71.076 -16.227 1.00 69.75  ? 140 HIS B CA  1 
ATOM   3856  C C   . HIS B 2 140 ? 34.887  -70.650 -16.782 1.00 75.20  ? 140 HIS B C   1 
ATOM   3857  O O   . HIS B 2 140 ? 35.256  -71.027 -17.897 1.00 72.94  ? 140 HIS B O   1 
ATOM   3858  C CB  . HIS B 2 140 ? 32.507  -69.972 -16.471 1.00 67.69  ? 140 HIS B CB  1 
ATOM   3859  C CG  . HIS B 2 140 ? 32.264  -69.681 -17.920 1.00 70.75  ? 140 HIS B CG  1 
ATOM   3860  N ND1 . HIS B 2 140 ? 31.799  -68.465 -18.367 1.00 62.48  ? 140 HIS B ND1 1 
ATOM   3861  C CD2 . HIS B 2 140 ? 32.425  -70.453 -19.022 1.00 72.96  ? 140 HIS B CD2 1 
ATOM   3862  C CE1 . HIS B 2 140 ? 31.682  -68.497 -19.684 1.00 65.56  ? 140 HIS B CE1 1 
ATOM   3863  N NE2 . HIS B 2 140 ? 32.055  -69.691 -20.104 1.00 73.44  ? 140 HIS B NE2 1 
ATOM   3864  N N   . ASP B 2 141 ? 35.620  -69.860 -16.002 1.00 67.66  ? 141 ASP B N   1 
ATOM   3865  C CA  . ASP B 2 141 ? 36.950  -69.411 -16.402 1.00 64.91  ? 141 ASP B CA  1 
ATOM   3866  C C   . ASP B 2 141 ? 37.873  -70.607 -16.609 1.00 65.58  ? 141 ASP B C   1 
ATOM   3867  O O   . ASP B 2 141 ? 38.601  -70.684 -17.606 1.00 60.20  ? 141 ASP B O   1 
ATOM   3868  C CB  . ASP B 2 141 ? 37.538  -68.459 -15.360 1.00 67.91  ? 141 ASP B CB  1 
ATOM   3869  C CG  . ASP B 2 141 ? 36.753  -67.168 -15.241 1.00 79.85  ? 141 ASP B CG  1 
ATOM   3870  O OD1 . ASP B 2 141 ? 36.179  -66.724 -16.258 1.00 76.86  ? 141 ASP B OD1 1 
ATOM   3871  O OD2 . ASP B 2 141 ? 36.709  -66.599 -14.130 1.00 84.50  ? 141 ASP B OD2 1 
ATOM   3872  N N   . LEU B 2 142 ? 37.835  -71.539 -15.661 1.00 72.57  ? 142 LEU B N   1 
ATOM   3873  C CA  . LEU B 2 142 ? 38.627  -72.761 -15.762 1.00 75.76  ? 142 LEU B CA  1 
ATOM   3874  C C   . LEU B 2 142 ? 38.259  -73.552 -17.021 1.00 64.37  ? 142 LEU B C   1 
ATOM   3875  O O   . LEU B 2 142 ? 39.136  -74.015 -17.771 1.00 68.44  ? 142 LEU B O   1 
ATOM   3876  C CB  . LEU B 2 142 ? 38.424  -73.622 -14.514 1.00 76.42  ? 142 LEU B CB  1 
ATOM   3877  C CG  . LEU B 2 142 ? 38.971  -73.035 -13.211 1.00 77.27  ? 142 LEU B CG  1 
ATOM   3878  C CD1 . LEU B 2 142 ? 38.498  -73.844 -12.012 1.00 61.52  ? 142 LEU B CD1 1 
ATOM   3879  C CD2 . LEU B 2 142 ? 40.491  -72.957 -13.247 1.00 65.03  ? 142 LEU B CD2 1 
ATOM   3880  N N   . SER B 2 143 ? 36.954  -73.693 -17.246 1.00 61.61  ? 143 SER B N   1 
ATOM   3881  C CA  . SER B 2 143 ? 36.432  -74.409 -18.407 1.00 64.29  ? 143 SER B CA  1 
ATOM   3882  C C   . SER B 2 143 ? 36.960  -73.817 -19.708 1.00 70.37  ? 143 SER B C   1 
ATOM   3883  O O   . SER B 2 143 ? 37.439  -74.539 -20.583 1.00 79.83  ? 143 SER B O   1 
ATOM   3884  C CB  . SER B 2 143 ? 34.902  -74.384 -18.412 1.00 68.75  ? 143 SER B CB  1 
ATOM   3885  O OG  . SER B 2 143 ? 34.375  -74.960 -17.231 1.00 92.43  ? 143 SER B OG  1 
ATOM   3886  N N   . MET B 2 144 ? 36.868  -72.496 -19.824 1.00 67.55  ? 144 MET B N   1 
ATOM   3887  C CA  . MET B 2 144 ? 37.360  -71.792 -21.001 1.00 75.47  ? 144 MET B CA  1 
ATOM   3888  C C   . MET B 2 144 ? 38.873  -71.924 -21.155 1.00 66.03  ? 144 MET B C   1 
ATOM   3889  O O   . MET B 2 144 ? 39.385  -71.940 -22.273 1.00 67.80  ? 144 MET B O   1 
ATOM   3890  C CB  . MET B 2 144 ? 36.954  -70.320 -20.943 1.00 71.76  ? 144 MET B CB  1 
ATOM   3891  C CG  . MET B 2 144 ? 35.480  -70.096 -21.251 1.00 69.28  ? 144 MET B CG  1 
ATOM   3892  S SD  . MET B 2 144 ? 34.983  -68.365 -21.208 1.00 70.09  ? 144 MET B SD  1 
ATOM   3893  C CE  . MET B 2 144 ? 35.231  -67.992 -19.474 1.00 73.94  ? 144 MET B CE  1 
ATOM   3894  N N   . ALA B 2 145 ? 39.588  -72.006 -20.037 1.00 63.25  ? 145 ALA B N   1 
ATOM   3895  C CA  . ALA B 2 145 ? 41.030  -72.237 -20.088 1.00 66.19  ? 145 ALA B CA  1 
ATOM   3896  C C   . ALA B 2 145 ? 41.347  -73.596 -20.722 1.00 75.29  ? 145 ALA B C   1 
ATOM   3897  O O   . ALA B 2 145 ? 42.183  -73.701 -21.641 1.00 79.57  ? 145 ALA B O   1 
ATOM   3898  C CB  . ALA B 2 145 ? 41.634  -72.145 -18.694 1.00 68.85  ? 145 ALA B CB  1 
ATOM   3899  N N   . LYS B 2 146 ? 40.647  -74.633 -20.272 1.00 66.94  ? 146 LYS B N   1 
ATOM   3900  C CA  . LYS B 2 146 ? 40.973  -75.976 -20.736 1.00 75.97  ? 146 LYS B CA  1 
ATOM   3901  C C   . LYS B 2 146 ? 40.378  -76.241 -22.122 1.00 75.12  ? 146 LYS B C   1 
ATOM   3902  O O   . LYS B 2 146 ? 40.797  -77.161 -22.828 1.00 71.38  ? 146 LYS B O   1 
ATOM   3903  C CB  . LYS B 2 146 ? 40.475  -77.020 -19.731 1.00 60.92  ? 146 LYS B CB  1 
ATOM   3904  C CG  . LYS B 2 146 ? 39.244  -77.779 -20.223 1.00 71.91  ? 146 LYS B CG  1 
ATOM   3905  C CD  . LYS B 2 146 ? 39.041  -79.098 -19.505 1.00 88.22  ? 146 LYS B CD  1 
ATOM   3906  C CE  . LYS B 2 146 ? 38.762  -78.887 -18.032 1.00 96.16  ? 146 LYS B CE  1 
ATOM   3907  N NZ  . LYS B 2 146 ? 38.709  -80.177 -17.290 1.00 104.56 ? 146 LYS B NZ  1 
ATOM   3908  N N   . TYR B 2 147 ? 39.413  -75.419 -22.517 1.00 65.56  ? 147 TYR B N   1 
ATOM   3909  C CA  . TYR B 2 147 ? 38.945  -75.408 -23.895 1.00 71.43  ? 147 TYR B CA  1 
ATOM   3910  C C   . TYR B 2 147 ? 39.979  -74.754 -24.809 1.00 73.03  ? 147 TYR B C   1 
ATOM   3911  O O   . TYR B 2 147 ? 40.317  -75.286 -25.867 1.00 72.84  ? 147 TYR B O   1 
ATOM   3912  C CB  . TYR B 2 147 ? 37.607  -74.681 -23.990 1.00 74.34  ? 147 TYR B CB  1 
ATOM   3913  C CG  . TYR B 2 147 ? 36.961  -74.746 -25.350 1.00 74.58  ? 147 TYR B CG  1 
ATOM   3914  C CD1 . TYR B 2 147 ? 37.214  -73.778 -26.311 1.00 77.95  ? 147 TYR B CD1 1 
ATOM   3915  C CD2 . TYR B 2 147 ? 36.095  -75.782 -25.671 1.00 69.91  ? 147 TYR B CD2 1 
ATOM   3916  C CE1 . TYR B 2 147 ? 36.620  -73.839 -27.552 1.00 76.55  ? 147 TYR B CE1 1 
ATOM   3917  C CE2 . TYR B 2 147 ? 35.498  -75.852 -26.909 1.00 83.46  ? 147 TYR B CE2 1 
ATOM   3918  C CZ  . TYR B 2 147 ? 35.763  -74.878 -27.845 1.00 87.96  ? 147 TYR B CZ  1 
ATOM   3919  O OH  . TYR B 2 147 ? 35.171  -74.944 -29.081 1.00 76.95  ? 147 TYR B OH  1 
ATOM   3920  N N   . SER B 2 148 ? 40.456  -73.583 -24.396 1.00 76.05  ? 148 SER B N   1 
ATOM   3921  C CA  . SER B 2 148 ? 41.513  -72.869 -25.105 1.00 64.19  ? 148 SER B CA  1 
ATOM   3922  C C   . SER B 2 148 ? 42.729  -73.750 -25.370 1.00 56.37  ? 148 SER B C   1 
ATOM   3923  O O   . SER B 2 148 ? 43.291  -73.721 -26.464 1.00 68.02  ? 148 SER B O   1 
ATOM   3924  C CB  . SER B 2 148 ? 41.936  -71.621 -24.325 1.00 67.52  ? 148 SER B CB  1 
ATOM   3925  O OG  . SER B 2 148 ? 42.520  -71.964 -23.082 1.00 87.78  ? 148 SER B OG  1 
ATOM   3926  N N   . ARG B 2 149 ? 43.140  -74.529 -24.371 1.00 74.25  ? 149 ARG B N   1 
ATOM   3927  C CA  . ARG B 2 149 ? 44.365  -75.323 -24.520 1.00 66.91  ? 149 ARG B CA  1 
ATOM   3928  C C   . ARG B 2 149 ? 44.251  -76.544 -25.447 1.00 67.62  ? 149 ARG B C   1 
ATOM   3929  O O   . ARG B 2 149 ? 45.254  -77.208 -25.708 1.00 78.92  ? 149 ARG B O   1 
ATOM   3930  C CB  . ARG B 2 149 ? 44.879  -75.777 -23.153 1.00 62.89  ? 149 ARG B CB  1 
ATOM   3931  C CG  . ARG B 2 149 ? 45.407  -74.642 -22.293 1.00 67.12  ? 149 ARG B CG  1 
ATOM   3932  C CD  . ARG B 2 149 ? 46.176  -75.173 -21.097 1.00 69.24  ? 149 ARG B CD  1 
ATOM   3933  N NE  . ARG B 2 149 ? 45.331  -75.977 -20.222 1.00 83.66  ? 149 ARG B NE  1 
ATOM   3934  C CZ  . ARG B 2 149 ? 44.586  -75.478 -19.243 1.00 86.78  ? 149 ARG B CZ  1 
ATOM   3935  N NH1 . ARG B 2 149 ? 43.844  -76.284 -18.495 1.00 81.53  ? 149 ARG B NH1 1 
ATOM   3936  N NH2 . ARG B 2 149 ? 44.583  -74.172 -19.009 1.00 89.75  ? 149 ARG B NH2 1 
ATOM   3937  N N   . LEU B 2 150 ? 43.048  -76.843 -25.932 1.00 66.07  ? 150 LEU B N   1 
ATOM   3938  C CA  . LEU B 2 150 ? 42.838  -77.988 -26.825 1.00 68.41  ? 150 LEU B CA  1 
ATOM   3939  C C   . LEU B 2 150 ? 43.731  -77.913 -28.070 1.00 80.88  ? 150 LEU B C   1 
ATOM   3940  O O   . LEU B 2 150 ? 44.000  -76.824 -28.577 1.00 78.66  ? 150 LEU B O   1 
ATOM   3941  C CB  . LEU B 2 150 ? 41.366  -78.074 -27.244 1.00 54.39  ? 150 LEU B CB  1 
ATOM   3942  C CG  . LEU B 2 150 ? 40.344  -78.463 -26.173 1.00 76.01  ? 150 LEU B CG  1 
ATOM   3943  C CD1 . LEU B 2 150 ? 38.953  -78.572 -26.781 1.00 61.51  ? 150 LEU B CD1 1 
ATOM   3944  C CD2 . LEU B 2 150 ? 40.735  -79.763 -25.486 1.00 77.94  ? 150 LEU B CD2 1 
ATOM   3945  N N   . PRO B 2 151 ? 44.187  -79.076 -28.573 1.00 89.16  ? 151 PRO B N   1 
ATOM   3946  C CA  . PRO B 2 151 ? 45.156  -79.093 -29.674 1.00 92.62  ? 151 PRO B CA  1 
ATOM   3947  C C   . PRO B 2 151 ? 44.518  -78.840 -31.038 1.00 88.29  ? 151 PRO B C   1 
ATOM   3948  O O   . PRO B 2 151 ? 43.370  -79.216 -31.264 1.00 86.17  ? 151 PRO B O   1 
ATOM   3949  C CB  . PRO B 2 151 ? 45.750  -80.505 -29.596 1.00 92.45  ? 151 PRO B CB  1 
ATOM   3950  C CG  . PRO B 2 151 ? 44.751  -81.330 -28.808 1.00 81.53  ? 151 PRO B CG  1 
ATOM   3951  C CD  . PRO B 2 151 ? 43.665  -80.425 -28.295 1.00 77.27  ? 151 PRO B CD  1 
ATOM   3952  N N   . LYS B 2 152 ? 45.254  -78.170 -31.920 1.00 82.78  ? 152 LYS B N   1 
ATOM   3953  C CA  . LYS B 2 152 ? 44.790  -77.891 -33.277 1.00 95.45  ? 152 LYS B CA  1 
ATOM   3954  C C   . LYS B 2 152 ? 45.130  -78.995 -34.280 1.00 100.39 ? 152 LYS B C   1 
ATOM   3955  O O   . LYS B 2 152 ? 44.241  -79.556 -34.921 1.00 91.89  ? 152 LYS B O   1 
ATOM   3956  C CB  . LYS B 2 152 ? 45.365  -76.563 -33.772 1.00 89.05  ? 152 LYS B CB  1 
ATOM   3957  C CG  . LYS B 2 152 ? 44.788  -76.101 -35.101 1.00 77.46  ? 152 LYS B CG  1 
ATOM   3958  C CD  . LYS B 2 152 ? 45.550  -74.908 -35.655 1.00 80.39  ? 152 LYS B CD  1 
ATOM   3959  C CE  . LYS B 2 152 ? 44.786  -74.244 -36.792 1.00 83.85  ? 152 LYS B CE  1 
ATOM   3960  N NZ  . LYS B 2 152 ? 44.450  -75.208 -37.874 1.00 83.33  ? 152 LYS B NZ  1 
ATOM   3961  N N   . LYS B 2 153 ? 46.422  -79.293 -34.411 1.00 103.80 ? 153 LYS B N   1 
ATOM   3962  C CA  . LYS B 2 153 ? 46.911  -80.194 -35.452 1.00 95.78  ? 153 LYS B CA  1 
ATOM   3963  C C   . LYS B 2 153 ? 46.403  -81.622 -35.274 1.00 105.10 ? 153 LYS B C   1 
ATOM   3964  O O   . LYS B 2 153 ? 45.829  -82.197 -36.198 1.00 79.94  ? 153 LYS B O   1 
ATOM   3965  C CB  . LYS B 2 153 ? 48.441  -80.191 -35.478 1.00 82.91  ? 153 LYS B CB  1 
ATOM   3966  N N   . LYS B 2 154 ? 46.615  -82.197 -34.094 1.00 106.56 ? 154 LYS B N   1 
ATOM   3967  C CA  . LYS B 2 154 ? 46.130  -83.545 -33.824 1.00 98.91  ? 154 LYS B CA  1 
ATOM   3968  C C   . LYS B 2 154 ? 44.918  -83.457 -32.909 1.00 99.20  ? 154 LYS B C   1 
ATOM   3969  O O   . LYS B 2 154 ? 45.038  -83.135 -31.728 1.00 97.75  ? 154 LYS B O   1 
ATOM   3970  C CB  . LYS B 2 154 ? 47.224  -84.406 -33.193 1.00 91.26  ? 154 LYS B CB  1 
ATOM   3971  N N   . GLU B 2 155 ? 43.746  -83.730 -33.465 1.00 111.99 ? 155 GLU B N   1 
ATOM   3972  C CA  . GLU B 2 155 ? 42.512  -83.524 -32.726 1.00 114.30 ? 155 GLU B CA  1 
ATOM   3973  C C   . GLU B 2 155 ? 41.705  -84.756 -32.357 1.00 106.92 ? 155 GLU B C   1 
ATOM   3974  O O   . GLU B 2 155 ? 41.191  -85.467 -33.223 1.00 112.06 ? 155 GLU B O   1 
ATOM   3975  C CB  . GLU B 2 155 ? 41.612  -82.572 -33.501 1.00 107.83 ? 155 GLU B CB  1 
ATOM   3976  C CG  . GLU B 2 155 ? 41.630  -81.194 -32.907 1.00 113.78 ? 155 GLU B CG  1 
ATOM   3977  C CD  . GLU B 2 155 ? 40.769  -80.215 -33.659 1.00 111.52 ? 155 GLU B CD  1 
ATOM   3978  O OE1 . GLU B 2 155 ? 40.312  -80.532 -34.776 1.00 98.29  ? 155 GLU B OE1 1 
ATOM   3979  O OE2 . GLU B 2 155 ? 40.540  -79.124 -33.119 1.00 129.42 ? 155 GLU B OE2 1 
ATOM   3980  N N   . ASN B 2 156 ? 41.562  -84.967 -31.054 1.00 97.58  ? 156 ASN B N   1 
ATOM   3981  C CA  . ASN B 2 156 ? 40.612  -85.936 -30.537 1.00 106.15 ? 156 ASN B CA  1 
ATOM   3982  C C   . ASN B 2 156 ? 39.256  -85.260 -30.416 1.00 101.74 ? 156 ASN B C   1 
ATOM   3983  O O   . ASN B 2 156 ? 39.055  -84.387 -29.571 1.00 103.71 ? 156 ASN B O   1 
ATOM   3984  C CB  . ASN B 2 156 ? 41.057  -86.494 -29.187 1.00 108.34 ? 156 ASN B CB  1 
ATOM   3985  C CG  . ASN B 2 156 ? 40.425  -87.834 -28.874 1.00 114.83 ? 156 ASN B CG  1 
ATOM   3986  O OD1 . ASN B 2 156 ? 39.318  -88.129 -29.322 1.00 103.20 ? 156 ASN B OD1 1 
ATOM   3987  N ND2 . ASN B 2 156 ? 41.131  -88.659 -28.110 1.00 116.51 ? 156 ASN B ND2 1 
ATOM   3988  N N   . GLU B 2 157 ? 38.335  -85.634 -31.292 1.00 100.42 ? 157 GLU B N   1 
ATOM   3989  C CA  . GLU B 2 157 ? 37.041  -84.970 -31.361 1.00 100.79 ? 157 GLU B CA  1 
ATOM   3990  C C   . GLU B 2 157 ? 36.223  -85.230 -30.101 1.00 110.21 ? 157 GLU B C   1 
ATOM   3991  O O   . GLU B 2 157 ? 35.433  -84.386 -29.685 1.00 110.74 ? 157 GLU B O   1 
ATOM   3992  C CB  . GLU B 2 157 ? 36.274  -85.420 -32.606 1.00 104.52 ? 157 GLU B CB  1 
ATOM   3993  C CG  . GLU B 2 157 ? 36.528  -84.523 -33.805 1.00 114.54 ? 157 GLU B CG  1 
ATOM   3994  C CD  . GLU B 2 157 ? 35.670  -84.880 -34.999 1.00 117.33 ? 157 GLU B CD  1 
ATOM   3995  O OE1 . GLU B 2 157 ? 35.008  -85.938 -34.956 1.00 126.99 ? 157 GLU B OE1 1 
ATOM   3996  O OE2 . GLU B 2 157 ? 35.659  -84.106 -35.980 1.00 119.22 ? 157 GLU B OE2 1 
ATOM   3997  N N   . LYS B 2 158 ? 36.424  -86.395 -29.492 1.00 110.81 ? 158 LYS B N   1 
ATOM   3998  C CA  . LYS B 2 158 ? 35.702  -86.764 -28.279 1.00 103.39 ? 158 LYS B CA  1 
ATOM   3999  C C   . LYS B 2 158 ? 36.093  -85.884 -27.094 1.00 107.85 ? 158 LYS B C   1 
ATOM   4000  O O   . LYS B 2 158 ? 35.229  -85.305 -26.433 1.00 106.10 ? 158 LYS B O   1 
ATOM   4001  C CB  . LYS B 2 158 ? 35.951  -88.230 -27.941 1.00 103.99 ? 158 LYS B CB  1 
ATOM   4002  N N   . VAL B 2 159 ? 37.392  -85.811 -26.812 1.00 105.28 ? 159 VAL B N   1 
ATOM   4003  C CA  . VAL B 2 159 ? 37.899  -84.919 -25.774 1.00 109.38 ? 159 VAL B CA  1 
ATOM   4004  C C   . VAL B 2 159 ? 37.438  -83.490 -26.059 1.00 106.07 ? 159 VAL B C   1 
ATOM   4005  O O   . VAL B 2 159 ? 36.978  -82.792 -25.159 1.00 100.69 ? 159 VAL B O   1 
ATOM   4006  C CB  . VAL B 2 159 ? 39.452  -85.000 -25.651 1.00 114.49 ? 159 VAL B CB  1 
ATOM   4007  C CG1 . VAL B 2 159 ? 40.110  -83.626 -25.722 1.00 110.62 ? 159 VAL B CG1 1 
ATOM   4008  C CG2 . VAL B 2 159 ? 39.853  -85.737 -24.376 1.00 111.50 ? 159 VAL B CG2 1 
ATOM   4009  N N   . LYS B 2 160 ? 37.540  -83.073 -27.318 1.00 96.30  ? 160 LYS B N   1 
ATOM   4010  C CA  . LYS B 2 160 ? 37.159  -81.724 -27.717 1.00 92.57  ? 160 LYS B CA  1 
ATOM   4011  C C   . LYS B 2 160 ? 35.670  -81.449 -27.501 1.00 91.39  ? 160 LYS B C   1 
ATOM   4012  O O   . LYS B 2 160 ? 35.299  -80.409 -26.953 1.00 95.38  ? 160 LYS B O   1 
ATOM   4013  C CB  . LYS B 2 160 ? 37.531  -81.490 -29.181 1.00 93.50  ? 160 LYS B CB  1 
ATOM   4014  C CG  . LYS B 2 160 ? 36.708  -80.427 -29.875 1.00 74.39  ? 160 LYS B CG  1 
ATOM   4015  C CD  . LYS B 2 160 ? 37.183  -80.233 -31.299 1.00 83.18  ? 160 LYS B CD  1 
ATOM   4016  C CE  . LYS B 2 160 ? 36.099  -79.611 -32.153 1.00 88.72  ? 160 LYS B CE  1 
ATOM   4017  N NZ  . LYS B 2 160 ? 34.947  -80.540 -32.305 1.00 98.96  ? 160 LYS B NZ  1 
ATOM   4018  N N   . THR B 2 161 ? 34.820  -82.381 -27.923 1.00 90.95  ? 161 THR B N   1 
ATOM   4019  C CA  . THR B 2 161 ? 33.378  -82.184 -27.815 1.00 97.64  ? 161 THR B CA  1 
ATOM   4020  C C   . THR B 2 161 ? 32.926  -82.236 -26.353 1.00 98.67  ? 161 THR B C   1 
ATOM   4021  O O   . THR B 2 161 ? 32.025  -81.494 -25.951 1.00 92.95  ? 161 THR B O   1 
ATOM   4022  C CB  . THR B 2 161 ? 32.583  -83.218 -28.670 1.00 94.42  ? 161 THR B CB  1 
ATOM   4023  O OG1 . THR B 2 161 ? 31.222  -82.789 -28.805 1.00 97.90  ? 161 THR B OG1 1 
ATOM   4024  C CG2 . THR B 2 161 ? 32.618  -84.614 -28.064 1.00 102.96 ? 161 THR B CG2 1 
ATOM   4025  N N   . GLU B 2 162 ? 33.555  -83.093 -25.552 1.00 99.02  ? 162 GLU B N   1 
ATOM   4026  C CA  . GLU B 2 162 ? 33.183  -83.185 -24.147 1.00 101.59 ? 162 GLU B CA  1 
ATOM   4027  C C   . GLU B 2 162 ? 33.647  -81.950 -23.382 1.00 103.06 ? 162 GLU B C   1 
ATOM   4028  O O   . GLU B 2 162 ? 32.897  -81.410 -22.576 1.00 104.14 ? 162 GLU B O   1 
ATOM   4029  C CB  . GLU B 2 162 ? 33.746  -84.455 -23.505 1.00 104.39 ? 162 GLU B CB  1 
ATOM   4030  C CG  . GLU B 2 162 ? 32.661  -85.371 -22.956 1.00 107.46 ? 162 GLU B CG  1 
ATOM   4031  C CD  . GLU B 2 162 ? 33.215  -86.566 -22.206 1.00 120.38 ? 162 GLU B CD  1 
ATOM   4032  O OE1 . GLU B 2 162 ? 34.448  -86.762 -22.215 1.00 115.95 ? 162 GLU B OE1 1 
ATOM   4033  O OE2 . GLU B 2 162 ? 32.411  -87.310 -21.605 1.00 118.67 ? 162 GLU B OE2 1 
ATOM   4034  N N   . VAL B 2 163 ? 34.864  -81.487 -23.663 1.00 99.20  ? 163 VAL B N   1 
ATOM   4035  C CA  . VAL B 2 163 ? 35.372  -80.251 -23.071 1.00 90.98  ? 163 VAL B CA  1 
ATOM   4036  C C   . VAL B 2 163 ? 34.460  -79.085 -23.447 1.00 90.90  ? 163 VAL B C   1 
ATOM   4037  O O   . VAL B 2 163 ? 34.139  -78.229 -22.614 1.00 85.53  ? 163 VAL B O   1 
ATOM   4038  C CB  . VAL B 2 163 ? 36.822  -79.960 -23.524 1.00 75.02  ? 163 VAL B CB  1 
ATOM   4039  C CG1 . VAL B 2 163 ? 37.199  -78.517 -23.243 1.00 81.55  ? 163 VAL B CG1 1 
ATOM   4040  C CG2 . VAL B 2 163 ? 37.796  -80.913 -22.840 1.00 85.11  ? 163 VAL B CG2 1 
ATOM   4041  N N   . GLY B 2 164 ? 34.026  -79.081 -24.704 1.00 89.48  ? 164 GLY B N   1 
ATOM   4042  C CA  . GLY B 2 164 ? 33.078  -78.098 -25.192 1.00 85.01  ? 164 GLY B CA  1 
ATOM   4043  C C   . GLY B 2 164 ? 31.804  -78.152 -24.374 1.00 86.98  ? 164 GLY B C   1 
ATOM   4044  O O   . GLY B 2 164 ? 31.213  -77.120 -24.056 1.00 92.65  ? 164 GLY B O   1 
ATOM   4045  N N   . LYS B 2 165 ? 31.374  -79.365 -24.041 1.00 87.49  ? 165 LYS B N   1 
ATOM   4046  C CA  . LYS B 2 165 ? 30.189  -79.549 -23.213 1.00 86.80  ? 165 LYS B CA  1 
ATOM   4047  C C   . LYS B 2 165 ? 30.369  -78.988 -21.798 1.00 87.97  ? 165 LYS B C   1 
ATOM   4048  O O   . LYS B 2 165 ? 29.480  -78.295 -21.294 1.00 90.02  ? 165 LYS B O   1 
ATOM   4049  C CB  . LYS B 2 165 ? 29.811  -81.029 -23.144 1.00 83.25  ? 165 LYS B CB  1 
ATOM   4050  N N   . GLU B 2 166 ? 31.496  -79.299 -21.156 1.00 85.62  ? 166 GLU B N   1 
ATOM   4051  C CA  . GLU B 2 166 ? 31.859  -78.677 -19.881 1.00 81.58  ? 166 GLU B CA  1 
ATOM   4052  C C   . GLU B 2 166 ? 31.722  -77.156 -19.967 1.00 84.98  ? 166 GLU B C   1 
ATOM   4053  O O   . GLU B 2 166 ? 31.036  -76.532 -19.157 1.00 75.66  ? 166 GLU B O   1 
ATOM   4054  C CB  . GLU B 2 166 ? 33.294  -79.034 -19.495 1.00 89.85  ? 166 GLU B CB  1 
ATOM   4055  C CG  . GLU B 2 166 ? 33.724  -80.455 -19.828 1.00 108.44 ? 166 GLU B CG  1 
ATOM   4056  C CD  . GLU B 2 166 ? 35.121  -80.774 -19.343 1.00 113.70 ? 166 GLU B CD  1 
ATOM   4057  O OE1 . GLU B 2 166 ? 35.734  -79.909 -18.680 1.00 114.94 ? 166 GLU B OE1 1 
ATOM   4058  O OE2 . GLU B 2 166 ? 35.643  -81.851 -19.704 1.00 117.85 ? 166 GLU B OE2 1 
ATOM   4059  N N   . VAL B 2 167 ? 32.353  -76.574 -20.985 1.00 87.26  ? 167 VAL B N   1 
ATOM   4060  C CA  . VAL B 2 167 ? 32.343  -75.121 -21.178 1.00 82.88  ? 167 VAL B CA  1 
ATOM   4061  C C   . VAL B 2 167 ? 30.926  -74.571 -21.318 1.00 81.77  ? 167 VAL B C   1 
ATOM   4062  O O   . VAL B 2 167 ? 30.570  -73.579 -20.682 1.00 82.49  ? 167 VAL B O   1 
ATOM   4063  C CB  . VAL B 2 167 ? 33.175  -74.721 -22.417 1.00 76.20  ? 167 VAL B CB  1 
ATOM   4064  C CG1 . VAL B 2 167 ? 32.963  -73.254 -22.769 1.00 67.62  ? 167 VAL B CG1 1 
ATOM   4065  C CG2 . VAL B 2 167 ? 34.637  -75.015 -22.172 1.00 83.24  ? 167 VAL B CG2 1 
ATOM   4066  N N   . ALA B 2 168 ? 30.121  -75.234 -22.140 1.00 73.76  ? 168 ALA B N   1 
ATOM   4067  C CA  . ALA B 2 168 ? 28.728  -74.848 -22.342 1.00 73.50  ? 168 ALA B CA  1 
ATOM   4068  C C   . ALA B 2 168 ? 27.934  -74.881 -21.037 1.00 89.41  ? 168 ALA B C   1 
ATOM   4069  O O   . ALA B 2 168 ? 27.179  -73.953 -20.733 1.00 91.35  ? 168 ALA B O   1 
ATOM   4070  C CB  . ALA B 2 168 ? 28.079  -75.754 -23.375 1.00 69.76  ? 168 ALA B CB  1 
ATOM   4071  N N   . ALA B 2 169 ? 28.114  -75.949 -20.265 1.00 91.55  ? 169 ALA B N   1 
ATOM   4072  C CA  . ALA B 2 169 ? 27.407  -76.108 -18.997 1.00 84.05  ? 169 ALA B CA  1 
ATOM   4073  C C   . ALA B 2 169 ? 27.791  -75.015 -18.002 1.00 79.84  ? 169 ALA B C   1 
ATOM   4074  O O   . ALA B 2 169 ? 26.922  -74.358 -17.420 1.00 79.35  ? 169 ALA B O   1 
ATOM   4075  C CB  . ALA B 2 169 ? 27.679  -77.482 -18.408 1.00 88.73  ? 169 ALA B CB  1 
ATOM   4076  N N   . ALA B 2 170 ? 29.094  -74.828 -17.813 1.00 76.66  ? 170 ALA B N   1 
ATOM   4077  C CA  . ALA B 2 170 ? 29.603  -73.812 -16.897 1.00 89.13  ? 170 ALA B CA  1 
ATOM   4078  C C   . ALA B 2 170 ? 29.104  -72.427 -17.297 1.00 83.68  ? 170 ALA B C   1 
ATOM   4079  O O   . ALA B 2 170 ? 28.700  -71.628 -16.447 1.00 77.85  ? 170 ALA B O   1 
ATOM   4080  C CB  . ALA B 2 170 ? 31.125  -73.841 -16.862 1.00 73.92  ? 170 ALA B CB  1 
ATOM   4081  N N   . ARG B 2 171 ? 29.130  -72.158 -18.599 1.00 76.41  ? 171 ARG B N   1 
ATOM   4082  C CA  . ARG B 2 171 ? 28.663  -70.889 -19.144 1.00 73.52  ? 171 ARG B CA  1 
ATOM   4083  C C   . ARG B 2 171 ? 27.185  -70.656 -18.865 1.00 72.19  ? 171 ARG B C   1 
ATOM   4084  O O   . ARG B 2 171 ? 26.781  -69.553 -18.492 1.00 76.69  ? 171 ARG B O   1 
ATOM   4085  C CB  . ARG B 2 171 ? 28.908  -70.847 -20.652 1.00 77.09  ? 171 ARG B CB  1 
ATOM   4086  C CG  . ARG B 2 171 ? 28.533  -69.538 -21.320 1.00 69.39  ? 171 ARG B CG  1 
ATOM   4087  C CD  . ARG B 2 171 ? 29.028  -69.539 -22.750 1.00 63.33  ? 171 ARG B CD  1 
ATOM   4088  N NE  . ARG B 2 171 ? 30.482  -69.622 -22.791 1.00 60.75  ? 171 ARG B NE  1 
ATOM   4089  C CZ  . ARG B 2 171 ? 31.193  -69.771 -23.902 1.00 59.95  ? 171 ARG B CZ  1 
ATOM   4090  N NH1 . ARG B 2 171 ? 30.586  -69.856 -25.078 1.00 72.73  ? 171 ARG B NH1 1 
ATOM   4091  N NH2 . ARG B 2 171 ? 32.513  -69.838 -23.832 1.00 64.01  ? 171 ARG B NH2 1 
ATOM   4092  N N   . ARG B 2 172 ? 26.383  -71.700 -19.051 1.00 75.48  ? 172 ARG B N   1 
ATOM   4093  C CA  . ARG B 2 172 ? 24.951  -71.606 -18.800 1.00 79.36  ? 172 ARG B CA  1 
ATOM   4094  C C   . ARG B 2 172 ? 24.674  -71.326 -17.329 1.00 76.20  ? 172 ARG B C   1 
ATOM   4095  O O   . ARG B 2 172 ? 23.898  -70.423 -16.987 1.00 74.15  ? 172 ARG B O   1 
ATOM   4096  C CB  . ARG B 2 172 ? 24.241  -72.887 -19.241 1.00 73.35  ? 172 ARG B CB  1 
ATOM   4097  C CG  . ARG B 2 172 ? 22.742  -72.861 -19.021 1.00 79.10  ? 172 ARG B CG  1 
ATOM   4098  C CD  . ARG B 2 172 ? 22.089  -74.152 -19.481 1.00 91.08  ? 172 ARG B CD  1 
ATOM   4099  N NE  . ARG B 2 172 ? 20.641  -74.119 -19.304 1.00 120.80 ? 172 ARG B NE  1 
ATOM   4100  C CZ  . ARG B 2 172 ? 20.016  -74.456 -18.180 1.00 118.81 ? 172 ARG B CZ  1 
ATOM   4101  N NH1 . ARG B 2 172 ? 18.694  -74.393 -18.110 1.00 103.15 ? 172 ARG B NH1 1 
ATOM   4102  N NH2 . ARG B 2 172 ? 20.714  -74.856 -17.125 1.00 84.59  ? 172 ARG B NH2 1 
ATOM   4103  N N   . LYS B 2 173 ? 25.336  -72.087 -16.462 1.00 73.24  ? 173 LYS B N   1 
ATOM   4104  C CA  . LYS B 2 173 ? 25.144  -71.935 -15.027 1.00 75.88  ? 173 LYS B CA  1 
ATOM   4105  C C   . LYS B 2 173 ? 25.549  -70.534 -14.571 1.00 78.85  ? 173 LYS B C   1 
ATOM   4106  O O   . LYS B 2 173 ? 24.840  -69.908 -13.776 1.00 79.97  ? 173 LYS B O   1 
ATOM   4107  C CB  . LYS B 2 173 ? 25.929  -72.999 -14.254 1.00 76.16  ? 173 LYS B CB  1 
ATOM   4108  C CG  . LYS B 2 173 ? 25.513  -73.115 -12.792 1.00 92.80  ? 173 LYS B CG  1 
ATOM   4109  C CD  . LYS B 2 173 ? 26.440  -74.030 -12.003 1.00 82.45  ? 173 LYS B CD  1 
ATOM   4110  C CE  . LYS B 2 173 ? 27.884  -73.560 -12.063 1.00 95.95  ? 173 LYS B CE  1 
ATOM   4111  N NZ  . LYS B 2 173 ? 28.764  -74.439 -11.247 1.00 84.25  ? 173 LYS B NZ  1 
ATOM   4112  N N   . GLN B 2 174 ? 26.676  -70.035 -15.075 1.00 77.44  ? 174 GLN B N   1 
ATOM   4113  C CA  . GLN B 2 174 ? 27.101  -68.686 -14.708 1.00 71.90  ? 174 GLN B CA  1 
ATOM   4114  C C   . GLN B 2 174 ? 26.123  -67.643 -15.245 1.00 65.57  ? 174 GLN B C   1 
ATOM   4115  O O   . GLN B 2 174 ? 25.870  -66.635 -14.590 1.00 70.47  ? 174 GLN B O   1 
ATOM   4116  C CB  . GLN B 2 174 ? 28.512  -68.364 -15.214 1.00 55.79  ? 174 GLN B CB  1 
ATOM   4117  C CG  . GLN B 2 174 ? 28.691  -66.875 -15.533 1.00 56.95  ? 174 GLN B CG  1 
ATOM   4118  C CD  . GLN B 2 174 ? 30.117  -66.473 -15.848 1.00 71.47  ? 174 GLN B CD  1 
ATOM   4119  O OE1 . GLN B 2 174 ? 30.962  -67.309 -16.158 1.00 83.91  ? 174 GLN B OE1 1 
ATOM   4120  N NE2 . GLN B 2 174 ? 30.391  -65.176 -15.764 1.00 78.22  ? 174 GLN B NE2 1 
ATOM   4121  N N   . HIS B 2 175 ? 25.582  -67.876 -16.437 1.00 60.45  ? 175 HIS B N   1 
ATOM   4122  C CA  . HIS B 2 175 ? 24.620  -66.941 -17.004 1.00 66.99  ? 175 HIS B CA  1 
ATOM   4123  C C   . HIS B 2 175 ? 23.396  -66.832 -16.099 1.00 72.93  ? 175 HIS B C   1 
ATOM   4124  O O   . HIS B 2 175 ? 22.926  -65.728 -15.797 1.00 70.80  ? 175 HIS B O   1 
ATOM   4125  C CB  . HIS B 2 175 ? 24.206  -67.365 -18.412 1.00 59.57  ? 175 HIS B CB  1 
ATOM   4126  C CG  . HIS B 2 175 ? 23.379  -66.343 -19.125 1.00 59.81  ? 175 HIS B CG  1 
ATOM   4127  N ND1 . HIS B 2 175 ? 22.385  -66.676 -20.020 1.00 68.33  ? 175 HIS B ND1 1 
ATOM   4128  C CD2 . HIS B 2 175 ? 23.399  -64.991 -19.069 1.00 61.33  ? 175 HIS B CD2 1 
ATOM   4129  C CE1 . HIS B 2 175 ? 21.830  -65.571 -20.487 1.00 59.05  ? 175 HIS B CE1 1 
ATOM   4130  N NE2 . HIS B 2 175 ? 22.426  -64.535 -19.926 1.00 62.38  ? 175 HIS B NE2 1 
ATOM   4131  N N   . LEU B 2 176 ? 22.892  -67.982 -15.657 1.00 78.17  ? 176 LEU B N   1 
ATOM   4132  C CA  . LEU B 2 176 ? 21.714  -68.000 -14.795 1.00 75.53  ? 176 LEU B CA  1 
ATOM   4133  C C   . LEU B 2 176 ? 22.007  -67.337 -13.447 1.00 80.46  ? 176 LEU B C   1 
ATOM   4134  O O   . LEU B 2 176 ? 21.207  -66.531 -12.951 1.00 80.38  ? 176 LEU B O   1 
ATOM   4135  C CB  . LEU B 2 176 ? 21.230  -69.436 -14.583 1.00 79.13  ? 176 LEU B CB  1 
ATOM   4136  C CG  . LEU B 2 176 ? 20.958  -70.254 -15.849 1.00 88.05  ? 176 LEU B CG  1 
ATOM   4137  C CD1 . LEU B 2 176 ? 21.021  -71.745 -15.558 1.00 93.95  ? 176 LEU B CD1 1 
ATOM   4138  C CD2 . LEU B 2 176 ? 19.618  -69.886 -16.458 1.00 66.84  ? 176 LEU B CD2 1 
ATOM   4139  N N   . SER B 2 177 ? 23.160  -67.665 -12.867 1.00 65.34  ? 177 SER B N   1 
ATOM   4140  C CA  . SER B 2 177 ? 23.569  -67.073 -11.594 1.00 60.04  ? 177 SER B CA  1 
ATOM   4141  C C   . SER B 2 177 ? 23.706  -65.556 -11.705 1.00 72.36  ? 177 SER B C   1 
ATOM   4142  O O   . SER B 2 177 ? 23.332  -64.819 -10.794 1.00 75.48  ? 177 SER B O   1 
ATOM   4143  C CB  . SER B 2 177 ? 24.888  -67.678 -11.113 1.00 62.00  ? 177 SER B CB  1 
ATOM   4144  O OG  . SER B 2 177 ? 25.936  -67.415 -12.028 1.00 71.66  ? 177 SER B OG  1 
ATOM   4145  N N   . SER B 2 178 ? 24.257  -65.103 -12.825 1.00 81.22  ? 178 SER B N   1 
ATOM   4146  C CA  . SER B 2 178 ? 24.446  -63.684 -13.094 1.00 67.99  ? 178 SER B CA  1 
ATOM   4147  C C   . SER B 2 178 ? 23.109  -62.971 -13.217 1.00 69.87  ? 178 SER B C   1 
ATOM   4148  O O   . SER B 2 178 ? 22.933  -61.872 -12.692 1.00 73.36  ? 178 SER B O   1 
ATOM   4149  C CB  . SER B 2 178 ? 25.258  -63.483 -14.375 1.00 61.56  ? 178 SER B CB  1 
ATOM   4150  O OG  . SER B 2 178 ? 26.475  -64.204 -14.327 1.00 77.12  ? 178 SER B OG  1 
ATOM   4151  N N   . LEU B 2 179 ? 22.170  -63.603 -13.917 1.00 71.94  ? 179 LEU B N   1 
ATOM   4152  C CA  . LEU B 2 179 ? 20.832  -63.041 -14.058 1.00 79.49  ? 179 LEU B CA  1 
ATOM   4153  C C   . LEU B 2 179 ? 20.173  -62.889 -12.690 1.00 84.95  ? 179 LEU B C   1 
ATOM   4154  O O   . LEU B 2 179 ? 19.624  -61.827 -12.364 1.00 82.37  ? 179 LEU B O   1 
ATOM   4155  C CB  . LEU B 2 179 ? 19.974  -63.917 -14.974 1.00 69.98  ? 179 LEU B CB  1 
ATOM   4156  C CG  . LEU B 2 179 ? 20.352  -63.892 -16.457 1.00 63.79  ? 179 LEU B CG  1 
ATOM   4157  C CD1 . LEU B 2 179 ? 19.476  -64.842 -17.259 1.00 68.25  ? 179 LEU B CD1 1 
ATOM   4158  C CD2 . LEU B 2 179 ? 20.267  -62.477 -17.012 1.00 58.95  ? 179 LEU B CD2 1 
ATOM   4159  N N   . GLN B 2 180 ? 20.253  -63.946 -11.885 1.00 83.07  ? 180 GLN B N   1 
ATOM   4160  C CA  . GLN B 2 180 ? 19.680  -63.929 -10.540 1.00 68.43  ? 180 GLN B CA  1 
ATOM   4161  C C   . GLN B 2 180 ? 20.304  -62.846 -9.658  1.00 64.74  ? 180 GLN B C   1 
ATOM   4162  O O   . GLN B 2 180 ? 19.596  -62.113 -8.967  1.00 75.59  ? 180 GLN B O   1 
ATOM   4163  C CB  . GLN B 2 180 ? 19.844  -65.298 -9.877  1.00 71.41  ? 180 GLN B CB  1 
ATOM   4164  C CG  . GLN B 2 180 ? 19.042  -66.406 -10.539 1.00 80.06  ? 180 GLN B CG  1 
ATOM   4165  C CD  . GLN B 2 180 ? 17.555  -66.112 -10.566 1.00 71.26  ? 180 GLN B CD  1 
ATOM   4166  O OE1 . GLN B 2 180 ? 16.915  -65.986 -9.522  1.00 86.96  ? 180 GLN B OE1 1 
ATOM   4167  N NE2 . GLN B 2 180 ? 16.996  -65.998 -11.766 1.00 69.58  ? 180 GLN B NE2 1 
ATOM   4168  N N   . TYR B 2 181 ? 21.631  -62.756 -9.687  1.00 66.18  ? 181 TYR B N   1 
ATOM   4169  C CA  . TYR B 2 181 ? 22.369  -61.768 -8.904  1.00 51.14  ? 181 TYR B CA  1 
ATOM   4170  C C   . TYR B 2 181 ? 22.012  -60.336 -9.308  1.00 62.35  ? 181 TYR B C   1 
ATOM   4171  O O   . TYR B 2 181 ? 21.764  -59.481 -8.451  1.00 60.51  ? 181 TYR B O   1 
ATOM   4172  C CB  . TYR B 2 181 ? 23.876  -62.000 -9.060  1.00 60.09  ? 181 TYR B CB  1 
ATOM   4173  C CG  . TYR B 2 181 ? 24.752  -61.184 -8.131  1.00 59.34  ? 181 TYR B CG  1 
ATOM   4174  C CD1 . TYR B 2 181 ? 24.231  -60.587 -6.990  1.00 57.58  ? 181 TYR B CD1 1 
ATOM   4175  C CD2 . TYR B 2 181 ? 26.102  -61.004 -8.406  1.00 62.75  ? 181 TYR B CD2 1 
ATOM   4176  C CE1 . TYR B 2 181 ? 25.029  -59.839 -6.149  1.00 53.08  ? 181 TYR B CE1 1 
ATOM   4177  C CE2 . TYR B 2 181 ? 26.908  -60.257 -7.569  1.00 55.93  ? 181 TYR B CE2 1 
ATOM   4178  C CZ  . TYR B 2 181 ? 26.364  -59.676 -6.444  1.00 53.41  ? 181 TYR B CZ  1 
ATOM   4179  O OH  . TYR B 2 181 ? 27.157  -58.933 -5.604  1.00 63.80  ? 181 TYR B OH  1 
ATOM   4180  N N   . TYR B 2 182 ? 21.985  -60.080 -10.612 1.00 57.79  ? 182 TYR B N   1 
ATOM   4181  C CA  . TYR B 2 182 ? 21.721  -58.736 -11.118 1.00 50.93  ? 182 TYR B CA  1 
ATOM   4182  C C   . TYR B 2 182 ? 20.296  -58.320 -10.769 1.00 60.48  ? 182 TYR B C   1 
ATOM   4183  O O   . TYR B 2 182 ? 20.051  -57.185 -10.336 1.00 63.96  ? 182 TYR B O   1 
ATOM   4184  C CB  . TYR B 2 182 ? 21.943  -58.662 -12.633 1.00 72.93  ? 182 TYR B CB  1 
ATOM   4185  C CG  . TYR B 2 182 ? 23.378  -58.857 -13.085 1.00 62.22  ? 182 TYR B CG  1 
ATOM   4186  C CD1 . TYR B 2 182 ? 24.391  -59.129 -12.174 1.00 59.00  ? 182 TYR B CD1 1 
ATOM   4187  C CD2 . TYR B 2 182 ? 23.717  -58.769 -14.430 1.00 53.66  ? 182 TYR B CD2 1 
ATOM   4188  C CE1 . TYR B 2 182 ? 25.696  -59.311 -12.588 1.00 65.97  ? 182 TYR B CE1 1 
ATOM   4189  C CE2 . TYR B 2 182 ? 25.023  -58.947 -14.853 1.00 65.62  ? 182 TYR B CE2 1 
ATOM   4190  C CZ  . TYR B 2 182 ? 26.008  -59.218 -13.927 1.00 62.97  ? 182 TYR B CZ  1 
ATOM   4191  O OH  . TYR B 2 182 ? 27.309  -59.397 -14.337 1.00 62.03  ? 182 TYR B OH  1 
ATOM   4192  N N   . CYS B 2 183 ? 19.360  -59.250 -10.951 1.00 66.46  ? 183 CYS B N   1 
ATOM   4193  C CA  . CYS B 2 183 ? 17.974  -59.019 -10.561 1.00 70.69  ? 183 CYS B CA  1 
ATOM   4194  C C   . CYS B 2 183 ? 17.893  -58.706 -9.071  1.00 72.96  ? 183 CYS B C   1 
ATOM   4195  O O   . CYS B 2 183 ? 17.145  -57.822 -8.646  1.00 76.04  ? 183 CYS B O   1 
ATOM   4196  C CB  . CYS B 2 183 ? 17.108  -60.234 -10.896 1.00 75.17  ? 183 CYS B CB  1 
ATOM   4197  S SG  . CYS B 2 183 ? 15.331  -59.903 -10.920 1.00 100.79 ? 183 CYS B SG  1 
ATOM   4198  N N   . ALA B 2 184 ? 18.678  -59.439 -8.287  1.00 65.60  ? 184 ALA B N   1 
ATOM   4199  C CA  . ALA B 2 184 ? 18.736  -59.246 -6.843  1.00 59.98  ? 184 ALA B CA  1 
ATOM   4200  C C   . ALA B 2 184 ? 19.199  -57.840 -6.473  1.00 63.27  ? 184 ALA B C   1 
ATOM   4201  O O   . ALA B 2 184 ? 18.626  -57.214 -5.586  1.00 69.25  ? 184 ALA B O   1 
ATOM   4202  C CB  . ALA B 2 184 ? 19.648  -60.283 -6.208  1.00 64.78  ? 184 ALA B CB  1 
ATOM   4203  N N   . LEU B 2 185 ? 20.244  -57.351 -7.136  1.00 50.76  ? 185 LEU B N   1 
ATOM   4204  C CA  . LEU B 2 185 ? 20.769  -56.019 -6.836  1.00 54.57  ? 185 LEU B CA  1 
ATOM   4205  C C   . LEU B 2 185 ? 19.793  -54.916 -7.255  1.00 60.57  ? 185 LEU B C   1 
ATOM   4206  O O   . LEU B 2 185 ? 19.518  -53.976 -6.487  1.00 72.44  ? 185 LEU B O   1 
ATOM   4207  C CB  . LEU B 2 185 ? 22.122  -55.817 -7.521  1.00 40.50  ? 185 LEU B CB  1 
ATOM   4208  C CG  . LEU B 2 185 ? 23.223  -56.781 -7.069  1.00 53.22  ? 185 LEU B CG  1 
ATOM   4209  C CD1 . LEU B 2 185 ? 24.525  -56.510 -7.800  1.00 42.95  ? 185 LEU B CD1 1 
ATOM   4210  C CD2 . LEU B 2 185 ? 23.425  -56.687 -5.566  1.00 55.40  ? 185 LEU B CD2 1 
ATOM   4211  N N   . ASN B 2 186 ? 19.263  -55.041 -8.469  1.00 56.75  ? 186 ASN B N   1 
ATOM   4212  C CA  . ASN B 2 186 ? 18.263  -54.099 -8.960  1.00 62.04  ? 186 ASN B CA  1 
ATOM   4213  C C   . ASN B 2 186 ? 17.053  -54.032 -8.031  1.00 67.49  ? 186 ASN B C   1 
ATOM   4214  O O   . ASN B 2 186 ? 16.493  -52.959 -7.805  1.00 71.92  ? 186 ASN B O   1 
ATOM   4215  C CB  . ASN B 2 186 ? 17.827  -54.470 -10.378 1.00 75.19  ? 186 ASN B CB  1 
ATOM   4216  C CG  . ASN B 2 186 ? 18.903  -54.192 -11.411 1.00 63.49  ? 186 ASN B CG  1 
ATOM   4217  O OD1 . ASN B 2 186 ? 19.620  -53.194 -11.324 1.00 68.40  ? 186 ASN B OD1 1 
ATOM   4218  N ND2 . ASN B 2 186 ? 19.021  -55.075 -12.395 1.00 59.51  ? 186 ASN B ND2 1 
ATOM   4219  N N   . ALA B 2 187 ? 16.656  -55.184 -7.497  1.00 76.51  ? 187 ALA B N   1 
ATOM   4220  C CA  . ALA B 2 187 ? 15.590  -55.247 -6.500  1.00 67.13  ? 187 ALA B CA  1 
ATOM   4221  C C   . ALA B 2 187 ? 16.017  -54.570 -5.201  1.00 58.18  ? 187 ALA B C   1 
ATOM   4222  O O   . ALA B 2 187 ? 15.230  -53.872 -4.553  1.00 61.48  ? 187 ALA B O   1 
ATOM   4223  C CB  . ALA B 2 187 ? 15.200  -56.689 -6.236  1.00 75.63  ? 187 ALA B CB  1 
ATOM   4224  N N   . LEU B 2 188 ? 17.275  -54.793 -4.831  1.00 55.72  ? 188 LEU B N   1 
ATOM   4225  C CA  . LEU B 2 188 ? 17.848  -54.269 -3.598  1.00 63.21  ? 188 LEU B CA  1 
ATOM   4226  C C   . LEU B 2 188 ? 17.769  -52.753 -3.580  1.00 61.96  ? 188 LEU B C   1 
ATOM   4227  O O   . LEU B 2 188 ? 17.617  -52.143 -2.520  1.00 64.21  ? 188 LEU B O   1 
ATOM   4228  C CB  . LEU B 2 188 ? 19.301  -54.722 -3.440  1.00 64.56  ? 188 LEU B CB  1 
ATOM   4229  C CG  . LEU B 2 188 ? 20.016  -54.315 -2.151  1.00 64.03  ? 188 LEU B CG  1 
ATOM   4230  C CD1 . LEU B 2 188 ? 19.402  -55.014 -0.948  1.00 47.52  ? 188 LEU B CD1 1 
ATOM   4231  C CD2 . LEU B 2 188 ? 21.508  -54.602 -2.249  1.00 55.51  ? 188 LEU B CD2 1 
ATOM   4232  N N   . GLN B 2 189 ? 17.885  -52.150 -4.759  1.00 62.08  ? 189 GLN B N   1 
ATOM   4233  C CA  . GLN B 2 189 ? 17.801  -50.696 -4.871  1.00 62.25  ? 189 GLN B CA  1 
ATOM   4234  C C   . GLN B 2 189 ? 16.487  -50.133 -4.304  1.00 64.16  ? 189 GLN B C   1 
ATOM   4235  O O   . GLN B 2 189 ? 16.496  -49.128 -3.595  1.00 69.93  ? 189 GLN B O   1 
ATOM   4236  C CB  . GLN B 2 189 ? 17.977  -50.273 -6.328  1.00 63.27  ? 189 GLN B CB  1 
ATOM   4237  C CG  . GLN B 2 189 ? 19.307  -50.715 -6.914  1.00 53.79  ? 189 GLN B CG  1 
ATOM   4238  C CD  . GLN B 2 189 ? 20.488  -50.219 -6.103  1.00 62.82  ? 189 GLN B CD  1 
ATOM   4239  O OE1 . GLN B 2 189 ? 20.556  -49.045 -5.738  1.00 74.83  ? 189 GLN B OE1 1 
ATOM   4240  N NE2 . GLN B 2 189 ? 21.418  -51.118 -5.802  1.00 65.08  ? 189 GLN B NE2 1 
ATOM   4241  N N   . TYR B 2 190 ? 15.365  -50.773 -4.624  1.00 61.13  ? 190 TYR B N   1 
ATOM   4242  C CA  . TYR B 2 190 ? 14.061  -50.385 -4.076  1.00 66.28  ? 190 TYR B CA  1 
ATOM   4243  C C   . TYR B 2 190 ? 13.863  -50.880 -2.637  1.00 71.23  ? 190 TYR B C   1 
ATOM   4244  O O   . TYR B 2 190 ? 13.322  -50.169 -1.765  1.00 68.06  ? 190 TYR B O   1 
ATOM   4245  C CB  . TYR B 2 190 ? 12.930  -50.917 -4.962  1.00 82.39  ? 190 TYR B CB  1 
ATOM   4246  C CG  . TYR B 2 190 ? 12.912  -50.368 -6.374  1.00 88.88  ? 190 TYR B CG  1 
ATOM   4247  C CD1 . TYR B 2 190 ? 12.458  -49.081 -6.630  1.00 89.32  ? 190 TYR B CD1 1 
ATOM   4248  C CD2 . TYR B 2 190 ? 13.337  -51.139 -7.450  1.00 77.38  ? 190 TYR B CD2 1 
ATOM   4249  C CE1 . TYR B 2 190 ? 12.433  -48.573 -7.917  1.00 86.50  ? 190 TYR B CE1 1 
ATOM   4250  C CE2 . TYR B 2 190 ? 13.316  -50.639 -8.742  1.00 82.88  ? 190 TYR B CE2 1 
ATOM   4251  C CZ  . TYR B 2 190 ? 12.863  -49.356 -8.968  1.00 87.40  ? 190 TYR B CZ  1 
ATOM   4252  O OH  . TYR B 2 190 ? 12.840  -48.854 -10.250 1.00 94.45  ? 190 TYR B OH  1 
ATOM   4253  N N   . ARG B 2 191 ? 14.303  -52.113 -2.403  1.00 74.71  ? 191 ARG B N   1 
ATOM   4254  C CA  . ARG B 2 191 ? 14.100  -52.767 -1.117  1.00 70.03  ? 191 ARG B CA  1 
ATOM   4255  C C   . ARG B 2 191 ? 14.842  -52.064 0.013   1.00 71.51  ? 191 ARG B C   1 
ATOM   4256  O O   . ARG B 2 191 ? 14.451  -52.176 1.171   1.00 71.79  ? 191 ARG B O   1 
ATOM   4257  C CB  . ARG B 2 191 ? 14.535  -54.231 -1.198  1.00 75.69  ? 191 ARG B CB  1 
ATOM   4258  C CG  . ARG B 2 191 ? 13.424  -55.175 -1.623  1.00 75.00  ? 191 ARG B CG  1 
ATOM   4259  C CD  . ARG B 2 191 ? 13.972  -56.508 -2.104  1.00 88.07  ? 191 ARG B CD  1 
ATOM   4260  N NE  . ARG B 2 191 ? 12.909  -57.473 -2.369  1.00 87.73  ? 191 ARG B NE  1 
ATOM   4261  C CZ  . ARG B 2 191 ? 13.104  -58.666 -2.921  1.00 90.72  ? 191 ARG B CZ  1 
ATOM   4262  N NH1 . ARG B 2 191 ? 14.325  -59.045 -3.275  1.00 93.01  ? 191 ARG B NH1 1 
ATOM   4263  N NH2 . ARG B 2 191 ? 12.077  -59.481 -3.125  1.00 96.95  ? 191 ARG B NH2 1 
ATOM   4264  N N   . LYS B 2 192 ? 15.907  -51.340 -0.320  1.00 74.66  ? 192 LYS B N   1 
ATOM   4265  C CA  . LYS B 2 192 ? 16.570  -50.487 0.661   1.00 69.44  ? 192 LYS B CA  1 
ATOM   4266  C C   . LYS B 2 192 ? 15.586  -49.425 1.166   1.00 66.20  ? 192 LYS B C   1 
ATOM   4267  O O   . LYS B 2 192 ? 15.406  -49.247 2.376   1.00 81.68  ? 192 LYS B O   1 
ATOM   4268  C CB  . LYS B 2 192 ? 17.843  -49.850 0.062   1.00 76.24  ? 192 LYS B CB  1 
ATOM   4269  C CG  . LYS B 2 192 ? 17.665  -48.472 -0.589  1.00 87.15  ? 192 LYS B CG  1 
ATOM   4270  C CD  . LYS B 2 192 ? 18.894  -47.946 -1.308  1.00 78.42  ? 192 LYS B CD  1 
ATOM   4271  C CE  . LYS B 2 192 ? 19.648  -49.020 -2.064  1.00 70.08  ? 192 LYS B CE  1 
ATOM   4272  N NZ  . LYS B 2 192 ? 20.963  -48.489 -2.515  1.00 86.73  ? 192 LYS B NZ  1 
ATOM   4273  N N   . GLN B 2 193 ? 14.920  -48.762 0.224   1.00 68.53  ? 193 GLN B N   1 
ATOM   4274  C CA  . GLN B 2 193 ? 13.984  -47.694 0.524   1.00 74.45  ? 193 GLN B CA  1 
ATOM   4275  C C   . GLN B 2 193 ? 12.845  -48.233 1.359   1.00 83.51  ? 193 GLN B C   1 
ATOM   4276  O O   . GLN B 2 193 ? 12.496  -47.645 2.375   1.00 84.72  ? 193 GLN B O   1 
ATOM   4277  C CB  . GLN B 2 193 ? 13.494  -47.022 -0.756  1.00 78.73  ? 193 GLN B CB  1 
ATOM   4278  C CG  . GLN B 2 193 ? 14.658  -46.552 -1.614  1.00 78.81  ? 193 GLN B CG  1 
ATOM   4279  C CD  . GLN B 2 193 ? 14.226  -45.742 -2.811  1.00 81.96  ? 193 GLN B CD  1 
ATOM   4280  O OE1 . GLN B 2 193 ? 14.072  -44.523 -2.722  1.00 85.25  ? 193 GLN B OE1 1 
ATOM   4281  N NE2 . GLN B 2 193 ? 13.997  -46.415 -3.934  1.00 83.98  ? 193 GLN B NE2 1 
ATOM   4282  N N   . MET B 2 194 ? 12.267  -49.354 0.937   1.00 86.19  ? 194 MET B N   1 
ATOM   4283  C CA  . MET B 2 194 ? 11.173  -49.931 1.715   1.00 76.92  ? 194 MET B CA  1 
ATOM   4284  C C   . MET B 2 194 ? 11.642  -50.296 3.126   1.00 81.11  ? 194 MET B C   1 
ATOM   4285  O O   . MET B 2 194 ? 10.958  -50.004 4.121   1.00 73.82  ? 194 MET B O   1 
ATOM   4286  C CB  . MET B 2 194 ? 10.625  -51.180 1.027   1.00 71.47  ? 194 MET B CB  1 
ATOM   4287  C CG  . MET B 2 194 ? 9.991   -50.949 -0.329  1.00 76.87  ? 194 MET B CG  1 
ATOM   4288  S SD  . MET B 2 194 ? 8.351   -50.229 -0.172  1.00 104.97 ? 194 MET B SD  1 
ATOM   4289  C CE  . MET B 2 194 ? 7.351   -51.692 -0.425  1.00 109.23 ? 194 MET B CE  1 
ATOM   4290  N N   . ALA B 2 195 ? 12.827  -50.898 3.203   1.00 84.49  ? 195 ALA B N   1 
ATOM   4291  C CA  . ALA B 2 195 ? 13.376  -51.365 4.471   1.00 68.16  ? 195 ALA B CA  1 
ATOM   4292  C C   . ALA B 2 195 ? 13.624  -50.236 5.453   1.00 70.60  ? 195 ALA B C   1 
ATOM   4293  O O   . ALA B 2 195 ? 13.544  -50.441 6.659   1.00 83.55  ? 195 ALA B O   1 
ATOM   4294  C CB  . ALA B 2 195 ? 14.659  -52.124 4.239   1.00 75.00  ? 195 ALA B CB  1 
ATOM   4295  N N   . MET B 2 196 ? 13.975  -49.057 4.953   1.00 71.12  ? 196 MET B N   1 
ATOM   4296  C CA  . MET B 2 196 ? 14.195  -47.943 5.868   1.00 74.55  ? 196 MET B CA  1 
ATOM   4297  C C   . MET B 2 196 ? 13.007  -47.004 6.030   1.00 73.59  ? 196 MET B C   1 
ATOM   4298  O O   . MET B 2 196 ? 12.986  -46.193 6.951   1.00 81.01  ? 196 MET B O   1 
ATOM   4299  C CB  . MET B 2 196 ? 15.432  -47.159 5.430   1.00 63.82  ? 196 MET B CB  1 
ATOM   4300  C CG  . MET B 2 196 ? 16.697  -47.697 6.072   1.00 97.22  ? 196 MET B CG  1 
ATOM   4301  S SD  . MET B 2 196 ? 18.215  -47.499 5.136   1.00 122.41 ? 196 MET B SD  1 
ATOM   4302  C CE  . MET B 2 196 ? 18.235  -49.093 4.317   1.00 99.37  ? 196 MET B CE  1 
ATOM   4303  N N   . MET B 2 197 ? 12.006  -47.127 5.168   1.00 69.12  ? 197 MET B N   1 
ATOM   4304  C CA  . MET B 2 197 ? 10.792  -46.340 5.343   1.00 68.12  ? 197 MET B CA  1 
ATOM   4305  C C   . MET B 2 197 ? 9.746   -46.998 6.246   1.00 69.16  ? 197 MET B C   1 
ATOM   4306  O O   . MET B 2 197 ? 9.031   -46.307 6.971   1.00 68.88  ? 197 MET B O   1 
ATOM   4307  C CB  . MET B 2 197 ? 10.191  -46.006 3.983   1.00 67.11  ? 197 MET B CB  1 
ATOM   4308  C CG  . MET B 2 197 ? 11.076  -45.064 3.195   1.00 77.05  ? 197 MET B CG  1 
ATOM   4309  S SD  . MET B 2 197 ? 10.321  -44.398 1.713   1.00 77.82  ? 197 MET B SD  1 
ATOM   4310  C CE  . MET B 2 197 ? 9.765   -42.839 2.385   1.00 90.24  ? 197 MET B CE  1 
ATOM   4311  N N   . GLU B 2 198 ? 9.655   -48.326 6.199   1.00 63.05  ? 198 GLU B N   1 
ATOM   4312  C CA  . GLU B 2 198 ? 8.725   -49.051 7.073   1.00 73.93  ? 198 GLU B CA  1 
ATOM   4313  C C   . GLU B 2 198 ? 8.915   -48.782 8.586   1.00 76.63  ? 198 GLU B C   1 
ATOM   4314  O O   . GLU B 2 198 ? 7.936   -48.490 9.291   1.00 74.08  ? 198 GLU B O   1 
ATOM   4315  C CB  . GLU B 2 198 ? 8.817   -50.559 6.799   1.00 80.25  ? 198 GLU B CB  1 
ATOM   4316  C CG  . GLU B 2 198 ? 7.488   -51.295 6.894   1.00 106.64 ? 198 GLU B CG  1 
ATOM   4317  C CD  . GLU B 2 198 ? 7.646   -52.801 6.793   1.00 112.50 ? 198 GLU B CD  1 
ATOM   4318  O OE1 . GLU B 2 198 ? 8.799   -53.282 6.801   1.00 110.43 ? 198 GLU B OE1 1 
ATOM   4319  O OE2 . GLU B 2 198 ? 6.617   -53.502 6.699   1.00 114.18 ? 198 GLU B OE2 1 
ATOM   4320  N N   . PRO B 2 199 ? 10.165  -48.864 9.094   1.00 69.71  ? 199 PRO B N   1 
ATOM   4321  C CA  . PRO B 2 199 ? 10.381  -48.638 10.528  1.00 64.17  ? 199 PRO B CA  1 
ATOM   4322  C C   . PRO B 2 199 ? 10.093  -47.205 10.945  1.00 62.30  ? 199 PRO B C   1 
ATOM   4323  O O   . PRO B 2 199 ? 9.693   -46.967 12.082  1.00 67.28  ? 199 PRO B O   1 
ATOM   4324  C CB  . PRO B 2 199 ? 11.869  -48.959 10.715  1.00 66.35  ? 199 PRO B CB  1 
ATOM   4325  C CG  . PRO B 2 199 ? 12.248  -49.731 9.507   1.00 69.13  ? 199 PRO B CG  1 
ATOM   4326  C CD  . PRO B 2 199 ? 11.443  -49.139 8.421   1.00 71.82  ? 199 PRO B CD  1 
ATOM   4327  N N   . MET B 2 200 ? 10.323  -46.266 10.035  1.00 53.42  ? 200 MET B N   1 
ATOM   4328  C CA  . MET B 2 200 ? 10.011  -44.864 10.278  1.00 59.99  ? 200 MET B CA  1 
ATOM   4329  C C   . MET B 2 200 ? 8.515   -44.705 10.542  1.00 66.69  ? 200 MET B C   1 
ATOM   4330  O O   . MET B 2 200 ? 8.103   -44.037 11.497  1.00 73.65  ? 200 MET B O   1 
ATOM   4331  C CB  . MET B 2 200 ? 10.460  -44.008 9.089   1.00 65.75  ? 200 MET B CB  1 
ATOM   4332  C CG  . MET B 2 200 ? 11.971  -43.817 9.022   1.00 62.73  ? 200 MET B CG  1 
ATOM   4333  S SD  . MET B 2 200 ? 12.638  -43.247 7.441   1.00 101.54 ? 200 MET B SD  1 
ATOM   4334  C CE  . MET B 2 200 ? 11.486  -41.960 6.990   1.00 94.35  ? 200 MET B CE  1 
ATOM   4335  N N   . ILE B 2 201 ? 7.709   -45.352 9.705   1.00 65.29  ? 201 ILE B N   1 
ATOM   4336  C CA  . ILE B 2 201 ? 6.259   -45.303 9.837   1.00 75.43  ? 201 ILE B CA  1 
ATOM   4337  C C   . ILE B 2 201 ? 5.798   -45.981 11.125  1.00 72.56  ? 201 ILE B C   1 
ATOM   4338  O O   . ILE B 2 201 ? 4.956   -45.443 11.854  1.00 64.57  ? 201 ILE B O   1 
ATOM   4339  C CB  . ILE B 2 201 ? 5.568   -45.980 8.634   1.00 76.82  ? 201 ILE B CB  1 
ATOM   4340  C CG1 . ILE B 2 201 ? 5.853   -45.199 7.350   1.00 73.74  ? 201 ILE B CG1 1 
ATOM   4341  C CG2 . ILE B 2 201 ? 4.069   -46.091 8.865   1.00 58.95  ? 201 ILE B CG2 1 
ATOM   4342  C CD1 . ILE B 2 201 ? 5.040   -45.653 6.155   1.00 62.40  ? 201 ILE B CD1 1 
ATOM   4343  N N   . GLY B 2 202 ? 6.370   -47.147 11.416  1.00 69.48  ? 202 GLY B N   1 
ATOM   4344  C CA  . GLY B 2 202 ? 6.021   -47.873 12.627  1.00 79.24  ? 202 GLY B CA  1 
ATOM   4345  C C   . GLY B 2 202 ? 6.316   -47.070 13.881  1.00 75.73  ? 202 GLY B C   1 
ATOM   4346  O O   . GLY B 2 202 ? 5.481   -46.957 14.786  1.00 78.48  ? 202 GLY B O   1 
ATOM   4347  N N   . PHE B 2 203 ? 7.517   -46.502 13.917  1.00 71.37  ? 203 PHE B N   1 
ATOM   4348  C CA  . PHE B 2 203 ? 7.960   -45.649 15.010  1.00 62.31  ? 203 PHE B CA  1 
ATOM   4349  C C   . PHE B 2 203 ? 7.023   -44.456 15.174  1.00 63.45  ? 203 PHE B C   1 
ATOM   4350  O O   . PHE B 2 203 ? 6.631   -44.110 16.293  1.00 70.89  ? 203 PHE B O   1 
ATOM   4351  C CB  . PHE B 2 203 ? 9.399   -45.185 14.756  1.00 51.64  ? 203 PHE B CB  1 
ATOM   4352  C CG  . PHE B 2 203 ? 9.891   -44.148 15.723  1.00 52.92  ? 203 PHE B CG  1 
ATOM   4353  C CD1 . PHE B 2 203 ? 9.830   -42.800 15.407  1.00 48.00  ? 203 PHE B CD1 1 
ATOM   4354  C CD2 . PHE B 2 203 ? 10.439  -44.522 16.939  1.00 69.35  ? 203 PHE B CD2 1 
ATOM   4355  C CE1 . PHE B 2 203 ? 10.290  -41.846 16.292  1.00 57.70  ? 203 PHE B CE1 1 
ATOM   4356  C CE2 . PHE B 2 203 ? 10.901  -43.572 17.829  1.00 50.33  ? 203 PHE B CE2 1 
ATOM   4357  C CZ  . PHE B 2 203 ? 10.827  -42.233 17.504  1.00 57.60  ? 203 PHE B CZ  1 
ATOM   4358  N N   . ALA B 2 204 ? 6.659   -43.839 14.053  1.00 60.61  ? 204 ALA B N   1 
ATOM   4359  C CA  . ALA B 2 204 ? 5.760   -42.690 14.079  1.00 61.28  ? 204 ALA B CA  1 
ATOM   4360  C C   . ALA B 2 204 ? 4.394   -43.043 14.672  1.00 57.36  ? 204 ALA B C   1 
ATOM   4361  O O   . ALA B 2 204 ? 3.868   -42.307 15.512  1.00 51.66  ? 204 ALA B O   1 
ATOM   4362  C CB  . ALA B 2 204 ? 5.599   -42.122 12.682  1.00 65.16  ? 204 ALA B CB  1 
ATOM   4363  N N   . HIS B 2 205 ? 3.829   -44.170 14.244  1.00 62.82  ? 205 HIS B N   1 
ATOM   4364  C CA  . HIS B 2 205 ? 2.539   -44.620 14.771  1.00 65.34  ? 205 HIS B CA  1 
ATOM   4365  C C   . HIS B 2 205 ? 2.606   -44.920 16.268  1.00 67.89  ? 205 HIS B C   1 
ATOM   4366  O O   . HIS B 2 205 ? 1.732   -44.498 17.042  1.00 58.14  ? 205 HIS B O   1 
ATOM   4367  C CB  . HIS B 2 205 ? 2.044   -45.854 14.014  1.00 78.85  ? 205 HIS B CB  1 
ATOM   4368  C CG  . HIS B 2 205 ? 1.405   -45.539 12.697  1.00 83.06  ? 205 HIS B CG  1 
ATOM   4369  N ND1 . HIS B 2 205 ? 0.275   -44.759 12.589  1.00 85.17  ? 205 HIS B ND1 1 
ATOM   4370  C CD2 . HIS B 2 205 ? 1.733   -45.905 11.435  1.00 86.45  ? 205 HIS B CD2 1 
ATOM   4371  C CE1 . HIS B 2 205 ? -0.064  -44.652 11.316  1.00 84.08  ? 205 HIS B CE1 1 
ATOM   4372  N NE2 . HIS B 2 205 ? 0.804   -45.339 10.595  1.00 88.53  ? 205 HIS B NE2 1 
ATOM   4373  N N   . GLY B 2 206 ? 3.645   -45.649 16.668  1.00 68.44  ? 206 GLY B N   1 
ATOM   4374  C CA  . GLY B 2 206 ? 3.860   -45.954 18.070  1.00 51.02  ? 206 GLY B CA  1 
ATOM   4375  C C   . GLY B 2 206 ? 3.908   -44.684 18.896  1.00 52.55  ? 206 GLY B C   1 
ATOM   4376  O O   . GLY B 2 206 ? 3.276   -44.584 19.953  1.00 63.05  ? 206 GLY B O   1 
ATOM   4377  N N   . GLN B 2 207 ? 4.642   -43.697 18.396  1.00 47.06  ? 207 GLN B N   1 
ATOM   4378  C CA  . GLN B 2 207 ? 4.790   -42.437 19.110  1.00 55.65  ? 207 GLN B CA  1 
ATOM   4379  C C   . GLN B 2 207 ? 3.487   -41.644 19.203  1.00 55.64  ? 207 GLN B C   1 
ATOM   4380  O O   . GLN B 2 207 ? 3.167   -41.112 20.269  1.00 68.05  ? 207 GLN B O   1 
ATOM   4381  C CB  . GLN B 2 207 ? 5.877   -41.580 18.456  1.00 59.32  ? 207 GLN B CB  1 
ATOM   4382  C CG  . GLN B 2 207 ? 7.298   -42.042 18.762  1.00 60.97  ? 207 GLN B CG  1 
ATOM   4383  C CD  . GLN B 2 207 ? 7.545   -42.256 20.248  1.00 59.58  ? 207 GLN B CD  1 
ATOM   4384  O OE1 . GLN B 2 207 ? 7.050   -41.505 21.090  1.00 53.79  ? 207 GLN B OE1 1 
ATOM   4385  N NE2 . GLN B 2 207 ? 8.313   -43.289 20.576  1.00 61.82  ? 207 GLN B NE2 1 
ATOM   4386  N N   . ILE B 2 208 ? 2.728   -41.561 18.110  1.00 68.17  ? 208 ILE B N   1 
ATOM   4387  C CA  . ILE B 2 208 ? 1.498   -40.771 18.163  1.00 64.80  ? 208 ILE B CA  1 
ATOM   4388  C C   . ILE B 2 208 ? 0.442   -41.430 19.047  1.00 60.56  ? 208 ILE B C   1 
ATOM   4389  O O   . ILE B 2 208 ? -0.274  -40.732 19.768  1.00 58.12  ? 208 ILE B O   1 
ATOM   4390  C CB  . ILE B 2 208 ? 0.883   -40.513 16.762  1.00 71.19  ? 208 ILE B CB  1 
ATOM   4391  C CG1 . ILE B 2 208 ? 0.765   -41.801 15.953  1.00 77.73  ? 208 ILE B CG1 1 
ATOM   4392  C CG2 . ILE B 2 208 ? 1.675   -39.453 16.012  1.00 67.73  ? 208 ILE B CG2 1 
ATOM   4393  C CD1 . ILE B 2 208 ? -0.240  -41.723 14.824  1.00 84.50  ? 208 ILE B CD1 1 
ATOM   4394  N N   . ASN B 2 209 ? 0.342   -42.759 19.015  1.00 63.00  ? 209 ASN B N   1 
ATOM   4395  C CA  . ASN B 2 209 ? -0.632  -43.411 19.890  1.00 65.83  ? 209 ASN B CA  1 
ATOM   4396  C C   . ASN B 2 209 ? -0.196  -43.278 21.351  1.00 64.45  ? 209 ASN B C   1 
ATOM   4397  O O   . ASN B 2 209 ? -1.023  -43.024 22.233  1.00 62.35  ? 209 ASN B O   1 
ATOM   4398  C CB  . ASN B 2 209 ? -0.874  -44.879 19.488  1.00 73.09  ? 209 ASN B CB  1 
ATOM   4399  C CG  . ASN B 2 209 ? 0.332   -45.783 19.708  1.00 88.28  ? 209 ASN B CG  1 
ATOM   4400  O OD1 . ASN B 2 209 ? 0.972   -45.762 20.759  1.00 84.23  ? 209 ASN B OD1 1 
ATOM   4401  N ND2 . ASN B 2 209 ? 0.628   -46.608 18.710  1.00 77.21  ? 209 ASN B ND2 1 
ATOM   4402  N N   . PHE B 2 210 ? 1.105   -43.440 21.596  1.00 63.11  ? 210 PHE B N   1 
ATOM   4403  C CA  . PHE B 2 210 ? 1.649   -43.305 22.945  1.00 49.17  ? 210 PHE B CA  1 
ATOM   4404  C C   . PHE B 2 210 ? 1.367   -41.921 23.526  1.00 52.82  ? 210 PHE B C   1 
ATOM   4405  O O   . PHE B 2 210 ? 0.911   -41.800 24.665  1.00 63.68  ? 210 PHE B O   1 
ATOM   4406  C CB  . PHE B 2 210 ? 3.158   -43.571 22.948  1.00 64.25  ? 210 PHE B CB  1 
ATOM   4407  C CG  . PHE B 2 210 ? 3.837   -43.220 24.246  1.00 63.05  ? 210 PHE B CG  1 
ATOM   4408  C CD1 . PHE B 2 210 ? 3.806   -44.095 25.320  1.00 55.95  ? 210 PHE B CD1 1 
ATOM   4409  C CD2 . PHE B 2 210 ? 4.513   -42.018 24.387  1.00 48.94  ? 210 PHE B CD2 1 
ATOM   4410  C CE1 . PHE B 2 210 ? 4.431   -43.773 26.512  1.00 49.66  ? 210 PHE B CE1 1 
ATOM   4411  C CE2 . PHE B 2 210 ? 5.138   -41.691 25.576  1.00 46.93  ? 210 PHE B CE2 1 
ATOM   4412  C CZ  . PHE B 2 210 ? 5.098   -42.570 26.639  1.00 44.95  ? 210 PHE B CZ  1 
ATOM   4413  N N   . PHE B 2 211 ? 1.633   -40.881 22.743  1.00 44.98  ? 211 PHE B N   1 
ATOM   4414  C CA  . PHE B 2 211 ? 1.446   -39.513 23.219  1.00 52.89  ? 211 PHE B CA  1 
ATOM   4415  C C   . PHE B 2 211 ? -0.021  -39.098 23.288  1.00 60.44  ? 211 PHE B C   1 
ATOM   4416  O O   . PHE B 2 211 ? -0.394  -38.272 24.123  1.00 58.88  ? 211 PHE B O   1 
ATOM   4417  C CB  . PHE B 2 211 ? 2.225   -38.533 22.343  1.00 48.54  ? 211 PHE B CB  1 
ATOM   4418  C CG  . PHE B 2 211 ? 3.652   -38.355 22.767  1.00 60.31  ? 211 PHE B CG  1 
ATOM   4419  C CD1 . PHE B 2 211 ? 3.986   -37.423 23.735  1.00 61.58  ? 211 PHE B CD1 1 
ATOM   4420  C CD2 . PHE B 2 211 ? 4.657   -39.131 22.214  1.00 66.73  ? 211 PHE B CD2 1 
ATOM   4421  C CE1 . PHE B 2 211 ? 5.297   -37.259 24.135  1.00 62.92  ? 211 PHE B CE1 1 
ATOM   4422  C CE2 . PHE B 2 211 ? 5.969   -38.972 22.611  1.00 69.18  ? 211 PHE B CE2 1 
ATOM   4423  C CZ  . PHE B 2 211 ? 6.290   -38.034 23.572  1.00 69.26  ? 211 PHE B CZ  1 
ATOM   4424  N N   . LYS B 2 212 ? -0.853  -39.667 22.422  1.00 73.87  ? 212 LYS B N   1 
ATOM   4425  C CA  . LYS B 2 212 ? -2.274  -39.336 22.439  1.00 65.92  ? 212 LYS B CA  1 
ATOM   4426  C C   . LYS B 2 212 ? -2.937  -39.966 23.659  1.00 54.76  ? 212 LYS B C   1 
ATOM   4427  O O   . LYS B 2 212 ? -3.679  -39.301 24.387  1.00 54.81  ? 212 LYS B O   1 
ATOM   4428  C CB  . LYS B 2 212 ? -2.963  -39.795 21.153  1.00 69.38  ? 212 LYS B CB  1 
ATOM   4429  C CG  . LYS B 2 212 ? -4.363  -39.228 20.967  1.00 65.86  ? 212 LYS B CG  1 
ATOM   4430  C CD  . LYS B 2 212 ? -4.878  -39.462 19.555  1.00 83.03  ? 212 LYS B CD  1 
ATOM   4431  C CE  . LYS B 2 212 ? -4.048  -38.706 18.525  1.00 90.05  ? 212 LYS B CE  1 
ATOM   4432  N NZ  . LYS B 2 212 ? -4.153  -37.227 18.684  1.00 61.75  ? 212 LYS B NZ  1 
ATOM   4433  N N   . LYS B 2 213 ? -2.659  -41.247 23.886  1.00 54.85  ? 213 LYS B N   1 
ATOM   4434  C CA  . LYS B 2 213 ? -3.206  -41.942 25.047  1.00 52.42  ? 213 LYS B CA  1 
ATOM   4435  C C   . LYS B 2 213 ? -2.608  -41.409 26.345  1.00 58.23  ? 213 LYS B C   1 
ATOM   4436  O O   . LYS B 2 213 ? -3.265  -41.410 27.385  1.00 65.93  ? 213 LYS B O   1 
ATOM   4437  C CB  . LYS B 2 213 ? -2.966  -43.448 24.941  1.00 40.90  ? 213 LYS B CB  1 
ATOM   4438  C CG  . LYS B 2 213 ? -3.880  -44.150 23.956  1.00 49.83  ? 213 LYS B CG  1 
ATOM   4439  C CD  . LYS B 2 213 ? -4.014  -45.626 24.291  1.00 53.68  ? 213 LYS B CD  1 
ATOM   4440  C CE  . LYS B 2 213 ? -5.100  -46.282 23.454  1.00 77.83  ? 213 LYS B CE  1 
ATOM   4441  N NZ  . LYS B 2 213 ? -5.282  -47.718 23.804  1.00 89.45  ? 213 LYS B NZ  1 
ATOM   4442  N N   . GLY B 2 214 ? -1.356  -40.965 26.283  1.00 61.90  ? 214 GLY B N   1 
ATOM   4443  C CA  . GLY B 2 214 ? -0.730  -40.310 27.416  1.00 55.74  ? 214 GLY B CA  1 
ATOM   4444  C C   . GLY B 2 214 ? -1.402  -38.995 27.756  1.00 60.97  ? 214 GLY B C   1 
ATOM   4445  O O   . GLY B 2 214 ? -1.649  -38.696 28.925  1.00 47.34  ? 214 GLY B O   1 
ATOM   4446  N N   . ALA B 2 215 ? -1.694  -38.209 26.724  1.00 63.91  ? 215 ALA B N   1 
ATOM   4447  C CA  . ALA B 2 215 ? -2.401  -36.944 26.889  1.00 52.56  ? 215 ALA B CA  1 
ATOM   4448  C C   . ALA B 2 215 ? -3.799  -37.166 27.458  1.00 68.48  ? 215 ALA B C   1 
ATOM   4449  O O   . ALA B 2 215 ? -4.263  -36.402 28.304  1.00 55.75  ? 215 ALA B O   1 
ATOM   4450  C CB  . ALA B 2 215 ? -2.480  -36.204 25.564  1.00 54.65  ? 215 ALA B CB  1 
ATOM   4451  N N   . GLU B 2 216 ? -4.467  -38.212 26.980  1.00 73.70  ? 216 GLU B N   1 
ATOM   4452  C CA  . GLU B 2 216 ? -5.781  -38.584 27.495  1.00 60.76  ? 216 GLU B CA  1 
ATOM   4453  C C   . GLU B 2 216 ? -5.695  -38.994 28.962  1.00 71.42  ? 216 GLU B C   1 
ATOM   4454  O O   . GLU B 2 216 ? -6.559  -38.643 29.768  1.00 65.39  ? 216 GLU B O   1 
ATOM   4455  C CB  . GLU B 2 216 ? -6.385  -39.718 26.664  1.00 53.55  ? 216 GLU B CB  1 
ATOM   4456  N N   . MET B 2 217 ? -4.646  -39.741 29.295  1.00 76.70  ? 217 MET B N   1 
ATOM   4457  C CA  . MET B 2 217 ? -4.422  -40.214 30.658  1.00 59.61  ? 217 MET B CA  1 
ATOM   4458  C C   . MET B 2 217 ? -4.271  -39.070 31.647  1.00 48.78  ? 217 MET B C   1 
ATOM   4459  O O   . MET B 2 217 ? -4.964  -39.029 32.663  1.00 68.56  ? 217 MET B O   1 
ATOM   4460  C CB  . MET B 2 217 ? -3.186  -41.105 30.723  1.00 62.31  ? 217 MET B CB  1 
ATOM   4461  C CG  . MET B 2 217 ? -2.777  -41.458 32.142  1.00 59.78  ? 217 MET B CG  1 
ATOM   4462  S SD  . MET B 2 217 ? -1.504  -42.724 32.165  1.00 85.40  ? 217 MET B SD  1 
ATOM   4463  C CE  . MET B 2 217 ? -2.242  -43.901 31.040  1.00 66.68  ? 217 MET B CE  1 
ATOM   4464  N N   . PHE B 2 218 ? -3.372  -38.137 31.354  1.00 64.88  ? 218 PHE B N   1 
ATOM   4465  C CA  . PHE B 2 218 ? -3.181  -37.023 32.265  1.00 58.96  ? 218 PHE B CA  1 
ATOM   4466  C C   . PHE B 2 218 ? -3.986  -35.856 31.716  1.00 63.39  ? 218 PHE B C   1 
ATOM   4467  O O   . PHE B 2 218 ? -3.540  -35.124 30.834  1.00 76.20  ? 218 PHE B O   1 
ATOM   4468  C CB  . PHE B 2 218 ? -1.697  -36.661 32.386  1.00 61.29  ? 218 PHE B CB  1 
ATOM   4469  C CG  . PHE B 2 218 ? -0.849  -37.751 32.989  1.00 63.04  ? 218 PHE B CG  1 
ATOM   4470  C CD1 . PHE B 2 218 ? -0.391  -38.802 32.209  1.00 50.59  ? 218 PHE B CD1 1 
ATOM   4471  C CD2 . PHE B 2 218 ? -0.498  -37.717 34.329  1.00 64.18  ? 218 PHE B CD2 1 
ATOM   4472  C CE1 . PHE B 2 218 ? 0.390   -39.803 32.756  1.00 50.07  ? 218 PHE B CE1 1 
ATOM   4473  C CE2 . PHE B 2 218 ? 0.285   -38.716 34.881  1.00 56.09  ? 218 PHE B CE2 1 
ATOM   4474  C CZ  . PHE B 2 218 ? 0.729   -39.761 34.093  1.00 46.39  ? 218 PHE B CZ  1 
ATOM   4475  N N   . SER B 2 219 ? -5.177  -35.694 32.280  1.00 78.78  ? 219 SER B N   1 
ATOM   4476  C CA  . SER B 2 219 ? -6.140  -34.688 31.854  1.00 75.86  ? 219 SER B CA  1 
ATOM   4477  C C   . SER B 2 219 ? -6.135  -33.467 32.761  1.00 84.99  ? 219 SER B C   1 
ATOM   4478  O O   . SER B 2 219 ? -5.252  -33.304 33.602  1.00 87.80  ? 219 SER B O   1 
ATOM   4479  C CB  . SER B 2 219 ? -7.543  -35.294 31.797  1.00 84.69  ? 219 SER B CB  1 
ATOM   4480  O OG  . SER B 2 219 ? -7.868  -35.933 33.019  1.00 84.55  ? 219 SER B OG  1 
ATOM   4481  N N   . LYS B 2 220 ? -7.135  -32.612 32.581  1.00 85.32  ? 220 LYS B N   1 
ATOM   4482  C CA  . LYS B 2 220 ? -7.343  -31.485 33.476  1.00 77.61  ? 220 LYS B CA  1 
ATOM   4483  C C   . LYS B 2 220 ? -7.865  -31.996 34.819  1.00 83.63  ? 220 LYS B C   1 
ATOM   4484  O O   . LYS B 2 220 ? -7.624  -31.392 35.868  1.00 72.96  ? 220 LYS B O   1 
ATOM   4485  C CB  . LYS B 2 220 ? -8.320  -30.480 32.862  1.00 74.01  ? 220 LYS B CB  1 
ATOM   4486  N N   . ARG B 2 221 ? -8.572  -33.123 34.774  1.00 78.64  ? 221 ARG B N   1 
ATOM   4487  C CA  . ARG B 2 221 ? -9.073  -33.773 35.980  1.00 75.71  ? 221 ARG B CA  1 
ATOM   4488  C C   . ARG B 2 221 ? -7.918  -34.263 36.850  1.00 85.60  ? 221 ARG B C   1 
ATOM   4489  O O   . ARG B 2 221 ? -7.879  -34.010 38.059  1.00 84.34  ? 221 ARG B O   1 
ATOM   4490  C CB  . ARG B 2 221 ? -9.995  -34.941 35.618  1.00 68.11  ? 221 ARG B CB  1 
ATOM   4491  N N   . MET B 2 222 ? -6.976  -34.959 36.223  1.00 79.31  ? 222 MET B N   1 
ATOM   4492  C CA  . MET B 2 222 ? -5.797  -35.451 36.922  1.00 65.28  ? 222 MET B CA  1 
ATOM   4493  C C   . MET B 2 222 ? -5.000  -34.313 37.562  1.00 72.10  ? 222 MET B C   1 
ATOM   4494  O O   . MET B 2 222 ? -4.432  -34.477 38.643  1.00 86.99  ? 222 MET B O   1 
ATOM   4495  C CB  . MET B 2 222 ? -4.903  -36.243 35.962  1.00 65.70  ? 222 MET B CB  1 
ATOM   4496  C CG  . MET B 2 222 ? -3.638  -36.798 36.596  1.00 74.96  ? 222 MET B CG  1 
ATOM   4497  S SD  . MET B 2 222 ? -3.953  -38.089 37.813  1.00 98.01  ? 222 MET B SD  1 
ATOM   4498  C CE  . MET B 2 222 ? -5.108  -39.129 36.920  1.00 82.50  ? 222 MET B CE  1 
ATOM   4499  N N   . ASP B 2 223 ? -4.982  -33.155 36.906  1.00 67.40  ? 223 ASP B N   1 
ATOM   4500  C CA  . ASP B 2 223 ? -4.159  -32.038 37.358  1.00 80.82  ? 223 ASP B CA  1 
ATOM   4501  C C   . ASP B 2 223 ? -4.905  -31.291 38.479  1.00 82.95  ? 223 ASP B C   1 
ATOM   4502  O O   . ASP B 2 223 ? -4.283  -30.758 39.398  1.00 97.05  ? 223 ASP B O   1 
ATOM   4503  C CB  . ASP B 2 223 ? -3.836  -31.118 36.157  1.00 80.49  ? 223 ASP B CB  1 
ATOM   4504  C CG  . ASP B 2 223 ? -3.214  -29.768 36.550  1.00 108.28 ? 223 ASP B CG  1 
ATOM   4505  O OD1 . ASP B 2 223 ? -2.806  -29.561 37.709  1.00 117.31 ? 223 ASP B OD1 1 
ATOM   4506  O OD2 . ASP B 2 223 ? -3.132  -28.890 35.664  1.00 94.73  ? 223 ASP B OD2 1 
ATOM   4507  N N   . SER B 2 224 ? -6.236  -31.310 38.450  1.00 78.65  ? 224 SER B N   1 
ATOM   4508  C CA  . SER B 2 224 ? -6.998  -30.827 39.600  1.00 86.20  ? 224 SER B CA  1 
ATOM   4509  C C   . SER B 2 224 ? -6.743  -31.731 40.810  1.00 81.74  ? 224 SER B C   1 
ATOM   4510  O O   . SER B 2 224 ? -6.583  -31.237 41.933  1.00 75.23  ? 224 SER B O   1 
ATOM   4511  C CB  . SER B 2 224 ? -8.493  -30.750 39.295  1.00 54.18  ? 224 SER B CB  1 
ATOM   4512  O OG  . SER B 2 224 ? -9.166  -29.998 40.294  1.00 68.08  ? 224 SER B OG  1 
ATOM   4513  N N   . PHE B 2 225 ? -6.735  -33.046 40.586  1.00 72.44  ? 225 PHE B N   1 
ATOM   4514  C CA  . PHE B 2 225 ? -6.394  -33.982 41.653  1.00 73.51  ? 225 PHE B CA  1 
ATOM   4515  C C   . PHE B 2 225 ? -5.014  -33.676 42.232  1.00 80.05  ? 225 PHE B C   1 
ATOM   4516  O O   . PHE B 2 225 ? -4.837  -33.639 43.455  1.00 74.66  ? 225 PHE B O   1 
ATOM   4517  C CB  . PHE B 2 225 ? -6.425  -35.424 41.149  1.00 57.42  ? 225 PHE B CB  1 
ATOM   4518  C CG  . PHE B 2 225 ? -6.048  -36.439 42.200  1.00 75.02  ? 225 PHE B CG  1 
ATOM   4519  C CD1 . PHE B 2 225 ? -4.740  -36.894 42.312  1.00 78.23  ? 225 PHE B CD1 1 
ATOM   4520  C CD2 . PHE B 2 225 ? -6.995  -36.927 43.084  1.00 84.49  ? 225 PHE B CD2 1 
ATOM   4521  C CE1 . PHE B 2 225 ? -4.390  -37.815 43.280  1.00 78.28  ? 225 PHE B CE1 1 
ATOM   4522  C CE2 . PHE B 2 225 ? -6.650  -37.850 44.053  1.00 90.87  ? 225 PHE B CE2 1 
ATOM   4523  C CZ  . PHE B 2 225 ? -5.346  -38.295 44.152  1.00 75.92  ? 225 PHE B CZ  1 
ATOM   4524  N N   . LEU B 2 226 ? -4.036  -33.478 41.351  1.00 68.53  ? 226 LEU B N   1 
ATOM   4525  C CA  . LEU B 2 226 ? -2.684  -33.142 41.780  1.00 67.38  ? 226 LEU B CA  1 
ATOM   4526  C C   . LEU B 2 226 ? -2.667  -31.834 42.561  1.00 73.86  ? 226 LEU B C   1 
ATOM   4527  O O   . LEU B 2 226 ? -1.866  -31.662 43.476  1.00 75.88  ? 226 LEU B O   1 
ATOM   4528  C CB  . LEU B 2 226 ? -1.742  -33.052 40.580  1.00 71.80  ? 226 LEU B CB  1 
ATOM   4529  C CG  . LEU B 2 226 ? -1.401  -34.372 39.889  1.00 73.94  ? 226 LEU B CG  1 
ATOM   4530  C CD1 . LEU B 2 226 ? -0.369  -34.143 38.802  1.00 79.49  ? 226 LEU B CD1 1 
ATOM   4531  C CD2 . LEU B 2 226 ? -0.903  -35.397 40.896  1.00 66.48  ? 226 LEU B CD2 1 
ATOM   4532  N N   . SER B 2 227 ? -3.547  -30.911 42.187  1.00 68.30  ? 227 SER B N   1 
ATOM   4533  C CA  . SER B 2 227 ? -3.671  -29.638 42.884  1.00 77.91  ? 227 SER B CA  1 
ATOM   4534  C C   . SER B 2 227 ? -4.206  -29.847 44.298  1.00 76.19  ? 227 SER B C   1 
ATOM   4535  O O   . SER B 2 227 ? -3.749  -29.207 45.248  1.00 73.99  ? 227 SER B O   1 
ATOM   4536  C CB  . SER B 2 227 ? -4.586  -28.691 42.103  1.00 74.33  ? 227 SER B CB  1 
ATOM   4537  O OG  . SER B 2 227 ? -4.750  -27.457 42.779  1.00 85.39  ? 227 SER B OG  1 
ATOM   4538  N N   . SER B 2 228 ? -5.172  -30.752 44.428  1.00 73.34  ? 228 SER B N   1 
ATOM   4539  C CA  . SER B 2 228 ? -5.722  -31.113 45.730  1.00 77.18  ? 228 SER B CA  1 
ATOM   4540  C C   . SER B 2 228 ? -4.653  -31.738 46.623  1.00 80.75  ? 228 SER B C   1 
ATOM   4541  O O   . SER B 2 228 ? -4.497  -31.357 47.788  1.00 73.38  ? 228 SER B O   1 
ATOM   4542  C CB  . SER B 2 228 ? -6.899  -32.076 45.565  1.00 69.99  ? 228 SER B CB  1 
ATOM   4543  O OG  . SER B 2 228 ? -6.454  -33.361 45.167  1.00 68.93  ? 228 SER B OG  1 
ATOM   4544  N N   . VAL B 2 229 ? -3.920  -32.697 46.064  1.00 76.39  ? 229 VAL B N   1 
ATOM   4545  C CA  . VAL B 2 229 ? -2.830  -33.350 46.782  1.00 60.31  ? 229 VAL B CA  1 
ATOM   4546  C C   . VAL B 2 229 ? -1.798  -32.316 47.214  1.00 66.59  ? 229 VAL B C   1 
ATOM   4547  O O   . VAL B 2 229 ? -1.290  -32.363 48.329  1.00 71.08  ? 229 VAL B O   1 
ATOM   4548  C CB  . VAL B 2 229 ? -2.154  -34.436 45.926  1.00 56.56  ? 229 VAL B CB  1 
ATOM   4549  C CG1 . VAL B 2 229 ? -0.900  -34.959 46.612  1.00 70.12  ? 229 VAL B CG1 1 
ATOM   4550  C CG2 . VAL B 2 229 ? -3.127  -35.570 45.660  1.00 51.34  ? 229 VAL B CG2 1 
ATOM   4551  N N   . ALA B 2 230 ? -1.505  -31.379 46.320  1.00 76.23  ? 230 ALA B N   1 
ATOM   4552  C CA  . ALA B 2 230 ? -0.574  -30.294 46.600  1.00 74.06  ? 230 ALA B CA  1 
ATOM   4553  C C   . ALA B 2 230 ? -1.067  -29.452 47.773  1.00 76.02  ? 230 ALA B C   1 
ATOM   4554  O O   . ALA B 2 230 ? -0.276  -29.029 48.622  1.00 83.02  ? 230 ALA B O   1 
ATOM   4555  C CB  . ALA B 2 230 ? -0.376  -29.429 45.367  1.00 76.91  ? 230 ALA B CB  1 
ATOM   4556  N N   . ASP B 2 231 ? -2.376  -29.213 47.821  1.00 81.60  ? 231 ASP B N   1 
ATOM   4557  C CA  . ASP B 2 231 ? -2.952  -28.406 48.892  1.00 87.96  ? 231 ASP B CA  1 
ATOM   4558  C C   . ASP B 2 231 ? -2.894  -29.138 50.228  1.00 82.02  ? 231 ASP B C   1 
ATOM   4559  O O   . ASP B 2 231 ? -2.667  -28.526 51.281  1.00 76.29  ? 231 ASP B O   1 
ATOM   4560  C CB  . ASP B 2 231 ? -4.408  -28.057 48.572  1.00 71.83  ? 231 ASP B CB  1 
ATOM   4561  C CG  . ASP B 2 231 ? -4.558  -26.699 47.924  1.00 99.00  ? 231 ASP B CG  1 
ATOM   4562  O OD1 . ASP B 2 231 ? -3.531  -26.103 47.540  1.00 106.26 ? 231 ASP B OD1 1 
ATOM   4563  O OD2 . ASP B 2 231 ? -5.709  -26.231 47.796  1.00 117.91 ? 231 ASP B OD2 1 
ATOM   4564  N N   . MET B 2 232 ? -3.070  -30.455 50.175  1.00 73.33  ? 232 MET B N   1 
ATOM   4565  C CA  . MET B 2 232 ? -2.897  -31.289 51.354  1.00 74.38  ? 232 MET B CA  1 
ATOM   4566  C C   . MET B 2 232 ? -1.462  -31.203 51.836  1.00 75.17  ? 232 MET B C   1 
ATOM   4567  O O   . MET B 2 232 ? -1.205  -31.007 53.027  1.00 72.14  ? 232 MET B O   1 
ATOM   4568  C CB  . MET B 2 232 ? -3.269  -32.744 51.062  1.00 57.51  ? 232 MET B CB  1 
ATOM   4569  C CG  . MET B 2 232 ? -2.664  -33.743 52.037  1.00 67.43  ? 232 MET B CG  1 
ATOM   4570  S SD  . MET B 2 232 ? -3.196  -35.432 51.707  1.00 90.82  ? 232 MET B SD  1 
ATOM   4571  C CE  . MET B 2 232 ? -2.882  -35.545 49.947  1.00 75.33  ? 232 MET B CE  1 
ATOM   4572  N N   . VAL B 2 233 ? -0.529  -31.338 50.899  1.00 74.69  ? 233 VAL B N   1 
ATOM   4573  C CA  . VAL B 2 233 ? 0.879   -31.233 51.233  1.00 74.27  ? 233 VAL B CA  1 
ATOM   4574  C C   . VAL B 2 233 ? 1.217   -29.889 51.879  1.00 77.02  ? 233 VAL B C   1 
ATOM   4575  O O   . VAL B 2 233 ? 1.942   -29.864 52.874  1.00 79.85  ? 233 VAL B O   1 
ATOM   4576  C CB  . VAL B 2 233 ? 1.782   -31.450 49.990  1.00 75.11  ? 233 VAL B CB  1 
ATOM   4577  C CG1 . VAL B 2 233 ? 3.219   -31.044 50.292  1.00 61.94  ? 233 VAL B CG1 1 
ATOM   4578  C CG2 . VAL B 2 233 ? 1.728   -32.899 49.539  1.00 60.54  ? 233 VAL B CG2 1 
ATOM   4579  N N   . GLN B 2 234 ? 0.709   -28.762 51.387  1.00 70.91  ? 234 GLN B N   1 
ATOM   4580  C CA  . GLN B 2 234 ? 1.162   -27.567 52.090  1.00 84.23  ? 234 GLN B CA  1 
ATOM   4581  C C   . GLN B 2 234 ? 0.364   -27.301 53.364  1.00 78.78  ? 234 GLN B C   1 
ATOM   4582  O O   . GLN B 2 234 ? 0.790   -26.483 54.181  1.00 87.80  ? 234 GLN B O   1 
ATOM   4583  C CB  . GLN B 2 234 ? 1.199   -26.285 51.266  1.00 69.02  ? 234 GLN B CB  1 
ATOM   4584  C CG  . GLN B 2 234 ? 2.566   -25.758 51.586  1.00 101.31 ? 234 GLN B CG  1 
ATOM   4585  C CD  . GLN B 2 234 ? 3.541   -26.091 50.511  1.00 102.07 ? 234 GLN B CD  1 
ATOM   4586  O OE1 . GLN B 2 234 ? 3.434   -25.543 49.385  1.00 118.79 ? 234 GLN B OE1 1 
ATOM   4587  N NE2 . GLN B 2 234 ? 4.284   -27.231 50.734  1.00 113.66 ? 234 GLN B NE2 1 
ATOM   4588  N N   . SER B 2 235 ? -0.828  -27.874 53.499  1.00 78.43  ? 235 SER B N   1 
ATOM   4589  C CA  . SER B 2 235 ? -1.461  -27.828 54.807  1.00 71.42  ? 235 SER B CA  1 
ATOM   4590  C C   . SER B 2 235 ? -0.577  -28.575 55.814  1.00 76.11  ? 235 SER B C   1 
ATOM   4591  O O   . SER B 2 235 ? -0.257  -28.063 56.892  1.00 61.91  ? 235 SER B O   1 
ATOM   4592  C CB  . SER B 2 235 ? -2.855  -28.432 54.760  1.00 77.02  ? 235 SER B CB  1 
ATOM   4593  O OG  . SER B 2 235 ? -2.781  -29.824 54.525  1.00 80.77  ? 235 SER B OG  1 
ATOM   4594  N N   . ILE B 2 236 ? -0.192  -29.797 55.462  1.00 83.34  ? 236 ILE B N   1 
ATOM   4595  C CA  . ILE B 2 236 ? 0.697   -30.586 56.312  1.00 63.16  ? 236 ILE B CA  1 
ATOM   4596  C C   . ILE B 2 236 ? 1.955   -29.800 56.659  1.00 57.03  ? 236 ILE B C   1 
ATOM   4597  O O   . ILE B 2 236 ? 2.436   -29.834 57.800  1.00 71.97  ? 236 ILE B O   1 
ATOM   4598  C CB  . ILE B 2 236 ? 1.095   -31.910 55.645  1.00 62.93  ? 236 ILE B CB  1 
ATOM   4599  C CG1 . ILE B 2 236 ? -0.135  -32.797 55.457  1.00 64.40  ? 236 ILE B CG1 1 
ATOM   4600  C CG2 . ILE B 2 236 ? 2.121   -32.652 56.492  1.00 53.68  ? 236 ILE B CG2 1 
ATOM   4601  C CD1 . ILE B 2 236 ? 0.144   -34.048 54.670  1.00 69.78  ? 236 ILE B CD1 1 
ATOM   4602  N N   . GLN B 2 237 ? 2.474   -29.078 55.669  1.00 67.49  ? 237 GLN B N   1 
ATOM   4603  C CA  . GLN B 2 237 ? 3.649   -28.251 55.889  1.00 76.42  ? 237 GLN B CA  1 
ATOM   4604  C C   . GLN B 2 237 ? 3.333   -27.129 56.905  1.00 74.43  ? 237 GLN B C   1 
ATOM   4605  O O   . GLN B 2 237 ? 4.049   -26.998 57.899  1.00 83.31  ? 237 GLN B O   1 
ATOM   4606  C CB  . GLN B 2 237 ? 4.177   -27.680 54.567  1.00 74.29  ? 237 GLN B CB  1 
ATOM   4607  C CG  . GLN B 2 237 ? 5.659   -27.320 54.624  1.00 68.68  ? 237 GLN B CG  1 
ATOM   4608  C CD  . GLN B 2 237 ? 6.320   -27.270 53.267  1.00 100.50 ? 237 GLN B CD  1 
ATOM   4609  O OE1 . GLN B 2 237 ? 5.670   -27.397 52.231  1.00 108.34 ? 237 GLN B OE1 1 
ATOM   4610  N NE2 . GLN B 2 237 ? 7.631   -27.078 53.267  1.00 113.93 ? 237 GLN B NE2 1 
ATOM   4611  N N   . VAL B 2 238 ? 2.266   -26.351 56.686  1.00 75.43  ? 238 VAL B N   1 
ATOM   4612  C CA  . VAL B 2 238 ? 1.978   -25.233 57.583  1.00 85.82  ? 238 VAL B CA  1 
ATOM   4613  C C   . VAL B 2 238 ? 1.782   -25.715 59.032  1.00 82.07  ? 238 VAL B C   1 
ATOM   4614  O O   . VAL B 2 238 ? 2.249   -25.061 59.991  1.00 63.78  ? 238 VAL B O   1 
ATOM   4615  C CB  . VAL B 2 238 ? 0.753   -24.389 57.107  1.00 80.95  ? 238 VAL B CB  1 
ATOM   4616  C CG1 . VAL B 2 238 ? 0.954   -23.896 55.672  1.00 83.64  ? 238 VAL B CG1 1 
ATOM   4617  C CG2 . VAL B 2 238 ? -0.537  -25.164 57.223  1.00 69.68  ? 238 VAL B CG2 1 
ATOM   4618  N N   . GLU B 2 239 ? 1.198   -26.896 59.207  1.00 74.88  ? 239 GLU B N   1 
ATOM   4619  C CA  . GLU B 2 239 ? 1.043   -27.410 60.563  1.00 69.38  ? 239 GLU B CA  1 
ATOM   4620  C C   . GLU B 2 239 ? 2.396   -27.893 61.096  1.00 79.07  ? 239 GLU B C   1 
ATOM   4621  O O   . GLU B 2 239 ? 2.673   -27.812 62.306  1.00 82.98  ? 239 GLU B O   1 
ATOM   4622  C CB  . GLU B 2 239 ? 0.024   -28.553 60.594  1.00 76.19  ? 239 GLU B CB  1 
ATOM   4623  C CG  . GLU B 2 239 ? -0.316  -29.083 61.980  1.00 103.58 ? 239 GLU B CG  1 
ATOM   4624  C CD  . GLU B 2 239 ? -1.587  -29.911 61.955  1.00 104.66 ? 239 GLU B CD  1 
ATOM   4625  O OE1 . GLU B 2 239 ? -1.881  -30.484 60.886  1.00 92.04  ? 239 GLU B OE1 1 
ATOM   4626  O OE2 . GLU B 2 239 ? -2.295  -29.989 62.981  1.00 109.20 ? 239 GLU B OE2 1 
ATOM   4627  N N   . LEU B 2 240 ? 3.257   -28.336 60.180  1.00 82.34  ? 240 LEU B N   1 
ATOM   4628  C CA  . LEU B 2 240 ? 4.614   -28.727 60.539  1.00 74.43  ? 240 LEU B CA  1 
ATOM   4629  C C   . LEU B 2 240 ? 5.395   -27.550 61.120  1.00 81.08  ? 240 LEU B C   1 
ATOM   4630  O O   . LEU B 2 240 ? 5.960   -27.694 62.191  1.00 94.57  ? 240 LEU B O   1 
ATOM   4631  C CB  . LEU B 2 240 ? 5.350   -29.317 59.323  1.00 72.52  ? 240 LEU B CB  1 
ATOM   4632  C CG  . LEU B 2 240 ? 6.826   -29.748 59.381  1.00 69.49  ? 240 LEU B CG  1 
ATOM   4633  C CD1 . LEU B 2 240 ? 7.108   -30.731 58.256  1.00 87.66  ? 240 LEU B CD1 1 
ATOM   4634  C CD2 . LEU B 2 240 ? 7.816   -28.587 59.292  1.00 57.36  ? 240 LEU B CD2 1 
ATOM   4635  N N   . GLU B 2 241 ? 5.437   -26.394 60.448  1.00 79.54  ? 241 GLU B N   1 
ATOM   4636  C CA  . GLU B 2 241 ? 6.242   -25.295 61.013  1.00 83.63  ? 241 GLU B CA  1 
ATOM   4637  C C   . GLU B 2 241 ? 5.560   -24.705 62.252  1.00 88.36  ? 241 GLU B C   1 
ATOM   4638  O O   . GLU B 2 241 ? 6.239   -24.277 63.204  1.00 98.50  ? 241 GLU B O   1 
ATOM   4639  C CB  . GLU B 2 241 ? 6.564   -24.174 59.993  1.00 87.40  ? 241 GLU B CB  1 
ATOM   4640  C CG  . GLU B 2 241 ? 5.468   -23.188 59.614  1.00 119.00 ? 241 GLU B CG  1 
ATOM   4641  C CD  . GLU B 2 241 ? 4.809   -23.498 58.285  1.00 126.93 ? 241 GLU B CD  1 
ATOM   4642  O OE1 . GLU B 2 241 ? 5.156   -24.532 57.681  1.00 127.05 ? 241 GLU B OE1 1 
ATOM   4643  O OE2 . GLU B 2 241 ? 3.957   -22.688 57.848  1.00 120.43 ? 241 GLU B OE2 1 
ATOM   4644  N N   . ALA B 2 242 ? 4.229   -24.717 62.270  1.00 89.39  ? 242 ALA B N   1 
ATOM   4645  C CA  . ALA B 2 242 ? 3.551   -24.161 63.433  1.00 84.23  ? 242 ALA B CA  1 
ATOM   4646  C C   . ALA B 2 242 ? 3.969   -24.949 64.676  1.00 86.92  ? 242 ALA B C   1 
ATOM   4647  O O   . ALA B 2 242 ? 4.465   -24.371 65.670  1.00 87.21  ? 242 ALA B O   1 
ATOM   4648  C CB  . ALA B 2 242 ? 2.051   -24.192 63.245  1.00 65.21  ? 242 ALA B CB  1 
ATOM   4649  N N   . GLU B 2 243 ? 3.842   -26.271 64.592  1.00 83.26  ? 243 GLU B N   1 
ATOM   4650  C CA  . GLU B 2 243 ? 4.218   -27.116 65.714  1.00 82.88  ? 243 GLU B CA  1 
ATOM   4651  C C   . GLU B 2 243 ? 5.732   -27.081 65.925  1.00 83.82  ? 243 GLU B C   1 
ATOM   4652  O O   . GLU B 2 243 ? 6.219   -27.285 67.041  1.00 85.55  ? 243 GLU B O   1 
ATOM   4653  C CB  . GLU B 2 243 ? 3.749   -28.553 65.487  1.00 81.45  ? 243 GLU B CB  1 
ATOM   4654  C CG  . GLU B 2 243 ? 2.242   -28.707 65.435  1.00 94.57  ? 243 GLU B CG  1 
ATOM   4655  C CD  . GLU B 2 243 ? 1.558   -28.216 66.696  1.00 114.91 ? 243 GLU B CD  1 
ATOM   4656  O OE1 . GLU B 2 243 ? 2.092   -28.454 67.800  1.00 127.12 ? 243 GLU B OE1 1 
ATOM   4657  O OE2 . GLU B 2 243 ? 0.483   -27.590 66.581  1.00 111.27 ? 243 GLU B OE2 1 
ATOM   4658  N N   . ALA B 2 244 ? 6.470   -26.804 64.853  1.00 77.71  ? 244 ALA B N   1 
ATOM   4659  C CA  . ALA B 2 244 ? 7.922   -26.722 64.923  1.00 70.88  ? 244 ALA B CA  1 
ATOM   4660  C C   . ALA B 2 244 ? 8.413   -25.565 65.788  1.00 77.40  ? 244 ALA B C   1 
ATOM   4661  O O   . ALA B 2 244 ? 9.292   -25.768 66.618  1.00 85.49  ? 244 ALA B O   1 
ATOM   4662  C CB  . ALA B 2 244 ? 8.515   -26.614 63.526  1.00 84.42  ? 244 ALA B CB  1 
ATOM   4663  N N   . GLU B 2 245 ? 7.867   -24.360 65.622  1.00 80.50  ? 245 GLU B N   1 
ATOM   4664  C CA  . GLU B 2 245 ? 8.376   -23.254 66.439  1.00 89.57  ? 245 GLU B CA  1 
ATOM   4665  C C   . GLU B 2 245 ? 7.684   -23.230 67.805  1.00 91.94  ? 245 GLU B C   1 
ATOM   4666  O O   . GLU B 2 245 ? 8.264   -22.749 68.809  1.00 106.33 ? 245 GLU B O   1 
ATOM   4667  C CB  . GLU B 2 245 ? 8.234   -21.904 65.713  1.00 86.45  ? 245 GLU B CB  1 
ATOM   4668  C CG  . GLU B 2 245 ? 8.095   -20.696 66.635  1.00 89.36  ? 245 GLU B CG  1 
ATOM   4669  C CD  . GLU B 2 245 ? 8.834   -19.465 66.126  1.00 112.19 ? 245 GLU B CD  1 
ATOM   4670  O OE1 . GLU B 2 245 ? 8.421   -18.875 65.104  1.00 120.17 ? 245 GLU B OE1 1 
ATOM   4671  O OE2 . GLU B 2 245 ? 9.852   -19.101 66.754  1.00 116.08 ? 245 GLU B OE2 1 
ATOM   4672  N N   . LYS B 2 246 ? 6.499   -23.843 67.873  1.00 81.04  ? 246 LYS B N   1 
ATOM   4673  C CA  . LYS B 2 246 ? 5.881   -24.069 69.176  1.00 78.28  ? 246 LYS B CA  1 
ATOM   4674  C C   . LYS B 2 246 ? 6.830   -24.920 70.028  1.00 88.76  ? 246 LYS B C   1 
ATOM   4675  O O   . LYS B 2 246 ? 7.134   -24.600 71.203  1.00 79.82  ? 246 LYS B O   1 
ATOM   4676  C CB  . LYS B 2 246 ? 4.529   -24.759 69.010  1.00 67.41  ? 246 LYS B CB  1 
ATOM   4677  N N   . MET B 2 247 ? 7.354   -25.966 69.396  1.00 93.30  ? 247 MET B N   1 
ATOM   4678  C CA  . MET B 2 247 ? 8.325   -26.832 70.039  1.00 84.80  ? 247 MET B CA  1 
ATOM   4679  C C   . MET B 2 247 ? 9.644   -26.098 70.220  1.00 83.78  ? 247 MET B C   1 
ATOM   4680  O O   . MET B 2 247 ? 10.416  -26.426 71.119  1.00 89.11  ? 247 MET B O   1 
ATOM   4681  C CB  . MET B 2 247 ? 8.560   -28.107 69.222  1.00 84.54  ? 247 MET B CB  1 
ATOM   4682  C CG  . MET B 2 247 ? 7.704   -29.293 69.607  1.00 92.47  ? 247 MET B CG  1 
ATOM   4683  S SD  . MET B 2 247 ? 8.449   -30.820 69.003  1.00 100.69 ? 247 MET B SD  1 
ATOM   4684  C CE  . MET B 2 247 ? 8.787   -30.386 67.296  1.00 57.70  ? 247 MET B CE  1 
ATOM   4685  N N   . ARG B 2 248 ? 9.896   -25.095 69.383  1.00 86.00  ? 248 ARG B N   1 
ATOM   4686  C CA  . ARG B 2 248 ? 11.127  -24.332 69.507  1.00 83.35  ? 248 ARG B CA  1 
ATOM   4687  C C   . ARG B 2 248 ? 11.202  -23.552 70.820  1.00 85.58  ? 248 ARG B C   1 
ATOM   4688  O O   . ARG B 2 248 ? 12.184  -23.707 71.553  1.00 88.86  ? 248 ARG B O   1 
ATOM   4689  C CB  . ARG B 2 248 ? 11.290  -23.378 68.306  1.00 69.44  ? 248 ARG B CB  1 
ATOM   4690  N N   . VAL B 2 249 ? 10.185  -22.736 71.136  1.00 92.42  ? 249 VAL B N   1 
ATOM   4691  C CA  . VAL B 2 249 ? 10.232  -21.956 72.398  1.00 92.47  ? 249 VAL B CA  1 
ATOM   4692  C C   . VAL B 2 249 ? 9.826   -22.780 73.650  1.00 94.56  ? 249 VAL B C   1 
ATOM   4693  O O   . VAL B 2 249 ? 10.244  -22.431 74.790  1.00 94.73  ? 249 VAL B O   1 
ATOM   4694  C CB  . VAL B 2 249 ? 9.342   -20.653 72.327  1.00 109.13 ? 249 VAL B CB  1 
ATOM   4695  C CG1 . VAL B 2 249 ? 8.981   -20.311 70.898  1.00 91.51  ? 249 VAL B CG1 1 
ATOM   4696  C CG2 . VAL B 2 249 ? 8.109   -20.786 73.194  1.00 92.18  ? 249 VAL B CG2 1 
ATOM   4697  N N   . SER B 2 250 ? 9.038   -23.851 73.462  1.00 80.22  ? 250 SER B N   1 
ATOM   4698  C CA  . SER B 2 250 ? 8.890   -24.804 74.560  1.00 77.60  ? 250 SER B CA  1 
ATOM   4699  C C   . SER B 2 250 ? 10.260  -25.390 74.928  1.00 89.50  ? 250 SER B C   1 
ATOM   4700  O O   . SER B 2 250 ? 10.639  -25.472 76.118  1.00 88.14  ? 250 SER B O   1 
ATOM   4701  C CB  . SER B 2 250 ? 7.924   -25.923 74.189  1.00 71.63  ? 250 SER B CB  1 
ATOM   4702  O OG  . SER B 2 250 ? 6.587   -25.470 74.220  1.00 81.79  ? 250 SER B OG  1 
ATOM   4703  N N   . GLN B 2 251 ? 11.017  -25.738 73.891  1.00 85.79  ? 251 GLN B N   1 
ATOM   4704  C CA  . GLN B 2 251 ? 12.383  -26.202 74.057  1.00 81.19  ? 251 GLN B CA  1 
ATOM   4705  C C   . GLN B 2 251 ? 13.253  -25.165 74.741  1.00 90.54  ? 251 GLN B C   1 
ATOM   4706  O O   . GLN B 2 251 ? 13.996  -25.485 75.670  1.00 96.66  ? 251 GLN B O   1 
ATOM   4707  C CB  . GLN B 2 251 ? 13.013  -26.564 72.710  1.00 81.46  ? 251 GLN B CB  1 
ATOM   4708  C CG  . GLN B 2 251 ? 14.518  -26.751 72.805  1.00 77.80  ? 251 GLN B CG  1 
ATOM   4709  C CD  . GLN B 2 251 ? 15.124  -27.433 71.601  1.00 84.90  ? 251 GLN B CD  1 
ATOM   4710  O OE1 . GLN B 2 251 ? 14.651  -28.476 71.153  1.00 95.85  ? 251 GLN B OE1 1 
ATOM   4711  N NE2 . GLN B 2 251 ? 16.183  -26.838 71.064  1.00 87.46  ? 251 GLN B NE2 1 
ATOM   4712  N N   . GLN B 2 252 ? 13.147  -23.913 74.306  1.00 90.67  ? 252 GLN B N   1 
ATOM   4713  C CA  . GLN B 2 252 ? 14.121  -22.943 74.763  1.00 92.14  ? 252 GLN B CA  1 
ATOM   4714  C C   . GLN B 2 252 ? 13.826  -22.369 76.150  1.00 98.08  ? 252 GLN B C   1 
ATOM   4715  O O   . GLN B 2 252 ? 14.741  -21.818 76.783  1.00 107.53 ? 252 GLN B O   1 
ATOM   4716  C CB  . GLN B 2 252 ? 14.235  -21.802 73.721  1.00 92.82  ? 252 GLN B CB  1 
ATOM   4717  C CG  . GLN B 2 252 ? 14.180  -20.387 74.301  1.00 91.44  ? 252 GLN B CG  1 
ATOM   4718  C CD  . GLN B 2 252 ? 14.447  -19.292 73.279  1.00 106.58 ? 252 GLN B CD  1 
ATOM   4719  O OE1 . GLN B 2 252 ? 15.575  -19.121 72.811  1.00 96.55  ? 252 GLN B OE1 1 
ATOM   4720  N NE2 . GLN B 2 252 ? 13.414  -18.527 72.950  1.00 110.39 ? 252 GLN B NE2 1 
ATOM   4721  N N   . GLU B 2 253 ? 12.608  -22.535 76.674  1.00 92.42  ? 253 GLU B N   1 
ATOM   4722  C CA  . GLU B 2 253 ? 12.467  -22.278 78.110  1.00 108.81 ? 253 GLU B CA  1 
ATOM   4723  C C   . GLU B 2 253 ? 12.443  -23.539 79.008  1.00 106.09 ? 253 GLU B C   1 
ATOM   4724  O O   . GLU B 2 253 ? 12.405  -23.397 80.246  1.00 107.99 ? 253 GLU B O   1 
ATOM   4725  C CB  . GLU B 2 253 ? 11.262  -21.380 78.387  1.00 114.36 ? 253 GLU B CB  1 
ATOM   4726  C CG  . GLU B 2 253 ? 11.771  -19.954 78.274  1.00 126.67 ? 253 GLU B CG  1 
ATOM   4727  C CD  . GLU B 2 253 ? 11.171  -18.963 79.244  1.00 144.30 ? 253 GLU B CD  1 
ATOM   4728  O OE1 . GLU B 2 253 ? 10.002  -19.095 79.675  1.00 142.34 ? 253 GLU B OE1 1 
ATOM   4729  O OE2 . GLU B 2 253 ? 11.936  -18.053 79.624  1.00 148.54 ? 253 GLU B OE2 1 
ATOM   4730  N N   . LEU B 2 254 ? 12.425  -24.750 78.440  1.00 100.52 ? 254 LEU B N   1 
ATOM   4731  C CA  . LEU B 2 254 ? 12.705  -25.881 79.314  1.00 87.55  ? 254 LEU B CA  1 
ATOM   4732  C C   . LEU B 2 254 ? 14.228  -26.048 79.443  1.00 87.81  ? 254 LEU B C   1 
ATOM   4733  O O   . LEU B 2 254 ? 14.732  -26.527 80.468  1.00 71.02  ? 254 LEU B O   1 
ATOM   4734  C CB  . LEU B 2 254 ? 12.072  -27.172 78.822  1.00 77.73  ? 254 LEU B CB  1 
ATOM   4735  C CG  . LEU B 2 254 ? 10.570  -27.367 78.989  1.00 72.98  ? 254 LEU B CG  1 
ATOM   4736  C CD1 . LEU B 2 254 ? 9.976   -28.359 77.977  1.00 79.47  ? 254 LEU B CD1 1 
ATOM   4737  C CD2 . LEU B 2 254 ? 10.297  -27.813 80.416  1.00 68.02  ? 254 LEU B CD2 1 
ATOM   4738  N N   . LEU B 2 255 ? 14.955  -25.676 78.390  1.00 98.80  ? 255 LEU B N   1 
ATOM   4739  C CA  . LEU B 2 255 ? 16.403  -25.835 78.374  1.00 89.74  ? 255 LEU B CA  1 
ATOM   4740  C C   . LEU B 2 255 ? 17.078  -24.686 79.109  1.00 95.30  ? 255 LEU B C   1 
ATOM   4741  O O   . LEU B 2 255 ? 18.263  -24.765 79.439  1.00 102.02 ? 255 LEU B O   1 
ATOM   4742  C CB  . LEU B 2 255 ? 16.916  -25.926 76.936  1.00 86.28  ? 255 LEU B CB  1 
ATOM   4743  N N   . SER B 2 256 ? 16.327  -23.620 79.374  1.00 99.32  ? 256 SER B N   1 
ATOM   4744  C CA  . SER B 2 256 ? 16.875  -22.528 80.163  1.00 108.16 ? 256 SER B CA  1 
ATOM   4745  C C   . SER B 2 256 ? 16.344  -22.607 81.590  1.00 104.96 ? 256 SER B C   1 
ATOM   4746  O O   . SER B 2 256 ? 15.197  -22.248 81.862  1.00 98.94  ? 256 SER B O   1 
ATOM   4747  C CB  . SER B 2 256 ? 16.532  -21.172 79.536  1.00 108.04 ? 256 SER B CB  1 
ATOM   4748  O OG  . SER B 2 256 ? 16.942  -20.102 80.372  1.00 117.53 ? 256 SER B OG  1 
ATOM   4749  N N   . VAL B 2 257 ? 17.209  -23.067 82.492  1.00 94.86  ? 257 VAL B N   1 
ATOM   4750  C CA  . VAL B 2 257 ? 16.900  -23.221 83.908  1.00 96.54  ? 257 VAL B CA  1 
ATOM   4751  C C   . VAL B 2 257 ? 18.195  -22.918 84.665  1.00 104.78 ? 257 VAL B C   1 
ATOM   4752  O O   . VAL B 2 257 ? 19.238  -22.732 84.045  1.00 96.04  ? 257 VAL B O   1 
ATOM   4753  C CB  . VAL B 2 257 ? 16.391  -24.637 84.251  1.00 88.92  ? 257 VAL B CB  1 
ATOM   4754  C CG1 . VAL B 2 257 ? 15.009  -24.883 83.647  1.00 75.84  ? 257 VAL B CG1 1 
ATOM   4755  C CG2 . VAL B 2 257 ? 17.380  -25.677 83.765  1.00 80.49  ? 257 VAL B CG2 1 
ATOM   4756  N N   . ASP B 2 258 ? 18.145  -22.876 85.992  1.00 99.45  ? 258 ASP B N   1 
ATOM   4757  C CA  . ASP B 2 258 ? 19.350  -22.596 86.773  1.00 99.17  ? 258 ASP B CA  1 
ATOM   4758  C C   . ASP B 2 258 ? 20.158  -23.890 86.910  1.00 94.26  ? 258 ASP B C   1 
ATOM   4759  O O   . ASP B 2 258 ? 19.628  -24.990 86.764  1.00 83.54  ? 258 ASP B O   1 
ATOM   4760  C CB  . ASP B 2 258 ? 18.979  -21.972 88.132  1.00 104.33 ? 258 ASP B CB  1 
ATOM   4761  C CG  . ASP B 2 258 ? 20.151  -21.893 89.136  1.00 119.32 ? 258 ASP B CG  1 
ATOM   4762  O OD1 . ASP B 2 258 ? 21.217  -22.517 88.973  1.00 122.11 ? 258 ASP B OD1 1 
ATOM   4763  O OD2 . ASP B 2 258 ? 20.003  -21.124 90.108  1.00 116.95 ? 258 ASP B OD2 1 
ATOM   4764  N N   . GLU B 2 259 ? 21.459  -23.722 87.127  1.00 92.29  ? 259 GLU B N   1 
ATOM   4765  C CA  . GLU B 2 259 ? 22.433  -24.809 87.243  1.00 75.99  ? 259 GLU B CA  1 
ATOM   4766  C C   . GLU B 2 259 ? 22.018  -25.956 88.151  1.00 87.18  ? 259 GLU B C   1 
ATOM   4767  O O   . GLU B 2 259 ? 22.218  -27.130 87.831  1.00 88.02  ? 259 GLU B O   1 
ATOM   4768  C CB  . GLU B 2 259 ? 23.715  -24.232 87.812  1.00 89.59  ? 259 GLU B CB  1 
ATOM   4769  C CG  . GLU B 2 259 ? 24.960  -25.036 87.669  1.00 99.07  ? 259 GLU B CG  1 
ATOM   4770  C CD  . GLU B 2 259 ? 26.026  -24.465 88.552  1.00 105.17 ? 259 GLU B CD  1 
ATOM   4771  O OE1 . GLU B 2 259 ? 25.800  -23.340 89.042  1.00 104.21 ? 259 GLU B OE1 1 
ATOM   4772  O OE2 . GLU B 2 259 ? 27.074  -25.109 88.748  1.00 105.91 ? 259 GLU B OE2 1 
ATOM   4773  N N   . SER B 2 260 ? 21.412  -25.594 89.276  1.00 87.20  ? 260 SER B N   1 
ATOM   4774  C CA  . SER B 2 260 ? 21.162  -26.522 90.370  1.00 69.61  ? 260 SER B CA  1 
ATOM   4775  C C   . SER B 2 260 ? 20.251  -27.679 89.982  1.00 63.25  ? 260 SER B C   1 
ATOM   4776  O O   . SER B 2 260 ? 20.319  -28.759 90.569  1.00 79.65  ? 260 SER B O   1 
ATOM   4777  C CB  . SER B 2 260 ? 20.572  -25.764 91.555  1.00 78.90  ? 260 SER B CB  1 
ATOM   4778  O OG  . SER B 2 260 ? 19.227  -25.418 91.305  1.00 80.20  ? 260 SER B OG  1 
ATOM   4779  N N   . VAL B 2 261 ? 19.393  -27.441 88.997  1.00 69.95  ? 261 VAL B N   1 
ATOM   4780  C CA  . VAL B 2 261 ? 18.471  -28.458 88.517  1.00 73.63  ? 261 VAL B CA  1 
ATOM   4781  C C   . VAL B 2 261 ? 19.245  -29.657 87.964  1.00 74.11  ? 261 VAL B C   1 
ATOM   4782  O O   . VAL B 2 261 ? 18.824  -30.803 88.118  1.00 66.41  ? 261 VAL B O   1 
ATOM   4783  C CB  . VAL B 2 261 ? 17.534  -27.892 87.433  1.00 80.34  ? 261 VAL B CB  1 
ATOM   4784  C CG1 . VAL B 2 261 ? 16.505  -28.932 87.020  1.00 75.17  ? 261 VAL B CG1 1 
ATOM   4785  C CG2 . VAL B 2 261 ? 16.848  -26.631 87.938  1.00 77.77  ? 261 VAL B CG2 1 
ATOM   4786  N N   . TYR B 2 262 ? 20.377  -29.388 87.318  1.00 72.71  ? 262 TYR B N   1 
ATOM   4787  C CA  . TYR B 2 262 ? 21.234  -30.454 86.802  1.00 66.58  ? 262 TYR B CA  1 
ATOM   4788  C C   . TYR B 2 262 ? 22.287  -30.894 87.813  1.00 67.74  ? 262 TYR B C   1 
ATOM   4789  O O   . TYR B 2 262 ? 22.927  -31.931 87.641  1.00 66.00  ? 262 TYR B O   1 
ATOM   4790  C CB  . TYR B 2 262 ? 21.933  -30.010 85.517  1.00 57.99  ? 262 TYR B CB  1 
ATOM   4791  C CG  . TYR B 2 262 ? 20.994  -29.598 84.411  1.00 67.04  ? 262 TYR B CG  1 
ATOM   4792  C CD1 . TYR B 2 262 ? 20.258  -30.544 83.710  1.00 59.11  ? 262 TYR B CD1 1 
ATOM   4793  C CD2 . TYR B 2 262 ? 20.845  -28.263 84.067  1.00 69.33  ? 262 TYR B CD2 1 
ATOM   4794  C CE1 . TYR B 2 262 ? 19.400  -30.170 82.697  1.00 57.51  ? 262 TYR B CE1 1 
ATOM   4795  C CE2 . TYR B 2 262 ? 19.990  -27.880 83.057  1.00 68.82  ? 262 TYR B CE2 1 
ATOM   4796  C CZ  . TYR B 2 262 ? 19.270  -28.836 82.375  1.00 61.89  ? 262 TYR B CZ  1 
ATOM   4797  O OH  . TYR B 2 262 ? 18.416  -28.454 81.366  1.00 72.51  ? 262 TYR B OH  1 
ATOM   4798  N N   . THR B 2 263 ? 22.462  -30.106 88.869  1.00 69.84  ? 263 THR B N   1 
ATOM   4799  C CA  . THR B 2 263 ? 23.505  -30.377 89.852  1.00 68.57  ? 263 THR B CA  1 
ATOM   4800  C C   . THR B 2 263 ? 23.004  -31.257 90.992  1.00 68.74  ? 263 THR B C   1 
ATOM   4801  O O   . THR B 2 263 ? 22.057  -30.897 91.689  1.00 70.09  ? 263 THR B O   1 
ATOM   4802  C CB  . THR B 2 263 ? 24.077  -29.071 90.441  1.00 68.03  ? 263 THR B CB  1 
ATOM   4803  O OG1 . THR B 2 263 ? 24.458  -28.189 89.378  1.00 76.54  ? 263 THR B OG1 1 
ATOM   4804  C CG2 . THR B 2 263 ? 25.293  -29.364 91.307  1.00 63.95  ? 263 THR B CG2 1 
ATOM   4805  N N   . PRO B 2 264 ? 23.646  -32.419 91.182  1.00 64.04  ? 264 PRO B N   1 
ATOM   4806  C CA  . PRO B 2 264 ? 23.289  -33.346 92.259  1.00 65.46  ? 264 PRO B CA  1 
ATOM   4807  C C   . PRO B 2 264 ? 23.638  -32.765 93.623  1.00 64.12  ? 264 PRO B C   1 
ATOM   4808  O O   . PRO B 2 264 ? 24.707  -32.171 93.776  1.00 68.89  ? 264 PRO B O   1 
ATOM   4809  C CB  . PRO B 2 264 ? 24.132  -34.585 91.948  1.00 49.68  ? 264 PRO B CB  1 
ATOM   4810  C CG  . PRO B 2 264 ? 25.312  -34.049 91.218  1.00 63.66  ? 264 PRO B CG  1 
ATOM   4811  C CD  . PRO B 2 264 ? 24.778  -32.918 90.382  1.00 69.39  ? 264 PRO B CD  1 
ATOM   4812  N N   . ASP B 2 265 ? 22.738  -32.931 94.588  1.00 70.51  ? 265 ASP B N   1 
ATOM   4813  C CA  . ASP B 2 265 ? 22.905  -32.364 95.923  1.00 73.44  ? 265 ASP B CA  1 
ATOM   4814  C C   . ASP B 2 265 ? 23.078  -30.846 95.856  1.00 70.49  ? 265 ASP B C   1 
ATOM   4815  O O   . ASP B 2 265 ? 23.867  -30.268 96.600  1.00 63.24  ? 265 ASP B O   1 
ATOM   4816  C CB  . ASP B 2 265 ? 24.098  -33.007 96.642  1.00 72.74  ? 265 ASP B CB  1 
ATOM   4817  C CG  . ASP B 2 265 ? 23.784  -33.377 98.080  1.00 78.68  ? 265 ASP B CG  1 
ATOM   4818  O OD1 . ASP B 2 265 ? 22.649  -33.121 98.534  1.00 83.91  ? 265 ASP B OD1 1 
ATOM   4819  O OD2 . ASP B 2 265 ? 24.678  -33.922 98.762  1.00 66.56  ? 265 ASP B OD2 1 
ATOM   4820  N N   . SER B 2 266 ? 22.361  -30.219 94.926  1.00 85.65  ? 266 SER B N   1 
ATOM   4821  C CA  . SER B 2 266 ? 22.202  -28.769 94.895  1.00 73.89  ? 266 SER B CA  1 
ATOM   4822  C C   . SER B 2 266 ? 21.800  -28.240 96.267  1.00 84.75  ? 266 SER B C   1 
ATOM   4823  O O   . SER B 2 266 ? 22.507  -27.453 96.894  1.00 79.71  ? 266 SER B O   1 
ATOM   4824  C CB  . SER B 2 266 ? 21.140  -28.377 93.867  1.00 62.54  ? 266 SER B CB  1 
ATOM   4825  O OG  . SER B 2 266 ? 21.123  -29.282 92.779  1.00 70.20  ? 266 SER B OG  1 
ATOM   4826  N N   . ASP B 2 267 ? 20.635  -28.701 96.704  1.00 92.17  ? 267 ASP B N   1 
ATOM   4827  C CA  . ASP B 2 267 ? 20.024  -28.371 97.988  1.00 90.44  ? 267 ASP B CA  1 
ATOM   4828  C C   . ASP B 2 267 ? 20.878  -28.574 99.248  1.00 102.33 ? 267 ASP B C   1 
ATOM   4829  O O   . ASP B 2 267 ? 20.536  -28.036 100.297 1.00 106.43 ? 267 ASP B O   1 
ATOM   4830  C CB  . ASP B 2 267 ? 18.716  -29.156 98.122  1.00 91.23  ? 267 ASP B CB  1 
ATOM   4831  C CG  . ASP B 2 267 ? 18.822  -30.566 97.577  1.00 104.41 ? 267 ASP B CG  1 
ATOM   4832  O OD1 . ASP B 2 267 ? 19.782  -31.279 97.935  1.00 97.61  ? 267 ASP B OD1 1 
ATOM   4833  O OD2 . ASP B 2 267 ? 17.949  -30.950 96.770  1.00 100.08 ? 267 ASP B OD2 1 
ATOM   4834  N N   . VAL B 2 268 ? 21.974  -29.327 99.147  1.00 94.67  ? 268 VAL B N   1 
ATOM   4835  C CA  . VAL B 2 268 ? 22.663  -29.907 100.311 1.00 90.78  ? 268 VAL B CA  1 
ATOM   4836  C C   . VAL B 2 268 ? 22.857  -28.945 101.494 1.00 99.59  ? 268 VAL B C   1 
ATOM   4837  O O   . VAL B 2 268 ? 22.763  -29.362 102.649 1.00 97.13  ? 268 VAL B O   1 
ATOM   4838  C CB  . VAL B 2 268 ? 24.057  -30.469 99.905  1.00 93.33  ? 268 VAL B CB  1 
ATOM   4839  C CG1 . VAL B 2 268 ? 24.976  -29.360 99.390  1.00 100.66 ? 268 VAL B CG1 1 
ATOM   4840  C CG2 . VAL B 2 268 ? 24.706  -31.209 101.066 1.00 61.03  ? 268 VAL B CG2 1 
ATOM   4841  N N   . ALA B 2 269 ? 23.114  -27.670 101.213 1.00 112.86 ? 269 ALA B N   1 
ATOM   4842  C CA  . ALA B 2 269 ? 23.280  -26.678 102.272 1.00 117.37 ? 269 ALA B CA  1 
ATOM   4843  C C   . ALA B 2 269 ? 21.994  -26.512 103.081 1.00 110.91 ? 269 ALA B C   1 
ATOM   4844  O O   . ALA B 2 269 ? 22.024  -26.448 104.310 1.00 100.67 ? 269 ALA B O   1 
ATOM   4845  C CB  . ALA B 2 269 ? 23.713  -25.344 101.684 1.00 114.65 ? 269 ALA B CB  1 
ATOM   4846  N N   . ALA B 2 270 ? 20.866  -26.449 102.380 1.00 105.94 ? 270 ALA B N   1 
ATOM   4847  C CA  . ALA B 2 270 ? 19.557  -26.356 103.018 1.00 104.30 ? 270 ALA B CA  1 
ATOM   4848  C C   . ALA B 2 270 ? 18.530  -27.158 102.230 1.00 108.43 ? 270 ALA B C   1 
ATOM   4849  O O   . ALA B 2 270 ? 17.734  -26.585 101.485 1.00 108.14 ? 270 ALA B O   1 
ATOM   4850  C CB  . ALA B 2 270 ? 19.122  -24.905 103.136 1.00 109.81 ? 270 ALA B CB  1 
ATOM   4851  N N   . PRO B 2 271 ? 18.552  -28.491 102.383 1.00 111.22 ? 271 PRO B N   1 
ATOM   4852  C CA  . PRO B 2 271 ? 17.689  -29.359 101.575 1.00 102.90 ? 271 PRO B CA  1 
ATOM   4853  C C   . PRO B 2 271 ? 16.209  -29.104 101.830 1.00 95.60  ? 271 PRO B C   1 
ATOM   4854  O O   . PRO B 2 271 ? 15.807  -28.958 102.984 1.00 103.93 ? 271 PRO B O   1 
ATOM   4855  C CB  . PRO B 2 271 ? 18.079  -30.772 102.035 1.00 91.85  ? 271 PRO B CB  1 
ATOM   4856  C CG  . PRO B 2 271 ? 19.426  -30.619 102.670 1.00 91.35  ? 271 PRO B CG  1 
ATOM   4857  C CD  . PRO B 2 271 ? 19.404  -29.263 103.302 1.00 103.80 ? 271 PRO B CD  1 
ATOM   4858  N N   . GLN B 2 272 ? 15.412  -29.055 100.768 1.00 97.32  ? 272 GLN B N   1 
ATOM   4859  C CA  . GLN B 2 272 ? 13.980  -28.843 100.919 1.00 107.32 ? 272 GLN B CA  1 
ATOM   4860  C C   . GLN B 2 272 ? 13.251  -30.167 100.768 1.00 100.75 ? 272 GLN B C   1 
ATOM   4861  O O   . GLN B 2 272 ? 13.105  -30.709 99.671  1.00 98.14  ? 272 GLN B O   1 
ATOM   4862  C CB  . GLN B 2 272 ? 13.463  -27.802 99.923  1.00 110.91 ? 272 GLN B CB  1 
ATOM   4863  C CG  . GLN B 2 272 ? 14.427  -26.651 99.704  1.00 116.16 ? 272 GLN B CG  1 
ATOM   4864  C CD  . GLN B 2 272 ? 13.761  -25.435 99.090  1.00 127.91 ? 272 GLN B CD  1 
ATOM   4865  O OE1 . GLN B 2 272 ? 12.732  -24.961 99.575  1.00 131.79 ? 272 GLN B OE1 1 
ATOM   4866  N NE2 . GLN B 2 272 ? 14.358  -24.913 98.027  1.00 123.13 ? 272 GLN B NE2 1 
ATOM   4867  N N   . ILE B 2 273 ? 12.799  -30.670 101.910 1.00 86.91  ? 273 ILE B N   1 
ATOM   4868  C CA  . ILE B 2 273 ? 12.290  -32.024 102.044 1.00 78.20  ? 273 ILE B CA  1 
ATOM   4869  C C   . ILE B 2 273 ? 10.790  -32.035 102.297 1.00 74.55  ? 273 ILE B C   1 
ATOM   4870  O O   . ILE B 2 273 ? 10.298  -31.318 103.166 1.00 83.38  ? 273 ILE B O   1 
ATOM   4871  C CB  . ILE B 2 273 ? 13.003  -32.759 103.201 1.00 65.58  ? 273 ILE B CB  1 
ATOM   4872  C CG1 . ILE B 2 273 ? 14.502  -32.873 102.914 1.00 79.99  ? 273 ILE B CG1 1 
ATOM   4873  C CG2 . ILE B 2 273 ? 12.385  -34.131 103.440 1.00 58.88  ? 273 ILE B CG2 1 
ATOM   4874  C CD1 . ILE B 2 273 ? 15.320  -33.306 104.107 1.00 82.05  ? 273 ILE B CD1 1 
ATOM   4875  N N   . ASN B 2 274 ? 10.065  -32.845 101.533 1.00 68.36  ? 274 ASN B N   1 
ATOM   4876  C CA  . ASN B 2 274 ? 8.648   -33.069 101.786 1.00 64.61  ? 274 ASN B CA  1 
ATOM   4877  C C   . ASN B 2 274 ? 8.500   -34.362 102.578 1.00 76.50  ? 274 ASN B C   1 
ATOM   4878  O O   . ASN B 2 274 ? 8.752   -35.446 102.055 1.00 69.44  ? 274 ASN B O   1 
ATOM   4879  C CB  . ASN B 2 274 ? 7.863   -33.132 100.475 1.00 76.01  ? 274 ASN B CB  1 
ATOM   4880  C CG  . ASN B 2 274 ? 6.369   -33.249 100.698 1.00 91.04  ? 274 ASN B CG  1 
ATOM   4881  O OD1 . ASN B 2 274 ? 5.877   -33.026 101.803 1.00 95.12  ? 274 ASN B OD1 1 
ATOM   4882  N ND2 . ASN B 2 274 ? 5.639   -33.599 99.646  1.00 85.63  ? 274 ASN B ND2 1 
ATOM   4883  N N   . ARG B 2 275 ? 8.106   -34.247 103.843 1.00 84.94  ? 275 ARG B N   1 
ATOM   4884  C CA  . ARG B 2 275 ? 8.083   -35.409 104.723 1.00 87.32  ? 275 ARG B CA  1 
ATOM   4885  C C   . ARG B 2 275 ? 6.742   -36.148 104.725 1.00 73.39  ? 275 ARG B C   1 
ATOM   4886  O O   . ARG B 2 275 ? 6.604   -37.202 105.354 1.00 73.23  ? 275 ARG B O   1 
ATOM   4887  C CB  . ARG B 2 275 ? 8.430   -34.974 106.147 1.00 77.26  ? 275 ARG B CB  1 
ATOM   4888  C CG  . ARG B 2 275 ? 9.590   -35.730 106.743 1.00 85.86  ? 275 ARG B CG  1 
ATOM   4889  C CD  . ARG B 2 275 ? 9.481   -35.826 108.249 1.00 123.35 ? 275 ARG B CD  1 
ATOM   4890  N NE  . ARG B 2 275 ? 8.601   -36.918 108.654 1.00 128.12 ? 275 ARG B NE  1 
ATOM   4891  C CZ  . ARG B 2 275 ? 7.877   -36.918 109.767 1.00 115.41 ? 275 ARG B CZ  1 
ATOM   4892  N NH1 . ARG B 2 275 ? 7.933   -35.883 110.594 1.00 109.64 ? 275 ARG B NH1 1 
ATOM   4893  N NH2 . ARG B 2 275 ? 7.102   -37.953 110.056 1.00 117.96 ? 275 ARG B NH2 1 
ATOM   4894  N N   . ASN B 2 276 ? 5.761   -35.582 104.031 1.00 81.30  ? 276 ASN B N   1 
ATOM   4895  C CA  . ASN B 2 276 ? 4.443   -36.191 103.902 1.00 85.10  ? 276 ASN B CA  1 
ATOM   4896  C C   . ASN B 2 276 ? 4.225   -36.904 102.567 1.00 66.07  ? 276 ASN B C   1 
ATOM   4897  O O   . ASN B 2 276 ? 3.091   -37.236 102.221 1.00 61.14  ? 276 ASN B O   1 
ATOM   4898  C CB  . ASN B 2 276 ? 3.344   -35.154 104.138 1.00 71.92  ? 276 ASN B CB  1 
ATOM   4899  C CG  . ASN B 2 276 ? 3.358   -34.610 105.557 1.00 85.32  ? 276 ASN B CG  1 
ATOM   4900  O OD1 . ASN B 2 276 ? 3.157   -35.358 106.517 1.00 91.92  ? 276 ASN B OD1 1 
ATOM   4901  N ND2 . ASN B 2 276 ? 3.588   -33.311 105.698 1.00 92.81  ? 276 ASN B ND2 1 
ATOM   4902  N N   . LEU B 2 277 ? 5.297   -37.113 101.804 1.00 54.43  ? 277 LEU B N   1 
ATOM   4903  C CA  . LEU B 2 277 ? 5.172   -37.815 100.530 1.00 66.88  ? 277 LEU B CA  1 
ATOM   4904  C C   . LEU B 2 277 ? 4.692   -39.246 100.730 1.00 59.76  ? 277 LEU B C   1 
ATOM   4905  O O   . LEU B 2 277 ? 5.258   -40.008 101.512 1.00 65.99  ? 277 LEU B O   1 
ATOM   4906  C CB  . LEU B 2 277 ? 6.513   -37.837 99.788  1.00 71.22  ? 277 LEU B CB  1 
ATOM   4907  C CG  . LEU B 2 277 ? 7.079   -36.552 99.191  1.00 74.60  ? 277 LEU B CG  1 
ATOM   4908  C CD1 . LEU B 2 277 ? 8.577   -36.688 98.982  1.00 73.71  ? 277 LEU B CD1 1 
ATOM   4909  C CD2 . LEU B 2 277 ? 6.391   -36.258 97.869  1.00 66.40  ? 277 LEU B CD2 1 
ATOM   4910  N N   . ILE B 2 278 ? 3.621   -39.589 100.026 1.00 64.81  ? 278 ILE B N   1 
ATOM   4911  C CA  . ILE B 2 278 ? 3.116   -40.954 99.971  1.00 70.01  ? 278 ILE B CA  1 
ATOM   4912  C C   . ILE B 2 278 ? 3.500   -41.636 98.660  1.00 61.78  ? 278 ILE B C   1 
ATOM   4913  O O   . ILE B 2 278 ? 3.193   -42.809 98.447  1.00 57.81  ? 278 ILE B O   1 
ATOM   4914  C CB  . ILE B 2 278 ? 1.593   -40.981 100.155 1.00 80.19  ? 278 ILE B CB  1 
ATOM   4915  C CG1 . ILE B 2 278 ? 0.942   -39.918 99.270  1.00 92.10  ? 278 ILE B CG1 1 
ATOM   4916  C CG2 . ILE B 2 278 ? 1.238   -40.709 101.606 1.00 66.91  ? 278 ILE B CG2 1 
ATOM   4917  C CD1 . ILE B 2 278 ? -0.547  -39.782 99.475  1.00 91.15  ? 278 ILE B CD1 1 
ATOM   4918  N N   . GLN B 2 279 ? 4.167   -40.890 97.784  1.00 74.75  ? 279 GLN B N   1 
ATOM   4919  C CA  . GLN B 2 279 ? 4.507   -41.380 96.450  1.00 80.37  ? 279 GLN B CA  1 
ATOM   4920  C C   . GLN B 2 279 ? 5.838   -40.818 95.958  1.00 72.52  ? 279 GLN B C   1 
ATOM   4921  O O   . GLN B 2 279 ? 6.113   -39.629 96.121  1.00 75.36  ? 279 GLN B O   1 
ATOM   4922  C CB  . GLN B 2 279 ? 3.390   -41.012 95.470  1.00 74.69  ? 279 GLN B CB  1 
ATOM   4923  C CG  . GLN B 2 279 ? 3.730   -41.192 93.999  1.00 90.45  ? 279 GLN B CG  1 
ATOM   4924  C CD  . GLN B 2 279 ? 2.832   -40.365 93.096  1.00 93.08  ? 279 GLN B CD  1 
ATOM   4925  O OE1 . GLN B 2 279 ? 2.524   -39.211 93.398  1.00 94.15  ? 279 GLN B OE1 1 
ATOM   4926  N NE2 . GLN B 2 279 ? 2.405   -40.952 91.985  1.00 89.32  ? 279 GLN B NE2 1 
ATOM   4927  N N   . LYS B 2 280 ? 6.667   -41.672 95.360  1.00 61.04  ? 280 LYS B N   1 
ATOM   4928  C CA  . LYS B 2 280 ? 7.950   -41.215 94.837  1.00 52.27  ? 280 LYS B CA  1 
ATOM   4929  C C   . LYS B 2 280 ? 8.478   -42.059 93.675  1.00 56.97  ? 280 LYS B C   1 
ATOM   4930  O O   . LYS B 2 280 ? 8.291   -43.276 93.637  1.00 41.07  ? 280 LYS B O   1 
ATOM   4931  C CB  . LYS B 2 280 ? 8.984   -41.178 95.960  1.00 50.66  ? 280 LYS B CB  1 
ATOM   4932  C CG  . LYS B 2 280 ? 10.180  -40.309 95.644  1.00 60.79  ? 280 LYS B CG  1 
ATOM   4933  C CD  . LYS B 2 280 ? 10.970  -39.984 96.890  1.00 57.71  ? 280 LYS B CD  1 
ATOM   4934  C CE  . LYS B 2 280 ? 12.250  -39.263 96.530  1.00 71.03  ? 280 LYS B CE  1 
ATOM   4935  N NZ  . LYS B 2 280 ? 11.976  -38.043 95.718  1.00 77.24  ? 280 LYS B NZ  1 
ATOM   4936  N N   . ALA B 2 281 ? 9.145   -41.395 92.734  1.00 50.36  ? 281 ALA B N   1 
ATOM   4937  C CA  . ALA B 2 281 ? 9.777   -42.064 91.602  1.00 45.30  ? 281 ALA B CA  1 
ATOM   4938  C C   . ALA B 2 281 ? 11.129  -41.428 91.275  1.00 47.19  ? 281 ALA B C   1 
ATOM   4939  O O   . ALA B 2 281 ? 11.276  -40.207 91.334  1.00 46.60  ? 281 ALA B O   1 
ATOM   4940  C CB  . ALA B 2 281 ? 8.863   -42.026 90.388  1.00 42.56  ? 281 ALA B CB  1 
ATOM   4941  N N   . GLY B 2 282 ? 12.114  -42.254 90.933  1.00 37.06  ? 282 GLY B N   1 
ATOM   4942  C CA  . GLY B 2 282 ? 13.420  -41.749 90.543  1.00 47.46  ? 282 GLY B CA  1 
ATOM   4943  C C   . GLY B 2 282 ? 14.470  -42.835 90.411  1.00 39.61  ? 282 GLY B C   1 
ATOM   4944  O O   . GLY B 2 282 ? 14.207  -43.998 90.701  1.00 41.44  ? 282 GLY B O   1 
ATOM   4945  N N   . TYR B 2 283 ? 15.664  -42.458 89.968  1.00 45.72  ? 283 TYR B N   1 
ATOM   4946  C CA  . TYR B 2 283 ? 16.752  -43.420 89.838  1.00 31.58  ? 283 TYR B CA  1 
ATOM   4947  C C   . TYR B 2 283 ? 17.458  -43.663 91.165  1.00 39.29  ? 283 TYR B C   1 
ATOM   4948  O O   . TYR B 2 283 ? 17.806  -42.723 91.883  1.00 32.33  ? 283 TYR B O   1 
ATOM   4949  C CB  . TYR B 2 283 ? 17.759  -42.954 88.785  1.00 23.98  ? 283 TYR B CB  1 
ATOM   4950  C CG  . TYR B 2 283 ? 17.282  -43.179 87.371  1.00 40.91  ? 283 TYR B CG  1 
ATOM   4951  C CD1 . TYR B 2 283 ? 17.232  -44.457 86.833  1.00 36.96  ? 283 TYR B CD1 1 
ATOM   4952  C CD2 . TYR B 2 283 ? 16.878  -42.116 86.575  1.00 29.52  ? 283 TYR B CD2 1 
ATOM   4953  C CE1 . TYR B 2 283 ? 16.793  -44.671 85.544  1.00 39.69  ? 283 TYR B CE1 1 
ATOM   4954  C CE2 . TYR B 2 283 ? 16.439  -42.320 85.285  1.00 32.14  ? 283 TYR B CE2 1 
ATOM   4955  C CZ  . TYR B 2 283 ? 16.398  -43.599 84.774  1.00 42.93  ? 283 TYR B CZ  1 
ATOM   4956  O OH  . TYR B 2 283 ? 15.960  -43.806 83.488  1.00 55.19  ? 283 TYR B OH  1 
ATOM   4957  N N   . LEU B 2 284 ? 17.667  -44.934 91.484  1.00 44.41  ? 284 LEU B N   1 
ATOM   4958  C CA  . LEU B 2 284 ? 18.426  -45.313 92.666  1.00 29.18  ? 284 LEU B CA  1 
ATOM   4959  C C   . LEU B 2 284 ? 19.452  -46.370 92.295  1.00 37.14  ? 284 LEU B C   1 
ATOM   4960  O O   . LEU B 2 284 ? 19.328  -47.033 91.265  1.00 41.09  ? 284 LEU B O   1 
ATOM   4961  C CB  . LEU B 2 284 ? 17.504  -45.841 93.766  1.00 40.72  ? 284 LEU B CB  1 
ATOM   4962  C CG  . LEU B 2 284 ? 16.488  -44.878 94.381  1.00 42.75  ? 284 LEU B CG  1 
ATOM   4963  C CD1 . LEU B 2 284 ? 15.579  -45.625 95.342  1.00 49.44  ? 284 LEU B CD1 1 
ATOM   4964  C CD2 . LEU B 2 284 ? 17.187  -43.728 95.089  1.00 33.32  ? 284 LEU B CD2 1 
ATOM   4965  N N   . ASN B 2 285 ? 20.469  -46.525 93.132  1.00 36.09  ? 285 ASN B N   1 
ATOM   4966  C CA  . ASN B 2 285 ? 21.431  -47.594 92.930  1.00 40.96  ? 285 ASN B CA  1 
ATOM   4967  C C   . ASN B 2 285 ? 21.109  -48.776 93.829  1.00 37.60  ? 285 ASN B C   1 
ATOM   4968  O O   . ASN B 2 285 ? 21.124  -48.663 95.054  1.00 46.43  ? 285 ASN B O   1 
ATOM   4969  C CB  . ASN B 2 285 ? 22.854  -47.100 93.186  1.00 42.96  ? 285 ASN B CB  1 
ATOM   4970  C CG  . ASN B 2 285 ? 23.338  -46.146 92.113  1.00 42.89  ? 285 ASN B CG  1 
ATOM   4971  O OD1 . ASN B 2 285 ? 22.924  -46.231 90.956  1.00 32.57  ? 285 ASN B OD1 1 
ATOM   4972  N ND2 . ASN B 2 285 ? 24.220  -45.229 92.492  1.00 46.39  ? 285 ASN B ND2 1 
ATOM   4973  N N   . LEU B 2 286 ? 20.822  -49.911 93.205  1.00 40.56  ? 286 LEU B N   1 
ATOM   4974  C CA  . LEU B 2 286 ? 20.496  -51.127 93.930  1.00 43.25  ? 286 LEU B CA  1 
ATOM   4975  C C   . LEU B 2 286 ? 21.739  -51.972 94.118  1.00 41.07  ? 286 LEU B C   1 
ATOM   4976  O O   . LEU B 2 286 ? 22.434  -52.295 93.154  1.00 41.40  ? 286 LEU B O   1 
ATOM   4977  C CB  . LEU B 2 286 ? 19.421  -51.928 93.196  1.00 44.24  ? 286 LEU B CB  1 
ATOM   4978  C CG  . LEU B 2 286 ? 18.991  -53.236 93.864  1.00 26.33  ? 286 LEU B CG  1 
ATOM   4979  C CD1 . LEU B 2 286 ? 18.599  -53.015 95.316  1.00 44.41  ? 286 LEU B CD1 1 
ATOM   4980  C CD2 . LEU B 2 286 ? 17.853  -53.881 93.091  1.00 39.20  ? 286 LEU B CD2 1 
ATOM   4981  N N   . ARG B 2 287 ? 22.018  -52.325 95.366  1.00 40.94  ? 287 ARG B N   1 
ATOM   4982  C CA  . ARG B 2 287 ? 23.156  -53.175 95.655  1.00 41.93  ? 287 ARG B CA  1 
ATOM   4983  C C   . ARG B 2 287 ? 22.779  -54.639 95.516  1.00 46.42  ? 287 ARG B C   1 
ATOM   4984  O O   . ARG B 2 287 ? 21.735  -55.077 96.003  1.00 61.60  ? 287 ARG B O   1 
ATOM   4985  C CB  . ARG B 2 287 ? 23.698  -52.913 97.060  1.00 42.10  ? 287 ARG B CB  1 
ATOM   4986  C CG  . ARG B 2 287 ? 25.045  -53.572 97.313  1.00 48.81  ? 287 ARG B CG  1 
ATOM   4987  C CD  . ARG B 2 287 ? 25.469  -53.459 98.764  1.00 50.26  ? 287 ARG B CD  1 
ATOM   4988  N NE  . ARG B 2 287 ? 24.893  -54.522 99.581  1.00 63.11  ? 287 ARG B NE  1 
ATOM   4989  C CZ  . ARG B 2 287 ? 25.599  -55.298 100.396 1.00 65.25  ? 287 ARG B CZ  1 
ATOM   4990  N NH1 . ARG B 2 287 ? 26.910  -55.129 100.502 1.00 46.48  ? 287 ARG B NH1 1 
ATOM   4991  N NH2 . ARG B 2 287 ? 24.996  -56.243 101.104 1.00 69.59  ? 287 ARG B NH2 1 
ATOM   4992  N N   . ASN B 2 288 ? 23.641  -55.386 94.841  1.00 55.31  ? 288 ASN B N   1 
ATOM   4993  C CA  . ASN B 2 288 ? 23.494  -56.822 94.739  1.00 57.19  ? 288 ASN B CA  1 
ATOM   4994  C C   . ASN B 2 288 ? 24.752  -57.508 95.254  1.00 66.35  ? 288 ASN B C   1 
ATOM   4995  O O   . ASN B 2 288 ? 25.846  -57.348 94.696  1.00 74.90  ? 288 ASN B O   1 
ATOM   4996  C CB  . ASN B 2 288 ? 23.218  -57.229 93.289  1.00 64.01  ? 288 ASN B CB  1 
ATOM   4997  C CG  . ASN B 2 288 ? 22.840  -58.691 93.150  1.00 73.47  ? 288 ASN B CG  1 
ATOM   4998  O OD1 . ASN B 2 288 ? 23.704  -59.568 93.124  1.00 67.68  ? 288 ASN B OD1 1 
ATOM   4999  N ND2 . ASN B 2 288 ? 21.543  -58.960 93.051  1.00 89.46  ? 288 ASN B ND2 1 
ATOM   5000  N N   . LYS B 2 289 ? 24.579  -58.240 96.351  1.00 51.24  ? 289 LYS B N   1 
ATOM   5001  C CA  . LYS B 2 289 ? 25.640  -59.008 96.990  1.00 69.09  ? 289 LYS B CA  1 
ATOM   5002  C C   . LYS B 2 289 ? 25.273  -60.492 96.974  1.00 74.65  ? 289 LYS B C   1 
ATOM   5003  O O   . LYS B 2 289 ? 24.391  -60.907 97.735  1.00 79.28  ? 289 LYS B O   1 
ATOM   5004  C CB  . LYS B 2 289 ? 25.821  -58.529 98.430  1.00 75.92  ? 289 LYS B CB  1 
ATOM   5005  C CG  . LYS B 2 289 ? 26.737  -59.375 99.281  1.00 60.90  ? 289 LYS B CG  1 
ATOM   5006  C CD  . LYS B 2 289 ? 28.074  -58.716 99.464  1.00 77.50  ? 289 LYS B CD  1 
ATOM   5007  C CE  . LYS B 2 289 ? 28.716  -59.257 100.715 1.00 68.75  ? 289 LYS B CE  1 
ATOM   5008  N NZ  . LYS B 2 289 ? 29.746  -58.340 101.254 1.00 50.44  ? 289 LYS B NZ  1 
ATOM   5009  N N   . THR B 2 290 ? 25.907  -61.292 96.117  1.00 84.94  ? 290 THR B N   1 
ATOM   5010  C CA  . THR B 2 290 ? 25.631  -62.732 96.120  1.00 95.14  ? 290 THR B CA  1 
ATOM   5011  C C   . THR B 2 290 ? 26.694  -63.568 96.852  1.00 98.17  ? 290 THR B C   1 
ATOM   5012  O O   . THR B 2 290 ? 26.491  -64.778 97.044  1.00 99.15  ? 290 THR B O   1 
ATOM   5013  C CB  . THR B 2 290 ? 25.472  -63.285 94.691  1.00 102.40 ? 290 THR B CB  1 
ATOM   5014  O OG1 . THR B 2 290 ? 26.626  -62.950 93.919  1.00 99.00  ? 290 THR B OG1 1 
ATOM   5015  C CG2 . THR B 2 290 ? 24.197  -62.734 94.033  1.00 91.16  ? 290 THR B CG2 1 
ATOM   5016  N N   . GLY B 2 291 ? 27.830  -62.962 97.212  1.00 88.51  ? 291 GLY B N   1 
ATOM   5017  C CA  . GLY B 2 291 ? 28.806  -63.673 98.024  1.00 80.61  ? 291 GLY B CA  1 
ATOM   5018  C C   . GLY B 2 291 ? 28.944  -63.105 99.426  1.00 83.00  ? 291 GLY B C   1 
ATOM   5019  O O   . GLY B 2 291 ? 28.048  -62.412 99.903  1.00 75.89  ? 291 GLY B O   1 
ATOM   5020  N N   . LEU B 2 292 ? 30.075  -63.363 100.079 1.00 85.04  ? 292 LEU B N   1 
ATOM   5021  C CA  . LEU B 2 292 ? 30.352  -62.722 101.360 1.00 72.70  ? 292 LEU B CA  1 
ATOM   5022  C C   . LEU B 2 292 ? 31.260  -61.515 101.177 1.00 73.02  ? 292 LEU B C   1 
ATOM   5023  O O   . LEU B 2 292 ? 31.504  -60.755 102.116 1.00 61.45  ? 292 LEU B O   1 
ATOM   5024  C CB  . LEU B 2 292 ? 30.996  -63.709 102.340 1.00 63.43  ? 292 LEU B CB  1 
ATOM   5025  C CG  . LEU B 2 292 ? 30.227  -64.950 102.805 1.00 79.35  ? 292 LEU B CG  1 
ATOM   5026  C CD1 . LEU B 2 292 ? 31.076  -65.748 103.786 1.00 57.99  ? 292 LEU B CD1 1 
ATOM   5027  C CD2 . LEU B 2 292 ? 28.890  -64.582 103.433 1.00 74.95  ? 292 LEU B CD2 1 
ATOM   5028  N N   . VAL B 2 293 ? 31.743  -61.339 99.953  1.00 72.91  ? 293 VAL B N   1 
ATOM   5029  C CA  . VAL B 2 293 ? 32.718  -60.305 99.647  1.00 66.09  ? 293 VAL B CA  1 
ATOM   5030  C C   . VAL B 2 293 ? 32.282  -59.449 98.463  1.00 66.47  ? 293 VAL B C   1 
ATOM   5031  O O   . VAL B 2 293 ? 32.095  -58.239 98.592  1.00 63.42  ? 293 VAL B O   1 
ATOM   5032  C CB  . VAL B 2 293 ? 34.100  -60.916 99.349  1.00 53.29  ? 293 VAL B CB  1 
ATOM   5033  C CG1 . VAL B 2 293 ? 35.061  -59.837 98.882  1.00 46.46  ? 293 VAL B CG1 1 
ATOM   5034  C CG2 . VAL B 2 293 ? 34.644  -61.621 100.582 1.00 60.52  ? 293 VAL B CG2 1 
ATOM   5035  N N   . THR B 2 294 ? 32.119  -60.091 97.309  1.00 73.33  ? 294 THR B N   1 
ATOM   5036  C CA  . THR B 2 294 ? 31.947  -59.376 96.049  1.00 71.70  ? 294 THR B CA  1 
ATOM   5037  C C   . THR B 2 294 ? 30.570  -58.721 95.973  1.00 75.67  ? 294 THR B C   1 
ATOM   5038  O O   . THR B 2 294 ? 29.554  -59.339 96.293  1.00 66.98  ? 294 THR B O   1 
ATOM   5039  C CB  . THR B 2 294 ? 32.142  -60.326 94.843  1.00 71.92  ? 294 THR B CB  1 
ATOM   5040  O OG1 . THR B 2 294 ? 33.536  -60.607 94.674  1.00 85.86  ? 294 THR B OG1 1 
ATOM   5041  C CG2 . THR B 2 294 ? 31.594  -59.712 93.561  1.00 73.19  ? 294 THR B CG2 1 
ATOM   5042  N N   . THR B 2 295 ? 30.552  -57.462 95.544  1.00 73.85  ? 295 THR B N   1 
ATOM   5043  C CA  . THR B 2 295 ? 29.331  -56.667 95.508  1.00 71.13  ? 295 THR B CA  1 
ATOM   5044  C C   . THR B 2 295 ? 29.239  -55.829 94.234  1.00 68.49  ? 295 THR B C   1 
ATOM   5045  O O   . THR B 2 295 ? 30.254  -55.379 93.697  1.00 72.58  ? 295 THR B O   1 
ATOM   5046  C CB  . THR B 2 295 ? 29.234  -55.742 96.740  1.00 66.37  ? 295 THR B CB  1 
ATOM   5047  O OG1 . THR B 2 295 ? 27.962  -55.084 96.750  1.00 64.94  ? 295 THR B OG1 1 
ATOM   5048  C CG2 . THR B 2 295 ? 30.343  -54.699 96.718  1.00 73.12  ? 295 THR B CG2 1 
ATOM   5049  N N   . THR B 2 296 ? 28.019  -55.645 93.737  1.00 67.00  ? 296 THR B N   1 
ATOM   5050  C CA  . THR B 2 296 ? 27.787  -54.791 92.575  1.00 60.72  ? 296 THR B CA  1 
ATOM   5051  C C   . THR B 2 296 ? 26.688  -53.771 92.848  1.00 51.32  ? 296 THR B C   1 
ATOM   5052  O O   . THR B 2 296 ? 25.841  -53.981 93.705  1.00 47.30  ? 296 THR B O   1 
ATOM   5053  C CB  . THR B 2 296 ? 27.396  -55.612 91.328  1.00 56.90  ? 296 THR B CB  1 
ATOM   5054  O OG1 . THR B 2 296 ? 26.085  -56.162 91.506  1.00 68.65  ? 296 THR B OG1 1 
ATOM   5055  C CG2 . THR B 2 296 ? 28.388  -56.738 91.089  1.00 62.06  ? 296 THR B CG2 1 
ATOM   5056  N N   . TRP B 2 297 ? 26.716  -52.658 92.125  1.00 54.51  ? 297 TRP B N   1 
ATOM   5057  C CA  . TRP B 2 297 ? 25.650  -51.668 92.214  1.00 39.04  ? 297 TRP B CA  1 
ATOM   5058  C C   . TRP B 2 297 ? 25.067  -51.430 90.826  1.00 44.66  ? 297 TRP B C   1 
ATOM   5059  O O   . TRP B 2 297 ? 25.803  -51.352 89.843  1.00 61.52  ? 297 TRP B O   1 
ATOM   5060  C CB  . TRP B 2 297 ? 26.161  -50.355 92.815  1.00 43.06  ? 297 TRP B CB  1 
ATOM   5061  C CG  . TRP B 2 297 ? 26.628  -50.469 94.241  1.00 50.53  ? 297 TRP B CG  1 
ATOM   5062  C CD1 . TRP B 2 297 ? 27.842  -50.919 94.673  1.00 45.05  ? 297 TRP B CD1 1 
ATOM   5063  C CD2 . TRP B 2 297 ? 25.886  -50.119 95.421  1.00 63.67  ? 297 TRP B CD2 1 
ATOM   5064  N NE1 . TRP B 2 297 ? 27.902  -50.873 96.045  1.00 50.88  ? 297 TRP B NE1 1 
ATOM   5065  C CE2 . TRP B 2 297 ? 26.721  -50.388 96.526  1.00 46.65  ? 297 TRP B CE2 1 
ATOM   5066  C CE3 . TRP B 2 297 ? 24.606  -49.609 95.645  1.00 50.34  ? 297 TRP B CE3 1 
ATOM   5067  C CZ2 . TRP B 2 297 ? 26.306  -50.159 97.840  1.00 40.14  ? 297 TRP B CZ2 1 
ATOM   5068  C CZ3 . TRP B 2 297 ? 24.200  -49.384 96.949  1.00 41.48  ? 297 TRP B CZ3 1 
ATOM   5069  C CH2 . TRP B 2 297 ? 25.048  -49.660 98.030  1.00 50.32  ? 297 TRP B CH2 1 
ATOM   5070  N N   . GLU B 2 298 ? 23.746  -51.315 90.748  1.00 48.87  ? 298 GLU B N   1 
ATOM   5071  C CA  . GLU B 2 298 ? 23.067  -51.158 89.466  1.00 36.88  ? 298 GLU B CA  1 
ATOM   5072  C C   . GLU B 2 298 ? 22.076  -50.004 89.505  1.00 49.15  ? 298 GLU B C   1 
ATOM   5073  O O   . GLU B 2 298 ? 21.182  -49.977 90.349  1.00 57.28  ? 298 GLU B O   1 
ATOM   5074  C CB  . GLU B 2 298 ? 22.338  -52.448 89.081  1.00 47.33  ? 298 GLU B CB  1 
ATOM   5075  C CG  . GLU B 2 298 ? 22.299  -52.729 87.587  1.00 72.75  ? 298 GLU B CG  1 
ATOM   5076  C CD  . GLU B 2 298 ? 21.215  -53.723 87.212  1.00 90.11  ? 298 GLU B CD  1 
ATOM   5077  O OE1 . GLU B 2 298 ? 20.757  -54.468 88.104  1.00 72.82  ? 298 GLU B OE1 1 
ATOM   5078  O OE2 . GLU B 2 298 ? 20.820  -53.758 86.027  1.00 83.02  ? 298 GLU B OE2 1 
ATOM   5079  N N   . ARG B 2 299 ? 22.223  -49.057 88.585  1.00 47.04  ? 299 ARG B N   1 
ATOM   5080  C CA  . ARG B 2 299 ? 21.312  -47.922 88.544  1.00 41.46  ? 299 ARG B CA  1 
ATOM   5081  C C   . ARG B 2 299 ? 20.002  -48.338 87.891  1.00 41.60  ? 299 ARG B C   1 
ATOM   5082  O O   . ARG B 2 299 ? 19.971  -48.738 86.728  1.00 41.58  ? 299 ARG B O   1 
ATOM   5083  C CB  . ARG B 2 299 ? 21.936  -46.747 87.790  1.00 26.64  ? 299 ARG B CB  1 
ATOM   5084  C CG  . ARG B 2 299 ? 21.099  -45.479 87.832  1.00 27.60  ? 299 ARG B CG  1 
ATOM   5085  C CD  . ARG B 2 299 ? 21.977  -44.242 87.891  1.00 44.10  ? 299 ARG B CD  1 
ATOM   5086  N NE  . ARG B 2 299 ? 21.194  -43.009 87.882  1.00 43.02  ? 299 ARG B NE  1 
ATOM   5087  C CZ  . ARG B 2 299 ? 20.719  -42.430 86.785  1.00 41.95  ? 299 ARG B CZ  1 
ATOM   5088  N NH1 . ARG B 2 299 ? 20.946  -42.970 85.594  1.00 56.46  ? 299 ARG B NH1 1 
ATOM   5089  N NH2 . ARG B 2 299 ? 20.017  -41.309 86.877  1.00 45.92  ? 299 ARG B NH2 1 
ATOM   5090  N N   . LEU B 2 300 ? 18.921  -48.242 88.656  1.00 46.30  ? 300 LEU B N   1 
ATOM   5091  C CA  . LEU B 2 300 ? 17.608  -48.670 88.196  1.00 33.80  ? 300 LEU B CA  1 
ATOM   5092  C C   . LEU B 2 300 ? 16.562  -47.621 88.540  1.00 39.80  ? 300 LEU B C   1 
ATOM   5093  O O   . LEU B 2 300 ? 16.773  -46.788 89.424  1.00 41.26  ? 300 LEU B O   1 
ATOM   5094  C CB  . LEU B 2 300 ? 17.232  -50.016 88.824  1.00 31.91  ? 300 LEU B CB  1 
ATOM   5095  C CG  . LEU B 2 300 ? 18.249  -51.149 88.653  1.00 56.17  ? 300 LEU B CG  1 
ATOM   5096  C CD1 . LEU B 2 300 ? 17.853  -52.379 89.451  1.00 61.21  ? 300 LEU B CD1 1 
ATOM   5097  C CD2 . LEU B 2 300 ? 18.408  -51.502 87.187  1.00 53.49  ? 300 LEU B CD2 1 
ATOM   5098  N N   . TYR B 2 301 ? 15.434  -47.661 87.839  1.00 47.66  ? 301 TYR B N   1 
ATOM   5099  C CA  . TYR B 2 301 ? 14.321  -46.776 88.153  1.00 43.52  ? 301 TYR B CA  1 
ATOM   5100  C C   . TYR B 2 301 ? 13.453  -47.401 89.232  1.00 43.68  ? 301 TYR B C   1 
ATOM   5101  O O   . TYR B 2 301 ? 13.138  -48.584 89.178  1.00 48.02  ? 301 TYR B O   1 
ATOM   5102  C CB  . TYR B 2 301 ? 13.492  -46.485 86.905  1.00 38.23  ? 301 TYR B CB  1 
ATOM   5103  C CG  . TYR B 2 301 ? 12.670  -45.219 86.975  1.00 36.92  ? 301 TYR B CG  1 
ATOM   5104  C CD1 . TYR B 2 301 ? 13.276  -43.970 86.947  1.00 41.56  ? 301 TYR B CD1 1 
ATOM   5105  C CD2 . TYR B 2 301 ? 11.285  -45.274 87.045  1.00 32.03  ? 301 TYR B CD2 1 
ATOM   5106  C CE1 . TYR B 2 301 ? 12.523  -42.811 87.004  1.00 45.26  ? 301 TYR B CE1 1 
ATOM   5107  C CE2 . TYR B 2 301 ? 10.525  -44.123 87.101  1.00 33.13  ? 301 TYR B CE2 1 
ATOM   5108  C CZ  . TYR B 2 301 ? 11.149  -42.894 87.081  1.00 38.58  ? 301 TYR B CZ  1 
ATOM   5109  O OH  . TYR B 2 301 ? 10.394  -41.745 87.136  1.00 52.80  ? 301 TYR B OH  1 
ATOM   5110  N N   . PHE B 2 302 ? 13.083  -46.603 90.223  1.00 37.19  ? 302 PHE B N   1 
ATOM   5111  C CA  . PHE B 2 302 ? 12.241  -47.078 91.309  1.00 55.42  ? 302 PHE B CA  1 
ATOM   5112  C C   . PHE B 2 302 ? 11.035  -46.172 91.453  1.00 54.51  ? 302 PHE B C   1 
ATOM   5113  O O   . PHE B 2 302 ? 11.173  -44.949 91.468  1.00 38.91  ? 302 PHE B O   1 
ATOM   5114  C CB  . PHE B 2 302 ? 13.022  -47.127 92.624  1.00 48.23  ? 302 PHE B CB  1 
ATOM   5115  C CG  . PHE B 2 302 ? 14.019  -48.244 92.695  1.00 39.23  ? 302 PHE B CG  1 
ATOM   5116  C CD1 . PHE B 2 302 ? 15.306  -48.068 92.218  1.00 46.23  ? 302 PHE B CD1 1 
ATOM   5117  C CD2 . PHE B 2 302 ? 13.672  -49.468 93.239  1.00 45.05  ? 302 PHE B CD2 1 
ATOM   5118  C CE1 . PHE B 2 302 ? 16.230  -49.092 92.282  1.00 52.36  ? 302 PHE B CE1 1 
ATOM   5119  C CE2 . PHE B 2 302 ? 14.591  -50.496 93.306  1.00 43.76  ? 302 PHE B CE2 1 
ATOM   5120  C CZ  . PHE B 2 302 ? 15.871  -50.309 92.824  1.00 52.52  ? 302 PHE B CZ  1 
ATOM   5121  N N   . PHE B 2 303 ? 9.850   -46.762 91.554  1.00 52.65  ? 303 PHE B N   1 
ATOM   5122  C CA  . PHE B 2 303 ? 8.666   -45.950 91.791  1.00 47.55  ? 303 PHE B CA  1 
ATOM   5123  C C   . PHE B 2 303 ? 7.681   -46.638 92.720  1.00 58.93  ? 303 PHE B C   1 
ATOM   5124  O O   . PHE B 2 303 ? 7.548   -47.861 92.717  1.00 55.32  ? 303 PHE B O   1 
ATOM   5125  C CB  . PHE B 2 303 ? 7.977   -45.591 90.468  1.00 47.68  ? 303 PHE B CB  1 
ATOM   5126  C CG  . PHE B 2 303 ? 7.635   -46.777 89.605  1.00 64.56  ? 303 PHE B CG  1 
ATOM   5127  C CD1 . PHE B 2 303 ? 8.585   -47.344 88.769  1.00 59.28  ? 303 PHE B CD1 1 
ATOM   5128  C CD2 . PHE B 2 303 ? 6.356   -47.312 89.614  1.00 50.27  ? 303 PHE B CD2 1 
ATOM   5129  C CE1 . PHE B 2 303 ? 8.270   -48.429 87.969  1.00 54.24  ? 303 PHE B CE1 1 
ATOM   5130  C CE2 . PHE B 2 303 ? 6.034   -48.395 88.816  1.00 60.49  ? 303 PHE B CE2 1 
ATOM   5131  C CZ  . PHE B 2 303 ? 6.994   -48.954 87.993  1.00 53.97  ? 303 PHE B CZ  1 
ATOM   5132  N N   . THR B 2 304 ? 6.988   -45.833 93.516  1.00 59.18  ? 304 THR B N   1 
ATOM   5133  C CA  . THR B 2 304 ? 5.951   -46.344 94.395  1.00 56.29  ? 304 THR B CA  1 
ATOM   5134  C C   . THR B 2 304 ? 4.596   -46.309 93.713  1.00 60.22  ? 304 THR B C   1 
ATOM   5135  O O   . THR B 2 304 ? 4.206   -45.308 93.108  1.00 75.09  ? 304 THR B O   1 
ATOM   5136  C CB  . THR B 2 304 ? 5.868   -45.559 95.715  1.00 62.85  ? 304 THR B CB  1 
ATOM   5137  O OG1 . THR B 2 304 ? 5.444   -44.218 95.448  1.00 50.03  ? 304 THR B OG1 1 
ATOM   5138  C CG2 . THR B 2 304 ? 7.216   -45.535 96.410  1.00 63.20  ? 304 THR B CG2 1 
ATOM   5139  N N   . GLN B 2 305 ? 3.884   -47.419 93.828  1.00 72.68  ? 305 GLN B N   1 
ATOM   5140  C CA  . GLN B 2 305 ? 2.533   -47.540 93.315  1.00 86.19  ? 305 GLN B CA  1 
ATOM   5141  C C   . GLN B 2 305 ? 1.705   -48.204 94.401  1.00 82.52  ? 305 GLN B C   1 
ATOM   5142  O O   . GLN B 2 305 ? 1.927   -49.368 94.737  1.00 81.59  ? 305 GLN B O   1 
ATOM   5143  C CB  . GLN B 2 305 ? 2.527   -48.347 92.017  1.00 73.90  ? 305 GLN B CB  1 
ATOM   5144  C CG  . GLN B 2 305 ? 1.182   -48.902 91.600  1.00 88.67  ? 305 GLN B CG  1 
ATOM   5145  C CD  . GLN B 2 305 ? 1.326   -50.077 90.653  1.00 101.30 ? 305 GLN B CD  1 
ATOM   5146  O OE1 . GLN B 2 305 ? 1.922   -49.954 89.582  1.00 94.08  ? 305 GLN B OE1 1 
ATOM   5147  N NE2 . GLN B 2 305 ? 0.786   -51.226 91.045  1.00 102.97 ? 305 GLN B NE2 1 
ATOM   5148  N N   . GLY B 2 306 ? 0.732   -47.470 94.929  1.00 80.99  ? 306 GLY B N   1 
ATOM   5149  C CA  . GLY B 2 306 ? -0.045  -47.961 96.049  1.00 83.28  ? 306 GLY B CA  1 
ATOM   5150  C C   . GLY B 2 306 ? 0.859   -48.111 97.258  1.00 84.07  ? 306 GLY B C   1 
ATOM   5151  O O   . GLY B 2 306 ? 1.492   -47.149 97.694  1.00 71.45  ? 306 GLY B O   1 
ATOM   5152  N N   . GLY B 2 307 ? 0.907   -49.318 97.808  1.00 87.84  ? 307 GLY B N   1 
ATOM   5153  C CA  . GLY B 2 307 ? 1.760   -49.604 98.947  1.00 84.54  ? 307 GLY B CA  1 
ATOM   5154  C C   . GLY B 2 307 ? 2.980   -50.417 98.554  1.00 84.05  ? 307 GLY B C   1 
ATOM   5155  O O   . GLY B 2 307 ? 3.635   -51.019 99.405  1.00 81.58  ? 307 GLY B O   1 
ATOM   5156  N N   . ASN B 2 308 ? 3.286   -50.436 97.260  1.00 73.53  ? 308 ASN B N   1 
ATOM   5157  C CA  . ASN B 2 308 ? 4.399   -51.231 96.749  1.00 77.43  ? 308 ASN B CA  1 
ATOM   5158  C C   . ASN B 2 308 ? 5.548   -50.450 96.111  1.00 73.65  ? 308 ASN B C   1 
ATOM   5159  O O   . ASN B 2 308 ? 5.344   -49.417 95.472  1.00 71.60  ? 308 ASN B O   1 
ATOM   5160  C CB  . ASN B 2 308 ? 3.874   -52.242 95.730  1.00 76.53  ? 308 ASN B CB  1 
ATOM   5161  C CG  . ASN B 2 308 ? 3.073   -53.356 96.370  1.00 79.47  ? 308 ASN B CG  1 
ATOM   5162  O OD1 . ASN B 2 308 ? 2.644   -53.250 97.518  1.00 91.41  ? 308 ASN B OD1 1 
ATOM   5163  N ND2 . ASN B 2 308 ? 2.873   -54.440 95.629  1.00 72.16  ? 308 ASN B ND2 1 
ATOM   5164  N N   . LEU B 2 309 ? 6.757   -50.973 96.297  1.00 75.98  ? 309 LEU B N   1 
ATOM   5165  C CA  . LEU B 2 309 ? 7.962   -50.455 95.658  1.00 69.89  ? 309 LEU B CA  1 
ATOM   5166  C C   . LEU B 2 309 ? 8.318   -51.276 94.422  1.00 59.17  ? 309 LEU B C   1 
ATOM   5167  O O   . LEU B 2 309 ? 8.609   -52.482 94.516  1.00 59.99  ? 309 LEU B O   1 
ATOM   5168  C CB  . LEU B 2 309 ? 9.140   -50.447 96.631  1.00 70.15  ? 309 LEU B CB  1 
ATOM   5169  C CG  . LEU B 2 309 ? 10.394  -49.727 96.128  1.00 61.21  ? 309 LEU B CG  1 
ATOM   5170  C CD1 . LEU B 2 309 ? 10.092  -48.270 95.814  1.00 56.68  ? 309 LEU B CD1 1 
ATOM   5171  C CD2 . LEU B 2 309 ? 11.524  -49.838 97.135  1.00 53.21  ? 309 LEU B CD2 1 
ATOM   5172  N N   . MET B 2 310 ? 8.301   -50.591 93.280  1.00 53.07  ? 310 MET B N   1 
ATOM   5173  C CA  . MET B 2 310 ? 8.494   -51.182 91.960  1.00 52.07  ? 310 MET B CA  1 
ATOM   5174  C C   . MET B 2 310 ? 9.845   -50.797 91.358  1.00 51.23  ? 310 MET B C   1 
ATOM   5175  O O   . MET B 2 310 ? 10.305  -49.662 91.524  1.00 51.67  ? 310 MET B O   1 
ATOM   5176  C CB  . MET B 2 310 ? 7.375   -50.736 91.018  1.00 68.29  ? 310 MET B CB  1 
ATOM   5177  C CG  . MET B 2 310 ? 5.970   -51.112 91.462  1.00 64.81  ? 310 MET B CG  1 
ATOM   5178  S SD  . MET B 2 310 ? 5.600   -52.858 91.229  1.00 78.02  ? 310 MET B SD  1 
ATOM   5179  C CE  . MET B 2 310 ? 4.005   -52.978 92.030  1.00 90.24  ? 310 MET B CE  1 
ATOM   5180  N N   . CYS B 2 311 ? 10.464  -51.731 90.639  1.00 58.78  ? 311 CYS B N   1 
ATOM   5181  C CA  . CYS B 2 311 ? 11.775  -51.492 90.040  1.00 56.87  ? 311 CYS B CA  1 
ATOM   5182  C C   . CYS B 2 311 ? 11.847  -51.842 88.548  1.00 65.25  ? 311 CYS B C   1 
ATOM   5183  O O   . CYS B 2 311 ? 11.678  -52.997 88.157  1.00 74.89  ? 311 CYS B O   1 
ATOM   5184  C CB  . CYS B 2 311 ? 12.839  -52.283 90.798  1.00 48.71  ? 311 CYS B CB  1 
ATOM   5185  S SG  . CYS B 2 311 ? 14.426  -52.368 89.956  1.00 100.40 ? 311 CYS B SG  1 
ATOM   5186  N N   . GLN B 2 312 ? 12.104  -50.826 87.729  1.00 55.57  ? 312 GLN B N   1 
ATOM   5187  C CA  . GLN B 2 312 ? 12.255  -50.974 86.283  1.00 61.69  ? 312 GLN B CA  1 
ATOM   5188  C C   . GLN B 2 312 ? 13.648  -50.565 85.798  1.00 55.17  ? 312 GLN B C   1 
ATOM   5189  O O   . GLN B 2 312 ? 14.046  -49.411 85.956  1.00 56.53  ? 312 GLN B O   1 
ATOM   5190  C CB  . GLN B 2 312 ? 11.194  -50.150 85.553  1.00 68.91  ? 312 GLN B CB  1 
ATOM   5191  C CG  . GLN B 2 312 ? 11.269  -50.243 84.038  1.00 62.59  ? 312 GLN B CG  1 
ATOM   5192  C CD  . GLN B 2 312 ? 10.158  -49.473 83.356  1.00 63.98  ? 312 GLN B CD  1 
ATOM   5193  O OE1 . GLN B 2 312 ? 9.471   -48.666 83.983  1.00 61.14  ? 312 GLN B OE1 1 
ATOM   5194  N NE2 . GLN B 2 312 ? 9.974   -49.718 82.064  1.00 76.11  ? 312 GLN B NE2 1 
ATOM   5195  N N   . PRO B 2 313 ? 14.404  -51.512 85.222  1.00 52.80  ? 313 PRO B N   1 
ATOM   5196  C CA  . PRO B 2 313 ? 15.682  -51.150 84.598  1.00 51.48  ? 313 PRO B CA  1 
ATOM   5197  C C   . PRO B 2 313 ? 15.475  -50.420 83.272  1.00 50.28  ? 313 PRO B C   1 
ATOM   5198  O O   . PRO B 2 313 ? 14.516  -50.716 82.560  1.00 55.40  ? 313 PRO B O   1 
ATOM   5199  C CB  . PRO B 2 313 ? 16.361  -52.504 84.378  1.00 38.68  ? 313 PRO B CB  1 
ATOM   5200  C CG  . PRO B 2 313 ? 15.231  -53.464 84.249  1.00 48.59  ? 313 PRO B CG  1 
ATOM   5201  C CD  . PRO B 2 313 ? 14.165  -52.966 85.188  1.00 55.77  ? 313 PRO B CD  1 
ATOM   5202  N N   . ARG B 2 314 ? 16.354  -49.474 82.952  1.00 56.97  ? 314 ARG B N   1 
ATOM   5203  C CA  . ARG B 2 314 ? 16.252  -48.734 81.698  1.00 64.44  ? 314 ARG B CA  1 
ATOM   5204  C C   . ARG B 2 314 ? 16.452  -49.654 80.498  1.00 70.99  ? 314 ARG B C   1 
ATOM   5205  O O   . ARG B 2 314 ? 17.421  -50.412 80.439  1.00 60.97  ? 314 ARG B O   1 
ATOM   5206  C CB  . ARG B 2 314 ? 17.273  -47.596 81.659  1.00 70.81  ? 314 ARG B CB  1 
ATOM   5207  C CG  . ARG B 2 314 ? 16.798  -46.359 80.914  1.00 78.07  ? 314 ARG B CG  1 
ATOM   5208  C CD  . ARG B 2 314 ? 17.672  -45.159 81.234  1.00 81.37  ? 314 ARG B CD  1 
ATOM   5209  N NE  . ARG B 2 314 ? 19.044  -45.343 80.774  1.00 82.50  ? 314 ARG B NE  1 
ATOM   5210  C CZ  . ARG B 2 314 ? 20.051  -44.533 81.083  1.00 73.30  ? 314 ARG B CZ  1 
ATOM   5211  N NH1 . ARG B 2 314 ? 19.842  -43.479 81.861  1.00 71.95  ? 314 ARG B NH1 1 
ATOM   5212  N NH2 . ARG B 2 314 ? 21.268  -44.778 80.618  1.00 50.36  ? 314 ARG B NH2 1 
ATOM   5213  N N   . GLY B 2 315 ? 15.532  -49.584 79.541  1.00 75.37  ? 315 GLY B N   1 
ATOM   5214  C CA  . GLY B 2 315 ? 15.570  -50.465 78.389  1.00 77.64  ? 315 GLY B CA  1 
ATOM   5215  C C   . GLY B 2 315 ? 14.578  -51.603 78.516  1.00 77.79  ? 315 GLY B C   1 
ATOM   5216  O O   . GLY B 2 315 ? 14.414  -52.404 77.595  1.00 103.37 ? 315 GLY B O   1 
ATOM   5217  N N   . ALA B 2 316 ? 13.911  -51.672 79.663  1.00 66.44  ? 316 ALA B N   1 
ATOM   5218  C CA  . ALA B 2 316 ? 12.907  -52.700 79.906  1.00 74.19  ? 316 ALA B CA  1 
ATOM   5219  C C   . ALA B 2 316 ? 11.510  -52.122 79.733  1.00 81.52  ? 316 ALA B C   1 
ATOM   5220  O O   . ALA B 2 316 ? 11.229  -51.008 80.174  1.00 78.65  ? 316 ALA B O   1 
ATOM   5221  C CB  . ALA B 2 316 ? 13.070  -53.294 81.294  1.00 76.30  ? 316 ALA B CB  1 
ATOM   5222  N N   . VAL B 2 317 ? 10.638  -52.888 79.087  1.00 83.30  ? 317 VAL B N   1 
ATOM   5223  C CA  . VAL B 2 317 ? 9.294   -52.421 78.780  1.00 80.83  ? 317 VAL B CA  1 
ATOM   5224  C C   . VAL B 2 317 ? 8.432   -52.285 80.031  1.00 85.26  ? 317 VAL B C   1 
ATOM   5225  O O   . VAL B 2 317 ? 7.623   -51.363 80.136  1.00 94.95  ? 317 VAL B O   1 
ATOM   5226  C CB  . VAL B 2 317 ? 8.591   -53.371 77.791  1.00 78.10  ? 317 VAL B CB  1 
ATOM   5227  C CG1 . VAL B 2 317 ? 7.413   -52.672 77.131  1.00 76.75  ? 317 VAL B CG1 1 
ATOM   5228  C CG2 . VAL B 2 317 ? 9.575   -53.861 76.740  1.00 75.75  ? 317 VAL B CG2 1 
ATOM   5229  N N   . ALA B 2 318 ? 8.605   -53.198 80.982  1.00 85.77  ? 318 ALA B N   1 
ATOM   5230  C CA  . ALA B 2 318 ? 7.786   -53.183 82.189  1.00 86.74  ? 318 ALA B CA  1 
ATOM   5231  C C   . ALA B 2 318 ? 8.624   -53.245 83.462  1.00 88.34  ? 318 ALA B C   1 
ATOM   5232  O O   . ALA B 2 318 ? 9.694   -53.856 83.485  1.00 83.54  ? 318 ALA B O   1 
ATOM   5233  C CB  . ALA B 2 318 ? 6.794   -54.336 82.159  1.00 86.24  ? 318 ALA B CB  1 
ATOM   5234  N N   . GLY B 2 319 ? 8.134   -52.604 84.519  1.00 79.70  ? 319 GLY B N   1 
ATOM   5235  C CA  . GLY B 2 319 ? 8.773   -52.694 85.818  1.00 81.87  ? 319 GLY B CA  1 
ATOM   5236  C C   . GLY B 2 319 ? 8.164   -53.790 86.669  1.00 86.75  ? 319 GLY B C   1 
ATOM   5237  O O   . GLY B 2 319 ? 6.979   -54.097 86.544  1.00 77.67  ? 319 GLY B O   1 
ATOM   5238  N N   . GLY B 2 320 ? 8.976   -54.378 87.541  1.00 87.44  ? 320 GLY B N   1 
ATOM   5239  C CA  . GLY B 2 320 ? 8.506   -55.409 88.448  1.00 75.25  ? 320 GLY B CA  1 
ATOM   5240  C C   . GLY B 2 320 ? 8.410   -54.921 89.880  1.00 80.20  ? 320 GLY B C   1 
ATOM   5241  O O   . GLY B 2 320 ? 8.899   -53.841 90.206  1.00 83.05  ? 320 GLY B O   1 
ATOM   5242  N N   . LEU B 2 321 ? 7.777   -55.717 90.737  1.00 77.76  ? 321 LEU B N   1 
ATOM   5243  C CA  . LEU B 2 321 ? 7.747   -55.423 92.164  1.00 66.23  ? 321 LEU B CA  1 
ATOM   5244  C C   . LEU B 2 321 ? 9.051   -55.833 92.826  1.00 61.16  ? 321 LEU B C   1 
ATOM   5245  O O   . LEU B 2 321 ? 9.391   -57.016 92.846  1.00 78.67  ? 321 LEU B O   1 
ATOM   5246  C CB  . LEU B 2 321 ? 6.573   -56.144 92.833  1.00 73.03  ? 321 LEU B CB  1 
ATOM   5247  C CG  . LEU B 2 321 ? 6.452   -55.998 94.352  1.00 70.79  ? 321 LEU B CG  1 
ATOM   5248  C CD1 . LEU B 2 321 ? 6.204   -54.561 94.729  1.00 63.11  ? 321 LEU B CD1 1 
ATOM   5249  C CD2 . LEU B 2 321 ? 5.349   -56.893 94.898  1.00 68.47  ? 321 LEU B CD2 1 
ATOM   5250  N N   . ILE B 2 322 ? 9.787   -54.868 93.370  1.00 57.36  ? 322 ILE B N   1 
ATOM   5251  C CA  . ILE B 2 322 ? 10.971  -55.216 94.141  1.00 73.68  ? 322 ILE B CA  1 
ATOM   5252  C C   . ILE B 2 322 ? 10.609  -55.513 95.599  1.00 72.62  ? 322 ILE B C   1 
ATOM   5253  O O   . ILE B 2 322 ? 11.145  -56.456 96.182  1.00 76.14  ? 322 ILE B O   1 
ATOM   5254  C CB  . ILE B 2 322 ? 12.077  -54.120 94.055  1.00 62.11  ? 322 ILE B CB  1 
ATOM   5255  C CG1 . ILE B 2 322 ? 13.391  -54.643 94.641  1.00 52.01  ? 322 ILE B CG1 1 
ATOM   5256  C CG2 . ILE B 2 322 ? 11.663  -52.829 94.737  1.00 67.98  ? 322 ILE B CG2 1 
ATOM   5257  C CD1 . ILE B 2 322 ? 13.921  -55.873 93.939  1.00 65.16  ? 322 ILE B CD1 1 
ATOM   5258  N N   . GLN B 2 323 ? 9.699   -54.737 96.191  1.00 64.52  ? 323 GLN B N   1 
ATOM   5259  C CA  . GLN B 2 323 ? 9.355   -54.995 97.594  1.00 60.49  ? 323 GLN B CA  1 
ATOM   5260  C C   . GLN B 2 323 ? 7.964   -54.490 97.977  1.00 70.58  ? 323 GLN B C   1 
ATOM   5261  O O   . GLN B 2 323 ? 7.506   -53.479 97.459  1.00 74.98  ? 323 GLN B O   1 
ATOM   5262  C CB  . GLN B 2 323 ? 10.418  -54.372 98.512  1.00 79.18  ? 323 GLN B CB  1 
ATOM   5263  C CG  . GLN B 2 323 ? 10.096  -54.417 100.000 1.00 55.84  ? 323 GLN B CG  1 
ATOM   5264  C CD  . GLN B 2 323 ? 10.283  -55.801 100.595 1.00 61.90  ? 323 GLN B CD  1 
ATOM   5265  O OE1 . GLN B 2 323 ? 11.298  -56.458 100.363 1.00 69.32  ? 323 GLN B OE1 1 
ATOM   5266  N NE2 . GLN B 2 323 ? 9.297   -56.253 101.362 1.00 68.82  ? 323 GLN B NE2 1 
ATOM   5267  N N   . ASP B 2 324 ? 7.302   -55.185 98.901  1.00 76.32  ? 324 ASP B N   1 
ATOM   5268  C CA  . ASP B 2 324 ? 6.044   -54.692 99.452  1.00 70.26  ? 324 ASP B CA  1 
ATOM   5269  C C   . ASP B 2 324 ? 6.388   -53.867 100.676 1.00 67.52  ? 324 ASP B C   1 
ATOM   5270  O O   . ASP B 2 324 ? 6.999   -54.359 101.619 1.00 67.82  ? 324 ASP B O   1 
ATOM   5271  C CB  . ASP B 2 324 ? 5.103   -55.850 99.809  1.00 82.76  ? 324 ASP B CB  1 
ATOM   5272  C CG  . ASP B 2 324 ? 3.793   -55.390 100.456 1.00 97.06  ? 324 ASP B CG  1 
ATOM   5273  O OD1 . ASP B 2 324 ? 3.662   -54.214 100.861 1.00 102.63 ? 324 ASP B OD1 1 
ATOM   5274  O OD2 . ASP B 2 324 ? 2.869   -56.225 100.550 1.00 97.41  ? 324 ASP B OD2 1 
ATOM   5275  N N   . LEU B 2 325 ? 5.984   -52.606 100.664 1.00 75.17  ? 325 LEU B N   1 
ATOM   5276  C CA  . LEU B 2 325 ? 6.462   -51.669 101.671 1.00 83.01  ? 325 LEU B CA  1 
ATOM   5277  C C   . LEU B 2 325 ? 5.568   -51.433 102.874 1.00 91.73  ? 325 LEU B C   1 
ATOM   5278  O O   . LEU B 2 325 ? 5.896   -50.603 103.713 1.00 87.15  ? 325 LEU B O   1 
ATOM   5279  C CB  . LEU B 2 325 ? 6.706   -50.300 101.032 1.00 68.92  ? 325 LEU B CB  1 
ATOM   5280  C CG  . LEU B 2 325 ? 7.775   -50.136 99.960  1.00 83.54  ? 325 LEU B CG  1 
ATOM   5281  C CD1 . LEU B 2 325 ? 7.730   -48.714 99.402  1.00 87.48  ? 325 LEU B CD1 1 
ATOM   5282  C CD2 . LEU B 2 325 ? 9.134   -50.456 100.535 1.00 71.28  ? 325 LEU B CD2 1 
ATOM   5283  N N   . ASP B 2 326 ? 4.448   -52.121 103.003 1.00 82.02  ? 326 ASP B N   1 
ATOM   5284  C CA  . ASP B 2 326 ? 3.504   -51.559 103.943 1.00 94.63  ? 326 ASP B CA  1 
ATOM   5285  C C   . ASP B 2 326 ? 3.736   -51.923 105.420 1.00 95.79  ? 326 ASP B C   1 
ATOM   5286  O O   . ASP B 2 326 ? 3.445   -51.098 106.312 1.00 78.70  ? 326 ASP B O   1 
ATOM   5287  C CB  . ASP B 2 326 ? 2.082   -51.921 103.532 1.00 99.35  ? 326 ASP B CB  1 
ATOM   5288  C CG  . ASP B 2 326 ? 1.116   -50.821 103.875 1.00 118.40 ? 326 ASP B CG  1 
ATOM   5289  O OD1 . ASP B 2 326 ? 1.528   -49.661 103.707 1.00 124.33 ? 326 ASP B OD1 1 
ATOM   5290  O OD2 . ASP B 2 326 ? -0.031  -51.095 104.277 1.00 130.52 ? 326 ASP B OD2 1 
ATOM   5291  N N   . ASN B 2 327 ? 4.138   -53.154 105.711 1.00 81.44  ? 327 ASN B N   1 
ATOM   5292  C CA  . ASN B 2 327 ? 4.657   -53.415 107.035 1.00 80.54  ? 327 ASN B CA  1 
ATOM   5293  C C   . ASN B 2 327 ? 6.178   -53.544 107.114 1.00 76.93  ? 327 ASN B C   1 
ATOM   5294  O O   . ASN B 2 327 ? 6.691   -54.209 108.012 1.00 68.97  ? 327 ASN B O   1 
ATOM   5295  C CB  . ASN B 2 327 ? 3.959   -54.610 107.654 1.00 96.09  ? 327 ASN B CB  1 
ATOM   5296  C CG  . ASN B 2 327 ? 3.020   -54.184 108.785 1.00 97.29  ? 327 ASN B CG  1 
ATOM   5297  O OD1 . ASN B 2 327 ? 3.463   -53.673 109.815 1.00 91.72  ? 327 ASN B OD1 1 
ATOM   5298  N ND2 . ASN B 2 327 ? 1.719   -54.348 108.572 1.00 101.77 ? 327 ASN B ND2 1 
ATOM   5299  N N   . CYS B 2 328 ? 6.893   -52.964 106.152 1.00 83.06  ? 328 CYS B N   1 
ATOM   5300  C CA  . CYS B 2 328 ? 8.351   -52.975 106.203 1.00 71.54  ? 328 CYS B CA  1 
ATOM   5301  C C   . CYS B 2 328 ? 8.834   -51.713 106.904 1.00 66.91  ? 328 CYS B C   1 
ATOM   5302  O O   . CYS B 2 328 ? 8.034   -50.858 107.283 1.00 65.75  ? 328 CYS B O   1 
ATOM   5303  C CB  . CYS B 2 328 ? 8.972   -53.035 104.802 1.00 56.64  ? 328 CYS B CB  1 
ATOM   5304  S SG  . CYS B 2 328 ? 8.966   -54.636 103.975 1.00 86.19  ? 328 CYS B SG  1 
ATOM   5305  N N   . SER B 2 329 ? 10.146  -51.606 107.086 1.00 53.50  ? 329 SER B N   1 
ATOM   5306  C CA  . SER B 2 329 ? 10.742  -50.403 107.657 1.00 51.71  ? 329 SER B CA  1 
ATOM   5307  C C   . SER B 2 329 ? 11.896  -49.923 106.782 1.00 63.47  ? 329 SER B C   1 
ATOM   5308  O O   . SER B 2 329 ? 12.443  -50.695 106.003 1.00 52.11  ? 329 SER B O   1 
ATOM   5309  C CB  . SER B 2 329 ? 11.219  -50.664 109.087 1.00 41.06  ? 329 SER B CB  1 
ATOM   5310  O OG  . SER B 2 329 ? 12.294  -49.808 109.432 1.00 68.76  ? 329 SER B OG  1 
ATOM   5311  N N   . VAL B 2 330 ? 12.255  -48.649 106.892 1.00 48.70  ? 330 VAL B N   1 
ATOM   5312  C CA  . VAL B 2 330 ? 13.381  -48.127 106.124 1.00 46.16  ? 330 VAL B CA  1 
ATOM   5313  C C   . VAL B 2 330 ? 14.206  -47.133 106.944 1.00 49.73  ? 330 VAL B C   1 
ATOM   5314  O O   . VAL B 2 330 ? 13.661  -46.346 107.721 1.00 54.56  ? 330 VAL B O   1 
ATOM   5315  C CB  . VAL B 2 330 ? 12.899  -47.467 104.804 1.00 52.55  ? 330 VAL B CB  1 
ATOM   5316  C CG1 . VAL B 2 330 ? 12.194  -46.147 105.073 1.00 56.47  ? 330 VAL B CG1 1 
ATOM   5317  C CG2 . VAL B 2 330 ? 14.062  -47.271 103.843 1.00 46.75  ? 330 VAL B CG2 1 
ATOM   5318  N N   . MET B 2 331 ? 15.528  -47.197 106.803 1.00 56.78  ? 331 MET B N   1 
ATOM   5319  C CA  . MET B 2 331 ? 16.397  -46.281 107.545 1.00 45.49  ? 331 MET B CA  1 
ATOM   5320  C C   . MET B 2 331 ? 17.703  -45.993 106.813 1.00 45.40  ? 331 MET B C   1 
ATOM   5321  O O   . MET B 2 331 ? 18.194  -46.828 106.061 1.00 42.66  ? 331 MET B O   1 
ATOM   5322  C CB  . MET B 2 331 ? 16.711  -46.841 108.934 1.00 44.56  ? 331 MET B CB  1 
ATOM   5323  C CG  . MET B 2 331 ? 17.713  -47.986 108.929 1.00 43.27  ? 331 MET B CG  1 
ATOM   5324  S SD  . MET B 2 331 ? 18.255  -48.454 110.582 1.00 85.83  ? 331 MET B SD  1 
ATOM   5325  C CE  . MET B 2 331 ? 19.205  -47.008 111.047 1.00 59.51  ? 331 MET B CE  1 
ATOM   5326  N N   . ALA B 2 332 ? 18.265  -44.810 107.039 1.00 44.06  ? 332 ALA B N   1 
ATOM   5327  C CA  . ALA B 2 332 ? 19.571  -44.481 106.479 1.00 52.30  ? 332 ALA B CA  1 
ATOM   5328  C C   . ALA B 2 332 ? 20.631  -45.416 107.048 1.00 41.74  ? 332 ALA B C   1 
ATOM   5329  O O   . ALA B 2 332 ? 20.654  -45.680 108.250 1.00 54.12  ? 332 ALA B O   1 
ATOM   5330  C CB  . ALA B 2 332 ? 19.928  -43.031 106.763 1.00 41.98  ? 332 ALA B CB  1 
ATOM   5331  N N   . VAL B 2 333 ? 21.507  -45.917 106.182 1.00 46.22  ? 333 VAL B N   1 
ATOM   5332  C CA  . VAL B 2 333 ? 22.576  -46.813 106.612 1.00 52.36  ? 333 VAL B CA  1 
ATOM   5333  C C   . VAL B 2 333 ? 23.900  -46.441 105.956 1.00 55.88  ? 333 VAL B C   1 
ATOM   5334  O O   . VAL B 2 333 ? 23.961  -45.532 105.128 1.00 57.32  ? 333 VAL B O   1 
ATOM   5335  C CB  . VAL B 2 333 ? 22.256  -48.289 106.279 1.00 47.56  ? 333 VAL B CB  1 
ATOM   5336  C CG1 . VAL B 2 333 ? 20.956  -48.731 106.940 1.00 36.17  ? 333 VAL B CG1 1 
ATOM   5337  C CG2 . VAL B 2 333 ? 22.199  -48.494 104.772 1.00 50.59  ? 333 VAL B CG2 1 
ATOM   5338  N N   . ASP B 2 334 ? 24.959  -47.152 106.332 1.00 52.91  ? 334 ASP B N   1 
ATOM   5339  C CA  . ASP B 2 334 ? 26.267  -46.966 105.716 1.00 59.38  ? 334 ASP B CA  1 
ATOM   5340  C C   . ASP B 2 334 ? 26.724  -48.237 105.012 1.00 65.53  ? 334 ASP B C   1 
ATOM   5341  O O   . ASP B 2 334 ? 26.796  -49.302 105.625 1.00 67.85  ? 334 ASP B O   1 
ATOM   5342  C CB  . ASP B 2 334 ? 27.303  -46.552 106.763 1.00 60.16  ? 334 ASP B CB  1 
ATOM   5343  C CG  . ASP B 2 334 ? 27.074  -45.149 107.285 1.00 67.16  ? 334 ASP B CG  1 
ATOM   5344  O OD1 . ASP B 2 334 ? 25.906  -44.791 107.546 1.00 72.63  ? 334 ASP B OD1 1 
ATOM   5345  O OD2 . ASP B 2 334 ? 28.063  -44.402 107.433 1.00 80.16  ? 334 ASP B OD2 1 
ATOM   5346  N N   . CYS B 2 335 ? 27.032  -48.123 103.725 1.00 51.46  ? 335 CYS B N   1 
ATOM   5347  C CA  . CYS B 2 335 ? 27.519  -49.266 102.964 1.00 45.02  ? 335 CYS B CA  1 
ATOM   5348  C C   . CYS B 2 335 ? 28.672  -48.887 102.042 1.00 59.95  ? 335 CYS B C   1 
ATOM   5349  O O   . CYS B 2 335 ? 28.515  -48.047 101.156 1.00 53.79  ? 335 CYS B O   1 
ATOM   5350  C CB  . CYS B 2 335 ? 26.386  -49.890 102.150 1.00 44.73  ? 335 CYS B CB  1 
ATOM   5351  S SG  . CYS B 2 335 ? 26.779  -51.516 101.467 1.00 52.94  ? 335 CYS B SG  1 
ATOM   5352  N N   . GLU B 2 336 ? 29.823  -49.518 102.262 1.00 51.11  ? 336 GLU B N   1 
ATOM   5353  C CA  . GLU B 2 336 ? 30.994  -49.364 101.400 1.00 36.47  ? 336 GLU B CA  1 
ATOM   5354  C C   . GLU B 2 336 ? 31.424  -47.911 101.224 1.00 38.82  ? 336 GLU B C   1 
ATOM   5355  O O   . GLU B 2 336 ? 31.838  -47.509 100.135 1.00 50.07  ? 336 GLU B O   1 
ATOM   5356  C CB  . GLU B 2 336 ? 30.715  -49.990 100.032 1.00 55.99  ? 336 GLU B CB  1 
ATOM   5357  C CG  . GLU B 2 336 ? 30.532  -51.494 100.078 1.00 57.31  ? 336 GLU B CG  1 
ATOM   5358  C CD  . GLU B 2 336 ? 29.789  -52.026 98.872  1.00 57.55  ? 336 GLU B CD  1 
ATOM   5359  O OE1 . GLU B 2 336 ? 29.009  -52.987 99.035  1.00 60.94  ? 336 GLU B OE1 1 
ATOM   5360  O OE2 . GLU B 2 336 ? 29.982  -51.483 97.763  1.00 74.24  ? 336 GLU B OE2 1 
ATOM   5361  N N   . ASP B 2 337 ? 31.324  -47.140 102.304 1.00 38.96  ? 337 ASP B N   1 
ATOM   5362  C CA  . ASP B 2 337 ? 31.746  -45.741 102.326 1.00 41.54  ? 337 ASP B CA  1 
ATOM   5363  C C   . ASP B 2 337 ? 31.052  -44.940 101.224 1.00 45.92  ? 337 ASP B C   1 
ATOM   5364  O O   . ASP B 2 337 ? 31.640  -44.042 100.624 1.00 46.43  ? 337 ASP B O   1 
ATOM   5365  C CB  . ASP B 2 337 ? 33.269  -45.647 102.190 1.00 57.63  ? 337 ASP B CB  1 
ATOM   5366  C CG  . ASP B 2 337 ? 33.817  -44.302 102.626 1.00 71.09  ? 337 ASP B CG  1 
ATOM   5367  O OD1 . ASP B 2 337 ? 33.103  -43.563 103.335 1.00 64.70  ? 337 ASP B OD1 1 
ATOM   5368  O OD2 . ASP B 2 337 ? 34.973  -43.994 102.271 1.00 86.43  ? 337 ASP B OD2 1 
ATOM   5369  N N   . ARG B 2 338 ? 29.791  -45.276 100.968 1.00 48.22  ? 338 ARG B N   1 
ATOM   5370  C CA  . ARG B 2 338 ? 29.006  -44.601 99.942  1.00 46.43  ? 338 ARG B CA  1 
ATOM   5371  C C   . ARG B 2 338 ? 28.047  -43.595 100.564 1.00 54.02  ? 338 ARG B C   1 
ATOM   5372  O O   . ARG B 2 338 ? 27.544  -43.800 101.669 1.00 48.90  ? 338 ARG B O   1 
ATOM   5373  C CB  . ARG B 2 338 ? 28.229  -45.615 99.101  1.00 39.59  ? 338 ARG B CB  1 
ATOM   5374  C CG  . ARG B 2 338 ? 28.974  -46.108 97.873  1.00 33.13  ? 338 ARG B CG  1 
ATOM   5375  C CD  . ARG B 2 338 ? 28.156  -47.142 97.118  1.00 38.33  ? 338 ARG B CD  1 
ATOM   5376  N NE  . ARG B 2 338 ? 28.944  -47.828 96.098  1.00 53.29  ? 338 ARG B NE  1 
ATOM   5377  C CZ  . ARG B 2 338 ? 28.794  -47.647 94.790  1.00 46.49  ? 338 ARG B CZ  1 
ATOM   5378  N NH1 . ARG B 2 338 ? 27.879  -46.801 94.337  1.00 47.99  ? 338 ARG B NH1 1 
ATOM   5379  N NH2 . ARG B 2 338 ? 29.556  -48.314 93.935  1.00 43.76  ? 338 ARG B NH2 1 
ATOM   5380  N N   . ARG B 2 339 ? 27.806  -42.504 99.847  1.00 36.22  ? 339 ARG B N   1 
ATOM   5381  C CA  . ARG B 2 339 ? 26.943  -41.440 100.338 1.00 43.88  ? 339 ARG B CA  1 
ATOM   5382  C C   . ARG B 2 339 ? 25.474  -41.734 100.051 1.00 51.22  ? 339 ARG B C   1 
ATOM   5383  O O   . ARG B 2 339 ? 25.132  -42.251 98.987  1.00 35.03  ? 339 ARG B O   1 
ATOM   5384  C CB  . ARG B 2 339 ? 27.337  -40.104 99.707  1.00 48.17  ? 339 ARG B CB  1 
ATOM   5385  C CG  . ARG B 2 339 ? 28.654  -39.547 100.205 1.00 46.00  ? 339 ARG B CG  1 
ATOM   5386  C CD  . ARG B 2 339 ? 29.246  -38.567 99.205  1.00 66.58  ? 339 ARG B CD  1 
ATOM   5387  N NE  . ARG B 2 339 ? 28.545  -37.287 99.201  1.00 63.80  ? 339 ARG B NE  1 
ATOM   5388  C CZ  . ARG B 2 339 ? 27.830  -36.835 98.176  1.00 64.93  ? 339 ARG B CZ  1 
ATOM   5389  N NH1 . ARG B 2 339 ? 27.725  -37.563 97.073  1.00 56.25  ? 339 ARG B NH1 1 
ATOM   5390  N NH2 . ARG B 2 339 ? 27.224  -35.658 98.252  1.00 62.94  ? 339 ARG B NH2 1 
ATOM   5391  N N   . TYR B 2 340 ? 24.623  -41.419 101.025 1.00 66.12  ? 340 TYR B N   1 
ATOM   5392  C CA  . TYR B 2 340 ? 23.170  -41.447 100.862 1.00 51.55  ? 340 TYR B CA  1 
ATOM   5393  C C   . TYR B 2 340 ? 22.615  -42.838 100.576 1.00 44.43  ? 340 TYR B C   1 
ATOM   5394  O O   . TYR B 2 340 ? 21.767  -43.009 99.700  1.00 43.04  ? 340 TYR B O   1 
ATOM   5395  C CB  . TYR B 2 340 ? 22.750  -40.480 99.753  1.00 45.95  ? 340 TYR B CB  1 
ATOM   5396  C CG  . TYR B 2 340 ? 23.224  -39.067 99.994  1.00 56.56  ? 340 TYR B CG  1 
ATOM   5397  C CD1 . TYR B 2 340 ? 23.064  -38.467 101.236 1.00 48.15  ? 340 TYR B CD1 1 
ATOM   5398  C CD2 . TYR B 2 340 ? 23.843  -38.339 98.988  1.00 60.31  ? 340 TYR B CD2 1 
ATOM   5399  C CE1 . TYR B 2 340 ? 23.500  -37.179 101.466 1.00 58.88  ? 340 TYR B CE1 1 
ATOM   5400  C CE2 . TYR B 2 340 ? 24.282  -37.048 99.210  1.00 60.36  ? 340 TYR B CE2 1 
ATOM   5401  C CZ  . TYR B 2 340 ? 24.107  -36.473 100.450 1.00 52.93  ? 340 TYR B CZ  1 
ATOM   5402  O OH  . TYR B 2 340 ? 24.543  -35.187 100.678 1.00 61.85  ? 340 TYR B OH  1 
ATOM   5403  N N   . CYS B 2 341 ? 23.100  -43.829 101.314 1.00 53.02  ? 341 CYS B N   1 
ATOM   5404  C CA  . CYS B 2 341 ? 22.506  -45.158 101.269 1.00 45.05  ? 341 CYS B CA  1 
ATOM   5405  C C   . CYS B 2 341 ? 21.436  -45.305 102.345 1.00 57.56  ? 341 CYS B C   1 
ATOM   5406  O O   . CYS B 2 341 ? 21.602  -44.834 103.471 1.00 47.44  ? 341 CYS B O   1 
ATOM   5407  C CB  . CYS B 2 341 ? 23.578  -46.238 101.437 1.00 46.91  ? 341 CYS B CB  1 
ATOM   5408  S SG  . CYS B 2 341 ? 24.759  -46.346 100.072 1.00 54.13  ? 341 CYS B SG  1 
ATOM   5409  N N   . PHE B 2 342 ? 20.333  -45.954 101.990 1.00 52.10  ? 342 PHE B N   1 
ATOM   5410  C CA  . PHE B 2 342 ? 19.321  -46.326 102.967 1.00 39.89  ? 342 PHE B CA  1 
ATOM   5411  C C   . PHE B 2 342 ? 18.902  -47.765 102.702 1.00 39.25  ? 342 PHE B C   1 
ATOM   5412  O O   . PHE B 2 342 ? 19.187  -48.309 101.642 1.00 49.28  ? 342 PHE B O   1 
ATOM   5413  C CB  . PHE B 2 342 ? 18.117  -45.379 102.914 1.00 42.37  ? 342 PHE B CB  1 
ATOM   5414  C CG  . PHE B 2 342 ? 17.408  -45.354 101.586 1.00 58.64  ? 342 PHE B CG  1 
ATOM   5415  C CD1 . PHE B 2 342 ? 17.821  -44.497 100.579 1.00 57.46  ? 342 PHE B CD1 1 
ATOM   5416  C CD2 . PHE B 2 342 ? 16.313  -46.172 101.356 1.00 54.43  ? 342 PHE B CD2 1 
ATOM   5417  C CE1 . PHE B 2 342 ? 17.164  -44.469 99.361  1.00 53.58  ? 342 PHE B CE1 1 
ATOM   5418  C CE2 . PHE B 2 342 ? 15.653  -46.148 100.141 1.00 41.01  ? 342 PHE B CE2 1 
ATOM   5419  C CZ  . PHE B 2 342 ? 16.079  -45.295 99.143  1.00 50.72  ? 342 PHE B CZ  1 
ATOM   5420  N N   . GLN B 2 343 ? 18.227  -48.381 103.663 1.00 45.59  ? 343 GLN B N   1 
ATOM   5421  C CA  . GLN B 2 343 ? 17.912  -49.796 103.563 1.00 44.20  ? 343 GLN B CA  1 
ATOM   5422  C C   . GLN B 2 343 ? 16.502  -50.101 104.047 1.00 59.80  ? 343 GLN B C   1 
ATOM   5423  O O   . GLN B 2 343 ? 16.032  -49.539 105.047 1.00 53.75  ? 343 GLN B O   1 
ATOM   5424  C CB  . GLN B 2 343 ? 18.928  -50.620 104.361 1.00 36.76  ? 343 GLN B CB  1 
ATOM   5425  C CG  . GLN B 2 343 ? 18.544  -52.079 104.568 1.00 39.93  ? 343 GLN B CG  1 
ATOM   5426  C CD  . GLN B 2 343 ? 19.674  -52.904 105.149 1.00 49.23  ? 343 GLN B CD  1 
ATOM   5427  O OE1 . GLN B 2 343 ? 20.273  -52.532 106.158 1.00 54.52  ? 343 GLN B OE1 1 
ATOM   5428  N NE2 . GLN B 2 343 ? 19.970  -54.034 104.517 1.00 52.29  ? 343 GLN B NE2 1 
ATOM   5429  N N   . ILE B 2 344 ? 15.838  -50.988 103.312 1.00 58.56  ? 344 ILE B N   1 
ATOM   5430  C CA  . ILE B 2 344 ? 14.534  -51.504 103.695 1.00 55.93  ? 344 ILE B CA  1 
ATOM   5431  C C   . ILE B 2 344 ? 14.702  -52.848 104.376 1.00 56.85  ? 344 ILE B C   1 
ATOM   5432  O O   . ILE B 2 344 ? 15.287  -53.770 103.793 1.00 71.76  ? 344 ILE B O   1 
ATOM   5433  C CB  . ILE B 2 344 ? 13.603  -51.681 102.486 1.00 52.07  ? 344 ILE B CB  1 
ATOM   5434  C CG1 . ILE B 2 344 ? 13.271  -50.328 101.862 1.00 55.48  ? 344 ILE B CG1 1 
ATOM   5435  C CG2 . ILE B 2 344 ? 12.327  -52.406 102.895 1.00 45.49  ? 344 ILE B CG2 1 
ATOM   5436  C CD1 . ILE B 2 344 ? 12.702  -50.439 100.475 1.00 60.84  ? 344 ILE B CD1 1 
ATOM   5437  N N   . THR B 2 345 ? 14.176  -52.942 105.596 1.00 50.57  ? 345 THR B N   1 
ATOM   5438  C CA  . THR B 2 345 ? 14.103  -54.186 106.351 1.00 72.86  ? 345 THR B CA  1 
ATOM   5439  C C   . THR B 2 345 ? 12.685  -54.752 106.292 1.00 68.24  ? 345 THR B C   1 
ATOM   5440  O O   . THR B 2 345 ? 11.695  -54.029 106.466 1.00 46.28  ? 345 THR B O   1 
ATOM   5441  C CB  . THR B 2 345 ? 14.517  -53.992 107.830 1.00 67.62  ? 345 THR B CB  1 
ATOM   5442  O OG1 . THR B 2 345 ? 13.595  -53.112 108.487 1.00 47.66  ? 345 THR B OG1 1 
ATOM   5443  C CG2 . THR B 2 345 ? 15.929  -53.429 107.929 1.00 71.16  ? 345 THR B CG2 1 
ATOM   5444  N N   . THR B 2 346 ? 12.614  -56.059 106.058 1.00 68.96  ? 346 THR B N   1 
ATOM   5445  C CA  . THR B 2 346 ? 11.367  -56.776 105.819 1.00 75.24  ? 346 THR B CA  1 
ATOM   5446  C C   . THR B 2 346 ? 10.545  -56.934 107.108 1.00 77.71  ? 346 THR B C   1 
ATOM   5447  O O   . THR B 2 346 ? 11.080  -56.738 108.198 1.00 71.66  ? 346 THR B O   1 
ATOM   5448  C CB  . THR B 2 346 ? 11.675  -58.159 105.197 1.00 82.01  ? 346 THR B CB  1 
ATOM   5449  O OG1 . THR B 2 346 ? 12.777  -58.761 105.885 1.00 84.45  ? 346 THR B OG1 1 
ATOM   5450  C CG2 . THR B 2 346 ? 12.032  -58.006 103.726 1.00 70.22  ? 346 THR B CG2 1 
ATOM   5451  N N   . PRO B 2 347 ? 9.241   -57.275 106.987 1.00 84.33  ? 347 PRO B N   1 
ATOM   5452  C CA  . PRO B 2 347 ? 8.361   -57.347 108.163 1.00 77.96  ? 347 PRO B CA  1 
ATOM   5453  C C   . PRO B 2 347 ? 8.861   -58.228 109.309 1.00 82.81  ? 347 PRO B C   1 
ATOM   5454  O O   . PRO B 2 347 ? 8.678   -57.862 110.470 1.00 76.27  ? 347 PRO B O   1 
ATOM   5455  C CB  . PRO B 2 347 ? 7.070   -57.930 107.586 1.00 85.48  ? 347 PRO B CB  1 
ATOM   5456  C CG  . PRO B 2 347 ? 7.050   -57.459 106.193 1.00 71.56  ? 347 PRO B CG  1 
ATOM   5457  C CD  . PRO B 2 347 ? 8.480   -57.500 105.742 1.00 75.87  ? 347 PRO B CD  1 
ATOM   5458  N N   . ASN B 2 348 ? 9.467   -59.368 108.993 1.00 80.66  ? 348 ASN B N   1 
ATOM   5459  C CA  . ASN B 2 348 ? 9.969   -60.273 110.024 1.00 81.59  ? 348 ASN B CA  1 
ATOM   5460  C C   . ASN B 2 348 ? 11.216  -59.743 110.742 1.00 86.84  ? 348 ASN B C   1 
ATOM   5461  O O   . ASN B 2 348 ? 11.700  -60.359 111.690 1.00 80.45  ? 348 ASN B O   1 
ATOM   5462  C CB  . ASN B 2 348 ? 10.231  -61.659 109.427 1.00 80.50  ? 348 ASN B CB  1 
ATOM   5463  C CG  . ASN B 2 348 ? 11.106  -61.615 108.199 1.00 92.03  ? 348 ASN B CG  1 
ATOM   5464  O OD1 . ASN B 2 348 ? 11.235  -60.581 107.543 1.00 94.54  ? 348 ASN B OD1 1 
ATOM   5465  N ND2 . ASN B 2 348 ? 11.673  -62.760 107.848 1.00 106.99 ? 348 ASN B ND2 1 
ATOM   5466  N N   . GLY B 2 349 ? 11.737  -58.608 110.281 1.00 86.53  ? 349 GLY B N   1 
ATOM   5467  C CA  . GLY B 2 349 ? 12.859  -57.954 110.935 1.00 78.44  ? 349 GLY B CA  1 
ATOM   5468  C C   . GLY B 2 349 ? 14.229  -58.194 110.323 1.00 82.13  ? 349 GLY B C   1 
ATOM   5469  O O   . GLY B 2 349 ? 15.212  -57.580 110.740 1.00 79.99  ? 349 GLY B O   1 
ATOM   5470  N N   . LYS B 2 350 ? 14.302  -59.089 109.344 1.00 81.49  ? 350 LYS B N   1 
ATOM   5471  C CA  . LYS B 2 350 ? 15.543  -59.312 108.608 1.00 82.07  ? 350 LYS B CA  1 
ATOM   5472  C C   . LYS B 2 350 ? 15.935  -58.046 107.859 1.00 72.06  ? 350 LYS B C   1 
ATOM   5473  O O   . LYS B 2 350 ? 15.089  -57.414 107.225 1.00 59.16  ? 350 LYS B O   1 
ATOM   5474  C CB  . LYS B 2 350 ? 15.415  -60.473 107.624 1.00 81.68  ? 350 LYS B CB  1 
ATOM   5475  C CG  . LYS B 2 350 ? 15.482  -61.851 108.254 1.00 80.79  ? 350 LYS B CG  1 
ATOM   5476  C CD  . LYS B 2 350 ? 15.436  -62.927 107.183 1.00 90.94  ? 350 LYS B CD  1 
ATOM   5477  C CE  . LYS B 2 350 ? 14.273  -62.704 106.227 1.00 89.03  ? 350 LYS B CE  1 
ATOM   5478  N NZ  . LYS B 2 350 ? 14.319  -63.604 105.041 1.00 96.33  ? 350 LYS B NZ  1 
ATOM   5479  N N   . SER B 2 351 ? 17.207  -57.670 107.933 1.00 76.16  ? 351 SER B N   1 
ATOM   5480  C CA  . SER B 2 351 ? 17.683  -56.547 107.138 1.00 64.76  ? 351 SER B CA  1 
ATOM   5481  C C   . SER B 2 351 ? 17.635  -56.892 105.654 1.00 74.18  ? 351 SER B C   1 
ATOM   5482  O O   . SER B 2 351 ? 18.218  -57.878 105.200 1.00 65.69  ? 351 SER B O   1 
ATOM   5483  C CB  . SER B 2 351 ? 19.103  -56.152 107.547 1.00 62.84  ? 351 SER B CB  1 
ATOM   5484  O OG  . SER B 2 351 ? 19.112  -55.573 108.840 1.00 78.05  ? 351 SER B OG  1 
ATOM   5485  N N   . GLY B 2 352 ? 16.929  -56.051 104.910 1.00 65.74  ? 352 GLY B N   1 
ATOM   5486  C CA  . GLY B 2 352 ? 16.627  -56.292 103.514 1.00 69.91  ? 352 GLY B CA  1 
ATOM   5487  C C   . GLY B 2 352 ? 17.470  -55.461 102.570 1.00 64.57  ? 352 GLY B C   1 
ATOM   5488  O O   . GLY B 2 352 ? 18.656  -55.232 102.806 1.00 67.55  ? 352 GLY B O   1 
ATOM   5489  N N   . ILE B 2 353 ? 16.844  -55.014 101.486 1.00 66.34  ? 353 ILE B N   1 
ATOM   5490  C CA  . ILE B 2 353 ? 17.587  -54.429 100.363 1.00 55.39  ? 353 ILE B CA  1 
ATOM   5491  C C   . ILE B 2 353 ? 18.209  -53.066 100.663 1.00 55.82  ? 353 ILE B C   1 
ATOM   5492  O O   . ILE B 2 353 ? 17.681  -52.281 101.454 1.00 55.55  ? 353 ILE B O   1 
ATOM   5493  C CB  . ILE B 2 353 ? 16.705  -54.298 99.094  1.00 54.79  ? 353 ILE B CB  1 
ATOM   5494  C CG1 . ILE B 2 353 ? 15.625  -53.228 99.271  1.00 67.37  ? 353 ILE B CG1 1 
ATOM   5495  C CG2 . ILE B 2 353 ? 16.096  -55.644 98.717  1.00 40.99  ? 353 ILE B CG2 1 
ATOM   5496  C CD1 . ILE B 2 353 ? 14.898  -52.892 97.985  1.00 52.40  ? 353 ILE B CD1 1 
ATOM   5497  N N   . ILE B 2 354 ? 19.348  -52.808 100.023 1.00 61.45  ? 354 ILE B N   1 
ATOM   5498  C CA  . ILE B 2 354 ? 20.091  -51.564 100.199 1.00 53.28  ? 354 ILE B CA  1 
ATOM   5499  C C   . ILE B 2 354 ? 20.094  -50.719 98.926  1.00 43.68  ? 354 ILE B C   1 
ATOM   5500  O O   . ILE B 2 354 ? 20.445  -51.199 97.848  1.00 46.79  ? 354 ILE B O   1 
ATOM   5501  C CB  . ILE B 2 354 ? 21.550  -51.839 100.613 1.00 50.32  ? 354 ILE B CB  1 
ATOM   5502  C CG1 . ILE B 2 354 ? 21.596  -52.612 101.933 1.00 50.52  ? 354 ILE B CG1 1 
ATOM   5503  C CG2 . ILE B 2 354 ? 22.330  -50.538 100.725 1.00 43.71  ? 354 ILE B CG2 1 
ATOM   5504  C CD1 . ILE B 2 354 ? 22.935  -53.258 102.214 1.00 51.71  ? 354 ILE B CD1 1 
ATOM   5505  N N   . LEU B 2 355 ? 19.704  -49.457 99.067  1.00 45.55  ? 355 LEU B N   1 
ATOM   5506  C CA  . LEU B 2 355 ? 19.587  -48.537 97.943  1.00 47.25  ? 355 LEU B CA  1 
ATOM   5507  C C   . LEU B 2 355 ? 20.412  -47.277 98.177  1.00 43.46  ? 355 LEU B C   1 
ATOM   5508  O O   . LEU B 2 355 ? 20.768  -46.962 99.310  1.00 45.52  ? 355 LEU B O   1 
ATOM   5509  C CB  . LEU B 2 355 ? 18.124  -48.164 97.709  1.00 43.06  ? 355 LEU B CB  1 
ATOM   5510  C CG  . LEU B 2 355 ? 17.200  -49.317 97.332  1.00 38.72  ? 355 LEU B CG  1 
ATOM   5511  C CD1 . LEU B 2 355 ? 15.751  -48.946 97.591  1.00 54.13  ? 355 LEU B CD1 1 
ATOM   5512  C CD2 . LEU B 2 355 ? 17.410  -49.682 95.878  1.00 43.98  ? 355 LEU B CD2 1 
ATOM   5513  N N   . GLN B 2 356 ? 20.707  -46.558 97.100  1.00 42.41  ? 356 GLN B N   1 
ATOM   5514  C CA  . GLN B 2 356 ? 21.515  -45.348 97.183  1.00 38.45  ? 356 GLN B CA  1 
ATOM   5515  C C   . GLN B 2 356 ? 20.923  -44.214 96.353  1.00 35.89  ? 356 GLN B C   1 
ATOM   5516  O O   . GLN B 2 356 ? 20.614  -44.397 95.174  1.00 37.89  ? 356 GLN B O   1 
ATOM   5517  C CB  . GLN B 2 356 ? 22.944  -45.636 96.721  1.00 39.96  ? 356 GLN B CB  1 
ATOM   5518  C CG  . GLN B 2 356 ? 23.924  -44.504 96.963  1.00 31.59  ? 356 GLN B CG  1 
ATOM   5519  C CD  . GLN B 2 356 ? 25.196  -44.664 96.154  1.00 41.02  ? 356 GLN B CD  1 
ATOM   5520  O OE1 . GLN B 2 356 ? 25.322  -45.593 95.356  1.00 39.74  ? 356 GLN B OE1 1 
ATOM   5521  N NE2 . GLN B 2 356 ? 26.146  -43.759 96.355  1.00 49.83  ? 356 GLN B NE2 1 
ATOM   5522  N N   . ALA B 2 357 ? 20.763  -43.045 96.969  1.00 33.91  ? 357 ALA B N   1 
ATOM   5523  C CA  . ALA B 2 357 ? 20.318  -41.867 96.234  1.00 37.43  ? 357 ALA B CA  1 
ATOM   5524  C C   . ALA B 2 357 ? 21.499  -40.952 95.922  1.00 41.93  ? 357 ALA B C   1 
ATOM   5525  O O   . ALA B 2 357 ? 22.612  -41.179 96.396  1.00 44.50  ? 357 ALA B O   1 
ATOM   5526  C CB  . ALA B 2 357 ? 19.258  -41.119 97.024  1.00 47.83  ? 357 ALA B CB  1 
ATOM   5527  N N   . GLU B 2 358 ? 21.248  -39.907 95.139  1.00 43.43  ? 358 GLU B N   1 
ATOM   5528  C CA  . GLU B 2 358 ? 22.312  -39.005 94.708  1.00 53.60  ? 358 GLU B CA  1 
ATOM   5529  C C   . GLU B 2 358 ? 22.387  -37.718 95.524  1.00 47.79  ? 358 GLU B C   1 
ATOM   5530  O O   . GLU B 2 358 ? 23.300  -36.913 95.341  1.00 57.52  ? 358 GLU B O   1 
ATOM   5531  C CB  . GLU B 2 358 ? 22.138  -38.663 93.227  1.00 42.78  ? 358 GLU B CB  1 
ATOM   5532  C CG  . GLU B 2 358 ? 21.149  -37.543 92.963  1.00 57.76  ? 358 GLU B CG  1 
ATOM   5533  C CD  . GLU B 2 358 ? 20.996  -37.240 91.487  1.00 74.57  ? 358 GLU B CD  1 
ATOM   5534  O OE1 . GLU B 2 358 ? 21.608  -37.953 90.664  1.00 68.79  ? 358 GLU B OE1 1 
ATOM   5535  O OE2 . GLU B 2 358 ? 20.263  -36.288 91.148  1.00 101.42 ? 358 GLU B OE2 1 
ATOM   5536  N N   . SER B 2 359 ? 21.433  -37.525 96.427  1.00 55.31  ? 359 SER B N   1 
ATOM   5537  C CA  . SER B 2 359 ? 21.353  -36.279 97.178  1.00 54.69  ? 359 SER B CA  1 
ATOM   5538  C C   . SER B 2 359 ? 20.777  -36.506 98.564  1.00 52.99  ? 359 SER B C   1 
ATOM   5539  O O   . SER B 2 359 ? 20.113  -37.512 98.814  1.00 51.88  ? 359 SER B O   1 
ATOM   5540  C CB  . SER B 2 359 ? 20.509  -35.248 96.426  1.00 53.40  ? 359 SER B CB  1 
ATOM   5541  O OG  . SER B 2 359 ? 19.126  -35.481 96.623  1.00 61.34  ? 359 SER B OG  1 
ATOM   5542  N N   . ARG B 2 360 ? 21.056  -35.570 99.465  1.00 60.08  ? 360 ARG B N   1 
ATOM   5543  C CA  . ARG B 2 360 ? 20.468  -35.578 100.796 1.00 60.63  ? 360 ARG B CA  1 
ATOM   5544  C C   . ARG B 2 360 ? 18.947  -35.631 100.697 1.00 56.25  ? 360 ARG B C   1 
ATOM   5545  O O   . ARG B 2 360 ? 18.292  -36.459 101.339 1.00 63.17  ? 360 ARG B O   1 
ATOM   5546  C CB  . ARG B 2 360 ? 20.903  -34.338 101.580 1.00 71.83  ? 360 ARG B CB  1 
ATOM   5547  C CG  . ARG B 2 360 ? 20.382  -34.284 103.004 1.00 72.59  ? 360 ARG B CG  1 
ATOM   5548  C CD  . ARG B 2 360 ? 21.307  -35.070 103.921 1.00 81.34  ? 360 ARG B CD  1 
ATOM   5549  N NE  . ARG B 2 360 ? 20.944  -34.950 105.328 1.00 99.23  ? 360 ARG B NE  1 
ATOM   5550  C CZ  . ARG B 2 360 ? 20.435  -35.942 106.051 1.00 104.58 ? 360 ARG B CZ  1 
ATOM   5551  N NH1 . ARG B 2 360 ? 20.237  -37.131 105.499 1.00 97.03  ? 360 ARG B NH1 1 
ATOM   5552  N NH2 . ARG B 2 360 ? 20.132  -35.747 107.327 1.00 100.76 ? 360 ARG B NH2 1 
ATOM   5553  N N   . LYS B 2 361 ? 18.400  -34.747 99.867  1.00 63.33  ? 361 LYS B N   1 
ATOM   5554  C CA  . LYS B 2 361 ? 16.959  -34.555 99.774  1.00 61.37  ? 361 LYS B CA  1 
ATOM   5555  C C   . LYS B 2 361 ? 16.254  -35.804 99.256  1.00 58.81  ? 361 LYS B C   1 
ATOM   5556  O O   . LYS B 2 361 ? 15.222  -36.191 99.789  1.00 68.40  ? 361 LYS B O   1 
ATOM   5557  C CB  . LYS B 2 361 ? 16.626  -33.358 98.877  1.00 53.97  ? 361 LYS B CB  1 
ATOM   5558  C CG  . LYS B 2 361 ? 15.213  -33.384 98.304  1.00 62.62  ? 361 LYS B CG  1 
ATOM   5559  C CD  . LYS B 2 361 ? 15.153  -32.803 96.903  1.00 82.92  ? 361 LYS B CD  1 
ATOM   5560  C CE  . LYS B 2 361 ? 13.842  -33.160 96.218  1.00 72.25  ? 361 LYS B CE  1 
ATOM   5561  N NZ  . LYS B 2 361 ? 12.668  -32.639 96.972  1.00 85.75  ? 361 LYS B NZ  1 
ATOM   5562  N N   . GLU B 2 362 ? 16.807  -36.438 98.226  1.00 51.10  ? 362 GLU B N   1 
ATOM   5563  C CA  . GLU B 2 362 ? 16.147  -37.597 97.632  1.00 59.23  ? 362 GLU B CA  1 
ATOM   5564  C C   . GLU B 2 362 ? 16.255  -38.800 98.561  1.00 49.30  ? 362 GLU B C   1 
ATOM   5565  O O   . GLU B 2 362 ? 15.371  -39.655 98.592  1.00 49.01  ? 362 GLU B O   1 
ATOM   5566  C CB  . GLU B 2 362 ? 16.767  -37.945 96.273  1.00 57.15  ? 362 GLU B CB  1 
ATOM   5567  C CG  . GLU B 2 362 ? 16.592  -36.911 95.165  1.00 88.66  ? 362 GLU B CG  1 
ATOM   5568  C CD  . GLU B 2 362 ? 15.140  -36.646 94.821  1.00 97.91  ? 362 GLU B CD  1 
ATOM   5569  O OE1 . GLU B 2 362 ? 14.329  -37.589 94.901  1.00 113.83 ? 362 GLU B OE1 1 
ATOM   5570  O OE2 . GLU B 2 362 ? 14.817  -35.505 94.431  1.00 89.56  ? 362 GLU B OE2 1 
ATOM   5571  N N   . ASN B 2 363 ? 17.325  -38.836 99.348  1.00 45.23  ? 363 ASN B N   1 
ATOM   5572  C CA  . ASN B 2 363 ? 17.486  -39.862 100.368 1.00 53.15  ? 363 ASN B CA  1 
ATOM   5573  C C   . ASN B 2 363 ? 16.430  -39.736 101.455 1.00 56.42  ? 363 ASN B C   1 
ATOM   5574  O O   . ASN B 2 363 ? 15.683  -40.683 101.735 1.00 46.33  ? 363 ASN B O   1 
ATOM   5575  C CB  . ASN B 2 363 ? 18.884  -39.777 100.984 1.00 41.65  ? 363 ASN B CB  1 
ATOM   5576  C CG  . ASN B 2 363 ? 19.116  -40.826 102.050 1.00 53.63  ? 363 ASN B CG  1 
ATOM   5577  O OD1 . ASN B 2 363 ? 19.415  -41.982 101.748 1.00 59.15  ? 363 ASN B OD1 1 
ATOM   5578  N ND2 . ASN B 2 363 ? 18.984  -40.427 103.310 1.00 70.34  ? 363 ASN B ND2 1 
ATOM   5579  N N   . GLU B 2 364 ? 16.361  -38.550 102.050 1.00 55.51  ? 364 GLU B N   1 
ATOM   5580  C CA  . GLU B 2 364 ? 15.413  -38.301 103.124 1.00 56.47  ? 364 GLU B CA  1 
ATOM   5581  C C   . GLU B 2 364 ? 13.972  -38.452 102.648 1.00 58.71  ? 364 GLU B C   1 
ATOM   5582  O O   . GLU B 2 364 ? 13.152  -39.043 103.340 1.00 51.93  ? 364 GLU B O   1 
ATOM   5583  C CB  . GLU B 2 364 ? 15.637  -36.916 103.729 1.00 64.39  ? 364 GLU B CB  1 
ATOM   5584  C CG  . GLU B 2 364 ? 17.042  -36.723 104.277 1.00 67.76  ? 364 GLU B CG  1 
ATOM   5585  C CD  . GLU B 2 364 ? 17.103  -36.869 105.784 1.00 83.74  ? 364 GLU B CD  1 
ATOM   5586  O OE1 . GLU B 2 364 ? 16.939  -35.854 106.492 1.00 97.38  ? 364 GLU B OE1 1 
ATOM   5587  O OE2 . GLU B 2 364 ? 17.323  -38.004 106.259 1.00 79.74  ? 364 GLU B OE2 1 
ATOM   5588  N N   . GLU B 2 365 ? 13.669  -37.921 101.469 1.00 56.46  ? 365 GLU B N   1 
ATOM   5589  C CA  . GLU B 2 365 ? 12.321  -38.013 100.918 1.00 48.47  ? 365 GLU B CA  1 
ATOM   5590  C C   . GLU B 2 365 ? 11.947  -39.444 100.544 1.00 48.00  ? 365 GLU B C   1 
ATOM   5591  O O   . GLU B 2 365 ? 10.790  -39.827 100.680 1.00 60.34  ? 365 GLU B O   1 
ATOM   5592  C CB  . GLU B 2 365 ? 12.162  -37.090 99.708  1.00 49.53  ? 365 GLU B CB  1 
ATOM   5593  C CG  . GLU B 2 365 ? 12.155  -35.613 100.074 1.00 58.25  ? 365 GLU B CG  1 
ATOM   5594  C CD  . GLU B 2 365 ? 11.567  -34.739 98.986  1.00 67.80  ? 365 GLU B CD  1 
ATOM   5595  O OE1 . GLU B 2 365 ? 11.481  -35.202 97.829  1.00 84.65  ? 365 GLU B OE1 1 
ATOM   5596  O OE2 . GLU B 2 365 ? 11.190  -33.587 99.289  1.00 58.73  ? 365 GLU B OE2 1 
ATOM   5597  N N   . TRP B 2 366 ? 12.906  -40.226 100.053 1.00 42.50  ? 366 TRP B N   1 
ATOM   5598  C CA  . TRP B 2 366 ? 12.647  -41.646 99.820  1.00 44.02  ? 366 TRP B CA  1 
ATOM   5599  C C   . TRP B 2 366 ? 12.305  -42.348 101.130 1.00 54.28  ? 366 TRP B C   1 
ATOM   5600  O O   . TRP B 2 366 ? 11.298  -43.058 101.224 1.00 49.37  ? 366 TRP B O   1 
ATOM   5601  C CB  . TRP B 2 366 ? 13.846  -42.333 99.162  1.00 54.85  ? 366 TRP B CB  1 
ATOM   5602  C CG  . TRP B 2 366 ? 13.737  -42.436 97.672  1.00 53.55  ? 366 TRP B CG  1 
ATOM   5603  C CD1 . TRP B 2 366 ? 14.520  -41.814 96.744  1.00 55.24  ? 366 TRP B CD1 1 
ATOM   5604  C CD2 . TRP B 2 366 ? 12.780  -43.209 96.937  1.00 55.43  ? 366 TRP B CD2 1 
ATOM   5605  N NE1 . TRP B 2 366 ? 14.111  -42.152 95.477  1.00 65.35  ? 366 TRP B NE1 1 
ATOM   5606  C CE2 . TRP B 2 366 ? 13.046  -43.006 95.568  1.00 57.91  ? 366 TRP B CE2 1 
ATOM   5607  C CE3 . TRP B 2 366 ? 11.727  -44.051 97.304  1.00 52.81  ? 366 TRP B CE3 1 
ATOM   5608  C CZ2 . TRP B 2 366 ? 12.294  -43.618 94.566  1.00 47.25  ? 366 TRP B CZ2 1 
ATOM   5609  C CZ3 . TRP B 2 366 ? 10.983  -44.656 96.308  1.00 51.85  ? 366 TRP B CZ3 1 
ATOM   5610  C CH2 . TRP B 2 366 ? 11.270  -44.436 94.955  1.00 55.03  ? 366 TRP B CH2 1 
ATOM   5611  N N   . ILE B 2 367 ? 13.140  -42.125 102.142 1.00 56.05  ? 367 ILE B N   1 
ATOM   5612  C CA  . ILE B 2 367 ? 12.941  -42.734 103.455 1.00 46.80  ? 367 ILE B CA  1 
ATOM   5613  C C   . ILE B 2 367 ? 11.583  -42.376 104.043 1.00 58.62  ? 367 ILE B C   1 
ATOM   5614  O O   . ILE B 2 367 ? 10.854  -43.237 104.537 1.00 67.32  ? 367 ILE B O   1 
ATOM   5615  C CB  . ILE B 2 367 ? 14.044  -42.297 104.442 1.00 54.15  ? 367 ILE B CB  1 
ATOM   5616  C CG1 . ILE B 2 367 ? 15.389  -42.896 104.027 1.00 41.59  ? 367 ILE B CG1 1 
ATOM   5617  C CG2 . ILE B 2 367 ? 13.696  -42.711 105.864 1.00 42.89  ? 367 ILE B CG2 1 
ATOM   5618  C CD1 . ILE B 2 367 ? 16.567  -42.346 104.797 1.00 43.04  ? 367 ILE B CD1 1 
ATOM   5619  N N   . CYS B 2 368 ? 11.254  -41.094 103.975 1.00 59.29  ? 368 CYS B N   1 
ATOM   5620  C CA  . CYS B 2 368 ? 9.995   -40.578 104.486 1.00 54.49  ? 368 CYS B CA  1 
ATOM   5621  C C   . CYS B 2 368 ? 8.802   -41.111 103.703 1.00 50.65  ? 368 CYS B C   1 
ATOM   5622  O O   . CYS B 2 368 ? 7.757   -41.392 104.279 1.00 70.68  ? 368 CYS B O   1 
ATOM   5623  C CB  . CYS B 2 368 ? 10.026  -39.054 104.466 1.00 42.91  ? 368 CYS B CB  1 
ATOM   5624  S SG  . CYS B 2 368 ? 11.212  -38.400 105.659 1.00 100.82 ? 368 CYS B SG  1 
ATOM   5625  N N   . ALA B 2 369 ? 8.962   -41.239 102.391 1.00 54.54  ? 369 ALA B N   1 
ATOM   5626  C CA  . ALA B 2 369 ? 7.915   -41.788 101.539 1.00 56.49  ? 369 ALA B CA  1 
ATOM   5627  C C   . ALA B 2 369 ? 7.609   -43.221 101.951 1.00 56.52  ? 369 ALA B C   1 
ATOM   5628  O O   . ALA B 2 369 ? 6.451   -43.588 102.146 1.00 72.42  ? 369 ALA B O   1 
ATOM   5629  C CB  . ALA B 2 369 ? 8.323   -41.727 100.075 1.00 57.76  ? 369 ALA B CB  1 
ATOM   5630  N N   . ILE B 2 370 ? 8.657   -44.031 102.074 1.00 61.30  ? 370 ILE B N   1 
ATOM   5631  C CA  . ILE B 2 370 ? 8.495   -45.426 102.470 1.00 67.10  ? 370 ILE B CA  1 
ATOM   5632  C C   . ILE B 2 370 ? 7.939   -45.572 103.894 1.00 62.97  ? 370 ILE B C   1 
ATOM   5633  O O   . ILE B 2 370 ? 7.119   -46.455 104.153 1.00 65.20  ? 370 ILE B O   1 
ATOM   5634  C CB  . ILE B 2 370 ? 9.828   -46.188 102.352 1.00 64.02  ? 370 ILE B CB  1 
ATOM   5635  C CG1 . ILE B 2 370 ? 10.365  -46.078 100.924 1.00 58.70  ? 370 ILE B CG1 1 
ATOM   5636  C CG2 . ILE B 2 370 ? 9.651   -47.648 102.725 1.00 54.79  ? 370 ILE B CG2 1 
ATOM   5637  C CD1 . ILE B 2 370 ? 11.717  -46.719 100.723 1.00 70.52  ? 370 ILE B CD1 1 
ATOM   5638  N N   . ASN B 2 371 ? 8.377   -44.708 104.808 1.00 59.02  ? 371 ASN B N   1 
ATOM   5639  C CA  . ASN B 2 371 ? 7.846   -44.706 106.172 1.00 68.46  ? 371 ASN B CA  1 
ATOM   5640  C C   . ASN B 2 371 ? 6.364   -44.368 106.197 1.00 62.59  ? 371 ASN B C   1 
ATOM   5641  O O   . ASN B 2 371 ? 5.579   -45.009 106.898 1.00 82.17  ? 371 ASN B O   1 
ATOM   5642  C CB  . ASN B 2 371 ? 8.609   -43.716 107.054 1.00 62.33  ? 371 ASN B CB  1 
ATOM   5643  C CG  . ASN B 2 371 ? 9.916   -44.279 107.566 1.00 61.24  ? 371 ASN B CG  1 
ATOM   5644  O OD1 . ASN B 2 371 ? 10.071  -45.492 107.706 1.00 48.92  ? 371 ASN B OD1 1 
ATOM   5645  N ND2 . ASN B 2 371 ? 10.862  -43.397 107.865 1.00 56.87  ? 371 ASN B ND2 1 
ATOM   5646  N N   . ASN B 2 372 ? 5.992   -43.355 105.422 1.00 55.99  ? 372 ASN B N   1 
ATOM   5647  C CA  . ASN B 2 372 ? 4.605   -42.926 105.320 1.00 52.20  ? 372 ASN B CA  1 
ATOM   5648  C C   . ASN B 2 372 ? 3.743   -44.009 104.731 1.00 61.52  ? 372 ASN B C   1 
ATOM   5649  O O   . ASN B 2 372 ? 2.620   -44.236 105.179 1.00 64.07  ? 372 ASN B O   1 
ATOM   5650  C CB  . ASN B 2 372 ? 4.473   -41.669 104.464 1.00 54.56  ? 372 ASN B CB  1 
ATOM   5651  C CG  . ASN B 2 372 ? 5.087   -40.457 105.115 1.00 61.45  ? 372 ASN B CG  1 
ATOM   5652  O OD1 . ASN B 2 372 ? 5.342   -40.445 106.319 1.00 70.15  ? 372 ASN B OD1 1 
ATOM   5653  N ND2 . ASN B 2 372 ? 5.327   -39.422 104.321 1.00 56.07  ? 372 ASN B ND2 1 
ATOM   5654  N N   . ILE B 2 373 ? 4.264   -44.672 103.709 1.00 59.18  ? 373 ILE B N   1 
ATOM   5655  C CA  . ILE B 2 373 ? 3.498   -45.730 103.091 1.00 48.96  ? 373 ILE B CA  1 
ATOM   5656  C C   . ILE B 2 373 ? 3.274   -46.845 104.097 1.00 60.22  ? 373 ILE B C   1 
ATOM   5657  O O   . ILE B 2 373 ? 2.152   -47.317 104.225 1.00 94.46  ? 373 ILE B O   1 
ATOM   5658  C CB  . ILE B 2 373 ? 4.200   -46.285 101.837 1.00 54.63  ? 373 ILE B CB  1 
ATOM   5659  C CG1 . ILE B 2 373 ? 4.137   -45.261 100.702 1.00 52.56  ? 373 ILE B CG1 1 
ATOM   5660  C CG2 . ILE B 2 373 ? 3.541   -47.580 101.384 1.00 55.60  ? 373 ILE B CG2 1 
ATOM   5661  C CD1 . ILE B 2 373 ? 4.624   -45.790 99.346  1.00 49.07  ? 373 ILE B CD1 1 
ATOM   5662  N N   . SER B 2 374 ? 4.282   -47.135 104.917 1.00 68.83  ? 374 SER B N   1 
ATOM   5663  C CA  . SER B 2 374 ? 4.194   -48.250 105.857 1.00 75.10  ? 374 SER B CA  1 
ATOM   5664  C C   . SER B 2 374 ? 3.026   -48.105 106.830 1.00 65.56  ? 374 SER B C   1 
ATOM   5665  O O   . SER B 2 374 ? 3.198   -47.691 107.972 1.00 52.51  ? 374 SER B O   1 
ATOM   5666  C CB  . SER B 2 374 ? 5.494   -48.404 106.649 1.00 73.83  ? 374 SER B CB  1 
ATOM   5667  O OG  . SER B 2 374 ? 5.657   -47.336 107.564 1.00 93.23  ? 374 SER B OG  1 
ATOM   5668  N N   . MET C 1 4   ? -1.156  3.160   63.260  1.00 91.72  ? 4   MET C N   1 
ATOM   5669  C CA  . MET C 1 4   ? 0.196   3.570   63.622  1.00 84.54  ? 4   MET C CA  1 
ATOM   5670  C C   . MET C 1 4   ? 0.313   3.815   65.124  1.00 82.38  ? 4   MET C C   1 
ATOM   5671  O O   . MET C 1 4   ? -0.397  4.652   65.681  1.00 80.96  ? 4   MET C O   1 
ATOM   5672  C CB  . MET C 1 4   ? 0.599   4.828   62.849  1.00 76.16  ? 4   MET C CB  1 
ATOM   5673  N N   . ASP C 1 5   ? 1.215   3.082   65.772  1.00 85.71  ? 5   ASP C N   1 
ATOM   5674  C CA  . ASP C 1 5   ? 1.473   3.263   67.198  1.00 88.94  ? 5   ASP C CA  1 
ATOM   5675  C C   . ASP C 1 5   ? 2.778   4.022   67.434  1.00 81.15  ? 5   ASP C C   1 
ATOM   5676  O O   . ASP C 1 5   ? 3.500   4.337   66.488  1.00 77.58  ? 5   ASP C O   1 
ATOM   5677  C CB  . ASP C 1 5   ? 1.512   1.909   67.910  1.00 90.26  ? 5   ASP C CB  1 
ATOM   5678  N N   . LYS C 1 6   ? 3.079   4.306   68.698  1.00 75.54  ? 6   LYS C N   1 
ATOM   5679  C CA  . LYS C 1 6   ? 4.209   5.169   69.042  1.00 70.96  ? 6   LYS C CA  1 
ATOM   5680  C C   . LYS C 1 6   ? 4.852   4.801   70.379  1.00 64.70  ? 6   LYS C C   1 
ATOM   5681  O O   . LYS C 1 6   ? 4.251   4.108   71.201  1.00 57.73  ? 6   LYS C O   1 
ATOM   5682  C CB  . LYS C 1 6   ? 3.766   6.634   69.068  1.00 66.04  ? 6   LYS C CB  1 
ATOM   5683  C CG  . LYS C 1 6   ? 2.735   6.952   70.136  1.00 42.71  ? 6   LYS C CG  1 
ATOM   5684  N N   . LEU C 1 7   ? 6.080   5.272   70.584  1.00 66.07  ? 7   LEU C N   1 
ATOM   5685  C CA  . LEU C 1 7   ? 6.813   5.040   71.827  1.00 55.85  ? 7   LEU C CA  1 
ATOM   5686  C C   . LEU C 1 7   ? 6.576   6.140   72.870  1.00 68.49  ? 7   LEU C C   1 
ATOM   5687  O O   . LEU C 1 7   ? 6.398   7.306   72.519  1.00 65.66  ? 7   LEU C O   1 
ATOM   5688  C CB  . LEU C 1 7   ? 8.313   4.917   71.532  1.00 56.15  ? 7   LEU C CB  1 
ATOM   5689  C CG  . LEU C 1 7   ? 8.780   3.630   70.850  1.00 54.81  ? 7   LEU C CG  1 
ATOM   5690  C CD1 . LEU C 1 7   ? 10.047  3.878   70.045  1.00 42.68  ? 7   LEU C CD1 1 
ATOM   5691  C CD2 . LEU C 1 7   ? 9.000   2.530   71.878  1.00 46.99  ? 7   LEU C CD2 1 
ATOM   5692  N N   . PRO C 1 8   ? 6.577   5.758   74.161  1.00 73.72  ? 8   PRO C N   1 
ATOM   5693  C CA  . PRO C 1 8   ? 6.379   6.620   75.338  1.00 68.33  ? 8   PRO C CA  1 
ATOM   5694  C C   . PRO C 1 8   ? 7.643   7.360   75.798  1.00 68.38  ? 8   PRO C C   1 
ATOM   5695  O O   . PRO C 1 8   ? 8.366   6.847   76.652  1.00 69.75  ? 8   PRO C O   1 
ATOM   5696  C CB  . PRO C 1 8   ? 5.913   5.634   76.412  1.00 58.25  ? 8   PRO C CB  1 
ATOM   5697  C CG  . PRO C 1 8   ? 6.534   4.343   76.029  1.00 54.95  ? 8   PRO C CG  1 
ATOM   5698  C CD  . PRO C 1 8   ? 6.627   4.330   74.530  1.00 65.32  ? 8   PRO C CD  1 
ATOM   5699  N N   . ILE C 1 9   ? 7.904   8.539   75.236  1.00 59.45  ? 9   ILE C N   1 
ATOM   5700  C CA  . ILE C 1 9   ? 9.105   9.312   75.568  1.00 62.87  ? 9   ILE C CA  1 
ATOM   5701  C C   . ILE C 1 9   ? 9.259   9.692   77.049  1.00 69.33  ? 9   ILE C C   1 
ATOM   5702  O O   . ILE C 1 9   ? 10.370  9.983   77.495  1.00 75.53  ? 9   ILE C O   1 
ATOM   5703  C CB  . ILE C 1 9   ? 9.183   10.606  74.718  1.00 63.95  ? 9   ILE C CB  1 
ATOM   5704  C CG1 . ILE C 1 9   ? 7.789   11.108  74.333  1.00 77.16  ? 9   ILE C CG1 1 
ATOM   5705  C CG2 . ILE C 1 9   ? 9.984   10.355  73.455  1.00 74.21  ? 9   ILE C CG2 1 
ATOM   5706  C CD1 . ILE C 1 9   ? 7.035   11.792  75.443  1.00 82.58  ? 9   ILE C CD1 1 
ATOM   5707  N N   . GLU C 1 10  ? 8.164   9.700   77.806  1.00 83.75  ? 10  GLU C N   1 
ATOM   5708  C CA  . GLU C 1 10  ? 8.227   10.089  79.218  1.00 77.27  ? 10  GLU C CA  1 
ATOM   5709  C C   . GLU C 1 10  ? 8.753   8.942   80.079  1.00 74.73  ? 10  GLU C C   1 
ATOM   5710  O O   . GLU C 1 10  ? 9.094   9.140   81.245  1.00 70.18  ? 10  GLU C O   1 
ATOM   5711  C CB  . GLU C 1 10  ? 6.865   10.543  79.759  1.00 71.21  ? 10  GLU C CB  1 
ATOM   5712  C CG  . GLU C 1 10  ? 5.888   11.074  78.737  1.00 94.09  ? 10  GLU C CG  1 
ATOM   5713  C CD  . GLU C 1 10  ? 5.039   9.978   78.127  1.00 110.12 ? 10  GLU C CD  1 
ATOM   5714  O OE1 . GLU C 1 10  ? 4.526   9.128   78.886  1.00 127.18 ? 10  GLU C OE1 1 
ATOM   5715  O OE2 . GLU C 1 10  ? 4.876   9.968   76.890  1.00 105.06 ? 10  GLU C OE2 1 
ATOM   5716  N N   . GLU C 1 11  ? 8.816   7.745   79.503  1.00 78.33  ? 11  GLU C N   1 
ATOM   5717  C CA  . GLU C 1 11  ? 9.334   6.583   80.215  1.00 71.41  ? 11  GLU C CA  1 
ATOM   5718  C C   . GLU C 1 11  ? 10.807  6.339   79.915  1.00 71.77  ? 11  GLU C C   1 
ATOM   5719  O O   . GLU C 1 11  ? 11.373  5.331   80.336  1.00 67.87  ? 11  GLU C O   1 
ATOM   5720  C CB  . GLU C 1 11  ? 8.567   5.328   79.802  1.00 67.49  ? 11  GLU C CB  1 
ATOM   5721  C CG  . GLU C 1 11  ? 7.122   5.196   80.226  1.00 76.83  ? 11  GLU C CG  1 
ATOM   5722  C CD  . GLU C 1 11  ? 6.552   3.870   79.763  1.00 91.54  ? 11  GLU C CD  1 
ATOM   5723  O OE1 . GLU C 1 11  ? 7.312   3.116   79.124  1.00 87.39  ? 11  GLU C OE1 1 
ATOM   5724  O OE2 . GLU C 1 11  ? 5.365   3.581   80.020  1.00 98.55  ? 11  GLU C OE2 1 
ATOM   5725  N N   . THR C 1 12  ? 11.434  7.276   79.215  1.00 67.22  ? 12  THR C N   1 
ATOM   5726  C CA  . THR C 1 12  ? 12.860  7.178   78.913  1.00 64.75  ? 12  THR C CA  1 
ATOM   5727  C C   . THR C 1 12  ? 13.778  7.422   80.108  1.00 56.81  ? 12  THR C C   1 
ATOM   5728  O O   . THR C 1 12  ? 14.850  6.826   80.202  1.00 71.07  ? 12  THR C O   1 
ATOM   5729  C CB  . THR C 1 12  ? 13.247  8.162   77.797  1.00 70.07  ? 12  THR C CB  1 
ATOM   5730  O OG1 . THR C 1 12  ? 12.789  9.473   78.146  1.00 73.91  ? 12  THR C OG1 1 
ATOM   5731  C CG2 . THR C 1 12  ? 12.608  7.748   76.479  1.00 57.24  ? 12  THR C CG2 1 
ATOM   5732  N N   . LEU C 1 13  ? 13.360  8.293   81.019  1.00 56.34  ? 13  LEU C N   1 
ATOM   5733  C CA  . LEU C 1 13  ? 14.194  8.630   82.166  1.00 44.65  ? 13  LEU C CA  1 
ATOM   5734  C C   . LEU C 1 13  ? 14.258  7.473   83.154  1.00 54.89  ? 13  LEU C C   1 
ATOM   5735  O O   . LEU C 1 13  ? 15.330  7.131   83.651  1.00 46.27  ? 13  LEU C O   1 
ATOM   5736  C CB  . LEU C 1 13  ? 13.674  9.891   82.857  1.00 42.84  ? 13  LEU C CB  1 
ATOM   5737  C CG  . LEU C 1 13  ? 14.473  10.374  84.070  1.00 52.02  ? 13  LEU C CG  1 
ATOM   5738  C CD1 . LEU C 1 13  ? 15.900  10.722  83.674  1.00 52.48  ? 13  LEU C CD1 1 
ATOM   5739  C CD2 . LEU C 1 13  ? 13.787  11.564  84.719  1.00 44.31  ? 13  LEU C CD2 1 
ATOM   5740  N N   . GLU C 1 14  ? 13.104  6.872   83.431  1.00 56.99  ? 14  GLU C N   1 
ATOM   5741  C CA  . GLU C 1 14  ? 13.026  5.739   84.347  1.00 58.57  ? 14  GLU C CA  1 
ATOM   5742  C C   . GLU C 1 14  ? 13.761  4.531   83.776  1.00 53.65  ? 14  GLU C C   1 
ATOM   5743  O O   . GLU C 1 14  ? 14.384  3.767   84.515  1.00 67.05  ? 14  GLU C O   1 
ATOM   5744  C CB  . GLU C 1 14  ? 11.565  5.387   84.644  1.00 67.85  ? 14  GLU C CB  1 
ATOM   5745  C CG  . GLU C 1 14  ? 11.379  4.217   85.604  1.00 64.88  ? 14  GLU C CG  1 
ATOM   5746  C CD  . GLU C 1 14  ? 11.645  4.581   87.056  1.00 75.69  ? 14  GLU C CD  1 
ATOM   5747  O OE1 . GLU C 1 14  ? 12.081  5.720   87.326  1.00 75.29  ? 14  GLU C OE1 1 
ATOM   5748  O OE2 . GLU C 1 14  ? 11.416  3.720   87.932  1.00 68.66  ? 14  GLU C OE2 1 
ATOM   5749  N N   . ASP C 1 15  ? 13.670  4.368   82.458  1.00 53.64  ? 15  ASP C N   1 
ATOM   5750  C CA  . ASP C 1 15  ? 14.400  3.328   81.734  1.00 55.77  ? 15  ASP C CA  1 
ATOM   5751  C C   . ASP C 1 15  ? 14.043  1.916   82.204  1.00 52.96  ? 15  ASP C C   1 
ATOM   5752  O O   . ASP C 1 15  ? 14.922  1.076   82.399  1.00 52.40  ? 15  ASP C O   1 
ATOM   5753  C CB  . ASP C 1 15  ? 15.911  3.563   81.860  1.00 69.27  ? 15  ASP C CB  1 
ATOM   5754  C CG  . ASP C 1 15  ? 16.714  2.774   80.844  1.00 81.27  ? 15  ASP C CG  1 
ATOM   5755  O OD1 . ASP C 1 15  ? 16.187  2.506   79.743  1.00 82.35  ? 15  ASP C OD1 1 
ATOM   5756  O OD2 . ASP C 1 15  ? 17.873  2.420   81.149  1.00 75.20  ? 15  ASP C OD2 1 
ATOM   5757  N N   . SER C 1 16  ? 12.752  1.661   82.397  1.00 57.60  ? 16  SER C N   1 
ATOM   5758  C CA  . SER C 1 16  ? 12.289  0.331   82.780  1.00 47.97  ? 16  SER C CA  1 
ATOM   5759  C C   . SER C 1 16  ? 12.614  -0.682  81.683  1.00 46.23  ? 16  SER C C   1 
ATOM   5760  O O   . SER C 1 16  ? 12.642  -0.331  80.504  1.00 57.23  ? 16  SER C O   1 
ATOM   5761  C CB  . SER C 1 16  ? 10.785  0.349   83.064  1.00 56.45  ? 16  SER C CB  1 
ATOM   5762  O OG  . SER C 1 16  ? 10.257  -0.964  83.138  1.00 69.39  ? 16  SER C OG  1 
ATOM   5763  N N   . PRO C 1 17  ? 12.866  -1.943  82.069  1.00 45.49  ? 17  PRO C N   1 
ATOM   5764  C CA  . PRO C 1 17  ? 13.099  -3.024  81.104  1.00 51.94  ? 17  PRO C CA  1 
ATOM   5765  C C   . PRO C 1 17  ? 11.933  -3.236  80.147  1.00 46.42  ? 17  PRO C C   1 
ATOM   5766  O O   . PRO C 1 17  ? 12.140  -3.678  79.018  1.00 68.25  ? 17  PRO C O   1 
ATOM   5767  C CB  . PRO C 1 17  ? 13.284  -4.252  81.999  1.00 51.93  ? 17  PRO C CB  1 
ATOM   5768  C CG  . PRO C 1 17  ? 13.822  -3.700  83.261  1.00 53.71  ? 17  PRO C CG  1 
ATOM   5769  C CD  . PRO C 1 17  ? 13.109  -2.389  83.451  1.00 50.16  ? 17  PRO C CD  1 
ATOM   5770  N N   . GLN C 1 18  ? 10.723  -2.930  80.601  1.00 49.09  ? 18  GLN C N   1 
ATOM   5771  C CA  . GLN C 1 18  ? 9.545   -3.003  79.750  1.00 49.45  ? 18  GLN C CA  1 
ATOM   5772  C C   . GLN C 1 18  ? 9.660   -1.995  78.608  1.00 55.24  ? 18  GLN C C   1 
ATOM   5773  O O   . GLN C 1 18  ? 9.414   -2.329  77.448  1.00 48.37  ? 18  GLN C O   1 
ATOM   5774  C CB  . GLN C 1 18  ? 8.273   -2.765  80.562  1.00 59.60  ? 18  GLN C CB  1 
ATOM   5775  C CG  . GLN C 1 18  ? 7.246   -3.874  80.394  1.00 78.57  ? 18  GLN C CG  1 
ATOM   5776  C CD  . GLN C 1 18  ? 7.660   -5.150  81.110  1.00 104.69 ? 18  GLN C CD  1 
ATOM   5777  O OE1 . GLN C 1 18  ? 7.734   -5.189  82.339  1.00 104.12 ? 18  GLN C OE1 1 
ATOM   5778  N NE2 . GLN C 1 18  ? 7.949   -6.195  80.342  1.00 104.87 ? 18  GLN C NE2 1 
ATOM   5779  N N   . THR C 1 19  ? 10.021  -0.760  78.950  1.00 45.86  ? 19  THR C N   1 
ATOM   5780  C CA  . THR C 1 19  ? 10.214  0.292   77.957  1.00 45.15  ? 19  THR C CA  1 
ATOM   5781  C C   . THR C 1 19  ? 11.242  -0.139  76.913  1.00 54.94  ? 19  THR C C   1 
ATOM   5782  O O   . THR C 1 19  ? 11.042  0.055   75.711  1.00 58.12  ? 19  THR C O   1 
ATOM   5783  C CB  . THR C 1 19  ? 10.677  1.608   78.613  1.00 41.88  ? 19  THR C CB  1 
ATOM   5784  O OG1 . THR C 1 19  ? 9.751   1.986   79.640  1.00 53.41  ? 19  THR C OG1 1 
ATOM   5785  C CG2 . THR C 1 19  ? 10.764  2.720   77.579  1.00 44.88  ? 19  THR C CG2 1 
ATOM   5786  N N   . ARG C 1 20  ? 12.336  -0.732  77.382  1.00 46.13  ? 20  ARG C N   1 
ATOM   5787  C CA  . ARG C 1 20  ? 13.350  -1.286  76.492  1.00 40.48  ? 20  ARG C CA  1 
ATOM   5788  C C   . ARG C 1 20  ? 12.799  -2.409  75.620  1.00 39.38  ? 20  ARG C C   1 
ATOM   5789  O O   . ARG C 1 20  ? 13.211  -2.559  74.475  1.00 59.75  ? 20  ARG C O   1 
ATOM   5790  C CB  . ARG C 1 20  ? 14.559  -1.787  77.283  1.00 44.80  ? 20  ARG C CB  1 
ATOM   5791  C CG  . ARG C 1 20  ? 15.524  -0.693  77.707  1.00 50.93  ? 20  ARG C CG  1 
ATOM   5792  C CD  . ARG C 1 20  ? 16.941  -1.242  77.742  1.00 78.58  ? 20  ARG C CD  1 
ATOM   5793  N NE  . ARG C 1 20  ? 17.935  -0.303  77.229  1.00 65.24  ? 20  ARG C NE  1 
ATOM   5794  C CZ  . ARG C 1 20  ? 18.572  0.595   77.975  1.00 70.16  ? 20  ARG C CZ  1 
ATOM   5795  N NH1 . ARG C 1 20  ? 19.466  1.403   77.425  1.00 74.82  ? 20  ARG C NH1 1 
ATOM   5796  N NH2 . ARG C 1 20  ? 18.315  0.686   79.270  1.00 70.62  ? 20  ARG C NH2 1 
ATOM   5797  N N   . SER C 1 21  ? 11.892  -3.210  76.170  1.00 39.43  ? 21  SER C N   1 
ATOM   5798  C CA  . SER C 1 21  ? 11.265  -4.288  75.408  1.00 49.80  ? 21  SER C CA  1 
ATOM   5799  C C   . SER C 1 21  ? 10.429  -3.719  74.263  1.00 50.04  ? 21  SER C C   1 
ATOM   5800  O O   . SER C 1 21  ? 10.506  -4.193  73.127  1.00 50.80  ? 21  SER C O   1 
ATOM   5801  C CB  . SER C 1 21  ? 10.399  -5.162  76.317  1.00 45.59  ? 21  SER C CB  1 
ATOM   5802  O OG  . SER C 1 21  ? 11.181  -5.791  77.316  1.00 68.27  ? 21  SER C OG  1 
ATOM   5803  N N   . LEU C 1 22  ? 9.628   -2.706  74.579  1.00 44.43  ? 22  LEU C N   1 
ATOM   5804  C CA  . LEU C 1 22  ? 8.818   -2.010  73.585  1.00 46.84  ? 22  LEU C CA  1 
ATOM   5805  C C   . LEU C 1 22  ? 9.715   -1.429  72.496  1.00 45.61  ? 22  LEU C C   1 
ATOM   5806  O O   . LEU C 1 22  ? 9.429   -1.546  71.291  1.00 52.47  ? 22  LEU C O   1 
ATOM   5807  C CB  . LEU C 1 22  ? 7.995   -0.906  74.251  1.00 42.43  ? 22  LEU C CB  1 
ATOM   5808  C CG  . LEU C 1 22  ? 6.877   -0.256  73.437  1.00 55.11  ? 22  LEU C CG  1 
ATOM   5809  C CD1 . LEU C 1 22  ? 6.055   -1.311  72.714  1.00 58.40  ? 22  LEU C CD1 1 
ATOM   5810  C CD2 . LEU C 1 22  ? 5.996   0.595   74.338  1.00 52.13  ? 22  LEU C CD2 1 
ATOM   5811  N N   . LEU C 1 23  ? 10.809  -0.809  72.934  1.00 44.96  ? 23  LEU C N   1 
ATOM   5812  C CA  . LEU C 1 23  ? 11.821  -0.303  72.018  1.00 52.91  ? 23  LEU C CA  1 
ATOM   5813  C C   . LEU C 1 23  ? 12.306  -1.421  71.108  1.00 39.62  ? 23  LEU C C   1 
ATOM   5814  O O   . LEU C 1 23  ? 12.452  -1.223  69.910  1.00 38.64  ? 23  LEU C O   1 
ATOM   5815  C CB  . LEU C 1 23  ? 13.003  0.298   72.781  1.00 52.12  ? 23  LEU C CB  1 
ATOM   5816  C CG  . LEU C 1 23  ? 14.207  0.676   71.914  1.00 44.49  ? 23  LEU C CG  1 
ATOM   5817  C CD1 . LEU C 1 23  ? 13.825  1.752   70.912  1.00 43.02  ? 23  LEU C CD1 1 
ATOM   5818  C CD2 . LEU C 1 23  ? 15.385  1.124   72.766  1.00 48.40  ? 23  LEU C CD2 1 
ATOM   5819  N N   . GLY C 1 24  ? 12.539  -2.595  71.687  1.00 32.13  ? 24  GLY C N   1 
ATOM   5820  C CA  . GLY C 1 24  ? 12.964  -3.763  70.938  1.00 38.79  ? 24  GLY C CA  1 
ATOM   5821  C C   . GLY C 1 24  ? 11.968  -4.174  69.874  1.00 50.41  ? 24  GLY C C   1 
ATOM   5822  O O   . GLY C 1 24  ? 12.352  -4.553  68.766  1.00 50.89  ? 24  GLY C O   1 
ATOM   5823  N N   . VAL C 1 25  ? 10.684  -4.105  70.214  1.00 42.60  ? 25  VAL C N   1 
ATOM   5824  C CA  . VAL C 1 25  ? 9.621   -4.380  69.254  1.00 47.14  ? 25  VAL C CA  1 
ATOM   5825  C C   . VAL C 1 25  ? 9.713   -3.416  68.075  1.00 46.65  ? 25  VAL C C   1 
ATOM   5826  O O   . VAL C 1 25  ? 9.718   -3.833  66.906  1.00 43.84  ? 25  VAL C O   1 
ATOM   5827  C CB  . VAL C 1 25  ? 8.229   -4.268  69.906  1.00 49.67  ? 25  VAL C CB  1 
ATOM   5828  C CG1 . VAL C 1 25  ? 7.143   -4.231  68.844  1.00 50.47  ? 25  VAL C CG1 1 
ATOM   5829  C CG2 . VAL C 1 25  ? 8.000   -5.424  70.867  1.00 52.51  ? 25  VAL C CG2 1 
ATOM   5830  N N   . PHE C 1 26  ? 9.806   -2.126  68.388  1.00 42.76  ? 26  PHE C N   1 
ATOM   5831  C CA  . PHE C 1 26  ? 9.950   -1.108  67.350  1.00 37.43  ? 26  PHE C CA  1 
ATOM   5832  C C   . PHE C 1 26  ? 11.198  -1.333  66.491  1.00 54.78  ? 26  PHE C C   1 
ATOM   5833  O O   . PHE C 1 26  ? 11.182  -1.078  65.289  1.00 54.83  ? 26  PHE C O   1 
ATOM   5834  C CB  . PHE C 1 26  ? 9.979   0.289   67.968  1.00 39.46  ? 26  PHE C CB  1 
ATOM   5835  C CG  . PHE C 1 26  ? 8.616   0.888   68.167  1.00 55.28  ? 26  PHE C CG  1 
ATOM   5836  C CD1 . PHE C 1 26  ? 7.800   0.463   69.204  1.00 52.26  ? 26  PHE C CD1 1 
ATOM   5837  C CD2 . PHE C 1 26  ? 8.144   1.869   67.309  1.00 44.39  ? 26  PHE C CD2 1 
ATOM   5838  C CE1 . PHE C 1 26  ? 6.545   1.012   69.386  1.00 50.14  ? 26  PHE C CE1 1 
ATOM   5839  C CE2 . PHE C 1 26  ? 6.889   2.420   67.484  1.00 54.74  ? 26  PHE C CE2 1 
ATOM   5840  C CZ  . PHE C 1 26  ? 6.088   1.991   68.525  1.00 62.38  ? 26  PHE C CZ  1 
ATOM   5841  N N   . GLU C 1 27  ? 12.275  -1.799  67.116  1.00 51.84  ? 27  GLU C N   1 
ATOM   5842  C CA  . GLU C 1 27  ? 13.518  -2.102  66.412  1.00 44.88  ? 27  GLU C CA  1 
ATOM   5843  C C   . GLU C 1 27  ? 13.332  -3.263  65.442  1.00 45.38  ? 27  GLU C C   1 
ATOM   5844  O O   . GLU C 1 27  ? 13.841  -3.230  64.321  1.00 54.99  ? 27  GLU C O   1 
ATOM   5845  C CB  . GLU C 1 27  ? 14.639  -2.419  67.406  1.00 42.65  ? 27  GLU C CB  1 
ATOM   5846  C CG  . GLU C 1 27  ? 15.059  -1.237  68.265  1.00 41.82  ? 27  GLU C CG  1 
ATOM   5847  C CD  . GLU C 1 27  ? 16.393  -1.454  68.950  1.00 53.40  ? 27  GLU C CD  1 
ATOM   5848  O OE1 . GLU C 1 27  ? 16.445  -1.376  70.196  1.00 62.42  ? 27  GLU C OE1 1 
ATOM   5849  O OE2 . GLU C 1 27  ? 17.393  -1.696  68.244  1.00 84.38  ? 27  GLU C OE2 1 
ATOM   5850  N N   . GLU C 1 28  ? 12.615  -4.291  65.887  1.00 45.08  ? 28  GLU C N   1 
ATOM   5851  C CA  . GLU C 1 28  ? 12.270  -5.421  65.030  1.00 45.01  ? 28  GLU C CA  1 
ATOM   5852  C C   . GLU C 1 28  ? 11.507  -4.933  63.805  1.00 53.39  ? 28  GLU C C   1 
ATOM   5853  O O   . GLU C 1 28  ? 11.838  -5.277  62.659  1.00 52.84  ? 28  GLU C O   1 
ATOM   5854  C CB  . GLU C 1 28  ? 11.427  -6.444  65.794  1.00 52.58  ? 28  GLU C CB  1 
ATOM   5855  C CG  . GLU C 1 28  ? 12.191  -7.658  66.288  1.00 67.98  ? 28  GLU C CG  1 
ATOM   5856  C CD  . GLU C 1 28  ? 11.279  -8.690  66.926  1.00 97.01  ? 28  GLU C CD  1 
ATOM   5857  O OE1 . GLU C 1 28  ? 10.453  -9.282  66.199  1.00 73.46  ? 28  GLU C OE1 1 
ATOM   5858  O OE2 . GLU C 1 28  ? 11.387  -8.909  68.152  1.00 117.18 ? 28  GLU C OE2 1 
ATOM   5859  N N   . ASP C 1 29  ? 10.485  -4.120  64.059  1.00 49.83  ? 29  ASP C N   1 
ATOM   5860  C CA  . ASP C 1 29  ? 9.668   -3.578  62.982  1.00 60.52  ? 29  ASP C CA  1 
ATOM   5861  C C   . ASP C 1 29  ? 10.508  -2.759  62.007  1.00 57.68  ? 29  ASP C C   1 
ATOM   5862  O O   . ASP C 1 29  ? 10.353  -2.882  60.795  1.00 50.17  ? 29  ASP C O   1 
ATOM   5863  C CB  . ASP C 1 29  ? 8.533   -2.722  63.545  1.00 51.93  ? 29  ASP C CB  1 
ATOM   5864  C CG  . ASP C 1 29  ? 7.901   -1.833  62.493  1.00 75.65  ? 29  ASP C CG  1 
ATOM   5865  O OD1 . ASP C 1 29  ? 8.152   -0.610  62.522  1.00 78.05  ? 29  ASP C OD1 1 
ATOM   5866  O OD2 . ASP C 1 29  ? 7.159   -2.356  61.633  1.00 58.63  ? 29  ASP C OD2 1 
ATOM   5867  N N   . ALA C 1 30  ? 11.408  -1.940  62.543  1.00 44.91  ? 30  ALA C N   1 
ATOM   5868  C CA  . ALA C 1 30  ? 12.270  -1.095  61.723  1.00 41.40  ? 30  ALA C CA  1 
ATOM   5869  C C   . ALA C 1 30  ? 13.214  -1.944  60.878  1.00 44.38  ? 30  ALA C C   1 
ATOM   5870  O O   . ALA C 1 30  ? 13.563  -1.575  59.754  1.00 41.95  ? 30  ALA C O   1 
ATOM   5871  C CB  . ALA C 1 30  ? 13.057  -0.132  62.599  1.00 32.59  ? 30  ALA C CB  1 
ATOM   5872  N N   . THR C 1 31  ? 13.627  -3.080  61.430  1.00 40.46  ? 31  THR C N   1 
ATOM   5873  C CA  . THR C 1 31  ? 14.454  -4.030  60.697  1.00 49.14  ? 31  THR C CA  1 
ATOM   5874  C C   . THR C 1 31  ? 13.686  -4.594  59.506  1.00 43.13  ? 31  THR C C   1 
ATOM   5875  O O   . THR C 1 31  ? 14.188  -4.593  58.374  1.00 57.70  ? 31  THR C O   1 
ATOM   5876  C CB  . THR C 1 31  ? 14.925  -5.185  61.600  1.00 40.20  ? 31  THR C CB  1 
ATOM   5877  O OG1 . THR C 1 31  ? 15.757  -4.666  62.644  1.00 53.14  ? 31  THR C OG1 1 
ATOM   5878  C CG2 . THR C 1 31  ? 15.711  -6.206  60.794  1.00 45.12  ? 31  THR C CG2 1 
ATOM   5879  N N   . ALA C 1 32  ? 12.468  -5.067  59.764  1.00 48.14  ? 32  ALA C N   1 
ATOM   5880  C CA  . ALA C 1 32  ? 11.619  -5.595  58.696  1.00 53.35  ? 32  ALA C CA  1 
ATOM   5881  C C   . ALA C 1 32  ? 11.387  -4.543  57.608  1.00 44.71  ? 32  ALA C C   1 
ATOM   5882  O O   . ALA C 1 32  ? 11.441  -4.846  56.407  1.00 41.95  ? 32  ALA C O   1 
ATOM   5883  C CB  . ALA C 1 32  ? 10.293  -6.074  59.263  1.00 46.82  ? 32  ALA C CB  1 
ATOM   5884  N N   . ILE C 1 33  ? 11.138  -3.310  58.045  1.00 40.19  ? 33  ILE C N   1 
ATOM   5885  C CA  . ILE C 1 33  ? 10.998  -2.172  57.144  1.00 33.67  ? 33  ILE C CA  1 
ATOM   5886  C C   . ILE C 1 33  ? 12.221  -2.032  56.255  1.00 42.15  ? 33  ILE C C   1 
ATOM   5887  O O   . ILE C 1 33  ? 12.102  -1.951  55.037  1.00 49.57  ? 33  ILE C O   1 
ATOM   5888  C CB  . ILE C 1 33  ? 10.813  -0.848  57.909  1.00 32.08  ? 33  ILE C CB  1 
ATOM   5889  C CG1 . ILE C 1 33  ? 9.484   -0.819  58.657  1.00 51.31  ? 33  ILE C CG1 1 
ATOM   5890  C CG2 . ILE C 1 33  ? 10.904  0.339   56.959  1.00 32.88  ? 33  ILE C CG2 1 
ATOM   5891  C CD1 . ILE C 1 33  ? 9.431   0.269   59.699  1.00 50.73  ? 33  ILE C CD1 1 
ATOM   5892  N N   . SER C 1 34  ? 13.397  -2.007  56.878  1.00 51.05  ? 34  SER C N   1 
ATOM   5893  C CA  . SER C 1 34  ? 14.651  -1.839  56.152  1.00 53.86  ? 34  SER C CA  1 
ATOM   5894  C C   . SER C 1 34  ? 14.833  -2.926  55.098  1.00 50.30  ? 34  SER C C   1 
ATOM   5895  O O   . SER C 1 34  ? 15.204  -2.642  53.954  1.00 55.71  ? 34  SER C O   1 
ATOM   5896  C CB  . SER C 1 34  ? 15.833  -1.843  57.121  1.00 58.13  ? 34  SER C CB  1 
ATOM   5897  O OG  . SER C 1 34  ? 17.058  -1.664  56.430  1.00 58.05  ? 34  SER C OG  1 
ATOM   5898  N N   . ASN C 1 35  ? 14.556  -4.168  55.487  1.00 43.31  ? 35  ASN C N   1 
ATOM   5899  C CA  . ASN C 1 35  ? 14.658  -5.292  54.563  1.00 50.36  ? 35  ASN C CA  1 
ATOM   5900  C C   . ASN C 1 35  ? 13.731  -5.142  53.357  1.00 45.78  ? 35  ASN C C   1 
ATOM   5901  O O   . ASN C 1 35  ? 14.185  -5.176  52.200  1.00 65.17  ? 35  ASN C O   1 
ATOM   5902  C CB  . ASN C 1 35  ? 14.355  -6.604  55.288  1.00 46.94  ? 35  ASN C CB  1 
ATOM   5903  C CG  . ASN C 1 35  ? 15.475  -7.028  56.218  1.00 64.68  ? 35  ASN C CG  1 
ATOM   5904  O OD1 . ASN C 1 35  ? 16.649  -6.986  55.852  1.00 69.57  ? 35  ASN C OD1 1 
ATOM   5905  N ND2 . ASN C 1 35  ? 15.115  -7.441  57.428  1.00 77.95  ? 35  ASN C ND2 1 
ATOM   5906  N N   . TYR C 1 36  ? 12.437  -4.971  53.626  1.00 50.26  ? 36  TYR C N   1 
ATOM   5907  C CA  . TYR C 1 36  ? 11.468  -4.848  52.541  1.00 51.62  ? 36  TYR C CA  1 
ATOM   5908  C C   . TYR C 1 36  ? 11.792  -3.670  51.627  1.00 55.13  ? 36  TYR C C   1 
ATOM   5909  O O   . TYR C 1 36  ? 11.732  -3.796  50.408  1.00 57.92  ? 36  TYR C O   1 
ATOM   5910  C CB  . TYR C 1 36  ? 10.041  -4.703  53.068  1.00 46.07  ? 36  TYR C CB  1 
ATOM   5911  C CG  . TYR C 1 36  ? 9.040   -4.581  51.940  1.00 46.93  ? 36  TYR C CG  1 
ATOM   5912  C CD1 . TYR C 1 36  ? 8.618   -5.704  51.240  1.00 41.48  ? 36  TYR C CD1 1 
ATOM   5913  C CD2 . TYR C 1 36  ? 8.541   -3.344  51.554  1.00 32.29  ? 36  TYR C CD2 1 
ATOM   5914  C CE1 . TYR C 1 36  ? 7.717   -5.600  50.198  1.00 41.21  ? 36  TYR C CE1 1 
ATOM   5915  C CE2 . TYR C 1 36  ? 7.642   -3.232  50.513  1.00 41.93  ? 36  TYR C CE2 1 
ATOM   5916  C CZ  . TYR C 1 36  ? 7.232   -4.362  49.839  1.00 57.00  ? 36  TYR C CZ  1 
ATOM   5917  O OH  . TYR C 1 36  ? 6.333   -4.253  48.801  1.00 58.59  ? 36  TYR C OH  1 
ATOM   5918  N N   . MET C 1 37  ? 12.119  -2.527  52.222  1.00 48.98  ? 37  MET C N   1 
ATOM   5919  C CA  . MET C 1 37  ? 12.450  -1.331  51.454  1.00 47.49  ? 37  MET C CA  1 
ATOM   5920  C C   . MET C 1 37  ? 13.694  -1.547  50.602  1.00 56.31  ? 37  MET C C   1 
ATOM   5921  O O   . MET C 1 37  ? 13.816  -0.976  49.518  1.00 46.79  ? 37  MET C O   1 
ATOM   5922  C CB  . MET C 1 37  ? 12.646  -0.128  52.379  1.00 51.50  ? 37  MET C CB  1 
ATOM   5923  C CG  . MET C 1 37  ? 11.370  0.352   53.053  1.00 54.82  ? 37  MET C CG  1 
ATOM   5924  S SD  . MET C 1 37  ? 10.071  0.751   51.868  1.00 62.56  ? 37  MET C SD  1 
ATOM   5925  C CE  . MET C 1 37  ? 10.867  2.044   50.918  1.00 62.50  ? 37  MET C CE  1 
ATOM   5926  N N   . ASN C 1 38  ? 14.623  -2.362  51.093  1.00 60.67  ? 38  ASN C N   1 
ATOM   5927  C CA  . ASN C 1 38  ? 15.801  -2.695  50.302  1.00 54.06  ? 38  ASN C CA  1 
ATOM   5928  C C   . ASN C 1 38  ? 15.436  -3.567  49.103  1.00 45.25  ? 38  ASN C C   1 
ATOM   5929  O O   . ASN C 1 38  ? 15.937  -3.348  47.996  1.00 58.23  ? 38  ASN C O   1 
ATOM   5930  C CB  . ASN C 1 38  ? 16.863  -3.382  51.160  1.00 45.74  ? 38  ASN C CB  1 
ATOM   5931  C CG  . ASN C 1 38  ? 17.978  -2.436  51.567  1.00 59.99  ? 38  ASN C CG  1 
ATOM   5932  O OD1 . ASN C 1 38  ? 18.893  -2.169  50.788  1.00 73.31  ? 38  ASN C OD1 1 
ATOM   5933  N ND2 . ASN C 1 38  ? 17.905  -1.922  52.789  1.00 75.05  ? 38  ASN C ND2 1 
ATOM   5934  N N   . GLN C 1 39  ? 14.557  -4.546  49.313  1.00 45.26  ? 39  GLN C N   1 
ATOM   5935  C CA  . GLN C 1 39  ? 14.127  -5.398  48.202  1.00 53.62  ? 39  GLN C CA  1 
ATOM   5936  C C   . GLN C 1 39  ? 13.329  -4.593  47.169  1.00 51.42  ? 39  GLN C C   1 
ATOM   5937  O O   . GLN C 1 39  ? 13.429  -4.825  45.956  1.00 43.47  ? 39  GLN C O   1 
ATOM   5938  C CB  . GLN C 1 39  ? 13.284  -6.567  48.715  1.00 39.49  ? 39  GLN C CB  1 
ATOM   5939  C CG  . GLN C 1 39  ? 14.074  -7.820  49.054  1.00 50.02  ? 39  GLN C CG  1 
ATOM   5940  C CD  . GLN C 1 39  ? 13.204  -8.908  49.654  1.00 69.27  ? 39  GLN C CD  1 
ATOM   5941  O OE1 . GLN C 1 39  ? 12.075  -8.654  50.076  1.00 80.49  ? 39  GLN C OE1 1 
ATOM   5942  N NE2 . GLN C 1 39  ? 13.724  -10.129 49.693  1.00 89.72  ? 39  GLN C NE2 1 
ATOM   5943  N N   . LEU C 1 40  ? 12.553  -3.635  47.665  1.00 46.42  ? 40  LEU C N   1 
ATOM   5944  C CA  . LEU C 1 40  ? 11.790  -2.726  46.821  1.00 49.35  ? 40  LEU C CA  1 
ATOM   5945  C C   . LEU C 1 40  ? 12.732  -1.861  45.998  1.00 44.76  ? 40  LEU C C   1 
ATOM   5946  O O   . LEU C 1 40  ? 12.512  -1.641  44.802  1.00 55.54  ? 40  LEU C O   1 
ATOM   5947  C CB  . LEU C 1 40  ? 10.868  -1.849  47.671  1.00 40.33  ? 40  LEU C CB  1 
ATOM   5948  C CG  . LEU C 1 40  ? 9.831   -1.010  46.923  1.00 52.17  ? 40  LEU C CG  1 
ATOM   5949  C CD1 . LEU C 1 40  ? 8.849   -1.903  46.181  1.00 30.15  ? 40  LEU C CD1 1 
ATOM   5950  C CD2 . LEU C 1 40  ? 9.101   -0.081  47.881  1.00 51.34  ? 40  LEU C CD2 1 
ATOM   5951  N N   . TYR C 1 41  ? 13.784  -1.375  46.651  1.00 52.21  ? 41  TYR C N   1 
ATOM   5952  C CA  . TYR C 1 41  ? 14.821  -0.608  45.976  1.00 52.57  ? 41  TYR C CA  1 
ATOM   5953  C C   . TYR C 1 41  ? 15.442  -1.436  44.866  1.00 48.10  ? 41  TYR C C   1 
ATOM   5954  O O   . TYR C 1 41  ? 15.702  -0.927  43.780  1.00 53.80  ? 41  TYR C O   1 
ATOM   5955  C CB  . TYR C 1 41  ? 15.902  -0.155  46.961  1.00 42.50  ? 41  TYR C CB  1 
ATOM   5956  C CG  . TYR C 1 41  ? 17.126  0.431   46.290  1.00 48.65  ? 41  TYR C CG  1 
ATOM   5957  C CD1 . TYR C 1 41  ? 18.244  -0.353  46.024  1.00 58.53  ? 41  TYR C CD1 1 
ATOM   5958  C CD2 . TYR C 1 41  ? 17.161  1.768   45.915  1.00 64.43  ? 41  TYR C CD2 1 
ATOM   5959  C CE1 . TYR C 1 41  ? 19.360  0.179   45.405  1.00 52.58  ? 41  TYR C CE1 1 
ATOM   5960  C CE2 . TYR C 1 41  ? 18.274  2.309   45.297  1.00 58.90  ? 41  TYR C CE2 1 
ATOM   5961  C CZ  . TYR C 1 41  ? 19.370  1.510   45.045  1.00 53.83  ? 41  TYR C CZ  1 
ATOM   5962  O OH  . TYR C 1 41  ? 20.479  2.045   44.430  1.00 64.23  ? 41  TYR C OH  1 
ATOM   5963  N N   . GLN C 1 42  ? 15.682  -2.712  45.150  1.00 42.60  ? 42  GLN C N   1 
ATOM   5964  C CA  . GLN C 1 42  ? 16.233  -3.624  44.155  1.00 48.51  ? 42  GLN C CA  1 
ATOM   5965  C C   . GLN C 1 42  ? 15.319  -3.744  42.935  1.00 42.85  ? 42  GLN C C   1 
ATOM   5966  O O   . GLN C 1 42  ? 15.769  -3.595  41.793  1.00 46.53  ? 42  GLN C O   1 
ATOM   5967  C CB  . GLN C 1 42  ? 16.476  -5.001  44.775  1.00 43.24  ? 42  GLN C CB  1 
ATOM   5968  C CG  . GLN C 1 42  ? 17.585  -5.018  45.816  1.00 58.57  ? 42  GLN C CG  1 
ATOM   5969  C CD  . GLN C 1 42  ? 17.739  -6.370  46.485  1.00 67.38  ? 42  GLN C CD  1 
ATOM   5970  O OE1 . GLN C 1 42  ? 17.095  -7.345  46.096  1.00 78.88  ? 42  GLN C OE1 1 
ATOM   5971  N NE2 . GLN C 1 42  ? 18.592  -6.434  47.500  1.00 57.28  ? 42  GLN C NE2 1 
ATOM   5972  N N   . ALA C 1 43  ? 14.037  -4.001  43.181  1.00 44.88  ? 43  ALA C N   1 
ATOM   5973  C CA  . ALA C 1 43  ? 13.068  -4.146  42.095  1.00 39.68  ? 43  ALA C CA  1 
ATOM   5974  C C   . ALA C 1 43  ? 12.970  -2.886  41.231  1.00 44.51  ? 43  ALA C C   1 
ATOM   5975  O O   . ALA C 1 43  ? 13.055  -2.946  39.993  1.00 48.46  ? 43  ALA C O   1 
ATOM   5976  C CB  . ALA C 1 43  ? 11.701  -4.500  42.659  1.00 48.94  ? 43  ALA C CB  1 
ATOM   5977  N N   . MET C 1 44  ? 12.811  -1.743  41.890  1.00 29.89  ? 44  MET C N   1 
ATOM   5978  C CA  . MET C 1 44  ? 12.636  -0.483  41.182  1.00 41.11  ? 44  MET C CA  1 
ATOM   5979  C C   . MET C 1 44  ? 13.910  -0.107  40.423  1.00 47.08  ? 44  MET C C   1 
ATOM   5980  O O   . MET C 1 44  ? 13.849  0.437   39.318  1.00 48.72  ? 44  MET C O   1 
ATOM   5981  C CB  . MET C 1 44  ? 12.227  0.619   42.160  1.00 39.46  ? 44  MET C CB  1 
ATOM   5982  C CG  . MET C 1 44  ? 10.836  0.396   42.758  1.00 64.35  ? 44  MET C CG  1 
ATOM   5983  S SD  . MET C 1 44  ? 10.268  1.673   43.899  1.00 82.81  ? 44  MET C SD  1 
ATOM   5984  C CE  . MET C 1 44  ? 11.610  2.847   43.799  1.00 76.48  ? 44  MET C CE  1 
ATOM   5985  N N   . HIS C 1 45  ? 15.060  -0.422  41.011  1.00 46.91  ? 45  HIS C N   1 
ATOM   5986  C CA  . HIS C 1 45  ? 16.343  -0.190  40.358  1.00 46.64  ? 45  HIS C CA  1 
ATOM   5987  C C   . HIS C 1 45  ? 16.438  -1.030  39.091  1.00 51.17  ? 45  HIS C C   1 
ATOM   5988  O O   . HIS C 1 45  ? 16.914  -0.556  38.056  1.00 53.04  ? 45  HIS C O   1 
ATOM   5989  C CB  . HIS C 1 45  ? 17.506  -0.512  41.298  1.00 57.31  ? 45  HIS C CB  1 
ATOM   5990  C CG  . HIS C 1 45  ? 18.855  -0.330  40.676  1.00 60.24  ? 45  HIS C CG  1 
ATOM   5991  N ND1 . HIS C 1 45  ? 19.574  -1.376  40.141  1.00 51.13  ? 45  HIS C ND1 1 
ATOM   5992  C CD2 . HIS C 1 45  ? 19.615  0.776   40.502  1.00 63.60  ? 45  HIS C CD2 1 
ATOM   5993  C CE1 . HIS C 1 45  ? 20.720  -0.924  39.667  1.00 65.83  ? 45  HIS C CE1 1 
ATOM   5994  N NE2 . HIS C 1 45  ? 20.769  0.379   39.871  1.00 74.53  ? 45  HIS C NE2 1 
ATOM   5995  N N   . ARG C 1 46  ? 15.987  -2.279  39.182  1.00 43.84  ? 46  ARG C N   1 
ATOM   5996  C CA  . ARG C 1 46  ? 15.954  -3.157  38.017  1.00 41.15  ? 46  ARG C CA  1 
ATOM   5997  C C   . ARG C 1 46  ? 15.095  -2.538  36.918  1.00 36.51  ? 46  ARG C C   1 
ATOM   5998  O O   . ARG C 1 46  ? 15.477  -2.540  35.744  1.00 43.82  ? 46  ARG C O   1 
ATOM   5999  C CB  . ARG C 1 46  ? 15.423  -4.542  38.387  1.00 30.97  ? 46  ARG C CB  1 
ATOM   6000  C CG  . ARG C 1 46  ? 15.322  -5.490  37.203  1.00 29.15  ? 46  ARG C CG  1 
ATOM   6001  C CD  . ARG C 1 46  ? 15.312  -6.942  37.645  1.00 32.82  ? 46  ARG C CD  1 
ATOM   6002  N NE  . ARG C 1 46  ? 15.416  -7.853  36.509  1.00 36.26  ? 46  ARG C NE  1 
ATOM   6003  C CZ  . ARG C 1 46  ? 15.375  -9.178  36.606  1.00 45.16  ? 46  ARG C CZ  1 
ATOM   6004  N NH1 . ARG C 1 46  ? 15.227  -9.754  37.791  1.00 47.83  ? 46  ARG C NH1 1 
ATOM   6005  N NH2 . ARG C 1 46  ? 15.479  -9.927  35.516  1.00 36.90  ? 46  ARG C NH2 1 
ATOM   6006  N N   . ILE C 1 47  ? 13.938  -2.007  37.308  1.00 40.91  ? 47  ILE C N   1 
ATOM   6007  C CA  . ILE C 1 47  ? 13.079  -1.281  36.371  1.00 39.45  ? 47  ILE C CA  1 
ATOM   6008  C C   . ILE C 1 47  ? 13.836  -0.134  35.690  1.00 46.13  ? 47  ILE C C   1 
ATOM   6009  O O   . ILE C 1 47  ? 13.770  0.038   34.468  1.00 55.01  ? 47  ILE C O   1 
ATOM   6010  C CB  . ILE C 1 47  ? 11.829  -0.713  37.080  1.00 45.50  ? 47  ILE C CB  1 
ATOM   6011  C CG1 . ILE C 1 47  ? 10.968  -1.848  37.642  1.00 43.37  ? 47  ILE C CG1 1 
ATOM   6012  C CG2 . ILE C 1 47  ? 11.027  0.174   36.135  1.00 28.75  ? 47  ILE C CG2 1 
ATOM   6013  C CD1 . ILE C 1 47  ? 9.975   -2.416  36.653  1.00 37.38  ? 47  ILE C CD1 1 
ATOM   6014  N N   . TYR C 1 48  ? 14.564  0.636   36.494  1.00 42.90  ? 48  TYR C N   1 
ATOM   6015  C CA  . TYR C 1 48  ? 15.317  1.795   36.016  1.00 48.86  ? 48  TYR C CA  1 
ATOM   6016  C C   . TYR C 1 48  ? 16.372  1.411   34.976  1.00 50.36  ? 48  TYR C C   1 
ATOM   6017  O O   . TYR C 1 48  ? 16.421  1.979   33.872  1.00 41.19  ? 48  TYR C O   1 
ATOM   6018  C CB  . TYR C 1 48  ? 15.971  2.496   37.209  1.00 42.15  ? 48  TYR C CB  1 
ATOM   6019  C CG  . TYR C 1 48  ? 16.731  3.763   36.893  1.00 50.94  ? 48  TYR C CG  1 
ATOM   6020  C CD1 . TYR C 1 48  ? 16.087  4.871   36.360  1.00 55.74  ? 48  TYR C CD1 1 
ATOM   6021  C CD2 . TYR C 1 48  ? 18.089  3.865   37.171  1.00 53.27  ? 48  TYR C CD2 1 
ATOM   6022  C CE1 . TYR C 1 48  ? 16.779  6.034   36.083  1.00 63.86  ? 48  TYR C CE1 1 
ATOM   6023  C CE2 . TYR C 1 48  ? 18.788  5.025   36.901  1.00 45.52  ? 48  TYR C CE2 1 
ATOM   6024  C CZ  . TYR C 1 48  ? 18.129  6.106   36.358  1.00 54.99  ? 48  TYR C CZ  1 
ATOM   6025  O OH  . TYR C 1 48  ? 18.822  7.263   36.087  1.00 73.92  ? 48  TYR C OH  1 
ATOM   6026  N N   . ASP C 1 49  ? 17.203  0.435   35.331  1.00 43.29  ? 49  ASP C N   1 
ATOM   6027  C CA  . ASP C 1 49  ? 18.231  -0.068  34.428  1.00 45.56  ? 49  ASP C CA  1 
ATOM   6028  C C   . ASP C 1 49  ? 17.608  -0.609  33.147  1.00 42.47  ? 49  ASP C C   1 
ATOM   6029  O O   . ASP C 1 49  ? 18.149  -0.416  32.057  1.00 55.36  ? 49  ASP C O   1 
ATOM   6030  C CB  . ASP C 1 49  ? 19.067  -1.157  35.103  1.00 57.05  ? 49  ASP C CB  1 
ATOM   6031  C CG  . ASP C 1 49  ? 20.141  -0.590  36.011  1.00 69.59  ? 49  ASP C CG  1 
ATOM   6032  O OD1 . ASP C 1 49  ? 20.340  0.643   36.006  1.00 74.04  ? 49  ASP C OD1 1 
ATOM   6033  O OD2 . ASP C 1 49  ? 20.796  -1.383  36.718  1.00 70.98  ? 49  ASP C OD2 1 
ATOM   6034  N N   . ALA C 1 50  ? 16.471  -1.285  33.286  1.00 41.45  ? 50  ALA C N   1 
ATOM   6035  C CA  . ALA C 1 50  ? 15.747  -1.807  32.131  1.00 52.07  ? 50  ALA C CA  1 
ATOM   6036  C C   . ALA C 1 50  ? 15.335  -0.688  31.174  1.00 47.93  ? 50  ALA C C   1 
ATOM   6037  O O   . ALA C 1 50  ? 15.544  -0.788  29.962  1.00 41.69  ? 50  ALA C O   1 
ATOM   6038  C CB  . ALA C 1 50  ? 14.529  -2.592  32.584  1.00 34.28  ? 50  ALA C CB  1 
ATOM   6039  N N   . GLN C 1 51  ? 14.749  0.372   31.725  1.00 37.83  ? 51  GLN C N   1 
ATOM   6040  C CA  . GLN C 1 51  ? 14.304  1.513   30.925  1.00 37.07  ? 51  GLN C CA  1 
ATOM   6041  C C   . GLN C 1 51  ? 15.470  2.176   30.187  1.00 38.43  ? 51  GLN C C   1 
ATOM   6042  O O   . GLN C 1 51  ? 15.414  2.404   28.961  1.00 48.25  ? 51  GLN C O   1 
ATOM   6043  C CB  . GLN C 1 51  ? 13.597  2.537   31.817  1.00 31.71  ? 51  GLN C CB  1 
ATOM   6044  C CG  . GLN C 1 51  ? 12.919  3.662   31.057  1.00 47.37  ? 51  GLN C CG  1 
ATOM   6045  C CD  . GLN C 1 51  ? 11.799  3.168   30.165  1.00 63.71  ? 51  GLN C CD  1 
ATOM   6046  O OE1 . GLN C 1 51  ? 11.609  3.665   29.055  1.00 62.84  ? 51  GLN C OE1 1 
ATOM   6047  N NE2 . GLN C 1 51  ? 11.039  2.196   30.653  1.00 56.70  ? 51  GLN C NE2 1 
ATOM   6048  N N   . ASN C 1 52  ? 16.528  2.471   30.941  1.00 47.34  ? 52  ASN C N   1 
ATOM   6049  C CA  . ASN C 1 52  ? 17.746  3.030   30.361  1.00 48.80  ? 52  ASN C CA  1 
ATOM   6050  C C   . ASN C 1 52  ? 18.276  2.161   29.223  1.00 49.01  ? 52  ASN C C   1 
ATOM   6051  O O   . ASN C 1 52  ? 18.672  2.667   28.168  1.00 43.59  ? 52  ASN C O   1 
ATOM   6052  C CB  . ASN C 1 52  ? 18.820  3.197   31.439  1.00 44.58  ? 52  ASN C CB  1 
ATOM   6053  C CG  . ASN C 1 52  ? 18.634  4.461   32.257  1.00 62.36  ? 52  ASN C CG  1 
ATOM   6054  O OD1 . ASN C 1 52  ? 18.249  5.503   31.730  1.00 56.85  ? 52  ASN C OD1 1 
ATOM   6055  N ND2 . ASN C 1 52  ? 18.906  4.372   33.555  1.00 62.76  ? 52  ASN C ND2 1 
ATOM   6056  N N   . GLU C 1 53  ? 18.265  0.850   29.444  1.00 38.82  ? 53  GLU C N   1 
ATOM   6057  C CA  . GLU C 1 53  ? 18.719  -0.105  28.441  1.00 48.26  ? 53  GLU C CA  1 
ATOM   6058  C C   . GLU C 1 53  ? 17.852  -0.065  27.183  1.00 50.18  ? 53  GLU C C   1 
ATOM   6059  O O   . GLU C 1 53  ? 18.364  -0.175  26.069  1.00 58.63  ? 53  GLU C O   1 
ATOM   6060  C CB  . GLU C 1 53  ? 18.741  -1.521  29.019  1.00 37.42  ? 53  GLU C CB  1 
ATOM   6061  C CG  . GLU C 1 53  ? 19.338  -2.558  28.081  1.00 50.36  ? 53  GLU C CG  1 
ATOM   6062  C CD  . GLU C 1 53  ? 20.564  -2.046  27.346  1.00 89.55  ? 53  GLU C CD  1 
ATOM   6063  O OE1 . GLU C 1 53  ? 20.582  -2.114  26.098  1.00 71.66  ? 53  GLU C OE1 1 
ATOM   6064  O OE2 . GLU C 1 53  ? 21.514  -1.582  28.013  1.00 103.08 ? 53  GLU C OE2 1 
ATOM   6065  N N   . LEU C 1 54  ? 16.542  0.084   27.365  1.00 44.10  ? 54  LEU C N   1 
ATOM   6066  C CA  . LEU C 1 54  ? 15.626  0.221   26.235  1.00 44.71  ? 54  LEU C CA  1 
ATOM   6067  C C   . LEU C 1 54  ? 16.012  1.423   25.381  1.00 56.38  ? 54  LEU C C   1 
ATOM   6068  O O   . LEU C 1 54  ? 16.199  1.306   24.154  1.00 62.32  ? 54  LEU C O   1 
ATOM   6069  C CB  . LEU C 1 54  ? 14.182  0.367   26.721  1.00 50.90  ? 54  LEU C CB  1 
ATOM   6070  C CG  . LEU C 1 54  ? 13.442  -0.896  27.164  1.00 50.17  ? 54  LEU C CG  1 
ATOM   6071  C CD1 . LEU C 1 54  ? 12.129  -0.529  27.832  1.00 67.22  ? 54  LEU C CD1 1 
ATOM   6072  C CD2 . LEU C 1 54  ? 13.194  -1.811  25.978  1.00 42.58  ? 54  LEU C CD2 1 
ATOM   6073  N N   . SER C 1 55  ? 16.148  2.573   26.040  1.00 41.62  ? 55  SER C N   1 
ATOM   6074  C CA  . SER C 1 55  ? 16.516  3.802   25.339  1.00 44.92  ? 55  SER C CA  1 
ATOM   6075  C C   . SER C 1 55  ? 17.837  3.631   24.586  1.00 54.25  ? 55  SER C C   1 
ATOM   6076  O O   . SER C 1 55  ? 17.960  4.012   23.412  1.00 55.95  ? 55  SER C O   1 
ATOM   6077  C CB  . SER C 1 55  ? 16.618  4.968   26.325  1.00 46.53  ? 55  SER C CB  1 
ATOM   6078  O OG  . SER C 1 55  ? 17.053  6.150   25.677  1.00 62.60  ? 55  SER C OG  1 
ATOM   6079  N N   . ALA C 1 56  ? 18.809  3.026   25.263  1.00 43.91  ? 56  ALA C N   1 
ATOM   6080  C CA  . ALA C 1 56  ? 20.120  2.777   24.676  1.00 41.26  ? 56  ALA C CA  1 
ATOM   6081  C C   . ALA C 1 56  ? 20.042  1.914   23.416  1.00 51.20  ? 56  ALA C C   1 
ATOM   6082  O O   . ALA C 1 56  ? 20.594  2.275   22.374  1.00 61.39  ? 56  ALA C O   1 
ATOM   6083  C CB  . ALA C 1 56  ? 21.034  2.123   25.701  1.00 48.35  ? 56  ALA C CB  1 
ATOM   6084  N N   . ALA C 1 57  ? 19.356  0.779   23.516  1.00 45.97  ? 57  ALA C N   1 
ATOM   6085  C CA  . ALA C 1 57  ? 19.240  -0.152  22.396  1.00 58.34  ? 57  ALA C CA  1 
ATOM   6086  C C   . ALA C 1 57  ? 18.564  0.494   21.187  1.00 59.83  ? 57  ALA C C   1 
ATOM   6087  O O   . ALA C 1 57  ? 19.052  0.375   20.049  1.00 52.54  ? 57  ALA C O   1 
ATOM   6088  C CB  . ALA C 1 57  ? 18.477  -1.398  22.826  1.00 41.44  ? 57  ALA C CB  1 
ATOM   6089  N N   . THR C 1 58  ? 17.457  1.193   21.437  1.00 48.32  ? 58  THR C N   1 
ATOM   6090  C CA  . THR C 1 58  ? 16.754  1.884   20.357  1.00 52.06  ? 58  THR C CA  1 
ATOM   6091  C C   . THR C 1 58  ? 17.681  2.892   19.675  1.00 56.08  ? 58  THR C C   1 
ATOM   6092  O O   . THR C 1 58  ? 17.785  2.926   18.439  1.00 64.15  ? 58  THR C O   1 
ATOM   6093  C CB  . THR C 1 58  ? 15.486  2.603   20.858  1.00 60.21  ? 58  THR C CB  1 
ATOM   6094  O OG1 . THR C 1 58  ? 15.779  3.315   22.066  1.00 60.14  ? 58  THR C OG1 1 
ATOM   6095  C CG2 . THR C 1 58  ? 14.375  1.596   21.126  1.00 39.04  ? 58  THR C CG2 1 
ATOM   6096  N N   . HIS C 1 59  ? 18.356  3.704   20.486  1.00 59.56  ? 59  HIS C N   1 
ATOM   6097  C CA  . HIS C 1 59  ? 19.295  4.693   19.960  1.00 62.58  ? 59  HIS C CA  1 
ATOM   6098  C C   . HIS C 1 59  ? 20.387  4.059   19.091  1.00 62.84  ? 59  HIS C C   1 
ATOM   6099  O O   . HIS C 1 59  ? 20.708  4.568   18.009  1.00 65.03  ? 59  HIS C O   1 
ATOM   6100  C CB  . HIS C 1 59  ? 19.936  5.475   21.106  1.00 57.64  ? 59  HIS C CB  1 
ATOM   6101  C CG  . HIS C 1 59  ? 20.813  6.598   20.650  1.00 71.40  ? 59  HIS C CG  1 
ATOM   6102  N ND1 . HIS C 1 59  ? 20.310  7.769   20.125  1.00 74.75  ? 59  HIS C ND1 1 
ATOM   6103  C CD2 . HIS C 1 59  ? 22.161  6.727   20.632  1.00 68.60  ? 59  HIS C CD2 1 
ATOM   6104  C CE1 . HIS C 1 59  ? 21.309  8.572   19.808  1.00 75.35  ? 59  HIS C CE1 1 
ATOM   6105  N NE2 . HIS C 1 59  ? 22.443  7.963   20.105  1.00 66.42  ? 59  HIS C NE2 1 
ATOM   6106  N N   . LEU C 1 60  ? 20.951  2.951   19.563  1.00 47.01  ? 60  LEU C N   1 
ATOM   6107  C CA  . LEU C 1 60  ? 22.009  2.261   18.828  1.00 56.07  ? 60  LEU C CA  1 
ATOM   6108  C C   . LEU C 1 60  ? 21.511  1.760   17.473  1.00 63.28  ? 60  LEU C C   1 
ATOM   6109  O O   . LEU C 1 60  ? 22.200  1.916   16.452  1.00 67.67  ? 60  LEU C O   1 
ATOM   6110  C CB  . LEU C 1 60  ? 22.575  1.102   19.649  1.00 55.51  ? 60  LEU C CB  1 
ATOM   6111  C CG  . LEU C 1 60  ? 23.456  1.508   20.835  1.00 72.24  ? 60  LEU C CG  1 
ATOM   6112  C CD1 . LEU C 1 60  ? 24.374  0.367   21.236  1.00 66.01  ? 60  LEU C CD1 1 
ATOM   6113  C CD2 . LEU C 1 60  ? 24.262  2.761   20.519  1.00 61.37  ? 60  LEU C CD2 1 
ATOM   6114  N N   . THR C 1 61  ? 20.318  1.166   17.462  1.00 55.97  ? 61  THR C N   1 
ATOM   6115  C CA  . THR C 1 61  ? 19.719  0.735   16.199  1.00 54.54  ? 61  THR C CA  1 
ATOM   6116  C C   . THR C 1 61  ? 19.582  1.915   15.242  1.00 65.64  ? 61  THR C C   1 
ATOM   6117  O O   . THR C 1 61  ? 19.943  1.816   14.063  1.00 73.40  ? 61  THR C O   1 
ATOM   6118  C CB  . THR C 1 61  ? 18.334  0.096   16.396  1.00 50.86  ? 61  THR C CB  1 
ATOM   6119  O OG1 . THR C 1 61  ? 17.522  0.949   17.213  1.00 74.27  ? 61  THR C OG1 1 
ATOM   6120  C CG2 . THR C 1 61  ? 18.466  -1.255  17.059  1.00 55.07  ? 61  THR C CG2 1 
ATOM   6121  N N   . SER C 1 62  ? 19.060  3.026   15.758  1.00 49.66  ? 62  SER C N   1 
ATOM   6122  C CA  . SER C 1 62  ? 18.939  4.250   14.969  1.00 58.37  ? 62  SER C CA  1 
ATOM   6123  C C   . SER C 1 62  ? 20.267  4.652   14.323  1.00 77.18  ? 62  SER C C   1 
ATOM   6124  O O   . SER C 1 62  ? 20.329  4.939   13.117  1.00 83.02  ? 62  SER C O   1 
ATOM   6125  C CB  . SER C 1 62  ? 18.423  5.391   15.842  1.00 57.67  ? 62  SER C CB  1 
ATOM   6126  O OG  . SER C 1 62  ? 18.388  6.608   15.118  1.00 72.00  ? 62  SER C OG  1 
ATOM   6127  N N   . LYS C 1 63  ? 21.325  4.664   15.130  1.00 67.50  ? 63  LYS C N   1 
ATOM   6128  C CA  . LYS C 1 63  ? 22.653  5.022   14.638  1.00 58.26  ? 63  LYS C CA  1 
ATOM   6129  C C   . LYS C 1 63  ? 23.113  4.084   13.526  1.00 71.64  ? 63  LYS C C   1 
ATOM   6130  O O   . LYS C 1 63  ? 23.696  4.527   12.533  1.00 75.66  ? 63  LYS C O   1 
ATOM   6131  C CB  . LYS C 1 63  ? 23.670  5.016   15.780  1.00 55.19  ? 63  LYS C CB  1 
ATOM   6132  C CG  . LYS C 1 63  ? 23.824  6.356   16.480  1.00 68.91  ? 63  LYS C CG  1 
ATOM   6133  C CD  . LYS C 1 63  ? 24.891  6.292   17.560  1.00 72.47  ? 63  LYS C CD  1 
ATOM   6134  C CE  . LYS C 1 63  ? 26.179  5.679   17.033  1.00 73.48  ? 63  LYS C CE  1 
ATOM   6135  N NZ  . LYS C 1 63  ? 27.300  5.829   18.001  1.00 82.77  ? 63  LYS C NZ  1 
ATOM   6136  N N   . LEU C 1 64  ? 22.850  2.791   13.695  1.00 67.15  ? 64  LEU C N   1 
ATOM   6137  C CA  . LEU C 1 64  ? 23.183  1.814   12.659  1.00 55.32  ? 64  LEU C CA  1 
ATOM   6138  C C   . LEU C 1 64  ? 22.470  2.134   11.344  1.00 68.11  ? 64  LEU C C   1 
ATOM   6139  O O   . LEU C 1 64  ? 23.086  2.134   10.258  1.00 91.47  ? 64  LEU C O   1 
ATOM   6140  C CB  . LEU C 1 64  ? 22.821  0.404   13.123  1.00 56.20  ? 64  LEU C CB  1 
ATOM   6141  C CG  . LEU C 1 64  ? 23.173  -0.722  12.153  1.00 66.30  ? 64  LEU C CG  1 
ATOM   6142  C CD1 . LEU C 1 64  ? 24.661  -0.720  11.836  1.00 63.56  ? 64  LEU C CD1 1 
ATOM   6143  C CD2 . LEU C 1 64  ? 22.752  -2.058  12.729  1.00 62.98  ? 64  LEU C CD2 1 
ATOM   6144  N N   . LEU C 1 65  ? 21.174  2.420   11.458  1.00 67.05  ? 65  LEU C N   1 
ATOM   6145  C CA  . LEU C 1 65  ? 20.361  2.804   10.309  1.00 66.18  ? 65  LEU C CA  1 
ATOM   6146  C C   . LEU C 1 65  ? 20.978  3.984   9.573   1.00 77.59  ? 65  LEU C C   1 
ATOM   6147  O O   . LEU C 1 65  ? 21.196  3.926   8.360   1.00 95.22  ? 65  LEU C O   1 
ATOM   6148  C CB  . LEU C 1 65  ? 18.939  3.156   10.748  1.00 74.39  ? 65  LEU C CB  1 
ATOM   6149  C CG  . LEU C 1 65  ? 18.121  2.068   11.442  1.00 70.79  ? 65  LEU C CG  1 
ATOM   6150  C CD1 . LEU C 1 65  ? 16.787  2.635   11.886  1.00 77.66  ? 65  LEU C CD1 1 
ATOM   6151  C CD2 . LEU C 1 65  ? 17.920  0.874   10.521  1.00 59.52  ? 65  LEU C CD2 1 
ATOM   6152  N N   . LYS C 1 66  ? 21.271  5.051   10.310  1.00 80.14  ? 66  LYS C N   1 
ATOM   6153  C CA  . LYS C 1 66  ? 21.836  6.239   9.683   1.00 86.68  ? 66  LYS C CA  1 
ATOM   6154  C C   . LYS C 1 66  ? 23.255  6.011   9.166   1.00 96.36  ? 66  LYS C C   1 
ATOM   6155  O O   . LYS C 1 66  ? 23.740  6.766   8.326   1.00 92.71  ? 66  LYS C O   1 
ATOM   6156  C CB  . LYS C 1 66  ? 21.851  7.414   10.662  1.00 77.05  ? 66  LYS C CB  1 
ATOM   6157  C CG  . LYS C 1 66  ? 20.492  7.908   11.102  1.00 80.31  ? 66  LYS C CG  1 
ATOM   6158  C CD  . LYS C 1 66  ? 20.655  9.091   12.043  1.00 91.62  ? 66  LYS C CD  1 
ATOM   6159  C CE  . LYS C 1 66  ? 19.318  9.590   12.542  1.00 101.08 ? 66  LYS C CE  1 
ATOM   6160  N NZ  . LYS C 1 66  ? 18.563  8.510   13.232  1.00 93.01  ? 66  LYS C NZ  1 
ATOM   6161  N N   . GLU C 1 67  ? 23.919  4.970   9.660   1.00 97.73  ? 67  GLU C N   1 
ATOM   6162  C CA  . GLU C 1 67  ? 25.268  4.662   9.193   1.00 92.13  ? 67  GLU C CA  1 
ATOM   6163  C C   . GLU C 1 67  ? 25.316  3.894   7.876   1.00 98.71  ? 67  GLU C C   1 
ATOM   6164  O O   . GLU C 1 67  ? 26.113  4.244   7.003   1.00 116.08 ? 67  GLU C O   1 
ATOM   6165  C CB  . GLU C 1 67  ? 26.038  3.881   10.266  1.00 80.79  ? 67  GLU C CB  1 
ATOM   6166  C CG  . GLU C 1 67  ? 27.098  2.899   9.741   1.00 97.25  ? 67  GLU C CG  1 
ATOM   6167  C CD  . GLU C 1 67  ? 28.214  3.576   8.947   1.00 122.60 ? 67  GLU C CD  1 
ATOM   6168  O OE1 . GLU C 1 67  ? 28.681  4.648   9.386   1.00 123.00 ? 67  GLU C OE1 1 
ATOM   6169  O OE2 . GLU C 1 67  ? 28.628  3.038   7.895   1.00 133.53 ? 67  GLU C OE2 1 
ATOM   6170  N N   . TYR C 1 68  ? 24.475  2.880   7.687   1.00 94.40  ? 68  TYR C N   1 
ATOM   6171  C CA  . TYR C 1 68  ? 24.463  2.279   6.348   1.00 107.94 ? 68  TYR C CA  1 
ATOM   6172  C C   . TYR C 1 68  ? 23.449  2.872   5.376   1.00 100.02 ? 68  TYR C C   1 
ATOM   6173  O O   . TYR C 1 68  ? 23.404  2.459   4.218   1.00 105.19 ? 68  TYR C O   1 
ATOM   6174  C CB  . TYR C 1 68  ? 24.287  0.762   6.400   1.00 110.11 ? 68  TYR C CB  1 
ATOM   6175  C CG  . TYR C 1 68  ? 25.566  0.035   6.769   1.00 129.63 ? 68  TYR C CG  1 
ATOM   6176  C CD1 . TYR C 1 68  ? 26.649  0.720   7.296   1.00 135.83 ? 68  TYR C CD1 1 
ATOM   6177  C CD2 . TYR C 1 68  ? 25.726  -1.312  6.497   1.00 119.73 ? 68  TYR C CD2 1 
ATOM   6178  C CE1 . TYR C 1 68  ? 27.820  0.065   7.630   1.00 138.59 ? 68  TYR C CE1 1 
ATOM   6179  C CE2 . TYR C 1 68  ? 26.889  -1.978  6.822   1.00 122.42 ? 68  TYR C CE2 1 
ATOM   6180  C CZ  . TYR C 1 68  ? 27.937  -1.282  7.384   1.00 139.54 ? 68  TYR C CZ  1 
ATOM   6181  O OH  . TYR C 1 68  ? 29.106  -1.937  7.703   1.00 143.92 ? 68  TYR C OH  1 
ATOM   6182  N N   . GLU C 1 69  ? 22.625  3.815   5.816   1.00 94.31  ? 69  GLU C N   1 
ATOM   6183  C CA  . GLU C 1 69  ? 21.894  4.585   4.821   1.00 98.11  ? 69  GLU C CA  1 
ATOM   6184  C C   . GLU C 1 69  ? 22.862  5.607   4.216   1.00 113.29 ? 69  GLU C C   1 
ATOM   6185  O O   . GLU C 1 69  ? 22.690  6.044   3.078   1.00 116.65 ? 69  GLU C O   1 
ATOM   6186  C CB  . GLU C 1 69  ? 20.674  5.276   5.430   1.00 84.25  ? 69  GLU C CB  1 
ATOM   6187  N N   . LYS C 1 70  ? 23.880  5.978   4.991   1.00 114.88 ? 70  LYS C N   1 
ATOM   6188  C CA  . LYS C 1 70  ? 25.014  6.755   4.489   1.00 108.04 ? 70  LYS C CA  1 
ATOM   6189  C C   . LYS C 1 70  ? 25.827  5.993   3.441   1.00 115.51 ? 70  LYS C C   1 
ATOM   6190  O O   . LYS C 1 70  ? 25.999  6.454   2.314   1.00 126.61 ? 70  LYS C O   1 
ATOM   6191  C CB  . LYS C 1 70  ? 25.927  7.177   5.645   1.00 97.29  ? 70  LYS C CB  1 
ATOM   6192  N N   . GLN C 1 71  ? 26.330  4.825   3.830   1.00 113.04 ? 71  GLN C N   1 
ATOM   6193  C CA  . GLN C 1 71  ? 27.185  4.021   2.962   1.00 101.46 ? 71  GLN C CA  1 
ATOM   6194  C C   . GLN C 1 71  ? 26.362  3.143   2.027   1.00 110.44 ? 71  GLN C C   1 
ATOM   6195  O O   . GLN C 1 71  ? 26.233  3.437   0.838   1.00 101.34 ? 71  GLN C O   1 
ATOM   6196  C CB  . GLN C 1 71  ? 28.132  3.155   3.796   1.00 70.18  ? 71  GLN C CB  1 
ATOM   6197  N N   . GLU C 1 80  ? 17.227  3.253   -3.590  1.00 84.17  ? 80  GLU C N   1 
ATOM   6198  C CA  . GLU C 1 80  ? 16.739  4.621   -3.727  1.00 92.78  ? 80  GLU C CA  1 
ATOM   6199  C C   . GLU C 1 80  ? 15.506  4.884   -2.851  1.00 107.87 ? 80  GLU C C   1 
ATOM   6200  O O   . GLU C 1 80  ? 15.588  5.641   -1.882  1.00 105.29 ? 80  GLU C O   1 
ATOM   6201  C CB  . GLU C 1 80  ? 16.434  4.929   -5.197  1.00 97.43  ? 80  GLU C CB  1 
ATOM   6202  C CG  . GLU C 1 80  ? 15.939  3.738   -6.011  1.00 103.12 ? 80  GLU C CG  1 
ATOM   6203  C CD  . GLU C 1 80  ? 16.329  3.821   -7.479  1.00 119.37 ? 80  GLU C CD  1 
ATOM   6204  O OE1 . GLU C 1 80  ? 17.467  4.245   -7.772  1.00 117.47 ? 80  GLU C OE1 1 
ATOM   6205  O OE2 . GLU C 1 80  ? 15.497  3.460   -8.340  1.00 112.74 ? 80  GLU C OE2 1 
ATOM   6206  N N   . VAL C 1 81  ? 14.366  4.293   -3.208  1.00 112.53 ? 81  VAL C N   1 
ATOM   6207  C CA  . VAL C 1 81  ? 13.201  4.242   -2.317  1.00 94.91  ? 81  VAL C CA  1 
ATOM   6208  C C   . VAL C 1 81  ? 13.635  3.823   -0.894  1.00 96.82  ? 81  VAL C C   1 
ATOM   6209  O O   . VAL C 1 81  ? 13.239  4.438   0.111   1.00 99.63  ? 81  VAL C O   1 
ATOM   6210  C CB  . VAL C 1 81  ? 12.072  3.333   -2.904  1.00 89.83  ? 81  VAL C CB  1 
ATOM   6211  C CG1 . VAL C 1 81  ? 12.462  1.860   -2.928  1.00 81.39  ? 81  VAL C CG1 1 
ATOM   6212  C CG2 . VAL C 1 81  ? 10.781  3.506   -2.105  1.00 82.14  ? 81  VAL C CG2 1 
ATOM   6213  N N   . MET C 1 82  ? 14.434  2.764   -0.816  1.00 94.51  ? 82  MET C N   1 
ATOM   6214  C CA  . MET C 1 82  ? 14.767  2.123   0.447   1.00 97.09  ? 82  MET C CA  1 
ATOM   6215  C C   . MET C 1 82  ? 15.447  3.099   1.408   1.00 102.15 ? 82  MET C C   1 
ATOM   6216  O O   . MET C 1 82  ? 15.254  3.020   2.614   1.00 107.37 ? 82  MET C O   1 
ATOM   6217  C CB  . MET C 1 82  ? 15.669  0.913   0.198   1.00 99.69  ? 82  MET C CB  1 
ATOM   6218  C CG  . MET C 1 82  ? 15.941  0.092   1.440   1.00 105.28 ? 82  MET C CG  1 
ATOM   6219  S SD  . MET C 1 82  ? 16.859  -1.410  1.082   1.00 124.35 ? 82  MET C SD  1 
ATOM   6220  C CE  . MET C 1 82  ? 17.003  -2.074  2.733   1.00 106.23 ? 82  MET C CE  1 
ATOM   6221  N N   . SER C 1 83  ? 16.244  4.017   0.868   1.00 106.05 ? 83  SER C N   1 
ATOM   6222  C CA  . SER C 1 83  ? 16.945  5.002   1.691   1.00 102.38 ? 83  SER C CA  1 
ATOM   6223  C C   . SER C 1 83  ? 15.955  5.972   2.320   1.00 102.35 ? 83  SER C C   1 
ATOM   6224  O O   . SER C 1 83  ? 16.042  6.294   3.506   1.00 113.75 ? 83  SER C O   1 
ATOM   6225  C CB  . SER C 1 83  ? 17.992  5.764   0.875   1.00 101.12 ? 83  SER C CB  1 
ATOM   6226  O OG  . SER C 1 83  ? 17.408  6.405   -0.241  1.00 100.53 ? 83  SER C OG  1 
ATOM   6227  N N   . SER C 1 84  ? 14.978  6.389   1.532   1.00 99.32  ? 84  SER C N   1 
ATOM   6228  C CA  . SER C 1 84  ? 13.870  7.126   2.090   1.00 105.74 ? 84  SER C CA  1 
ATOM   6229  C C   . SER C 1 84  ? 13.178  6.377   3.223   1.00 97.80  ? 84  SER C C   1 
ATOM   6230  O O   . SER C 1 84  ? 12.975  6.935   4.321   1.00 92.56  ? 84  SER C O   1 
ATOM   6231  C CB  . SER C 1 84  ? 12.872  7.419   0.962   1.00 111.92 ? 84  SER C CB  1 
ATOM   6232  O OG  . SER C 1 84  ? 11.517  7.168   1.350   1.00 105.32 ? 84  SER C OG  1 
ATOM   6233  N N   . THR C 1 85  ? 12.951  5.085   3.021   1.00 89.22  ? 85  THR C N   1 
ATOM   6234  C CA  . THR C 1 85  ? 12.263  4.312   4.046   1.00 82.77  ? 85  THR C CA  1 
ATOM   6235  C C   . THR C 1 85  ? 13.092  4.291   5.323   1.00 91.55  ? 85  THR C C   1 
ATOM   6236  O O   . THR C 1 85  ? 12.569  4.456   6.430   1.00 92.84  ? 85  THR C O   1 
ATOM   6237  C CB  . THR C 1 85  ? 11.976  2.884   3.594   1.00 72.60  ? 85  THR C CB  1 
ATOM   6238  O OG1 . THR C 1 85  ? 13.209  2.213   3.323   1.00 80.84  ? 85  THR C OG1 1 
ATOM   6239  C CG2 . THR C 1 85  ? 11.111  2.891   2.338   1.00 81.42  ? 85  THR C CG2 1 
ATOM   6240  N N   . LEU C 1 86  ? 14.395  4.104   5.147   1.00 80.55  ? 86  LEU C N   1 
ATOM   6241  C CA  . LEU C 1 86  ? 15.352  4.070   6.245   1.00 82.53  ? 86  LEU C CA  1 
ATOM   6242  C C   . LEU C 1 86  ? 15.510  5.388   7.002   1.00 93.02  ? 86  LEU C C   1 
ATOM   6243  O O   . LEU C 1 86  ? 15.820  5.369   8.192   1.00 98.42  ? 86  LEU C O   1 
ATOM   6244  C CB  . LEU C 1 86  ? 16.721  3.628   5.722   1.00 65.70  ? 86  LEU C CB  1 
ATOM   6245  C CG  . LEU C 1 86  ? 17.046  2.139   5.864   1.00 68.34  ? 86  LEU C CG  1 
ATOM   6246  C CD1 . LEU C 1 86  ? 16.073  1.267   5.081   1.00 78.64  ? 86  LEU C CD1 1 
ATOM   6247  C CD2 . LEU C 1 86  ? 18.482  1.867   5.433   1.00 77.34  ? 86  LEU C CD2 1 
ATOM   6248  N N   . GLN C 1 87  ? 15.320  6.530   6.344   1.00 90.05  ? 87  GLN C N   1 
ATOM   6249  C CA  . GLN C 1 87  ? 15.399  7.786   7.096   1.00 91.79  ? 87  GLN C CA  1 
ATOM   6250  C C   . GLN C 1 87  ? 14.106  8.102   7.833   1.00 89.52  ? 87  GLN C C   1 
ATOM   6251  O O   . GLN C 1 87  ? 14.146  8.633   8.957   1.00 100.09 ? 87  GLN C O   1 
ATOM   6252  C CB  . GLN C 1 87  ? 15.785  8.961   6.197   1.00 98.20  ? 87  GLN C CB  1 
ATOM   6253  C CG  . GLN C 1 87  ? 16.882  8.660   5.202   1.00 111.93 ? 87  GLN C CG  1 
ATOM   6254  C CD  . GLN C 1 87  ? 17.154  9.806   4.253   1.00 120.23 ? 87  GLN C CD  1 
ATOM   6255  O OE1 . GLN C 1 87  ? 16.267  10.601  3.950   1.00 127.24 ? 87  GLN C OE1 1 
ATOM   6256  N NE2 . GLN C 1 87  ? 18.394  9.901   3.781   1.00 113.48 ? 87  GLN C NE2 1 
ATOM   6257  N N   . GLN C 1 88  ? 12.971  7.740   7.236   1.00 93.59  ? 88  GLN C N   1 
ATOM   6258  C CA  . GLN C 1 88  ? 11.710  7.836   7.969   1.00 93.70  ? 88  GLN C CA  1 
ATOM   6259  C C   . GLN C 1 88  ? 11.765  6.966   9.226   1.00 81.04  ? 88  GLN C C   1 
ATOM   6260  O O   . GLN C 1 88  ? 11.403  7.397   10.332  1.00 78.56  ? 88  GLN C O   1 
ATOM   6261  C CB  . GLN C 1 88  ? 10.534  7.423   7.084   1.00 96.26  ? 88  GLN C CB  1 
ATOM   6262  C CG  . GLN C 1 88  ? 10.422  8.210   5.783   1.00 91.59  ? 88  GLN C CG  1 
ATOM   6263  C CD  . GLN C 1 88  ? 9.584   7.499   4.737   1.00 109.42 ? 88  GLN C CD  1 
ATOM   6264  O OE1 . GLN C 1 88  ? 8.734   6.670   5.064   1.00 122.43 ? 88  GLN C OE1 1 
ATOM   6265  N NE2 . GLN C 1 88  ? 9.811   7.829   3.470   1.00 112.87 ? 88  GLN C NE2 1 
ATOM   6266  N N   . PHE C 1 89  ? 12.256  5.746   9.036   1.00 77.23  ? 89  PHE C N   1 
ATOM   6267  C CA  . PHE C 1 89  ? 12.385  4.762   10.103  1.00 75.68  ? 89  PHE C CA  1 
ATOM   6268  C C   . PHE C 1 89  ? 13.375  5.194   11.180  1.00 84.49  ? 89  PHE C C   1 
ATOM   6269  O O   . PHE C 1 89  ? 13.114  5.045   12.377  1.00 81.83  ? 89  PHE C O   1 
ATOM   6270  C CB  . PHE C 1 89  ? 12.808  3.420   9.505   1.00 68.42  ? 89  PHE C CB  1 
ATOM   6271  C CG  . PHE C 1 89  ? 12.790  2.284   10.480  1.00 74.76  ? 89  PHE C CG  1 
ATOM   6272  C CD1 . PHE C 1 89  ? 11.680  2.047   11.270  1.00 83.52  ? 89  PHE C CD1 1 
ATOM   6273  C CD2 . PHE C 1 89  ? 13.870  1.426   10.576  1.00 82.39  ? 89  PHE C CD2 1 
ATOM   6274  C CE1 . PHE C 1 89  ? 11.659  0.992   12.160  1.00 85.37  ? 89  PHE C CE1 1 
ATOM   6275  C CE2 . PHE C 1 89  ? 13.857  0.369   11.463  1.00 79.16  ? 89  PHE C CE2 1 
ATOM   6276  C CZ  . PHE C 1 89  ? 12.748  0.148   12.253  1.00 74.93  ? 89  PHE C CZ  1 
ATOM   6277  N N   . SER C 1 90  ? 14.516  5.722   10.751  1.00 92.26  ? 90  SER C N   1 
ATOM   6278  C CA  . SER C 1 90  ? 15.523  6.193   11.690  1.00 85.25  ? 90  SER C CA  1 
ATOM   6279  C C   . SER C 1 90  ? 14.973  7.341   12.525  1.00 85.29  ? 90  SER C C   1 
ATOM   6280  O O   . SER C 1 90  ? 15.256  7.437   13.722  1.00 91.42  ? 90  SER C O   1 
ATOM   6281  C CB  . SER C 1 90  ? 16.793  6.631   10.957  1.00 75.69  ? 90  SER C CB  1 
ATOM   6282  O OG  . SER C 1 90  ? 16.584  7.835   10.239  1.00 92.95  ? 90  SER C OG  1 
ATOM   6283  N N   . LYS C 1 91  ? 14.167  8.198   11.903  1.00 74.69  ? 91  LYS C N   1 
ATOM   6284  C CA  . LYS C 1 91  ? 13.643  9.348   12.628  1.00 74.37  ? 91  LYS C CA  1 
ATOM   6285  C C   . LYS C 1 91  ? 12.576  8.905   13.639  1.00 86.42  ? 91  LYS C C   1 
ATOM   6286  O O   . LYS C 1 91  ? 12.586  9.348   14.801  1.00 98.38  ? 91  LYS C O   1 
ATOM   6287  C CB  . LYS C 1 91  ? 13.095  10.402  11.657  1.00 70.65  ? 91  LYS C CB  1 
ATOM   6288  C CG  . LYS C 1 91  ? 11.782  11.041  12.072  1.00 89.52  ? 91  LYS C CG  1 
ATOM   6289  C CD  . LYS C 1 91  ? 11.597  12.394  11.401  1.00 87.16  ? 91  LYS C CD  1 
ATOM   6290  C CE  . LYS C 1 91  ? 10.178  12.881  11.579  1.00 96.64  ? 91  LYS C CE  1 
ATOM   6291  N NZ  . LYS C 1 91  ? 10.071  14.338  11.308  1.00 91.94  ? 91  LYS C NZ  1 
ATOM   6292  N N   . VAL C 1 92  ? 11.686  8.001   13.224  1.00 77.43  ? 92  VAL C N   1 
ATOM   6293  C CA  . VAL C 1 92  ? 10.632  7.551   14.135  1.00 80.81  ? 92  VAL C CA  1 
ATOM   6294  C C   . VAL C 1 92  ? 11.247  6.771   15.307  1.00 87.43  ? 92  VAL C C   1 
ATOM   6295  O O   . VAL C 1 92  ? 10.805  6.907   16.459  1.00 77.45  ? 92  VAL C O   1 
ATOM   6296  C CB  . VAL C 1 92  ? 9.540   6.703   13.407  1.00 55.69  ? 92  VAL C CB  1 
ATOM   6297  C CG1 . VAL C 1 92  ? 10.068  5.349   12.961  1.00 57.43  ? 92  VAL C CG1 1 
ATOM   6298  C CG2 . VAL C 1 92  ? 8.319   6.528   14.300  1.00 64.86  ? 92  VAL C CG2 1 
ATOM   6299  N N   . ILE C 1 93  ? 12.285  5.985   15.026  1.00 76.77  ? 93  ILE C N   1 
ATOM   6300  C CA  . ILE C 1 93  ? 13.010  5.291   16.087  1.00 65.74  ? 93  ILE C CA  1 
ATOM   6301  C C   . ILE C 1 93  ? 13.709  6.307   16.996  1.00 74.66  ? 93  ILE C C   1 
ATOM   6302  O O   . ILE C 1 93  ? 13.804  6.099   18.208  1.00 77.81  ? 93  ILE C O   1 
ATOM   6303  C CB  . ILE C 1 93  ? 14.029  4.269   15.525  1.00 57.10  ? 93  ILE C CB  1 
ATOM   6304  C CG1 . ILE C 1 93  ? 13.332  2.942   15.224  1.00 62.19  ? 93  ILE C CG1 1 
ATOM   6305  C CG2 . ILE C 1 93  ? 15.144  3.994   16.514  1.00 72.30  ? 93  ILE C CG2 1 
ATOM   6306  C CD1 . ILE C 1 93  ? 14.279  1.846   14.791  1.00 66.94  ? 93  ILE C CD1 1 
ATOM   6307  N N   . ASP C 1 94  ? 14.150  7.429   16.430  1.00 82.28  ? 94  ASP C N   1 
ATOM   6308  C CA  . ASP C 1 94  ? 14.827  8.439   17.242  1.00 86.67  ? 94  ASP C CA  1 
ATOM   6309  C C   . ASP C 1 94  ? 13.868  9.086   18.228  1.00 82.58  ? 94  ASP C C   1 
ATOM   6310  O O   . ASP C 1 94  ? 14.226  9.354   19.383  1.00 80.62  ? 94  ASP C O   1 
ATOM   6311  C CB  . ASP C 1 94  ? 15.417  9.545   16.362  1.00 84.01  ? 94  ASP C CB  1 
ATOM   6312  C CG  . ASP C 1 94  ? 16.730  9.162   15.727  1.00 105.89 ? 94  ASP C CG  1 
ATOM   6313  O OD1 . ASP C 1 94  ? 17.445  8.309   16.289  1.00 110.41 ? 94  ASP C OD1 1 
ATOM   6314  O OD2 . ASP C 1 94  ? 17.046  9.725   14.658  1.00 106.94 ? 94  ASP C OD2 1 
ATOM   6315  N N   . GLU C 1 95  ? 12.632  9.298   17.790  1.00 74.47  ? 95  GLU C N   1 
ATOM   6316  C CA  . GLU C 1 95  ? 11.631  9.846   18.698  1.00 87.32  ? 95  GLU C CA  1 
ATOM   6317  C C   . GLU C 1 95  ? 11.158  8.825   19.739  1.00 71.55  ? 95  GLU C C   1 
ATOM   6318  O O   . GLU C 1 95  ? 10.888  9.191   20.890  1.00 70.42  ? 95  GLU C O   1 
ATOM   6319  C CB  . GLU C 1 95  ? 10.466  10.431  17.902  1.00 89.65  ? 95  GLU C CB  1 
ATOM   6320  C CG  . GLU C 1 95  ? 10.901  11.687  17.147  1.00 110.41 ? 95  GLU C CG  1 
ATOM   6321  C CD  . GLU C 1 95  ? 9.757   12.609  16.787  1.00 119.36 ? 95  GLU C CD  1 
ATOM   6322  O OE1 . GLU C 1 95  ? 8.614   12.336  17.204  1.00 116.21 ? 95  GLU C OE1 1 
ATOM   6323  O OE2 . GLU C 1 95  ? 10.011  13.621  16.098  1.00 129.27 ? 95  GLU C OE2 1 
ATOM   6324  N N   . LEU C 1 96  ? 11.067  7.552   19.354  1.00 65.47  ? 96  LEU C N   1 
ATOM   6325  C CA  . LEU C 1 96  ? 10.784  6.506   20.342  1.00 53.80  ? 96  LEU C CA  1 
ATOM   6326  C C   . LEU C 1 96  ? 11.859  6.483   21.433  1.00 69.33  ? 96  LEU C C   1 
ATOM   6327  O O   . LEU C 1 96  ? 11.557  6.446   22.637  1.00 70.49  ? 96  LEU C O   1 
ATOM   6328  C CB  . LEU C 1 96  ? 10.694  5.131   19.680  1.00 47.63  ? 96  LEU C CB  1 
ATOM   6329  C CG  . LEU C 1 96  ? 10.625  3.959   20.666  1.00 49.15  ? 96  LEU C CG  1 
ATOM   6330  C CD1 . LEU C 1 96  ? 9.351   4.016   21.492  1.00 47.95  ? 96  LEU C CD1 1 
ATOM   6331  C CD2 . LEU C 1 96  ? 10.741  2.624   19.952  1.00 36.50  ? 96  LEU C CD2 1 
ATOM   6332  N N   . SER C 1 97  ? 13.114  6.508   20.997  1.00 69.56  ? 97  SER C N   1 
ATOM   6333  C CA  . SER C 1 97  ? 14.253  6.552   21.904  1.00 58.62  ? 97  SER C CA  1 
ATOM   6334  C C   . SER C 1 97  ? 14.158  7.770   22.817  1.00 69.65  ? 97  SER C C   1 
ATOM   6335  O O   . SER C 1 97  ? 14.477  7.692   24.005  1.00 64.26  ? 97  SER C O   1 
ATOM   6336  C CB  . SER C 1 97  ? 15.566  6.573   21.122  1.00 65.44  ? 97  SER C CB  1 
ATOM   6337  O OG  . SER C 1 97  ? 16.680  6.596   21.998  1.00 71.29  ? 97  SER C OG  1 
ATOM   6338  N N   . SER C 1 98  ? 13.719  8.894   22.253  1.00 68.13  ? 98  SER C N   1 
ATOM   6339  C CA  . SER C 1 98  ? 13.499  10.102  23.043  1.00 60.34  ? 98  SER C CA  1 
ATOM   6340  C C   . SER C 1 98  ? 12.468  9.857   24.147  1.00 75.83  ? 98  SER C C   1 
ATOM   6341  O O   . SER C 1 98  ? 12.660  10.274  25.297  1.00 72.24  ? 98  SER C O   1 
ATOM   6342  C CB  . SER C 1 98  ? 13.048  11.255  22.144  1.00 61.64  ? 98  SER C CB  1 
ATOM   6343  O OG  . SER C 1 98  ? 12.515  12.322  22.909  1.00 77.51  ? 98  SER C OG  1 
ATOM   6344  N N   . CYS C 1 99  ? 11.384  9.170   23.791  1.00 67.26  ? 99  CYS C N   1 
ATOM   6345  C CA  . CYS C 1 99  ? 10.350  8.813   24.761  1.00 69.81  ? 99  CYS C CA  1 
ATOM   6346  C C   . CYS C 1 99  ? 10.936  8.001   25.915  1.00 62.93  ? 99  CYS C C   1 
ATOM   6347  O O   . CYS C 1 99  ? 10.769  8.355   27.092  1.00 66.20  ? 99  CYS C O   1 
ATOM   6348  C CB  . CYS C 1 99  ? 9.227   8.021   24.085  1.00 61.12  ? 99  CYS C CB  1 
ATOM   6349  S SG  . CYS C 1 99  ? 7.984   9.026   23.241  1.00 74.99  ? 99  CYS C SG  1 
ATOM   6350  N N   . HIS C 1 100 ? 11.634  6.922   25.568  1.00 55.99  ? 100 HIS C N   1 
ATOM   6351  C CA  . HIS C 1 100 ? 12.253  6.061   26.574  1.00 52.06  ? 100 HIS C CA  1 
ATOM   6352  C C   . HIS C 1 100 ? 13.242  6.831   27.454  1.00 59.80  ? 100 HIS C C   1 
ATOM   6353  O O   . HIS C 1 100 ? 13.378  6.549   28.648  1.00 65.47  ? 100 HIS C O   1 
ATOM   6354  C CB  . HIS C 1 100 ? 12.954  4.877   25.904  1.00 49.67  ? 100 HIS C CB  1 
ATOM   6355  C CG  . HIS C 1 100 ? 12.015  3.841   25.370  1.00 45.78  ? 100 HIS C CG  1 
ATOM   6356  N ND1 . HIS C 1 100 ? 11.174  3.108   26.181  1.00 53.30  ? 100 HIS C ND1 1 
ATOM   6357  C CD2 . HIS C 1 100 ? 11.785  3.410   24.106  1.00 54.80  ? 100 HIS C CD2 1 
ATOM   6358  C CE1 . HIS C 1 100 ? 10.466  2.274   25.441  1.00 44.96  ? 100 HIS C CE1 1 
ATOM   6359  N NE2 . HIS C 1 100 ? 10.818  2.437   24.178  1.00 59.72  ? 100 HIS C NE2 1 
ATOM   6360  N N   . ALA C 1 101 ? 13.923  7.806   26.860  1.00 63.62  ? 101 ALA C N   1 
ATOM   6361  C CA  . ALA C 1 101 ? 14.876  8.638   27.589  1.00 60.18  ? 101 ALA C CA  1 
ATOM   6362  C C   . ALA C 1 101 ? 14.175  9.510   28.627  1.00 56.78  ? 101 ALA C C   1 
ATOM   6363  O O   . ALA C 1 101 ? 14.598  9.580   29.789  1.00 65.45  ? 101 ALA C O   1 
ATOM   6364  C CB  . ALA C 1 101 ? 15.668  9.504   26.624  1.00 68.36  ? 101 ALA C CB  1 
ATOM   6365  N N   . VAL C 1 102 ? 13.103  10.175  28.203  1.00 55.99  ? 102 VAL C N   1 
ATOM   6366  C CA  . VAL C 1 102 ? 12.367  11.061  29.097  1.00 63.88  ? 102 VAL C CA  1 
ATOM   6367  C C   . VAL C 1 102 ? 11.758  10.248  30.238  1.00 69.89  ? 102 VAL C C   1 
ATOM   6368  O O   . VAL C 1 102 ? 11.749  10.689  31.399  1.00 57.45  ? 102 VAL C O   1 
ATOM   6369  C CB  . VAL C 1 102 ? 11.259  11.843  28.338  1.00 44.41  ? 102 VAL C CB  1 
ATOM   6370  C CG1 . VAL C 1 102 ? 9.901   11.713  29.027  1.00 59.43  ? 102 VAL C CG1 1 
ATOM   6371  C CG2 . VAL C 1 102 ? 11.649  13.304  28.185  1.00 46.23  ? 102 VAL C CG2 1 
ATOM   6372  N N   . LEU C 1 103 ? 11.303  9.039   29.917  1.00 64.35  ? 103 LEU C N   1 
ATOM   6373  C CA  . LEU C 1 103 ? 10.791  8.144   30.945  1.00 59.03  ? 103 LEU C CA  1 
ATOM   6374  C C   . LEU C 1 103 ? 11.909  7.765   31.909  1.00 63.10  ? 103 LEU C C   1 
ATOM   6375  O O   . LEU C 1 103 ? 11.687  7.677   33.111  1.00 63.62  ? 103 LEU C O   1 
ATOM   6376  C CB  . LEU C 1 103 ? 10.163  6.893   30.327  1.00 48.76  ? 103 LEU C CB  1 
ATOM   6377  C CG  . LEU C 1 103 ? 9.612   5.848   31.303  1.00 55.74  ? 103 LEU C CG  1 
ATOM   6378  C CD1 . LEU C 1 103 ? 8.703   6.494   32.337  1.00 37.55  ? 103 LEU C CD1 1 
ATOM   6379  C CD2 . LEU C 1 103 ? 8.860   4.761   30.551  1.00 48.49  ? 103 LEU C CD2 1 
ATOM   6380  N N   . SER C 1 104 ? 13.109  7.549   31.377  1.00 52.84  ? 104 SER C N   1 
ATOM   6381  C CA  . SER C 1 104 ? 14.259  7.205   32.210  1.00 50.32  ? 104 SER C CA  1 
ATOM   6382  C C   . SER C 1 104 ? 14.592  8.302   33.221  1.00 59.72  ? 104 SER C C   1 
ATOM   6383  O O   . SER C 1 104 ? 14.735  8.032   34.419  1.00 52.89  ? 104 SER C O   1 
ATOM   6384  C CB  . SER C 1 104 ? 15.480  6.927   31.334  1.00 45.22  ? 104 SER C CB  1 
ATOM   6385  O OG  . SER C 1 104 ? 15.441  5.617   30.799  1.00 59.22  ? 104 SER C OG  1 
ATOM   6386  N N   . THR C 1 105 ? 14.708  9.537   32.738  1.00 57.80  ? 105 THR C N   1 
ATOM   6387  C CA  . THR C 1 105 ? 15.055  10.656  33.611  1.00 59.24  ? 105 THR C CA  1 
ATOM   6388  C C   . THR C 1 105 ? 13.965  10.899  34.651  1.00 59.03  ? 105 THR C C   1 
ATOM   6389  O O   . THR C 1 105 ? 14.248  11.105  35.844  1.00 68.92  ? 105 THR C O   1 
ATOM   6390  C CB  . THR C 1 105 ? 15.288  11.959  32.817  1.00 63.44  ? 105 THR C CB  1 
ATOM   6391  O OG1 . THR C 1 105 ? 14.119  12.268  32.048  1.00 70.65  ? 105 THR C OG1 1 
ATOM   6392  C CG2 . THR C 1 105 ? 16.484  11.814  31.886  1.00 67.35  ? 105 THR C CG2 1 
ATOM   6393  N N   . GLN C 1 106 ? 12.715  10.868  34.199  1.00 67.21  ? 106 GLN C N   1 
ATOM   6394  C CA  . GLN C 1 106 ? 11.604  11.119  35.105  1.00 61.93  ? 106 GLN C CA  1 
ATOM   6395  C C   . GLN C 1 106 ? 11.474  10.015  36.151  1.00 63.66  ? 106 GLN C C   1 
ATOM   6396  O O   . GLN C 1 106 ? 11.111  10.281  37.295  1.00 68.59  ? 106 GLN C O   1 
ATOM   6397  C CB  . GLN C 1 106 ? 10.313  11.274  34.309  1.00 69.40  ? 106 GLN C CB  1 
ATOM   6398  C CG  . GLN C 1 106 ? 9.420   12.381  34.829  1.00 84.58  ? 106 GLN C CG  1 
ATOM   6399  C CD  . GLN C 1 106 ? 8.140   12.509  34.039  1.00 101.24 ? 106 GLN C CD  1 
ATOM   6400  O OE1 . GLN C 1 106 ? 7.968   11.860  33.006  1.00 95.00  ? 106 GLN C OE1 1 
ATOM   6401  N NE2 . GLN C 1 106 ? 7.258   13.397  34.483  1.00 114.57 ? 106 GLN C NE2 1 
ATOM   6402  N N   . LEU C 1 107 ? 11.811  8.788   35.764  1.00 55.60  ? 107 LEU C N   1 
ATOM   6403  C CA  . LEU C 1 107 ? 11.893  7.676   36.709  1.00 54.27  ? 107 LEU C CA  1 
ATOM   6404  C C   . LEU C 1 107 ? 12.975  7.956   37.732  1.00 57.15  ? 107 LEU C C   1 
ATOM   6405  O O   . LEU C 1 107 ? 12.792  7.726   38.926  1.00 59.54  ? 107 LEU C O   1 
ATOM   6406  C CB  . LEU C 1 107 ? 12.185  6.351   36.000  1.00 41.24  ? 107 LEU C CB  1 
ATOM   6407  C CG  . LEU C 1 107 ? 11.031  5.583   35.353  1.00 49.02  ? 107 LEU C CG  1 
ATOM   6408  C CD1 . LEU C 1 107 ? 11.543  4.270   34.789  1.00 42.47  ? 107 LEU C CD1 1 
ATOM   6409  C CD2 . LEU C 1 107 ? 9.912   5.334   36.351  1.00 47.07  ? 107 LEU C CD2 1 
ATOM   6410  N N   . ALA C 1 108 ? 14.112  8.444   37.249  1.00 68.39  ? 108 ALA C N   1 
ATOM   6411  C CA  . ALA C 1 108 ? 15.234  8.759   38.122  1.00 62.29  ? 108 ALA C CA  1 
ATOM   6412  C C   . ALA C 1 108 ? 14.818  9.762   39.195  1.00 62.84  ? 108 ALA C C   1 
ATOM   6413  O O   . ALA C 1 108 ? 15.167  9.599   40.365  1.00 66.70  ? 108 ALA C O   1 
ATOM   6414  C CB  . ALA C 1 108 ? 16.407  9.293   37.318  1.00 55.59  ? 108 ALA C CB  1 
ATOM   6415  N N   . ASP C 1 109 ? 14.070  10.794  38.810  1.00 61.93  ? 109 ASP C N   1 
ATOM   6416  C CA  . ASP C 1 109 ? 13.698  11.815  39.791  1.00 67.67  ? 109 ASP C CA  1 
ATOM   6417  C C   . ASP C 1 109 ? 12.489  11.464  40.671  1.00 68.83  ? 109 ASP C C   1 
ATOM   6418  O O   . ASP C 1 109 ? 12.511  11.694  41.881  1.00 74.60  ? 109 ASP C O   1 
ATOM   6419  C CB  . ASP C 1 109 ? 13.397  13.135  39.081  1.00 81.23  ? 109 ASP C CB  1 
ATOM   6420  C CG  . ASP C 1 109 ? 14.586  13.679  38.323  1.00 91.41  ? 109 ASP C CG  1 
ATOM   6421  O OD1 . ASP C 1 109 ? 15.726  13.533  38.807  1.00 92.95  ? 109 ASP C OD1 1 
ATOM   6422  O OD2 . ASP C 1 109 ? 14.373  14.255  37.235  1.00 97.63  ? 109 ASP C OD2 1 
ATOM   6423  N N   . ALA C 1 110 ? 11.442  10.908  40.066  1.00 75.21  ? 110 ALA C N   1 
ATOM   6424  C CA  . ALA C 1 110 ? 10.201  10.620  40.789  1.00 69.09  ? 110 ALA C CA  1 
ATOM   6425  C C   . ALA C 1 110 ? 10.188  9.285   41.531  1.00 63.62  ? 110 ALA C C   1 
ATOM   6426  O O   . ALA C 1 110 ? 9.518   9.141   42.554  1.00 64.43  ? 110 ALA C O   1 
ATOM   6427  C CB  . ALA C 1 110 ? 9.021   10.683  39.827  1.00 82.20  ? 110 ALA C CB  1 
ATOM   6428  N N   . MET C 1 111 ? 10.921  8.312   41.007  1.00 50.15  ? 111 MET C N   1 
ATOM   6429  C CA  . MET C 1 111 ? 10.877  6.953   41.530  1.00 48.90  ? 111 MET C CA  1 
ATOM   6430  C C   . MET C 1 111 ? 12.131  6.596   42.318  1.00 52.70  ? 111 MET C C   1 
ATOM   6431  O O   . MET C 1 111 ? 12.067  6.289   43.507  1.00 53.45  ? 111 MET C O   1 
ATOM   6432  C CB  . MET C 1 111 ? 10.680  5.960   40.383  1.00 40.66  ? 111 MET C CB  1 
ATOM   6433  C CG  . MET C 1 111 ? 10.716  4.504   40.795  1.00 37.47  ? 111 MET C CG  1 
ATOM   6434  S SD  . MET C 1 111 ? 10.866  3.411   39.370  1.00 60.06  ? 111 MET C SD  1 
ATOM   6435  C CE  . MET C 1 111 ? 9.779   2.073   39.847  1.00 67.04  ? 111 MET C CE  1 
ATOM   6436  N N   . MET C 1 112 ? 13.268  6.621   41.634  1.00 62.72  ? 112 MET C N   1 
ATOM   6437  C CA  . MET C 1 112 ? 14.529  6.174   42.209  1.00 55.27  ? 112 MET C CA  1 
ATOM   6438  C C   . MET C 1 112 ? 15.010  7.061   43.352  1.00 51.96  ? 112 MET C C   1 
ATOM   6439  O O   . MET C 1 112 ? 15.523  6.567   44.356  1.00 57.31  ? 112 MET C O   1 
ATOM   6440  C CB  . MET C 1 112 ? 15.596  6.103   41.114  1.00 50.14  ? 112 MET C CB  1 
ATOM   6441  C CG  . MET C 1 112 ? 16.586  4.963   41.278  1.00 53.06  ? 112 MET C CG  1 
ATOM   6442  S SD  . MET C 1 112 ? 15.779  3.387   41.623  1.00 65.86  ? 112 MET C SD  1 
ATOM   6443  C CE  . MET C 1 112 ? 14.577  3.307   40.297  1.00 52.13  ? 112 MET C CE  1 
ATOM   6444  N N   . PHE C 1 113 ? 14.850  8.369   43.193  1.00 55.54  ? 113 PHE C N   1 
ATOM   6445  C CA  . PHE C 1 113 ? 15.339  9.328   44.181  1.00 58.04  ? 113 PHE C CA  1 
ATOM   6446  C C   . PHE C 1 113 ? 14.654  9.233   45.557  1.00 64.29  ? 113 PHE C C   1 
ATOM   6447  O O   . PHE C 1 113 ? 15.347  9.230   46.573  1.00 67.70  ? 113 PHE C O   1 
ATOM   6448  C CB  . PHE C 1 113 ? 15.217  10.757  43.637  1.00 56.80  ? 113 PHE C CB  1 
ATOM   6449  C CG  . PHE C 1 113 ? 15.676  11.812  44.602  1.00 71.37  ? 113 PHE C CG  1 
ATOM   6450  C CD1 . PHE C 1 113 ? 17.025  11.999  44.856  1.00 67.07  ? 113 PHE C CD1 1 
ATOM   6451  C CD2 . PHE C 1 113 ? 14.758  12.618  45.256  1.00 79.40  ? 113 PHE C CD2 1 
ATOM   6452  C CE1 . PHE C 1 113 ? 17.450  12.969  45.745  1.00 74.42  ? 113 PHE C CE1 1 
ATOM   6453  C CE2 . PHE C 1 113 ? 15.177  13.589  46.145  1.00 71.25  ? 113 PHE C CE2 1 
ATOM   6454  C CZ  . PHE C 1 113 ? 16.525  13.765  46.390  1.00 72.74  ? 113 PHE C CZ  1 
ATOM   6455  N N   . PRO C 1 114 ? 13.305  9.167   45.607  1.00 67.54  ? 114 PRO C N   1 
ATOM   6456  C CA  . PRO C 1 114 ? 12.666  9.093   46.930  1.00 57.77  ? 114 PRO C CA  1 
ATOM   6457  C C   . PRO C 1 114 ? 13.072  7.887   47.777  1.00 59.32  ? 114 PRO C C   1 
ATOM   6458  O O   . PRO C 1 114 ? 13.334  8.051   48.968  1.00 65.40  ? 114 PRO C O   1 
ATOM   6459  C CB  . PRO C 1 114 ? 11.175  9.016   46.590  1.00 53.76  ? 114 PRO C CB  1 
ATOM   6460  C CG  . PRO C 1 114 ? 11.060  9.700   45.291  1.00 61.87  ? 114 PRO C CG  1 
ATOM   6461  C CD  . PRO C 1 114 ? 12.296  9.314   44.540  1.00 62.74  ? 114 PRO C CD  1 
ATOM   6462  N N   . ILE C 1 115 ? 13.113  6.699   47.182  1.00 47.93  ? 115 ILE C N   1 
ATOM   6463  C CA  . ILE C 1 115 ? 13.442  5.494   47.935  1.00 50.77  ? 115 ILE C CA  1 
ATOM   6464  C C   . ILE C 1 115 ? 14.915  5.495   48.359  1.00 58.10  ? 115 ILE C C   1 
ATOM   6465  O O   . ILE C 1 115 ? 15.259  5.016   49.443  1.00 71.47  ? 115 ILE C O   1 
ATOM   6466  C CB  . ILE C 1 115 ? 13.116  4.214   47.122  1.00 50.83  ? 115 ILE C CB  1 
ATOM   6467  C CG1 . ILE C 1 115 ? 13.086  2.986   48.034  1.00 57.81  ? 115 ILE C CG1 1 
ATOM   6468  C CG2 . ILE C 1 115 ? 14.086  4.026   45.959  1.00 54.07  ? 115 ILE C CG2 1 
ATOM   6469  C CD1 . ILE C 1 115 ? 12.443  1.775   47.396  1.00 68.54  ? 115 ILE C CD1 1 
ATOM   6470  N N   . THR C 1 116 ? 15.774  6.051   47.508  1.00 51.28  ? 116 THR C N   1 
ATOM   6471  C CA  . THR C 1 116 ? 17.195  6.166   47.803  1.00 61.40  ? 116 THR C CA  1 
ATOM   6472  C C   . THR C 1 116 ? 17.409  7.119   48.969  1.00 61.50  ? 116 THR C C   1 
ATOM   6473  O O   . THR C 1 116 ? 18.185  6.841   49.885  1.00 65.15  ? 116 THR C O   1 
ATOM   6474  C CB  . THR C 1 116 ? 17.990  6.663   46.580  1.00 64.20  ? 116 THR C CB  1 
ATOM   6475  O OG1 . THR C 1 116 ? 17.853  5.725   45.504  1.00 67.63  ? 116 THR C OG1 1 
ATOM   6476  C CG2 . THR C 1 116 ? 19.463  6.821   46.923  1.00 53.34  ? 116 THR C CG2 1 
ATOM   6477  N N   . GLN C 1 117 ? 16.700  8.241   48.929  1.00 56.28  ? 117 GLN C N   1 
ATOM   6478  C CA  . GLN C 1 117 ? 16.770  9.227   49.994  1.00 55.48  ? 117 GLN C CA  1 
ATOM   6479  C C   . GLN C 1 117 ? 16.198  8.664   51.288  1.00 61.54  ? 117 GLN C C   1 
ATOM   6480  O O   . GLN C 1 117 ? 16.673  8.983   52.375  1.00 70.46  ? 117 GLN C O   1 
ATOM   6481  C CB  . GLN C 1 117 ? 16.021  10.496  49.582  1.00 55.43  ? 117 GLN C CB  1 
ATOM   6482  C CG  . GLN C 1 117 ? 15.275  11.194  50.707  1.00 82.53  ? 117 GLN C CG  1 
ATOM   6483  C CD  . GLN C 1 117 ? 14.132  12.045  50.195  1.00 106.45 ? 117 GLN C CD  1 
ATOM   6484  O OE1 . GLN C 1 117 ? 14.335  13.171  49.743  1.00 113.72 ? 117 GLN C OE1 1 
ATOM   6485  N NE2 . GLN C 1 117 ? 12.920  11.505  50.256  1.00 110.66 ? 117 GLN C NE2 1 
ATOM   6486  N N   . PHE C 1 118 ? 15.202  7.794   51.169  1.00 60.70  ? 118 PHE C N   1 
ATOM   6487  C CA  . PHE C 1 118 ? 14.658  7.124   52.343  1.00 63.11  ? 118 PHE C CA  1 
ATOM   6488  C C   . PHE C 1 118 ? 15.665  6.160   52.951  1.00 70.16  ? 118 PHE C C   1 
ATOM   6489  O O   . PHE C 1 118 ? 15.775  6.053   54.172  1.00 72.28  ? 118 PHE C O   1 
ATOM   6490  C CB  . PHE C 1 118 ? 13.371  6.371   52.005  1.00 62.24  ? 118 PHE C CB  1 
ATOM   6491  C CG  . PHE C 1 118 ? 12.753  5.685   53.188  1.00 56.38  ? 118 PHE C CG  1 
ATOM   6492  C CD1 . PHE C 1 118 ? 12.180  6.422   54.211  1.00 58.53  ? 118 PHE C CD1 1 
ATOM   6493  C CD2 . PHE C 1 118 ? 12.768  4.304   53.290  1.00 58.44  ? 118 PHE C CD2 1 
ATOM   6494  C CE1 . PHE C 1 118 ? 11.618  5.793   55.308  1.00 57.76  ? 118 PHE C CE1 1 
ATOM   6495  C CE2 . PHE C 1 118 ? 12.208  3.669   54.383  1.00 61.15  ? 118 PHE C CE2 1 
ATOM   6496  C CZ  . PHE C 1 118 ? 11.632  4.415   55.394  1.00 51.85  ? 118 PHE C CZ  1 
ATOM   6497  N N   . LYS C 1 119 ? 16.404  5.460   52.097  1.00 73.40  ? 119 LYS C N   1 
ATOM   6498  C CA  . LYS C 1 119 ? 17.309  4.430   52.584  1.00 72.91  ? 119 LYS C CA  1 
ATOM   6499  C C   . LYS C 1 119 ? 18.653  5.001   53.039  1.00 69.55  ? 119 LYS C C   1 
ATOM   6500  O O   . LYS C 1 119 ? 19.324  4.414   53.889  1.00 73.55  ? 119 LYS C O   1 
ATOM   6501  C CB  . LYS C 1 119 ? 17.520  3.374   51.489  1.00 68.20  ? 119 LYS C CB  1 
ATOM   6502  C CG  . LYS C 1 119 ? 18.444  2.225   51.863  1.00 85.49  ? 119 LYS C CG  1 
ATOM   6503  C CD  . LYS C 1 119 ? 18.547  1.209   50.734  1.00 82.48  ? 119 LYS C CD  1 
ATOM   6504  C CE  . LYS C 1 119 ? 19.298  1.771   49.540  1.00 86.31  ? 119 LYS C CE  1 
ATOM   6505  N NZ  . LYS C 1 119 ? 20.725  2.042   49.872  1.00 100.09 ? 119 LYS C NZ  1 
ATOM   6506  N N   . GLU C 1 120 ? 19.043  6.149   52.491  1.00 59.80  ? 120 GLU C N   1 
ATOM   6507  C CA  . GLU C 1 120 ? 20.301  6.775   52.894  1.00 65.12  ? 120 GLU C CA  1 
ATOM   6508  C C   . GLU C 1 120 ? 20.174  7.939   53.883  1.00 62.47  ? 120 GLU C C   1 
ATOM   6509  O O   . GLU C 1 120 ? 21.182  8.413   54.407  1.00 72.35  ? 120 GLU C O   1 
ATOM   6510  C CB  . GLU C 1 120 ? 21.067  7.236   51.653  1.00 63.40  ? 120 GLU C CB  1 
ATOM   6511  C CG  . GLU C 1 120 ? 21.655  6.079   50.858  1.00 64.21  ? 120 GLU C CG  1 
ATOM   6512  C CD  . GLU C 1 120 ? 21.899  6.424   49.406  1.00 89.62  ? 120 GLU C CD  1 
ATOM   6513  O OE1 . GLU C 1 120 ? 21.957  7.628   49.078  1.00 94.95  ? 120 GLU C OE1 1 
ATOM   6514  O OE2 . GLU C 1 120 ? 22.037  5.488   48.590  1.00 100.37 ? 120 GLU C OE2 1 
ATOM   6515  N N   . ARG C 1 121 ? 18.955  8.403   54.143  1.00 61.20  ? 121 ARG C N   1 
ATOM   6516  C CA  . ARG C 1 121 ? 18.766  9.451   55.144  1.00 70.07  ? 121 ARG C CA  1 
ATOM   6517  C C   . ARG C 1 121 ? 18.070  8.918   56.389  1.00 70.90  ? 121 ARG C C   1 
ATOM   6518  O O   . ARG C 1 121 ? 18.645  8.927   57.472  1.00 78.81  ? 121 ARG C O   1 
ATOM   6519  C CB  . ARG C 1 121 ? 17.978  10.638  54.579  1.00 65.17  ? 121 ARG C CB  1 
ATOM   6520  C CG  . ARG C 1 121 ? 18.839  11.699  53.911  1.00 78.81  ? 121 ARG C CG  1 
ATOM   6521  C CD  . ARG C 1 121 ? 18.246  13.093  54.088  1.00 91.74  ? 121 ARG C CD  1 
ATOM   6522  N NE  . ARG C 1 121 ? 16.807  13.122  53.844  1.00 107.21 ? 121 ARG C NE  1 
ATOM   6523  C CZ  . ARG C 1 121 ? 16.035  14.184  54.052  1.00 104.78 ? 121 ARG C CZ  1 
ATOM   6524  N NH1 . ARG C 1 121 ? 16.562  15.311  54.512  1.00 103.48 ? 121 ARG C NH1 1 
ATOM   6525  N NH2 . ARG C 1 121 ? 14.734  14.120  53.801  1.00 90.52  ? 121 ARG C NH2 1 
ATOM   6526  N N   . ASP C 1 122 ? 16.838  8.446   56.228  1.00 65.16  ? 122 ASP C N   1 
ATOM   6527  C CA  . ASP C 1 122 ? 16.005  8.096   57.375  1.00 77.40  ? 122 ASP C CA  1 
ATOM   6528  C C   . ASP C 1 122 ? 16.431  6.790   58.042  1.00 69.12  ? 122 ASP C C   1 
ATOM   6529  O O   . ASP C 1 122 ? 16.619  6.750   59.257  1.00 67.22  ? 122 ASP C O   1 
ATOM   6530  C CB  . ASP C 1 122 ? 14.533  8.013   56.960  1.00 79.56  ? 122 ASP C CB  1 
ATOM   6531  C CG  . ASP C 1 122 ? 14.048  9.278   56.275  1.00 91.01  ? 122 ASP C CG  1 
ATOM   6532  O OD1 . ASP C 1 122 ? 14.104  10.355  56.907  1.00 93.15  ? 122 ASP C OD1 1 
ATOM   6533  O OD2 . ASP C 1 122 ? 13.608  9.198   55.109  1.00 94.18  ? 122 ASP C OD2 1 
ATOM   6534  N N   . LEU C 1 123 ? 16.585  5.727   57.257  1.00 60.35  ? 123 LEU C N   1 
ATOM   6535  C CA  . LEU C 1 123 ? 17.023  4.445   57.802  1.00 53.09  ? 123 LEU C CA  1 
ATOM   6536  C C   . LEU C 1 123 ? 18.412  4.562   58.428  1.00 60.65  ? 123 LEU C C   1 
ATOM   6537  O O   . LEU C 1 123 ? 18.664  4.038   59.518  1.00 68.40  ? 123 LEU C O   1 
ATOM   6538  C CB  . LEU C 1 123 ? 17.021  3.366   56.716  1.00 56.49  ? 123 LEU C CB  1 
ATOM   6539  C CG  . LEU C 1 123 ? 15.653  2.827   56.296  1.00 56.48  ? 123 LEU C CG  1 
ATOM   6540  C CD1 . LEU C 1 123 ? 15.807  1.687   55.297  1.00 64.35  ? 123 LEU C CD1 1 
ATOM   6541  C CD2 . LEU C 1 123 ? 14.852  2.381   57.510  1.00 43.04  ? 123 LEU C CD2 1 
ATOM   6542  N N   . LYS C 1 124 ? 19.305  5.262   57.736  1.00 58.69  ? 124 LYS C N   1 
ATOM   6543  C CA  . LYS C 1 124 ? 20.657  5.486   58.234  1.00 59.74  ? 124 LYS C CA  1 
ATOM   6544  C C   . LYS C 1 124 ? 20.657  6.334   59.503  1.00 65.64  ? 124 LYS C C   1 
ATOM   6545  O O   . LYS C 1 124 ? 21.442  6.081   60.419  1.00 58.89  ? 124 LYS C O   1 
ATOM   6546  C CB  . LYS C 1 124 ? 21.530  6.130   57.153  1.00 50.91  ? 124 LYS C CB  1 
ATOM   6547  C CG  . LYS C 1 124 ? 22.039  5.134   56.119  1.00 75.43  ? 124 LYS C CG  1 
ATOM   6548  C CD  . LYS C 1 124 ? 22.865  4.047   56.798  1.00 75.82  ? 124 LYS C CD  1 
ATOM   6549  C CE  . LYS C 1 124 ? 23.401  3.036   55.800  1.00 91.24  ? 124 LYS C CE  1 
ATOM   6550  N NZ  . LYS C 1 124 ? 24.278  2.025   56.455  1.00 75.38  ? 124 LYS C NZ  1 
ATOM   6551  N N   . GLU C 1 125 ? 19.785  7.338   59.554  1.00 51.75  ? 125 GLU C N   1 
ATOM   6552  C CA  . GLU C 1 125 ? 19.646  8.154   60.756  1.00 50.67  ? 125 GLU C CA  1 
ATOM   6553  C C   . GLU C 1 125 ? 19.178  7.293   61.920  1.00 62.28  ? 125 GLU C C   1 
ATOM   6554  O O   . GLU C 1 125 ? 19.656  7.436   63.045  1.00 55.90  ? 125 GLU C O   1 
ATOM   6555  C CB  . GLU C 1 125 ? 18.662  9.303   60.529  1.00 51.47  ? 125 GLU C CB  1 
ATOM   6556  C CG  . GLU C 1 125 ? 18.066  9.866   61.809  1.00 79.06  ? 125 GLU C CG  1 
ATOM   6557  C CD  . GLU C 1 125 ? 17.021  10.933  61.557  1.00 91.24  ? 125 GLU C CD  1 
ATOM   6558  O OE1 . GLU C 1 125 ? 16.310  10.843  60.534  1.00 86.47  ? 125 GLU C OE1 1 
ATOM   6559  O OE2 . GLU C 1 125 ? 16.919  11.868  62.381  1.00 76.70  ? 125 GLU C OE2 1 
ATOM   6560  N N   . ILE C 1 126 ? 18.242  6.396   61.632  1.00 60.39  ? 126 ILE C N   1 
ATOM   6561  C CA  . ILE C 1 126 ? 17.749  5.445   62.620  1.00 54.00  ? 126 ILE C CA  1 
ATOM   6562  C C   . ILE C 1 126 ? 18.867  4.568   63.173  1.00 61.87  ? 126 ILE C C   1 
ATOM   6563  O O   . ILE C 1 126 ? 19.017  4.441   64.389  1.00 61.53  ? 126 ILE C O   1 
ATOM   6564  C CB  . ILE C 1 126 ? 16.643  4.547   62.033  1.00 56.62  ? 126 ILE C CB  1 
ATOM   6565  C CG1 . ILE C 1 126 ? 15.368  5.359   61.806  1.00 56.12  ? 126 ILE C CG1 1 
ATOM   6566  C CG2 . ILE C 1 126 ? 16.355  3.380   62.958  1.00 57.44  ? 126 ILE C CG2 1 
ATOM   6567  C CD1 . ILE C 1 126 ? 14.658  5.749   63.083  1.00 59.89  ? 126 ILE C CD1 1 
ATOM   6568  N N   . LEU C 1 127 ? 19.651  3.970   62.280  1.00 52.63  ? 127 LEU C N   1 
ATOM   6569  C CA  . LEU C 1 127 ? 20.751  3.102   62.697  1.00 58.23  ? 127 LEU C CA  1 
ATOM   6570  C C   . LEU C 1 127 ? 21.781  3.882   63.516  1.00 54.44  ? 127 LEU C C   1 
ATOM   6571  O O   . LEU C 1 127 ? 22.303  3.392   64.524  1.00 52.81  ? 127 LEU C O   1 
ATOM   6572  C CB  . LEU C 1 127 ? 21.413  2.456   61.478  1.00 43.19  ? 127 LEU C CB  1 
ATOM   6573  C CG  . LEU C 1 127 ? 22.209  1.170   61.716  1.00 71.18  ? 127 LEU C CG  1 
ATOM   6574  C CD1 . LEU C 1 127 ? 22.013  0.200   60.560  1.00 57.33  ? 127 LEU C CD1 1 
ATOM   6575  C CD2 . LEU C 1 127 ? 23.687  1.469   61.922  1.00 81.31  ? 127 LEU C CD2 1 
ATOM   6576  N N   . THR C 1 128 ? 22.047  5.109   63.078  1.00 43.48  ? 128 THR C N   1 
ATOM   6577  C CA  . THR C 1 128 ? 22.983  5.999   63.754  1.00 48.29  ? 128 THR C CA  1 
ATOM   6578  C C   . THR C 1 128 ? 22.542  6.287   65.185  1.00 54.34  ? 128 THR C C   1 
ATOM   6579  O O   . THR C 1 128 ? 23.291  6.057   66.137  1.00 51.74  ? 128 THR C O   1 
ATOM   6580  C CB  . THR C 1 128 ? 23.129  7.334   62.998  1.00 45.31  ? 128 THR C CB  1 
ATOM   6581  O OG1 . THR C 1 128 ? 23.722  7.099   61.715  1.00 55.07  ? 128 THR C OG1 1 
ATOM   6582  C CG2 . THR C 1 128 ? 23.997  8.303   63.785  1.00 45.91  ? 128 THR C CG2 1 
ATOM   6583  N N   . LEU C 1 129 ? 21.321  6.796   65.320  1.00 56.64  ? 129 LEU C N   1 
ATOM   6584  C CA  . LEU C 1 129 ? 20.747  7.125   66.619  1.00 47.00  ? 129 LEU C CA  1 
ATOM   6585  C C   . LEU C 1 129 ? 20.694  5.896   67.520  1.00 45.60  ? 129 LEU C C   1 
ATOM   6586  O O   . LEU C 1 129 ? 20.909  5.990   68.731  1.00 45.37  ? 129 LEU C O   1 
ATOM   6587  C CB  . LEU C 1 129 ? 19.350  7.720   66.443  1.00 39.50  ? 129 LEU C CB  1 
ATOM   6588  C CG  . LEU C 1 129 ? 19.329  9.216   66.121  1.00 41.17  ? 129 LEU C CG  1 
ATOM   6589  C CD1 . LEU C 1 129 ? 17.917  9.686   65.828  1.00 42.26  ? 129 LEU C CD1 1 
ATOM   6590  C CD2 . LEU C 1 129 ? 19.942  10.024  67.253  1.00 50.46  ? 129 LEU C CD2 1 
ATOM   6591  N N   . LYS C 1 130 ? 20.411  4.745   66.917  1.00 40.59  ? 130 LYS C N   1 
ATOM   6592  C CA  . LYS C 1 130 ? 20.441  3.473   67.628  1.00 37.39  ? 130 LYS C CA  1 
ATOM   6593  C C   . LYS C 1 130 ? 21.823  3.221   68.226  1.00 53.83  ? 130 LYS C C   1 
ATOM   6594  O O   . LYS C 1 130 ? 21.944  2.908   69.413  1.00 58.75  ? 130 LYS C O   1 
ATOM   6595  C CB  . LYS C 1 130 ? 20.048  2.321   66.701  1.00 36.67  ? 130 LYS C CB  1 
ATOM   6596  C CG  . LYS C 1 130 ? 20.234  0.941   67.317  1.00 35.65  ? 130 LYS C CG  1 
ATOM   6597  C CD  . LYS C 1 130 ? 19.957  -0.163  66.309  1.00 40.60  ? 130 LYS C CD  1 
ATOM   6598  C CE  . LYS C 1 130 ? 20.269  -1.533  66.888  1.00 50.34  ? 130 LYS C CE  1 
ATOM   6599  N N   . GLU C 1 131 ? 22.867  3.387   67.416  1.00 61.21  ? 131 GLU C N   1 
ATOM   6600  C CA  . GLU C 1 131 ? 24.223  3.056   67.860  1.00 61.16  ? 131 GLU C CA  1 
ATOM   6601  C C   . GLU C 1 131 ? 24.720  4.040   68.917  1.00 54.20  ? 131 GLU C C   1 
ATOM   6602  O O   . GLU C 1 131 ? 25.398  3.657   69.883  1.00 45.49  ? 131 GLU C O   1 
ATOM   6603  C CB  . GLU C 1 131 ? 25.189  3.076   66.669  1.00 62.81  ? 131 GLU C CB  1 
ATOM   6604  C CG  . GLU C 1 131 ? 25.014  1.964   65.651  1.00 92.39  ? 131 GLU C CG  1 
ATOM   6605  C CD  . GLU C 1 131 ? 25.753  0.698   66.031  1.00 110.74 ? 131 GLU C CD  1 
ATOM   6606  O OE1 . GLU C 1 131 ? 26.539  0.733   67.002  1.00 114.87 ? 131 GLU C OE1 1 
ATOM   6607  O OE2 . GLU C 1 131 ? 25.559  -0.329  65.348  1.00 113.91 ? 131 GLU C OE2 1 
ATOM   6608  N N   . VAL C 1 132 ? 24.336  5.302   68.749  1.00 45.61  ? 132 VAL C N   1 
ATOM   6609  C CA  . VAL C 1 132 ? 24.666  6.343   69.712  1.00 43.53  ? 132 VAL C CA  1 
ATOM   6610  C C   . VAL C 1 132 ? 24.001  6.063   71.056  1.00 56.96  ? 132 VAL C C   1 
ATOM   6611  O O   . VAL C 1 132 ? 24.638  6.147   72.112  1.00 56.21  ? 132 VAL C O   1 
ATOM   6612  C CB  . VAL C 1 132 ? 24.242  7.733   69.199  1.00 36.32  ? 132 VAL C CB  1 
ATOM   6613  C CG1 . VAL C 1 132 ? 24.402  8.775   70.288  1.00 42.05  ? 132 VAL C CG1 1 
ATOM   6614  C CG2 . VAL C 1 132 ? 25.067  8.116   67.982  1.00 46.06  ? 132 VAL C CG2 1 
ATOM   6615  N N   . PHE C 1 133 ? 22.719  5.712   71.004  1.00 54.20  ? 133 PHE C N   1 
ATOM   6616  C CA  . PHE C 1 133 ? 21.976  5.362   72.208  1.00 37.48  ? 133 PHE C CA  1 
ATOM   6617  C C   . PHE C 1 133 ? 22.575  4.150   72.913  1.00 48.30  ? 133 PHE C C   1 
ATOM   6618  O O   . PHE C 1 133 ? 22.672  4.133   74.140  1.00 60.32  ? 133 PHE C O   1 
ATOM   6619  C CB  . PHE C 1 133 ? 20.508  5.098   71.877  1.00 45.91  ? 133 PHE C CB  1 
ATOM   6620  C CG  . PHE C 1 133 ? 19.790  4.303   72.925  1.00 55.20  ? 133 PHE C CG  1 
ATOM   6621  C CD1 . PHE C 1 133 ? 19.557  4.837   74.182  1.00 48.39  ? 133 PHE C CD1 1 
ATOM   6622  C CD2 . PHE C 1 133 ? 19.348  3.019   72.655  1.00 60.97  ? 133 PHE C CD2 1 
ATOM   6623  C CE1 . PHE C 1 133 ? 18.903  4.102   75.149  1.00 37.40  ? 133 PHE C CE1 1 
ATOM   6624  C CE2 . PHE C 1 133 ? 18.688  2.282   73.617  1.00 61.54  ? 133 PHE C CE2 1 
ATOM   6625  C CZ  . PHE C 1 133 ? 18.463  2.826   74.864  1.00 48.56  ? 133 PHE C CZ  1 
ATOM   6626  N N   . GLN C 1 134 ? 22.965  3.136   72.145  1.00 41.99  ? 134 GLN C N   1 
ATOM   6627  C CA  . GLN C 1 134 ? 23.599  1.954   72.727  1.00 54.92  ? 134 GLN C CA  1 
ATOM   6628  C C   . GLN C 1 134 ? 24.890  2.332   73.449  1.00 52.06  ? 134 GLN C C   1 
ATOM   6629  O O   . GLN C 1 134 ? 25.141  1.881   74.574  1.00 58.80  ? 134 GLN C O   1 
ATOM   6630  C CB  . GLN C 1 134 ? 23.881  0.896   71.659  1.00 52.45  ? 134 GLN C CB  1 
ATOM   6631  C CG  . GLN C 1 134 ? 22.634  0.320   71.010  1.00 62.18  ? 134 GLN C CG  1 
ATOM   6632  C CD  . GLN C 1 134 ? 22.752  -1.167  70.741  1.00 89.36  ? 134 GLN C CD  1 
ATOM   6633  O OE1 . GLN C 1 134 ? 23.275  -1.919  71.564  1.00 102.11 ? 134 GLN C OE1 1 
ATOM   6634  N NE2 . GLN C 1 134 ? 22.267  -1.599  69.583  1.00 74.61  ? 134 GLN C NE2 1 
ATOM   6635  N N   . ILE C 1 135 ? 25.703  3.164   72.800  1.00 40.56  ? 135 ILE C N   1 
ATOM   6636  C CA  . ILE C 1 135 ? 26.951  3.622   73.407  1.00 46.69  ? 135 ILE C CA  1 
ATOM   6637  C C   . ILE C 1 135 ? 26.685  4.364   74.720  1.00 56.62  ? 135 ILE C C   1 
ATOM   6638  O O   . ILE C 1 135 ? 27.334  4.097   75.742  1.00 59.45  ? 135 ILE C O   1 
ATOM   6639  C CB  . ILE C 1 135 ? 27.741  4.534   72.448  1.00 44.56  ? 135 ILE C CB  1 
ATOM   6640  C CG1 . ILE C 1 135 ? 28.354  3.705   71.319  1.00 34.73  ? 135 ILE C CG1 1 
ATOM   6641  C CG2 . ILE C 1 135 ? 28.831  5.286   73.195  1.00 49.94  ? 135 ILE C CG2 1 
ATOM   6642  C CD1 . ILE C 1 135 ? 29.246  4.499   70.392  1.00 48.19  ? 135 ILE C CD1 1 
ATOM   6643  N N   . ALA C 1 136 ? 25.721  5.281   74.692  1.00 50.19  ? 136 ALA C N   1 
ATOM   6644  C CA  . ALA C 1 136 ? 25.339  6.024   75.890  1.00 46.55  ? 136 ALA C CA  1 
ATOM   6645  C C   . ALA C 1 136 ? 24.887  5.082   77.006  1.00 48.56  ? 136 ALA C C   1 
ATOM   6646  O O   . ALA C 1 136 ? 25.205  5.293   78.180  1.00 45.76  ? 136 ALA C O   1 
ATOM   6647  C CB  . ALA C 1 136 ? 24.242  7.026   75.565  1.00 45.53  ? 136 ALA C CB  1 
ATOM   6648  N N   . SER C 1 137 ? 24.149  4.041   76.628  1.00 43.77  ? 137 SER C N   1 
ATOM   6649  C CA  . SER C 1 137 ? 23.683  3.036   77.578  1.00 49.57  ? 137 SER C CA  1 
ATOM   6650  C C   . SER C 1 137 ? 24.847  2.321   78.253  1.00 43.18  ? 137 SER C C   1 
ATOM   6651  O O   . SER C 1 137 ? 24.877  2.192   79.479  1.00 48.52  ? 137 SER C O   1 
ATOM   6652  C CB  . SER C 1 137 ? 22.782  2.015   76.882  1.00 53.97  ? 137 SER C CB  1 
ATOM   6653  O OG  . SER C 1 137 ? 22.686  0.823   77.643  1.00 48.84  ? 137 SER C OG  1 
ATOM   6654  N N   . ASN C 1 138 ? 25.798  1.855   77.447  1.00 43.24  ? 138 ASN C N   1 
ATOM   6655  C CA  . ASN C 1 138 ? 26.979  1.181   77.979  1.00 44.62  ? 138 ASN C CA  1 
ATOM   6656  C C   . ASN C 1 138 ? 27.757  2.084   78.935  1.00 46.58  ? 138 ASN C C   1 
ATOM   6657  O O   . ASN C 1 138 ? 28.183  1.657   80.022  1.00 41.70  ? 138 ASN C O   1 
ATOM   6658  C CB  . ASN C 1 138 ? 27.887  0.719   76.838  1.00 44.64  ? 138 ASN C CB  1 
ATOM   6659  C CG  . ASN C 1 138 ? 27.271  -0.400  76.020  1.00 49.99  ? 138 ASN C CG  1 
ATOM   6660  O OD1 . ASN C 1 138 ? 26.350  -1.081  76.471  1.00 54.76  ? 138 ASN C OD1 1 
ATOM   6661  N ND2 . ASN C 1 138 ? 27.780  -0.596  74.808  1.00 35.42  ? 138 ASN C ND2 1 
ATOM   6662  N N   . ASP C 1 139 ? 27.920  3.341   78.529  1.00 39.16  ? 139 ASP C N   1 
ATOM   6663  C CA  . ASP C 1 139 ? 28.631  4.318   79.345  1.00 42.00  ? 139 ASP C CA  1 
ATOM   6664  C C   . ASP C 1 139 ? 27.940  4.531   80.690  1.00 49.53  ? 139 ASP C C   1 
ATOM   6665  O O   . ASP C 1 139 ? 28.598  4.572   81.734  1.00 51.11  ? 139 ASP C O   1 
ATOM   6666  C CB  . ASP C 1 139 ? 28.752  5.650   78.602  1.00 42.76  ? 139 ASP C CB  1 
ATOM   6667  C CG  . ASP C 1 139 ? 29.707  5.576   77.425  1.00 71.45  ? 139 ASP C CG  1 
ATOM   6668  O OD1 . ASP C 1 139 ? 30.530  4.637   77.382  1.00 68.30  ? 139 ASP C OD1 1 
ATOM   6669  O OD2 . ASP C 1 139 ? 29.635  6.458   76.543  1.00 79.12  ? 139 ASP C OD2 1 
ATOM   6670  N N   . HIS C 1 140 ? 26.615  4.656   80.664  1.00 54.75  ? 140 HIS C N   1 
ATOM   6671  C CA  . HIS C 1 140 ? 25.858  4.813   81.903  1.00 41.36  ? 140 HIS C CA  1 
ATOM   6672  C C   . HIS C 1 140 ? 25.978  3.587   82.797  1.00 42.45  ? 140 HIS C C   1 
ATOM   6673  O O   . HIS C 1 140 ? 26.080  3.713   84.019  1.00 39.04  ? 140 HIS C O   1 
ATOM   6674  C CB  . HIS C 1 140 ? 24.384  5.096   81.623  1.00 45.41  ? 140 HIS C CB  1 
ATOM   6675  C CG  . HIS C 1 140 ? 23.562  5.241   82.866  1.00 48.72  ? 140 HIS C CG  1 
ATOM   6676  N ND1 . HIS C 1 140 ? 22.685  4.271   83.299  1.00 52.89  ? 140 HIS C ND1 1 
ATOM   6677  C CD2 . HIS C 1 140 ? 23.505  6.237   83.783  1.00 50.48  ? 140 HIS C CD2 1 
ATOM   6678  C CE1 . HIS C 1 140 ? 22.112  4.668   84.422  1.00 55.10  ? 140 HIS C CE1 1 
ATOM   6679  N NE2 . HIS C 1 140 ? 22.593  5.857   84.736  1.00 48.32  ? 140 HIS C NE2 1 
ATOM   6680  N N   . ASP C 1 141 ? 25.952  2.406   82.184  1.00 42.77  ? 141 ASP C N   1 
ATOM   6681  C CA  . ASP C 1 141 ? 26.111  1.164   82.929  1.00 36.61  ? 141 ASP C CA  1 
ATOM   6682  C C   . ASP C 1 141 ? 27.421  1.207   83.700  1.00 38.76  ? 141 ASP C C   1 
ATOM   6683  O O   . ASP C 1 141 ? 27.439  1.047   84.927  1.00 55.13  ? 141 ASP C O   1 
ATOM   6684  C CB  . ASP C 1 141 ? 26.082  -0.047  81.994  1.00 29.98  ? 141 ASP C CB  1 
ATOM   6685  C CG  . ASP C 1 141 ? 24.727  -0.254  81.346  1.00 52.25  ? 141 ASP C CG  1 
ATOM   6686  O OD1 . ASP C 1 141 ? 23.714  0.199   81.921  1.00 67.80  ? 141 ASP C OD1 1 
ATOM   6687  O OD2 . ASP C 1 141 ? 24.673  -0.871  80.261  1.00 57.59  ? 141 ASP C OD2 1 
ATOM   6688  N N   . ALA C 1 142 ? 28.507  1.462   82.975  1.00 45.95  ? 142 ALA C N   1 
ATOM   6689  C CA  . ALA C 1 142 ? 29.825  1.594   83.589  1.00 47.00  ? 142 ALA C CA  1 
ATOM   6690  C C   . ALA C 1 142 ? 29.811  2.601   84.740  1.00 46.54  ? 142 ALA C C   1 
ATOM   6691  O O   . ALA C 1 142 ? 30.296  2.314   85.843  1.00 39.78  ? 142 ALA C O   1 
ATOM   6692  C CB  . ALA C 1 142 ? 30.853  2.001   82.544  1.00 30.37  ? 142 ALA C CB  1 
ATOM   6693  N N   . ALA C 1 143 ? 29.236  3.771   84.477  1.00 35.92  ? 143 ALA C N   1 
ATOM   6694  C CA  . ALA C 1 143 ? 29.209  4.856   85.453  1.00 41.38  ? 143 ALA C CA  1 
ATOM   6695  C C   . ALA C 1 143 ? 28.515  4.460   86.757  1.00 49.22  ? 143 ALA C C   1 
ATOM   6696  O O   . ALA C 1 143 ? 29.065  4.656   87.843  1.00 45.53  ? 143 ALA C O   1 
ATOM   6697  C CB  . ALA C 1 143 ? 28.535  6.080   84.851  1.00 37.64  ? 143 ALA C CB  1 
ATOM   6698  N N   . ILE C 1 144 ? 27.315  3.895   86.651  1.00 46.87  ? 144 ILE C N   1 
ATOM   6699  C CA  . ILE C 1 144 ? 26.552  3.539   87.843  1.00 45.93  ? 144 ILE C CA  1 
ATOM   6700  C C   . ILE C 1 144 ? 27.144  2.320   88.556  1.00 43.43  ? 144 ILE C C   1 
ATOM   6701  O O   . ILE C 1 144 ? 26.977  2.168   89.770  1.00 48.60  ? 144 ILE C O   1 
ATOM   6702  C CB  . ILE C 1 144 ? 25.059  3.278   87.509  1.00 47.75  ? 144 ILE C CB  1 
ATOM   6703  C CG1 . ILE C 1 144 ? 24.202  3.347   88.777  1.00 48.28  ? 144 ILE C CG1 1 
ATOM   6704  C CG2 . ILE C 1 144 ? 24.876  1.951   86.784  1.00 38.70  ? 144 ILE C CG2 1 
ATOM   6705  N N   . ASN C 1 145 ? 27.849  1.462   87.820  1.00 33.07  ? 145 ASN C N   1 
ATOM   6706  C CA  . ASN C 1 145 ? 28.550  0.362   88.478  1.00 44.03  ? 145 ASN C CA  1 
ATOM   6707  C C   . ASN C 1 145 ? 29.713  0.894   89.306  1.00 44.14  ? 145 ASN C C   1 
ATOM   6708  O O   . ASN C 1 145 ? 29.938  0.455   90.443  1.00 45.19  ? 145 ASN C O   1 
ATOM   6709  C CB  . ASN C 1 145 ? 29.046  -0.679  87.469  1.00 25.97  ? 145 ASN C CB  1 
ATOM   6710  C CG  . ASN C 1 145 ? 27.913  -1.456  86.822  1.00 63.71  ? 145 ASN C CG  1 
ATOM   6711  O OD1 . ASN C 1 145 ? 27.804  -1.521  85.597  1.00 81.08  ? 145 ASN C OD1 1 
ATOM   6712  N ND2 . ASN C 1 145 ? 27.063  -2.055  87.648  1.00 67.55  ? 145 ASN C ND2 1 
ATOM   6713  N N   . ARG C 1 146 ? 30.436  1.861   88.749  1.00 41.92  ? 146 ARG C N   1 
ATOM   6714  C CA  . ARG C 1 146 ? 31.544  2.460   89.480  1.00 53.51  ? 146 ARG C CA  1 
ATOM   6715  C C   . ARG C 1 146 ? 31.019  3.278   90.656  1.00 41.36  ? 146 ARG C C   1 
ATOM   6716  O O   . ARG C 1 146 ? 31.706  3.441   91.666  1.00 50.06  ? 146 ARG C O   1 
ATOM   6717  C CB  . ARG C 1 146 ? 32.400  3.334   88.562  1.00 35.78  ? 146 ARG C CB  1 
ATOM   6718  C CG  . ARG C 1 146 ? 33.760  2.729   88.249  1.00 66.12  ? 146 ARG C CG  1 
ATOM   6719  C CD  . ARG C 1 146 ? 34.585  2.538   89.515  1.00 96.87  ? 146 ARG C CD  1 
ATOM   6720  N NE  . ARG C 1 146 ? 35.078  3.800   90.060  1.00 102.48 ? 146 ARG C NE  1 
ATOM   6721  C CZ  . ARG C 1 146 ? 35.479  3.964   91.316  1.00 98.16  ? 146 ARG C CZ  1 
ATOM   6722  N NH1 . ARG C 1 146 ? 35.436  2.947   92.166  1.00 84.74  ? 146 ARG C NH1 1 
ATOM   6723  N NH2 . ARG C 1 146 ? 35.917  5.145   91.727  1.00 106.70 ? 146 ARG C NH2 1 
ATOM   6724  N N   . TYR C 1 147 ? 29.797  3.785   90.526  1.00 45.32  ? 147 TYR C N   1 
ATOM   6725  C CA  . TYR C 1 147 ? 29.159  4.510   91.619  1.00 48.77  ? 147 TYR C CA  1 
ATOM   6726  C C   . TYR C 1 147 ? 28.806  3.559   92.750  1.00 49.22  ? 147 TYR C C   1 
ATOM   6727  O O   . TYR C 1 147 ? 29.012  3.868   93.923  1.00 50.89  ? 147 TYR C O   1 
ATOM   6728  C CB  . TYR C 1 147 ? 27.907  5.240   91.135  1.00 40.21  ? 147 TYR C CB  1 
ATOM   6729  C CG  . TYR C 1 147 ? 27.223  6.048   92.216  1.00 41.16  ? 147 TYR C CG  1 
ATOM   6730  C CD1 . TYR C 1 147 ? 27.685  7.312   92.560  1.00 42.63  ? 147 TYR C CD1 1 
ATOM   6731  C CD2 . TYR C 1 147 ? 26.116  5.549   92.890  1.00 43.14  ? 147 TYR C CD2 1 
ATOM   6732  C CE1 . TYR C 1 147 ? 27.067  8.055   93.547  1.00 56.64  ? 147 TYR C CE1 1 
ATOM   6733  C CE2 . TYR C 1 147 ? 25.491  6.285   93.878  1.00 31.93  ? 147 TYR C CE2 1 
ATOM   6734  C CZ  . TYR C 1 147 ? 25.970  7.537   94.202  1.00 46.99  ? 147 TYR C CZ  1 
ATOM   6735  O OH  . TYR C 1 147 ? 25.351  8.275   95.185  1.00 51.71  ? 147 TYR C OH  1 
ATOM   6736  N N   . SER C 1 148 ? 28.261  2.403   92.385  1.00 41.50  ? 148 SER C N   1 
ATOM   6737  C CA  . SER C 1 148 ? 27.939  1.373   93.361  1.00 38.12  ? 148 SER C CA  1 
ATOM   6738  C C   . SER C 1 148 ? 29.190  0.884   94.083  1.00 38.01  ? 148 SER C C   1 
ATOM   6739  O O   . SER C 1 148 ? 29.149  0.594   95.278  1.00 39.46  ? 148 SER C O   1 
ATOM   6740  C CB  . SER C 1 148 ? 27.229  0.199   92.687  1.00 42.94  ? 148 SER C CB  1 
ATOM   6741  O OG  . SER C 1 148 ? 25.985  0.606   92.146  1.00 61.51  ? 148 SER C OG  1 
ATOM   6742  N N   . ARG C 1 149 ? 30.301  0.793   93.357  1.00 54.05  ? 149 ARG C N   1 
ATOM   6743  C CA  . ARG C 1 149 ? 31.539  0.286   93.950  1.00 42.31  ? 149 ARG C CA  1 
ATOM   6744  C C   . ARG C 1 149 ? 32.222  1.266   94.911  1.00 39.82  ? 149 ARG C C   1 
ATOM   6745  O O   . ARG C 1 149 ? 33.212  0.909   95.549  1.00 50.39  ? 149 ARG C O   1 
ATOM   6746  C CB  . ARG C 1 149 ? 32.525  -0.126  92.857  1.00 29.50  ? 149 ARG C CB  1 
ATOM   6747  C CG  . ARG C 1 149 ? 32.391  -1.583  92.439  1.00 30.20  ? 149 ARG C CG  1 
ATOM   6748  C CD  . ARG C 1 149 ? 33.543  -2.024  91.549  1.00 49.81  ? 149 ARG C CD  1 
ATOM   6749  N NE  . ARG C 1 149 ? 33.581  -1.291  90.288  1.00 64.01  ? 149 ARG C NE  1 
ATOM   6750  N N   . LEU C 1 150 ? 31.714  2.494   95.000  1.00 41.74  ? 150 LEU C N   1 
ATOM   6751  C CA  . LEU C 1 150 ? 32.248  3.479   95.944  1.00 44.60  ? 150 LEU C CA  1 
ATOM   6752  C C   . LEU C 1 150 ? 32.273  2.943   97.377  1.00 40.89  ? 150 LEU C C   1 
ATOM   6753  O O   . LEU C 1 150 ? 31.369  2.220   97.793  1.00 54.64  ? 150 LEU C O   1 
ATOM   6754  C CB  . LEU C 1 150 ? 31.436  4.777   95.889  1.00 44.69  ? 150 LEU C CB  1 
ATOM   6755  C CG  . LEU C 1 150 ? 31.755  5.760   94.758  1.00 41.78  ? 150 LEU C CG  1 
ATOM   6756  C CD1 . LEU C 1 150 ? 30.972  7.054   94.933  1.00 49.33  ? 150 LEU C CD1 1 
ATOM   6757  C CD2 . LEU C 1 150 ? 33.249  6.044   94.694  1.00 47.77  ? 150 LEU C CD2 1 
ATOM   6758  N N   . SER C 1 151 ? 33.312  3.305   98.125  1.00 57.28  ? 151 SER C N   1 
ATOM   6759  C CA  . SER C 1 151 ? 33.476  2.855   99.507  1.00 66.23  ? 151 SER C CA  1 
ATOM   6760  C C   . SER C 1 151 ? 32.655  3.708   100.469 1.00 58.85  ? 151 SER C C   1 
ATOM   6761  O O   . SER C 1 151 ? 32.672  4.928   100.377 1.00 76.18  ? 151 SER C O   1 
ATOM   6762  C CB  . SER C 1 151 ? 34.953  2.895   99.902  1.00 66.99  ? 151 SER C CB  1 
ATOM   6763  O OG  . SER C 1 151 ? 35.121  2.695   101.294 1.00 67.80  ? 151 SER C OG  1 
ATOM   6764  N N   . LYS C 1 152 ? 31.925  3.069   101.379 1.00 48.42  ? 152 LYS C N   1 
ATOM   6765  C CA  . LYS C 1 152 ? 31.068  3.807   102.307 1.00 61.34  ? 152 LYS C CA  1 
ATOM   6766  C C   . LYS C 1 152 ? 31.773  4.503   103.469 1.00 76.62  ? 152 LYS C C   1 
ATOM   6767  O O   . LYS C 1 152 ? 31.613  5.708   103.670 1.00 89.55  ? 152 LYS C O   1 
ATOM   6768  C CB  . LYS C 1 152 ? 30.020  2.866   102.903 1.00 56.70  ? 152 LYS C CB  1 
ATOM   6769  C CG  . LYS C 1 152 ? 29.097  3.552   103.899 1.00 50.44  ? 152 LYS C CG  1 
ATOM   6770  C CD  . LYS C 1 152 ? 28.520  2.566   104.901 1.00 49.20  ? 152 LYS C CD  1 
ATOM   6771  C CE  . LYS C 1 152 ? 27.154  3.018   105.389 1.00 59.26  ? 152 LYS C CE  1 
ATOM   6772  N NZ  . LYS C 1 152 ? 26.638  2.163   106.494 1.00 77.93  ? 152 LYS C NZ  1 
ATOM   6773  N N   . LYS C 1 153 ? 32.557  3.738   104.225 1.00 74.71  ? 153 LYS C N   1 
ATOM   6774  C CA  . LYS C 1 153 ? 33.075  4.207   105.509 1.00 83.96  ? 153 LYS C CA  1 
ATOM   6775  C C   . LYS C 1 153 ? 34.352  5.039   105.406 1.00 85.76  ? 153 LYS C C   1 
ATOM   6776  O O   . LYS C 1 153 ? 34.522  6.002   106.157 1.00 81.32  ? 153 LYS C O   1 
ATOM   6777  C CB  . LYS C 1 153 ? 33.266  3.009   106.448 1.00 82.13  ? 153 LYS C CB  1 
ATOM   6778  C CG  . LYS C 1 153 ? 34.434  2.094   106.129 1.00 81.75  ? 153 LYS C CG  1 
ATOM   6779  C CD  . LYS C 1 153 ? 34.544  0.986   107.169 1.00 103.19 ? 153 LYS C CD  1 
ATOM   6780  C CE  . LYS C 1 153 ? 34.889  1.529   108.549 1.00 98.67  ? 153 LYS C CE  1 
ATOM   6781  N NZ  . LYS C 1 153 ? 34.976  0.441   109.566 1.00 71.07  ? 153 LYS C NZ  1 
ATOM   6782  N N   . ARG C 1 154 ? 35.250  4.680   104.493 1.00 83.30  ? 154 ARG C N   1 
ATOM   6783  C CA  . ARG C 1 154 ? 36.363  5.566   104.196 1.00 94.66  ? 154 ARG C CA  1 
ATOM   6784  C C   . ARG C 1 154 ? 36.092  6.179   102.830 1.00 81.26  ? 154 ARG C C   1 
ATOM   6785  O O   . ARG C 1 154 ? 36.348  5.562   101.796 1.00 83.23  ? 154 ARG C O   1 
ATOM   6786  C CB  . ARG C 1 154 ? 37.705  4.818   104.224 1.00 91.12  ? 154 ARG C CB  1 
ATOM   6787  C CG  . ARG C 1 154 ? 37.987  4.123   105.551 1.00 112.70 ? 154 ARG C CG  1 
ATOM   6788  C CD  . ARG C 1 154 ? 39.286  3.326   105.533 1.00 95.03  ? 154 ARG C CD  1 
ATOM   6789  N NE  . ARG C 1 154 ? 39.365  2.414   106.673 1.00 114.67 ? 154 ARG C NE  1 
ATOM   6790  C CZ  . ARG C 1 154 ? 40.490  2.066   107.290 1.00 115.27 ? 154 ARG C CZ  1 
ATOM   6791  N NH1 . ARG C 1 154 ? 40.447  1.226   108.315 1.00 110.86 ? 154 ARG C NH1 1 
ATOM   6792  N NH2 . ARG C 1 154 ? 41.655  2.556   106.887 1.00 91.64  ? 154 ARG C NH2 1 
ATOM   6793  N N   . GLU C 1 155 ? 35.600  7.415   102.843 1.00 96.39  ? 155 GLU C N   1 
ATOM   6794  C CA  . GLU C 1 155 ? 35.299  8.142   101.616 1.00 96.66  ? 155 GLU C CA  1 
ATOM   6795  C C   . GLU C 1 155 ? 36.239  9.310   101.330 1.00 96.42  ? 155 GLU C C   1 
ATOM   6796  O O   . GLU C 1 155 ? 36.492  10.130  102.201 1.00 103.50 ? 155 GLU C O   1 
ATOM   6797  C CB  . GLU C 1 155 ? 33.860  8.686   101.624 1.00 87.21  ? 155 GLU C CB  1 
ATOM   6798  C CG  . GLU C 1 155 ? 32.886  7.861   100.828 1.00 94.32  ? 155 GLU C CG  1 
ATOM   6799  C CD  . GLU C 1 155 ? 31.466  8.320   101.005 1.00 97.87  ? 155 GLU C CD  1 
ATOM   6800  O OE1 . GLU C 1 155 ? 31.023  8.419   102.165 1.00 130.46 ? 155 GLU C OE1 1 
ATOM   6801  O OE2 . GLU C 1 155 ? 30.789  8.570   99.985  1.00 111.32 ? 155 GLU C OE2 1 
ATOM   6802  N N   . ASN C 1 156 ? 36.751  9.345   100.101 1.00 91.83  ? 156 ASN C N   1 
ATOM   6803  C CA  . ASN C 1 156 ? 37.505  10.456  99.536  1.00 97.97  ? 156 ASN C CA  1 
ATOM   6804  C C   . ASN C 1 156 ? 36.517  11.271  98.699  1.00 91.45  ? 156 ASN C C   1 
ATOM   6805  O O   . ASN C 1 156 ? 35.828  10.747  97.813  1.00 96.01  ? 156 ASN C O   1 
ATOM   6806  C CB  . ASN C 1 156 ? 38.721  9.968   98.717  1.00 74.27  ? 156 ASN C CB  1 
ATOM   6807  C CG  . ASN C 1 156 ? 38.349  9.501   97.315  1.00 102.19 ? 156 ASN C CG  1 
ATOM   6808  O OD1 . ASN C 1 156 ? 37.578  8.541   97.162  1.00 131.96 ? 156 ASN C OD1 1 
ATOM   6809  N ND2 . ASN C 1 156 ? 38.951  10.117  96.288  1.00 103.90 ? 156 ASN C ND2 1 
ATOM   6810  N N   . ASP C 1 157 ? 36.360  12.532  99.071  1.00 91.55  ? 157 ASP C N   1 
ATOM   6811  C CA  . ASP C 1 157 ? 35.379  13.387  98.425  1.00 88.34  ? 157 ASP C CA  1 
ATOM   6812  C C   . ASP C 1 157 ? 35.709  13.572  96.932  1.00 92.78  ? 157 ASP C C   1 
ATOM   6813  O O   . ASP C 1 157 ? 34.804  13.807  96.125  1.00 93.75  ? 157 ASP C O   1 
ATOM   6814  C CB  . ASP C 1 157 ? 35.289  14.725  99.168  1.00 99.15  ? 157 ASP C CB  1 
ATOM   6815  C CG  . ASP C 1 157 ? 34.659  14.565  100.540 1.00 99.82  ? 157 ASP C CG  1 
ATOM   6816  O OD1 . ASP C 1 157 ? 34.596  13.403  100.989 1.00 106.10 ? 157 ASP C OD1 1 
ATOM   6817  O OD2 . ASP C 1 157 ? 34.245  15.562  101.177 1.00 99.79  ? 157 ASP C OD2 1 
ATOM   6818  N N   . LYS C 1 158 ? 36.992  13.475  96.570  1.00 81.30  ? 158 LYS C N   1 
ATOM   6819  C CA  . LYS C 1 158 ? 37.411  13.609  95.169  1.00 75.13  ? 158 LYS C CA  1 
ATOM   6820  C C   . LYS C 1 158 ? 36.825  12.564  94.200  1.00 75.55  ? 158 LYS C C   1 
ATOM   6821  O O   . LYS C 1 158 ? 36.045  12.919  93.321  1.00 81.09  ? 158 LYS C O   1 
ATOM   6822  C CB  . LYS C 1 158 ? 38.941  13.573  95.073  1.00 69.50  ? 158 LYS C CB  1 
ATOM   6823  N N   . VAL C 1 159 ? 37.183  11.290  94.326  1.00 68.78  ? 159 VAL C N   1 
ATOM   6824  C CA  . VAL C 1 159 ? 36.656  10.325  93.362  1.00 95.89  ? 159 VAL C CA  1 
ATOM   6825  C C   . VAL C 1 159 ? 35.136  10.238  93.551  1.00 80.56  ? 159 VAL C C   1 
ATOM   6826  O O   . VAL C 1 159 ? 34.423  9.911   92.624  1.00 69.74  ? 159 VAL C O   1 
ATOM   6827  C CB  . VAL C 1 159 ? 37.285  8.906   93.437  1.00 101.75 ? 159 VAL C CB  1 
ATOM   6828  C CG1 . VAL C 1 159 ? 36.480  8.012   94.306  1.00 69.18  ? 159 VAL C CG1 1 
ATOM   6829  C CG2 . VAL C 1 159 ? 37.300  8.306   92.074  1.00 106.93 ? 159 VAL C CG2 1 
ATOM   6830  N N   . LYS C 1 160 ? 34.648  10.462  94.769  1.00 72.68  ? 160 LYS C N   1 
ATOM   6831  C CA  . LYS C 1 160 ? 33.211  10.386  94.989  1.00 63.66  ? 160 LYS C CA  1 
ATOM   6832  C C   . LYS C 1 160 ? 32.517  11.412  94.103  1.00 61.77  ? 160 LYS C C   1 
ATOM   6833  O O   . LYS C 1 160 ? 31.548  11.092  93.408  1.00 67.99  ? 160 LYS C O   1 
ATOM   6834  C CB  . LYS C 1 160 ? 32.844  10.622  96.455  1.00 64.79  ? 160 LYS C CB  1 
ATOM   6835  C CG  . LYS C 1 160 ? 31.358  10.884  96.646  1.00 64.73  ? 160 LYS C CG  1 
ATOM   6836  C CD  . LYS C 1 160 ? 30.995  11.233  98.077  1.00 67.77  ? 160 LYS C CD  1 
ATOM   6837  C CE  . LYS C 1 160 ? 29.480  11.373  98.235  1.00 75.53  ? 160 LYS C CE  1 
ATOM   6838  N NZ  . LYS C 1 160 ? 29.081  11.708  99.635  1.00 95.14  ? 160 LYS C NZ  1 
ATOM   6839  N N   . TYR C 1 161 ? 33.038  12.635  94.094  1.00 64.01  ? 161 TYR C N   1 
ATOM   6840  C CA  . TYR C 1 161 ? 32.471  13.675  93.245  1.00 71.48  ? 161 TYR C CA  1 
ATOM   6841  C C   . TYR C 1 161 ? 32.654  13.350  91.762  1.00 69.63  ? 161 TYR C C   1 
ATOM   6842  O O   . TYR C 1 161 ? 31.727  13.512  90.962  1.00 78.36  ? 161 TYR C O   1 
ATOM   6843  C CB  . TYR C 1 161 ? 33.094  15.035  93.565  1.00 76.66  ? 161 TYR C CB  1 
ATOM   6844  C CG  . TYR C 1 161 ? 32.685  16.126  92.599  1.00 89.81  ? 161 TYR C CG  1 
ATOM   6845  C CD1 . TYR C 1 161 ? 31.448  16.750  92.706  1.00 84.34  ? 161 TYR C CD1 1 
ATOM   6846  C CD2 . TYR C 1 161 ? 33.540  16.536  91.586  1.00 91.75  ? 161 TYR C CD2 1 
ATOM   6847  C CE1 . TYR C 1 161 ? 31.073  17.745  91.822  1.00 88.32  ? 161 TYR C CE1 1 
ATOM   6848  C CE2 . TYR C 1 161 ? 33.176  17.528  90.701  1.00 79.15  ? 161 TYR C CE2 1 
ATOM   6849  C CZ  . TYR C 1 161 ? 31.944  18.130  90.822  1.00 85.32  ? 161 TYR C CZ  1 
ATOM   6850  O OH  . TYR C 1 161 ? 31.582  19.120  89.938  1.00 105.53 ? 161 TYR C OH  1 
ATOM   6851  N N   . GLU C 1 162 ? 33.851  12.889  91.408  1.00 61.85  ? 162 GLU C N   1 
ATOM   6852  C CA  . GLU C 1 162 ? 34.171  12.536  90.026  1.00 68.79  ? 162 GLU C CA  1 
ATOM   6853  C C   . GLU C 1 162 ? 33.248  11.451  89.472  1.00 66.42  ? 162 GLU C C   1 
ATOM   6854  O O   . GLU C 1 162 ? 32.691  11.590  88.385  1.00 70.88  ? 162 GLU C O   1 
ATOM   6855  C CB  . GLU C 1 162 ? 35.631  12.083  89.923  1.00 81.25  ? 162 GLU C CB  1 
ATOM   6856  C CG  . GLU C 1 162 ? 36.653  13.201  90.115  1.00 91.49  ? 162 GLU C CG  1 
ATOM   6857  C CD  . GLU C 1 162 ? 38.084  12.705  89.991  1.00 104.65 ? 162 GLU C CD  1 
ATOM   6858  O OE1 . GLU C 1 162 ? 38.324  11.779  89.186  1.00 111.32 ? 162 GLU C OE1 1 
ATOM   6859  O OE2 . GLU C 1 162 ? 38.971  13.250  90.684  1.00 98.31  ? 162 GLU C OE2 1 
ATOM   6860  N N   . VAL C 1 163 ? 33.101  10.375  90.234  1.00 63.62  ? 163 VAL C N   1 
ATOM   6861  C CA  . VAL C 1 163 ? 32.246  9.246   89.898  1.00 62.30  ? 163 VAL C CA  1 
ATOM   6862  C C   . VAL C 1 163 ? 30.781  9.662   89.840  1.00 54.94  ? 163 VAL C C   1 
ATOM   6863  O O   . VAL C 1 163 ? 30.060  9.293   88.913  1.00 51.17  ? 163 VAL C O   1 
ATOM   6864  C CB  . VAL C 1 163 ? 32.412  8.097   90.920  1.00 49.03  ? 163 VAL C CB  1 
ATOM   6865  C CG1 . VAL C 1 163 ? 31.378  7.027   90.686  1.00 53.86  ? 163 VAL C CG1 1 
ATOM   6866  C CG2 . VAL C 1 163 ? 33.812  7.508   90.838  1.00 53.71  ? 163 VAL C CG2 1 
ATOM   6867  N N   . THR C 1 164 ? 30.349  10.438  90.830  1.00 58.73  ? 164 THR C N   1 
ATOM   6868  C CA  . THR C 1 164 ? 28.977  10.934  90.867  1.00 51.82  ? 164 THR C CA  1 
ATOM   6869  C C   . THR C 1 164 ? 28.649  11.746  89.614  1.00 54.10  ? 164 THR C C   1 
ATOM   6870  O O   . THR C 1 164 ? 27.575  11.586  89.023  1.00 59.94  ? 164 THR C O   1 
ATOM   6871  C CB  . THR C 1 164 ? 28.710  11.791  92.119  1.00 51.65  ? 164 THR C CB  1 
ATOM   6872  O OG1 . THR C 1 164 ? 29.039  11.040  93.294  1.00 57.14  ? 164 THR C OG1 1 
ATOM   6873  C CG2 . THR C 1 164 ? 27.246  12.194  92.184  1.00 51.65  ? 164 THR C CG2 1 
ATOM   6874  N N   . GLU C 1 165 ? 29.580  12.597  89.189  1.00 58.52  ? 165 GLU C N   1 
ATOM   6875  C CA  . GLU C 1 165 ? 29.306  13.486  88.066  1.00 64.19  ? 165 GLU C CA  1 
ATOM   6876  C C   . GLU C 1 165 ? 29.527  12.750  86.744  1.00 58.75  ? 165 GLU C C   1 
ATOM   6877  O O   . GLU C 1 165 ? 28.981  13.128  85.700  1.00 69.83  ? 165 GLU C O   1 
ATOM   6878  C CB  . GLU C 1 165 ? 30.210  14.725  88.150  1.00 62.22  ? 165 GLU C CB  1 
ATOM   6879  C CG  . GLU C 1 165 ? 30.395  15.482  86.844  1.00 73.82  ? 165 GLU C CG  1 
ATOM   6880  C CD  . GLU C 1 165 ? 31.817  15.956  86.635  1.00 107.03 ? 165 GLU C CD  1 
ATOM   6881  O OE1 . GLU C 1 165 ? 32.462  16.373  87.621  1.00 112.11 ? 165 GLU C OE1 1 
ATOM   6882  O OE2 . GLU C 1 165 ? 32.293  15.905  85.481  1.00 97.76  ? 165 GLU C OE2 1 
ATOM   6883  N N   . ASP C 1 166 ? 30.254  11.640  86.813  1.00 52.37  ? 166 ASP C N   1 
ATOM   6884  C CA  . ASP C 1 166 ? 30.304  10.696  85.706  1.00 55.12  ? 166 ASP C CA  1 
ATOM   6885  C C   . ASP C 1 166 ? 28.939  10.057  85.497  1.00 55.64  ? 166 ASP C C   1 
ATOM   6886  O O   . ASP C 1 166 ? 28.446  9.962   84.367  1.00 57.00  ? 166 ASP C O   1 
ATOM   6887  C CB  . ASP C 1 166 ? 31.363  9.624   85.962  1.00 53.16  ? 166 ASP C CB  1 
ATOM   6888  C CG  . ASP C 1 166 ? 32.628  9.855   85.162  1.00 66.74  ? 166 ASP C CG  1 
ATOM   6889  O OD1 . ASP C 1 166 ? 32.895  11.019  84.798  1.00 66.98  ? 166 ASP C OD1 1 
ATOM   6890  O OD2 . ASP C 1 166 ? 33.357  8.876   84.902  1.00 90.38  ? 166 ASP C OD2 1 
ATOM   6891  N N   . VAL C 1 167 ? 28.327  9.637   86.600  1.00 57.62  ? 167 VAL C N   1 
ATOM   6892  C CA  . VAL C 1 167 ? 26.991  9.064   86.557  1.00 57.26  ? 167 VAL C CA  1 
ATOM   6893  C C   . VAL C 1 167 ? 26.009  10.089  86.010  1.00 58.33  ? 167 VAL C C   1 
ATOM   6894  O O   . VAL C 1 167 ? 25.191  9.768   85.153  1.00 54.50  ? 167 VAL C O   1 
ATOM   6895  C CB  . VAL C 1 167 ? 26.523  8.586   87.941  1.00 41.84  ? 167 VAL C CB  1 
ATOM   6896  C CG1 . VAL C 1 167 ? 25.042  8.237   87.908  1.00 46.95  ? 167 VAL C CG1 1 
ATOM   6897  C CG2 . VAL C 1 167 ? 27.334  7.386   88.376  1.00 44.98  ? 167 VAL C CG2 1 
ATOM   6898  N N   . TYR C 1 168 ? 26.101  11.322  86.503  1.00 58.70  ? 168 TYR C N   1 
ATOM   6899  C CA  . TYR C 1 168 ? 25.247  12.400  86.007  1.00 55.49  ? 168 TYR C CA  1 
ATOM   6900  C C   . TYR C 1 168 ? 25.373  12.587  84.494  1.00 63.62  ? 168 TYR C C   1 
ATOM   6901  O O   . TYR C 1 168 ? 24.366  12.626  83.780  1.00 49.54  ? 168 TYR C O   1 
ATOM   6902  C CB  . TYR C 1 168 ? 25.565  13.716  86.721  1.00 54.96  ? 168 TYR C CB  1 
ATOM   6903  C CG  . TYR C 1 168 ? 25.277  14.941  85.880  1.00 61.65  ? 168 TYR C CG  1 
ATOM   6904  C CD1 . TYR C 1 168 ? 23.989  15.444  85.772  1.00 70.49  ? 168 TYR C CD1 1 
ATOM   6905  C CD2 . TYR C 1 168 ? 26.299  15.609  85.213  1.00 63.58  ? 168 TYR C CD2 1 
ATOM   6906  C CE1 . TYR C 1 168 ? 23.720  16.558  85.002  1.00 82.51  ? 168 TYR C CE1 1 
ATOM   6907  C CE2 . TYR C 1 168 ? 26.040  16.727  84.446  1.00 64.73  ? 168 TYR C CE2 1 
ATOM   6908  C CZ  . TYR C 1 168 ? 24.750  17.200  84.346  1.00 75.65  ? 168 TYR C CZ  1 
ATOM   6909  O OH  . TYR C 1 168 ? 24.487  18.316  83.585  1.00 82.81  ? 168 TYR C OH  1 
ATOM   6910  N N   . THR C 1 169 ? 26.610  12.696  84.014  1.00 59.19  ? 169 THR C N   1 
ATOM   6911  C CA  . THR C 1 169 ? 26.860  12.914  82.592  1.00 50.67  ? 169 THR C CA  1 
ATOM   6912  C C   . THR C 1 169 ? 26.285  11.778  81.752  1.00 53.61  ? 169 THR C C   1 
ATOM   6913  O O   . THR C 1 169 ? 25.525  12.007  80.802  1.00 55.00  ? 169 THR C O   1 
ATOM   6914  C CB  . THR C 1 169 ? 28.366  13.048  82.296  1.00 52.26  ? 169 THR C CB  1 
ATOM   6915  O OG1 . THR C 1 169 ? 28.853  14.280  82.841  1.00 48.37  ? 169 THR C OG1 1 
ATOM   6916  C CG2 . THR C 1 169 ? 28.621  13.027  80.795  1.00 58.67  ? 169 THR C CG2 1 
ATOM   6917  N N   . SER C 1 170 ? 26.644  10.553  82.122  1.00 51.98  ? 170 SER C N   1 
ATOM   6918  C CA  . SER C 1 170 ? 26.200  9.372   81.395  1.00 45.71  ? 170 SER C CA  1 
ATOM   6919  C C   . SER C 1 170 ? 24.678  9.227   81.389  1.00 54.69  ? 170 SER C C   1 
ATOM   6920  O O   . SER C 1 170 ? 24.089  8.845   80.378  1.00 57.99  ? 170 SER C O   1 
ATOM   6921  C CB  . SER C 1 170 ? 26.839  8.123   81.997  1.00 35.83  ? 170 SER C CB  1 
ATOM   6922  O OG  . SER C 1 170 ? 28.251  8.172   81.898  1.00 83.34  ? 170 SER C OG  1 
ATOM   6923  N N   . ARG C 1 171 ? 24.049  9.529   82.520  1.00 46.82  ? 171 ARG C N   1 
ATOM   6924  C CA  . ARG C 1 171 ? 22.598  9.441   82.648  1.00 45.13  ? 171 ARG C CA  1 
ATOM   6925  C C   . ARG C 1 171 ? 21.897  10.482  81.777  1.00 55.65  ? 171 ARG C C   1 
ATOM   6926  O O   . ARG C 1 171 ? 20.923  10.170  81.082  1.00 51.70  ? 171 ARG C O   1 
ATOM   6927  C CB  . ARG C 1 171 ? 22.186  9.595   84.115  1.00 48.39  ? 171 ARG C CB  1 
ATOM   6928  C CG  . ARG C 1 171 ? 20.723  9.299   84.395  1.00 48.63  ? 171 ARG C CG  1 
ATOM   6929  C CD  . ARG C 1 171 ? 20.483  9.142   85.886  1.00 47.05  ? 171 ARG C CD  1 
ATOM   6930  N NE  . ARG C 1 171 ? 21.085  7.912   86.393  1.00 39.56  ? 171 ARG C NE  1 
ATOM   6931  C CZ  . ARG C 1 171 ? 21.095  7.550   87.672  1.00 47.93  ? 171 ARG C CZ  1 
ATOM   6932  N NH1 . ARG C 1 171 ? 20.537  8.327   88.590  1.00 37.50  ? 171 ARG C NH1 1 
ATOM   6933  N NH2 . ARG C 1 171 ? 21.667  6.409   88.033  1.00 40.91  ? 171 ARG C NH2 1 
ATOM   6934  N N   . LYS C 1 172 ? 22.399  11.714  81.814  1.00 45.14  ? 172 LYS C N   1 
ATOM   6935  C CA  . LYS C 1 172 ? 21.860  12.778  80.972  1.00 53.60  ? 172 LYS C CA  1 
ATOM   6936  C C   . LYS C 1 172 ? 21.953  12.410  79.496  1.00 59.13  ? 172 LYS C C   1 
ATOM   6937  O O   . LYS C 1 172 ? 20.970  12.521  78.749  1.00 64.68  ? 172 LYS C O   1 
ATOM   6938  C CB  . LYS C 1 172 ? 22.596  14.097  81.218  1.00 57.03  ? 172 LYS C CB  1 
ATOM   6939  C CG  . LYS C 1 172 ? 21.812  15.327  80.783  1.00 69.54  ? 172 LYS C CG  1 
ATOM   6940  C CD  . LYS C 1 172 ? 22.661  16.586  80.856  1.00 67.28  ? 172 LYS C CD  1 
ATOM   6941  C CE  . LYS C 1 172 ? 21.835  17.825  80.548  1.00 64.23  ? 172 LYS C CE  1 
ATOM   6942  N NZ  . LYS C 1 172 ? 22.688  19.037  80.395  1.00 91.40  ? 172 LYS C NZ  1 
ATOM   6943  N N   . LYS C 1 173 ? 23.133  11.960  79.079  1.00 56.23  ? 173 LYS C N   1 
ATOM   6944  C CA  . LYS C 1 173 ? 23.328  11.571  77.688  1.00 52.27  ? 173 LYS C CA  1 
ATOM   6945  C C   . LYS C 1 173 ? 22.438  10.395  77.297  1.00 55.49  ? 173 LYS C C   1 
ATOM   6946  O O   . LYS C 1 173 ? 21.911  10.359  76.186  1.00 57.05  ? 173 LYS C O   1 
ATOM   6947  C CB  . LYS C 1 173 ? 24.790  11.222  77.414  1.00 41.24  ? 173 LYS C CB  1 
ATOM   6948  C CG  . LYS C 1 173 ? 25.171  11.391  75.953  1.00 66.02  ? 173 LYS C CG  1 
ATOM   6949  C CD  . LYS C 1 173 ? 26.468  10.683  75.612  1.00 95.24  ? 173 LYS C CD  1 
ATOM   6950  C CE  . LYS C 1 173 ? 26.775  10.807  74.127  1.00 60.89  ? 173 LYS C CE  1 
ATOM   6951  N NZ  . LYS C 1 173 ? 27.927  9.959   73.721  1.00 85.89  ? 173 LYS C NZ  1 
ATOM   6952  N N   . GLN C 1 174 ? 22.267  9.439   78.207  1.00 50.19  ? 174 GLN C N   1 
ATOM   6953  C CA  . GLN C 1 174 ? 21.395  8.300   77.938  1.00 48.84  ? 174 GLN C CA  1 
ATOM   6954  C C   . GLN C 1 174 ? 19.964  8.766   77.710  1.00 53.26  ? 174 GLN C C   1 
ATOM   6955  O O   . GLN C 1 174 ? 19.300  8.313   76.777  1.00 54.75  ? 174 GLN C O   1 
ATOM   6956  C CB  . GLN C 1 174 ? 21.437  7.281   79.078  1.00 37.73  ? 174 GLN C CB  1 
ATOM   6957  C CG  . GLN C 1 174 ? 20.726  5.976   78.736  1.00 41.27  ? 174 GLN C CG  1 
ATOM   6958  C CD  . GLN C 1 174 ? 20.744  4.974   79.872  1.00 58.39  ? 174 GLN C CD  1 
ATOM   6959  O OE1 . GLN C 1 174 ? 20.995  3.787   79.662  1.00 55.42  ? 174 GLN C OE1 1 
ATOM   6960  N NE2 . GLN C 1 174 ? 20.471  5.445   81.083  1.00 64.78  ? 174 GLN C NE2 1 
ATOM   6961  N N   . HIS C 1 175 ? 19.496  9.672   78.564  1.00 49.14  ? 175 HIS C N   1 
ATOM   6962  C CA  . HIS C 1 175 ? 18.151  10.224  78.426  1.00 56.78  ? 175 HIS C CA  1 
ATOM   6963  C C   . HIS C 1 175 ? 17.982  10.921  77.076  1.00 52.72  ? 175 HIS C C   1 
ATOM   6964  O O   . HIS C 1 175 ? 17.015  10.665  76.347  1.00 59.38  ? 175 HIS C O   1 
ATOM   6965  C CB  . HIS C 1 175 ? 17.850  11.199  79.567  1.00 58.62  ? 175 HIS C CB  1 
ATOM   6966  C CG  . HIS C 1 175 ? 16.399  11.544  79.700  1.00 47.75  ? 175 HIS C CG  1 
ATOM   6967  N ND1 . HIS C 1 175 ? 15.960  12.683  80.340  1.00 48.76  ? 175 HIS C ND1 1 
ATOM   6968  C CD2 . HIS C 1 175 ? 15.286  10.896  79.282  1.00 46.97  ? 175 HIS C CD2 1 
ATOM   6969  C CE1 . HIS C 1 175 ? 14.640  12.725  80.307  1.00 49.38  ? 175 HIS C CE1 1 
ATOM   6970  N NE2 . HIS C 1 175 ? 14.206  11.651  79.671  1.00 54.35  ? 175 HIS C NE2 1 
ATOM   6971  N N   . GLN C 1 176 ? 18.937  11.786  76.742  1.00 56.84  ? 176 GLN C N   1 
ATOM   6972  C CA  . GLN C 1 176 ? 18.867  12.566  75.507  1.00 60.02  ? 176 GLN C CA  1 
ATOM   6973  C C   . GLN C 1 176 ? 18.852  11.667  74.269  1.00 55.48  ? 176 GLN C C   1 
ATOM   6974  O O   . GLN C 1 176 ? 17.972  11.781  73.402  1.00 55.46  ? 176 GLN C O   1 
ATOM   6975  C CB  . GLN C 1 176 ? 20.051  13.533  75.426  1.00 57.92  ? 176 GLN C CB  1 
ATOM   6976  C CG  . GLN C 1 176 ? 19.939  14.750  76.330  1.00 64.60  ? 176 GLN C CG  1 
ATOM   6977  C CD  . GLN C 1 176 ? 21.184  15.615  76.292  1.00 70.13  ? 176 GLN C CD  1 
ATOM   6978  O OE1 . GLN C 1 176 ? 22.050  15.439  75.434  1.00 98.03  ? 176 GLN C OE1 1 
ATOM   6979  N NE2 . GLN C 1 176 ? 21.285  16.551  77.228  1.00 55.54  ? 176 GLN C NE2 1 
ATOM   6980  N N   . THR C 1 177 ? 19.823  10.761  74.207  1.00 41.51  ? 177 THR C N   1 
ATOM   6981  C CA  . THR C 1 177 ? 19.957  9.852   73.077  1.00 43.01  ? 177 THR C CA  1 
ATOM   6982  C C   . THR C 1 177 ? 18.753  8.927   72.938  1.00 37.44  ? 177 THR C C   1 
ATOM   6983  O O   . THR C 1 177 ? 18.275  8.687   71.828  1.00 59.76  ? 177 THR C O   1 
ATOM   6984  C CB  . THR C 1 177 ? 21.234  8.999   73.192  1.00 42.98  ? 177 THR C CB  1 
ATOM   6985  O OG1 . THR C 1 177 ? 21.230  8.293   74.438  1.00 50.36  ? 177 THR C OG1 1 
ATOM   6986  C CG2 . THR C 1 177 ? 22.469  9.881   73.121  1.00 30.54  ? 177 THR C CG2 1 
ATOM   6987  N N   . MET C 1 178 ? 18.266  8.406   74.061  1.00 46.06  ? 178 MET C N   1 
ATOM   6988  C CA  . MET C 1 178 ? 17.102  7.526   74.037  1.00 53.85  ? 178 MET C CA  1 
ATOM   6989  C C   . MET C 1 178 ? 15.866  8.265   73.541  1.00 53.35  ? 178 MET C C   1 
ATOM   6990  O O   . MET C 1 178 ? 15.068  7.713   72.776  1.00 50.13  ? 178 MET C O   1 
ATOM   6991  C CB  . MET C 1 178 ? 16.834  6.926   75.416  1.00 47.22  ? 178 MET C CB  1 
ATOM   6992  C CG  . MET C 1 178 ? 15.897  5.730   75.377  1.00 50.14  ? 178 MET C CG  1 
ATOM   6993  S SD  . MET C 1 178 ? 15.631  4.975   76.989  1.00 69.63  ? 178 MET C SD  1 
ATOM   6994  C CE  . MET C 1 178 ? 14.824  3.449   76.509  1.00 51.80  ? 178 MET C CE  1 
ATOM   6995  N N   . MET C 1 179 ? 15.708  9.516   73.968  1.00 50.52  ? 179 MET C N   1 
ATOM   6996  C CA  . MET C 1 179 ? 14.562  10.296  73.518  1.00 57.42  ? 179 MET C CA  1 
ATOM   6997  C C   . MET C 1 179 ? 14.648  10.584  72.016  1.00 62.82  ? 179 MET C C   1 
ATOM   6998  O O   . MET C 1 179 ? 13.643  10.460  71.308  1.00 55.87  ? 179 MET C O   1 
ATOM   6999  C CB  . MET C 1 179 ? 14.432  11.597  74.308  1.00 66.12  ? 179 MET C CB  1 
ATOM   7000  C CG  . MET C 1 179 ? 13.097  12.297  74.082  1.00 88.70  ? 179 MET C CG  1 
ATOM   7001  S SD  . MET C 1 179 ? 12.620  13.434  75.397  1.00 80.61  ? 179 MET C SD  1 
ATOM   7002  C CE  . MET C 1 179 ? 12.688  12.355  76.821  1.00 61.56  ? 179 MET C CE  1 
ATOM   7003  N N   . HIS C 1 180 ? 15.827  10.962  71.520  1.00 60.62  ? 180 HIS C N   1 
ATOM   7004  C CA  . HIS C 1 180 ? 15.962  11.176  70.072  1.00 59.69  ? 180 HIS C CA  1 
ATOM   7005  C C   . HIS C 1 180 ? 15.687  9.891   69.289  1.00 55.95  ? 180 HIS C C   1 
ATOM   7006  O O   . HIS C 1 180 ? 15.027  9.926   68.249  1.00 60.45  ? 180 HIS C O   1 
ATOM   7007  C CB  . HIS C 1 180 ? 17.346  11.725  69.705  1.00 56.95  ? 180 HIS C CB  1 
ATOM   7008  C CG  . HIS C 1 180 ? 17.630  13.084  70.263  1.00 73.87  ? 180 HIS C CG  1 
ATOM   7009  N ND1 . HIS C 1 180 ? 17.878  13.312  71.602  1.00 79.31  ? 180 HIS C ND1 1 
ATOM   7010  C CD2 . HIS C 1 180 ? 17.715  14.291  69.657  1.00 88.93  ? 180 HIS C CD2 1 
ATOM   7011  C CE1 . HIS C 1 180 ? 18.099  14.600  71.793  1.00 76.93  ? 180 HIS C CE1 1 
ATOM   7012  N NE2 . HIS C 1 180 ? 18.007  15.217  70.628  1.00 82.12  ? 180 HIS C NE2 1 
ATOM   7013  N N   . TYR C 1 181 ? 16.207  8.768   69.779  1.00 41.36  ? 181 TYR C N   1 
ATOM   7014  C CA  . TYR C 1 181 ? 15.946  7.467   69.165  1.00 37.81  ? 181 TYR C CA  1 
ATOM   7015  C C   . TYR C 1 181 ? 14.437  7.221   69.058  1.00 57.07  ? 181 TYR C C   1 
ATOM   7016  O O   . TYR C 1 181 ? 13.914  6.886   67.980  1.00 49.46  ? 181 TYR C O   1 
ATOM   7017  C CB  . TYR C 1 181 ? 16.614  6.354   69.977  1.00 37.55  ? 181 TYR C CB  1 
ATOM   7018  C CG  . TYR C 1 181 ? 16.682  5.014   69.278  1.00 41.93  ? 181 TYR C CG  1 
ATOM   7019  C CD1 . TYR C 1 181 ? 16.515  4.912   67.902  1.00 35.56  ? 181 TYR C CD1 1 
ATOM   7020  C CD2 . TYR C 1 181 ? 16.914  3.848   69.996  1.00 41.89  ? 181 TYR C CD2 1 
ATOM   7021  C CE1 . TYR C 1 181 ? 16.578  3.687   67.263  1.00 34.29  ? 181 TYR C CE1 1 
ATOM   7022  C CE2 . TYR C 1 181 ? 16.978  2.620   69.367  1.00 38.34  ? 181 TYR C CE2 1 
ATOM   7023  C CZ  . TYR C 1 181 ? 16.809  2.544   68.002  1.00 42.24  ? 181 TYR C CZ  1 
ATOM   7024  O OH  . TYR C 1 181 ? 16.873  1.322   67.374  1.00 48.67  ? 181 TYR C OH  1 
ATOM   7025  N N   . PHE C 1 182 ? 13.745  7.420   70.180  1.00 52.93  ? 182 PHE C N   1 
ATOM   7026  C CA  . PHE C 1 182 ? 12.298  7.228   70.248  1.00 58.00  ? 182 PHE C CA  1 
ATOM   7027  C C   . PHE C 1 182 ? 11.556  8.105   69.244  1.00 59.54  ? 182 PHE C C   1 
ATOM   7028  O O   . PHE C 1 182 ? 10.690  7.625   68.506  1.00 56.81  ? 182 PHE C O   1 
ATOM   7029  C CB  . PHE C 1 182 ? 11.779  7.525   71.658  1.00 60.19  ? 182 PHE C CB  1 
ATOM   7030  C CG  . PHE C 1 182 ? 11.869  6.361   72.604  1.00 64.51  ? 182 PHE C CG  1 
ATOM   7031  C CD1 . PHE C 1 182 ? 12.814  5.365   72.424  1.00 56.07  ? 182 PHE C CD1 1 
ATOM   7032  C CD2 . PHE C 1 182 ? 10.993  6.260   73.673  1.00 57.90  ? 182 PHE C CD2 1 
ATOM   7033  C CE1 . PHE C 1 182 ? 12.888  4.296   73.299  1.00 55.84  ? 182 PHE C CE1 1 
ATOM   7034  C CE2 . PHE C 1 182 ? 11.062  5.195   74.548  1.00 46.35  ? 182 PHE C CE2 1 
ATOM   7035  C CZ  . PHE C 1 182 ? 12.010  4.211   74.361  1.00 44.27  ? 182 PHE C CZ  1 
ATOM   7036  N N   . CYS C 1 183 ? 11.899  9.391   69.223  1.00 60.02  ? 183 CYS C N   1 
ATOM   7037  C CA  . CYS C 1 183 ? 11.257  10.339  68.318  1.00 65.21  ? 183 CYS C CA  1 
ATOM   7038  C C   . CYS C 1 183 ? 11.474  9.950   66.859  1.00 59.49  ? 183 CYS C C   1 
ATOM   7039  O O   . CYS C 1 183 ? 10.549  10.008  66.038  1.00 62.85  ? 183 CYS C O   1 
ATOM   7040  C CB  . CYS C 1 183 ? 11.786  11.753  68.568  1.00 48.19  ? 183 CYS C CB  1 
ATOM   7041  S SG  . CYS C 1 183 ? 11.243  12.481  70.131  1.00 84.99  ? 183 CYS C SG  1 
ATOM   7042  N N   . ALA C 1 184 ? 12.699  9.534   66.553  1.00 49.78  ? 184 ALA C N   1 
ATOM   7043  C CA  . ALA C 1 184 ? 13.052  9.097   65.210  1.00 42.81  ? 184 ALA C CA  1 
ATOM   7044  C C   . ALA C 1 184 ? 12.195  7.914   64.778  1.00 43.93  ? 184 ALA C C   1 
ATOM   7045  O O   . ALA C 1 184 ? 11.697  7.879   63.651  1.00 62.28  ? 184 ALA C O   1 
ATOM   7046  C CB  . ALA C 1 184 ? 14.523  8.738   65.143  1.00 46.23  ? 184 ALA C CB  1 
ATOM   7047  N N   . LEU C 1 185 ? 12.017  6.951   65.678  1.00 43.65  ? 185 LEU C N   1 
ATOM   7048  C CA  . LEU C 1 185 ? 11.185  5.788   65.371  1.00 49.27  ? 185 LEU C CA  1 
ATOM   7049  C C   . LEU C 1 185 ? 9.706   6.160   65.195  1.00 48.70  ? 185 LEU C C   1 
ATOM   7050  O O   . LEU C 1 185 ? 9.023   5.656   64.288  1.00 50.91  ? 185 LEU C O   1 
ATOM   7051  C CB  . LEU C 1 185 ? 11.341  4.731   66.464  1.00 46.59  ? 185 LEU C CB  1 
ATOM   7052  C CG  . LEU C 1 185 ? 12.695  4.019   66.437  1.00 38.06  ? 185 LEU C CG  1 
ATOM   7053  C CD1 . LEU C 1 185 ? 12.962  3.288   67.741  1.00 38.28  ? 185 LEU C CD1 1 
ATOM   7054  C CD2 . LEU C 1 185 ? 12.764  3.063   65.256  1.00 53.91  ? 185 LEU C CD2 1 
ATOM   7055  N N   . ASN C 1 186 ? 9.215   7.050   66.052  1.00 43.54  ? 186 ASN C N   1 
ATOM   7056  C CA  . ASN C 1 186 ? 7.824   7.483   65.974  1.00 50.18  ? 186 ASN C CA  1 
ATOM   7057  C C   . ASN C 1 186 ? 7.520   8.210   64.665  1.00 56.24  ? 186 ASN C C   1 
ATOM   7058  O O   . ASN C 1 186 ? 6.456   8.012   64.078  1.00 64.92  ? 186 ASN C O   1 
ATOM   7059  C CB  . ASN C 1 186 ? 7.467   8.364   67.172  1.00 68.82  ? 186 ASN C CB  1 
ATOM   7060  C CG  . ASN C 1 186 ? 7.449   7.587   68.478  1.00 56.96  ? 186 ASN C CG  1 
ATOM   7061  O OD1 . ASN C 1 186 ? 7.380   6.358   68.480  1.00 50.21  ? 186 ASN C OD1 1 
ATOM   7062  N ND2 . ASN C 1 186 ? 7.503   8.301   69.595  1.00 47.77  ? 186 ASN C ND2 1 
ATOM   7063  N N   . THR C 1 187 ? 8.444   9.052   64.209  1.00 56.67  ? 187 THR C N   1 
ATOM   7064  C CA  . THR C 1 187 ? 8.291   9.689   62.900  1.00 50.39  ? 187 THR C CA  1 
ATOM   7065  C C   . THR C 1 187 ? 8.401   8.639   61.788  1.00 43.04  ? 187 THR C C   1 
ATOM   7066  O O   . THR C 1 187 ? 7.675   8.685   60.780  1.00 58.24  ? 187 THR C O   1 
ATOM   7067  C CB  . THR C 1 187 ? 9.340   10.798  62.677  1.00 43.74  ? 187 THR C CB  1 
ATOM   7068  O OG1 . THR C 1 187 ? 9.133   11.851  63.627  1.00 56.54  ? 187 THR C OG1 1 
ATOM   7069  C CG2 . THR C 1 187 ? 9.227   11.371  61.272  1.00 61.88  ? 187 THR C CG2 1 
ATOM   7070  N N   . LEU C 1 188 ? 9.313   7.688   61.987  1.00 38.97  ? 188 LEU C N   1 
ATOM   7071  C CA  . LEU C 1 188 ? 9.500   6.580   61.054  1.00 46.97  ? 188 LEU C CA  1 
ATOM   7072  C C   . LEU C 1 188 ? 8.195   5.829   60.808  1.00 53.64  ? 188 LEU C C   1 
ATOM   7073  O O   . LEU C 1 188 ? 7.972   5.307   59.715  1.00 53.63  ? 188 LEU C O   1 
ATOM   7074  C CB  . LEU C 1 188 ? 10.571  5.613   61.565  1.00 47.72  ? 188 LEU C CB  1 
ATOM   7075  C CG  . LEU C 1 188 ? 10.894  4.432   60.644  1.00 51.49  ? 188 LEU C CG  1 
ATOM   7076  C CD1 . LEU C 1 188 ? 11.680  4.898   59.429  1.00 47.76  ? 188 LEU C CD1 1 
ATOM   7077  C CD2 . LEU C 1 188 ? 11.644  3.338   61.389  1.00 51.82  ? 188 LEU C CD2 1 
ATOM   7078  N N   . GLN C 1 189 ? 7.343   5.761   61.829  1.00 60.43  ? 189 GLN C N   1 
ATOM   7079  C CA  . GLN C 1 189 ? 6.036   5.114   61.681  1.00 56.07  ? 189 GLN C CA  1 
ATOM   7080  C C   . GLN C 1 189 ? 5.193   5.666   60.521  1.00 64.17  ? 189 GLN C C   1 
ATOM   7081  O O   . GLN C 1 189 ? 4.486   4.912   59.854  1.00 58.18  ? 189 GLN C O   1 
ATOM   7082  C CB  . GLN C 1 189 ? 5.244   5.231   62.986  1.00 49.21  ? 189 GLN C CB  1 
ATOM   7083  C CG  . GLN C 1 189 ? 5.893   4.525   64.164  1.00 61.74  ? 189 GLN C CG  1 
ATOM   7084  C CD  . GLN C 1 189 ? 6.442   3.164   63.786  1.00 66.35  ? 189 GLN C CD  1 
ATOM   7085  O OE1 . GLN C 1 189 ? 5.740   2.343   63.196  1.00 60.17  ? 189 GLN C OE1 1 
ATOM   7086  N NE2 . GLN C 1 189 ? 7.704   2.918   64.122  1.00 52.64  ? 189 GLN C NE2 1 
ATOM   7087  N N   . TYR C 1 190 ? 5.248   6.976   60.299  1.00 66.07  ? 190 TYR C N   1 
ATOM   7088  C CA  . TYR C 1 190 ? 4.595   7.596   59.144  1.00 51.12  ? 190 TYR C CA  1 
ATOM   7089  C C   . TYR C 1 190 ? 5.476   7.512   57.893  1.00 58.85  ? 190 TYR C C   1 
ATOM   7090  O O   . TYR C 1 190 ? 5.004   7.249   56.761  1.00 60.59  ? 190 TYR C O   1 
ATOM   7091  C CB  . TYR C 1 190 ? 4.257   9.055   59.445  1.00 43.82  ? 190 TYR C CB  1 
ATOM   7092  C CG  . TYR C 1 190 ? 3.363   9.254   60.646  1.00 56.72  ? 190 TYR C CG  1 
ATOM   7093  C CD1 . TYR C 1 190 ? 2.013   8.935   60.594  1.00 65.86  ? 190 TYR C CD1 1 
ATOM   7094  C CD2 . TYR C 1 190 ? 3.870   9.773   61.830  1.00 56.63  ? 190 TYR C CD2 1 
ATOM   7095  C CE1 . TYR C 1 190 ? 1.194   9.120   61.692  1.00 65.93  ? 190 TYR C CE1 1 
ATOM   7096  C CE2 . TYR C 1 190 ? 3.059   9.962   62.932  1.00 59.65  ? 190 TYR C CE2 1 
ATOM   7097  C CZ  . TYR C 1 190 ? 1.722   9.634   62.857  1.00 65.66  ? 190 TYR C CZ  1 
ATOM   7098  O OH  . TYR C 1 190 ? 0.910   9.821   63.952  1.00 79.11  ? 190 TYR C OH  1 
ATOM   7099  N N   . LYS C 1 191 ? 6.767   7.756   58.109  1.00 55.58  ? 191 LYS C N   1 
ATOM   7100  C CA  . LYS C 1 191 ? 7.719   7.804   57.007  1.00 50.83  ? 191 LYS C CA  1 
ATOM   7101  C C   . LYS C 1 191 ? 7.787   6.492   56.232  1.00 51.66  ? 191 LYS C C   1 
ATOM   7102  O O   . LYS C 1 191 ? 8.153   6.497   55.063  1.00 56.18  ? 191 LYS C O   1 
ATOM   7103  C CB  . LYS C 1 191 ? 9.112   8.188   57.509  1.00 56.81  ? 191 LYS C CB  1 
ATOM   7104  C CG  . LYS C 1 191 ? 9.330   9.691   57.575  1.00 66.15  ? 191 LYS C CG  1 
ATOM   7105  C CD  . LYS C 1 191 ? 10.754  10.047  57.957  1.00 61.69  ? 191 LYS C CD  1 
ATOM   7106  C CE  . LYS C 1 191 ? 10.976  11.549  57.867  1.00 59.96  ? 191 LYS C CE  1 
ATOM   7107  N NZ  . LYS C 1 191 ? 12.413  11.909  57.999  1.00 75.61  ? 191 LYS C NZ  1 
ATOM   7108  N N   . LYS C 1 192 ? 7.448   5.375   56.873  1.00 53.53  ? 192 LYS C N   1 
ATOM   7109  C CA  . LYS C 1 192 ? 7.477   4.090   56.179  1.00 61.47  ? 192 LYS C CA  1 
ATOM   7110  C C   . LYS C 1 192 ? 6.350   4.062   55.152  1.00 57.73  ? 192 LYS C C   1 
ATOM   7111  O O   . LYS C 1 192 ? 6.508   3.549   54.040  1.00 57.18  ? 192 LYS C O   1 
ATOM   7112  C CB  . LYS C 1 192 ? 7.318   2.905   57.144  1.00 52.78  ? 192 LYS C CB  1 
ATOM   7113  C CG  . LYS C 1 192 ? 6.023   2.912   57.954  1.00 57.94  ? 192 LYS C CG  1 
ATOM   7114  C CD  . LYS C 1 192 ? 5.798   1.599   58.686  1.00 65.33  ? 192 LYS C CD  1 
ATOM   7115  C CE  . LYS C 1 192 ? 6.251   1.660   60.127  1.00 83.55  ? 192 LYS C CE  1 
ATOM   7116  N NZ  . LYS C 1 192 ? 6.153   0.319   60.770  1.00 73.86  ? 192 LYS C NZ  1 
ATOM   7117  N N   . LYS C 1 193 ? 5.214   4.629   55.545  1.00 54.21  ? 193 LYS C N   1 
ATOM   7118  C CA  . LYS C 1 193 ? 4.028   4.679   54.711  1.00 63.08  ? 193 LYS C CA  1 
ATOM   7119  C C   . LYS C 1 193 ? 4.322   5.540   53.491  1.00 66.23  ? 193 LYS C C   1 
ATOM   7120  O O   . LYS C 1 193 ? 4.110   5.127   52.340  1.00 47.91  ? 193 LYS C O   1 
ATOM   7121  C CB  . LYS C 1 193 ? 2.850   5.244   55.504  1.00 52.56  ? 193 LYS C CB  1 
ATOM   7122  C CG  . LYS C 1 193 ? 2.393   4.357   56.653  1.00 57.11  ? 193 LYS C CG  1 
ATOM   7123  C CD  . LYS C 1 193 ? 0.891   4.155   56.651  1.00 70.66  ? 193 LYS C CD  1 
ATOM   7124  C CE  . LYS C 1 193 ? 0.425   3.517   57.948  1.00 82.72  ? 193 LYS C CE  1 
ATOM   7125  N NZ  . LYS C 1 193 ? 0.504   4.483   59.080  1.00 92.29  ? 193 LYS C NZ  1 
ATOM   7126  N N   . ILE C 1 194 ? 4.825   6.743   53.757  1.00 53.70  ? 194 ILE C N   1 
ATOM   7127  C CA  . ILE C 1 194 ? 5.173   7.659   52.671  1.00 57.28  ? 194 ILE C CA  1 
ATOM   7128  C C   . ILE C 1 194 ? 6.235   7.057   51.741  1.00 58.84  ? 194 ILE C C   1 
ATOM   7129  O O   . ILE C 1 194 ? 6.149   7.178   50.515  1.00 53.91  ? 194 ILE C O   1 
ATOM   7130  C CB  . ILE C 1 194 ? 5.668   9.001   53.232  1.00 54.06  ? 194 ILE C CB  1 
ATOM   7131  C CG1 . ILE C 1 194 ? 4.544   9.668   54.024  1.00 44.05  ? 194 ILE C CG1 1 
ATOM   7132  C CG2 . ILE C 1 194 ? 6.160   9.910   52.112  1.00 52.48  ? 194 ILE C CG2 1 
ATOM   7133  C CD1 . ILE C 1 194 ? 4.963   10.911  54.751  1.00 55.10  ? 194 ILE C CD1 1 
ATOM   7134  N N   . ALA C 1 195 ? 7.220   6.390   52.337  1.00 58.99  ? 195 ALA C N   1 
ATOM   7135  C CA  . ALA C 1 195 ? 8.290   5.730   51.591  1.00 59.93  ? 195 ALA C CA  1 
ATOM   7136  C C   . ALA C 1 195 ? 7.752   4.623   50.698  1.00 60.55  ? 195 ALA C C   1 
ATOM   7137  O O   . ALA C 1 195 ? 8.302   4.351   49.634  1.00 57.89  ? 195 ALA C O   1 
ATOM   7138  C CB  . ALA C 1 195 ? 9.333   5.169   52.539  1.00 57.28  ? 195 ALA C CB  1 
ATOM   7139  N N   . LEU C 1 196 ? 6.695   3.960   51.151  1.00 54.24  ? 196 LEU C N   1 
ATOM   7140  C CA  . LEU C 1 196 ? 6.064   2.925   50.346  1.00 43.46  ? 196 LEU C CA  1 
ATOM   7141  C C   . LEU C 1 196 ? 5.287   3.519   49.179  1.00 59.53  ? 196 LEU C C   1 
ATOM   7142  O O   . LEU C 1 196 ? 5.388   3.040   48.049  1.00 64.76  ? 196 LEU C O   1 
ATOM   7143  C CB  . LEU C 1 196 ? 5.134   2.074   51.208  1.00 57.43  ? 196 LEU C CB  1 
ATOM   7144  C CG  . LEU C 1 196 ? 5.784   0.855   51.857  1.00 65.88  ? 196 LEU C CG  1 
ATOM   7145  C CD1 . LEU C 1 196 ? 4.860   0.254   52.900  1.00 79.76  ? 196 LEU C CD1 1 
ATOM   7146  C CD2 . LEU C 1 196 ? 6.131   -0.162  50.790  1.00 48.75  ? 196 LEU C CD2 1 
ATOM   7147  N N   . LEU C 1 197 ? 4.511   4.562   49.455  1.00 57.97  ? 197 LEU C N   1 
ATOM   7148  C CA  . LEU C 1 197 ? 3.579   5.085   48.457  1.00 49.10  ? 197 LEU C CA  1 
ATOM   7149  C C   . LEU C 1 197 ? 4.197   6.005   47.396  1.00 48.36  ? 197 LEU C C   1 
ATOM   7150  O O   . LEU C 1 197 ? 3.878   5.887   46.213  1.00 54.99  ? 197 LEU C O   1 
ATOM   7151  C CB  . LEU C 1 197 ? 2.437   5.820   49.160  1.00 56.75  ? 197 LEU C CB  1 
ATOM   7152  C CG  . LEU C 1 197 ? 1.567   4.931   50.048  1.00 69.97  ? 197 LEU C CG  1 
ATOM   7153  C CD1 . LEU C 1 197 ? 0.524   5.755   50.787  1.00 72.80  ? 197 LEU C CD1 1 
ATOM   7154  C CD2 . LEU C 1 197 ? 0.906   3.840   49.218  1.00 57.14  ? 197 LEU C CD2 1 
ATOM   7155  N N   . GLU C 1 198 ? 5.072   6.914   47.815  1.00 47.96  ? 198 GLU C N   1 
ATOM   7156  C CA  . GLU C 1 198 ? 5.571   7.969   46.925  1.00 56.43  ? 198 GLU C CA  1 
ATOM   7157  C C   . GLU C 1 198 ? 6.344   7.499   45.669  1.00 61.51  ? 198 GLU C C   1 
ATOM   7158  O O   . GLU C 1 198 ? 6.070   7.988   44.565  1.00 53.05  ? 198 GLU C O   1 
ATOM   7159  C CB  . GLU C 1 198 ? 6.439   8.943   47.734  1.00 51.56  ? 198 GLU C CB  1 
ATOM   7160  C CG  . GLU C 1 198 ? 6.647   10.296  47.078  1.00 74.15  ? 198 GLU C CG  1 
ATOM   7161  C CD  . GLU C 1 198 ? 7.630   11.165  47.839  1.00 87.81  ? 198 GLU C CD  1 
ATOM   7162  O OE1 . GLU C 1 198 ? 8.455   10.612  48.596  1.00 89.30  ? 198 GLU C OE1 1 
ATOM   7163  O OE2 . GLU C 1 198 ? 7.574   12.404  47.684  1.00 104.50 ? 198 GLU C OE2 1 
ATOM   7164  N N   . PRO C 1 199 ? 7.300   6.557   45.815  1.00 54.58  ? 199 PRO C N   1 
ATOM   7165  C CA  . PRO C 1 199 ? 8.007   6.112   44.605  1.00 59.80  ? 199 PRO C CA  1 
ATOM   7166  C C   . PRO C 1 199 ? 7.110   5.401   43.593  1.00 55.93  ? 199 PRO C C   1 
ATOM   7167  O O   . PRO C 1 199 ? 7.290   5.588   42.388  1.00 61.68  ? 199 PRO C O   1 
ATOM   7168  C CB  . PRO C 1 199 ? 9.070   5.147   45.148  1.00 57.38  ? 199 PRO C CB  1 
ATOM   7169  C CG  . PRO C 1 199 ? 8.586   4.745   46.486  1.00 54.87  ? 199 PRO C CG  1 
ATOM   7170  C CD  . PRO C 1 199 ? 7.859   5.931   47.026  1.00 53.11  ? 199 PRO C CD  1 
ATOM   7171  N N   . LEU C 1 200 ? 6.162   4.602   44.074  1.00 51.88  ? 200 LEU C N   1 
ATOM   7172  C CA  . LEU C 1 200 ? 5.232   3.905   43.190  1.00 51.81  ? 200 LEU C CA  1 
ATOM   7173  C C   . LEU C 1 200 ? 4.350   4.909   42.460  1.00 51.19  ? 200 LEU C C   1 
ATOM   7174  O O   . LEU C 1 200 ? 4.015   4.729   41.288  1.00 50.35  ? 200 LEU C O   1 
ATOM   7175  C CB  . LEU C 1 200 ? 4.364   2.920   43.979  1.00 46.66  ? 200 LEU C CB  1 
ATOM   7176  C CG  . LEU C 1 200 ? 4.849   1.481   44.169  1.00 58.90  ? 200 LEU C CG  1 
ATOM   7177  C CD1 . LEU C 1 200 ? 6.299   1.427   44.627  1.00 71.98  ? 200 LEU C CD1 1 
ATOM   7178  C CD2 . LEU C 1 200 ? 3.950   0.758   45.160  1.00 63.36  ? 200 LEU C CD2 1 
ATOM   7179  N N   . LEU C 1 201 ? 3.987   5.971   43.169  1.00 53.90  ? 201 LEU C N   1 
ATOM   7180  C CA  . LEU C 1 201 ? 3.173   7.040   42.613  1.00 55.70  ? 201 LEU C CA  1 
ATOM   7181  C C   . LEU C 1 201 ? 3.928   7.758   41.494  1.00 43.14  ? 201 LEU C C   1 
ATOM   7182  O O   . LEU C 1 201 ? 3.375   8.033   40.412  1.00 63.95  ? 201 LEU C O   1 
ATOM   7183  C CB  . LEU C 1 201 ? 2.788   8.017   43.726  1.00 63.95  ? 201 LEU C CB  1 
ATOM   7184  C CG  . LEU C 1 201 ? 1.832   9.171   43.443  1.00 72.84  ? 201 LEU C CG  1 
ATOM   7185  C CD1 . LEU C 1 201 ? 0.430   8.635   43.247  1.00 78.52  ? 201 LEU C CD1 1 
ATOM   7186  C CD2 . LEU C 1 201 ? 1.872   10.164  44.593  1.00 55.31  ? 201 LEU C CD2 1 
ATOM   7187  N N   . GLY C 1 202 ? 5.212   8.007   41.746  1.00 52.78  ? 202 GLY C N   1 
ATOM   7188  C CA  . GLY C 1 202 ? 6.079   8.616   40.755  1.00 51.62  ? 202 GLY C CA  1 
ATOM   7189  C C   . GLY C 1 202 ? 6.209   7.736   39.529  1.00 47.58  ? 202 GLY C C   1 
ATOM   7190  O O   . GLY C 1 202 ? 6.150   8.220   38.396  1.00 53.32  ? 202 GLY C O   1 
ATOM   7191  N N   . TYR C 1 203 ? 6.373   6.437   39.762  1.00 40.36  ? 203 TYR C N   1 
ATOM   7192  C CA  . TYR C 1 203 ? 6.452   5.455   38.685  1.00 40.40  ? 203 TYR C CA  1 
ATOM   7193  C C   . TYR C 1 203 ? 5.206   5.476   37.810  1.00 46.26  ? 203 TYR C C   1 
ATOM   7194  O O   . TYR C 1 203 ? 5.294   5.565   36.581  1.00 49.44  ? 203 TYR C O   1 
ATOM   7195  C CB  . TYR C 1 203 ? 6.658   4.052   39.264  1.00 37.67  ? 203 TYR C CB  1 
ATOM   7196  C CG  . TYR C 1 203 ? 6.598   2.937   38.241  1.00 48.51  ? 203 TYR C CG  1 
ATOM   7197  C CD1 . TYR C 1 203 ? 7.589   2.790   37.280  1.00 44.19  ? 203 TYR C CD1 1 
ATOM   7198  C CD2 . TYR C 1 203 ? 5.551   2.023   38.247  1.00 48.05  ? 203 TYR C CD2 1 
ATOM   7199  C CE1 . TYR C 1 203 ? 7.536   1.768   36.349  1.00 44.80  ? 203 TYR C CE1 1 
ATOM   7200  C CE2 . TYR C 1 203 ? 5.490   0.998   37.321  1.00 50.34  ? 203 TYR C CE2 1 
ATOM   7201  C CZ  . TYR C 1 203 ? 6.485   0.875   36.374  1.00 48.10  ? 203 TYR C CZ  1 
ATOM   7202  O OH  . TYR C 1 203 ? 6.428   -0.143  35.449  1.00 58.48  ? 203 TYR C OH  1 
ATOM   7203  N N   . MET C 1 204 ? 4.045   5.402   38.450  1.00 58.43  ? 204 MET C N   1 
ATOM   7204  C CA  . MET C 1 204 ? 2.781   5.384   37.726  1.00 51.47  ? 204 MET C CA  1 
ATOM   7205  C C   . MET C 1 204 ? 2.527   6.650   36.901  1.00 51.23  ? 204 MET C C   1 
ATOM   7206  O O   . MET C 1 204 ? 2.149   6.557   35.725  1.00 49.84  ? 204 MET C O   1 
ATOM   7207  C CB  . MET C 1 204 ? 1.628   5.150   38.702  1.00 47.16  ? 204 MET C CB  1 
ATOM   7208  C CG  . MET C 1 204 ? 1.634   3.771   39.334  1.00 49.58  ? 204 MET C CG  1 
ATOM   7209  S SD  . MET C 1 204 ? 1.742   2.476   38.082  1.00 68.82  ? 204 MET C SD  1 
ATOM   7210  C CE  . MET C 1 204 ? 1.792   1.009   39.106  1.00 62.69  ? 204 MET C CE  1 
ATOM   7211  N N   . GLN C 1 205 ? 2.736   7.829   37.484  1.00 49.36  ? 205 GLN C N   1 
ATOM   7212  C CA  . GLN C 1 205 ? 2.482   9.040   36.699  1.00 64.89  ? 205 GLN C CA  1 
ATOM   7213  C C   . GLN C 1 205 ? 3.553   9.210   35.614  1.00 65.54  ? 205 GLN C C   1 
ATOM   7214  O O   . GLN C 1 205 ? 3.299   9.810   34.560  1.00 62.18  ? 205 GLN C O   1 
ATOM   7215  C CB  . GLN C 1 205 ? 2.391   10.286  37.583  1.00 57.02  ? 205 GLN C CB  1 
ATOM   7216  C CG  . GLN C 1 205 ? 1.774   11.471  36.842  1.00 84.80  ? 205 GLN C CG  1 
ATOM   7217  C CD  . GLN C 1 205 ? 0.597   12.084  37.578  1.00 100.62 ? 205 GLN C CD  1 
ATOM   7218  O OE1 . GLN C 1 205 ? 0.469   11.948  38.794  1.00 107.18 ? 205 GLN C OE1 1 
ATOM   7219  N NE2 . GLN C 1 205 ? -0.291  12.734  36.832  1.00 106.62 ? 205 GLN C NE2 1 
ATOM   7220  N N   . ALA C 1 206 ? 4.746   8.675   35.871  1.00 59.21  ? 206 ALA C N   1 
ATOM   7221  C CA  . ALA C 1 206 ? 5.776   8.605   34.840  1.00 66.39  ? 206 ALA C CA  1 
ATOM   7222  C C   . ALA C 1 206 ? 5.264   7.795   33.649  1.00 60.81  ? 206 ALA C C   1 
ATOM   7223  O O   . ALA C 1 206 ? 5.443   8.189   32.490  1.00 54.48  ? 206 ALA C O   1 
ATOM   7224  C CB  . ALA C 1 206 ? 7.047   7.993   35.393  1.00 69.49  ? 206 ALA C CB  1 
ATOM   7225  N N   . GLN C 1 207 ? 4.628   6.662   33.946  1.00 55.17  ? 207 GLN C N   1 
ATOM   7226  C CA  . GLN C 1 207 ? 4.018   5.831   32.912  1.00 40.34  ? 207 GLN C CA  1 
ATOM   7227  C C   . GLN C 1 207 ? 2.957   6.615   32.145  1.00 48.56  ? 207 GLN C C   1 
ATOM   7228  O O   . GLN C 1 207 ? 2.868   6.523   30.917  1.00 53.39  ? 207 GLN C O   1 
ATOM   7229  C CB  . GLN C 1 207 ? 3.394   4.576   33.523  1.00 37.06  ? 207 GLN C CB  1 
ATOM   7230  C CG  . GLN C 1 207 ? 4.389   3.573   34.080  1.00 53.89  ? 207 GLN C CG  1 
ATOM   7231  C CD  . GLN C 1 207 ? 5.378   3.099   33.038  1.00 57.44  ? 207 GLN C CD  1 
ATOM   7232  O OE1 . GLN C 1 207 ? 5.004   2.788   31.908  1.00 49.93  ? 207 GLN C OE1 1 
ATOM   7233  N NE2 . GLN C 1 207 ? 6.650   3.037   33.414  1.00 59.82  ? 207 GLN C NE2 1 
ATOM   7234  N N   . ILE C 1 208 ? 2.154   7.384   32.876  1.00 52.47  ? 208 ILE C N   1 
ATOM   7235  C CA  . ILE C 1 208 ? 1.115   8.206   32.256  1.00 56.18  ? 208 ILE C CA  1 
ATOM   7236  C C   . ILE C 1 208 ? 1.702   9.198   31.243  1.00 49.09  ? 208 ILE C C   1 
ATOM   7237  O O   . ILE C 1 208 ? 1.288   9.232   30.072  1.00 64.95  ? 208 ILE C O   1 
ATOM   7238  C CB  . ILE C 1 208 ? 0.308   8.980   33.325  1.00 53.54  ? 208 ILE C CB  1 
ATOM   7239  C CG1 . ILE C 1 208 ? -0.605  8.027   34.100  1.00 46.82  ? 208 ILE C CG1 1 
ATOM   7240  C CG2 . ILE C 1 208 ? -0.504  10.098  32.691  1.00 46.08  ? 208 ILE C CG2 1 
ATOM   7241  C CD1 . ILE C 1 208 ? -1.503  8.713   35.102  1.00 67.71  ? 208 ILE C CD1 1 
ATOM   7242  N N   . SER C 1 209 ? 2.682   9.983   31.688  1.00 44.12  ? 209 SER C N   1 
ATOM   7243  C CA  . SER C 1 209 ? 3.327   10.975  30.826  1.00 63.74  ? 209 SER C CA  1 
ATOM   7244  C C   . SER C 1 209 ? 3.972   10.322  29.600  1.00 62.17  ? 209 SER C C   1 
ATOM   7245  O O   . SER C 1 209 ? 3.853   10.820  28.464  1.00 66.02  ? 209 SER C O   1 
ATOM   7246  C CB  . SER C 1 209 ? 4.374   11.758  31.623  1.00 56.82  ? 209 SER C CB  1 
ATOM   7247  O OG  . SER C 1 209 ? 5.637   11.116  31.583  1.00 81.99  ? 209 SER C OG  1 
ATOM   7248  N N   . PHE C 1 210 ? 4.627   9.189   29.845  1.00 50.30  ? 210 PHE C N   1 
ATOM   7249  C CA  . PHE C 1 210 ? 5.268   8.402   28.797  1.00 48.12  ? 210 PHE C CA  1 
ATOM   7250  C C   . PHE C 1 210 ? 4.270   8.025   27.711  1.00 56.64  ? 210 PHE C C   1 
ATOM   7251  O O   . PHE C 1 210 ? 4.444   8.359   26.521  1.00 60.81  ? 210 PHE C O   1 
ATOM   7252  C CB  . PHE C 1 210 ? 5.893   7.141   29.402  1.00 44.74  ? 210 PHE C CB  1 
ATOM   7253  C CG  . PHE C 1 210 ? 6.469   6.191   28.387  1.00 54.84  ? 210 PHE C CG  1 
ATOM   7254  C CD1 . PHE C 1 210 ? 7.582   6.541   27.642  1.00 53.01  ? 210 PHE C CD1 1 
ATOM   7255  C CD2 . PHE C 1 210 ? 5.909   4.936   28.198  1.00 47.26  ? 210 PHE C CD2 1 
ATOM   7256  C CE1 . PHE C 1 210 ? 8.119   5.664   26.715  1.00 47.42  ? 210 PHE C CE1 1 
ATOM   7257  C CE2 . PHE C 1 210 ? 6.441   4.054   27.274  1.00 57.40  ? 210 PHE C CE2 1 
ATOM   7258  C CZ  . PHE C 1 210 ? 7.547   4.419   26.533  1.00 50.69  ? 210 PHE C CZ  1 
ATOM   7259  N N   . PHE C 1 211 ? 3.204   7.355   28.134  1.00 63.28  ? 211 PHE C N   1 
ATOM   7260  C CA  . PHE C 1 211 ? 2.212   6.873   27.190  1.00 52.64  ? 211 PHE C CA  1 
ATOM   7261  C C   . PHE C 1 211 ? 1.419   7.987   26.523  1.00 52.81  ? 211 PHE C C   1 
ATOM   7262  O O   . PHE C 1 211 ? 0.799   7.732   25.507  1.00 60.03  ? 211 PHE C O   1 
ATOM   7263  C CB  . PHE C 1 211 ? 1.260   5.878   27.855  1.00 46.89  ? 211 PHE C CB  1 
ATOM   7264  C CG  . PHE C 1 211 ? 1.831   4.496   27.972  1.00 53.35  ? 211 PHE C CG  1 
ATOM   7265  C CD1 . PHE C 1 211 ? 2.123   3.763   26.832  1.00 49.50  ? 211 PHE C CD1 1 
ATOM   7266  C CD2 . PHE C 1 211 ? 2.078   3.930   29.210  1.00 45.21  ? 211 PHE C CD2 1 
ATOM   7267  C CE1 . PHE C 1 211 ? 2.652   2.488   26.926  1.00 52.64  ? 211 PHE C CE1 1 
ATOM   7268  C CE2 . PHE C 1 211 ? 2.607   2.654   29.311  1.00 47.54  ? 211 PHE C CE2 1 
ATOM   7269  C CZ  . PHE C 1 211 ? 2.893   1.932   28.167  1.00 48.45  ? 211 PHE C CZ  1 
ATOM   7270  N N   . LYS C 1 212 ? 1.375   9.188   27.097  1.00 57.06  ? 212 LYS C N   1 
ATOM   7271  C CA  . LYS C 1 212 ? 0.709   10.295  26.394  1.00 67.48  ? 212 LYS C CA  1 
ATOM   7272  C C   . LYS C 1 212 ? 1.608   10.928  25.313  1.00 73.01  ? 212 LYS C C   1 
ATOM   7273  O O   . LYS C 1 212 ? 1.149   11.257  24.198  1.00 93.87  ? 212 LYS C O   1 
ATOM   7274  C CB  . LYS C 1 212 ? 0.252   11.374  27.373  1.00 54.70  ? 212 LYS C CB  1 
ATOM   7275  C CG  . LYS C 1 212 ? 0.305   12.775  26.789  1.00 73.64  ? 212 LYS C CG  1 
ATOM   7276  C CD  . LYS C 1 212 ? -0.394  13.779  27.676  1.00 71.71  ? 212 LYS C CD  1 
ATOM   7277  C CE  . LYS C 1 212 ? -0.029  15.204  27.281  1.00 82.41  ? 212 LYS C CE  1 
ATOM   7278  N NZ  . LYS C 1 212 ? -0.353  16.138  28.392  1.00 80.06  ? 212 LYS C NZ  1 
ATOM   7279  N N   . MET C 1 213 ? 2.881   11.114  25.658  1.00 62.60  ? 213 MET C N   1 
ATOM   7280  C CA  . MET C 1 213 ? 3.867   11.625  24.712  1.00 67.15  ? 213 MET C CA  1 
ATOM   7281  C C   . MET C 1 213 ? 3.840   10.736  23.468  1.00 83.22  ? 213 MET C C   1 
ATOM   7282  O O   . MET C 1 213 ? 3.677   11.200  22.310  1.00 84.88  ? 213 MET C O   1 
ATOM   7283  C CB  . MET C 1 213 ? 5.253   11.621  25.369  1.00 60.08  ? 213 MET C CB  1 
ATOM   7284  C CG  . MET C 1 213 ? 6.403   12.167  24.531  1.00 69.42  ? 213 MET C CG  1 
ATOM   7285  S SD  . MET C 1 213 ? 7.917   12.370  25.504  1.00 78.25  ? 213 MET C SD  1 
ATOM   7286  C CE  . MET C 1 213 ? 9.187   12.305  24.237  1.00 87.88  ? 213 MET C CE  1 
ATOM   7287  N N   . GLY C 1 214 ? 3.950   9.437   23.742  1.00 69.19  ? 214 GLY C N   1 
ATOM   7288  C CA  . GLY C 1 214 ? 3.860   8.434   22.701  1.00 69.62  ? 214 GLY C CA  1 
ATOM   7289  C C   . GLY C 1 214 ? 2.511   8.519   22.019  1.00 78.56  ? 214 GLY C C   1 
ATOM   7290  O O   . GLY C 1 214 ? 2.454   8.651   20.782  1.00 82.75  ? 214 GLY C O   1 
ATOM   7291  N N   . SER C 1 215 ? 1.461   8.597   22.847  1.00 102.00 ? 215 SER C N   1 
ATOM   7292  C CA  . SER C 1 215 ? 0.069   8.691   22.391  1.00 87.45  ? 215 SER C CA  1 
ATOM   7293  C C   . SER C 1 215 ? -0.117  9.637   21.255  1.00 86.40  ? 215 SER C C   1 
ATOM   7294  O O   . SER C 1 215 ? -0.380  9.188   20.146  1.00 98.54  ? 215 SER C O   1 
ATOM   7295  C CB  . SER C 1 215 ? -0.853  9.150   23.516  1.00 86.44  ? 215 SER C CB  1 
ATOM   7296  O OG  . SER C 1 215 ? -2.035  9.760   23.011  1.00 100.20 ? 215 SER C OG  1 
ATOM   7297  N N   . GLU C 1 216 ? 0.025   10.938  21.435  1.00 82.28  ? 216 GLU C N   1 
ATOM   7298  C CA  . GLU C 1 216 ? 0.121   11.606  20.155  1.00 99.31  ? 216 GLU C CA  1 
ATOM   7299  C C   . GLU C 1 216 ? 1.411   12.389  19.977  1.00 93.36  ? 216 GLU C C   1 
ATOM   7300  O O   . GLU C 1 216 ? 1.470   13.593  20.216  1.00 96.82  ? 216 GLU C O   1 
ATOM   7301  C CB  . GLU C 1 216 ? -1.123  12.481  19.910  1.00 123.10 ? 216 GLU C CB  1 
ATOM   7302  C CG  . GLU C 1 216 ? -1.432  13.498  20.976  1.00 131.53 ? 216 GLU C CG  1 
ATOM   7303  C CD  . GLU C 1 216 ? -2.712  14.250  20.697  1.00 134.49 ? 216 GLU C CD  1 
ATOM   7304  O OE1 . GLU C 1 216 ? -3.212  14.191  19.549  1.00 132.01 ? 216 GLU C OE1 1 
ATOM   7305  O OE2 . GLU C 1 216 ? -3.209  14.921  21.625  1.00 109.09 ? 216 GLU C OE2 1 
ATOM   7306  N N   . ASN C 1 217 ? 2.458   11.694  19.538  1.00 101.32 ? 217 ASN C N   1 
ATOM   7307  C CA  . ASN C 1 217 ? 3.163   12.047  18.307  1.00 100.76 ? 217 ASN C CA  1 
ATOM   7308  C C   . ASN C 1 217 ? 3.524   10.710  17.649  1.00 97.33  ? 217 ASN C C   1 
ATOM   7309  O O   . ASN C 1 217 ? 3.343   10.485  16.426  1.00 106.72 ? 217 ASN C O   1 
ATOM   7310  C CB  . ASN C 1 217 ? 4.403   12.933  18.517  1.00 99.39  ? 217 ASN C CB  1 
ATOM   7311  C CG  . ASN C 1 217 ? 5.166   13.205  17.207  1.00 117.76 ? 217 ASN C CG  1 
ATOM   7312  O OD1 . ASN C 1 217 ? 4.815   12.696  16.139  1.00 126.78 ? 217 ASN C OD1 1 
ATOM   7313  N ND2 . ASN C 1 217 ? 6.142   14.101  17.277  1.00 129.59 ? 217 ASN C ND2 1 
ATOM   7314  N N   . LEU C 1 218 ? 4.096   9.843   18.488  1.00 84.53  ? 218 LEU C N   1 
ATOM   7315  C CA  . LEU C 1 218 ? 4.781   8.661   17.995  1.00 77.75  ? 218 LEU C CA  1 
ATOM   7316  C C   . LEU C 1 218 ? 3.881   7.800   17.123  1.00 87.56  ? 218 LEU C C   1 
ATOM   7317  O O   . LEU C 1 218 ? 4.329   7.288   16.097  1.00 84.26  ? 218 LEU C O   1 
ATOM   7318  C CB  . LEU C 1 218 ? 5.343   7.862   19.167  1.00 71.77  ? 218 LEU C CB  1 
ATOM   7319  C CG  . LEU C 1 218 ? 6.399   6.826   18.801  1.00 58.02  ? 218 LEU C CG  1 
ATOM   7320  C CD1 . LEU C 1 218 ? 7.708   7.487   18.380  1.00 71.64  ? 218 LEU C CD1 1 
ATOM   7321  C CD2 . LEU C 1 218 ? 6.634   5.891   19.968  1.00 54.02  ? 218 LEU C CD2 1 
ATOM   7322  N N   . ASN C 1 219 ? 2.619   7.653   17.513  1.00 88.01  ? 219 ASN C N   1 
ATOM   7323  C CA  . ASN C 1 219 ? 1.714   6.824   16.740  1.00 90.07  ? 219 ASN C CA  1 
ATOM   7324  C C   . ASN C 1 219 ? 1.420   7.502   15.401  1.00 88.61  ? 219 ASN C C   1 
ATOM   7325  O O   . ASN C 1 219 ? 1.177   6.827   14.414  1.00 92.25  ? 219 ASN C O   1 
ATOM   7326  C CB  . ASN C 1 219 ? 0.436   6.481   17.527  1.00 83.20  ? 219 ASN C CB  1 
ATOM   7327  C CG  . ASN C 1 219 ? -0.510  7.657   17.712  1.00 98.25  ? 219 ASN C CG  1 
ATOM   7328  O OD1 . ASN C 1 219 ? -0.415  8.685   17.045  1.00 110.24 ? 219 ASN C OD1 1 
ATOM   7329  N ND2 . ASN C 1 219 ? -1.444  7.497   18.643  1.00 108.27 ? 219 ASN C ND2 1 
ATOM   7330  N N   . GLU C 1 220 ? 1.380   8.834   15.391  1.00 86.79  ? 220 GLU C N   1 
ATOM   7331  C CA  . GLU C 1 220 ? 1.214   9.591   14.147  1.00 89.95  ? 220 GLU C CA  1 
ATOM   7332  C C   . GLU C 1 220 ? 2.334   9.225   13.161  1.00 97.13  ? 220 GLU C C   1 
ATOM   7333  O O   . GLU C 1 220 ? 2.059   8.791   12.017  1.00 90.21  ? 220 GLU C O   1 
ATOM   7334  C CB  . GLU C 1 220 ? 1.198   11.103  14.413  1.00 96.78  ? 220 GLU C CB  1 
ATOM   7335  C CG  . GLU C 1 220 ? 0.974   11.973  13.174  1.00 120.93 ? 220 GLU C CG  1 
ATOM   7336  C CD  . GLU C 1 220 ? 1.005   13.465  13.483  1.00 122.31 ? 220 GLU C CD  1 
ATOM   7337  O OE1 . GLU C 1 220 ? 2.045   13.951  13.975  1.00 121.53 ? 220 GLU C OE1 1 
ATOM   7338  O OE2 . GLU C 1 220 ? -0.008  14.152  13.233  1.00 118.29 ? 220 GLU C OE2 1 
ATOM   7339  N N   . GLN C 1 221 ? 3.592   9.377   13.594  1.00 86.83  ? 221 GLN C N   1 
ATOM   7340  C CA  . GLN C 1 221 ? 4.698   9.103   12.661  1.00 81.43  ? 221 GLN C CA  1 
ATOM   7341  C C   . GLN C 1 221 ? 4.735   7.636   12.278  1.00 84.54  ? 221 GLN C C   1 
ATOM   7342  O O   . GLN C 1 221 ? 5.060   7.285   11.141  1.00 101.49 ? 221 GLN C O   1 
ATOM   7343  C CB  . GLN C 1 221 ? 6.074   9.449   13.241  1.00 77.90  ? 221 GLN C CB  1 
ATOM   7344  C CG  . GLN C 1 221 ? 6.244   10.808  13.876  1.00 86.72  ? 221 GLN C CG  1 
ATOM   7345  C CD  . GLN C 1 221 ? 7.714   11.182  14.011  1.00 101.47 ? 221 GLN C CD  1 
ATOM   7346  O OE1 . GLN C 1 221 ? 8.086   12.339  13.832  1.00 114.67 ? 221 GLN C OE1 1 
ATOM   7347  N NE2 . GLN C 1 221 ? 8.560   10.191  14.281  1.00 86.55  ? 221 GLN C NE2 1 
ATOM   7348  N N   . LEU C 1 222 ? 4.391   6.783   13.235  1.00 75.11  ? 222 LEU C N   1 
ATOM   7349  C CA  . LEU C 1 222 ? 4.321   5.351   12.994  1.00 77.35  ? 222 LEU C CA  1 
ATOM   7350  C C   . LEU C 1 222 ? 3.254   5.007   11.959  1.00 75.82  ? 222 LEU C C   1 
ATOM   7351  O O   . LEU C 1 222 ? 3.435   4.105   11.148  1.00 79.92  ? 222 LEU C O   1 
ATOM   7352  C CB  . LEU C 1 222 ? 4.062   4.614   14.305  1.00 73.63  ? 222 LEU C CB  1 
ATOM   7353  C CG  . LEU C 1 222 ? 5.293   4.402   15.189  1.00 69.08  ? 222 LEU C CG  1 
ATOM   7354  C CD1 . LEU C 1 222 ? 4.897   3.867   16.552  1.00 63.15  ? 222 LEU C CD1 1 
ATOM   7355  C CD2 . LEU C 1 222 ? 6.276   3.459   14.513  1.00 65.24  ? 222 LEU C CD2 1 
ATOM   7356  N N   . GLU C 1 223 ? 2.141   5.729   12.000  1.00 86.27  ? 223 GLU C N   1 
ATOM   7357  C CA  . GLU C 1 223 ? 1.052   5.539   11.051  1.00 85.35  ? 223 GLU C CA  1 
ATOM   7358  C C   . GLU C 1 223 ? 1.497   5.900   9.640   1.00 77.66  ? 223 GLU C C   1 
ATOM   7359  O O   . GLU C 1 223 ? 1.361   5.092   8.708   1.00 85.86  ? 223 GLU C O   1 
ATOM   7360  C CB  . GLU C 1 223 ? -0.163  6.378   11.453  1.00 71.29  ? 223 GLU C CB  1 
ATOM   7361  N N   . GLU C 1 224 ? 2.047   7.104   9.484   1.00 71.91  ? 224 GLU C N   1 
ATOM   7362  C CA  . GLU C 1 224 ? 2.476   7.538   8.152   1.00 80.78  ? 224 GLU C CA  1 
ATOM   7363  C C   . GLU C 1 224 ? 3.554   6.600   7.596   1.00 81.82  ? 224 GLU C C   1 
ATOM   7364  O O   . GLU C 1 224 ? 3.517   6.180   6.417   1.00 96.12  ? 224 GLU C O   1 
ATOM   7365  C CB  . GLU C 1 224 ? 2.997   8.976   8.200   1.00 50.20  ? 224 GLU C CB  1 
ATOM   7366  N N   . PHE C 1 225 ? 4.484   6.244   8.476   1.00 68.58  ? 225 PHE C N   1 
ATOM   7367  C CA  . PHE C 1 225 ? 5.556   5.314   8.155   1.00 83.63  ? 225 PHE C CA  1 
ATOM   7368  C C   . PHE C 1 225 ? 4.985   3.987   7.665   1.00 80.81  ? 225 PHE C C   1 
ATOM   7369  O O   . PHE C 1 225 ? 5.401   3.465   6.628   1.00 95.82  ? 225 PHE C O   1 
ATOM   7370  C CB  . PHE C 1 225 ? 6.448   5.104   9.385   1.00 78.97  ? 225 PHE C CB  1 
ATOM   7371  C CG  . PHE C 1 225 ? 7.414   3.967   9.254   1.00 84.89  ? 225 PHE C CG  1 
ATOM   7372  C CD1 . PHE C 1 225 ? 8.646   4.157   8.653   1.00 85.87  ? 225 PHE C CD1 1 
ATOM   7373  C CD2 . PHE C 1 225 ? 7.105   2.714   9.757   1.00 82.47  ? 225 PHE C CD2 1 
ATOM   7374  C CE1 . PHE C 1 225 ? 9.539   3.116   8.537   1.00 87.34  ? 225 PHE C CE1 1 
ATOM   7375  C CE2 . PHE C 1 225 ? 7.996   1.668   9.643   1.00 79.26  ? 225 PHE C CE2 1 
ATOM   7376  C CZ  . PHE C 1 225 ? 9.215   1.870   9.034   1.00 80.38  ? 225 PHE C CZ  1 
ATOM   7377  N N   . LEU C 1 226 ? 4.012   3.466   8.404   1.00 73.29  ? 226 LEU C N   1 
ATOM   7378  C CA  . LEU C 1 226 ? 3.343   2.220   8.050   1.00 86.33  ? 226 LEU C CA  1 
ATOM   7379  C C   . LEU C 1 226 ? 2.720   2.289   6.662   1.00 83.76  ? 226 LEU C C   1 
ATOM   7380  O O   . LEU C 1 226 ? 2.824   1.337   5.880   1.00 85.71  ? 226 LEU C O   1 
ATOM   7381  C CB  . LEU C 1 226 ? 2.271   1.879   9.087   1.00 85.38  ? 226 LEU C CB  1 
ATOM   7382  C CG  . LEU C 1 226 ? 2.736   1.021   10.264  1.00 68.33  ? 226 LEU C CG  1 
ATOM   7383  C CD1 . LEU C 1 226 ? 1.600   0.786   11.246  1.00 67.16  ? 226 LEU C CD1 1 
ATOM   7384  C CD2 . LEU C 1 226 ? 3.294   -0.299  9.758   1.00 75.66  ? 226 LEU C CD2 1 
ATOM   7385  N N   . ALA C 1 227 ? 2.084   3.418   6.356   1.00 76.40  ? 227 ALA C N   1 
ATOM   7386  C CA  . ALA C 1 227 ? 1.503   3.610   5.029   1.00 84.96  ? 227 ALA C CA  1 
ATOM   7387  C C   . ALA C 1 227 ? 2.563   3.474   3.931   1.00 87.62  ? 227 ALA C C   1 
ATOM   7388  O O   . ALA C 1 227 ? 2.451   2.618   3.024   1.00 83.12  ? 227 ALA C O   1 
ATOM   7389  C CB  . ALA C 1 227 ? 0.823   4.968   4.942   1.00 73.29  ? 227 ALA C CB  1 
ATOM   7390  N N   . ASN C 1 228 ? 3.618   4.280   4.048   1.00 77.39  ? 228 ASN C N   1 
ATOM   7391  C CA  . ASN C 1 228 ? 4.662   4.279   3.022   1.00 76.49  ? 228 ASN C CA  1 
ATOM   7392  C C   . ASN C 1 228 ? 5.322   2.909   2.840   1.00 82.06  ? 228 ASN C C   1 
ATOM   7393  O O   . ASN C 1 228 ? 5.423   2.391   1.710   1.00 89.36  ? 228 ASN C O   1 
ATOM   7394  C CB  . ASN C 1 228 ? 5.728   5.325   3.356   1.00 81.36  ? 228 ASN C CB  1 
ATOM   7395  C CG  . ASN C 1 228 ? 5.147   6.715   3.532   1.00 87.18  ? 228 ASN C CG  1 
ATOM   7396  O OD1 . ASN C 1 228 ? 3.934   6.909   3.453   1.00 70.67  ? 228 ASN C OD1 1 
ATOM   7397  N ND2 . ASN C 1 228 ? 6.014   7.692   3.775   1.00 97.10  ? 228 ASN C ND2 1 
ATOM   7398  N N   . ILE C 1 229 ? 5.746   2.311   3.951   1.00 86.70  ? 229 ILE C N   1 
ATOM   7399  C CA  . ILE C 1 229 ? 6.447   1.034   3.888   1.00 90.20  ? 229 ILE C CA  1 
ATOM   7400  C C   . ILE C 1 229 ? 5.530   -0.041  3.318   1.00 89.79  ? 229 ILE C C   1 
ATOM   7401  O O   . ILE C 1 229 ? 5.977   -0.911  2.570   1.00 84.53  ? 229 ILE C O   1 
ATOM   7402  C CB  . ILE C 1 229 ? 6.957   0.583   5.267   1.00 90.42  ? 229 ILE C CB  1 
ATOM   7403  C CG1 . ILE C 1 229 ? 7.783   1.687   5.914   1.00 94.17  ? 229 ILE C CG1 1 
ATOM   7404  C CG2 . ILE C 1 229 ? 7.791   -0.682  5.138   1.00 81.59  ? 229 ILE C CG2 1 
ATOM   7405  C CD1 . ILE C 1 229 ? 8.969   2.088   5.112   1.00 87.75  ? 229 ILE C CD1 1 
ATOM   7406  N N   . GLY C 1 230 ? 4.246   0.028   3.665   1.00 91.66  ? 230 GLY C N   1 
ATOM   7407  C CA  . GLY C 1 230 ? 3.273   -0.914  3.140   1.00 90.97  ? 230 GLY C CA  1 
ATOM   7408  C C   . GLY C 1 230 ? 3.211   -0.870  1.624   1.00 98.93  ? 230 GLY C C   1 
ATOM   7409  O O   . GLY C 1 230 ? 3.327   -1.915  0.943   1.00 99.67  ? 230 GLY C O   1 
ATOM   7410  N N   . THR C 1 231 ? 3.060   0.340   1.084   1.00 99.67  ? 231 THR C N   1 
ATOM   7411  C CA  . THR C 1 231 ? 3.040   0.482   -0.373  1.00 104.09 ? 231 THR C CA  1 
ATOM   7412  C C   . THR C 1 231 ? 4.312   -0.091  -1.004  1.00 102.35 ? 231 THR C C   1 
ATOM   7413  O O   . THR C 1 231 ? 4.251   -0.920  -1.931  1.00 103.59 ? 231 THR C O   1 
ATOM   7414  C CB  . THR C 1 231 ? 2.890   1.955   -0.813  1.00 100.32 ? 231 THR C CB  1 
ATOM   7415  O OG1 . THR C 1 231 ? 4.126   2.651   -0.602  1.00 104.17 ? 231 THR C OG1 1 
ATOM   7416  C CG2 . THR C 1 231 ? 1.786   2.642   -0.035  1.00 90.03  ? 231 THR C CG2 1 
ATOM   7417  N N   . SER C 1 232 ? 5.462   0.324   -0.474  1.00 95.66  ? 232 SER C N   1 
ATOM   7418  C CA  . SER C 1 232 ? 6.741   -0.110  -1.036  1.00 82.97  ? 232 SER C CA  1 
ATOM   7419  C C   . SER C 1 232 ? 6.940   -1.633  -1.033  1.00 83.34  ? 232 SER C C   1 
ATOM   7420  O O   . SER C 1 232 ? 7.320   -2.221  -2.059  1.00 91.72  ? 232 SER C O   1 
ATOM   7421  C CB  . SER C 1 232 ? 7.892   0.559   -0.281  1.00 83.82  ? 232 SER C CB  1 
ATOM   7422  O OG  . SER C 1 232 ? 7.723   1.966   -0.242  1.00 95.43  ? 232 SER C OG  1 
ATOM   7423  N N   . VAL C 1 233 ? 6.668   -2.273  0.103   1.00 85.54  ? 233 VAL C N   1 
ATOM   7424  C CA  . VAL C 1 233 ? 6.841   -3.721  0.211   1.00 87.77  ? 233 VAL C CA  1 
ATOM   7425  C C   . VAL C 1 233 ? 5.898   -4.463  -0.742  1.00 83.34  ? 233 VAL C C   1 
ATOM   7426  O O   . VAL C 1 233 ? 6.305   -5.452  -1.384  1.00 83.79  ? 233 VAL C O   1 
ATOM   7427  C CB  . VAL C 1 233 ? 6.654   -4.223  1.677   1.00 65.08  ? 233 VAL C CB  1 
ATOM   7428  C CG1 . VAL C 1 233 ? 5.242   -3.985  2.188   1.00 79.95  ? 233 VAL C CG1 1 
ATOM   7429  C CG2 . VAL C 1 233 ? 7.024   -5.695  1.791   1.00 53.94  ? 233 VAL C CG2 1 
ATOM   7430  N N   . GLN C 1 234 ? 4.662   -3.974  -0.869  1.00 87.67  ? 234 GLN C N   1 
ATOM   7431  C CA  . GLN C 1 234 ? 3.735   -4.570  -1.833  1.00 97.14  ? 234 GLN C CA  1 
ATOM   7432  C C   . GLN C 1 234 ? 4.342   -4.532  -3.241  1.00 91.30  ? 234 GLN C C   1 
ATOM   7433  O O   . GLN C 1 234 ? 4.404   -5.563  -3.958  1.00 83.85  ? 234 GLN C O   1 
ATOM   7434  C CB  . GLN C 1 234 ? 2.389   -3.842  -1.809  1.00 94.96  ? 234 GLN C CB  1 
ATOM   7435  N N   . ASN C 1 235 ? 4.830   -3.347  -3.608  1.00 89.02  ? 235 ASN C N   1 
ATOM   7436  C CA  . ASN C 1 235 ? 5.449   -3.146  -4.916  1.00 87.99  ? 235 ASN C CA  1 
ATOM   7437  C C   . ASN C 1 235 ? 6.587   -4.128  -5.194  1.00 92.59  ? 235 ASN C C   1 
ATOM   7438  O O   . ASN C 1 235 ? 6.575   -4.842  -6.213  1.00 100.45 ? 235 ASN C O   1 
ATOM   7439  C CB  . ASN C 1 235 ? 5.973   -1.713  -5.040  1.00 76.12  ? 235 ASN C CB  1 
ATOM   7440  C CG  . ASN C 1 235 ? 4.873   -0.677  -4.933  1.00 85.77  ? 235 ASN C CG  1 
ATOM   7441  O OD1 . ASN C 1 235 ? 3.708   -1.011  -4.719  1.00 97.23  ? 235 ASN C OD1 1 
ATOM   7442  N ND2 . ASN C 1 235 ? 5.238   0.591   -5.081  1.00 87.27  ? 235 ASN C ND2 1 
ATOM   7443  N N   . VAL C 1 236 ? 7.561   -4.171  -4.286  1.00 82.45  ? 236 VAL C N   1 
ATOM   7444  C CA  . VAL C 1 236 ? 8.717   -5.047  -4.468  1.00 82.83  ? 236 VAL C CA  1 
ATOM   7445  C C   . VAL C 1 236 ? 8.303   -6.516  -4.606  1.00 86.72  ? 236 VAL C C   1 
ATOM   7446  O O   . VAL C 1 236 ? 8.815   -7.234  -5.483  1.00 99.61  ? 236 VAL C O   1 
ATOM   7447  C CB  . VAL C 1 236 ? 9.717   -4.909  -3.302  1.00 78.70  ? 236 VAL C CB  1 
ATOM   7448  C CG1 . VAL C 1 236 ? 10.941  -5.780  -3.547  1.00 70.84  ? 236 VAL C CG1 1 
ATOM   7449  C CG2 . VAL C 1 236 ? 10.125  -3.454  -3.124  1.00 77.71  ? 236 VAL C CG2 1 
ATOM   7450  N N   . ARG C 1 237 ? 7.351   -6.946  -3.776  1.00 89.93  ? 237 ARG C N   1 
ATOM   7451  C CA  . ARG C 1 237 ? 6.851   -8.320  -3.852  1.00 90.20  ? 237 ARG C CA  1 
ATOM   7452  C C   . ARG C 1 237 ? 6.360   -8.659  -5.262  1.00 106.89 ? 237 ARG C C   1 
ATOM   7453  O O   . ARG C 1 237 ? 6.856   -9.612  -5.914  1.00 107.01 ? 237 ARG C O   1 
ATOM   7454  C CB  . ARG C 1 237 ? 5.721   -8.534  -2.843  1.00 90.05  ? 237 ARG C CB  1 
ATOM   7455  N N   . ARG C 1 238 ? 5.401   -7.860  -5.732  1.00 106.66 ? 238 ARG C N   1 
ATOM   7456  C CA  . ARG C 1 238 ? 4.822   -8.073  -7.060  1.00 103.10 ? 238 ARG C CA  1 
ATOM   7457  C C   . ARG C 1 238 ? 5.895   -8.128  -8.154  1.00 105.43 ? 238 ARG C C   1 
ATOM   7458  O O   . ARG C 1 238 ? 6.014   -9.127  -8.913  1.00 114.04 ? 238 ARG C O   1 
ATOM   7459  C CB  . ARG C 1 238 ? 3.812   -6.964  -7.372  1.00 96.41  ? 238 ARG C CB  1 
ATOM   7460  N N   . GLU C 1 239 ? 6.721   -7.082  -8.181  1.00 93.80  ? 239 GLU C N   1 
ATOM   7461  C CA  . GLU C 1 239 ? 7.689   -6.924  -9.258  1.00 99.87  ? 239 GLU C CA  1 
ATOM   7462  C C   . GLU C 1 239 ? 8.662   -8.097  -9.279  1.00 96.35  ? 239 GLU C C   1 
ATOM   7463  O O   . GLU C 1 239 ? 9.097   -8.551  -10.357 1.00 113.82 ? 239 GLU C O   1 
ATOM   7464  C CB  . GLU C 1 239 ? 8.446   -5.598  -9.099  1.00 78.99  ? 239 GLU C CB  1 
ATOM   7465  N N   . MET C 1 240 ? 8.964   -8.642  -8.105  1.00 96.25  ? 240 MET C N   1 
ATOM   7466  C CA  . MET C 1 240 ? 9.858   -9.790  -8.117  1.00 98.09  ? 240 MET C CA  1 
ATOM   7467  C C   . MET C 1 240 ? 9.320   -11.185 -8.310  1.00 101.39 ? 240 MET C C   1 
ATOM   7468  O O   . MET C 1 240 ? 10.082  -12.063 -8.703  1.00 98.50  ? 240 MET C O   1 
ATOM   7469  C CB  . MET C 1 240 ? 10.698  -9.842  -6.879  1.00 104.06 ? 240 MET C CB  1 
ATOM   7470  C CG  . MET C 1 240 ? 11.988  -9.436  -7.350  1.00 119.02 ? 240 MET C CG  1 
ATOM   7471  S SD  . MET C 1 240 ? 12.631  -10.631 -8.557  1.00 166.14 ? 240 MET C SD  1 
ATOM   7472  C CE  . MET C 1 240 ? 13.772  -11.506 -7.547  1.00 120.51 ? 240 MET C CE  1 
ATOM   7473  N N   . ASP C 1 241 ? 8.060   -11.461 -8.039  1.00 111.09 ? 241 ASP C N   1 
ATOM   7474  C CA  . ASP C 1 241 ? 7.692   -12.783 -8.496  1.00 112.34 ? 241 ASP C CA  1 
ATOM   7475  C C   . ASP C 1 241 ? 7.410   -12.721 -10.001 1.00 115.98 ? 241 ASP C C   1 
ATOM   7476  O O   . ASP C 1 241 ? 7.473   -13.758 -10.704 1.00 111.13 ? 241 ASP C O   1 
ATOM   7477  C CB  . ASP C 1 241 ? 6.536   -13.345 -7.682  1.00 103.79 ? 241 ASP C CB  1 
ATOM   7478  C CG  . ASP C 1 241 ? 6.819   -13.297 -6.197  1.00 118.68 ? 241 ASP C CG  1 
ATOM   7479  O OD1 . ASP C 1 241 ? 7.504   -14.217 -5.692  1.00 125.38 ? 241 ASP C OD1 1 
ATOM   7480  O OD2 . ASP C 1 241 ? 6.366   -12.350 -5.531  1.00 123.05 ? 241 ASP C OD2 1 
ATOM   7481  N N   . SER C 1 242 ? 7.179   -11.505 -10.504 1.00 109.03 ? 242 SER C N   1 
ATOM   7482  C CA  . SER C 1 242 ? 7.310   -11.276 -11.940 1.00 101.24 ? 242 SER C CA  1 
ATOM   7483  C C   . SER C 1 242 ? 8.709   -11.660 -12.475 1.00 104.15 ? 242 SER C C   1 
ATOM   7484  O O   . SER C 1 242 ? 8.845   -12.513 -13.382 1.00 104.37 ? 242 SER C O   1 
ATOM   7485  C CB  . SER C 1 242 ? 7.010   -9.820  -12.257 1.00 101.96 ? 242 SER C CB  1 
ATOM   7486  O OG  . SER C 1 242 ? 7.643   -9.409  -13.448 1.00 96.69  ? 242 SER C OG  1 
ATOM   7487  N N   . ASP C 1 243 ? 9.749   -11.056 -11.896 1.00 104.46 ? 243 ASP C N   1 
ATOM   7488  C CA  . ASP C 1 243 ? 11.096  -11.188 -12.456 1.00 88.57  ? 243 ASP C CA  1 
ATOM   7489  C C   . ASP C 1 243 ? 11.751  -12.547 -12.167 1.00 79.02  ? 243 ASP C C   1 
ATOM   7490  O O   . ASP C 1 243 ? 12.570  -13.030 -12.965 1.00 84.73  ? 243 ASP C O   1 
ATOM   7491  C CB  . ASP C 1 243 ? 11.977  -10.061 -11.901 1.00 84.49  ? 243 ASP C CB  1 
ATOM   7492  C CG  . ASP C 1 243 ? 13.097  -9.662  -12.843 1.00 95.82  ? 243 ASP C CG  1 
ATOM   7493  O OD1 . ASP C 1 243 ? 13.593  -10.531 -13.590 1.00 114.21 ? 243 ASP C OD1 1 
ATOM   7494  O OD2 . ASP C 1 243 ? 13.501  -8.479  -12.821 1.00 93.40  ? 243 ASP C OD2 1 
ATOM   7495  N N   . ILE C 1 244 ? 11.339  -13.192 -11.075 1.00 87.92  ? 244 ILE C N   1 
ATOM   7496  C CA  . ILE C 1 244 ? 11.734  -14.577 -10.806 1.00 92.46  ? 244 ILE C CA  1 
ATOM   7497  C C   . ILE C 1 244 ? 11.046  -15.543 -11.746 1.00 88.19  ? 244 ILE C C   1 
ATOM   7498  O O   . ILE C 1 244 ? 11.674  -16.491 -12.224 1.00 71.42  ? 244 ILE C O   1 
ATOM   7499  C CB  . ILE C 1 244 ? 11.435  -15.008 -9.352  1.00 96.78  ? 244 ILE C CB  1 
ATOM   7500  C CG1 . ILE C 1 244 ? 12.351  -14.282 -8.393  1.00 91.13  ? 244 ILE C CG1 1 
ATOM   7501  C CG2 . ILE C 1 244 ? 11.717  -16.479 -9.150  1.00 67.66  ? 244 ILE C CG2 1 
ATOM   7502  C CD1 . ILE C 1 244 ? 11.985  -14.440 -6.933  1.00 94.62  ? 244 ILE C CD1 1 
ATOM   7503  N N   . GLU C 1 245 ? 9.759   -15.317 -12.012 1.00 99.25  ? 245 GLU C N   1 
ATOM   7504  C CA  . GLU C 1 245 ? 9.073   -16.174 -12.975 1.00 91.07  ? 245 GLU C CA  1 
ATOM   7505  C C   . GLU C 1 245 ? 9.779   -16.117 -14.331 1.00 83.72  ? 245 GLU C C   1 
ATOM   7506  O O   . GLU C 1 245 ? 10.138  -17.159 -14.926 1.00 82.97  ? 245 GLU C O   1 
ATOM   7507  C CB  . GLU C 1 245 ? 7.610   -15.763 -13.123 1.00 84.02  ? 245 GLU C CB  1 
ATOM   7508  N N   . THR C 1 246 ? 10.021  -14.891 -14.791 1.00 79.99  ? 246 THR C N   1 
ATOM   7509  C CA  . THR C 1 246 ? 10.613  -14.697 -16.108 1.00 89.43  ? 246 THR C CA  1 
ATOM   7510  C C   . THR C 1 246 ? 12.026  -15.269 -16.174 1.00 90.46  ? 246 THR C C   1 
ATOM   7511  O O   . THR C 1 246 ? 12.406  -15.888 -17.175 1.00 86.91  ? 246 THR C O   1 
ATOM   7512  C CB  . THR C 1 246 ? 10.656  -13.206 -16.492 1.00 94.03  ? 246 THR C CB  1 
ATOM   7513  O OG1 . THR C 1 246 ? 9.344   -12.641 -16.374 1.00 96.46  ? 246 THR C OG1 1 
ATOM   7514  C CG2 . THR C 1 246 ? 11.158  -13.035 -17.923 1.00 83.45  ? 246 THR C CG2 1 
ATOM   7515  N N   . MET C 1 247 ? 12.791  -15.102 -15.099 1.00 91.76  ? 247 MET C N   1 
ATOM   7516  C CA  . MET C 1 247 ? 14.142  -15.654 -15.069 1.00 87.05  ? 247 MET C CA  1 
ATOM   7517  C C   . MET C 1 247 ? 14.154  -17.180 -15.040 1.00 84.91  ? 247 MET C C   1 
ATOM   7518  O O   . MET C 1 247 ? 15.024  -17.803 -15.642 1.00 87.45  ? 247 MET C O   1 
ATOM   7519  C CB  . MET C 1 247 ? 14.913  -15.112 -13.871 1.00 92.64  ? 247 MET C CB  1 
ATOM   7520  C CG  . MET C 1 247 ? 15.602  -13.790 -14.133 1.00 86.03  ? 247 MET C CG  1 
ATOM   7521  S SD  . MET C 1 247 ? 16.880  -13.488 -12.908 1.00 94.84  ? 247 MET C SD  1 
ATOM   7522  C CE  . MET C 1 247 ? 15.856  -12.918 -11.555 1.00 77.98  ? 247 MET C CE  1 
ATOM   7523  N N   . GLN C 1 248 ? 13.206  -17.779 -14.327 1.00 87.61  ? 248 GLN C N   1 
ATOM   7524  C CA  . GLN C 1 248 ? 13.138  -19.234 -14.244 1.00 86.66  ? 248 GLN C CA  1 
ATOM   7525  C C   . GLN C 1 248 ? 12.831  -19.840 -15.610 1.00 96.03  ? 248 GLN C C   1 
ATOM   7526  O O   . GLN C 1 248 ? 13.479  -20.808 -16.046 1.00 89.55  ? 248 GLN C O   1 
ATOM   7527  C CB  . GLN C 1 248 ? 12.082  -19.666 -13.224 1.00 70.18  ? 248 GLN C CB  1 
ATOM   7528  N N   . GLN C 1 249 ? 11.870  -19.242 -16.312 1.00 92.45  ? 249 GLN C N   1 
ATOM   7529  C CA  . GLN C 1 249 ? 11.543  -19.743 -17.645 1.00 91.89  ? 249 GLN C CA  1 
ATOM   7530  C C   . GLN C 1 249 ? 12.673  -19.468 -18.644 1.00 88.08  ? 249 GLN C C   1 
ATOM   7531  O O   . GLN C 1 249 ? 12.943  -20.287 -19.538 1.00 91.22  ? 249 GLN C O   1 
ATOM   7532  C CB  . GLN C 1 249 ? 10.228  -19.134 -18.136 1.00 94.29  ? 249 GLN C CB  1 
ATOM   7533  C CG  . GLN C 1 249 ? 9.871   -19.488 -19.569 1.00 94.25  ? 249 GLN C CG  1 
ATOM   7534  C CD  . GLN C 1 249 ? 8.513   -18.956 -19.975 1.00 111.73 ? 249 GLN C CD  1 
ATOM   7535  O OE1 . GLN C 1 249 ? 7.721   -18.537 -19.130 1.00 103.29 ? 249 GLN C OE1 1 
ATOM   7536  N NE2 . GLN C 1 249 ? 8.234   -18.969 -21.274 1.00 115.68 ? 249 GLN C NE2 1 
ATOM   7537  N N   . THR C 1 250 ? 13.372  -18.352 -18.452 1.00 86.19  ? 250 THR C N   1 
ATOM   7538  C CA  . THR C 1 250 ? 14.544  -18.046 -19.269 1.00 82.77  ? 250 THR C CA  1 
ATOM   7539  C C   . THR C 1 250 ? 15.637  -19.095 -19.074 1.00 82.78  ? 250 THR C C   1 
ATOM   7540  O O   . THR C 1 250 ? 16.249  -19.552 -20.041 1.00 75.05  ? 250 THR C O   1 
ATOM   7541  C CB  . THR C 1 250 ? 15.119  -16.654 -18.937 1.00 78.06  ? 250 THR C CB  1 
ATOM   7542  O OG1 . THR C 1 250 ? 14.078  -15.671 -19.001 1.00 96.71  ? 250 THR C OG1 1 
ATOM   7543  C CG2 . THR C 1 250 ? 16.224  -16.281 -19.917 1.00 59.36  ? 250 THR C CG2 1 
ATOM   7544  N N   . ILE C 1 251 ? 15.862  -19.484 -17.823 1.00 87.50  ? 251 ILE C N   1 
ATOM   7545  C CA  . ILE C 1 251 ? 16.790  -20.563 -17.508 1.00 88.74  ? 251 ILE C CA  1 
ATOM   7546  C C   . ILE C 1 251 ? 16.378  -21.844 -18.220 1.00 93.02  ? 251 ILE C C   1 
ATOM   7547  O O   . ILE C 1 251 ? 17.217  -22.535 -18.805 1.00 93.05  ? 251 ILE C O   1 
ATOM   7548  C CB  . ILE C 1 251 ? 16.873  -20.819 -15.990 1.00 75.97  ? 251 ILE C CB  1 
ATOM   7549  C CG1 . ILE C 1 251 ? 17.619  -19.675 -15.302 1.00 85.70  ? 251 ILE C CG1 1 
ATOM   7550  C CG2 . ILE C 1 251 ? 17.573  -22.140 -15.702 1.00 60.78  ? 251 ILE C CG2 1 
ATOM   7551  C CD1 . ILE C 1 251 ? 17.881  -19.912 -13.832 1.00 79.35  ? 251 ILE C CD1 1 
ATOM   7552  N N   . GLU C 1 252 ? 15.084  -22.152 -18.187 1.00 98.47  ? 252 GLU C N   1 
ATOM   7553  C CA  . GLU C 1 252 ? 14.612  -23.387 -18.807 1.00 95.39  ? 252 GLU C CA  1 
ATOM   7554  C C   . GLU C 1 252 ? 14.865  -23.395 -20.319 1.00 96.72  ? 252 GLU C C   1 
ATOM   7555  O O   . GLU C 1 252 ? 15.300  -24.411 -20.881 1.00 95.68  ? 252 GLU C O   1 
ATOM   7556  C CB  . GLU C 1 252 ? 13.123  -23.593 -18.524 1.00 85.26  ? 252 GLU C CB  1 
ATOM   7557  N N   . ASP C 1 253 ? 14.649  -22.254 -20.971 1.00 104.40 ? 253 ASP C N   1 
ATOM   7558  C CA  . ASP C 1 253 ? 14.856  -22.190 -22.419 1.00 88.97  ? 253 ASP C CA  1 
ATOM   7559  C C   . ASP C 1 253 ? 16.332  -22.148 -22.823 1.00 89.82  ? 253 ASP C C   1 
ATOM   7560  O O   . ASP C 1 253 ? 16.711  -22.712 -23.854 1.00 95.68  ? 253 ASP C O   1 
ATOM   7561  C CB  . ASP C 1 253 ? 14.134  -20.975 -23.008 1.00 88.29  ? 253 ASP C CB  1 
ATOM   7562  C CG  . ASP C 1 253 ? 12.713  -20.838 -22.500 1.00 104.92 ? 253 ASP C CG  1 
ATOM   7563  O OD1 . ASP C 1 253 ? 12.175  -21.824 -21.953 1.00 116.16 ? 253 ASP C OD1 1 
ATOM   7564  O OD2 . ASP C 1 253 ? 12.131  -19.743 -22.651 1.00 105.70 ? 253 ASP C OD2 1 
ATOM   7565  N N   . LEU C 1 254 ? 17.165  -21.494 -22.018 1.00 96.42  ? 254 LEU C N   1 
ATOM   7566  C CA  . LEU C 1 254 ? 18.606  -21.502 -22.271 1.00 96.24  ? 254 LEU C CA  1 
ATOM   7567  C C   . LEU C 1 254 ? 19.207  -22.886 -22.073 1.00 88.99  ? 254 LEU C C   1 
ATOM   7568  O O   . LEU C 1 254 ? 20.077  -23.306 -22.835 1.00 77.99  ? 254 LEU C O   1 
ATOM   7569  C CB  . LEU C 1 254 ? 19.326  -20.489 -21.382 1.00 84.51  ? 254 LEU C CB  1 
ATOM   7570  C CG  . LEU C 1 254 ? 19.475  -19.061 -21.911 1.00 84.96  ? 254 LEU C CG  1 
ATOM   7571  C CD1 . LEU C 1 254 ? 18.145  -18.416 -22.264 1.00 92.09  ? 254 LEU C CD1 1 
ATOM   7572  C CD2 . LEU C 1 254 ? 20.209  -18.234 -20.880 1.00 79.02  ? 254 LEU C CD2 1 
ATOM   7573  N N   . GLU C 1 255 ? 18.732  -23.596 -21.055 1.00 100.76 ? 255 GLU C N   1 
ATOM   7574  C CA  . GLU C 1 255 ? 19.181  -24.960 -20.813 1.00 98.55  ? 255 GLU C CA  1 
ATOM   7575  C C   . GLU C 1 255 ? 18.709  -25.854 -21.950 1.00 98.22  ? 255 GLU C C   1 
ATOM   7576  O O   . GLU C 1 255 ? 19.405  -26.790 -22.347 1.00 87.01  ? 255 GLU C O   1 
ATOM   7577  C CB  . GLU C 1 255 ? 18.664  -25.478 -19.470 1.00 98.33  ? 255 GLU C CB  1 
ATOM   7578  N N   . VAL C 1 256 ? 17.522  -25.557 -22.473 1.00 104.24 ? 256 VAL C N   1 
ATOM   7579  C CA  . VAL C 1 256 ? 17.001  -26.287 -23.622 1.00 94.25  ? 256 VAL C CA  1 
ATOM   7580  C C   . VAL C 1 256 ? 17.872  -26.091 -24.865 1.00 88.85  ? 256 VAL C C   1 
ATOM   7581  O O   . VAL C 1 256 ? 18.207  -27.054 -25.554 1.00 85.10  ? 256 VAL C O   1 
ATOM   7582  C CB  . VAL C 1 256 ? 15.558  -25.861 -23.953 1.00 73.10  ? 256 VAL C CB  1 
ATOM   7583  N N   . ALA C 1 257 ? 18.237  -24.843 -25.147 1.00 92.20  ? 257 ALA C N   1 
ATOM   7584  C CA  . ALA C 1 257 ? 18.936  -24.514 -26.390 1.00 94.66  ? 257 ALA C CA  1 
ATOM   7585  C C   . ALA C 1 257 ? 20.437  -24.819 -26.359 1.00 93.59  ? 257 ALA C C   1 
ATOM   7586  O O   . ALA C 1 257 ? 21.032  -25.130 -27.392 1.00 93.47  ? 257 ALA C O   1 
ATOM   7587  C CB  . ALA C 1 257 ? 18.715  -23.047 -26.733 1.00 95.00  ? 257 ALA C CB  1 
ATOM   7588  N N   . SER C 1 258 ? 21.043  -24.732 -25.178 1.00 91.90  ? 258 SER C N   1 
ATOM   7589  C CA  . SER C 1 258 ? 22.496  -24.845 -25.039 1.00 88.96  ? 258 SER C CA  1 
ATOM   7590  C C   . SER C 1 258 ? 23.020  -26.274 -25.141 1.00 98.63  ? 258 SER C C   1 
ATOM   7591  O O   . SER C 1 258 ? 24.230  -26.494 -25.151 1.00 97.92  ? 258 SER C O   1 
ATOM   7592  C CB  . SER C 1 258 ? 22.947  -24.253 -23.703 1.00 74.89  ? 258 SER C CB  1 
ATOM   7593  O OG  . SER C 1 258 ? 22.371  -22.980 -23.486 1.00 79.32  ? 258 SER C OG  1 
ATOM   7594  N N   . ASP C 1 259 ? 22.117  -27.243 -25.217 1.00 106.48 ? 259 ASP C N   1 
ATOM   7595  C CA  . ASP C 1 259 ? 22.504  -28.644 -25.071 1.00 105.51 ? 259 ASP C CA  1 
ATOM   7596  C C   . ASP C 1 259 ? 23.401  -29.212 -26.180 1.00 89.05  ? 259 ASP C C   1 
ATOM   7597  O O   . ASP C 1 259 ? 24.260  -30.046 -25.897 1.00 80.44  ? 259 ASP C O   1 
ATOM   7598  C CB  . ASP C 1 259 ? 21.245  -29.506 -24.950 1.00 103.82 ? 259 ASP C CB  1 
ATOM   7599  C CG  . ASP C 1 259 ? 21.450  -30.719 -24.062 1.00 111.68 ? 259 ASP C CG  1 
ATOM   7600  O OD1 . ASP C 1 259 ? 22.556  -31.302 -24.065 1.00 116.50 ? 259 ASP C OD1 1 
ATOM   7601  O OD2 . ASP C 1 259 ? 20.503  -31.071 -23.333 1.00 113.27 ? 259 ASP C OD2 1 
ATOM   7602  N N   . PRO C 1 260 ? 23.204  -28.791 -27.442 1.00 89.37  ? 260 PRO C N   1 
ATOM   7603  C CA  . PRO C 1 260 ? 24.231  -29.189 -28.411 1.00 98.83  ? 260 PRO C CA  1 
ATOM   7604  C C   . PRO C 1 260 ? 25.550  -28.433 -28.232 1.00 93.53  ? 260 PRO C C   1 
ATOM   7605  O O   . PRO C 1 260 ? 26.602  -28.920 -28.648 1.00 93.43  ? 260 PRO C O   1 
ATOM   7606  C CB  . PRO C 1 260 ? 23.590  -28.854 -29.762 1.00 85.44  ? 260 PRO C CB  1 
ATOM   7607  C CG  . PRO C 1 260 ? 22.580  -27.803 -29.452 1.00 98.16  ? 260 PRO C CG  1 
ATOM   7608  C CD  . PRO C 1 260 ? 22.040  -28.175 -28.105 1.00 75.47  ? 260 PRO C CD  1 
ATOM   7609  N N   . LEU C 1 261 ? 25.487  -27.259 -27.612 1.00 92.06  ? 261 LEU C N   1 
ATOM   7610  C CA  . LEU C 1 261 ? 26.629  -26.347 -27.554 1.00 82.37  ? 261 LEU C CA  1 
ATOM   7611  C C   . LEU C 1 261 ? 27.717  -26.738 -26.556 1.00 78.44  ? 261 LEU C C   1 
ATOM   7612  O O   . LEU C 1 261 ? 28.816  -26.185 -26.587 1.00 85.53  ? 261 LEU C O   1 
ATOM   7613  C CB  . LEU C 1 261 ? 26.141  -24.934 -27.227 1.00 82.88  ? 261 LEU C CB  1 
ATOM   7614  C CG  . LEU C 1 261 ? 25.269  -24.262 -28.287 1.00 93.56  ? 261 LEU C CG  1 
ATOM   7615  C CD1 . LEU C 1 261 ? 24.476  -23.118 -27.681 1.00 85.03  ? 261 LEU C CD1 1 
ATOM   7616  C CD2 . LEU C 1 261 ? 26.135  -23.763 -29.431 1.00 89.73  ? 261 LEU C CD2 1 
ATOM   7617  N N   . TYR C 1 262 ? 27.419  -27.681 -25.669 1.00 77.21  ? 262 TYR C N   1 
ATOM   7618  C CA  . TYR C 1 262 ? 28.393  -28.088 -24.662 1.00 74.71  ? 262 TYR C CA  1 
ATOM   7619  C C   . TYR C 1 262 ? 29.536  -28.882 -25.292 1.00 75.23  ? 262 TYR C C   1 
ATOM   7620  O O   . TYR C 1 262 ? 30.642  -28.925 -24.754 1.00 74.71  ? 262 TYR C O   1 
ATOM   7621  C CB  . TYR C 1 262 ? 27.721  -28.897 -23.553 1.00 71.04  ? 262 TYR C CB  1 
ATOM   7622  C CG  . TYR C 1 262 ? 26.651  -28.124 -22.816 1.00 80.09  ? 262 TYR C CG  1 
ATOM   7623  C CD1 . TYR C 1 262 ? 26.957  -26.947 -22.143 1.00 78.75  ? 262 TYR C CD1 1 
ATOM   7624  C CD2 . TYR C 1 262 ? 25.337  -28.572 -22.785 1.00 84.63  ? 262 TYR C CD2 1 
ATOM   7625  C CE1 . TYR C 1 262 ? 25.984  -26.235 -21.467 1.00 74.97  ? 262 TYR C CE1 1 
ATOM   7626  C CE2 . TYR C 1 262 ? 24.358  -27.868 -22.109 1.00 79.91  ? 262 TYR C CE2 1 
ATOM   7627  C CZ  . TYR C 1 262 ? 24.687  -26.701 -21.452 1.00 66.86  ? 262 TYR C CZ  1 
ATOM   7628  O OH  . TYR C 1 262 ? 23.714  -25.998 -20.779 1.00 73.30  ? 262 TYR C OH  1 
ATOM   7629  N N   . VAL C 1 263 ? 29.257  -29.510 -26.430 1.00 71.47  ? 263 VAL C N   1 
ATOM   7630  C CA  . VAL C 1 263 ? 30.274  -30.243 -27.178 1.00 73.54  ? 263 VAL C CA  1 
ATOM   7631  C C   . VAL C 1 263 ? 31.409  -29.325 -27.635 1.00 67.60  ? 263 VAL C C   1 
ATOM   7632  O O   . VAL C 1 263 ? 31.177  -28.368 -28.373 1.00 68.70  ? 263 VAL C O   1 
ATOM   7633  C CB  . VAL C 1 263 ? 29.666  -30.941 -28.408 1.00 87.36  ? 263 VAL C CB  1 
ATOM   7634  C CG1 . VAL C 1 263 ? 30.731  -31.736 -29.149 1.00 89.69  ? 263 VAL C CG1 1 
ATOM   7635  C CG2 . VAL C 1 263 ? 28.514  -31.842 -27.989 1.00 70.12  ? 263 VAL C CG2 1 
ATOM   7636  N N   . PRO C 1 264 ? 32.641  -29.619 -27.187 1.00 62.23  ? 264 PRO C N   1 
ATOM   7637  C CA  . PRO C 1 264 ? 33.854  -28.848 -27.497 1.00 74.28  ? 264 PRO C CA  1 
ATOM   7638  C C   . PRO C 1 264 ? 34.107  -28.676 -28.995 1.00 83.86  ? 264 PRO C C   1 
ATOM   7639  O O   . PRO C 1 264 ? 34.424  -27.571 -29.438 1.00 84.61  ? 264 PRO C O   1 
ATOM   7640  C CB  . PRO C 1 264 ? 34.978  -29.675 -26.854 1.00 62.14  ? 264 PRO C CB  1 
ATOM   7641  C CG  . PRO C 1 264 ? 34.376  -31.003 -26.534 1.00 57.98  ? 264 PRO C CG  1 
ATOM   7642  C CD  . PRO C 1 264 ? 32.927  -30.757 -26.300 1.00 67.64  ? 264 PRO C CD  1 
ATOM   7643  N N   . ASP C 1 265 ? 33.980  -29.757 -29.758 1.00 80.01  ? 265 ASP C N   1 
ATOM   7644  C CA  . ASP C 1 265 ? 34.228  -29.711 -31.195 1.00 73.55  ? 265 ASP C CA  1 
ATOM   7645  C C   . ASP C 1 265 ? 32.957  -30.065 -31.962 1.00 64.95  ? 265 ASP C C   1 
ATOM   7646  O O   . ASP C 1 265 ? 32.772  -31.211 -32.369 1.00 68.90  ? 265 ASP C O   1 
ATOM   7647  C CB  . ASP C 1 265 ? 35.367  -30.664 -31.572 1.00 67.10  ? 265 ASP C CB  1 
ATOM   7648  C CG  . ASP C 1 265 ? 36.071  -30.261 -32.857 1.00 78.87  ? 265 ASP C CG  1 
ATOM   7649  O OD1 . ASP C 1 265 ? 35.437  -29.612 -33.715 1.00 82.22  ? 265 ASP C OD1 1 
ATOM   7650  O OD2 . ASP C 1 265 ? 37.267  -30.593 -33.005 1.00 71.90  ? 265 ASP C OD2 1 
ATOM   7651  N N   . PRO C 1 266 ? 32.075  -29.072 -32.162 1.00 66.54  ? 266 PRO C N   1 
ATOM   7652  C CA  . PRO C 1 266 ? 30.765  -29.280 -32.791 1.00 75.41  ? 266 PRO C CA  1 
ATOM   7653  C C   . PRO C 1 266 ? 30.892  -29.752 -34.235 1.00 85.30  ? 266 PRO C C   1 
ATOM   7654  O O   . PRO C 1 266 ? 31.801  -29.311 -34.940 1.00 86.12  ? 266 PRO C O   1 
ATOM   7655  C CB  . PRO C 1 266 ? 30.122  -27.894 -32.724 1.00 73.34  ? 266 PRO C CB  1 
ATOM   7656  C CG  . PRO C 1 266 ? 31.273  -26.952 -32.710 1.00 73.51  ? 266 PRO C CG  1 
ATOM   7657  C CD  . PRO C 1 266 ? 32.356  -27.644 -31.931 1.00 69.95  ? 266 PRO C CD  1 
ATOM   7658  N N   . ASP C 1 267 ? 29.989  -30.629 -34.669 1.00 92.97  ? 267 ASP C N   1 
ATOM   7659  C CA  . ASP C 1 267 ? 30.034  -31.161 -36.027 1.00 109.51 ? 267 ASP C CA  1 
ATOM   7660  C C   . ASP C 1 267 ? 29.276  -30.207 -36.957 1.00 106.83 ? 267 ASP C C   1 
ATOM   7661  O O   . ASP C 1 267 ? 28.260  -29.641 -36.558 1.00 95.57  ? 267 ASP C O   1 
ATOM   7662  C CB  . ASP C 1 267 ? 29.423  -32.575 -36.065 1.00 113.98 ? 267 ASP C CB  1 
ATOM   7663  C CG  . ASP C 1 267 ? 29.079  -33.041 -37.474 1.00 122.90 ? 267 ASP C CG  1 
ATOM   7664  O OD1 . ASP C 1 267 ? 30.004  -33.473 -38.196 1.00 126.57 ? 267 ASP C OD1 1 
ATOM   7665  O OD2 . ASP C 1 267 ? 27.894  -32.978 -37.866 1.00 107.03 ? 267 ASP C OD2 1 
ATOM   7666  N N   . PRO C 1 268 ? 29.784  -30.006 -38.188 1.00 97.98  ? 268 PRO C N   1 
ATOM   7667  C CA  . PRO C 1 268 ? 29.292  -29.017 -39.161 1.00 97.06  ? 268 PRO C CA  1 
ATOM   7668  C C   . PRO C 1 268 ? 27.771  -28.983 -39.386 1.00 99.74  ? 268 PRO C C   1 
ATOM   7669  O O   . PRO C 1 268 ? 27.246  -27.914 -39.697 1.00 93.82  ? 268 PRO C O   1 
ATOM   7670  C CB  . PRO C 1 268 ? 30.014  -29.420 -40.443 1.00 78.77  ? 268 PRO C CB  1 
ATOM   7671  C CG  . PRO C 1 268 ? 31.327  -29.917 -39.959 1.00 100.13 ? 268 PRO C CG  1 
ATOM   7672  C CD  . PRO C 1 268 ? 31.065  -30.592 -38.627 1.00 94.67  ? 268 PRO C CD  1 
ATOM   7673  N N   . THR C 1 269 ? 27.083  -30.114 -39.264 1.00 101.47 ? 269 THR C N   1 
ATOM   7674  C CA  . THR C 1 269 ? 25.641  -30.135 -39.494 1.00 110.50 ? 269 THR C CA  1 
ATOM   7675  C C   . THR C 1 269 ? 24.924  -29.451 -38.329 1.00 105.56 ? 269 THR C C   1 
ATOM   7676  O O   . THR C 1 269 ? 23.878  -28.821 -38.508 1.00 95.48  ? 269 THR C O   1 
ATOM   7677  C CB  . THR C 1 269 ? 25.128  -31.584 -39.680 1.00 114.12 ? 269 THR C CB  1 
ATOM   7678  O OG1 . THR C 1 269 ? 25.654  -32.126 -40.899 1.00 109.68 ? 269 THR C OG1 1 
ATOM   7679  C CG2 . THR C 1 269 ? 23.606  -31.647 -39.696 1.00 113.35 ? 269 THR C CG2 1 
ATOM   7680  N N   . LYS C 1 270 ? 25.515  -29.541 -37.143 1.00 112.23 ? 270 LYS C N   1 
ATOM   7681  C CA  . LYS C 1 270 ? 24.957  -28.881 -35.968 1.00 116.26 ? 270 LYS C CA  1 
ATOM   7682  C C   . LYS C 1 270 ? 25.142  -27.366 -36.057 1.00 115.55 ? 270 LYS C C   1 
ATOM   7683  O O   . LYS C 1 270 ? 24.170  -26.612 -36.097 1.00 110.86 ? 270 LYS C O   1 
ATOM   7684  C CB  . LYS C 1 270 ? 25.605  -29.419 -34.691 1.00 92.91  ? 270 LYS C CB  1 
ATOM   7685  N N   . PHE C 1 271 ? 26.398  -26.930 -36.078 1.00 113.66 ? 271 PHE C N   1 
ATOM   7686  C CA  . PHE C 1 271 ? 26.730  -25.507 -36.136 1.00 106.04 ? 271 PHE C CA  1 
ATOM   7687  C C   . PHE C 1 271 ? 27.798  -25.205 -37.186 1.00 99.97  ? 271 PHE C C   1 
ATOM   7688  O O   . PHE C 1 271 ? 28.993  -25.311 -36.913 1.00 73.79  ? 271 PHE C O   1 
ATOM   7689  C CB  . PHE C 1 271 ? 27.163  -25.007 -34.759 1.00 93.77  ? 271 PHE C CB  1 
ATOM   7690  C CG  . PHE C 1 271 ? 26.092  -25.131 -33.716 1.00 105.44 ? 271 PHE C CG  1 
ATOM   7691  C CD1 . PHE C 1 271 ? 25.019  -24.254 -33.709 1.00 102.06 ? 271 PHE C CD1 1 
ATOM   7692  C CD2 . PHE C 1 271 ? 26.141  -26.130 -32.759 1.00 113.54 ? 271 PHE C CD2 1 
ATOM   7693  C CE1 . PHE C 1 271 ? 24.022  -24.361 -32.760 1.00 96.78  ? 271 PHE C CE1 1 
ATOM   7694  C CE2 . PHE C 1 271 ? 25.145  -26.243 -31.806 1.00 115.58 ? 271 PHE C CE2 1 
ATOM   7695  C CZ  . PHE C 1 271 ? 24.084  -25.357 -31.808 1.00 113.85 ? 271 PHE C CZ  1 
ATOM   7696  N N   . PRO C 1 272 ? 27.359  -24.837 -38.399 1.00 96.85  ? 272 PRO C N   1 
ATOM   7697  C CA  . PRO C 1 272 ? 28.230  -24.623 -39.561 1.00 79.93  ? 272 PRO C CA  1 
ATOM   7698  C C   . PRO C 1 272 ? 29.122  -23.392 -39.422 1.00 71.61  ? 272 PRO C C   1 
ATOM   7699  O O   . PRO C 1 272 ? 28.840  -22.508 -38.612 1.00 75.63  ? 272 PRO C O   1 
ATOM   7700  C CB  . PRO C 1 272 ? 27.235  -24.438 -40.707 1.00 75.33  ? 272 PRO C CB  1 
ATOM   7701  C CG  . PRO C 1 272 ? 26.031  -23.858 -40.053 1.00 86.15  ? 272 PRO C CG  1 
ATOM   7702  C CD  . PRO C 1 272 ? 25.954  -24.502 -38.696 1.00 86.71  ? 272 PRO C CD  1 
ATOM   7703  N N   . VAL C 1 273 ? 30.193  -23.347 -40.208 1.00 61.87  ? 273 VAL C N   1 
ATOM   7704  C CA  . VAL C 1 273 ? 31.112  -22.215 -40.193 1.00 64.03  ? 273 VAL C CA  1 
ATOM   7705  C C   . VAL C 1 273 ? 30.516  -21.005 -40.907 1.00 66.02  ? 273 VAL C C   1 
ATOM   7706  O O   . VAL C 1 273 ? 30.108  -21.095 -42.064 1.00 66.04  ? 273 VAL C O   1 
ATOM   7707  C CB  . VAL C 1 273 ? 32.458  -22.577 -40.853 1.00 63.34  ? 273 VAL C CB  1 
ATOM   7708  C CG1 . VAL C 1 273 ? 33.300  -21.328 -41.075 1.00 53.88  ? 273 VAL C CG1 1 
ATOM   7709  C CG2 . VAL C 1 273 ? 33.208  -23.591 -40.004 1.00 60.47  ? 273 VAL C CG2 1 
ATOM   7710  N N   . ASN C 1 274 ? 30.471  -19.876 -40.208 1.00 68.96  ? 274 ASN C N   1 
ATOM   7711  C CA  . ASN C 1 274 ? 29.997  -18.629 -40.794 1.00 64.21  ? 274 ASN C CA  1 
ATOM   7712  C C   . ASN C 1 274 ? 31.162  -17.828 -41.361 1.00 55.35  ? 274 ASN C C   1 
ATOM   7713  O O   . ASN C 1 274 ? 32.008  -17.339 -40.613 1.00 65.05  ? 274 ASN C O   1 
ATOM   7714  C CB  . ASN C 1 274 ? 29.238  -17.804 -39.752 1.00 58.30  ? 274 ASN C CB  1 
ATOM   7715  C CG  . ASN C 1 274 ? 28.424  -16.682 -40.369 1.00 64.74  ? 274 ASN C CG  1 
ATOM   7716  O OD1 . ASN C 1 274 ? 28.718  -16.213 -41.469 1.00 52.89  ? 274 ASN C OD1 1 
ATOM   7717  N ND2 . ASN C 1 274 ? 27.391  -16.244 -39.658 1.00 66.03  ? 274 ASN C ND2 1 
ATOM   7718  N N   . ARG C 1 275 ? 31.205  -17.689 -42.682 1.00 62.96  ? 275 ARG C N   1 
ATOM   7719  C CA  . ARG C 1 275 ? 32.339  -17.037 -43.323 1.00 62.45  ? 275 ARG C CA  1 
ATOM   7720  C C   . ARG C 1 275 ? 32.073  -15.553 -43.561 1.00 57.49  ? 275 ARG C C   1 
ATOM   7721  O O   . ARG C 1 275 ? 32.894  -14.853 -44.153 1.00 58.74  ? 275 ARG C O   1 
ATOM   7722  C CB  . ARG C 1 275 ? 32.682  -17.728 -44.648 1.00 59.21  ? 275 ARG C CB  1 
ATOM   7723  C CG  . ARG C 1 275 ? 33.014  -19.208 -44.515 1.00 52.23  ? 275 ARG C CG  1 
ATOM   7724  C CD  . ARG C 1 275 ? 33.447  -19.805 -45.847 1.00 70.79  ? 275 ARG C CD  1 
ATOM   7725  N NE  . ARG C 1 275 ? 32.595  -19.383 -46.956 1.00 100.34 ? 275 ARG C NE  1 
ATOM   7726  C CZ  . ARG C 1 275 ? 31.535  -20.056 -47.388 1.00 92.73  ? 275 ARG C CZ  1 
ATOM   7727  N NH1 . ARG C 1 275 ? 31.184  -21.195 -46.806 1.00 98.50  ? 275 ARG C NH1 1 
ATOM   7728  N NH2 . ARG C 1 275 ? 30.824  -19.590 -48.406 1.00 71.93  ? 275 ARG C NH2 1 
ATOM   7729  N N   . ASN C 1 276 ? 30.920  -15.082 -43.100 1.00 57.35  ? 276 ASN C N   1 
ATOM   7730  C CA  . ASN C 1 276 ? 30.536  -13.685 -43.275 1.00 58.05  ? 276 ASN C CA  1 
ATOM   7731  C C   . ASN C 1 276 ? 30.750  -12.797 -42.048 1.00 61.26  ? 276 ASN C C   1 
ATOM   7732  O O   . ASN C 1 276 ? 30.345  -11.635 -42.048 1.00 66.53  ? 276 ASN C O   1 
ATOM   7733  C CB  . ASN C 1 276 ? 29.074  -13.606 -43.717 1.00 69.45  ? 276 ASN C CB  1 
ATOM   7734  C CG  . ASN C 1 276 ? 28.838  -14.278 -45.055 1.00 71.44  ? 276 ASN C CG  1 
ATOM   7735  O OD1 . ASN C 1 276 ? 29.733  -14.337 -45.898 1.00 63.18  ? 276 ASN C OD1 1 
ATOM   7736  N ND2 . ASN C 1 276 ? 27.628  -14.788 -45.257 1.00 71.16  ? 276 ASN C ND2 1 
ATOM   7737  N N   . LEU C 1 277 ? 31.379  -13.335 -41.006 1.00 59.28  ? 277 LEU C N   1 
ATOM   7738  C CA  . LEU C 1 277 ? 31.529  -12.590 -39.758 1.00 49.99  ? 277 LEU C CA  1 
ATOM   7739  C C   . LEU C 1 277 ? 32.502  -11.427 -39.907 1.00 44.75  ? 277 LEU C C   1 
ATOM   7740  O O   . LEU C 1 277 ? 33.656  -11.612 -40.295 1.00 43.83  ? 277 LEU C O   1 
ATOM   7741  C CB  . LEU C 1 277 ? 32.013  -13.508 -38.632 1.00 44.02  ? 277 LEU C CB  1 
ATOM   7742  C CG  . LEU C 1 277 ? 31.215  -14.770 -38.309 1.00 37.37  ? 277 LEU C CG  1 
ATOM   7743  C CD1 . LEU C 1 277 ? 31.927  -15.579 -37.237 1.00 45.59  ? 277 LEU C CD1 1 
ATOM   7744  C CD2 . LEU C 1 277 ? 29.809  -14.416 -37.865 1.00 34.92  ? 277 LEU C CD2 1 
ATOM   7745  N N   . THR C 1 278 ? 32.026  -10.226 -39.595 1.00 38.95  ? 278 THR C N   1 
ATOM   7746  C CA  . THR C 1 278 ? 32.876  -9.044  -39.599 1.00 38.12  ? 278 THR C CA  1 
ATOM   7747  C C   . THR C 1 278 ? 33.397  -8.804  -38.192 1.00 43.56  ? 278 THR C C   1 
ATOM   7748  O O   . THR C 1 278 ? 34.226  -7.928  -37.958 1.00 47.26  ? 278 THR C O   1 
ATOM   7749  C CB  . THR C 1 278 ? 32.114  -7.790  -40.072 1.00 48.05  ? 278 THR C CB  1 
ATOM   7750  O OG1 . THR C 1 278 ? 30.956  -7.594  -39.249 1.00 56.82  ? 278 THR C OG1 1 
ATOM   7751  C CG2 . THR C 1 278 ? 31.684  -7.933  -41.525 1.00 51.10  ? 278 THR C CG2 1 
ATOM   7752  N N   . ARG C 1 279 ? 32.883  -9.588  -37.253 1.00 49.40  ? 279 ARG C N   1 
ATOM   7753  C CA  . ARG C 1 279 ? 33.178  -9.410  -35.839 1.00 41.13  ? 279 ARG C CA  1 
ATOM   7754  C C   . ARG C 1 279 ? 33.157  -10.759 -35.124 1.00 43.07  ? 279 ARG C C   1 
ATOM   7755  O O   . ARG C 1 279 ? 32.245  -11.559 -35.334 1.00 58.96  ? 279 ARG C O   1 
ATOM   7756  C CB  . ARG C 1 279 ? 32.172  -8.408  -35.263 1.00 58.27  ? 279 ARG C CB  1 
ATOM   7757  C CG  . ARG C 1 279 ? 31.950  -8.346  -33.768 1.00 64.99  ? 279 ARG C CG  1 
ATOM   7758  C CD  . ARG C 1 279 ? 30.619  -7.614  -33.576 1.00 79.92  ? 279 ARG C CD  1 
ATOM   7759  N NE  . ARG C 1 279 ? 29.883  -7.955  -32.363 1.00 111.22 ? 279 ARG C NE  1 
ATOM   7760  C CZ  . ARG C 1 279 ? 28.874  -7.230  -31.887 1.00 109.36 ? 279 ARG C CZ  1 
ATOM   7761  N NH1 . ARG C 1 279 ? 28.489  -6.131  -32.523 1.00 97.94  ? 279 ARG C NH1 1 
ATOM   7762  N NH2 . ARG C 1 279 ? 28.246  -7.599  -30.779 1.00 107.71 ? 279 ARG C NH2 1 
ATOM   7763  N N   . LYS C 1 280 ? 34.167  -11.021 -34.298 1.00 43.27  ? 280 LYS C N   1 
ATOM   7764  C CA  . LYS C 1 280 ? 34.209  -12.275 -33.550 1.00 42.60  ? 280 LYS C CA  1 
ATOM   7765  C C   . LYS C 1 280 ? 34.839  -12.139 -32.165 1.00 42.19  ? 280 LYS C C   1 
ATOM   7766  O O   . LYS C 1 280 ? 35.761  -11.348 -31.960 1.00 34.43  ? 280 LYS C O   1 
ATOM   7767  C CB  . LYS C 1 280 ? 34.961  -13.345 -34.347 1.00 37.51  ? 280 LYS C CB  1 
ATOM   7768  C CG  . LYS C 1 280 ? 34.607  -14.762 -33.927 1.00 41.26  ? 280 LYS C CG  1 
ATOM   7769  C CD  . LYS C 1 280 ? 35.679  -15.765 -34.306 1.00 43.39  ? 280 LYS C CD  1 
ATOM   7770  C CE  . LYS C 1 280 ? 35.476  -17.077 -33.560 1.00 42.23  ? 280 LYS C CE  1 
ATOM   7771  N NZ  . LYS C 1 280 ? 34.079  -17.585 -33.681 1.00 44.61  ? 280 LYS C NZ  1 
ATOM   7772  N N   . ALA C 1 281 ? 34.333  -12.931 -31.224 1.00 55.39  ? 281 ALA C N   1 
ATOM   7773  C CA  . ALA C 1 281 ? 34.833  -12.937 -29.855 1.00 44.96  ? 281 ALA C CA  1 
ATOM   7774  C C   . ALA C 1 281 ? 34.783  -14.340 -29.256 1.00 50.34  ? 281 ALA C C   1 
ATOM   7775  O O   . ALA C 1 281 ? 33.809  -15.068 -29.446 1.00 62.15  ? 281 ALA C O   1 
ATOM   7776  C CB  . ALA C 1 281 ? 34.034  -11.972 -29.001 1.00 41.41  ? 281 ALA C CB  1 
ATOM   7777  N N   . GLY C 1 282 ? 35.835  -14.716 -28.535 1.00 44.40  ? 282 GLY C N   1 
ATOM   7778  C CA  . GLY C 1 282 ? 35.869  -15.996 -27.851 1.00 39.46  ? 282 GLY C CA  1 
ATOM   7779  C C   . GLY C 1 282 ? 37.187  -16.253 -27.146 1.00 43.34  ? 282 GLY C C   1 
ATOM   7780  O O   . GLY C 1 282 ? 38.125  -15.464 -27.260 1.00 44.25  ? 282 GLY C O   1 
ATOM   7781  N N   . TYR C 1 283 ? 37.260  -17.361 -26.414 1.00 40.63  ? 283 TYR C N   1 
ATOM   7782  C CA  . TYR C 1 283 ? 38.477  -17.715 -25.691 1.00 37.20  ? 283 TYR C CA  1 
ATOM   7783  C C   . TYR C 1 283 ? 39.469  -18.470 -26.570 1.00 45.00  ? 283 TYR C C   1 
ATOM   7784  O O   . TYR C 1 283 ? 39.090  -19.346 -27.348 1.00 54.02  ? 283 TYR C O   1 
ATOM   7785  C CB  . TYR C 1 283 ? 38.147  -18.555 -24.456 1.00 48.58  ? 283 TYR C CB  1 
ATOM   7786  C CG  . TYR C 1 283 ? 37.659  -17.752 -23.271 1.00 58.00  ? 283 TYR C CG  1 
ATOM   7787  C CD1 . TYR C 1 283 ? 38.556  -17.124 -22.416 1.00 41.14  ? 283 TYR C CD1 1 
ATOM   7788  C CD2 . TYR C 1 283 ? 36.302  -17.633 -23.000 1.00 44.40  ? 283 TYR C CD2 1 
ATOM   7789  C CE1 . TYR C 1 283 ? 38.114  -16.391 -21.330 1.00 42.37  ? 283 TYR C CE1 1 
ATOM   7790  C CE2 . TYR C 1 283 ? 35.851  -16.904 -21.916 1.00 43.54  ? 283 TYR C CE2 1 
ATOM   7791  C CZ  . TYR C 1 283 ? 36.761  -16.285 -21.084 1.00 54.04  ? 283 TYR C CZ  1 
ATOM   7792  O OH  . TYR C 1 283 ? 36.315  -15.559 -20.003 1.00 57.37  ? 283 TYR C OH  1 
ATOM   7793  N N   . LEU C 1 284 ? 40.745  -18.125 -26.431 1.00 43.35  ? 284 LEU C N   1 
ATOM   7794  C CA  . LEU C 1 284 ? 41.817  -18.786 -27.165 1.00 47.34  ? 284 LEU C CA  1 
ATOM   7795  C C   . LEU C 1 284 ? 43.023  -18.989 -26.258 1.00 58.79  ? 284 LEU C C   1 
ATOM   7796  O O   . LEU C 1 284 ? 43.187  -18.282 -25.264 1.00 46.31  ? 284 LEU C O   1 
ATOM   7797  C CB  . LEU C 1 284 ? 42.226  -17.969 -28.394 1.00 40.39  ? 284 LEU C CB  1 
ATOM   7798  C CG  . LEU C 1 284 ? 41.198  -17.732 -29.501 1.00 51.28  ? 284 LEU C CG  1 
ATOM   7799  C CD1 . LEU C 1 284 ? 41.777  -16.813 -30.565 1.00 41.80  ? 284 LEU C CD1 1 
ATOM   7800  C CD2 . LEU C 1 284 ? 40.749  -19.045 -30.115 1.00 43.02  ? 284 LEU C CD2 1 
ATOM   7801  N N   . ASN C 1 285 ? 43.871  -19.950 -26.606 1.00 55.60  ? 285 ASN C N   1 
ATOM   7802  C CA  . ASN C 1 285 ? 45.113  -20.156 -25.876 1.00 52.54  ? 285 ASN C CA  1 
ATOM   7803  C C   . ASN C 1 285 ? 46.278  -19.568 -26.657 1.00 57.06  ? 285 ASN C C   1 
ATOM   7804  O O   . ASN C 1 285 ? 46.352  -19.704 -27.878 1.00 64.19  ? 285 ASN C O   1 
ATOM   7805  C CB  . ASN C 1 285 ? 45.345  -21.642 -25.597 1.00 62.18  ? 285 ASN C CB  1 
ATOM   7806  C CG  . ASN C 1 285 ? 44.200  -22.277 -24.833 1.00 64.01  ? 285 ASN C CG  1 
ATOM   7807  O OD1 . ASN C 1 285 ? 43.765  -21.761 -23.802 1.00 63.35  ? 285 ASN C OD1 1 
ATOM   7808  N ND2 . ASN C 1 285 ? 43.706  -23.403 -25.334 1.00 59.91  ? 285 ASN C ND2 1 
ATOM   7809  N N   . ALA C 1 286 ? 47.191  -18.918 -25.946 1.00 47.19  ? 286 ALA C N   1 
ATOM   7810  C CA  . ALA C 1 286 ? 48.295  -18.212 -26.580 1.00 58.18  ? 286 ALA C CA  1 
ATOM   7811  C C   . ALA C 1 286 ? 49.635  -18.714 -26.073 1.00 68.30  ? 286 ALA C C   1 
ATOM   7812  O O   . ALA C 1 286 ? 49.857  -18.801 -24.867 1.00 75.89  ? 286 ALA C O   1 
ATOM   7813  C CB  . ALA C 1 286 ? 48.169  -16.717 -26.344 1.00 56.87  ? 286 ALA C CB  1 
ATOM   7814  N N   . ARG C 1 287 ? 50.535  -19.031 -26.998 1.00 70.84  ? 287 ARG C N   1 
ATOM   7815  C CA  . ARG C 1 287 ? 51.855  -19.512 -26.620 1.00 72.79  ? 287 ARG C CA  1 
ATOM   7816  C C   . ARG C 1 287 ? 52.728  -18.330 -26.226 1.00 79.46  ? 287 ARG C C   1 
ATOM   7817  O O   . ARG C 1 287 ? 52.952  -17.415 -27.018 1.00 78.58  ? 287 ARG C O   1 
ATOM   7818  C CB  . ARG C 1 287 ? 52.497  -20.296 -27.766 1.00 72.08  ? 287 ARG C CB  1 
ATOM   7819  N N   . ASN C 1 288 ? 53.226  -18.367 -24.994 1.00 86.65  ? 288 ASN C N   1 
ATOM   7820  C CA  . ASN C 1 288 ? 54.072  -17.305 -24.465 1.00 86.88  ? 288 ASN C CA  1 
ATOM   7821  C C   . ASN C 1 288 ? 55.308  -17.860 -23.768 1.00 80.46  ? 288 ASN C C   1 
ATOM   7822  O O   . ASN C 1 288 ? 56.099  -17.110 -23.199 1.00 91.67  ? 288 ASN C O   1 
ATOM   7823  C CB  . ASN C 1 288 ? 53.277  -16.431 -23.490 1.00 89.72  ? 288 ASN C CB  1 
ATOM   7824  C CG  . ASN C 1 288 ? 52.183  -15.632 -24.175 1.00 88.43  ? 288 ASN C CG  1 
ATOM   7825  O OD1 . ASN C 1 288 ? 52.293  -15.286 -25.351 1.00 106.00 ? 288 ASN C OD1 1 
ATOM   7826  N ND2 . ASN C 1 288 ? 51.116  -15.340 -23.440 1.00 72.77  ? 288 ASN C ND2 1 
ATOM   7827  N N   . SER C 1 295 ? 57.877  -20.736 -21.668 1.00 83.78  ? 295 SER C N   1 
ATOM   7828  C CA  . SER C 1 295 ? 56.942  -20.990 -22.757 1.00 105.88 ? 295 SER C CA  1 
ATOM   7829  C C   . SER C 1 295 ? 55.658  -21.647 -22.266 1.00 106.53 ? 295 SER C C   1 
ATOM   7830  O O   . SER C 1 295 ? 55.521  -22.870 -22.309 1.00 95.71  ? 295 SER C O   1 
ATOM   7831  C CB  . SER C 1 295 ? 57.597  -21.869 -23.822 1.00 96.51  ? 295 SER C CB  1 
ATOM   7832  O OG  . SER C 1 295 ? 56.624  -22.641 -24.501 1.00 109.24 ? 295 SER C OG  1 
ATOM   7833  N N   . THR C 1 296 ? 54.716  -20.827 -21.811 1.00 99.63  ? 296 THR C N   1 
ATOM   7834  C CA  . THR C 1 296 ? 53.431  -21.327 -21.344 1.00 90.04  ? 296 THR C CA  1 
ATOM   7835  C C   . THR C 1 296 ? 52.322  -21.051 -22.354 1.00 83.01  ? 296 THR C C   1 
ATOM   7836  O O   . THR C 1 296 ? 52.548  -20.406 -23.377 1.00 83.88  ? 296 THR C O   1 
ATOM   7837  C CB  . THR C 1 296 ? 53.044  -20.699 -19.992 1.00 91.82  ? 296 THR C CB  1 
ATOM   7838  O OG1 . THR C 1 296 ? 52.696  -19.323 -20.191 1.00 90.97  ? 296 THR C OG1 1 
ATOM   7839  C CG2 . THR C 1 296 ? 54.203  -20.786 -19.014 1.00 90.76  ? 296 THR C CG2 1 
ATOM   7840  N N   . TRP C 1 297 ? 51.122  -21.534 -22.046 1.00 83.69  ? 297 TRP C N   1 
ATOM   7841  C CA  . TRP C 1 297 ? 49.940  -21.266 -22.857 1.00 70.36  ? 297 TRP C CA  1 
ATOM   7842  C C   . TRP C 1 297 ? 48.827  -20.700 -21.987 1.00 78.61  ? 297 TRP C C   1 
ATOM   7843  O O   . TRP C 1 297 ? 48.269  -21.403 -21.144 1.00 85.46  ? 297 TRP C O   1 
ATOM   7844  C CB  . TRP C 1 297 ? 49.459  -22.533 -23.567 1.00 68.14  ? 297 TRP C CB  1 
ATOM   7845  C CG  . TRP C 1 297 ? 50.342  -22.995 -24.687 1.00 84.17  ? 297 TRP C CG  1 
ATOM   7846  C CD1 . TRP C 1 297 ? 51.584  -23.550 -24.583 1.00 85.96  ? 297 TRP C CD1 1 
ATOM   7847  C CD2 . TRP C 1 297 ? 50.036  -22.955 -26.085 1.00 83.40  ? 297 TRP C CD2 1 
ATOM   7848  N NE1 . TRP C 1 297 ? 52.073  -23.851 -25.832 1.00 90.85  ? 297 TRP C NE1 1 
ATOM   7849  C CE2 . TRP C 1 297 ? 51.140  -23.495 -26.772 1.00 85.38  ? 297 TRP C CE2 1 
ATOM   7850  C CE3 . TRP C 1 297 ? 48.934  -22.511 -26.825 1.00 79.17  ? 297 TRP C CE3 1 
ATOM   7851  C CZ2 . TRP C 1 297 ? 51.177  -23.603 -28.161 1.00 79.46  ? 297 TRP C CZ2 1 
ATOM   7852  C CZ3 . TRP C 1 297 ? 48.972  -22.618 -28.202 1.00 88.05  ? 297 TRP C CZ3 1 
ATOM   7853  C CH2 . TRP C 1 297 ? 50.085  -23.160 -28.857 1.00 73.82  ? 297 TRP C CH2 1 
ATOM   7854  N N   . ASP C 1 298 ? 48.508  -19.427 -22.193 1.00 74.13  ? 298 ASP C N   1 
ATOM   7855  C CA  . ASP C 1 298 ? 47.524  -18.746 -21.363 1.00 79.27  ? 298 ASP C CA  1 
ATOM   7856  C C   . ASP C 1 298 ? 46.179  -18.602 -22.063 1.00 64.79  ? 298 ASP C C   1 
ATOM   7857  O O   . ASP C 1 298 ? 46.101  -18.100 -23.184 1.00 53.86  ? 298 ASP C O   1 
ATOM   7858  C CB  . ASP C 1 298 ? 48.046  -17.369 -20.951 1.00 93.67  ? 298 ASP C CB  1 
ATOM   7859  C CG  . ASP C 1 298 ? 49.465  -17.422 -20.424 1.00 99.29  ? 298 ASP C CG  1 
ATOM   7860  O OD1 . ASP C 1 298 ? 50.393  -17.622 -21.235 1.00 98.21  ? 298 ASP C OD1 1 
ATOM   7861  O OD2 . ASP C 1 298 ? 49.651  -17.263 -19.199 1.00 94.38  ? 298 ASP C OD2 1 
ATOM   7862  N N   . ARG C 1 299 ? 45.121  -19.046 -21.394 1.00 70.99  ? 299 ARG C N   1 
ATOM   7863  C CA  . ARG C 1 299 ? 43.772  -18.864 -21.905 1.00 54.52  ? 299 ARG C CA  1 
ATOM   7864  C C   . ARG C 1 299 ? 43.284  -17.451 -21.614 1.00 49.85  ? 299 ARG C C   1 
ATOM   7865  O O   . ARG C 1 299 ? 43.278  -17.010 -20.465 1.00 72.00  ? 299 ARG C O   1 
ATOM   7866  C CB  . ARG C 1 299 ? 42.820  -19.894 -21.296 1.00 43.87  ? 299 ARG C CB  1 
ATOM   7867  C CG  . ARG C 1 299 ? 41.376  -19.752 -21.745 1.00 48.27  ? 299 ARG C CG  1 
ATOM   7868  C CD  . ARG C 1 299 ? 40.606  -21.039 -21.510 1.00 52.30  ? 299 ARG C CD  1 
ATOM   7869  N NE  . ARG C 1 299 ? 39.227  -20.952 -21.980 1.00 50.76  ? 299 ARG C NE  1 
ATOM   7870  C CZ  . ARG C 1 299 ? 38.204  -20.589 -21.216 1.00 60.49  ? 299 ARG C CZ  1 
ATOM   7871  N NH1 . ARG C 1 299 ? 38.409  -20.279 -19.944 1.00 63.87  ? 299 ARG C NH1 1 
ATOM   7872  N NH2 . ARG C 1 299 ? 36.978  -20.536 -21.720 1.00 62.01  ? 299 ARG C NH2 1 
ATOM   7873  N N   . GLN C 1 300 ? 42.876  -16.745 -22.661 1.00 48.76  ? 300 GLN C N   1 
ATOM   7874  C CA  . GLN C 1 300 ? 42.343  -15.396 -22.523 1.00 50.94  ? 300 GLN C CA  1 
ATOM   7875  C C   . GLN C 1 300 ? 41.190  -15.206 -23.495 1.00 45.70  ? 300 GLN C C   1 
ATOM   7876  O O   . GLN C 1 300 ? 41.042  -15.967 -24.450 1.00 51.89  ? 300 GLN C O   1 
ATOM   7877  C CB  . GLN C 1 300 ? 43.429  -14.344 -22.766 1.00 43.63  ? 300 GLN C CB  1 
ATOM   7878  C CG  . GLN C 1 300 ? 44.459  -14.240 -21.650 1.00 62.57  ? 300 GLN C CG  1 
ATOM   7879  C CD  . GLN C 1 300 ? 45.327  -13.002 -21.768 1.00 69.23  ? 300 GLN C CD  1 
ATOM   7880  O OE1 . GLN C 1 300 ? 45.131  -12.174 -22.657 1.00 56.42  ? 300 GLN C OE1 1 
ATOM   7881  N NE2 . GLN C 1 300 ? 46.290  -12.867 -20.863 1.00 71.54  ? 300 GLN C NE2 1 
ATOM   7882  N N   . PHE C 1 301 ? 40.372  -14.190 -23.251 1.00 47.23  ? 301 PHE C N   1 
ATOM   7883  C CA  . PHE C 1 301 ? 39.252  -13.900 -24.134 1.00 45.38  ? 301 PHE C CA  1 
ATOM   7884  C C   . PHE C 1 301 ? 39.670  -12.926 -25.225 1.00 46.38  ? 301 PHE C C   1 
ATOM   7885  O O   . PHE C 1 301 ? 40.006  -11.776 -24.948 1.00 45.47  ? 301 PHE C O   1 
ATOM   7886  C CB  . PHE C 1 301 ? 38.081  -13.327 -23.338 1.00 35.13  ? 301 PHE C CB  1 
ATOM   7887  C CG  . PHE C 1 301 ? 36.828  -13.139 -24.145 1.00 28.78  ? 301 PHE C CG  1 
ATOM   7888  C CD1 . PHE C 1 301 ? 35.978  -14.204 -24.392 1.00 30.71  ? 301 PHE C CD1 1 
ATOM   7889  C CD2 . PHE C 1 301 ? 36.496  -11.893 -24.652 1.00 31.34  ? 301 PHE C CD2 1 
ATOM   7890  C CE1 . PHE C 1 301 ? 34.822  -14.030 -25.131 1.00 30.81  ? 301 PHE C CE1 1 
ATOM   7891  C CE2 . PHE C 1 301 ? 35.343  -11.713 -25.393 1.00 40.46  ? 301 PHE C CE2 1 
ATOM   7892  C CZ  . PHE C 1 301 ? 34.505  -12.783 -25.631 1.00 32.45  ? 301 PHE C CZ  1 
ATOM   7893  N N   . TYR C 1 302 ? 39.639  -13.392 -26.468 1.00 45.51  ? 302 TYR C N   1 
ATOM   7894  C CA  . TYR C 1 302 ? 39.996  -12.550 -27.600 1.00 44.99  ? 302 TYR C CA  1 
ATOM   7895  C C   . TYR C 1 302 ? 38.743  -12.031 -28.287 1.00 46.12  ? 302 TYR C C   1 
ATOM   7896  O O   . TYR C 1 302 ? 37.751  -12.747 -28.416 1.00 47.29  ? 302 TYR C O   1 
ATOM   7897  C CB  . TYR C 1 302 ? 40.866  -13.319 -28.596 1.00 40.39  ? 302 TYR C CB  1 
ATOM   7898  C CG  . TYR C 1 302 ? 42.287  -13.539 -28.129 1.00 40.03  ? 302 TYR C CG  1 
ATOM   7899  C CD1 . TYR C 1 302 ? 42.587  -14.521 -27.194 1.00 43.76  ? 302 TYR C CD1 1 
ATOM   7900  C CD2 . TYR C 1 302 ? 43.329  -12.766 -28.624 1.00 39.20  ? 302 TYR C CD2 1 
ATOM   7901  C CE1 . TYR C 1 302 ? 43.883  -14.726 -26.764 1.00 47.15  ? 302 TYR C CE1 1 
ATOM   7902  C CE2 . TYR C 1 302 ? 44.630  -12.963 -28.201 1.00 43.12  ? 302 TYR C CE2 1 
ATOM   7903  C CZ  . TYR C 1 302 ? 44.901  -13.944 -27.270 1.00 52.16  ? 302 TYR C CZ  1 
ATOM   7904  O OH  . TYR C 1 302 ? 46.193  -14.146 -26.843 1.00 57.79  ? 302 TYR C OH  1 
ATOM   7905  N N   . PHE C 1 303 ? 38.794  -10.779 -28.724 1.00 40.01  ? 303 PHE C N   1 
ATOM   7906  C CA  . PHE C 1 303 ? 37.680  -10.184 -29.445 1.00 42.72  ? 303 PHE C CA  1 
ATOM   7907  C C   . PHE C 1 303 ? 38.166  -9.096  -30.389 1.00 46.44  ? 303 PHE C C   1 
ATOM   7908  O O   . PHE C 1 303 ? 39.126  -8.384  -30.092 1.00 38.38  ? 303 PHE C O   1 
ATOM   7909  C CB  . PHE C 1 303 ? 36.639  -9.626  -28.466 1.00 42.29  ? 303 PHE C CB  1 
ATOM   7910  C CG  . PHE C 1 303 ? 37.179  -8.600  -27.506 1.00 42.97  ? 303 PHE C CG  1 
ATOM   7911  C CD1 . PHE C 1 303 ? 37.842  -8.993  -26.354 1.00 46.22  ? 303 PHE C CD1 1 
ATOM   7912  C CD2 . PHE C 1 303 ? 37.001  -7.246  -27.741 1.00 44.32  ? 303 PHE C CD2 1 
ATOM   7913  C CE1 . PHE C 1 303 ? 38.334  -8.058  -25.464 1.00 38.29  ? 303 PHE C CE1 1 
ATOM   7914  C CE2 . PHE C 1 303 ? 37.488  -6.304  -26.852 1.00 49.39  ? 303 PHE C CE2 1 
ATOM   7915  C CZ  . PHE C 1 303 ? 38.156  -6.712  -25.712 1.00 43.79  ? 303 PHE C CZ  1 
ATOM   7916  N N   . THR C 1 304 ? 37.497  -8.977  -31.530 1.00 57.14  ? 304 THR C N   1 
ATOM   7917  C CA  . THR C 1 304 ? 37.825  -7.940  -32.494 1.00 52.20  ? 304 THR C CA  1 
ATOM   7918  C C   . THR C 1 304 ? 37.104  -6.657  -32.126 1.00 58.08  ? 304 THR C C   1 
ATOM   7919  O O   . THR C 1 304 ? 35.915  -6.671  -31.809 1.00 73.73  ? 304 THR C O   1 
ATOM   7920  C CB  . THR C 1 304 ? 37.440  -8.347  -33.927 1.00 60.13  ? 304 THR C CB  1 
ATOM   7921  O OG1 . THR C 1 304 ? 36.014  -8.309  -34.072 1.00 62.92  ? 304 THR C OG1 1 
ATOM   7922  C CG2 . THR C 1 304 ? 37.943  -9.749  -34.236 1.00 40.53  ? 304 THR C CG2 1 
ATOM   7923  N N   . GLN C 1 305 ? 37.827  -5.546  -32.164 1.00 47.27  ? 305 GLN C N   1 
ATOM   7924  C CA  . GLN C 1 305 ? 37.211  -4.255  -31.931 1.00 46.20  ? 305 GLN C CA  1 
ATOM   7925  C C   . GLN C 1 305 ? 37.780  -3.277  -32.945 1.00 54.41  ? 305 GLN C C   1 
ATOM   7926  O O   . GLN C 1 305 ? 38.971  -2.967  -32.916 1.00 55.59  ? 305 GLN C O   1 
ATOM   7927  C CB  . GLN C 1 305 ? 37.478  -3.802  -30.498 1.00 51.80  ? 305 GLN C CB  1 
ATOM   7928  C CG  . GLN C 1 305 ? 36.244  -3.366  -29.738 1.00 76.97  ? 305 GLN C CG  1 
ATOM   7929  C CD  . GLN C 1 305 ? 36.561  -2.985  -28.308 1.00 83.48  ? 305 GLN C CD  1 
ATOM   7930  O OE1 . GLN C 1 305 ? 37.726  -2.892  -27.922 1.00 86.31  ? 305 GLN C OE1 1 
ATOM   7931  N NE2 . GLN C 1 305 ? 35.522  -2.803  -27.501 1.00 98.72  ? 305 GLN C NE2 1 
ATOM   7932  N N   . GLY C 1 306 ? 36.926  -2.780  -33.833 1.00 48.72  ? 306 GLY C N   1 
ATOM   7933  C CA  . GLY C 1 306 ? 37.402  -2.008  -34.963 1.00 49.09  ? 306 GLY C CA  1 
ATOM   7934  C C   . GLY C 1 306 ? 38.329  -2.869  -35.800 1.00 64.20  ? 306 GLY C C   1 
ATOM   7935  O O   . GLY C 1 306 ? 37.965  -3.972  -36.215 1.00 60.54  ? 306 GLY C O   1 
ATOM   7936  N N   . GLY C 1 307 ? 39.536  -2.367  -36.038 1.00 39.76  ? 307 GLY C N   1 
ATOM   7937  C CA  . GLY C 1 307 ? 40.530  -3.092  -36.807 1.00 50.43  ? 307 GLY C CA  1 
ATOM   7938  C C   . GLY C 1 307 ? 41.580  -3.729  -35.918 1.00 52.25  ? 307 GLY C C   1 
ATOM   7939  O O   . GLY C 1 307 ? 42.688  -4.025  -36.363 1.00 57.91  ? 307 GLY C O   1 
ATOM   7940  N N   . ASN C 1 308 ? 41.229  -3.939  -34.653 1.00 55.86  ? 308 ASN C N   1 
ATOM   7941  C CA  . ASN C 1 308 ? 42.161  -4.508  -33.688 1.00 51.30  ? 308 ASN C CA  1 
ATOM   7942  C C   . ASN C 1 308 ? 41.698  -5.838  -33.113 1.00 47.29  ? 308 ASN C C   1 
ATOM   7943  O O   . ASN C 1 308 ? 40.504  -6.065  -32.919 1.00 57.71  ? 308 ASN C O   1 
ATOM   7944  C CB  . ASN C 1 308 ? 42.397  -3.528  -32.536 1.00 40.67  ? 308 ASN C CB  1 
ATOM   7945  C CG  . ASN C 1 308 ? 43.022  -2.227  -32.991 1.00 51.47  ? 308 ASN C CG  1 
ATOM   7946  O OD1 . ASN C 1 308 ? 43.937  -2.219  -33.813 1.00 71.15  ? 308 ASN C OD1 1 
ATOM   7947  N ND2 . ASN C 1 308 ? 42.534  -1.116  -32.451 1.00 69.93  ? 308 ASN C ND2 1 
ATOM   7948  N N   . LEU C 1 309 ? 42.656  -6.714  -32.836 1.00 51.48  ? 309 LEU C N   1 
ATOM   7949  C CA  . LEU C 1 309 ? 42.382  -7.910  -32.059 1.00 49.38  ? 309 LEU C CA  1 
ATOM   7950  C C   . LEU C 1 309 ? 42.767  -7.622  -30.618 1.00 41.99  ? 309 LEU C C   1 
ATOM   7951  O O   . LEU C 1 309 ? 43.943  -7.403  -30.307 1.00 42.05  ? 309 LEU C O   1 
ATOM   7952  C CB  . LEU C 1 309 ? 43.146  -9.120  -32.598 1.00 37.66  ? 309 LEU C CB  1 
ATOM   7953  C CG  . LEU C 1 309 ? 42.939  -10.421 -31.818 1.00 41.02  ? 309 LEU C CG  1 
ATOM   7954  C CD1 . LEU C 1 309 ? 41.467  -10.807 -31.786 1.00 28.06  ? 309 LEU C CD1 1 
ATOM   7955  C CD2 . LEU C 1 309 ? 43.775  -11.543 -32.410 1.00 39.11  ? 309 LEU C CD2 1 
ATOM   7956  N N   . MET C 1 310 ? 41.756  -7.605  -29.757 1.00 46.43  ? 310 MET C N   1 
ATOM   7957  C CA  . MET C 1 310 ? 41.916  -7.291  -28.345 1.00 55.57  ? 310 MET C CA  1 
ATOM   7958  C C   . MET C 1 310 ? 41.802  -8.565  -27.523 1.00 47.27  ? 310 MET C C   1 
ATOM   7959  O O   . MET C 1 310 ? 41.091  -9.492  -27.908 1.00 41.09  ? 310 MET C O   1 
ATOM   7960  C CB  . MET C 1 310 ? 40.855  -6.283  -27.895 1.00 41.37  ? 310 MET C CB  1 
ATOM   7961  C CG  . MET C 1 310 ? 40.726  -5.052  -28.779 1.00 43.60  ? 310 MET C CG  1 
ATOM   7962  S SD  . MET C 1 310 ? 42.132  -3.936  -28.651 1.00 65.18  ? 310 MET C SD  1 
ATOM   7963  C CE  . MET C 1 310 ? 41.975  -3.404  -26.947 1.00 57.52  ? 310 MET C CE  1 
ATOM   7964  N N   . SER C 1 311 ? 42.495  -8.614  -26.392 1.00 38.65  ? 311 SER C N   1 
ATOM   7965  C CA  . SER C 1 311 ? 42.367  -9.758  -25.503 1.00 44.49  ? 311 SER C CA  1 
ATOM   7966  C C   . SER C 1 311 ? 42.264  -9.328  -24.048 1.00 49.16  ? 311 SER C C   1 
ATOM   7967  O O   . SER C 1 311 ? 42.817  -8.304  -23.648 1.00 52.11  ? 311 SER C O   1 
ATOM   7968  C CB  . SER C 1 311 ? 43.551  -10.711 -25.680 1.00 48.67  ? 311 SER C CB  1 
ATOM   7969  O OG  . SER C 1 311 ? 44.759  -10.111 -25.246 1.00 74.40  ? 311 SER C OG  1 
ATOM   7970  N N   . GLN C 1 312 ? 41.549  -10.123 -23.261 1.00 54.26  ? 312 GLN C N   1 
ATOM   7971  C CA  . GLN C 1 312 ? 41.390  -9.851  -21.841 1.00 50.78  ? 312 GLN C CA  1 
ATOM   7972  C C   . GLN C 1 312 ? 41.385  -11.157 -21.061 1.00 46.65  ? 312 GLN C C   1 
ATOM   7973  O O   . GLN C 1 312 ? 40.584  -12.051 -21.335 1.00 37.09  ? 312 GLN C O   1 
ATOM   7974  C CB  . GLN C 1 312 ? 40.100  -9.065  -21.589 1.00 56.25  ? 312 GLN C CB  1 
ATOM   7975  C CG  . GLN C 1 312 ? 39.928  -8.568  -20.162 1.00 65.56  ? 312 GLN C CG  1 
ATOM   7976  C CD  . GLN C 1 312 ? 38.566  -7.940  -19.926 1.00 77.52  ? 312 GLN C CD  1 
ATOM   7977  O OE1 . GLN C 1 312 ? 37.792  -7.739  -20.863 1.00 77.54  ? 312 GLN C OE1 1 
ATOM   7978  N NE2 . GLN C 1 312 ? 38.268  -7.623  -18.671 1.00 77.87  ? 312 GLN C NE2 1 
ATOM   7979  N N   . ALA C 1 313 ? 42.284  -11.263 -20.089 1.00 58.88  ? 313 ALA C N   1 
ATOM   7980  C CA  . ALA C 1 313 ? 42.306  -12.411 -19.192 1.00 62.25  ? 313 ALA C CA  1 
ATOM   7981  C C   . ALA C 1 313 ? 41.069  -12.401 -18.304 1.00 60.77  ? 313 ALA C C   1 
ATOM   7982  O O   . ALA C 1 313 ? 40.665  -11.347 -17.814 1.00 50.41  ? 313 ALA C O   1 
ATOM   7983  C CB  . ALA C 1 313 ? 43.571  -12.406 -18.351 1.00 49.78  ? 313 ALA C CB  1 
ATOM   7984  N N   . ARG C 1 314 ? 40.463  -13.565 -18.097 1.00 59.85  ? 314 ARG C N   1 
ATOM   7985  C CA  . ARG C 1 314 ? 39.314  -13.641 -17.205 1.00 61.80  ? 314 ARG C CA  1 
ATOM   7986  C C   . ARG C 1 314 ? 39.737  -13.349 -15.773 1.00 79.49  ? 314 ARG C C   1 
ATOM   7987  O O   . ARG C 1 314 ? 40.709  -13.916 -15.274 1.00 77.92  ? 314 ARG C O   1 
ATOM   7988  C CB  . ARG C 1 314 ? 38.651  -15.015 -17.252 1.00 51.55  ? 314 ARG C CB  1 
ATOM   7989  C CG  . ARG C 1 314 ? 37.361  -15.049 -16.449 1.00 58.32  ? 314 ARG C CG  1 
ATOM   7990  C CD  . ARG C 1 314 ? 37.054  -16.432 -15.912 1.00 58.43  ? 314 ARG C CD  1 
ATOM   7991  N NE  . ARG C 1 314 ? 36.824  -17.420 -16.957 1.00 82.28  ? 314 ARG C NE  1 
ATOM   7992  C CZ  . ARG C 1 314 ? 36.892  -18.731 -16.757 1.00 86.33  ? 314 ARG C CZ  1 
ATOM   7993  N NH1 . ARG C 1 314 ? 36.664  -19.569 -17.757 1.00 80.65  ? 314 ARG C NH1 1 
ATOM   7994  N NH2 . ARG C 1 314 ? 37.194  -19.203 -15.555 1.00 49.88  ? 314 ARG C NH2 1 
ATOM   7995  N N   . GLY C 1 315 ? 39.006  -12.454 -15.118 1.00 83.59  ? 315 GLY C N   1 
ATOM   7996  C CA  . GLY C 1 315 ? 39.349  -12.033 -13.774 1.00 90.34  ? 315 GLY C CA  1 
ATOM   7997  C C   . GLY C 1 315 ? 40.408  -10.948 -13.742 1.00 80.54  ? 315 GLY C C   1 
ATOM   7998  O O   . GLY C 1 315 ? 41.112  -10.800 -12.745 1.00 97.82  ? 315 GLY C O   1 
ATOM   7999  N N   . ASP C 1 316 ? 40.478  -10.155 -14.808 1.00 71.24  ? 316 ASP C N   1 
ATOM   8000  C CA  . ASP C 1 316 ? 41.298  -8.943  -14.838 1.00 90.72  ? 316 ASP C CA  1 
ATOM   8001  C C   . ASP C 1 316 ? 40.434  -7.751  -15.233 1.00 91.96  ? 316 ASP C C   1 
ATOM   8002  O O   . ASP C 1 316 ? 39.315  -7.921  -15.712 1.00 86.60  ? 316 ASP C O   1 
ATOM   8003  C CB  . ASP C 1 316 ? 42.483  -9.080  -15.805 1.00 87.27  ? 316 ASP C CB  1 
ATOM   8004  C CG  . ASP C 1 316 ? 43.604  -9.958  -15.256 1.00 101.41 ? 316 ASP C CG  1 
ATOM   8005  O OD1 . ASP C 1 316 ? 43.418  -10.598 -14.200 1.00 113.27 ? 316 ASP C OD1 1 
ATOM   8006  O OD2 . ASP C 1 316 ? 44.687  -9.991  -15.882 1.00 86.23  ? 316 ASP C OD2 1 
ATOM   8007  N N   . VAL C 1 317 ? 40.953  -6.546  -15.018 1.00 102.89 ? 317 VAL C N   1 
ATOM   8008  C CA  . VAL C 1 317 ? 40.105  -5.355  -14.985 1.00 106.92 ? 317 VAL C CA  1 
ATOM   8009  C C   . VAL C 1 317 ? 39.806  -4.724  -16.341 1.00 110.39 ? 317 VAL C C   1 
ATOM   8010  O O   . VAL C 1 317 ? 38.785  -4.054  -16.506 1.00 115.68 ? 317 VAL C O   1 
ATOM   8011  C CB  . VAL C 1 317 ? 40.744  -4.252  -14.113 1.00 101.78 ? 317 VAL C CB  1 
ATOM   8012  C CG1 . VAL C 1 317 ? 39.673  -3.405  -13.446 1.00 101.25 ? 317 VAL C CG1 1 
ATOM   8013  C CG2 . VAL C 1 317 ? 41.677  -4.857  -13.072 1.00 79.92  ? 317 VAL C CG2 1 
ATOM   8014  N N   . ALA C 1 318 ? 40.680  -4.951  -17.314 1.00 98.35  ? 318 ALA C N   1 
ATOM   8015  C CA  . ALA C 1 318 ? 40.479  -4.412  -18.651 1.00 95.22  ? 318 ALA C CA  1 
ATOM   8016  C C   . ALA C 1 318 ? 41.216  -5.239  -19.689 1.00 101.52 ? 318 ALA C C   1 
ATOM   8017  O O   . ALA C 1 318 ? 42.089  -6.039  -19.353 1.00 95.74  ? 318 ALA C O   1 
ATOM   8018  C CB  . ALA C 1 318 ? 40.927  -2.957  -18.710 1.00 96.49  ? 318 ALA C CB  1 
ATOM   8019  N N   . GLY C 1 319 ? 40.857  -5.043  -20.952 1.00 96.16  ? 319 GLY C N   1 
ATOM   8020  C CA  . GLY C 1 319 ? 41.490  -5.762  -22.038 1.00 90.60  ? 319 GLY C CA  1 
ATOM   8021  C C   . GLY C 1 319 ? 42.801  -5.111  -22.434 1.00 89.10  ? 319 GLY C C   1 
ATOM   8022  O O   . GLY C 1 319 ? 43.343  -4.280  -21.702 1.00 95.97  ? 319 GLY C O   1 
ATOM   8023  N N   . GLY C 1 320 ? 43.316  -5.494  -23.596 1.00 76.50  ? 320 GLY C N   1 
ATOM   8024  C CA  . GLY C 1 320 ? 44.562  -4.944  -24.095 1.00 77.03  ? 320 GLY C CA  1 
ATOM   8025  C C   . GLY C 1 320 ? 44.734  -5.225  -25.572 1.00 71.62  ? 320 GLY C C   1 
ATOM   8026  O O   . GLY C 1 320 ? 44.148  -6.169  -26.105 1.00 59.18  ? 320 GLY C O   1 
ATOM   8027  N N   . LEU C 1 321 ? 45.534  -4.402  -26.241 1.00 66.87  ? 321 LEU C N   1 
ATOM   8028  C CA  . LEU C 1 321 ? 45.801  -4.609  -27.655 1.00 58.23  ? 321 LEU C CA  1 
ATOM   8029  C C   . LEU C 1 321 ? 46.642  -5.868  -27.820 1.00 64.31  ? 321 LEU C C   1 
ATOM   8030  O O   . LEU C 1 321 ? 47.728  -5.982  -27.251 1.00 77.56  ? 321 LEU C O   1 
ATOM   8031  C CB  . LEU C 1 321 ? 46.510  -3.387  -28.256 1.00 69.27  ? 321 LEU C CB  1 
ATOM   8032  C CG  . LEU C 1 321 ? 46.628  -3.213  -29.778 1.00 56.76  ? 321 LEU C CG  1 
ATOM   8033  C CD1 . LEU C 1 321 ? 47.667  -4.131  -30.414 1.00 52.88  ? 321 LEU C CD1 1 
ATOM   8034  C CD2 . LEU C 1 321 ? 45.273  -3.416  -30.432 1.00 55.47  ? 321 LEU C CD2 1 
ATOM   8035  N N   . ALA C 1 322 ? 46.132  -6.810  -28.604 1.00 56.97  ? 322 ALA C N   1 
ATOM   8036  C CA  . ALA C 1 322 ? 46.870  -8.020  -28.930 1.00 60.70  ? 322 ALA C CA  1 
ATOM   8037  C C   . ALA C 1 322 ? 47.539  -7.819  -30.279 1.00 65.81  ? 322 ALA C C   1 
ATOM   8038  O O   . ALA C 1 322 ? 48.763  -7.888  -30.391 1.00 62.12  ? 322 ALA C O   1 
ATOM   8039  C CB  . ALA C 1 322 ? 45.962  -9.241  -28.943 1.00 52.24  ? 322 ALA C CB  1 
ATOM   8040  N N   . MET C 1 323 ? 46.733  -7.567  -31.305 1.00 53.84  ? 323 MET C N   1 
ATOM   8041  C CA  . MET C 1 323 ? 47.283  -7.338  -32.639 1.00 58.53  ? 323 MET C CA  1 
ATOM   8042  C C   . MET C 1 323 ? 46.559  -6.237  -33.396 1.00 56.97  ? 323 MET C C   1 
ATOM   8043  O O   . MET C 1 323 ? 45.410  -5.922  -33.099 1.00 55.09  ? 323 MET C O   1 
ATOM   8044  C CB  . MET C 1 323 ? 47.237  -8.626  -33.459 1.00 54.74  ? 323 MET C CB  1 
ATOM   8045  C CG  . MET C 1 323 ? 48.485  -9.469  -33.349 1.00 51.62  ? 323 MET C CG  1 
ATOM   8046  S SD  . MET C 1 323 ? 49.904  -8.740  -34.188 1.00 71.10  ? 323 MET C SD  1 
ATOM   8047  C CE  . MET C 1 323 ? 49.546  -9.164  -35.891 1.00 54.40  ? 323 MET C CE  1 
ATOM   8048  N N   . ASP C 1 324 ? 47.245  -5.638  -34.364 1.00 59.72  ? 324 ASP C N   1 
ATOM   8049  C CA  . ASP C 1 324 ? 46.580  -4.729  -35.283 1.00 56.09  ? 324 ASP C CA  1 
ATOM   8050  C C   . ASP C 1 324 ? 46.326  -5.493  -36.577 1.00 61.05  ? 324 ASP C C   1 
ATOM   8051  O O   . ASP C 1 324 ? 47.238  -5.726  -37.371 1.00 73.63  ? 324 ASP C O   1 
ATOM   8052  C CB  . ASP C 1 324 ? 47.430  -3.483  -35.532 1.00 64.75  ? 324 ASP C CB  1 
ATOM   8053  C CG  . ASP C 1 324 ? 46.712  -2.446  -36.366 1.00 76.45  ? 324 ASP C CG  1 
ATOM   8054  O OD1 . ASP C 1 324 ? 45.478  -2.321  -36.221 1.00 79.83  ? 324 ASP C OD1 1 
ATOM   8055  O OD2 . ASP C 1 324 ? 47.380  -1.754  -37.164 1.00 63.22  ? 324 ASP C OD2 1 
ATOM   8056  N N   . ILE C 1 325 ? 45.071  -5.877  -36.776 1.00 52.06  ? 325 ILE C N   1 
ATOM   8057  C CA  . ILE C 1 325 ? 44.702  -6.773  -37.866 1.00 49.55  ? 325 ILE C CA  1 
ATOM   8058  C C   . ILE C 1 325 ? 44.105  -6.085  -39.092 1.00 46.23  ? 325 ILE C C   1 
ATOM   8059  O O   . ILE C 1 325 ? 43.586  -6.762  -39.974 1.00 62.11  ? 325 ILE C O   1 
ATOM   8060  C CB  . ILE C 1 325 ? 43.728  -7.865  -37.374 1.00 46.31  ? 325 ILE C CB  1 
ATOM   8061  C CG1 . ILE C 1 325 ? 42.490  -7.248  -36.725 1.00 49.62  ? 325 ILE C CG1 1 
ATOM   8062  C CG2 . ILE C 1 325 ? 44.430  -8.794  -36.394 1.00 42.17  ? 325 ILE C CG2 1 
ATOM   8063  C CD1 . ILE C 1 325 ? 41.320  -8.204  -36.637 1.00 34.85  ? 325 ILE C CD1 1 
ATOM   8064  N N   . ASP C 1 326 ? 44.154  -4.757  -39.157 1.00 44.72  ? 326 ASP C N   1 
ATOM   8065  C CA  . ASP C 1 326 ? 43.457  -4.064  -40.238 1.00 73.14  ? 326 ASP C CA  1 
ATOM   8066  C C   . ASP C 1 326 ? 44.221  -4.187  -41.555 1.00 68.54  ? 326 ASP C C   1 
ATOM   8067  O O   . ASP C 1 326 ? 43.644  -4.034  -42.631 1.00 63.08  ? 326 ASP C O   1 
ATOM   8068  C CB  . ASP C 1 326 ? 43.240  -2.587  -39.892 1.00 79.57  ? 326 ASP C CB  1 
ATOM   8069  C CG  . ASP C 1 326 ? 44.523  -1.777  -39.935 1.00 80.53  ? 326 ASP C CG  1 
ATOM   8070  O OD1 . ASP C 1 326 ? 44.903  -1.315  -41.032 1.00 106.89 ? 326 ASP C OD1 1 
ATOM   8071  O OD2 . ASP C 1 326 ? 45.148  -1.593  -38.872 1.00 75.79  ? 326 ASP C OD2 1 
ATOM   8072  N N   . ASN C 1 327 ? 45.518  -4.464  -41.466 1.00 73.04  ? 327 ASN C N   1 
ATOM   8073  C CA  . ASN C 1 327 ? 46.291  -4.857  -42.638 1.00 57.77  ? 327 ASN C CA  1 
ATOM   8074  C C   . ASN C 1 327 ? 47.187  -6.034  -42.270 1.00 57.52  ? 327 ASN C C   1 
ATOM   8075  O O   . ASN C 1 327 ? 48.191  -5.857  -41.579 1.00 67.71  ? 327 ASN C O   1 
ATOM   8076  C CB  . ASN C 1 327 ? 47.124  -3.676  -43.147 1.00 59.59  ? 327 ASN C CB  1 
ATOM   8077  C CG  . ASN C 1 327 ? 47.837  -3.975  -44.454 1.00 58.35  ? 327 ASN C CG  1 
ATOM   8078  O OD1 . ASN C 1 327 ? 47.698  -5.057  -45.023 1.00 57.96  ? 327 ASN C OD1 1 
ATOM   8079  N ND2 . ASN C 1 327 ? 48.610  -3.008  -44.936 1.00 68.04  ? 327 ASN C ND2 1 
ATOM   8080  N N   . CYS C 1 328 ? 46.839  -7.225  -42.752 1.00 49.60  ? 328 CYS C N   1 
ATOM   8081  C CA  . CYS C 1 328 ? 47.575  -8.431  -42.380 1.00 42.46  ? 328 CYS C CA  1 
ATOM   8082  C C   . CYS C 1 328 ? 47.191  -9.669  -43.186 1.00 45.23  ? 328 CYS C C   1 
ATOM   8083  O O   . CYS C 1 328 ? 46.331  -9.623  -44.066 1.00 65.40  ? 328 CYS C O   1 
ATOM   8084  C CB  . CYS C 1 328 ? 47.375  -8.733  -40.892 1.00 49.29  ? 328 CYS C CB  1 
ATOM   8085  S SG  . CYS C 1 328 ? 45.708  -9.277  -40.471 1.00 52.19  ? 328 CYS C SG  1 
ATOM   8086  N N   . SER C 1 329 ? 47.851  -10.775 -42.859 1.00 36.50  ? 329 SER C N   1 
ATOM   8087  C CA  . SER C 1 329 ? 47.492  -12.098 -43.355 1.00 51.11  ? 329 SER C CA  1 
ATOM   8088  C C   . SER C 1 329 ? 47.407  -13.034 -42.154 1.00 46.04  ? 329 SER C C   1 
ATOM   8089  O O   . SER C 1 329 ? 47.923  -12.714 -41.090 1.00 49.46  ? 329 SER C O   1 
ATOM   8090  C CB  . SER C 1 329 ? 48.510  -12.603 -44.378 1.00 58.39  ? 329 SER C CB  1 
ATOM   8091  O OG  . SER C 1 329 ? 49.823  -12.588 -43.846 1.00 61.98  ? 329 SER C OG  1 
ATOM   8092  N N   . VAL C 1 330 ? 46.746  -14.175 -42.309 1.00 51.43  ? 330 VAL C N   1 
ATOM   8093  C CA  . VAL C 1 330 ? 46.607  -15.113 -41.197 1.00 46.05  ? 330 VAL C CA  1 
ATOM   8094  C C   . VAL C 1 330 ? 46.573  -16.547 -41.716 1.00 53.78  ? 330 VAL C C   1 
ATOM   8095  O O   . VAL C 1 330 ? 45.948  -16.824 -42.740 1.00 64.23  ? 330 VAL C O   1 
ATOM   8096  C CB  . VAL C 1 330 ? 45.331  -14.813 -40.370 1.00 54.53  ? 330 VAL C CB  1 
ATOM   8097  C CG1 . VAL C 1 330 ? 44.118  -14.676 -41.280 1.00 51.62  ? 330 VAL C CG1 1 
ATOM   8098  C CG2 . VAL C 1 330 ? 45.099  -15.880 -39.308 1.00 56.86  ? 330 VAL C CG2 1 
ATOM   8099  N N   . MET C 1 331 ? 47.247  -17.463 -41.022 1.00 55.19  ? 331 MET C N   1 
ATOM   8100  C CA  . MET C 1 331 ? 47.266  -18.849 -41.485 1.00 69.51  ? 331 MET C CA  1 
ATOM   8101  C C   . MET C 1 331 ? 47.284  -19.871 -40.354 1.00 57.64  ? 331 MET C C   1 
ATOM   8102  O O   . MET C 1 331 ? 47.702  -19.572 -39.238 1.00 48.91  ? 331 MET C O   1 
ATOM   8103  C CB  . MET C 1 331 ? 48.472  -19.085 -42.397 1.00 74.51  ? 331 MET C CB  1 
ATOM   8104  C CG  . MET C 1 331 ? 49.781  -19.302 -41.656 1.00 68.17  ? 331 MET C CG  1 
ATOM   8105  S SD  . MET C 1 331 ? 51.174  -19.537 -42.774 1.00 91.24  ? 331 MET C SD  1 
ATOM   8106  C CE  . MET C 1 331 ? 50.498  -20.757 -43.899 1.00 88.59  ? 331 MET C CE  1 
ATOM   8107  N N   . ALA C 1 332 ? 46.821  -21.080 -40.657 1.00 55.97  ? 332 ALA C N   1 
ATOM   8108  C CA  . ALA C 1 332 ? 46.908  -22.189 -39.718 1.00 54.06  ? 332 ALA C CA  1 
ATOM   8109  C C   . ALA C 1 332 ? 48.364  -22.580 -39.501 1.00 51.73  ? 332 ALA C C   1 
ATOM   8110  O O   . ALA C 1 332 ? 49.158  -22.601 -40.441 1.00 59.42  ? 332 ALA C O   1 
ATOM   8111  C CB  . ALA C 1 332 ? 46.103  -23.377 -40.216 1.00 59.15  ? 332 ALA C CB  1 
ATOM   8112  N N   . VAL C 1 333 ? 48.707  -22.889 -38.257 1.00 62.77  ? 333 VAL C N   1 
ATOM   8113  C CA  . VAL C 1 333 ? 50.083  -23.201 -37.897 1.00 46.87  ? 333 VAL C CA  1 
ATOM   8114  C C   . VAL C 1 333 ? 50.113  -24.410 -36.971 1.00 70.27  ? 333 VAL C C   1 
ATOM   8115  O O   . VAL C 1 333 ? 49.250  -24.556 -36.113 1.00 78.64  ? 333 VAL C O   1 
ATOM   8116  C CB  . VAL C 1 333 ? 50.768  -21.988 -37.212 1.00 45.66  ? 333 VAL C CB  1 
ATOM   8117  C CG1 . VAL C 1 333 ? 52.026  -22.406 -36.461 1.00 59.09  ? 333 VAL C CG1 1 
ATOM   8118  C CG2 . VAL C 1 333 ? 51.088  -20.908 -38.233 1.00 55.60  ? 333 VAL C CG2 1 
ATOM   8119  N N   . ASP C 1 334 ? 51.089  -25.291 -37.156 1.00 80.65  ? 334 ASP C N   1 
ATOM   8120  C CA  . ASP C 1 334 ? 51.312  -26.369 -36.200 1.00 81.09  ? 334 ASP C CA  1 
ATOM   8121  C C   . ASP C 1 334 ? 52.413  -25.979 -35.222 1.00 56.57  ? 334 ASP C C   1 
ATOM   8122  O O   . ASP C 1 334 ? 53.526  -25.664 -35.631 1.00 62.27  ? 334 ASP C O   1 
ATOM   8123  C CB  . ASP C 1 334 ? 51.670  -27.671 -36.912 1.00 76.93  ? 334 ASP C CB  1 
ATOM   8124  C CG  . ASP C 1 334 ? 50.475  -28.315 -37.580 1.00 92.12  ? 334 ASP C CG  1 
ATOM   8125  O OD1 . ASP C 1 334 ? 49.424  -28.449 -36.916 1.00 93.79  ? 334 ASP C OD1 1 
ATOM   8126  O OD2 . ASP C 1 334 ? 50.585  -28.692 -38.765 1.00 94.12  ? 334 ASP C OD2 1 
ATOM   8127  N N   . CYS C 1 335 ? 52.095  -25.992 -33.932 1.00 74.70  ? 335 CYS C N   1 
ATOM   8128  C CA  . CYS C 1 335 ? 53.068  -25.660 -32.899 1.00 86.12  ? 335 CYS C CA  1 
ATOM   8129  C C   . CYS C 1 335 ? 52.884  -26.516 -31.650 1.00 86.81  ? 335 CYS C C   1 
ATOM   8130  O O   . CYS C 1 335 ? 51.773  -26.618 -31.146 1.00 84.37  ? 335 CYS C O   1 
ATOM   8131  C CB  . CYS C 1 335 ? 52.943  -24.180 -32.529 1.00 70.82  ? 335 CYS C CB  1 
ATOM   8132  S SG  . CYS C 1 335 ? 53.887  -23.711 -31.071 1.00 95.80  ? 335 CYS C SG  1 
ATOM   8133  N N   . GLU C 1 336 ? 53.960  -27.135 -31.164 1.00 89.66  ? 336 GLU C N   1 
ATOM   8134  C CA  . GLU C 1 336 ? 53.934  -27.839 -29.877 1.00 81.30  ? 336 GLU C CA  1 
ATOM   8135  C C   . GLU C 1 336 ? 52.847  -28.908 -29.710 1.00 100.61 ? 336 GLU C C   1 
ATOM   8136  O O   . GLU C 1 336 ? 52.178  -28.924 -28.661 1.00 113.01 ? 336 GLU C O   1 
ATOM   8137  C CB  . GLU C 1 336 ? 53.789  -26.854 -28.719 1.00 85.60  ? 336 GLU C CB  1 
ATOM   8138  C CG  . GLU C 1 336 ? 55.009  -25.985 -28.385 1.00 90.38  ? 336 GLU C CG  1 
ATOM   8139  C CD  . GLU C 1 336 ? 54.850  -25.429 -26.989 1.00 96.02  ? 336 GLU C CD  1 
ATOM   8140  O OE1 . GLU C 1 336 ? 53.926  -25.940 -26.330 1.00 98.41  ? 336 GLU C OE1 1 
ATOM   8141  O OE2 . GLU C 1 336 ? 55.585  -24.513 -26.548 1.00 102.36 ? 336 GLU C OE2 1 
ATOM   8142  N N   . ASP C 1 337 ? 52.666  -29.763 -30.722 1.00 96.94  ? 337 ASP C N   1 
ATOM   8143  C CA  . ASP C 1 337 ? 51.691  -30.864 -30.691 1.00 102.71 ? 337 ASP C CA  1 
ATOM   8144  C C   . ASP C 1 337 ? 50.247  -30.374 -30.747 1.00 101.22 ? 337 ASP C C   1 
ATOM   8145  O O   . ASP C 1 337 ? 49.327  -31.184 -30.907 1.00 99.61  ? 337 ASP C O   1 
ATOM   8146  C CB  . ASP C 1 337 ? 51.869  -31.697 -29.389 1.00 124.18 ? 337 ASP C CB  1 
ATOM   8147  C CG  . ASP C 1 337 ? 52.999  -32.703 -29.466 1.00 129.55 ? 337 ASP C CG  1 
ATOM   8148  O OD1 . ASP C 1 337 ? 53.140  -33.369 -30.511 1.00 136.39 ? 337 ASP C OD1 1 
ATOM   8149  O OD2 . ASP C 1 337 ? 53.792  -32.793 -28.489 1.00 128.65 ? 337 ASP C OD2 1 
ATOM   8150  N N   . ARG C 1 338 ? 50.047  -29.060 -30.706 1.00 87.36  ? 338 ARG C N   1 
ATOM   8151  C CA  . ARG C 1 338 ? 48.729  -28.545 -30.369 1.00 72.93  ? 338 ARG C CA  1 
ATOM   8152  C C   . ARG C 1 338 ? 47.755  -28.538 -31.544 1.00 73.32  ? 338 ARG C C   1 
ATOM   8153  O O   . ARG C 1 338 ? 48.153  -28.397 -32.700 1.00 87.15  ? 338 ARG C O   1 
ATOM   8154  C CB  . ARG C 1 338 ? 48.851  -27.135 -29.799 1.00 73.47  ? 338 ARG C CB  1 
ATOM   8155  C CG  . ARG C 1 338 ? 49.685  -27.028 -28.540 1.00 74.16  ? 338 ARG C CG  1 
ATOM   8156  C CD  . ARG C 1 338 ? 48.823  -27.197 -27.306 1.00 90.21  ? 338 ARG C CD  1 
ATOM   8157  N NE  . ARG C 1 338 ? 49.356  -26.477 -26.154 1.00 82.02  ? 338 ARG C NE  1 
ATOM   8158  C CZ  . ARG C 1 338 ? 48.832  -26.533 -24.934 1.00 76.39  ? 338 ARG C CZ  1 
ATOM   8159  N NH1 . ARG C 1 338 ? 49.379  -25.843 -23.943 1.00 80.91  ? 338 ARG C NH1 1 
ATOM   8160  N NH2 . ARG C 1 338 ? 47.760  -27.279 -24.704 1.00 70.86  ? 338 ARG C NH2 1 
ATOM   8161  N N   . ARG C 1 339 ? 46.474  -28.691 -31.213 1.00 69.06  ? 339 ARG C N   1 
ATOM   8162  C CA  . ARG C 1 339 ? 45.393  -28.779 -32.188 1.00 53.33  ? 339 ARG C CA  1 
ATOM   8163  C C   . ARG C 1 339 ? 44.759  -27.416 -32.438 1.00 65.82  ? 339 ARG C C   1 
ATOM   8164  O O   . ARG C 1 339 ? 44.534  -26.653 -31.502 1.00 70.09  ? 339 ARG C O   1 
ATOM   8165  C CB  . ARG C 1 339 ? 44.343  -29.783 -31.701 1.00 55.98  ? 339 ARG C CB  1 
ATOM   8166  C CG  . ARG C 1 339 ? 44.816  -31.230 -31.752 1.00 64.30  ? 339 ARG C CG  1 
ATOM   8167  C CD  . ARG C 1 339 ? 43.721  -32.222 -31.381 1.00 77.13  ? 339 ARG C CD  1 
ATOM   8168  N NE  . ARG C 1 339 ? 42.460  -31.991 -32.079 1.00 46.82  ? 339 ARG C NE  1 
ATOM   8169  C CZ  . ARG C 1 339 ? 41.324  -31.667 -31.470 1.00 64.31  ? 339 ARG C CZ  1 
ATOM   8170  N NH1 . ARG C 1 339 ? 41.294  -31.533 -30.151 1.00 77.49  ? 339 ARG C NH1 1 
ATOM   8171  N NH2 . ARG C 1 339 ? 40.218  -31.481 -32.174 1.00 67.31  ? 339 ARG C NH2 1 
ATOM   8172  N N   . TYR C 1 340 ? 44.482  -27.123 -33.706 1.00 77.12  ? 340 TYR C N   1 
ATOM   8173  C CA  . TYR C 1 340 ? 43.792  -25.900 -34.117 1.00 68.33  ? 340 TYR C CA  1 
ATOM   8174  C C   . TYR C 1 340 ? 44.562  -24.629 -33.779 1.00 61.43  ? 340 TYR C C   1 
ATOM   8175  O O   . TYR C 1 340 ? 43.982  -23.658 -33.294 1.00 60.14  ? 340 TYR C O   1 
ATOM   8176  C CB  . TYR C 1 340 ? 42.398  -25.825 -33.491 1.00 45.95  ? 340 TYR C CB  1 
ATOM   8177  C CG  . TYR C 1 340 ? 41.515  -27.004 -33.813 1.00 63.18  ? 340 TYR C CG  1 
ATOM   8178  C CD1 . TYR C 1 340 ? 41.534  -27.585 -35.075 1.00 60.78  ? 340 TYR C CD1 1 
ATOM   8179  C CD2 . TYR C 1 340 ? 40.648  -27.524 -32.865 1.00 68.38  ? 340 TYR C CD2 1 
ATOM   8180  C CE1 . TYR C 1 340 ? 40.723  -28.659 -35.377 1.00 62.96  ? 340 TYR C CE1 1 
ATOM   8181  C CE2 . TYR C 1 340 ? 39.833  -28.594 -33.159 1.00 75.21  ? 340 TYR C CE2 1 
ATOM   8182  C CZ  . TYR C 1 340 ? 39.873  -29.159 -34.414 1.00 72.30  ? 340 TYR C CZ  1 
ATOM   8183  O OH  . TYR C 1 340 ? 39.058  -30.229 -34.705 1.00 78.06  ? 340 TYR C OH  1 
ATOM   8184  N N   . CYS C 1 341 ? 45.865  -24.634 -34.036 1.00 56.96  ? 341 CYS C N   1 
ATOM   8185  C CA  . CYS C 1 341 ? 46.665  -23.428 -33.867 1.00 57.39  ? 341 CYS C CA  1 
ATOM   8186  C C   . CYS C 1 341 ? 46.718  -22.612 -35.152 1.00 64.84  ? 341 CYS C C   1 
ATOM   8187  O O   . CYS C 1 341 ? 46.741  -23.161 -36.254 1.00 57.35  ? 341 CYS C O   1 
ATOM   8188  C CB  . CYS C 1 341 ? 48.080  -23.766 -33.403 1.00 54.44  ? 341 CYS C CB  1 
ATOM   8189  S SG  . CYS C 1 341 ? 48.169  -24.430 -31.741 1.00 87.98  ? 341 CYS C SG  1 
ATOM   8190  N N   . PHE C 1 342 ? 46.730  -21.293 -34.996 1.00 56.78  ? 342 PHE C N   1 
ATOM   8191  C CA  . PHE C 1 342 ? 46.881  -20.384 -36.121 1.00 47.08  ? 342 PHE C CA  1 
ATOM   8192  C C   . PHE C 1 342 ? 47.658  -19.151 -35.682 1.00 46.84  ? 342 PHE C C   1 
ATOM   8193  O O   . PHE C 1 342 ? 47.796  -18.887 -34.489 1.00 52.66  ? 342 PHE C O   1 
ATOM   8194  C CB  . PHE C 1 342 ? 45.516  -19.989 -36.695 1.00 53.85  ? 342 PHE C CB  1 
ATOM   8195  C CG  . PHE C 1 342 ? 44.698  -19.113 -35.784 1.00 53.01  ? 342 PHE C CG  1 
ATOM   8196  C CD1 . PHE C 1 342 ? 44.779  -17.731 -35.866 1.00 47.12  ? 342 PHE C CD1 1 
ATOM   8197  C CD2 . PHE C 1 342 ? 43.832  -19.673 -34.858 1.00 52.54  ? 342 PHE C CD2 1 
ATOM   8198  C CE1 . PHE C 1 342 ? 44.025  -16.925 -35.033 1.00 44.43  ? 342 PHE C CE1 1 
ATOM   8199  C CE2 . PHE C 1 342 ? 43.075  -18.872 -34.023 1.00 51.88  ? 342 PHE C CE2 1 
ATOM   8200  C CZ  . PHE C 1 342 ? 43.171  -17.497 -34.112 1.00 44.59  ? 342 PHE C CZ  1 
ATOM   8201  N N   . GLN C 1 343 ? 48.164  -18.399 -36.651 1.00 49.42  ? 343 GLN C N   1 
ATOM   8202  C CA  . GLN C 1 343 ? 48.964  -17.224 -36.350 1.00 50.02  ? 343 GLN C CA  1 
ATOM   8203  C C   . GLN C 1 343 ? 48.685  -16.102 -37.346 1.00 42.59  ? 343 GLN C C   1 
ATOM   8204  O O   . GLN C 1 343 ? 48.349  -16.348 -38.514 1.00 54.38  ? 343 GLN C O   1 
ATOM   8205  C CB  . GLN C 1 343 ? 50.453  -17.582 -36.346 1.00 49.84  ? 343 GLN C CB  1 
ATOM   8206  C CG  . GLN C 1 343 ? 51.341  -16.586 -35.614 1.00 49.99  ? 343 GLN C CG  1 
ATOM   8207  C CD  . GLN C 1 343 ? 52.818  -16.867 -35.814 1.00 46.91  ? 343 GLN C CD  1 
ATOM   8208  O OE1 . GLN C 1 343 ? 53.201  -17.648 -36.684 1.00 60.44  ? 343 GLN C OE1 1 
ATOM   8209  N NE2 . GLN C 1 343 ? 53.657  -16.235 -35.001 1.00 40.33  ? 343 GLN C NE2 1 
ATOM   8210  N N   . ILE C 1 344 ? 48.810  -14.871 -36.860 1.00 43.73  ? 344 ILE C N   1 
ATOM   8211  C CA  . ILE C 1 344 ? 48.603  -13.683 -37.669 1.00 37.87  ? 344 ILE C CA  1 
ATOM   8212  C C   . ILE C 1 344 ? 49.950  -13.053 -37.995 1.00 55.88  ? 344 ILE C C   1 
ATOM   8213  O O   . ILE C 1 344 ? 50.869  -13.073 -37.177 1.00 65.51  ? 344 ILE C O   1 
ATOM   8214  C CB  . ILE C 1 344 ? 47.717  -12.646 -36.942 1.00 40.98  ? 344 ILE C CB  1 
ATOM   8215  C CG1 . ILE C 1 344 ? 46.463  -13.308 -36.370 1.00 43.11  ? 344 ILE C CG1 1 
ATOM   8216  C CG2 . ILE C 1 344 ? 47.342  -11.497 -37.870 1.00 42.21  ? 344 ILE C CG2 1 
ATOM   8217  C CD1 . ILE C 1 344 ? 45.616  -12.370 -35.543 1.00 36.11  ? 344 ILE C CD1 1 
ATOM   8218  N N   . THR C 1 345 ? 50.056  -12.486 -39.190 1.00 51.75  ? 345 THR C N   1 
ATOM   8219  C CA  . THR C 1 345 ? 51.270  -11.820 -39.626 1.00 48.42  ? 345 THR C CA  1 
ATOM   8220  C C   . THR C 1 345 ? 50.929  -10.465 -40.227 1.00 40.46  ? 345 THR C C   1 
ATOM   8221  O O   . THR C 1 345 ? 50.227  -10.381 -41.234 1.00 41.82  ? 345 THR C O   1 
ATOM   8222  C CB  . THR C 1 345 ? 52.040  -12.663 -40.661 1.00 61.11  ? 345 THR C CB  1 
ATOM   8223  O OG1 . THR C 1 345 ? 52.244  -13.985 -40.148 1.00 60.75  ? 345 THR C OG1 1 
ATOM   8224  C CG2 . THR C 1 345 ? 53.386  -12.028 -40.972 1.00 54.14  ? 345 THR C CG2 1 
ATOM   8225  N N   . SER C 1 346 ? 51.417  -9.405  -39.592 1.00 46.18  ? 346 SER C N   1 
ATOM   8226  C CA  . SER C 1 346 ? 51.270  -8.057  -40.122 1.00 45.09  ? 346 SER C CA  1 
ATOM   8227  C C   . SER C 1 346 ? 52.016  -7.932  -41.443 1.00 56.84  ? 346 SER C C   1 
ATOM   8228  O O   . SER C 1 346 ? 52.918  -8.719  -41.728 1.00 60.14  ? 346 SER C O   1 
ATOM   8229  C CB  . SER C 1 346 ? 51.787  -7.023  -39.118 1.00 53.30  ? 346 SER C CB  1 
ATOM   8230  O OG  . SER C 1 346 ? 51.750  -5.715  -39.663 1.00 55.10  ? 346 SER C OG  1 
ATOM   8231  N N   . PHE C 1 347 ? 51.636  -6.950  -42.254 1.00 56.75  ? 347 PHE C N   1 
ATOM   8232  C CA  . PHE C 1 347 ? 52.362  -6.675  -43.490 1.00 54.24  ? 347 PHE C CA  1 
ATOM   8233  C C   . PHE C 1 347 ? 53.762  -6.165  -43.152 1.00 52.43  ? 347 PHE C C   1 
ATOM   8234  O O   . PHE C 1 347 ? 54.651  -6.145  -44.003 1.00 56.97  ? 347 PHE C O   1 
ATOM   8235  C CB  . PHE C 1 347 ? 51.601  -5.672  -44.363 1.00 42.08  ? 347 PHE C CB  1 
ATOM   8236  C CG  . PHE C 1 347 ? 51.766  -4.241  -43.939 1.00 56.33  ? 347 PHE C CG  1 
ATOM   8237  C CD1 . PHE C 1 347 ? 51.123  -3.761  -42.809 1.00 57.46  ? 347 PHE C CD1 1 
ATOM   8238  C CD2 . PHE C 1 347 ? 52.554  -3.373  -44.676 1.00 52.45  ? 347 PHE C CD2 1 
ATOM   8239  C CE1 . PHE C 1 347 ? 51.270  -2.442  -42.418 1.00 47.26  ? 347 PHE C CE1 1 
ATOM   8240  C CE2 . PHE C 1 347 ? 52.706  -2.053  -44.290 1.00 56.59  ? 347 PHE C CE2 1 
ATOM   8241  C CZ  . PHE C 1 347 ? 52.062  -1.588  -43.160 1.00 54.13  ? 347 PHE C CZ  1 
ATOM   8242  N N   . ASP C 1 348 ? 53.940  -5.751  -41.900 1.00 52.54  ? 348 ASP C N   1 
ATOM   8243  C CA  . ASP C 1 348 ? 55.250  -5.413  -41.356 1.00 52.28  ? 348 ASP C CA  1 
ATOM   8244  C C   . ASP C 1 348 ? 56.153  -6.638  -41.304 1.00 50.41  ? 348 ASP C C   1 
ATOM   8245  O O   . ASP C 1 348 ? 57.367  -6.540  -41.486 1.00 54.33  ? 348 ASP C O   1 
ATOM   8246  C CB  . ASP C 1 348 ? 55.116  -4.832  -39.947 1.00 61.44  ? 348 ASP C CB  1 
ATOM   8247  C CG  . ASP C 1 348 ? 54.513  -3.449  -39.941 1.00 67.31  ? 348 ASP C CG  1 
ATOM   8248  O OD1 . ASP C 1 348 ? 54.414  -2.841  -41.026 1.00 80.74  ? 348 ASP C OD1 1 
ATOM   8249  O OD2 . ASP C 1 348 ? 54.140  -2.971  -38.849 1.00 66.54  ? 348 ASP C OD2 1 
ATOM   8250  N N   . GLY C 1 349 ? 55.545  -7.791  -41.047 1.00 39.82  ? 349 GLY C N   1 
ATOM   8251  C CA  . GLY C 1 349 ? 56.286  -9.005  -40.764 1.00 47.86  ? 349 GLY C CA  1 
ATOM   8252  C C   . GLY C 1 349 ? 56.140  -9.365  -39.299 1.00 52.79  ? 349 GLY C C   1 
ATOM   8253  O O   . GLY C 1 349 ? 56.528  -10.452 -38.868 1.00 50.13  ? 349 GLY C O   1 
ATOM   8254  N N   . LYS C 1 350 ? 55.580  -8.436  -38.530 1.00 56.66  ? 350 LYS C N   1 
ATOM   8255  C CA  . LYS C 1 350 ? 55.313  -8.657  -37.115 1.00 47.21  ? 350 LYS C CA  1 
ATOM   8256  C C   . LYS C 1 350 ? 54.276  -9.761  -36.933 1.00 53.42  ? 350 LYS C C   1 
ATOM   8257  O O   . LYS C 1 350 ? 53.213  -9.732  -37.553 1.00 59.09  ? 350 LYS C O   1 
ATOM   8258  C CB  . LYS C 1 350 ? 54.837  -7.358  -36.457 1.00 55.08  ? 350 LYS C CB  1 
ATOM   8259  C CG  . LYS C 1 350 ? 54.388  -7.502  -35.013 1.00 59.59  ? 350 LYS C CG  1 
ATOM   8260  C CD  . LYS C 1 350 ? 54.088  -6.141  -34.402 1.00 66.79  ? 350 LYS C CD  1 
ATOM   8261  C CE  . LYS C 1 350 ? 53.578  -6.270  -32.976 1.00 78.92  ? 350 LYS C CE  1 
ATOM   8262  N NZ  . LYS C 1 350 ? 52.977  -4.998  -32.488 1.00 86.16  ? 350 LYS C NZ  1 
ATOM   8263  N N   . LYS C 1 351 ? 54.589  -10.733 -36.082 1.00 54.66  ? 351 LYS C N   1 
ATOM   8264  C CA  . LYS C 1 351 ? 53.698  -11.866 -35.859 1.00 55.65  ? 351 LYS C CA  1 
ATOM   8265  C C   . LYS C 1 351 ? 53.061  -11.844 -34.476 1.00 58.91  ? 351 LYS C C   1 
ATOM   8266  O O   . LYS C 1 351 ? 53.629  -11.314 -33.521 1.00 68.67  ? 351 LYS C O   1 
ATOM   8267  C CB  . LYS C 1 351 ? 54.441  -13.191 -36.054 1.00 50.37  ? 351 LYS C CB  1 
ATOM   8268  C CG  . LYS C 1 351 ? 55.071  -13.380 -37.423 1.00 55.26  ? 351 LYS C CG  1 
ATOM   8269  C CD  . LYS C 1 351 ? 55.329  -14.857 -37.691 1.00 57.19  ? 351 LYS C CD  1 
ATOM   8270  C CE  . LYS C 1 351 ? 55.940  -15.081 -39.062 1.00 71.68  ? 351 LYS C CE  1 
ATOM   8271  N NZ  . LYS C 1 351 ? 57.427  -15.010 -39.018 1.00 102.19 ? 351 LYS C NZ  1 
ATOM   8272  N N   . SER C 1 352 ? 51.871  -12.426 -34.386 1.00 61.00  ? 352 SER C N   1 
ATOM   8273  C CA  . SER C 1 352 ? 51.160  -12.556 -33.123 1.00 47.60  ? 352 SER C CA  1 
ATOM   8274  C C   . SER C 1 352 ? 51.652  -13.764 -32.347 1.00 48.34  ? 352 SER C C   1 
ATOM   8275  O O   . SER C 1 352 ? 52.511  -14.510 -32.816 1.00 59.23  ? 352 SER C O   1 
ATOM   8276  C CB  . SER C 1 352 ? 49.657  -12.690 -33.363 1.00 49.50  ? 352 SER C CB  1 
ATOM   8277  O OG  . SER C 1 352 ? 49.365  -13.852 -34.119 1.00 41.25  ? 352 SER C OG  1 
ATOM   8278  N N   . SER C 1 353 ? 51.102  -13.952 -31.154 1.00 66.84  ? 353 SER C N   1 
ATOM   8279  C CA  . SER C 1 353 ? 51.281  -15.204 -30.443 1.00 68.71  ? 353 SER C CA  1 
ATOM   8280  C C   . SER C 1 353 ? 50.608  -16.294 -31.260 1.00 58.57  ? 353 SER C C   1 
ATOM   8281  O O   . SER C 1 353 ? 49.646  -16.027 -31.980 1.00 64.60  ? 353 SER C O   1 
ATOM   8282  C CB  . SER C 1 353 ? 50.683  -15.134 -29.037 1.00 63.47  ? 353 SER C CB  1 
ATOM   8283  O OG  . SER C 1 353 ? 51.358  -14.180 -28.238 1.00 83.03  ? 353 SER C OG  1 
ATOM   8284  N N   . ILE C 1 354 ? 51.110  -17.519 -31.164 1.00 59.97  ? 354 ILE C N   1 
ATOM   8285  C CA  . ILE C 1 354 ? 50.421  -18.631 -31.795 1.00 59.00  ? 354 ILE C CA  1 
ATOM   8286  C C   . ILE C 1 354 ? 49.154  -18.881 -30.991 1.00 68.75  ? 354 ILE C C   1 
ATOM   8287  O O   . ILE C 1 354 ? 49.207  -19.052 -29.773 1.00 62.77  ? 354 ILE C O   1 
ATOM   8288  C CB  . ILE C 1 354 ? 51.291  -19.898 -31.852 1.00 52.10  ? 354 ILE C CB  1 
ATOM   8289  C CG1 . ILE C 1 354 ? 52.493  -19.674 -32.771 1.00 56.11  ? 354 ILE C CG1 1 
ATOM   8290  C CG2 . ILE C 1 354 ? 50.470  -21.087 -32.325 1.00 53.72  ? 354 ILE C CG2 1 
ATOM   8291  C CD1 . ILE C 1 354 ? 53.770  -20.314 -32.276 1.00 74.52  ? 354 ILE C CD1 1 
ATOM   8292  N N   . LEU C 1 355 ? 48.015  -18.898 -31.673 1.00 57.01  ? 355 LEU C N   1 
ATOM   8293  C CA  . LEU C 1 355 ? 46.733  -18.947 -30.986 1.00 48.23  ? 355 LEU C CA  1 
ATOM   8294  C C   . LEU C 1 355 ? 46.027  -20.264 -31.249 1.00 56.00  ? 355 LEU C C   1 
ATOM   8295  O O   . LEU C 1 355 ? 45.959  -20.730 -32.383 1.00 67.07  ? 355 LEU C O   1 
ATOM   8296  C CB  . LEU C 1 355 ? 45.846  -17.777 -31.418 1.00 41.43  ? 355 LEU C CB  1 
ATOM   8297  C CG  . LEU C 1 355 ? 46.421  -16.377 -31.197 1.00 38.82  ? 355 LEU C CG  1 
ATOM   8298  C CD1 . LEU C 1 355 ? 45.526  -15.323 -31.826 1.00 33.13  ? 355 LEU C CD1 1 
ATOM   8299  C CD2 . LEU C 1 355 ? 46.619  -16.102 -29.715 1.00 43.92  ? 355 LEU C CD2 1 
ATOM   8300  N N   . GLN C 1 356 ? 45.490  -20.851 -30.186 1.00 48.06  ? 356 GLN C N   1 
ATOM   8301  C CA  . GLN C 1 356 ? 44.868  -22.164 -30.261 1.00 43.70  ? 356 GLN C CA  1 
ATOM   8302  C C   . GLN C 1 356 ? 43.371  -22.068 -30.010 1.00 51.64  ? 356 GLN C C   1 
ATOM   8303  O O   . GLN C 1 356 ? 42.942  -21.556 -28.976 1.00 50.72  ? 356 GLN C O   1 
ATOM   8304  C CB  . GLN C 1 356 ? 45.510  -23.110 -29.244 1.00 55.60  ? 356 GLN C CB  1 
ATOM   8305  C CG  . GLN C 1 356 ? 45.014  -24.539 -29.327 1.00 60.37  ? 356 GLN C CG  1 
ATOM   8306  C CD  . GLN C 1 356 ? 45.234  -25.313 -28.043 1.00 72.84  ? 356 GLN C CD  1 
ATOM   8307  O OE1 . GLN C 1 356 ? 44.961  -24.818 -26.950 1.00 84.71  ? 356 GLN C OE1 1 
ATOM   8308  N NE2 . GLN C 1 356 ? 45.732  -26.537 -28.169 1.00 71.42  ? 356 GLN C NE2 1 
ATOM   8309  N N   . ALA C 1 357 ? 42.575  -22.560 -30.954 1.00 51.94  ? 357 ALA C N   1 
ATOM   8310  C CA  . ALA C 1 357 ? 41.134  -22.600 -30.750 1.00 42.76  ? 357 ALA C CA  1 
ATOM   8311  C C   . ALA C 1 357 ? 40.715  -23.937 -30.155 1.00 62.34  ? 357 ALA C C   1 
ATOM   8312  O O   . ALA C 1 357 ? 41.527  -24.855 -30.037 1.00 59.98  ? 357 ALA C O   1 
ATOM   8313  C CB  . ALA C 1 357 ? 40.406  -22.345 -32.060 1.00 57.63  ? 357 ALA C CB  1 
ATOM   8314  N N   . GLU C 1 358 ? 39.443  -24.043 -29.785 1.00 54.74  ? 358 GLU C N   1 
ATOM   8315  C CA  . GLU C 1 358 ? 38.932  -25.256 -29.162 1.00 57.29  ? 358 GLU C CA  1 
ATOM   8316  C C   . GLU C 1 358 ? 38.271  -26.180 -30.178 1.00 74.11  ? 358 GLU C C   1 
ATOM   8317  O O   . GLU C 1 358 ? 37.995  -27.346 -29.892 1.00 80.45  ? 358 GLU C O   1 
ATOM   8318  C CB  . GLU C 1 358 ? 37.938  -24.892 -28.060 1.00 82.86  ? 358 GLU C CB  1 
ATOM   8319  C CG  . GLU C 1 358 ? 37.621  -26.016 -27.096 1.00 86.09  ? 358 GLU C CG  1 
ATOM   8320  C CD  . GLU C 1 358 ? 36.412  -25.710 -26.238 1.00 91.27  ? 358 GLU C CD  1 
ATOM   8321  O OE1 . GLU C 1 358 ? 35.367  -25.316 -26.799 1.00 92.46  ? 358 GLU C OE1 1 
ATOM   8322  O OE2 . GLU C 1 358 ? 36.509  -25.858 -25.002 1.00 103.37 ? 358 GLU C OE2 1 
ATOM   8323  N N   . SER C 1 359 ? 38.030  -25.651 -31.371 1.00 82.48  ? 359 SER C N   1 
ATOM   8324  C CA  . SER C 1 359 ? 37.294  -26.383 -32.393 1.00 73.72  ? 359 SER C CA  1 
ATOM   8325  C C   . SER C 1 359 ? 37.693  -25.925 -33.789 1.00 69.67  ? 359 SER C C   1 
ATOM   8326  O O   . SER C 1 359 ? 38.244  -24.838 -33.959 1.00 65.03  ? 359 SER C O   1 
ATOM   8327  C CB  . SER C 1 359 ? 35.788  -26.210 -32.194 1.00 70.40  ? 359 SER C CB  1 
ATOM   8328  O OG  . SER C 1 359 ? 35.346  -24.983 -32.748 1.00 61.76  ? 359 SER C OG  1 
ATOM   8329  N N   . LYS C 1 360 ? 37.420  -26.759 -34.787 1.00 78.13  ? 360 LYS C N   1 
ATOM   8330  C CA  . LYS C 1 360 ? 37.708  -26.387 -36.166 1.00 73.56  ? 360 LYS C CA  1 
ATOM   8331  C C   . LYS C 1 360 ? 36.805  -25.247 -36.622 1.00 67.19  ? 360 LYS C C   1 
ATOM   8332  O O   . LYS C 1 360 ? 37.234  -24.371 -37.386 1.00 72.25  ? 360 LYS C O   1 
ATOM   8333  C CB  . LYS C 1 360 ? 37.584  -27.589 -37.111 1.00 70.13  ? 360 LYS C CB  1 
ATOM   8334  C CG  . LYS C 1 360 ? 37.229  -27.190 -38.541 1.00 76.61  ? 360 LYS C CG  1 
ATOM   8335  C CD  . LYS C 1 360 ? 37.374  -28.323 -39.541 1.00 80.34  ? 360 LYS C CD  1 
ATOM   8336  C CE  . LYS C 1 360 ? 38.839  -28.746 -39.626 1.00 100.94 ? 360 LYS C CE  1 
ATOM   8337  N NZ  . LYS C 1 360 ? 39.090  -29.800 -40.648 1.00 93.29  ? 360 LYS C NZ  1 
ATOM   8338  N N   . LYS C 1 361 ? 35.567  -25.248 -36.134 1.00 54.73  ? 361 LYS C N   1 
ATOM   8339  C CA  . LYS C 1 361 ? 34.630  -24.184 -36.458 1.00 61.95  ? 361 LYS C CA  1 
ATOM   8340  C C   . LYS C 1 361 ? 35.212  -22.840 -36.051 1.00 72.47  ? 361 LYS C C   1 
ATOM   8341  O O   . LYS C 1 361 ? 35.248  -21.916 -36.853 1.00 81.02  ? 361 LYS C O   1 
ATOM   8342  C CB  . LYS C 1 361 ? 33.285  -24.400 -35.765 1.00 59.59  ? 361 LYS C CB  1 
ATOM   8343  C CG  . LYS C 1 361 ? 32.369  -23.185 -35.844 1.00 59.55  ? 361 LYS C CG  1 
ATOM   8344  C CD  . LYS C 1 361 ? 30.990  -23.473 -35.281 1.00 69.98  ? 361 LYS C CD  1 
ATOM   8345  C CE  . LYS C 1 361 ? 30.181  -22.194 -35.130 1.00 71.78  ? 361 LYS C CE  1 
ATOM   8346  N NZ  . LYS C 1 361 ? 30.817  -21.240 -34.181 1.00 73.64  ? 361 LYS C NZ  1 
ATOM   8347  N N   . ASP C 1 362 ? 35.687  -22.742 -34.813 1.00 68.05  ? 362 ASP C N   1 
ATOM   8348  C CA  . ASP C 1 362 ? 36.289  -21.506 -34.323 1.00 67.64  ? 362 ASP C CA  1 
ATOM   8349  C C   . ASP C 1 362 ? 37.635  -21.225 -34.976 1.00 55.35  ? 362 ASP C C   1 
ATOM   8350  O O   . ASP C 1 362 ? 38.009  -20.072 -35.158 1.00 58.43  ? 362 ASP C O   1 
ATOM   8351  C CB  . ASP C 1 362 ? 36.449  -21.547 -32.803 1.00 64.51  ? 362 ASP C CB  1 
ATOM   8352  C CG  . ASP C 1 362 ? 35.182  -21.153 -32.078 1.00 68.59  ? 362 ASP C CG  1 
ATOM   8353  O OD1 . ASP C 1 362 ? 34.253  -20.643 -32.740 1.00 57.86  ? 362 ASP C OD1 1 
ATOM   8354  O OD2 . ASP C 1 362 ? 35.121  -21.341 -30.846 1.00 78.80  ? 362 ASP C OD2 1 
ATOM   8355  N N   . HIS C 1 363 ? 38.359  -22.283 -35.324 1.00 61.93  ? 363 HIS C N   1 
ATOM   8356  C CA  . HIS C 1 363 ? 39.646  -22.151 -35.998 1.00 63.53  ? 363 HIS C CA  1 
ATOM   8357  C C   . HIS C 1 363 ? 39.485  -21.386 -37.313 1.00 61.39  ? 363 HIS C C   1 
ATOM   8358  O O   . HIS C 1 363 ? 40.042  -20.287 -37.511 1.00 58.81  ? 363 HIS C O   1 
ATOM   8359  C CB  . HIS C 1 363 ? 40.226  -23.551 -36.245 1.00 45.78  ? 363 HIS C CB  1 
ATOM   8360  C CG  . HIS C 1 363 ? 41.621  -23.558 -36.786 1.00 64.44  ? 363 HIS C CG  1 
ATOM   8361  N ND1 . HIS C 1 363 ? 41.926  -24.031 -38.046 1.00 66.50  ? 363 HIS C ND1 1 
ATOM   8362  C CD2 . HIS C 1 363 ? 42.797  -23.180 -36.232 1.00 66.36  ? 363 HIS C CD2 1 
ATOM   8363  C CE1 . HIS C 1 363 ? 43.226  -23.930 -38.248 1.00 66.40  ? 363 HIS C CE1 1 
ATOM   8364  N NE2 . HIS C 1 363 ? 43.780  -23.417 -37.163 1.00 55.92  ? 363 HIS C NE2 1 
ATOM   8365  N N   . GLU C 1 364 ? 38.675  -21.956 -38.195 1.00 64.57  ? 364 GLU C N   1 
ATOM   8366  C CA  . GLU C 1 364 ? 38.475  -21.383 -39.518 1.00 66.89  ? 364 GLU C CA  1 
ATOM   8367  C C   . GLU C 1 364 ? 37.579  -20.138 -39.490 1.00 54.53  ? 364 GLU C C   1 
ATOM   8368  O O   . GLU C 1 364 ? 37.663  -19.297 -40.383 1.00 60.27  ? 364 GLU C O   1 
ATOM   8369  C CB  . GLU C 1 364 ? 37.931  -22.450 -40.471 1.00 80.95  ? 364 GLU C CB  1 
ATOM   8370  C CG  . GLU C 1 364 ? 38.874  -23.646 -40.579 1.00 94.49  ? 364 GLU C CG  1 
ATOM   8371  C CD  . GLU C 1 364 ? 38.410  -24.696 -41.569 1.00 102.97 ? 364 GLU C CD  1 
ATOM   8372  O OE1 . GLU C 1 364 ? 37.231  -24.665 -41.986 1.00 84.18  ? 364 GLU C OE1 1 
ATOM   8373  O OE2 . GLU C 1 364 ? 39.240  -25.553 -41.943 1.00 110.37 ? 364 GLU C OE2 1 
ATOM   8374  N N   . GLU C 1 365 ? 36.706  -20.029 -38.491 1.00 59.57  ? 365 GLU C N   1 
ATOM   8375  C CA  . GLU C 1 365 ? 35.938  -18.797 -38.319 1.00 56.49  ? 365 GLU C CA  1 
ATOM   8376  C C   . GLU C 1 365 ? 36.844  -17.646 -37.905 1.00 62.29  ? 365 GLU C C   1 
ATOM   8377  O O   . GLU C 1 365 ? 36.631  -16.516 -38.323 1.00 56.73  ? 365 GLU C O   1 
ATOM   8378  C CB  . GLU C 1 365 ? 34.823  -18.958 -37.285 1.00 57.42  ? 365 GLU C CB  1 
ATOM   8379  C CG  . GLU C 1 365 ? 33.511  -19.481 -37.842 1.00 58.58  ? 365 GLU C CG  1 
ATOM   8380  C CD  . GLU C 1 365 ? 32.388  -19.407 -36.828 1.00 65.88  ? 365 GLU C CD  1 
ATOM   8381  O OE1 . GLU C 1 365 ? 31.211  -19.483 -37.238 1.00 61.23  ? 365 GLU C OE1 1 
ATOM   8382  O OE2 . GLU C 1 365 ? 32.682  -19.275 -35.620 1.00 75.07  ? 365 GLU C OE2 1 
ATOM   8383  N N   . TRP C 1 366 ? 37.841  -17.931 -37.071 1.00 58.48  ? 366 TRP C N   1 
ATOM   8384  C CA  . TRP C 1 366 ? 38.815  -16.916 -36.679 1.00 50.13  ? 366 TRP C CA  1 
ATOM   8385  C C   . TRP C 1 366 ? 39.635  -16.485 -37.884 1.00 52.72  ? 366 TRP C C   1 
ATOM   8386  O O   . TRP C 1 366 ? 39.769  -15.284 -38.159 1.00 51.35  ? 366 TRP C O   1 
ATOM   8387  C CB  . TRP C 1 366 ? 39.741  -17.425 -35.570 1.00 46.54  ? 366 TRP C CB  1 
ATOM   8388  C CG  . TRP C 1 366 ? 39.239  -17.142 -34.185 1.00 50.69  ? 366 TRP C CG  1 
ATOM   8389  C CD1 . TRP C 1 366 ? 38.878  -18.057 -33.239 1.00 43.56  ? 366 TRP C CD1 1 
ATOM   8390  C CD2 . TRP C 1 366 ? 39.033  -15.853 -33.594 1.00 51.60  ? 366 TRP C CD2 1 
ATOM   8391  N NE1 . TRP C 1 366 ? 38.464  -17.419 -32.096 1.00 51.26  ? 366 TRP C NE1 1 
ATOM   8392  C CE2 . TRP C 1 366 ? 38.549  -16.067 -32.287 1.00 54.44  ? 366 TRP C CE2 1 
ATOM   8393  C CE3 . TRP C 1 366 ? 39.211  -14.541 -34.042 1.00 38.45  ? 366 TRP C CE3 1 
ATOM   8394  C CZ2 . TRP C 1 366 ? 38.242  -15.015 -31.425 1.00 44.15  ? 366 TRP C CZ2 1 
ATOM   8395  C CZ3 . TRP C 1 366 ? 38.905  -13.500 -33.186 1.00 29.65  ? 366 TRP C CZ3 1 
ATOM   8396  C CH2 . TRP C 1 366 ? 38.426  -13.743 -31.891 1.00 48.91  ? 366 TRP C CH2 1 
ATOM   8397  N N   . ILE C 1 367 ? 40.176  -17.469 -38.601 1.00 47.09  ? 367 ILE C N   1 
ATOM   8398  C CA  . ILE C 1 367 ? 40.962  -17.178 -39.800 1.00 53.73  ? 367 ILE C CA  1 
ATOM   8399  C C   . ILE C 1 367 ? 40.156  -16.324 -40.781 1.00 54.54  ? 367 ILE C C   1 
ATOM   8400  O O   . ILE C 1 367 ? 40.603  -15.258 -41.229 1.00 48.89  ? 367 ILE C O   1 
ATOM   8401  C CB  . ILE C 1 367 ? 41.406  -18.470 -40.511 1.00 49.22  ? 367 ILE C CB  1 
ATOM   8402  C CG1 . ILE C 1 367 ? 42.348  -19.278 -39.616 1.00 55.95  ? 367 ILE C CG1 1 
ATOM   8403  C CG2 . ILE C 1 367 ? 42.067  -18.151 -41.843 1.00 41.75  ? 367 ILE C CG2 1 
ATOM   8404  C CD1 . ILE C 1 367 ? 42.683  -20.646 -40.165 1.00 58.33  ? 367 ILE C CD1 1 
ATOM   8405  N N   . CYS C 1 368 ? 38.951  -16.795 -41.081 1.00 51.91  ? 368 CYS C N   1 
ATOM   8406  C CA  . CYS C 1 368 ? 38.074  -16.143 -42.042 1.00 49.23  ? 368 CYS C CA  1 
ATOM   8407  C C   . CYS C 1 368 ? 37.659  -14.743 -41.606 1.00 49.80  ? 368 CYS C C   1 
ATOM   8408  O O   . CYS C 1 368 ? 37.610  -13.830 -42.421 1.00 60.51  ? 368 CYS C O   1 
ATOM   8409  C CB  . CYS C 1 368 ? 36.830  -16.995 -42.281 1.00 54.27  ? 368 CYS C CB  1 
ATOM   8410  S SG  . CYS C 1 368 ? 35.746  -16.372 -43.570 1.00 82.93  ? 368 CYS C SG  1 
ATOM   8411  N N   . THR C 1 369 ? 37.347  -14.583 -40.324 1.00 46.45  ? 369 THR C N   1 
ATOM   8412  C CA  . THR C 1 369 ? 36.920  -13.292 -39.797 1.00 40.65  ? 369 THR C CA  1 
ATOM   8413  C C   . THR C 1 369 ? 38.048  -12.277 -39.875 1.00 39.10  ? 369 THR C C   1 
ATOM   8414  O O   . THR C 1 369 ? 37.840  -11.139 -40.298 1.00 36.09  ? 369 THR C O   1 
ATOM   8415  C CB  . THR C 1 369 ? 36.441  -13.398 -38.338 1.00 34.75  ? 369 THR C CB  1 
ATOM   8416  O OG1 . THR C 1 369 ? 35.331  -14.300 -38.264 1.00 46.52  ? 369 THR C OG1 1 
ATOM   8417  C CG2 . THR C 1 369 ? 36.016  -12.035 -37.812 1.00 35.74  ? 369 THR C CG2 1 
ATOM   8418  N N   . ILE C 1 370 ? 39.245  -12.694 -39.474 1.00 44.72  ? 370 ILE C N   1 
ATOM   8419  C CA  . ILE C 1 370 ? 40.403  -11.811 -39.536 1.00 42.89  ? 370 ILE C CA  1 
ATOM   8420  C C   . ILE C 1 370 ? 40.703  -11.420 -40.983 1.00 43.76  ? 370 ILE C C   1 
ATOM   8421  O O   . ILE C 1 370 ? 41.010  -10.260 -41.266 1.00 41.61  ? 370 ILE C O   1 
ATOM   8422  C CB  . ILE C 1 370 ? 41.639  -12.461 -38.885 1.00 57.43  ? 370 ILE C CB  1 
ATOM   8423  C CG1 . ILE C 1 370 ? 41.425  -12.580 -37.374 1.00 41.86  ? 370 ILE C CG1 1 
ATOM   8424  C CG2 . ILE C 1 370 ? 42.893  -11.647 -39.167 1.00 48.22  ? 370 ILE C CG2 1 
ATOM   8425  C CD1 . ILE C 1 370 ? 42.375  -13.530 -36.690 1.00 43.30  ? 370 ILE C CD1 1 
ATOM   8426  N N   . ASN C 1 371 ? 40.591  -12.377 -41.901 1.00 48.43  ? 371 ASN C N   1 
ATOM   8427  C CA  . ASN C 1 371 ? 40.712  -12.064 -43.325 1.00 37.66  ? 371 ASN C CA  1 
ATOM   8428  C C   . ASN C 1 371 ? 39.647  -11.079 -43.817 1.00 50.40  ? 371 ASN C C   1 
ATOM   8429  O O   . ASN C 1 371 ? 39.934  -10.203 -44.634 1.00 61.34  ? 371 ASN C O   1 
ATOM   8430  C CB  . ASN C 1 371 ? 40.660  -13.344 -44.160 1.00 46.64  ? 371 ASN C CB  1 
ATOM   8431  C CG  . ASN C 1 371 ? 41.967  -14.111 -44.128 1.00 57.14  ? 371 ASN C CG  1 
ATOM   8432  O OD1 . ASN C 1 371 ? 43.043  -13.532 -44.288 1.00 59.96  ? 371 ASN C OD1 1 
ATOM   8433  N ND2 . ASN C 1 371 ? 41.882  -15.419 -43.919 1.00 53.43  ? 371 ASN C ND2 1 
ATOM   8434  N N   . ASN C 1 372 ? 38.422  -11.230 -43.321 1.00 48.48  ? 372 ASN C N   1 
ATOM   8435  C CA  . ASN C 1 372 ? 37.322  -10.334 -43.670 1.00 46.01  ? 372 ASN C CA  1 
ATOM   8436  C C   . ASN C 1 372 ? 37.545  -8.912  -43.173 1.00 44.78  ? 372 ASN C C   1 
ATOM   8437  O O   . ASN C 1 372 ? 37.194  -7.945  -43.849 1.00 47.94  ? 372 ASN C O   1 
ATOM   8438  C CB  . ASN C 1 372 ? 35.998  -10.861 -43.108 1.00 30.03  ? 372 ASN C CB  1 
ATOM   8439  C CG  . ASN C 1 372 ? 35.552  -12.148 -43.770 1.00 47.52  ? 372 ASN C CG  1 
ATOM   8440  O OD1 . ASN C 1 372 ? 36.120  -12.572 -44.775 1.00 51.31  ? 372 ASN C OD1 1 
ATOM   8441  N ND2 . ASN C 1 372 ? 34.528  -12.780 -43.206 1.00 48.59  ? 372 ASN C ND2 1 
ATOM   8442  N N   . ILE C 1 373 ? 38.126  -8.793  -41.984 1.00 46.67  ? 373 ILE C N   1 
ATOM   8443  C CA  . ILE C 1 373 ? 38.373  -7.491  -41.378 1.00 46.06  ? 373 ILE C CA  1 
ATOM   8444  C C   . ILE C 1 373 ? 39.525  -6.761  -42.064 1.00 40.46  ? 373 ILE C C   1 
ATOM   8445  O O   . ILE C 1 373 ? 39.446  -5.555  -42.307 1.00 42.11  ? 373 ILE C O   1 
ATOM   8446  C CB  . ILE C 1 373 ? 38.674  -7.627  -39.868 1.00 42.61  ? 373 ILE C CB  1 
ATOM   8447  C CG1 . ILE C 1 373 ? 37.450  -8.177  -39.134 1.00 38.38  ? 373 ILE C CG1 1 
ATOM   8448  C CG2 . ILE C 1 373 ? 39.085  -6.288  -39.274 1.00 33.94  ? 373 ILE C CG2 1 
ATOM   8449  C CD1 . ILE C 1 373 ? 37.649  -8.332  -37.644 1.00 47.51  ? 373 ILE C CD1 1 
ATOM   8450  N N   . SER C 1 374 ? 40.584  -7.492  -42.396 1.00 40.61  ? 374 SER C N   1 
ATOM   8451  C CA  . SER C 1 374 ? 41.752  -6.879  -43.020 1.00 44.20  ? 374 SER C CA  1 
ATOM   8452  C C   . SER C 1 374 ? 41.562  -6.609  -44.511 1.00 42.17  ? 374 SER C C   1 
ATOM   8453  O O   . SER C 1 374 ? 40.559  -6.996  -45.106 1.00 44.10  ? 374 SER C O   1 
ATOM   8454  C CB  . SER C 1 374 ? 42.981  -7.767  -42.820 1.00 37.79  ? 374 SER C CB  1 
ATOM   8455  O OG  . SER C 1 374 ? 44.082  -7.295  -43.575 1.00 48.64  ? 374 SER C OG  1 
ATOM   8456  N N   . LYS C 1 375 ? 42.554  -5.951  -45.101 1.00 47.68  ? 375 LYS C N   1 
ATOM   8457  C CA  . LYS C 1 375 ? 42.548  -5.615  -46.520 1.00 52.29  ? 375 LYS C CA  1 
ATOM   8458  C C   . LYS C 1 375 ? 42.605  -6.858  -47.405 1.00 51.32  ? 375 LYS C C   1 
ATOM   8459  O O   . LYS C 1 375 ? 41.948  -6.925  -48.444 1.00 49.19  ? 375 LYS C O   1 
ATOM   8460  C CB  . LYS C 1 375 ? 43.714  -4.676  -46.829 1.00 53.37  ? 375 LYS C CB  1 
ATOM   8461  C CG  . LYS C 1 375 ? 43.674  -3.408  -45.987 1.00 70.91  ? 375 LYS C CG  1 
ATOM   8462  C CD  . LYS C 1 375 ? 44.741  -2.404  -46.383 1.00 76.85  ? 375 LYS C CD  1 
ATOM   8463  C CE  . LYS C 1 375 ? 44.794  -1.263  -45.375 1.00 82.51  ? 375 LYS C CE  1 
ATOM   8464  N NZ  . LYS C 1 375 ? 45.821  -0.243  -45.718 1.00 93.97  ? 375 LYS C NZ  1 
ATOM   8465  N N   . ASP D 2 5   ? 22.223  -2.420  -12.390 1.00 114.43 ? 5   ASP D N   1 
ATOM   8466  C CA  . ASP D 2 5   ? 21.778  -3.261  -13.494 1.00 117.18 ? 5   ASP D CA  1 
ATOM   8467  C C   . ASP D 2 5   ? 21.439  -4.669  -13.015 1.00 114.22 ? 5   ASP D C   1 
ATOM   8468  O O   . ASP D 2 5   ? 21.294  -4.912  -11.815 1.00 86.76  ? 5   ASP D O   1 
ATOM   8469  C CB  . ASP D 2 5   ? 22.847  -3.320  -14.589 1.00 70.55  ? 5   ASP D CB  1 
ATOM   8470  N N   . LYS D 2 6   ? 21.305  -5.591  -13.964 1.00 109.03 ? 6   LYS D N   1 
ATOM   8471  C CA  . LYS D 2 6   ? 21.041  -6.990  -13.652 1.00 76.53  ? 6   LYS D CA  1 
ATOM   8472  C C   . LYS D 2 6   ? 22.052  -7.887  -14.352 1.00 74.29  ? 6   LYS D C   1 
ATOM   8473  O O   . LYS D 2 6   ? 22.666  -7.486  -15.341 1.00 75.36  ? 6   LYS D O   1 
ATOM   8474  C CB  . LYS D 2 6   ? 19.624  -7.384  -14.076 1.00 61.51  ? 6   LYS D CB  1 
ATOM   8475  C CG  . LYS D 2 6   ? 18.525  -6.461  -13.578 1.00 71.26  ? 6   LYS D CG  1 
ATOM   8476  C CD  . LYS D 2 6   ? 17.152  -7.046  -13.879 1.00 81.18  ? 6   LYS D CD  1 
ATOM   8477  C CE  . LYS D 2 6   ? 16.157  -5.965  -14.274 1.00 78.43  ? 6   LYS D CE  1 
ATOM   8478  N NZ  . LYS D 2 6   ? 14.751  -6.389  -14.031 1.00 88.62  ? 6   LYS D NZ  1 
ATOM   8479  N N   . LEU D 2 7   ? 22.228  -9.099  -13.838 1.00 64.36  ? 7   LEU D N   1 
ATOM   8480  C CA  . LEU D 2 7   ? 23.038  -10.096 -14.525 1.00 62.80  ? 7   LEU D CA  1 
ATOM   8481  C C   . LEU D 2 7   ? 22.227  -10.727 -15.649 1.00 71.56  ? 7   LEU D C   1 
ATOM   8482  O O   . LEU D 2 7   ? 21.078  -11.119 -15.448 1.00 94.37  ? 7   LEU D O   1 
ATOM   8483  C CB  . LEU D 2 7   ? 23.527  -11.174 -13.555 1.00 58.67  ? 7   LEU D CB  1 
ATOM   8484  C CG  . LEU D 2 7   ? 24.547  -10.747 -12.497 1.00 56.46  ? 7   LEU D CG  1 
ATOM   8485  C CD1 . LEU D 2 7   ? 24.719  -11.835 -11.449 1.00 44.48  ? 7   LEU D CD1 1 
ATOM   8486  C CD2 . LEU D 2 7   ? 25.879  -10.410 -13.149 1.00 73.01  ? 7   LEU D CD2 1 
ATOM   8487  N N   . LEU D 2 8   ? 22.826  -10.824 -16.831 1.00 67.31  ? 8   LEU D N   1 
ATOM   8488  C CA  . LEU D 2 8   ? 22.146  -11.422 -17.973 1.00 63.67  ? 8   LEU D CA  1 
ATOM   8489  C C   . LEU D 2 8   ? 22.426  -12.917 -18.042 1.00 59.29  ? 8   LEU D C   1 
ATOM   8490  O O   . LEU D 2 8   ? 23.570  -13.338 -18.216 1.00 65.94  ? 8   LEU D O   1 
ATOM   8491  C CB  . LEU D 2 8   ? 22.567  -10.752 -19.286 1.00 71.89  ? 8   LEU D CB  1 
ATOM   8492  C CG  . LEU D 2 8   ? 22.192  -9.288  -19.548 1.00 59.22  ? 8   LEU D CG  1 
ATOM   8493  C CD1 . LEU D 2 8   ? 20.731  -9.031  -19.198 1.00 61.72  ? 8   LEU D CD1 1 
ATOM   8494  C CD2 . LEU D 2 8   ? 23.113  -8.314  -18.821 1.00 85.76  ? 8   LEU D CD2 1 
ATOM   8495  N N   . LEU D 2 9   ? 21.370  -13.713 -17.900 1.00 63.50  ? 9   LEU D N   1 
ATOM   8496  C CA  . LEU D 2 9   ? 21.483  -15.166 -17.950 1.00 62.69  ? 9   LEU D CA  1 
ATOM   8497  C C   . LEU D 2 9   ? 21.936  -15.634 -19.326 1.00 75.79  ? 9   LEU D C   1 
ATOM   8498  O O   . LEU D 2 9   ? 22.603  -16.660 -19.453 1.00 72.54  ? 9   LEU D O   1 
ATOM   8499  C CB  . LEU D 2 9   ? 20.151  -15.826 -17.593 1.00 73.54  ? 9   LEU D CB  1 
ATOM   8500  C CG  . LEU D 2 9   ? 19.588  -15.555 -16.200 1.00 75.61  ? 9   LEU D CG  1 
ATOM   8501  C CD1 . LEU D 2 9   ? 18.171  -16.087 -16.094 1.00 76.68  ? 9   LEU D CD1 1 
ATOM   8502  C CD2 . LEU D 2 9   ? 20.479  -16.192 -15.150 1.00 72.63  ? 9   LEU D CD2 1 
ATOM   8503  N N   . GLU D 2 10  ? 21.569  -14.877 -20.354 1.00 79.93  ? 10  GLU D N   1 
ATOM   8504  C CA  . GLU D 2 10  ? 21.891  -15.246 -21.726 1.00 65.93  ? 10  GLU D CA  1 
ATOM   8505  C C   . GLU D 2 10  ? 23.378  -15.101 -22.023 1.00 70.65  ? 10  GLU D C   1 
ATOM   8506  O O   . GLU D 2 10  ? 23.877  -15.649 -23.006 1.00 69.61  ? 10  GLU D O   1 
ATOM   8507  C CB  . GLU D 2 10  ? 21.081  -14.396 -22.708 1.00 54.80  ? 10  GLU D CB  1 
ATOM   8508  N N   . GLU D 2 11  ? 24.084  -14.358 -21.178 1.00 53.93  ? 11  GLU D N   1 
ATOM   8509  C CA  . GLU D 2 11  ? 25.514  -14.161 -21.370 1.00 62.92  ? 11  GLU D CA  1 
ATOM   8510  C C   . GLU D 2 11  ? 26.351  -15.135 -20.532 1.00 54.55  ? 11  GLU D C   1 
ATOM   8511  O O   . GLU D 2 11  ? 27.581  -15.097 -20.566 1.00 59.57  ? 11  GLU D O   1 
ATOM   8512  C CB  . GLU D 2 11  ? 25.892  -12.719 -21.026 1.00 49.45  ? 11  GLU D CB  1 
ATOM   8513  C CG  . GLU D 2 11  ? 25.480  -11.698 -22.086 1.00 74.92  ? 11  GLU D CG  1 
ATOM   8514  C CD  . GLU D 2 11  ? 25.717  -12.175 -23.507 1.00 94.02  ? 11  GLU D CD  1 
ATOM   8515  O OE1 . GLU D 2 11  ? 26.859  -12.560 -23.832 1.00 85.96  ? 11  GLU D OE1 1 
ATOM   8516  O OE2 . GLU D 2 11  ? 24.752  -12.162 -24.302 1.00 86.55  ? 11  GLU D OE2 1 
ATOM   8517  N N   . ALA D 2 12  ? 25.676  -16.007 -19.788 1.00 65.38  ? 12  ALA D N   1 
ATOM   8518  C CA  . ALA D 2 12  ? 26.343  -16.910 -18.849 1.00 58.62  ? 12  ALA D CA  1 
ATOM   8519  C C   . ALA D 2 12  ? 27.249  -17.949 -19.509 1.00 57.87  ? 12  ALA D C   1 
ATOM   8520  O O   . ALA D 2 12  ? 28.394  -18.127 -19.092 1.00 70.93  ? 12  ALA D O   1 
ATOM   8521  C CB  . ALA D 2 12  ? 25.306  -17.612 -17.983 1.00 55.83  ? 12  ALA D CB  1 
ATOM   8522  N N   . LEU D 2 13  ? 26.735  -18.636 -20.525 1.00 58.85  ? 13  LEU D N   1 
ATOM   8523  C CA  . LEU D 2 13  ? 27.478  -19.715 -21.174 1.00 60.55  ? 13  LEU D CA  1 
ATOM   8524  C C   . LEU D 2 13  ? 28.792  -19.224 -21.773 1.00 59.43  ? 13  LEU D C   1 
ATOM   8525  O O   . LEU D 2 13  ? 29.818  -19.899 -21.673 1.00 54.44  ? 13  LEU D O   1 
ATOM   8526  C CB  . LEU D 2 13  ? 26.629  -20.381 -22.259 1.00 66.76  ? 13  LEU D CB  1 
ATOM   8527  C CG  . LEU D 2 13  ? 27.319  -21.510 -23.029 1.00 60.06  ? 13  LEU D CG  1 
ATOM   8528  C CD1 . LEU D 2 13  ? 27.843  -22.575 -22.075 1.00 47.67  ? 13  LEU D CD1 1 
ATOM   8529  C CD2 . LEU D 2 13  ? 26.378  -22.121 -24.055 1.00 64.41  ? 13  LEU D CD2 1 
ATOM   8530  N N   . GLN D 2 14  ? 28.752  -18.052 -22.400 1.00 60.03  ? 14  GLN D N   1 
ATOM   8531  C CA  . GLN D 2 14  ? 29.945  -17.456 -22.990 1.00 51.10  ? 14  GLN D CA  1 
ATOM   8532  C C   . GLN D 2 14  ? 31.000  -17.197 -21.919 1.00 56.54  ? 14  GLN D C   1 
ATOM   8533  O O   . GLN D 2 14  ? 32.187  -17.447 -22.133 1.00 57.85  ? 14  GLN D O   1 
ATOM   8534  C CB  . GLN D 2 14  ? 29.590  -16.158 -23.718 1.00 53.78  ? 14  GLN D CB  1 
ATOM   8535  C CG  . GLN D 2 14  ? 30.781  -15.437 -24.328 1.00 57.06  ? 14  GLN D CG  1 
ATOM   8536  C CD  . GLN D 2 14  ? 30.385  -14.157 -25.037 1.00 61.88  ? 14  GLN D CD  1 
ATOM   8537  O OE1 . GLN D 2 14  ? 29.558  -13.390 -24.543 1.00 66.65  ? 14  GLN D OE1 1 
ATOM   8538  N NE2 . GLN D 2 14  ? 30.972  -13.921 -26.205 1.00 76.45  ? 14  GLN D NE2 1 
ATOM   8539  N N   . ASP D 2 15  ? 30.549  -16.696 -20.770 1.00 57.10  ? 15  ASP D N   1 
ATOM   8540  C CA  . ASP D 2 15  ? 31.403  -16.487 -19.602 1.00 48.64  ? 15  ASP D CA  1 
ATOM   8541  C C   . ASP D 2 15  ? 32.588  -15.575 -19.915 1.00 50.94  ? 15  ASP D C   1 
ATOM   8542  O O   . ASP D 2 15  ? 33.740  -15.917 -19.647 1.00 38.95  ? 15  ASP D O   1 
ATOM   8543  C CB  . ASP D 2 15  ? 31.895  -17.830 -19.052 1.00 56.48  ? 15  ASP D CB  1 
ATOM   8544  C CG  . ASP D 2 15  ? 32.398  -17.727 -17.624 1.00 81.13  ? 15  ASP D CG  1 
ATOM   8545  O OD1 . ASP D 2 15  ? 31.575  -17.472 -16.719 1.00 79.16  ? 15  ASP D OD1 1 
ATOM   8546  O OD2 . ASP D 2 15  ? 33.615  -17.904 -17.406 1.00 85.63  ? 15  ASP D OD2 1 
ATOM   8547  N N   . SER D 2 16  ? 32.293  -14.415 -20.492 1.00 53.42  ? 16  SER D N   1 
ATOM   8548  C CA  . SER D 2 16  ? 33.314  -13.424 -20.809 1.00 48.69  ? 16  SER D CA  1 
ATOM   8549  C C   . SER D 2 16  ? 33.815  -12.742 -19.537 1.00 54.75  ? 16  SER D C   1 
ATOM   8550  O O   . SER D 2 16  ? 33.108  -12.712 -18.531 1.00 50.91  ? 16  SER D O   1 
ATOM   8551  C CB  . SER D 2 16  ? 32.757  -12.386 -21.787 1.00 50.78  ? 16  SER D CB  1 
ATOM   8552  O OG  . SER D 2 16  ? 31.557  -11.817 -21.295 1.00 58.15  ? 16  SER D OG  1 
ATOM   8553  N N   . PRO D 2 17  ? 35.046  -12.203 -19.573 1.00 54.79  ? 17  PRO D N   1 
ATOM   8554  C CA  . PRO D 2 17  ? 35.620  -11.524 -18.406 1.00 51.91  ? 17  PRO D CA  1 
ATOM   8555  C C   . PRO D 2 17  ? 34.795  -10.320 -17.951 1.00 59.95  ? 17  PRO D C   1 
ATOM   8556  O O   . PRO D 2 17  ? 34.875  -9.936  -16.785 1.00 78.14  ? 17  PRO D O   1 
ATOM   8557  C CB  . PRO D 2 17  ? 37.000  -11.081 -18.902 1.00 58.23  ? 17  PRO D CB  1 
ATOM   8558  C CG  . PRO D 2 17  ? 37.331  -12.038 -19.987 1.00 54.27  ? 17  PRO D CG  1 
ATOM   8559  C CD  . PRO D 2 17  ? 36.027  -12.340 -20.663 1.00 48.93  ? 17  PRO D CD  1 
ATOM   8560  N N   . GLN D 2 18  ? 34.020  -9.735  -18.858 1.00 54.19  ? 18  GLN D N   1 
ATOM   8561  C CA  . GLN D 2 18  ? 33.126  -8.638  -18.500 1.00 59.82  ? 18  GLN D CA  1 
ATOM   8562  C C   . GLN D 2 18  ? 31.985  -9.158  -17.625 1.00 62.10  ? 18  GLN D C   1 
ATOM   8563  O O   . GLN D 2 18  ? 31.637  -8.555  -16.599 1.00 69.49  ? 18  GLN D O   1 
ATOM   8564  C CB  . GLN D 2 18  ? 32.574  -7.961  -19.756 1.00 42.99  ? 18  GLN D CB  1 
ATOM   8565  N N   . THR D 2 19  ? 31.416  -10.287 -18.041 1.00 51.09  ? 19  THR D N   1 
ATOM   8566  C CA  . THR D 2 19  ? 30.396  -10.980 -17.263 1.00 54.85  ? 19  THR D CA  1 
ATOM   8567  C C   . THR D 2 19  ? 30.936  -11.304 -15.875 1.00 52.80  ? 19  THR D C   1 
ATOM   8568  O O   . THR D 2 19  ? 30.260  -11.091 -14.866 1.00 66.11  ? 19  THR D O   1 
ATOM   8569  C CB  . THR D 2 19  ? 29.937  -12.278 -17.958 1.00 46.11  ? 19  THR D CB  1 
ATOM   8570  O OG1 . THR D 2 19  ? 29.356  -11.965 -19.230 1.00 49.50  ? 19  THR D OG1 1 
ATOM   8571  C CG2 . THR D 2 19  ? 28.914  -13.013 -17.105 1.00 38.30  ? 19  THR D CG2 1 
ATOM   8572  N N   . ARG D 2 20  ? 32.163  -11.813 -15.838 1.00 49.69  ? 20  ARG D N   1 
ATOM   8573  C CA  . ARG D 2 20  ? 32.840  -12.107 -14.581 1.00 52.14  ? 20  ARG D CA  1 
ATOM   8574  C C   . ARG D 2 20  ? 33.027  -10.848 -13.742 1.00 58.39  ? 20  ARG D C   1 
ATOM   8575  O O   . ARG D 2 20  ? 32.993  -10.906 -12.515 1.00 67.73  ? 20  ARG D O   1 
ATOM   8576  C CB  . ARG D 2 20  ? 34.195  -12.769 -14.839 1.00 36.96  ? 20  ARG D CB  1 
ATOM   8577  C CG  . ARG D 2 20  ? 34.127  -14.271 -15.072 1.00 57.81  ? 20  ARG D CG  1 
ATOM   8578  C CD  . ARG D 2 20  ? 33.152  -14.948 -14.118 1.00 60.06  ? 20  ARG D CD  1 
ATOM   8579  N NE  . ARG D 2 20  ? 33.028  -16.377 -14.394 1.00 67.44  ? 20  ARG D NE  1 
ATOM   8580  C CZ  . ARG D 2 20  ? 33.781  -17.315 -13.828 1.00 64.53  ? 20  ARG D CZ  1 
ATOM   8581  N NH1 . ARG D 2 20  ? 34.710  -16.977 -12.944 1.00 72.94  ? 20  ARG D NH1 1 
ATOM   8582  N NH2 . ARG D 2 20  ? 33.602  -18.591 -14.140 1.00 65.17  ? 20  ARG D NH2 1 
ATOM   8583  N N   . SER D 2 21  ? 33.241  -9.716  -14.406 1.00 47.42  ? 21  SER D N   1 
ATOM   8584  C CA  . SER D 2 21  ? 33.419  -8.446  -13.711 1.00 55.56  ? 21  SER D CA  1 
ATOM   8585  C C   . SER D 2 21  ? 32.134  -8.024  -13.000 1.00 60.47  ? 21  SER D C   1 
ATOM   8586  O O   . SER D 2 21  ? 32.140  -7.707  -11.800 1.00 66.36  ? 21  SER D O   1 
ATOM   8587  C CB  . SER D 2 21  ? 33.860  -7.356  -14.692 1.00 53.98  ? 21  SER D CB  1 
ATOM   8588  O OG  . SER D 2 21  ? 35.213  -7.530  -15.075 1.00 63.16  ? 21  SER D OG  1 
ATOM   8589  N N   . LEU D 2 22  ? 31.029  -8.046  -13.741 1.00 48.42  ? 22  LEU D N   1 
ATOM   8590  C CA  . LEU D 2 22  ? 29.740  -7.664  -13.172 1.00 61.29  ? 22  LEU D CA  1 
ATOM   8591  C C   . LEU D 2 22  ? 29.345  -8.632  -12.057 1.00 65.61  ? 22  LEU D C   1 
ATOM   8592  O O   . LEU D 2 22  ? 28.812  -8.227  -11.013 1.00 74.24  ? 22  LEU D O   1 
ATOM   8593  C CB  . LEU D 2 22  ? 28.666  -7.624  -14.261 1.00 70.55  ? 22  LEU D CB  1 
ATOM   8594  C CG  . LEU D 2 22  ? 28.880  -6.551  -15.332 1.00 85.48  ? 22  LEU D CG  1 
ATOM   8595  C CD1 . LEU D 2 22  ? 27.880  -6.701  -16.470 1.00 68.12  ? 22  LEU D CD1 1 
ATOM   8596  C CD2 . LEU D 2 22  ? 28.809  -5.157  -14.726 1.00 88.64  ? 22  LEU D CD2 1 
ATOM   8597  N N   . LEU D 2 23  ? 29.636  -9.911  -12.281 1.00 55.27  ? 23  LEU D N   1 
ATOM   8598  C CA  . LEU D 2 23  ? 29.401  -10.942 -11.280 1.00 54.15  ? 23  LEU D CA  1 
ATOM   8599  C C   . LEU D 2 23  ? 30.183  -10.644 -10.007 1.00 63.51  ? 23  LEU D C   1 
ATOM   8600  O O   . LEU D 2 23  ? 29.656  -10.769 -8.905  1.00 61.71  ? 23  LEU D O   1 
ATOM   8601  C CB  . LEU D 2 23  ? 29.787  -12.320 -11.820 1.00 51.15  ? 23  LEU D CB  1 
ATOM   8602  C CG  . LEU D 2 23  ? 29.595  -13.476 -10.837 1.00 48.71  ? 23  LEU D CG  1 
ATOM   8603  C CD1 . LEU D 2 23  ? 28.152  -13.539 -10.376 1.00 46.71  ? 23  LEU D CD1 1 
ATOM   8604  C CD2 . LEU D 2 23  ? 30.019  -14.795 -11.456 1.00 59.30  ? 23  LEU D CD2 1 
ATOM   8605  N N   . SER D 2 24  ? 31.443  -10.252 -10.171 1.00 59.08  ? 24  SER D N   1 
ATOM   8606  C CA  . SER D 2 24  ? 32.304  -9.914  -9.043  1.00 57.05  ? 24  SER D CA  1 
ATOM   8607  C C   . SER D 2 24  ? 31.735  -8.738  -8.257  1.00 62.08  ? 24  SER D C   1 
ATOM   8608  O O   . SER D 2 24  ? 31.775  -8.727  -7.021  1.00 72.45  ? 24  SER D O   1 
ATOM   8609  C CB  . SER D 2 24  ? 33.721  -9.594  -9.524  1.00 55.42  ? 24  SER D CB  1 
ATOM   8610  O OG  . SER D 2 24  ? 33.789  -8.300  -10.098 1.00 67.32  ? 24  SER D OG  1 
ATOM   8611  N N   . VAL D 2 25  ? 31.201  -7.751  -8.974  1.00 50.21  ? 25  VAL D N   1 
ATOM   8612  C CA  . VAL D 2 25  ? 30.543  -6.621  -8.320  1.00 59.15  ? 25  VAL D CA  1 
ATOM   8613  C C   . VAL D 2 25  ? 29.377  -7.110  -7.455  1.00 66.34  ? 25  VAL D C   1 
ATOM   8614  O O   . VAL D 2 25  ? 29.279  -6.788  -6.250  1.00 63.80  ? 25  VAL D O   1 
ATOM   8615  C CB  . VAL D 2 25  ? 30.026  -5.597  -9.351  1.00 55.20  ? 25  VAL D CB  1 
ATOM   8616  C CG1 . VAL D 2 25  ? 29.091  -4.595  -8.690  1.00 39.97  ? 25  VAL D CG1 1 
ATOM   8617  C CG2 . VAL D 2 25  ? 31.191  -4.889  -10.029 1.00 55.07  ? 25  VAL D CG2 1 
ATOM   8618  N N   . PHE D 2 26  ? 28.508  -7.907  -8.076  1.00 55.36  ? 26  PHE D N   1 
ATOM   8619  C CA  . PHE D 2 26  ? 27.372  -8.504  -7.377  1.00 56.90  ? 26  PHE D CA  1 
ATOM   8620  C C   . PHE D 2 26  ? 27.792  -9.266  -6.119  1.00 63.27  ? 26  PHE D C   1 
ATOM   8621  O O   . PHE D 2 26  ? 27.165  -9.131  -5.069  1.00 57.44  ? 26  PHE D O   1 
ATOM   8622  C CB  . PHE D 2 26  ? 26.601  -9.434  -8.316  1.00 50.68  ? 26  PHE D CB  1 
ATOM   8623  C CG  . PHE D 2 26  ? 25.475  -8.759  -9.046  1.00 51.47  ? 26  PHE D CG  1 
ATOM   8624  C CD1 . PHE D 2 26  ? 25.724  -7.953  -10.144 1.00 61.92  ? 26  PHE D CD1 1 
ATOM   8625  C CD2 . PHE D 2 26  ? 24.164  -8.934  -8.633  1.00 52.30  ? 26  PHE D CD2 1 
ATOM   8626  C CE1 . PHE D 2 26  ? 24.687  -7.332  -10.816 1.00 63.04  ? 26  PHE D CE1 1 
ATOM   8627  C CE2 . PHE D 2 26  ? 23.123  -8.317  -9.300  1.00 68.81  ? 26  PHE D CE2 1 
ATOM   8628  C CZ  . PHE D 2 26  ? 23.385  -7.515  -10.393 1.00 74.43  ? 26  PHE D CZ  1 
ATOM   8629  N N   . GLU D 2 27  ? 28.854  -10.058 -6.230  1.00 66.09  ? 27  GLU D N   1 
ATOM   8630  C CA  . GLU D 2 27  ? 29.370  -10.821 -5.098  1.00 68.62  ? 27  GLU D CA  1 
ATOM   8631  C C   . GLU D 2 27  ? 29.837  -9.899  -3.978  1.00 65.01  ? 27  GLU D C   1 
ATOM   8632  O O   . GLU D 2 27  ? 29.559  -10.145 -2.797  1.00 61.82  ? 27  GLU D O   1 
ATOM   8633  C CB  . GLU D 2 27  ? 30.520  -11.732 -5.537  1.00 65.44  ? 27  GLU D CB  1 
ATOM   8634  C CG  . GLU D 2 27  ? 30.106  -12.827 -6.501  1.00 66.75  ? 27  GLU D CG  1 
ATOM   8635  C CD  . GLU D 2 27  ? 31.263  -13.712 -6.918  1.00 70.27  ? 27  GLU D CD  1 
ATOM   8636  O OE1 . GLU D 2 27  ? 32.425  -13.262 -6.823  1.00 63.14  ? 27  GLU D OE1 1 
ATOM   8637  O OE2 . GLU D 2 27  ? 31.010  -14.863 -7.333  1.00 68.83  ? 27  GLU D OE2 1 
ATOM   8638  N N   . GLU D 2 28  ? 30.553  -8.841  -4.351  1.00 59.38  ? 28  GLU D N   1 
ATOM   8639  C CA  . GLU D 2 28  ? 31.084  -7.907  -3.362  1.00 69.54  ? 28  GLU D CA  1 
ATOM   8640  C C   . GLU D 2 28  ? 29.967  -7.248  -2.564  1.00 75.41  ? 28  GLU D C   1 
ATOM   8641  O O   . GLU D 2 28  ? 30.050  -7.124  -1.330  1.00 69.53  ? 28  GLU D O   1 
ATOM   8642  C CB  . GLU D 2 28  ? 31.938  -6.826  -4.021  1.00 55.74  ? 28  GLU D CB  1 
ATOM   8643  C CG  . GLU D 2 28  ? 32.591  -5.898  -3.003  1.00 87.42  ? 28  GLU D CG  1 
ATOM   8644  C CD  . GLU D 2 28  ? 32.902  -4.525  -3.563  1.00 108.30 ? 28  GLU D CD  1 
ATOM   8645  O OE1 . GLU D 2 28  ? 32.971  -4.388  -4.803  1.00 95.57  ? 28  GLU D OE1 1 
ATOM   8646  O OE2 . GLU D 2 28  ? 33.100  -3.586  -2.761  1.00 106.08 ? 28  GLU D OE2 1 
ATOM   8647  N N   . ASP D 2 29  ? 28.901  -6.853  -3.252  1.00 67.38  ? 29  ASP D N   1 
ATOM   8648  C CA  . ASP D 2 29  ? 27.859  -6.128  -2.545  1.00 65.46  ? 29  ASP D CA  1 
ATOM   8649  C C   . ASP D 2 29  ? 26.885  -7.105  -1.890  1.00 64.78  ? 29  ASP D C   1 
ATOM   8650  O O   . ASP D 2 29  ? 26.124  -6.742  -0.981  1.00 68.54  ? 29  ASP D O   1 
ATOM   8651  C CB  . ASP D 2 29  ? 27.132  -5.200  -3.521  1.00 65.29  ? 29  ASP D CB  1 
ATOM   8652  C CG  . ASP D 2 29  ? 25.808  -4.711  -2.989  1.00 102.00 ? 29  ASP D CG  1 
ATOM   8653  O OD1 . ASP D 2 29  ? 25.793  -3.675  -2.293  1.00 108.91 ? 29  ASP D OD1 1 
ATOM   8654  O OD2 . ASP D 2 29  ? 24.781  -5.370  -3.262  1.00 107.27 ? 29  ASP D OD2 1 
ATOM   8655  N N   . ALA D 2 30  ? 26.998  -8.373  -2.273  1.00 56.83  ? 30  ALA D N   1 
ATOM   8656  C CA  . ALA D 2 30  ? 26.412  -9.455  -1.497  1.00 55.46  ? 30  ALA D CA  1 
ATOM   8657  C C   . ALA D 2 30  ? 27.095  -9.538  -0.140  1.00 54.20  ? 30  ALA D C   1 
ATOM   8658  O O   . ALA D 2 30  ? 26.430  -9.634  0.891   1.00 54.54  ? 30  ALA D O   1 
ATOM   8659  C CB  . ALA D 2 30  ? 26.520  -10.777 -2.239  1.00 48.29  ? 30  ALA D CB  1 
ATOM   8660  N N   . GLY D 2 31  ? 28.426  -9.498  -0.148  1.00 48.48  ? 31  GLY D N   1 
ATOM   8661  C CA  . GLY D 2 31  ? 29.188  -9.509  1.089   1.00 50.57  ? 31  GLY D CA  1 
ATOM   8662  C C   . GLY D 2 31  ? 28.856  -8.328  1.985   1.00 61.28  ? 31  GLY D C   1 
ATOM   8663  O O   . GLY D 2 31  ? 28.617  -8.493  3.193   1.00 50.01  ? 31  GLY D O   1 
ATOM   8664  N N   . THR D 2 32  ? 28.831  -7.136  1.390   1.00 58.91  ? 32  THR D N   1 
ATOM   8665  C CA  . THR D 2 32  ? 28.443  -5.927  2.118   1.00 51.44  ? 32  THR D CA  1 
ATOM   8666  C C   . THR D 2 32  ? 27.078  -6.109  2.786   1.00 67.02  ? 32  THR D C   1 
ATOM   8667  O O   . THR D 2 32  ? 26.904  -5.853  3.999   1.00 52.88  ? 32  THR D O   1 
ATOM   8668  C CB  . THR D 2 32  ? 28.396  -4.703  1.183   1.00 52.43  ? 32  THR D CB  1 
ATOM   8669  O OG1 . THR D 2 32  ? 29.730  -4.302  0.848   1.00 78.26  ? 32  THR D OG1 1 
ATOM   8670  C CG2 . THR D 2 32  ? 27.677  -3.542  1.852   1.00 70.48  ? 32  THR D CG2 1 
ATOM   8671  N N   . LEU D 2 33  ? 26.120  -6.587  1.994   1.00 70.69  ? 33  LEU D N   1 
ATOM   8672  C CA  . LEU D 2 33  ? 24.788  -6.873  2.509   1.00 52.37  ? 33  LEU D CA  1 
ATOM   8673  C C   . LEU D 2 33  ? 24.832  -7.822  3.704   1.00 55.65  ? 33  LEU D C   1 
ATOM   8674  O O   . LEU D 2 33  ? 24.204  -7.563  4.729   1.00 61.75  ? 33  LEU D O   1 
ATOM   8675  C CB  . LEU D 2 33  ? 23.910  -7.472  1.414   1.00 49.78  ? 33  LEU D CB  1 
ATOM   8676  C CG  . LEU D 2 33  ? 22.662  -8.177  1.945   1.00 64.88  ? 33  LEU D CG  1 
ATOM   8677  C CD1 . LEU D 2 33  ? 21.597  -7.167  2.341   1.00 65.68  ? 33  LEU D CD1 1 
ATOM   8678  C CD2 . LEU D 2 33  ? 22.133  -9.172  0.929   1.00 61.20  ? 33  LEU D CD2 1 
ATOM   8679  N N   . THR D 2 34  ? 25.594  -8.904  3.571   1.00 49.74  ? 34  THR D N   1 
ATOM   8680  C CA  . THR D 2 34  ? 25.718  -9.902  4.629   1.00 48.31  ? 34  THR D CA  1 
ATOM   8681  C C   . THR D 2 34  ? 26.207  -9.279  5.932   1.00 63.25  ? 34  THR D C   1 
ATOM   8682  O O   . THR D 2 34  ? 25.628  -9.513  7.000   1.00 52.04  ? 34  THR D O   1 
ATOM   8683  C CB  . THR D 2 34  ? 26.677  -11.037 4.222   1.00 44.11  ? 34  THR D CB  1 
ATOM   8684  O OG1 . THR D 2 34  ? 26.184  -11.681 3.041   1.00 65.40  ? 34  THR D OG1 1 
ATOM   8685  C CG2 . THR D 2 34  ? 26.797  -12.063 5.337   1.00 51.27  ? 34  THR D CG2 1 
ATOM   8686  N N   . ASP D 2 35  ? 27.260  -8.473  5.839   1.00 66.86  ? 35  ASP D N   1 
ATOM   8687  C CA  . ASP D 2 35  ? 27.792  -7.811  7.025   1.00 57.99  ? 35  ASP D CA  1 
ATOM   8688  C C   . ASP D 2 35  ? 26.731  -6.927  7.689   1.00 62.40  ? 35  ASP D C   1 
ATOM   8689  O O   . ASP D 2 35  ? 26.547  -6.979  8.921   1.00 68.01  ? 35  ASP D O   1 
ATOM   8690  C CB  . ASP D 2 35  ? 29.035  -6.991  6.670   1.00 65.71  ? 35  ASP D CB  1 
ATOM   8691  C CG  . ASP D 2 35  ? 30.239  -7.865  6.362   1.00 84.81  ? 35  ASP D CG  1 
ATOM   8692  O OD1 . ASP D 2 35  ? 30.153  -9.092  6.582   1.00 92.60  ? 35  ASP D OD1 1 
ATOM   8693  O OD2 . ASP D 2 35  ? 31.271  -7.329  5.905   1.00 97.96  ? 35  ASP D OD2 1 
ATOM   8694  N N   . TYR D 2 36  ? 26.024  -6.128  6.887   1.00 67.36  ? 36  TYR D N   1 
ATOM   8695  C CA  . TYR D 2 36  ? 24.996  -5.263  7.472   1.00 65.06  ? 36  TYR D CA  1 
ATOM   8696  C C   . TYR D 2 36  ? 23.880  -6.053  8.124   1.00 64.04  ? 36  TYR D C   1 
ATOM   8697  O O   . TYR D 2 36  ? 23.353  -5.654  9.158   1.00 55.84  ? 36  TYR D O   1 
ATOM   8698  C CB  . TYR D 2 36  ? 24.394  -4.313  6.443   1.00 63.18  ? 36  TYR D CB  1 
ATOM   8699  C CG  . TYR D 2 36  ? 23.369  -3.372  7.057   1.00 99.43  ? 36  TYR D CG  1 
ATOM   8700  C CD1 . TYR D 2 36  ? 23.618  -2.764  8.284   1.00 102.16 ? 36  TYR D CD1 1 
ATOM   8701  C CD2 . TYR D 2 36  ? 22.218  -3.002  6.371   1.00 107.75 ? 36  TYR D CD2 1 
ATOM   8702  C CE1 . TYR D 2 36  ? 22.724  -1.884  8.846   1.00 106.03 ? 36  TYR D CE1 1 
ATOM   8703  C CE2 . TYR D 2 36  ? 21.312  -2.104  6.930   1.00 109.79 ? 36  TYR D CE2 1 
ATOM   8704  C CZ  . TYR D 2 36  ? 21.576  -1.550  8.169   1.00 109.32 ? 36  TYR D CZ  1 
ATOM   8705  O OH  . TYR D 2 36  ? 20.696  -0.661  8.746   1.00 107.00 ? 36  TYR D OH  1 
ATOM   8706  N N   . THR D 2 37  ? 23.522  -7.177  7.522   1.00 54.20  ? 37  THR D N   1 
ATOM   8707  C CA  . THR D 2 37  ? 22.480  -8.008  8.091   1.00 56.81  ? 37  THR D CA  1 
ATOM   8708  C C   . THR D 2 37  ? 22.953  -8.568  9.417   1.00 59.84  ? 37  THR D C   1 
ATOM   8709  O O   . THR D 2 37  ? 22.160  -8.733  10.341  1.00 65.91  ? 37  THR D O   1 
ATOM   8710  C CB  . THR D 2 37  ? 22.087  -9.157  7.165   1.00 43.75  ? 37  THR D CB  1 
ATOM   8711  O OG1 . THR D 2 37  ? 23.247  -9.942  6.868   1.00 65.10  ? 37  THR D OG1 1 
ATOM   8712  C CG2 . THR D 2 37  ? 21.502  -8.615  5.885   1.00 47.38  ? 37  THR D CG2 1 
ATOM   8713  N N   . ASN D 2 38  ? 24.243  -8.870  9.515   1.00 61.64  ? 38  ASN D N   1 
ATOM   8714  C CA  . ASN D 2 38  ? 24.768  -9.353  10.783  1.00 57.58  ? 38  ASN D CA  1 
ATOM   8715  C C   . ASN D 2 38  ? 24.644  -8.285  11.872  1.00 59.87  ? 38  ASN D C   1 
ATOM   8716  O O   . ASN D 2 38  ? 24.095  -8.534  12.953  1.00 66.67  ? 38  ASN D O   1 
ATOM   8717  C CB  . ASN D 2 38  ? 26.239  -9.755  10.649  1.00 58.57  ? 38  ASN D CB  1 
ATOM   8718  C CG  . ASN D 2 38  ? 26.434  -10.978 9.769   1.00 94.10  ? 38  ASN D CG  1 
ATOM   8719  O OD1 . ASN D 2 38  ? 25.490  -11.717 9.492   1.00 98.16  ? 38  ASN D OD1 1 
ATOM   8720  N ND2 . ASN D 2 38  ? 27.677  -11.224 9.366   1.00 94.80  ? 38  ASN D ND2 1 
ATOM   8721  N N   . GLN D 2 39  ? 25.112  -7.079  11.553  1.00 51.73  ? 39  GLN D N   1 
ATOM   8722  C CA  . GLN D 2 39  ? 25.074  -5.963  12.500  1.00 53.15  ? 39  GLN D CA  1 
ATOM   8723  C C   . GLN D 2 39  ? 23.644  -5.676  12.943  1.00 57.83  ? 39  GLN D C   1 
ATOM   8724  O O   . GLN D 2 39  ? 23.343  -5.600  14.139  1.00 60.13  ? 39  GLN D O   1 
ATOM   8725  C CB  . GLN D 2 39  ? 25.691  -4.722  11.860  1.00 51.21  ? 39  GLN D CB  1 
ATOM   8726  C CG  . GLN D 2 39  ? 27.169  -4.868  11.569  1.00 66.25  ? 39  GLN D CG  1 
ATOM   8727  C CD  . GLN D 2 39  ? 27.799  -3.559  11.172  1.00 83.38  ? 39  GLN D CD  1 
ATOM   8728  O OE1 . GLN D 2 39  ? 28.336  -3.422  10.074  1.00 86.26  ? 39  GLN D OE1 1 
ATOM   8729  N NE2 . GLN D 2 39  ? 27.725  -2.577  12.060  1.00 91.57  ? 39  GLN D NE2 1 
ATOM   8730  N N   . LEU D 2 40  ? 22.768  -5.543  11.954  1.00 63.56  ? 40  LEU D N   1 
ATOM   8731  C CA  . LEU D 2 40  ? 21.359  -5.267  12.179  1.00 54.24  ? 40  LEU D CA  1 
ATOM   8732  C C   . LEU D 2 40  ? 20.722  -6.342  13.045  1.00 54.91  ? 40  LEU D C   1 
ATOM   8733  O O   . LEU D 2 40  ? 19.952  -6.036  13.952  1.00 58.34  ? 40  LEU D O   1 
ATOM   8734  C CB  . LEU D 2 40  ? 20.616  -5.160  10.846  1.00 55.02  ? 40  LEU D CB  1 
ATOM   8735  C CG  . LEU D 2 40  ? 19.195  -4.603  10.923  1.00 64.34  ? 40  LEU D CG  1 
ATOM   8736  C CD1 . LEU D 2 40  ? 19.209  -3.237  11.593  1.00 73.89  ? 40  LEU D CD1 1 
ATOM   8737  C CD2 . LEU D 2 40  ? 18.563  -4.519  9.542   1.00 72.88  ? 40  LEU D CD2 1 
ATOM   8738  N N   . LEU D 2 41  ? 21.051  -7.600  12.767  1.00 51.65  ? 41  LEU D N   1 
ATOM   8739  C CA  . LEU D 2 41  ? 20.545  -8.709  13.566  1.00 55.38  ? 41  LEU D CA  1 
ATOM   8740  C C   . LEU D 2 41  ? 20.976  -8.570  15.025  1.00 60.99  ? 41  LEU D C   1 
ATOM   8741  O O   . LEU D 2 41  ? 20.164  -8.761  15.931  1.00 53.51  ? 41  LEU D O   1 
ATOM   8742  C CB  . LEU D 2 41  ? 21.009  -10.050 12.996  1.00 39.09  ? 41  LEU D CB  1 
ATOM   8743  C CG  . LEU D 2 41  ? 20.762  -11.261 13.894  1.00 40.60  ? 41  LEU D CG  1 
ATOM   8744  C CD1 . LEU D 2 41  ? 19.281  -11.585 13.908  1.00 58.94  ? 41  LEU D CD1 1 
ATOM   8745  C CD2 . LEU D 2 41  ? 21.564  -12.459 13.421  1.00 49.60  ? 41  LEU D CD2 1 
ATOM   8746  N N   . GLN D 2 42  ? 22.246  -8.234  15.253  1.00 46.22  ? 42  GLN D N   1 
ATOM   8747  C CA  . GLN D 2 42  ? 22.719  -8.016  16.621  1.00 45.38  ? 42  GLN D CA  1 
ATOM   8748  C C   . GLN D 2 42  ? 21.933  -6.896  17.304  1.00 59.30  ? 42  GLN D C   1 
ATOM   8749  O O   . GLN D 2 42  ? 21.493  -7.040  18.449  1.00 64.18  ? 42  GLN D O   1 
ATOM   8750  C CB  . GLN D 2 42  ? 24.214  -7.681  16.647  1.00 46.88  ? 42  GLN D CB  1 
ATOM   8751  C CG  . GLN D 2 42  ? 25.118  -8.688  15.962  1.00 68.52  ? 42  GLN D CG  1 
ATOM   8752  C CD  . GLN D 2 42  ? 26.555  -8.208  15.891  1.00 98.12  ? 42  GLN D CD  1 
ATOM   8753  O OE1 . GLN D 2 42  ? 26.822  -7.068  15.510  1.00 91.85  ? 42  GLN D OE1 1 
ATOM   8754  N NE2 . GLN D 2 42  ? 27.489  -9.075  16.266  1.00 109.64 ? 42  GLN D NE2 1 
ATOM   8755  N N   . ALA D 2 43  ? 21.753  -5.788  16.590  1.00 43.60  ? 43  ALA D N   1 
ATOM   8756  C CA  . ALA D 2 43  ? 21.005  -4.647  17.113  1.00 44.75  ? 43  ALA D CA  1 
ATOM   8757  C C   . ALA D 2 43  ? 19.588  -5.047  17.529  1.00 57.40  ? 43  ALA D C   1 
ATOM   8758  O O   . ALA D 2 43  ? 19.136  -4.732  18.638  1.00 46.45  ? 43  ALA D O   1 
ATOM   8759  C CB  . ALA D 2 43  ? 20.961  -3.536  16.078  1.00 34.20  ? 43  ALA D CB  1 
ATOM   8760  N N   . MET D 2 44  ? 18.903  -5.753  16.635  1.00 55.18  ? 44  MET D N   1 
ATOM   8761  C CA  . MET D 2 44  ? 17.556  -6.248  16.891  1.00 55.28  ? 44  MET D CA  1 
ATOM   8762  C C   . MET D 2 44  ? 17.519  -7.140  18.119  1.00 50.21  ? 44  MET D C   1 
ATOM   8763  O O   . MET D 2 44  ? 16.656  -6.993  18.984  1.00 46.51  ? 44  MET D O   1 
ATOM   8764  C CB  . MET D 2 44  ? 17.030  -7.034  15.691  1.00 57.93  ? 44  MET D CB  1 
ATOM   8765  C CG  . MET D 2 44  ? 16.860  -6.224  14.428  1.00 65.56  ? 44  MET D CG  1 
ATOM   8766  S SD  . MET D 2 44  ? 15.841  -4.760  14.641  1.00 104.61 ? 44  MET D SD  1 
ATOM   8767  C CE  . MET D 2 44  ? 15.571  -4.307  12.930  1.00 91.08  ? 44  MET D CE  1 
ATOM   8768  N N   . GLN D 2 45  ? 18.464  -8.072  18.172  1.00 47.84  ? 45  GLN D N   1 
ATOM   8769  C CA  . GLN D 2 45  ? 18.555  -9.036  19.257  1.00 51.98  ? 45  GLN D CA  1 
ATOM   8770  C C   . GLN D 2 45  ? 18.721  -8.296  20.586  1.00 43.75  ? 45  GLN D C   1 
ATOM   8771  O O   . GLN D 2 45  ? 18.178  -8.706  21.617  1.00 52.65  ? 45  GLN D O   1 
ATOM   8772  C CB  . GLN D 2 45  ? 19.733  -9.985  19.011  1.00 58.24  ? 45  GLN D CB  1 
ATOM   8773  C CG  . GLN D 2 45  ? 19.462  -11.063 17.957  1.00 66.89  ? 45  GLN D CG  1 
ATOM   8774  C CD  . GLN D 2 45  ? 18.822  -12.321 18.502  1.00 83.37  ? 45  GLN D CD  1 
ATOM   8775  O OE1 . GLN D 2 45  ? 17.927  -12.265 19.344  1.00 90.84  ? 45  GLN D OE1 1 
ATOM   8776  N NE2 . GLN D 2 45  ? 19.264  -13.470 18.001  1.00 79.73  ? 45  GLN D NE2 1 
ATOM   8777  N N   . ARG D 2 46  ? 19.447  -7.181  20.541  1.00 45.21  ? 46  ARG D N   1 
ATOM   8778  C CA  . ARG D 2 46  ? 19.630  -6.334  21.717  1.00 40.77  ? 46  ARG D CA  1 
ATOM   8779  C C   . ARG D 2 46  ? 18.348  -5.600  22.115  1.00 45.89  ? 46  ARG D C   1 
ATOM   8780  O O   . ARG D 2 46  ? 18.033  -5.493  23.303  1.00 52.39  ? 46  ARG D O   1 
ATOM   8781  C CB  . ARG D 2 46  ? 20.757  -5.323  21.477  1.00 36.40  ? 46  ARG D CB  1 
ATOM   8782  C CG  . ARG D 2 46  ? 20.876  -4.266  22.564  1.00 55.38  ? 46  ARG D CG  1 
ATOM   8783  C CD  . ARG D 2 46  ? 22.177  -3.490  22.467  1.00 35.29  ? 46  ARG D CD  1 
ATOM   8784  N NE  . ARG D 2 46  ? 22.199  -2.360  23.392  1.00 57.43  ? 46  ARG D NE  1 
ATOM   8785  C CZ  . ARG D 2 46  ? 23.304  -1.738  23.788  1.00 69.33  ? 46  ARG D CZ  1 
ATOM   8786  N NH1 . ARG D 2 46  ? 24.488  -2.142  23.349  1.00 86.70  ? 46  ARG D NH1 1 
ATOM   8787  N NH2 . ARG D 2 46  ? 23.227  -0.717  24.631  1.00 75.75  ? 46  ARG D NH2 1 
ATOM   8788  N N   . VAL D 2 47  ? 17.609  -5.100  21.127  1.00 55.06  ? 47  VAL D N   1 
ATOM   8789  C CA  . VAL D 2 47  ? 16.332  -4.439  21.403  1.00 47.00  ? 47  VAL D CA  1 
ATOM   8790  C C   . VAL D 2 47  ? 15.347  -5.405  22.060  1.00 52.10  ? 47  VAL D C   1 
ATOM   8791  O O   . VAL D 2 47  ? 14.743  -5.098  23.099  1.00 51.23  ? 47  VAL D O   1 
ATOM   8792  C CB  . VAL D 2 47  ? 15.702  -3.864  20.120  1.00 43.19  ? 47  VAL D CB  1 
ATOM   8793  C CG1 . VAL D 2 47  ? 14.256  -3.463  20.364  1.00 37.61  ? 47  VAL D CG1 1 
ATOM   8794  C CG2 . VAL D 2 47  ? 16.507  -2.680  19.627  1.00 42.13  ? 47  VAL D CG2 1 
ATOM   8795  N N   . TYR D 2 48  ? 15.202  -6.577  21.449  1.00 45.53  ? 48  TYR D N   1 
ATOM   8796  C CA  . TYR D 2 48  ? 14.350  -7.626  21.988  1.00 47.52  ? 48  TYR D CA  1 
ATOM   8797  C C   . TYR D 2 48  ? 14.771  -7.995  23.404  1.00 51.76  ? 48  TYR D C   1 
ATOM   8798  O O   . TYR D 2 48  ? 13.928  -8.118  24.295  1.00 53.78  ? 48  TYR D O   1 
ATOM   8799  C CB  . TYR D 2 48  ? 14.385  -8.870  21.101  1.00 36.19  ? 48  TYR D CB  1 
ATOM   8800  C CG  . TYR D 2 48  ? 13.798  -10.080 21.784  1.00 45.02  ? 48  TYR D CG  1 
ATOM   8801  C CD1 . TYR D 2 48  ? 12.428  -10.186 21.991  1.00 47.20  ? 48  TYR D CD1 1 
ATOM   8802  C CD2 . TYR D 2 48  ? 14.612  -11.107 22.243  1.00 46.21  ? 48  TYR D CD2 1 
ATOM   8803  C CE1 . TYR D 2 48  ? 11.885  -11.285 22.625  1.00 57.95  ? 48  TYR D CE1 1 
ATOM   8804  C CE2 . TYR D 2 48  ? 14.078  -12.210 22.879  1.00 69.24  ? 48  TYR D CE2 1 
ATOM   8805  C CZ  . TYR D 2 48  ? 12.714  -12.295 23.067  1.00 72.88  ? 48  TYR D CZ  1 
ATOM   8806  O OH  . TYR D 2 48  ? 12.177  -13.392 23.700  1.00 70.73  ? 48  TYR D OH  1 
ATOM   8807  N N   . GLY D 2 49  ? 16.074  -8.179  23.603  1.00 43.13  ? 49  GLY D N   1 
ATOM   8808  C CA  . GLY D 2 49  ? 16.599  -8.483  24.922  1.00 39.39  ? 49  GLY D CA  1 
ATOM   8809  C C   . GLY D 2 49  ? 16.212  -7.432  25.947  1.00 49.18  ? 49  GLY D C   1 
ATOM   8810  O O   . GLY D 2 49  ? 15.840  -7.756  27.080  1.00 48.03  ? 49  GLY D O   1 
ATOM   8811  N N   . ALA D 2 50  ? 16.286  -6.167  25.542  1.00 38.05  ? 50  ALA D N   1 
ATOM   8812  C CA  . ALA D 2 50  ? 15.920  -5.060  26.419  1.00 35.08  ? 50  ALA D CA  1 
ATOM   8813  C C   . ALA D 2 50  ? 14.439  -5.115  26.799  1.00 50.82  ? 50  ALA D C   1 
ATOM   8814  O O   . ALA D 2 50  ? 14.085  -4.970  27.974  1.00 49.57  ? 50  ALA D O   1 
ATOM   8815  C CB  . ALA D 2 50  ? 16.253  -3.731  25.759  1.00 28.24  ? 50  ALA D CB  1 
ATOM   8816  N N   . GLN D 2 51  ? 13.577  -5.326  25.806  1.00 52.47  ? 51  GLN D N   1 
ATOM   8817  C CA  . GLN D 2 51  ? 12.141  -5.442  26.064  1.00 51.92  ? 51  GLN D CA  1 
ATOM   8818  C C   . GLN D 2 51  ? 11.835  -6.591  27.031  1.00 50.56  ? 51  GLN D C   1 
ATOM   8819  O O   . GLN D 2 51  ? 11.064  -6.437  27.988  1.00 54.69  ? 51  GLN D O   1 
ATOM   8820  C CB  . GLN D 2 51  ? 11.378  -5.644  24.754  1.00 57.66  ? 51  GLN D CB  1 
ATOM   8821  C CG  . GLN D 2 51  ? 9.919   -5.225  24.816  1.00 64.34  ? 51  GLN D CG  1 
ATOM   8822  C CD  . GLN D 2 51  ? 9.755   -3.732  25.024  1.00 67.77  ? 51  GLN D CD  1 
ATOM   8823  O OE1 . GLN D 2 51  ? 9.029   -3.292  25.916  1.00 57.88  ? 51  GLN D OE1 1 
ATOM   8824  N NE2 . GLN D 2 51  ? 10.429  -2.942  24.195  1.00 65.80  ? 51  GLN D NE2 1 
ATOM   8825  N N   . ASN D 2 52  ? 12.462  -7.736  26.774  1.00 48.41  ? 52  ASN D N   1 
ATOM   8826  C CA  . ASN D 2 52  ? 12.336  -8.920  27.619  1.00 47.59  ? 52  ASN D CA  1 
ATOM   8827  C C   . ASN D 2 52  ? 12.736  -8.612  29.064  1.00 58.65  ? 52  ASN D C   1 
ATOM   8828  O O   . ASN D 2 52  ? 12.060  -9.024  30.020  1.00 62.17  ? 52  ASN D O   1 
ATOM   8829  C CB  . ASN D 2 52  ? 13.183  -10.059 27.049  1.00 37.53  ? 52  ASN D CB  1 
ATOM   8830  C CG  . ASN D 2 52  ? 12.869  -11.396 27.685  1.00 54.81  ? 52  ASN D CG  1 
ATOM   8831  O OD1 . ASN D 2 52  ? 11.770  -11.926 27.529  1.00 68.95  ? 52  ASN D OD1 1 
ATOM   8832  N ND2 . ASN D 2 52  ? 13.840  -11.956 28.396  1.00 58.95  ? 52  ASN D ND2 1 
ATOM   8833  N N   . GLU D 2 53  ? 13.828  -7.868  29.218  1.00 50.09  ? 53  GLU D N   1 
ATOM   8834  C CA  . GLU D 2 53  ? 14.280  -7.467  30.546  1.00 58.37  ? 53  GLU D CA  1 
ATOM   8835  C C   . GLU D 2 53  ? 13.334  -6.489  31.228  1.00 52.68  ? 53  GLU D C   1 
ATOM   8836  O O   . GLU D 2 53  ? 13.188  -6.513  32.453  1.00 43.78  ? 53  GLU D O   1 
ATOM   8837  C CB  . GLU D 2 53  ? 15.683  -6.857  30.467  1.00 47.71  ? 53  GLU D CB  1 
ATOM   8838  C CG  . GLU D 2 53  ? 16.184  -6.299  31.795  1.00 64.23  ? 53  GLU D CG  1 
ATOM   8839  C CD  . GLU D 2 53  ? 16.540  -7.363  32.806  1.00 72.04  ? 53  GLU D CD  1 
ATOM   8840  O OE1 . GLU D 2 53  ? 17.030  -8.440  32.408  1.00 84.53  ? 53  GLU D OE1 1 
ATOM   8841  O OE2 . GLU D 2 53  ? 16.309  -7.119  34.010  1.00 48.29  ? 53  GLU D OE2 1 
ATOM   8842  N N   . MET D 2 54  ? 12.661  -5.655  30.444  1.00 37.66  ? 54  MET D N   1 
ATOM   8843  C CA  . MET D 2 54  ? 11.628  -4.803  31.013  1.00 46.61  ? 54  MET D CA  1 
ATOM   8844  C C   . MET D 2 54  ? 10.476  -5.659  31.540  1.00 56.27  ? 54  MET D C   1 
ATOM   8845  O O   . MET D 2 54  ? 9.922   -5.390  32.616  1.00 34.12  ? 54  MET D O   1 
ATOM   8846  C CB  . MET D 2 54  ? 11.127  -3.789  29.986  1.00 45.64  ? 54  MET D CB  1 
ATOM   8847  C CG  . MET D 2 54  ? 10.003  -2.917  30.507  1.00 64.64  ? 54  MET D CG  1 
ATOM   8848  S SD  . MET D 2 54  ? 10.395  -2.208  32.119  1.00 60.36  ? 54  MET D SD  1 
ATOM   8849  C CE  . MET D 2 54  ? 11.474  -0.864  31.640  1.00 54.27  ? 54  MET D CE  1 
ATOM   8850  N N   . CYS D 2 55  ? 10.139  -6.701  30.785  1.00 46.31  ? 55  CYS D N   1 
ATOM   8851  C CA  . CYS D 2 55  ? 9.118   -7.655  31.212  1.00 51.01  ? 55  CYS D CA  1 
ATOM   8852  C C   . CYS D 2 55  ? 9.464   -8.281  32.560  1.00 46.56  ? 55  CYS D C   1 
ATOM   8853  O O   . CYS D 2 55  ? 8.666   -8.233  33.510  1.00 46.27  ? 55  CYS D O   1 
ATOM   8854  C CB  . CYS D 2 55  ? 8.944   -8.755  30.164  1.00 51.29  ? 55  CYS D CB  1 
ATOM   8855  S SG  . CYS D 2 55  ? 8.265   -8.187  28.599  1.00 69.21  ? 55  CYS D SG  1 
ATOM   8856  N N   . LEU D 2 56  ? 10.663  -8.854  32.641  1.00 51.75  ? 56  LEU D N   1 
ATOM   8857  C CA  . LEU D 2 56  ? 11.127  -9.479  33.878  1.00 44.31  ? 56  LEU D CA  1 
ATOM   8858  C C   . LEU D 2 56  ? 11.130  -8.487  35.042  1.00 42.22  ? 56  LEU D C   1 
ATOM   8859  O O   . LEU D 2 56  ? 10.747  -8.827  36.169  1.00 39.98  ? 56  LEU D O   1 
ATOM   8860  C CB  . LEU D 2 56  ? 12.525  -10.070 33.687  1.00 32.46  ? 56  LEU D CB  1 
ATOM   8861  C CG  . LEU D 2 56  ? 12.609  -11.289 32.767  1.00 46.78  ? 56  LEU D CG  1 
ATOM   8862  C CD1 . LEU D 2 56  ? 14.054  -11.728 32.587  1.00 39.39  ? 56  LEU D CD1 1 
ATOM   8863  C CD2 . LEU D 2 56  ? 11.760  -12.431 33.306  1.00 33.76  ? 56  LEU D CD2 1 
ATOM   8864  N N   . ALA D 2 57  ? 11.551  -7.258  34.754  1.00 31.56  ? 57  ALA D N   1 
ATOM   8865  C CA  . ALA D 2 57  ? 11.604  -6.207  35.762  1.00 39.53  ? 57  ALA D CA  1 
ATOM   8866  C C   . ALA D 2 57  ? 10.220  -5.928  36.345  1.00 43.96  ? 57  ALA D C   1 
ATOM   8867  O O   . ALA D 2 57  ? 10.038  -5.932  37.568  1.00 41.85  ? 57  ALA D O   1 
ATOM   8868  C CB  . ALA D 2 57  ? 12.197  -4.937  35.172  1.00 24.41  ? 57  ALA D CB  1 
ATOM   8869  N N   . THR D 2 58  ? 9.246   -5.687  35.470  1.00 48.68  ? 58  THR D N   1 
ATOM   8870  C CA  . THR D 2 58  ? 7.885   -5.418  35.925  1.00 45.26  ? 58  THR D CA  1 
ATOM   8871  C C   . THR D 2 58  ? 7.311   -6.597  36.711  1.00 47.76  ? 58  THR D C   1 
ATOM   8872  O O   . THR D 2 58  ? 6.672   -6.403  37.753  1.00 42.07  ? 58  THR D O   1 
ATOM   8873  C CB  . THR D 2 58  ? 6.945   -5.091  34.750  1.00 35.86  ? 58  THR D CB  1 
ATOM   8874  O OG1 . THR D 2 58  ? 7.011   -6.139  33.775  1.00 44.30  ? 58  THR D OG1 1 
ATOM   8875  C CG2 . THR D 2 58  ? 7.340   -3.772  34.102  1.00 42.28  ? 58  THR D CG2 1 
ATOM   8876  N N   . GLN D 2 59  ? 7.561   -7.814  36.229  1.00 35.89  ? 59  GLN D N   1 
ATOM   8877  C CA  . GLN D 2 59  ? 7.117   -9.006  36.951  1.00 44.42  ? 59  GLN D CA  1 
ATOM   8878  C C   . GLN D 2 59  ? 7.665   -9.012  38.381  1.00 46.74  ? 59  GLN D C   1 
ATOM   8879  O O   . GLN D 2 59  ? 6.920   -9.238  39.348  1.00 53.86  ? 59  GLN D O   1 
ATOM   8880  C CB  . GLN D 2 59  ? 7.539   -10.280 36.217  1.00 28.11  ? 59  GLN D CB  1 
ATOM   8881  C CG  . GLN D 2 59  ? 7.564   -11.517 37.104  1.00 47.58  ? 59  GLN D CG  1 
ATOM   8882  C CD  . GLN D 2 59  ? 7.844   -12.791 36.330  1.00 60.40  ? 59  GLN D CD  1 
ATOM   8883  O OE1 . GLN D 2 59  ? 8.519   -12.771 35.302  1.00 77.27  ? 59  GLN D OE1 1 
ATOM   8884  N NE2 . GLN D 2 59  ? 7.323   -13.909 36.825  1.00 69.97  ? 59  GLN D NE2 1 
ATOM   8885  N N   . GLN D 2 60  ? 8.963   -8.744  38.510  1.00 40.21  ? 60  GLN D N   1 
ATOM   8886  C CA  . GLN D 2 60  ? 9.593   -8.683  39.826  1.00 42.48  ? 60  GLN D CA  1 
ATOM   8887  C C   . GLN D 2 60  ? 8.962   -7.617  40.717  1.00 40.15  ? 60  GLN D C   1 
ATOM   8888  O O   . GLN D 2 60  ? 8.676   -7.872  41.890  1.00 43.19  ? 60  GLN D O   1 
ATOM   8889  C CB  . GLN D 2 60  ? 11.092  -8.412  39.699  1.00 45.37  ? 60  GLN D CB  1 
ATOM   8890  C CG  . GLN D 2 60  ? 11.778  -8.234  41.044  1.00 40.71  ? 60  GLN D CG  1 
ATOM   8891  C CD  . GLN D 2 60  ? 13.280  -8.124  40.927  1.00 42.52  ? 60  GLN D CD  1 
ATOM   8892  O OE1 . GLN D 2 60  ? 13.884  -8.672  40.006  1.00 45.64  ? 60  GLN D OE1 1 
ATOM   8893  N NE2 . GLN D 2 60  ? 13.895  -7.414  41.866  1.00 53.47  ? 60  GLN D NE2 1 
ATOM   8894  N N   . LEU D 2 61  ? 8.750   -6.428  40.156  1.00 31.26  ? 61  LEU D N   1 
ATOM   8895  C CA  . LEU D 2 61  ? 8.148   -5.328  40.905  1.00 32.67  ? 61  LEU D CA  1 
ATOM   8896  C C   . LEU D 2 61  ? 6.791   -5.736  41.470  1.00 51.40  ? 61  LEU D C   1 
ATOM   8897  O O   . LEU D 2 61  ? 6.507   -5.536  42.660  1.00 47.02  ? 61  LEU D O   1 
ATOM   8898  C CB  . LEU D 2 61  ? 7.995   -4.095  40.014  1.00 34.55  ? 61  LEU D CB  1 
ATOM   8899  C CG  . LEU D 2 61  ? 7.252   -2.905  40.625  1.00 42.67  ? 61  LEU D CG  1 
ATOM   8900  C CD1 . LEU D 2 61  ? 7.960   -2.413  41.879  1.00 28.32  ? 61  LEU D CD1 1 
ATOM   8901  C CD2 . LEU D 2 61  ? 7.106   -1.784  39.608  1.00 45.56  ? 61  LEU D CD2 1 
ATOM   8902  N N   . SER D 2 62  ? 5.970   -6.333  40.610  1.00 53.93  ? 62  SER D N   1 
ATOM   8903  C CA  . SER D 2 62  ? 4.648   -6.794  41.012  1.00 46.99  ? 62  SER D CA  1 
ATOM   8904  C C   . SER D 2 62  ? 4.758   -7.802  42.150  1.00 49.16  ? 62  SER D C   1 
ATOM   8905  O O   . SER D 2 62  ? 4.045   -7.701  43.157  1.00 50.19  ? 62  SER D O   1 
ATOM   8906  C CB  . SER D 2 62  ? 3.910   -7.418  39.827  1.00 41.28  ? 62  SER D CB  1 
ATOM   8907  O OG  . SER D 2 62  ? 2.605   -7.829  40.197  1.00 65.76  ? 62  SER D OG  1 
ATOM   8908  N N   . LYS D 2 63  ? 5.664   -8.763  41.992  1.00 36.81  ? 63  LYS D N   1 
ATOM   8909  C CA  . LYS D 2 63  ? 5.829   -9.805  43.000  1.00 42.67  ? 63  LYS D CA  1 
ATOM   8910  C C   . LYS D 2 63  ? 6.258   -9.224  44.348  1.00 52.78  ? 63  LYS D C   1 
ATOM   8911  O O   . LYS D 2 63  ? 5.834   -9.707  45.395  1.00 51.47  ? 63  LYS D O   1 
ATOM   8912  C CB  . LYS D 2 63  ? 6.837   -10.857 42.534  1.00 35.66  ? 63  LYS D CB  1 
ATOM   8913  C CG  . LYS D 2 63  ? 7.035   -11.991 43.530  1.00 40.68  ? 63  LYS D CG  1 
ATOM   8914  C CD  . LYS D 2 63  ? 7.735   -13.182 42.900  1.00 57.25  ? 63  LYS D CD  1 
ATOM   8915  C CE  . LYS D 2 63  ? 8.044   -14.246 43.942  1.00 62.75  ? 63  LYS D CE  1 
ATOM   8916  N NZ  . LYS D 2 63  ? 9.103   -15.187 43.483  1.00 75.75  ? 63  LYS D NZ  1 
ATOM   8917  N N   . GLN D 2 64  ? 7.098   -8.193  44.320  1.00 43.97  ? 64  GLN D N   1 
ATOM   8918  C CA  . GLN D 2 64  ? 7.535   -7.534  45.549  1.00 51.61  ? 64  GLN D CA  1 
ATOM   8919  C C   . GLN D 2 64  ? 6.361   -6.819  46.230  1.00 53.93  ? 64  GLN D C   1 
ATOM   8920  O O   . GLN D 2 64  ? 6.142   -6.942  47.457  1.00 56.38  ? 64  GLN D O   1 
ATOM   8921  C CB  . GLN D 2 64  ? 8.660   -6.538  45.244  1.00 45.72  ? 64  GLN D CB  1 
ATOM   8922  C CG  . GLN D 2 64  ? 9.432   -6.055  46.464  1.00 54.27  ? 64  GLN D CG  1 
ATOM   8923  C CD  . GLN D 2 64  ? 10.031  -7.197  47.265  1.00 52.79  ? 64  GLN D CD  1 
ATOM   8924  O OE1 . GLN D 2 64  ? 10.466  -8.204  46.704  1.00 55.43  ? 64  GLN D OE1 1 
ATOM   8925  N NE2 . GLN D 2 64  ? 10.058  -7.045  48.582  1.00 54.54  ? 64  GLN D NE2 1 
ATOM   8926  N N   . LEU D 2 65  ? 5.591   -6.095  45.418  1.00 48.11  ? 65  LEU D N   1 
ATOM   8927  C CA  . LEU D 2 65  ? 4.435   -5.362  45.923  1.00 52.07  ? 65  LEU D CA  1 
ATOM   8928  C C   . LEU D 2 65  ? 3.437   -6.310  46.575  1.00 50.12  ? 65  LEU D C   1 
ATOM   8929  O O   . LEU D 2 65  ? 2.842   -5.985  47.602  1.00 42.91  ? 65  LEU D O   1 
ATOM   8930  C CB  . LEU D 2 65  ? 3.755   -4.573  44.802  1.00 45.52  ? 65  LEU D CB  1 
ATOM   8931  C CG  . LEU D 2 65  ? 4.560   -3.439  44.167  1.00 54.25  ? 65  LEU D CG  1 
ATOM   8932  C CD1 . LEU D 2 65  ? 3.656   -2.542  43.333  1.00 46.24  ? 65  LEU D CD1 1 
ATOM   8933  C CD2 . LEU D 2 65  ? 5.288   -2.634  45.234  1.00 39.17  ? 65  LEU D CD2 1 
ATOM   8934  N N   . LEU D 2 66  ? 3.259   -7.486  45.982  1.00 56.47  ? 66  LEU D N   1 
ATOM   8935  C CA  . LEU D 2 66  ? 2.392   -8.493  46.580  1.00 43.74  ? 66  LEU D CA  1 
ATOM   8936  C C   . LEU D 2 66  ? 3.042   -9.059  47.837  1.00 58.06  ? 66  LEU D C   1 
ATOM   8937  O O   . LEU D 2 66  ? 2.360   -9.403  48.803  1.00 70.90  ? 66  LEU D O   1 
ATOM   8938  C CB  . LEU D 2 66  ? 2.092   -9.616  45.588  1.00 47.57  ? 66  LEU D CB  1 
ATOM   8939  C CG  . LEU D 2 66  ? 1.118   -9.282  44.458  1.00 54.11  ? 66  LEU D CG  1 
ATOM   8940  C CD1 . LEU D 2 66  ? 0.904   -10.491 43.562  1.00 67.68  ? 66  LEU D CD1 1 
ATOM   8941  C CD2 . LEU D 2 66  ? -0.201  -8.797  45.030  1.00 46.01  ? 66  LEU D CD2 1 
ATOM   8942  N N   . ALA D 2 67  ? 4.368   -9.147  47.812  1.00 54.15  ? 67  ALA D N   1 
ATOM   8943  C CA  . ALA D 2 67  ? 5.135   -9.720  48.912  1.00 59.77  ? 67  ALA D CA  1 
ATOM   8944  C C   . ALA D 2 67  ? 5.036   -8.878  50.177  1.00 64.15  ? 67  ALA D C   1 
ATOM   8945  O O   . ALA D 2 67  ? 5.319   -9.368  51.272  1.00 60.37  ? 67  ALA D O   1 
ATOM   8946  C CB  . ALA D 2 67  ? 6.594   -9.896  48.511  1.00 49.24  ? 67  ALA D CB  1 
ATOM   8947  N N   . TYR D 2 68  ? 4.651   -7.610  50.032  1.00 60.89  ? 68  TYR D N   1 
ATOM   8948  C CA  . TYR D 2 68  ? 4.498   -6.747  51.214  1.00 45.79  ? 68  TYR D CA  1 
ATOM   8949  C C   . TYR D 2 68  ? 3.492   -7.285  52.236  1.00 67.41  ? 68  TYR D C   1 
ATOM   8950  O O   . TYR D 2 68  ? 3.725   -7.203  53.442  1.00 69.30  ? 68  TYR D O   1 
ATOM   8951  C CB  . TYR D 2 68  ? 4.087   -5.330  50.830  1.00 48.43  ? 68  TYR D CB  1 
ATOM   8952  C CG  . TYR D 2 68  ? 3.939   -4.431  52.043  1.00 58.00  ? 68  TYR D CG  1 
ATOM   8953  C CD1 . TYR D 2 68  ? 5.057   -3.926  52.696  1.00 58.61  ? 68  TYR D CD1 1 
ATOM   8954  C CD2 . TYR D 2 68  ? 2.686   -4.108  52.549  1.00 78.16  ? 68  TYR D CD2 1 
ATOM   8955  C CE1 . TYR D 2 68  ? 4.933   -3.116  53.811  1.00 53.47  ? 68  TYR D CE1 1 
ATOM   8956  C CE2 . TYR D 2 68  ? 2.551   -3.296  53.665  1.00 61.23  ? 68  TYR D CE2 1 
ATOM   8957  C CZ  . TYR D 2 68  ? 3.680   -2.802  54.291  1.00 52.59  ? 68  TYR D CZ  1 
ATOM   8958  O OH  . TYR D 2 68  ? 3.565   -1.993  55.400  1.00 57.97  ? 68  TYR D OH  1 
ATOM   8959  N N   . GLU D 2 69  ? 2.372   -7.820  51.760  1.00 80.39  ? 69  GLU D N   1 
ATOM   8960  C CA  . GLU D 2 69  ? 1.365   -8.379  52.659  1.00 73.25  ? 69  GLU D CA  1 
ATOM   8961  C C   . GLU D 2 69  ? 1.863   -9.608  53.426  1.00 72.33  ? 69  GLU D C   1 
ATOM   8962  O O   . GLU D 2 69  ? 1.582   -9.766  54.613  1.00 71.17  ? 69  GLU D O   1 
ATOM   8963  C CB  . GLU D 2 69  ? 0.124   -8.774  51.859  1.00 75.72  ? 69  GLU D CB  1 
ATOM   8964  C CG  . GLU D 2 69  ? -0.551  -10.033 52.398  1.00 87.52  ? 69  GLU D CG  1 
ATOM   8965  C CD  . GLU D 2 69  ? -1.741  -10.464 51.580  1.00 113.73 ? 69  GLU D CD  1 
ATOM   8966  O OE1 . GLU D 2 69  ? -1.564  -10.696 50.365  1.00 130.88 ? 69  GLU D OE1 1 
ATOM   8967  O OE2 . GLU D 2 69  ? -2.837  -10.620 52.154  1.00 112.53 ? 69  GLU D OE2 1 
ATOM   8968  N N   . LYS D 2 70  ? 2.645   -10.446 52.750  1.00 78.79  ? 70  LYS D N   1 
ATOM   8969  C CA  . LYS D 2 70  ? 3.210   -11.665 53.339  1.00 75.09  ? 70  LYS D CA  1 
ATOM   8970  C C   . LYS D 2 70  ? 4.214   -11.382 54.449  1.00 70.86  ? 70  LYS D C   1 
ATOM   8971  O O   . LYS D 2 70  ? 4.523   -12.249 55.262  1.00 66.08  ? 70  LYS D O   1 
ATOM   8972  C CB  . LYS D 2 70  ? 3.870   -12.530 52.257  1.00 54.10  ? 70  LYS D CB  1 
ATOM   8973  N N   . GLN D 2 71  ? 4.710   -10.156 54.478  1.00 85.29  ? 71  GLN D N   1 
ATOM   8974  C CA  . GLN D 2 71  ? 5.615   -9.708  55.525  1.00 78.36  ? 71  GLN D CA  1 
ATOM   8975  C C   . GLN D 2 71  ? 4.973   -9.681  56.905  1.00 83.30  ? 71  GLN D C   1 
ATOM   8976  O O   . GLN D 2 71  ? 3.767   -9.481  57.047  1.00 97.19  ? 71  GLN D O   1 
ATOM   8977  C CB  . GLN D 2 71  ? 6.157   -8.314  55.216  1.00 83.73  ? 71  GLN D CB  1 
ATOM   8978  C CG  . GLN D 2 71  ? 7.536   -8.093  55.803  1.00 100.85 ? 71  GLN D CG  1 
ATOM   8979  C CD  . GLN D 2 71  ? 7.993   -6.650  55.758  1.00 109.12 ? 71  GLN D CD  1 
ATOM   8980  O OE1 . GLN D 2 71  ? 7.190   -5.728  55.605  1.00 77.24  ? 71  GLN D OE1 1 
ATOM   8981  N NE2 . GLN D 2 71  ? 9.302   -6.451  55.855  1.00 99.30  ? 71  GLN D NE2 1 
ATOM   8982  N N   . ASN D 2 72  ? 5.808   -9.877  57.917  1.00 92.49  ? 72  ASN D N   1 
ATOM   8983  C CA  . ASN D 2 72  ? 5.390   -9.974  59.307  1.00 95.76  ? 72  ASN D CA  1 
ATOM   8984  C C   . ASN D 2 72  ? 5.517   -8.620  59.998  1.00 94.46  ? 72  ASN D C   1 
ATOM   8985  O O   . ASN D 2 72  ? 6.567   -7.972  59.943  1.00 70.96  ? 72  ASN D O   1 
ATOM   8986  C CB  . ASN D 2 72  ? 6.215   -11.010 60.059  1.00 70.35  ? 72  ASN D CB  1 
ATOM   8987  C CG  . ASN D 2 72  ? 5.801   -11.133 61.509  1.00 93.72  ? 72  ASN D CG  1 
ATOM   8988  O OD1 . ASN D 2 72  ? 4.614   -11.206 61.829  1.00 107.24 ? 72  ASN D OD1 1 
ATOM   8989  N ND2 . ASN D 2 72  ? 6.783   -11.128 62.401  1.00 96.64  ? 72  ASN D ND2 1 
ATOM   8990  N N   . PHE D 2 73  ? 4.415   -8.151  60.569  1.00 96.17  ? 73  PHE D N   1 
ATOM   8991  C CA  . PHE D 2 73  ? 4.415   -6.858  61.227  1.00 92.24  ? 73  PHE D CA  1 
ATOM   8992  C C   . PHE D 2 73  ? 4.488   -7.022  62.750  1.00 82.39  ? 73  PHE D C   1 
ATOM   8993  O O   . PHE D 2 73  ? 3.506   -7.418  63.381  1.00 85.57  ? 73  PHE D O   1 
ATOM   8994  C CB  . PHE D 2 73  ? 3.150   -6.102  60.844  1.00 85.51  ? 73  PHE D CB  1 
ATOM   8995  C CG  . PHE D 2 73  ? 2.992   -5.893  59.364  1.00 78.26  ? 73  PHE D CG  1 
ATOM   8996  C CD1 . PHE D 2 73  ? 2.396   -6.875  58.584  1.00 87.53  ? 73  PHE D CD1 1 
ATOM   8997  C CD2 . PHE D 2 73  ? 3.431   -4.734  58.750  1.00 79.48  ? 73  PHE D CD2 1 
ATOM   8998  C CE1 . PHE D 2 73  ? 2.237   -6.706  57.223  1.00 78.78  ? 73  PHE D CE1 1 
ATOM   8999  C CE2 . PHE D 2 73  ? 3.275   -4.559  57.384  1.00 91.97  ? 73  PHE D CE2 1 
ATOM   9000  C CZ  . PHE D 2 73  ? 2.677   -5.547  56.622  1.00 78.96  ? 73  PHE D CZ  1 
ATOM   9001  N N   . ALA D 2 74  ? 5.639   -6.713  63.340  1.00 89.70  ? 74  ALA D N   1 
ATOM   9002  C CA  . ALA D 2 74  ? 5.838   -6.929  64.772  1.00 88.51  ? 74  ALA D CA  1 
ATOM   9003  C C   . ALA D 2 74  ? 4.931   -6.028  65.606  1.00 78.11  ? 74  ALA D C   1 
ATOM   9004  O O   . ALA D 2 74  ? 4.406   -6.440  66.641  1.00 83.97  ? 74  ALA D O   1 
ATOM   9005  C CB  . ALA D 2 74  ? 7.296   -6.702  65.146  1.00 72.32  ? 74  ALA D CB  1 
ATOM   9006  N N   . LEU D 2 75  ? 4.753   -4.796  65.141  1.00 78.60  ? 75  LEU D N   1 
ATOM   9007  C CA  . LEU D 2 75  ? 4.025   -3.771  65.883  1.00 79.36  ? 75  LEU D CA  1 
ATOM   9008  C C   . LEU D 2 75  ? 2.538   -4.078  66.042  1.00 94.87  ? 75  LEU D C   1 
ATOM   9009  O O   . LEU D 2 75  ? 1.962   -3.875  67.112  1.00 106.32 ? 75  LEU D O   1 
ATOM   9010  C CB  . LEU D 2 75  ? 4.194   -2.415  65.198  1.00 70.09  ? 75  LEU D CB  1 
ATOM   9011  C CG  . LEU D 2 75  ? 5.528   -1.717  65.457  1.00 57.42  ? 75  LEU D CG  1 
ATOM   9012  C CD1 . LEU D 2 75  ? 5.611   -0.431  64.664  1.00 64.18  ? 75  LEU D CD1 1 
ATOM   9013  C CD2 . LEU D 2 75  ? 5.706   -1.445  66.939  1.00 62.78  ? 75  LEU D CD2 1 
ATOM   9014  N N   . GLY D 2 76  ? 1.923   -4.562  64.969  1.00 101.80 ? 76  GLY D N   1 
ATOM   9015  C CA  . GLY D 2 76  ? 0.490   -4.790  64.946  1.00 107.35 ? 76  GLY D CA  1 
ATOM   9016  C C   . GLY D 2 76  ? 0.024   -5.112  63.542  1.00 98.23  ? 76  GLY D C   1 
ATOM   9017  O O   . GLY D 2 76  ? 0.784   -5.650  62.742  1.00 100.45 ? 76  GLY D O   1 
ATOM   9018  N N   . LYS D 2 77  ? -1.230  -4.797  63.238  1.00 103.64 ? 77  LYS D N   1 
ATOM   9019  C CA  . LYS D 2 77  ? -1.735  -5.001  61.889  1.00 107.62 ? 77  LYS D CA  1 
ATOM   9020  C C   . LYS D 2 77  ? -1.309  -3.856  60.978  1.00 105.96 ? 77  LYS D C   1 
ATOM   9021  O O   . LYS D 2 77  ? -1.507  -2.685  61.303  1.00 110.61 ? 77  LYS D O   1 
ATOM   9022  C CB  . LYS D 2 77  ? -3.260  -5.127  61.898  1.00 86.57  ? 77  LYS D CB  1 
ATOM   9023  N N   . GLY D 2 78  ? -0.714  -4.204  59.841  1.00 91.83  ? 78  GLY D N   1 
ATOM   9024  C CA  . GLY D 2 78  ? -0.317  -3.221  58.850  1.00 86.10  ? 78  GLY D CA  1 
ATOM   9025  C C   . GLY D 2 78  ? -1.531  -2.480  58.333  1.00 87.75  ? 78  GLY D C   1 
ATOM   9026  O O   . GLY D 2 78  ? -2.618  -3.055  58.267  1.00 97.22  ? 78  GLY D O   1 
ATOM   9027  N N   . ASP D 2 79  ? -1.359  -1.205  57.991  1.00 86.26  ? 79  ASP D N   1 
ATOM   9028  C CA  . ASP D 2 79  ? -2.462  -0.398  57.478  1.00 79.20  ? 79  ASP D CA  1 
ATOM   9029  C C   . ASP D 2 79  ? -3.050  -1.109  56.264  1.00 84.72  ? 79  ASP D C   1 
ATOM   9030  O O   . ASP D 2 79  ? -2.313  -1.676  55.459  1.00 81.78  ? 79  ASP D O   1 
ATOM   9031  C CB  . ASP D 2 79  ? -1.974  1.006   57.112  1.00 69.17  ? 79  ASP D CB  1 
ATOM   9032  C CG  . ASP D 2 79  ? -3.109  1.991   56.897  1.00 94.70  ? 79  ASP D CG  1 
ATOM   9033  O OD1 . ASP D 2 79  ? -4.244  1.554   56.614  1.00 100.43 ? 79  ASP D OD1 1 
ATOM   9034  O OD2 . ASP D 2 79  ? -2.862  3.211   57.009  1.00 103.11 ? 79  ASP D OD2 1 
ATOM   9035  N N   . GLU D 2 80  ? -4.370  -1.091  56.123  1.00 85.55  ? 80  GLU D N   1 
ATOM   9036  C CA  . GLU D 2 80  ? -4.972  -1.856  55.041  1.00 75.67  ? 80  GLU D CA  1 
ATOM   9037  C C   . GLU D 2 80  ? -5.284  -0.984  53.830  1.00 74.49  ? 80  GLU D C   1 
ATOM   9038  O O   . GLU D 2 80  ? -5.626  -1.491  52.759  1.00 78.62  ? 80  GLU D O   1 
ATOM   9039  C CB  . GLU D 2 80  ? -6.246  -2.538  55.556  1.00 69.79  ? 80  GLU D CB  1 
ATOM   9040  C CG  . GLU D 2 80  ? -6.561  -3.890  54.934  1.00 85.84  ? 80  GLU D CG  1 
ATOM   9041  C CD  . GLU D 2 80  ? -7.359  -3.773  53.653  1.00 96.05  ? 80  GLU D CD  1 
ATOM   9042  O OE1 . GLU D 2 80  ? -8.179  -2.837  53.546  1.00 88.65  ? 80  GLU D OE1 1 
ATOM   9043  O OE2 . GLU D 2 80  ? -7.167  -4.618  52.754  1.00 93.98  ? 80  GLU D OE2 1 
ATOM   9044  N N   . GLU D 2 81  ? -5.096  0.324   53.984  1.00 64.94  ? 81  GLU D N   1 
ATOM   9045  C CA  . GLU D 2 81  ? -5.076  1.233   52.845  1.00 72.09  ? 81  GLU D CA  1 
ATOM   9046  C C   . GLU D 2 81  ? -3.764  1.119   52.074  1.00 70.68  ? 81  GLU D C   1 
ATOM   9047  O O   . GLU D 2 81  ? -3.772  1.146   50.849  1.00 73.64  ? 81  GLU D O   1 
ATOM   9048  C CB  . GLU D 2 81  ? -5.358  2.681   53.265  1.00 68.52  ? 81  GLU D CB  1 
ATOM   9049  C CG  . GLU D 2 81  ? -6.612  2.807   54.117  1.00 90.18  ? 81  GLU D CG  1 
ATOM   9050  C CD  . GLU D 2 81  ? -6.854  4.214   54.638  1.00 101.03 ? 81  GLU D CD  1 
ATOM   9051  O OE1 . GLU D 2 81  ? -5.918  4.835   55.184  1.00 96.85  ? 81  GLU D OE1 1 
ATOM   9052  O OE2 . GLU D 2 81  ? -8.011  4.680   54.535  1.00 108.34 ? 81  GLU D OE2 1 
ATOM   9053  N N   . VAL D 2 82  ? -2.635  1.050   52.773  1.00 54.09  ? 82  VAL D N   1 
ATOM   9054  C CA  . VAL D 2 82  ? -1.373  0.898   52.066  1.00 64.50  ? 82  VAL D CA  1 
ATOM   9055  C C   . VAL D 2 82  ? -1.287  -0.504  51.453  1.00 66.97  ? 82  VAL D C   1 
ATOM   9056  O O   . VAL D 2 82  ? -0.741  -0.673  50.359  1.00 61.33  ? 82  VAL D O   1 
ATOM   9057  C CB  . VAL D 2 82  ? -0.154  1.162   52.985  1.00 56.84  ? 82  VAL D CB  1 
ATOM   9058  C CG1 . VAL D 2 82  ? -0.208  2.578   53.541  1.00 56.34  ? 82  VAL D CG1 1 
ATOM   9059  C CG2 . VAL D 2 82  ? -0.072  0.150   54.115  1.00 69.86  ? 82  VAL D CG2 1 
ATOM   9060  N N   . ILE D 2 83  ? -1.853  -1.498  52.135  1.00 49.50  ? 83  ILE D N   1 
ATOM   9061  C CA  . ILE D 2 83  ? -1.893  -2.855  51.599  1.00 46.35  ? 83  ILE D CA  1 
ATOM   9062  C C   . ILE D 2 83  ? -2.786  -2.903  50.359  1.00 55.04  ? 83  ILE D C   1 
ATOM   9063  O O   . ILE D 2 83  ? -2.412  -3.488  49.337  1.00 67.32  ? 83  ILE D O   1 
ATOM   9064  C CB  . ILE D 2 83  ? -2.387  -3.875  52.649  1.00 57.27  ? 83  ILE D CB  1 
ATOM   9065  C CG1 . ILE D 2 83  ? -1.215  -4.366  53.499  1.00 59.06  ? 83  ILE D CG1 1 
ATOM   9066  C CG2 . ILE D 2 83  ? -3.041  -5.075  51.979  1.00 67.44  ? 83  ILE D CG2 1 
ATOM   9067  C CD1 . ILE D 2 83  ? -1.627  -5.218  54.680  1.00 74.48  ? 83  ILE D CD1 1 
ATOM   9068  N N   . SER D 2 84  ? -3.954  -2.270  50.444  1.00 63.20  ? 84  SER D N   1 
ATOM   9069  C CA  . SER D 2 84  ? -4.869  -2.233  49.306  1.00 59.43  ? 84  SER D CA  1 
ATOM   9070  C C   . SER D 2 84  ? -4.272  -1.465  48.124  1.00 48.67  ? 84  SER D C   1 
ATOM   9071  O O   . SER D 2 84  ? -4.374  -1.908  46.978  1.00 57.10  ? 84  SER D O   1 
ATOM   9072  C CB  . SER D 2 84  ? -6.207  -1.617  49.713  1.00 67.61  ? 84  SER D CB  1 
ATOM   9073  O OG  . SER D 2 84  ? -6.839  -2.391  50.717  1.00 72.22  ? 84  SER D OG  1 
ATOM   9074  N N   . THR D 2 85  ? -3.657  -0.319  48.407  1.00 52.95  ? 85  THR D N   1 
ATOM   9075  C CA  . THR D 2 85  ? -2.992  0.482   47.381  1.00 54.49  ? 85  THR D CA  1 
ATOM   9076  C C   . THR D 2 85  ? -1.930  -0.344  46.680  1.00 45.31  ? 85  THR D C   1 
ATOM   9077  O O   . THR D 2 85  ? -1.857  -0.368  45.454  1.00 50.47  ? 85  THR D O   1 
ATOM   9078  C CB  . THR D 2 85  ? -2.305  1.745   47.957  1.00 48.58  ? 85  THR D CB  1 
ATOM   9079  O OG1 . THR D 2 85  ? -3.229  2.508   48.737  1.00 52.79  ? 85  THR D OG1 1 
ATOM   9080  C CG2 . THR D 2 85  ? -1.768  2.615   46.835  1.00 45.81  ? 85  THR D CG2 1 
ATOM   9081  N N   . LEU D 2 86  ? -1.105  -1.021  47.472  1.00 45.86  ? 86  LEU D N   1 
ATOM   9082  C CA  . LEU D 2 86  ? -0.041  -1.853  46.925  1.00 51.71  ? 86  LEU D CA  1 
ATOM   9083  C C   . LEU D 2 86  ? -0.588  -3.008  46.090  1.00 45.39  ? 86  LEU D C   1 
ATOM   9084  O O   . LEU D 2 86  ? 0.011   -3.382  45.083  1.00 56.36  ? 86  LEU D O   1 
ATOM   9085  C CB  . LEU D 2 86  ? 0.850   -2.383  48.050  1.00 52.18  ? 86  LEU D CB  1 
ATOM   9086  C CG  . LEU D 2 86  ? 2.126   -1.582  48.334  1.00 46.14  ? 86  LEU D CG  1 
ATOM   9087  C CD1 . LEU D 2 86  ? 1.842   -0.094  48.497  1.00 35.14  ? 86  LEU D CD1 1 
ATOM   9088  C CD2 . LEU D 2 86  ? 2.824   -2.124  49.568  1.00 51.29  ? 86  LEU D CD2 1 
ATOM   9089  N N   . HIS D 2 87  ? -1.718  -3.574  46.503  1.00 40.89  ? 87  HIS D N   1 
ATOM   9090  C CA  . HIS D 2 87  ? -2.347  -4.640  45.726  1.00 55.60  ? 87  HIS D CA  1 
ATOM   9091  C C   . HIS D 2 87  ? -2.830  -4.114  44.373  1.00 48.52  ? 87  HIS D C   1 
ATOM   9092  O O   . HIS D 2 87  ? -2.596  -4.732  43.327  1.00 55.09  ? 87  HIS D O   1 
ATOM   9093  C CB  . HIS D 2 87  ? -3.513  -5.263  46.496  1.00 51.55  ? 87  HIS D CB  1 
ATOM   9094  C CG  . HIS D 2 87  ? -3.914  -6.613  45.988  1.00 49.98  ? 87  HIS D CG  1 
ATOM   9095  N ND1 . HIS D 2 87  ? -3.245  -7.767  46.336  1.00 61.15  ? 87  HIS D ND1 1 
ATOM   9096  C CD2 . HIS D 2 87  ? -4.905  -6.992  45.147  1.00 69.84  ? 87  HIS D CD2 1 
ATOM   9097  C CE1 . HIS D 2 87  ? -3.812  -8.799  45.738  1.00 59.66  ? 87  HIS D CE1 1 
ATOM   9098  N NE2 . HIS D 2 87  ? -4.821  -8.356  45.009  1.00 64.79  ? 87  HIS D NE2 1 
ATOM   9099  N N   . TYR D 2 88  ? -3.501  -2.966  44.409  1.00 34.60  ? 88  TYR D N   1 
ATOM   9100  C CA  . TYR D 2 88  ? -3.999  -2.307  43.206  1.00 47.77  ? 88  TYR D CA  1 
ATOM   9101  C C   . TYR D 2 88  ? -2.860  -2.015  42.232  1.00 52.03  ? 88  TYR D C   1 
ATOM   9102  O O   . TYR D 2 88  ? -2.934  -2.333  41.037  1.00 52.97  ? 88  TYR D O   1 
ATOM   9103  C CB  . TYR D 2 88  ? -4.711  -1.008  43.583  1.00 50.39  ? 88  TYR D CB  1 
ATOM   9104  C CG  . TYR D 2 88  ? -5.501  -0.378  42.462  1.00 63.33  ? 88  TYR D CG  1 
ATOM   9105  C CD1 . TYR D 2 88  ? -6.740  -0.881  42.090  1.00 45.45  ? 88  TYR D CD1 1 
ATOM   9106  C CD2 . TYR D 2 88  ? -4.998  0.708   41.761  1.00 57.20  ? 88  TYR D CD2 1 
ATOM   9107  C CE1 . TYR D 2 88  ? -7.465  -0.305  41.064  1.00 61.18  ? 88  TYR D CE1 1 
ATOM   9108  C CE2 . TYR D 2 88  ? -5.713  1.292   40.736  1.00 59.98  ? 88  TYR D CE2 1 
ATOM   9109  C CZ  . TYR D 2 88  ? -6.945  0.781   40.389  1.00 74.17  ? 88  TYR D CZ  1 
ATOM   9110  O OH  . TYR D 2 88  ? -7.657  1.359   39.364  1.00 86.34  ? 88  TYR D OH  1 
ATOM   9111  N N   . PHE D 2 89  ? -1.804  -1.407  42.763  1.00 53.54  ? 89  PHE D N   1 
ATOM   9112  C CA  . PHE D 2 89  ? -0.605  -1.109  41.992  1.00 44.26  ? 89  PHE D CA  1 
ATOM   9113  C C   . PHE D 2 89  ? 0.003   -2.375  41.410  1.00 45.83  ? 89  PHE D C   1 
ATOM   9114  O O   . PHE D 2 89  ? 0.464   -2.371  40.276  1.00 38.95  ? 89  PHE D O   1 
ATOM   9115  C CB  . PHE D 2 89  ? 0.424   -0.373  42.852  1.00 43.41  ? 89  PHE D CB  1 
ATOM   9116  C CG  . PHE D 2 89  ? 0.157   1.099   42.986  1.00 55.07  ? 89  PHE D CG  1 
ATOM   9117  C CD1 . PHE D 2 89  ? -0.588  1.768   42.029  1.00 63.46  ? 89  PHE D CD1 1 
ATOM   9118  C CD2 . PHE D 2 89  ? 0.659   1.816   44.059  1.00 57.45  ? 89  PHE D CD2 1 
ATOM   9119  C CE1 . PHE D 2 89  ? -0.834  3.123   42.143  1.00 63.01  ? 89  PHE D CE1 1 
ATOM   9120  C CE2 . PHE D 2 89  ? 0.418   3.172   44.178  1.00 56.09  ? 89  PHE D CE2 1 
ATOM   9121  C CZ  . PHE D 2 89  ? -0.331  3.826   43.220  1.00 59.90  ? 89  PHE D CZ  1 
ATOM   9122  N N   . SER D 2 90  ? 0.010   -3.452  42.190  1.00 37.81  ? 90  SER D N   1 
ATOM   9123  C CA  . SER D 2 90  ? 0.518   -4.732  41.708  1.00 50.59  ? 90  SER D CA  1 
ATOM   9124  C C   . SER D 2 90  ? -0.297  -5.210  40.510  1.00 47.82  ? 90  SER D C   1 
ATOM   9125  O O   . SER D 2 90  ? 0.255   -5.752  39.552  1.00 47.49  ? 90  SER D O   1 
ATOM   9126  C CB  . SER D 2 90  ? 0.491   -5.783  42.818  1.00 51.62  ? 90  SER D CB  1 
ATOM   9127  O OG  . SER D 2 90  ? -0.789  -6.379  42.920  1.00 65.43  ? 90  SER D OG  1 
ATOM   9128  N N   . LYS D 2 91  ? -1.610  -5.004  40.568  1.00 49.14  ? 91  LYS D N   1 
ATOM   9129  C CA  . LYS D 2 91  ? -2.482  -5.334  39.442  1.00 55.28  ? 91  LYS D CA  1 
ATOM   9130  C C   . LYS D 2 91  ? -2.135  -4.517  38.194  1.00 48.75  ? 91  LYS D C   1 
ATOM   9131  O O   . LYS D 2 91  ? -2.001  -5.068  37.091  1.00 40.60  ? 91  LYS D O   1 
ATOM   9132  C CB  . LYS D 2 91  ? -3.949  -5.120  39.821  1.00 54.66  ? 91  LYS D CB  1 
ATOM   9133  C CG  . LYS D 2 91  ? -4.484  -6.142  40.808  1.00 60.44  ? 91  LYS D CG  1 
ATOM   9134  C CD  . LYS D 2 91  ? -4.480  -7.534  40.196  1.00 67.27  ? 91  LYS D CD  1 
ATOM   9135  C CE  . LYS D 2 91  ? -5.280  -8.519  41.032  1.00 81.52  ? 91  LYS D CE  1 
ATOM   9136  N NZ  . LYS D 2 91  ? -5.356  -9.858  40.382  1.00 72.93  ? 91  LYS D NZ  1 
ATOM   9137  N N   . VAL D 2 92  ? -1.991  -3.206  38.373  1.00 39.44  ? 92  VAL D N   1 
ATOM   9138  C CA  . VAL D 2 92  ? -1.595  -2.323  37.276  1.00 42.82  ? 92  VAL D CA  1 
ATOM   9139  C C   . VAL D 2 92  ? -0.271  -2.762  36.645  1.00 48.48  ? 92  VAL D C   1 
ATOM   9140  O O   . VAL D 2 92  ? -0.148  -2.856  35.422  1.00 53.91  ? 92  VAL D O   1 
ATOM   9141  C CB  . VAL D 2 92  ? -1.461  -0.862  37.753  1.00 47.51  ? 92  VAL D CB  1 
ATOM   9142  C CG1 . VAL D 2 92  ? -0.855  0.008   36.658  1.00 37.12  ? 92  VAL D CG1 1 
ATOM   9143  C CG2 . VAL D 2 92  ? -2.811  -0.321  38.197  1.00 45.27  ? 92  VAL D CG2 1 
ATOM   9144  N N   . VAL D 2 93  ? 0.710   -3.033  37.498  1.00 52.77  ? 93  VAL D N   1 
ATOM   9145  C CA  . VAL D 2 93  ? 2.018   -3.513  37.071  1.00 44.05  ? 93  VAL D CA  1 
ATOM   9146  C C   . VAL D 2 93  ? 1.906   -4.830  36.307  1.00 48.94  ? 93  VAL D C   1 
ATOM   9147  O O   . VAL D 2 93  ? 2.624   -5.051  35.336  1.00 61.25  ? 93  VAL D O   1 
ATOM   9148  C CB  . VAL D 2 93  ? 2.968   -3.691  38.277  1.00 46.53  ? 93  VAL D CB  1 
ATOM   9149  C CG1 . VAL D 2 93  ? 4.230   -4.419  37.866  1.00 38.33  ? 93  VAL D CG1 1 
ATOM   9150  C CG2 . VAL D 2 93  ? 3.321   -2.342  38.875  1.00 40.62  ? 93  VAL D CG2 1 
ATOM   9151  N N   . ASP D 2 94  ? 1.001   -5.702  36.742  1.00 42.70  ? 94  ASP D N   1 
ATOM   9152  C CA  . ASP D 2 94  ? 0.752   -6.950  36.026  1.00 48.91  ? 94  ASP D CA  1 
ATOM   9153  C C   . ASP D 2 94  ? 0.236   -6.675  34.616  1.00 44.96  ? 94  ASP D C   1 
ATOM   9154  O O   . ASP D 2 94  ? 0.691   -7.288  33.644  1.00 45.41  ? 94  ASP D O   1 
ATOM   9155  C CB  . ASP D 2 94  ? -0.244  -7.826  36.792  1.00 56.31  ? 94  ASP D CB  1 
ATOM   9156  C CG  . ASP D 2 94  ? 0.385   -8.516  37.987  1.00 75.80  ? 94  ASP D CG  1 
ATOM   9157  O OD1 . ASP D 2 94  ? 1.557   -8.936  37.881  1.00 86.55  ? 94  ASP D OD1 1 
ATOM   9158  O OD2 . ASP D 2 94  ? -0.291  -8.641  39.031  1.00 78.34  ? 94  ASP D OD2 1 
ATOM   9159  N N   . GLU D 2 95  ? -0.707  -5.743  34.511  1.00 45.75  ? 95  GLU D N   1 
ATOM   9160  C CA  . GLU D 2 95  ? -1.247  -5.349  33.211  1.00 53.85  ? 95  GLU D CA  1 
ATOM   9161  C C   . GLU D 2 95  ? -0.157  -4.801  32.283  1.00 55.71  ? 95  GLU D C   1 
ATOM   9162  O O   . GLU D 2 95  ? -0.042  -5.206  31.114  1.00 59.22  ? 95  GLU D O   1 
ATOM   9163  C CB  . GLU D 2 95  ? -2.351  -4.306  33.396  1.00 56.94  ? 95  GLU D CB  1 
ATOM   9164  C CG  . GLU D 2 95  ? -3.660  -4.862  33.932  1.00 61.99  ? 95  GLU D CG  1 
ATOM   9165  C CD  . GLU D 2 95  ? -4.713  -3.786  34.118  1.00 90.08  ? 95  GLU D CD  1 
ATOM   9166  O OE1 . GLU D 2 95  ? -5.184  -3.231  33.102  1.00 100.41 ? 95  GLU D OE1 1 
ATOM   9167  O OE2 . GLU D 2 95  ? -5.070  -3.495  35.280  1.00 92.70  ? 95  GLU D OE2 1 
ATOM   9168  N N   . LEU D 2 96  ? 0.642   -3.879  32.814  1.00 46.98  ? 96  LEU D N   1 
ATOM   9169  C CA  . LEU D 2 96  ? 1.749   -3.294  32.064  1.00 50.07  ? 96  LEU D CA  1 
ATOM   9170  C C   . LEU D 2 96  ? 2.743   -4.363  31.620  1.00 40.80  ? 96  LEU D C   1 
ATOM   9171  O O   . LEU D 2 96  ? 3.254   -4.325  30.498  1.00 47.78  ? 96  LEU D O   1 
ATOM   9172  C CB  . LEU D 2 96  ? 2.460   -2.234  32.907  1.00 34.25  ? 96  LEU D CB  1 
ATOM   9173  C CG  . LEU D 2 96  ? 3.494   -1.367  32.188  1.00 43.29  ? 96  LEU D CG  1 
ATOM   9174  C CD1 . LEU D 2 96  ? 2.949   -0.879  30.855  1.00 42.09  ? 96  LEU D CD1 1 
ATOM   9175  C CD2 . LEU D 2 96  ? 3.910   -0.194  33.064  1.00 38.35  ? 96  LEU D CD2 1 
ATOM   9176  N N   . ASN D 2 97  ? 3.014   -5.309  32.514  1.00 35.14  ? 97  ASN D N   1 
ATOM   9177  C CA  . ASN D 2 97  ? 3.817   -6.480  32.189  1.00 44.72  ? 97  ASN D CA  1 
ATOM   9178  C C   . ASN D 2 97  ? 3.244   -7.225  30.993  1.00 42.10  ? 97  ASN D C   1 
ATOM   9179  O O   . ASN D 2 97  ? 3.990   -7.648  30.114  1.00 56.14  ? 97  ASN D O   1 
ATOM   9180  C CB  . ASN D 2 97  ? 3.929   -7.419  33.391  1.00 42.38  ? 97  ASN D CB  1 
ATOM   9181  C CG  . ASN D 2 97  ? 4.577   -8.743  33.035  1.00 46.30  ? 97  ASN D CG  1 
ATOM   9182  O OD1 . ASN D 2 97  ? 5.803   -8.857  33.000  1.00 47.61  ? 97  ASN D OD1 1 
ATOM   9183  N ND2 . ASN D 2 97  ? 3.756   -9.754  32.774  1.00 58.37  ? 97  ASN D ND2 1 
ATOM   9184  N N   . LEU D 2 98  ? 1.926   -7.407  30.977  1.00 51.47  ? 98  LEU D N   1 
ATOM   9185  C CA  . LEU D 2 98  ? 1.268   -8.077  29.857  1.00 50.67  ? 98  LEU D CA  1 
ATOM   9186  C C   . LEU D 2 98  ? 1.544   -7.325  28.555  1.00 51.97  ? 98  LEU D C   1 
ATOM   9187  O O   . LEU D 2 98  ? 1.928   -7.925  27.537  1.00 42.29  ? 98  LEU D O   1 
ATOM   9188  C CB  . LEU D 2 98  ? -0.241  -8.183  30.093  1.00 43.18  ? 98  LEU D CB  1 
ATOM   9189  C CG  . LEU D 2 98  ? -0.722  -9.181  31.147  1.00 51.08  ? 98  LEU D CG  1 
ATOM   9190  C CD1 . LEU D 2 98  ? -2.238  -9.133  31.277  1.00 55.89  ? 98  LEU D CD1 1 
ATOM   9191  C CD2 . LEU D 2 98  ? -0.254  -10.586 30.806  1.00 40.85  ? 98  LEU D CD2 1 
ATOM   9192  N N   . LEU D 2 99  ? 1.345   -6.009  28.602  1.00 41.11  ? 99  LEU D N   1 
ATOM   9193  C CA  . LEU D 2 99  ? 1.637   -5.136  27.466  1.00 38.14  ? 99  LEU D CA  1 
ATOM   9194  C C   . LEU D 2 99  ? 3.055   -5.346  26.926  1.00 54.93  ? 99  LEU D C   1 
ATOM   9195  O O   . LEU D 2 99  ? 3.261   -5.613  25.731  1.00 62.20  ? 99  LEU D O   1 
ATOM   9196  C CB  . LEU D 2 99  ? 1.468   -3.675  27.882  1.00 44.97  ? 99  LEU D CB  1 
ATOM   9197  C CG  . LEU D 2 99  ? 0.052   -3.106  27.916  1.00 48.12  ? 99  LEU D CG  1 
ATOM   9198  C CD1 . LEU D 2 99  ? 0.106   -1.597  28.055  1.00 50.81  ? 99  LEU D CD1 1 
ATOM   9199  C CD2 . LEU D 2 99  ? -0.725  -3.515  26.684  1.00 57.15  ? 99  LEU D CD2 1 
ATOM   9200  N N   . HIS D 2 100 ? 4.024   -5.240  27.831  1.00 47.71  ? 100 HIS D N   1 
ATOM   9201  C CA  . HIS D 2 100 ? 5.433   -5.397  27.488  1.00 49.04  ? 100 HIS D CA  1 
ATOM   9202  C C   . HIS D 2 100 ? 5.734   -6.777  26.915  1.00 53.18  ? 100 HIS D C   1 
ATOM   9203  O O   . HIS D 2 100 ? 6.539   -6.908  25.997  1.00 58.75  ? 100 HIS D O   1 
ATOM   9204  C CB  . HIS D 2 100 ? 6.311   -5.134  28.714  1.00 46.85  ? 100 HIS D CB  1 
ATOM   9205  C CG  . HIS D 2 100 ? 6.568   -3.683  28.973  1.00 53.12  ? 100 HIS D CG  1 
ATOM   9206  N ND1 . HIS D 2 100 ? 7.370   -2.911  28.159  1.00 55.61  ? 100 HIS D ND1 1 
ATOM   9207  C CD2 . HIS D 2 100 ? 6.125   -2.858  29.952  1.00 54.58  ? 100 HIS D CD2 1 
ATOM   9208  C CE1 . HIS D 2 100 ? 7.414   -1.678  28.627  1.00 57.36  ? 100 HIS D CE1 1 
ATOM   9209  N NE2 . HIS D 2 100 ? 6.665   -1.618  29.715  1.00 48.70  ? 100 HIS D NE2 1 
ATOM   9210  N N   . THR D 2 101 ? 5.102   -7.804  27.475  1.00 45.69  ? 101 THR D N   1 
ATOM   9211  C CA  . THR D 2 101 ? 5.285   -9.173  27.005  1.00 47.27  ? 101 THR D CA  1 
ATOM   9212  C C   . THR D 2 101 ? 4.821   -9.320  25.564  1.00 50.74  ? 101 THR D C   1 
ATOM   9213  O O   . THR D 2 101 ? 5.520   -9.910  24.731  1.00 61.28  ? 101 THR D O   1 
ATOM   9214  C CB  . THR D 2 101 ? 4.522   -10.181 27.884  1.00 51.08  ? 101 THR D CB  1 
ATOM   9215  O OG1 . THR D 2 101 ? 4.903   -10.009 29.254  1.00 58.69  ? 101 THR D OG1 1 
ATOM   9216  C CG2 . THR D 2 101 ? 4.830   -11.606 27.451  1.00 47.12  ? 101 THR D CG2 1 
ATOM   9217  N N   . GLU D 2 102 ? 3.644   -8.773  25.269  1.00 57.08  ? 102 GLU D N   1 
ATOM   9218  C CA  . GLU D 2 102 ? 3.117   -8.847  23.912  1.00 54.41  ? 102 GLU D CA  1 
ATOM   9219  C C   . GLU D 2 102 ? 4.011   -8.078  22.943  1.00 59.09  ? 102 GLU D C   1 
ATOM   9220  O O   . GLU D 2 102 ? 4.246   -8.526  21.816  1.00 58.51  ? 102 GLU D O   1 
ATOM   9221  C CB  . GLU D 2 102 ? 1.684   -8.319  23.851  1.00 53.05  ? 102 GLU D CB  1 
ATOM   9222  C CG  . GLU D 2 102 ? 0.642   -9.419  23.726  1.00 83.86  ? 102 GLU D CG  1 
ATOM   9223  C CD  . GLU D 2 102 ? 0.830   -10.260 22.475  1.00 93.67  ? 102 GLU D CD  1 
ATOM   9224  O OE1 . GLU D 2 102 ? 1.041   -9.678  21.390  1.00 71.36  ? 102 GLU D OE1 1 
ATOM   9225  O OE2 . GLU D 2 102 ? 0.775   -11.504 22.578  1.00 98.84  ? 102 GLU D OE2 1 
ATOM   9226  N N   . LEU D 2 103 ? 4.522   -6.931  23.385  1.00 54.58  ? 103 LEU D N   1 
ATOM   9227  C CA  . LEU D 2 103 ? 5.462   -6.178  22.557  1.00 51.81  ? 103 LEU D CA  1 
ATOM   9228  C C   . LEU D 2 103 ? 6.728   -6.993  22.287  1.00 50.71  ? 103 LEU D C   1 
ATOM   9229  O O   . LEU D 2 103 ? 7.244   -6.998  21.169  1.00 55.42  ? 103 LEU D O   1 
ATOM   9230  C CB  . LEU D 2 103 ? 5.822   -4.844  23.216  1.00 48.00  ? 103 LEU D CB  1 
ATOM   9231  C CG  . LEU D 2 103 ? 6.870   -3.988  22.499  1.00 29.29  ? 103 LEU D CG  1 
ATOM   9232  C CD1 . LEU D 2 103 ? 6.509   -3.785  21.036  1.00 35.22  ? 103 LEU D CD1 1 
ATOM   9233  C CD2 . LEU D 2 103 ? 7.029   -2.647  23.195  1.00 43.64  ? 103 LEU D CD2 1 
ATOM   9234  N N   . ALA D 2 104 ? 7.218   -7.683  23.313  1.00 49.50  ? 104 ALA D N   1 
ATOM   9235  C CA  . ALA D 2 104 ? 8.410   -8.516  23.192  1.00 47.51  ? 104 ALA D CA  1 
ATOM   9236  C C   . ALA D 2 104 ? 8.198   -9.633  22.175  1.00 58.11  ? 104 ALA D C   1 
ATOM   9237  O O   . ALA D 2 104 ? 9.074   -9.912  21.349  1.00 62.25  ? 104 ALA D O   1 
ATOM   9238  C CB  . ALA D 2 104 ? 8.791   -9.095  24.545  1.00 47.59  ? 104 ALA D CB  1 
ATOM   9239  N N   . LYS D 2 105 ? 7.027   -10.262 22.227  1.00 54.68  ? 105 LYS D N   1 
ATOM   9240  C CA  . LYS D 2 105 ? 6.730   -11.357 21.313  1.00 62.63  ? 105 LYS D CA  1 
ATOM   9241  C C   . LYS D 2 105 ? 6.569   -10.817 19.896  1.00 60.18  ? 105 LYS D C   1 
ATOM   9242  O O   . LYS D 2 105 ? 6.899   -11.495 18.918  1.00 48.69  ? 105 LYS D O   1 
ATOM   9243  C CB  . LYS D 2 105 ? 5.467   -12.103 21.746  1.00 30.67  ? 105 LYS D CB  1 
ATOM   9244  N N   . GLN D 2 106 ? 6.086   -9.582  19.797  1.00 55.45  ? 106 GLN D N   1 
ATOM   9245  C CA  . GLN D 2 106 ? 5.967   -8.914  18.507  1.00 59.23  ? 106 GLN D CA  1 
ATOM   9246  C C   . GLN D 2 106 ? 7.339   -8.652  17.896  1.00 53.06  ? 106 GLN D C   1 
ATOM   9247  O O   . GLN D 2 106 ? 7.553   -8.892  16.708  1.00 61.28  ? 106 GLN D O   1 
ATOM   9248  C CB  . GLN D 2 106 ? 5.198   -7.600  18.651  1.00 62.85  ? 106 GLN D CB  1 
ATOM   9249  C CG  . GLN D 2 106 ? 3.689   -7.764  18.649  1.00 69.68  ? 106 GLN D CG  1 
ATOM   9250  C CD  . GLN D 2 106 ? 3.181   -8.449  17.398  1.00 78.73  ? 106 GLN D CD  1 
ATOM   9251  O OE1 . GLN D 2 106 ? 2.790   -9.616  17.432  1.00 73.16  ? 106 GLN D OE1 1 
ATOM   9252  N NE2 . GLN D 2 106 ? 3.189   -7.728  16.283  1.00 77.66  ? 106 GLN D NE2 1 
ATOM   9253  N N   . LEU D 2 107 ? 8.265   -8.160  18.714  1.00 59.67  ? 107 LEU D N   1 
ATOM   9254  C CA  . LEU D 2 107 ? 9.631   -7.914  18.262  1.00 52.26  ? 107 LEU D CA  1 
ATOM   9255  C C   . LEU D 2 107 ? 10.308  -9.211  17.843  1.00 46.96  ? 107 LEU D C   1 
ATOM   9256  O O   . LEU D 2 107 ? 11.014  -9.253  16.836  1.00 53.41  ? 107 LEU D O   1 
ATOM   9257  C CB  . LEU D 2 107 ? 10.452  -7.221  19.351  1.00 49.69  ? 107 LEU D CB  1 
ATOM   9258  C CG  . LEU D 2 107 ? 9.954   -5.857  19.832  1.00 53.61  ? 107 LEU D CG  1 
ATOM   9259  C CD1 . LEU D 2 107 ? 10.862  -5.313  20.925  1.00 60.24  ? 107 LEU D CD1 1 
ATOM   9260  C CD2 . LEU D 2 107 ? 9.861   -4.881  18.670  1.00 50.53  ? 107 LEU D CD2 1 
ATOM   9261  N N   . ALA D 2 108 ? 10.098  -10.266 18.623  1.00 56.67  ? 108 ALA D N   1 
ATOM   9262  C CA  . ALA D 2 108 ? 10.709  -11.554 18.322  1.00 54.03  ? 108 ALA D CA  1 
ATOM   9263  C C   . ALA D 2 108 ? 10.189  -12.132 17.011  1.00 59.53  ? 108 ALA D C   1 
ATOM   9264  O O   . ALA D 2 108 ? 10.968  -12.548 16.155  1.00 62.86  ? 108 ALA D O   1 
ATOM   9265  C CB  . ALA D 2 108 ? 10.464  -12.533 19.460  1.00 59.29  ? 108 ALA D CB  1 
ATOM   9266  N N   . ASP D 2 109 ? 8.869   -12.154 16.859  1.00 66.86  ? 109 ASP D N   1 
ATOM   9267  C CA  . ASP D 2 109 ? 8.242   -12.746 15.678  1.00 59.13  ? 109 ASP D CA  1 
ATOM   9268  C C   . ASP D 2 109 ? 8.379   -11.917 14.399  1.00 61.84  ? 109 ASP D C   1 
ATOM   9269  O O   . ASP D 2 109 ? 8.824   -12.424 13.370  1.00 74.21  ? 109 ASP D O   1 
ATOM   9270  C CB  . ASP D 2 109 ? 6.760   -13.003 15.954  1.00 66.84  ? 109 ASP D CB  1 
ATOM   9271  C CG  . ASP D 2 109 ? 6.541   -14.127 16.947  1.00 88.63  ? 109 ASP D CG  1 
ATOM   9272  O OD1 . ASP D 2 109 ? 7.543   -14.695 17.432  1.00 83.86  ? 109 ASP D OD1 1 
ATOM   9273  O OD2 . ASP D 2 109 ? 5.370   -14.444 17.244  1.00 102.25 ? 109 ASP D OD2 1 
ATOM   9274  N N   . THR D 2 110 ? 7.988   -10.648 14.470  1.00 58.32  ? 110 THR D N   1 
ATOM   9275  C CA  . THR D 2 110 ? 7.815   -9.832  13.271  1.00 49.55  ? 110 THR D CA  1 
ATOM   9276  C C   . THR D 2 110 ? 8.996   -8.925  12.920  1.00 61.27  ? 110 THR D C   1 
ATOM   9277  O O   . THR D 2 110 ? 8.938   -8.183  11.939  1.00 61.38  ? 110 THR D O   1 
ATOM   9278  C CB  . THR D 2 110 ? 6.563   -8.947  13.399  1.00 51.50  ? 110 THR D CB  1 
ATOM   9279  O OG1 . THR D 2 110 ? 6.737   -8.024  14.481  1.00 63.74  ? 110 THR D OG1 1 
ATOM   9280  C CG2 . THR D 2 110 ? 5.333   -9.801  13.658  1.00 40.94  ? 110 THR D CG2 1 
ATOM   9281  N N   . MET D 2 111 ? 10.062  -8.980  13.711  1.00 63.65  ? 111 MET D N   1 
ATOM   9282  C CA  . MET D 2 111 ? 11.211  -8.107  13.479  1.00 65.08  ? 111 MET D CA  1 
ATOM   9283  C C   . MET D 2 111 ? 12.525  -8.881  13.421  1.00 63.69  ? 111 MET D C   1 
ATOM   9284  O O   . MET D 2 111 ? 13.185  -8.921  12.383  1.00 74.10  ? 111 MET D O   1 
ATOM   9285  C CB  . MET D 2 111 ? 11.287  -7.034  14.564  1.00 58.49  ? 111 MET D CB  1 
ATOM   9286  C CG  . MET D 2 111 ? 12.510  -6.143  14.469  1.00 55.21  ? 111 MET D CG  1 
ATOM   9287  S SD  . MET D 2 111 ? 12.416  -4.745  15.599  1.00 92.23  ? 111 MET D SD  1 
ATOM   9288  C CE  . MET D 2 111 ? 13.209  -5.437  17.049  1.00 50.52  ? 111 MET D CE  1 
ATOM   9289  N N   . VAL D 2 112 ? 12.903  -9.486  14.542  1.00 56.97  ? 112 VAL D N   1 
ATOM   9290  C CA  . VAL D 2 112 ? 14.150  -10.236 14.637  1.00 54.46  ? 112 VAL D CA  1 
ATOM   9291  C C   . VAL D 2 112 ? 14.132  -11.461 13.721  1.00 67.46  ? 112 VAL D C   1 
ATOM   9292  O O   . VAL D 2 112 ? 15.091  -11.722 12.988  1.00 74.27  ? 112 VAL D O   1 
ATOM   9293  C CB  . VAL D 2 112 ? 14.424  -10.687 16.085  1.00 47.96  ? 112 VAL D CB  1 
ATOM   9294  C CG1 . VAL D 2 112 ? 15.775  -11.374 16.180  1.00 57.06  ? 112 VAL D CG1 1 
ATOM   9295  C CG2 . VAL D 2 112 ? 14.357  -9.499  17.036  1.00 57.55  ? 112 VAL D CG2 1 
ATOM   9296  N N   . LEU D 2 113 ? 13.029  -12.202 13.767  1.00 66.59  ? 113 LEU D N   1 
ATOM   9297  C CA  . LEU D 2 113 ? 12.910  -13.477 13.062  1.00 72.87  ? 113 LEU D CA  1 
ATOM   9298  C C   . LEU D 2 113 ? 12.847  -13.377 11.525  1.00 75.37  ? 113 LEU D C   1 
ATOM   9299  O O   . LEU D 2 113 ? 13.297  -14.292 10.839  1.00 76.82  ? 113 LEU D O   1 
ATOM   9300  C CB  . LEU D 2 113 ? 11.675  -14.230 13.567  1.00 72.04  ? 113 LEU D CB  1 
ATOM   9301  C CG  . LEU D 2 113 ? 11.313  -15.506 12.804  1.00 77.59  ? 113 LEU D CG  1 
ATOM   9302  C CD1 . LEU D 2 113 ? 12.295  -16.626 13.138  1.00 85.52  ? 113 LEU D CD1 1 
ATOM   9303  C CD2 . LEU D 2 113 ? 9.881   -15.923 13.075  1.00 79.37  ? 113 LEU D CD2 1 
ATOM   9304  N N   . PRO D 2 114 ? 12.269  -12.293 10.970  1.00 67.10  ? 114 PRO D N   1 
ATOM   9305  C CA  . PRO D 2 114 ? 12.455  -12.140 9.521   1.00 65.46  ? 114 PRO D CA  1 
ATOM   9306  C C   . PRO D 2 114 ? 13.920  -11.991 9.109   1.00 70.12  ? 114 PRO D C   1 
ATOM   9307  O O   . PRO D 2 114 ? 14.326  -12.566 8.097   1.00 70.13  ? 114 PRO D O   1 
ATOM   9308  C CB  . PRO D 2 114 ? 11.666  -10.866 9.208   1.00 58.95  ? 114 PRO D CB  1 
ATOM   9309  C CG  . PRO D 2 114 ? 10.584  -10.872 10.223  1.00 67.06  ? 114 PRO D CG  1 
ATOM   9310  C CD  . PRO D 2 114 ? 11.252  -11.354 11.478  1.00 68.14  ? 114 PRO D CD  1 
ATOM   9311  N N   . ILE D 2 115 ? 14.696  -11.234 9.877   1.00 68.79  ? 115 ILE D N   1 
ATOM   9312  C CA  . ILE D 2 115 ? 16.122  -11.090 9.602   1.00 60.53  ? 115 ILE D CA  1 
ATOM   9313  C C   . ILE D 2 115 ? 16.831  -12.430 9.766   1.00 57.95  ? 115 ILE D C   1 
ATOM   9314  O O   . ILE D 2 115 ? 17.657  -12.814 8.930   1.00 60.72  ? 115 ILE D O   1 
ATOM   9315  C CB  . ILE D 2 115 ? 16.776  -10.038 10.514  1.00 52.26  ? 115 ILE D CB  1 
ATOM   9316  C CG1 . ILE D 2 115 ? 15.969  -8.740  10.470  1.00 64.65  ? 115 ILE D CG1 1 
ATOM   9317  C CG2 . ILE D 2 115 ? 18.199  -9.756  10.069  1.00 59.95  ? 115 ILE D CG2 1 
ATOM   9318  C CD1 . ILE D 2 115 ? 16.606  -7.597  11.216  1.00 51.04  ? 115 ILE D CD1 1 
ATOM   9319  N N   . ILE D 2 116 ? 16.501  -13.134 10.847  1.00 60.57  ? 116 ILE D N   1 
ATOM   9320  C CA  . ILE D 2 116 ? 17.057  -14.460 11.102  1.00 59.67  ? 116 ILE D CA  1 
ATOM   9321  C C   . ILE D 2 116 ? 16.789  -15.391 9.922   1.00 62.51  ? 116 ILE D C   1 
ATOM   9322  O O   . ILE D 2 116 ? 17.697  -16.064 9.444   1.00 64.17  ? 116 ILE D O   1 
ATOM   9323  C CB  . ILE D 2 116 ? 16.487  -15.085 12.391  1.00 69.06  ? 116 ILE D CB  1 
ATOM   9324  C CG1 . ILE D 2 116 ? 16.970  -14.307 13.615  1.00 61.87  ? 116 ILE D CG1 1 
ATOM   9325  C CG2 . ILE D 2 116 ? 16.900  -16.546 12.507  1.00 48.07  ? 116 ILE D CG2 1 
ATOM   9326  C CD1 . ILE D 2 116 ? 16.444  -14.837 14.930  1.00 78.68  ? 116 ILE D CD1 1 
ATOM   9327  N N   . GLN D 2 117 ? 15.543  -15.426 9.456   1.00 70.17  ? 117 GLN D N   1 
ATOM   9328  C CA  . GLN D 2 117 ? 15.163  -16.314 8.363   1.00 68.44  ? 117 GLN D CA  1 
ATOM   9329  C C   . GLN D 2 117 ? 15.847  -15.924 7.069   1.00 73.49  ? 117 GLN D C   1 
ATOM   9330  O O   . GLN D 2 117 ? 16.245  -16.781 6.280   1.00 73.09  ? 117 GLN D O   1 
ATOM   9331  C CB  . GLN D 2 117 ? 13.658  -16.272 8.113   1.00 85.52  ? 117 GLN D CB  1 
ATOM   9332  C CG  . GLN D 2 117 ? 12.761  -16.974 9.105   1.00 80.45  ? 117 GLN D CG  1 
ATOM   9333  C CD  . GLN D 2 117 ? 11.324  -16.961 8.622   1.00 99.24  ? 117 GLN D CD  1 
ATOM   9334  O OE1 . GLN D 2 117 ? 11.064  -17.066 7.421   1.00 112.56 ? 117 GLN D OE1 1 
ATOM   9335  N NE2 . GLN D 2 117 ? 10.387  -16.812 9.547   1.00 88.56  ? 117 GLN D NE2 1 
ATOM   9336  N N   . PHE D 2 118 ? 15.973  -14.620 6.853   1.00 66.83  ? 118 PHE D N   1 
ATOM   9337  C CA  . PHE D 2 118 ? 16.636  -14.113 5.662   1.00 65.80  ? 118 PHE D CA  1 
ATOM   9338  C C   . PHE D 2 118 ? 18.098  -14.550 5.601   1.00 70.11  ? 118 PHE D C   1 
ATOM   9339  O O   . PHE D 2 118 ? 18.519  -15.219 4.653   1.00 83.17  ? 118 PHE D O   1 
ATOM   9340  C CB  . PHE D 2 118 ? 16.520  -12.591 5.624   1.00 57.83  ? 118 PHE D CB  1 
ATOM   9341  C CG  . PHE D 2 118 ? 17.411  -11.944 4.618   1.00 64.01  ? 118 PHE D CG  1 
ATOM   9342  C CD1 . PHE D 2 118 ? 17.121  -12.029 3.268   1.00 79.08  ? 118 PHE D CD1 1 
ATOM   9343  C CD2 . PHE D 2 118 ? 18.533  -11.246 5.017   1.00 66.77  ? 118 PHE D CD2 1 
ATOM   9344  C CE1 . PHE D 2 118 ? 17.936  -11.431 2.334   1.00 63.81  ? 118 PHE D CE1 1 
ATOM   9345  C CE2 . PHE D 2 118 ? 19.354  -10.646 4.088   1.00 71.30  ? 118 PHE D CE2 1 
ATOM   9346  C CZ  . PHE D 2 118 ? 19.055  -10.737 2.743   1.00 66.57  ? 118 PHE D CZ  1 
ATOM   9347  N N   . ARG D 2 119 ? 18.853  -14.181 6.634   1.00 62.30  ? 119 ARG D N   1 
ATOM   9348  C CA  . ARG D 2 119 ? 20.247  -14.594 6.792   1.00 56.27  ? 119 ARG D CA  1 
ATOM   9349  C C   . ARG D 2 119 ? 20.425  -16.113 6.683   1.00 66.51  ? 119 ARG D C   1 
ATOM   9350  O O   . ARG D 2 119 ? 21.293  -16.594 5.955   1.00 73.27  ? 119 ARG D O   1 
ATOM   9351  C CB  . ARG D 2 119 ? 20.814  -14.092 8.123   1.00 58.41  ? 119 ARG D CB  1 
ATOM   9352  C CG  . ARG D 2 119 ? 22.307  -14.344 8.253   1.00 86.95  ? 119 ARG D CG  1 
ATOM   9353  C CD  . ARG D 2 119 ? 22.837  -14.108 9.656   1.00 82.47  ? 119 ARG D CD  1 
ATOM   9354  N NE  . ARG D 2 119 ? 24.295  -14.164 9.679   1.00 106.41 ? 119 ARG D NE  1 
ATOM   9355  C CZ  . ARG D 2 119 ? 25.025  -14.226 10.787  1.00 112.83 ? 119 ARG D CZ  1 
ATOM   9356  N NH1 . ARG D 2 119 ? 26.351  -14.286 10.709  1.00 112.34 ? 119 ARG D NH1 1 
ATOM   9357  N NH2 . ARG D 2 119 ? 24.430  -14.203 11.973  1.00 104.22 ? 119 ARG D NH2 1 
ATOM   9358  N N   . GLU D 2 120 ? 19.595  -16.853 7.412   1.00 74.51  ? 120 GLU D N   1 
ATOM   9359  C CA  . GLU D 2 120 ? 19.641  -18.317 7.444   1.00 74.41  ? 120 GLU D CA  1 
ATOM   9360  C C   . GLU D 2 120 ? 19.412  -18.960 6.080   1.00 82.12  ? 120 GLU D C   1 
ATOM   9361  O O   . GLU D 2 120 ? 20.137  -19.873 5.688   1.00 82.07  ? 120 GLU D O   1 
ATOM   9362  C CB  . GLU D 2 120 ? 18.608  -18.860 8.435   1.00 81.77  ? 120 GLU D CB  1 
ATOM   9363  N N   . LYS D 2 121 ? 18.376  -18.514 5.382   1.00 83.03  ? 121 LYS D N   1 
ATOM   9364  C CA  . LYS D 2 121 ? 17.875  -19.211 4.207   1.00 69.98  ? 121 LYS D CA  1 
ATOM   9365  C C   . LYS D 2 121 ? 18.354  -18.602 2.888   1.00 73.36  ? 121 LYS D C   1 
ATOM   9366  O O   . LYS D 2 121 ? 19.009  -19.275 2.089   1.00 81.59  ? 121 LYS D O   1 
ATOM   9367  C CB  . LYS D 2 121 ? 16.344  -19.246 4.231   1.00 62.13  ? 121 LYS D CB  1 
ATOM   9368  N N   . ASP D 2 122 ? 18.051  -17.326 2.674   1.00 67.95  ? 122 ASP D N   1 
ATOM   9369  C CA  . ASP D 2 122 ? 18.407  -16.658 1.423   1.00 76.08  ? 122 ASP D CA  1 
ATOM   9370  C C   . ASP D 2 122 ? 19.908  -16.416 1.230   1.00 73.39  ? 122 ASP D C   1 
ATOM   9371  O O   . ASP D 2 122 ? 20.471  -16.772 0.186   1.00 70.95  ? 122 ASP D O   1 
ATOM   9372  C CB  . ASP D 2 122 ? 17.666  -15.321 1.346   1.00 73.55  ? 122 ASP D CB  1 
ATOM   9373  C CG  . ASP D 2 122 ? 16.159  -15.496 1.302   1.00 94.78  ? 122 ASP D CG  1 
ATOM   9374  O OD1 . ASP D 2 122 ? 15.688  -16.471 0.679   1.00 104.39 ? 122 ASP D OD1 1 
ATOM   9375  O OD2 . ASP D 2 122 ? 15.446  -14.670 1.911   1.00 86.07  ? 122 ASP D OD2 1 
ATOM   9376  N N   . LEU D 2 123 ? 20.560  -15.839 2.233   1.00 65.84  ? 123 LEU D N   1 
ATOM   9377  C CA  . LEU D 2 123 ? 21.982  -15.529 2.122   1.00 56.18  ? 123 LEU D CA  1 
ATOM   9378  C C   . LEU D 2 123 ? 22.821  -16.796 1.990   1.00 64.43  ? 123 LEU D C   1 
ATOM   9379  O O   . LEU D 2 123 ? 23.762  -16.848 1.196   1.00 73.82  ? 123 LEU D O   1 
ATOM   9380  C CB  . LEU D 2 123 ? 22.450  -14.706 3.323   1.00 47.55  ? 123 LEU D CB  1 
ATOM   9381  C CG  . LEU D 2 123 ? 22.017  -13.239 3.312   1.00 56.31  ? 123 LEU D CG  1 
ATOM   9382  C CD1 . LEU D 2 123 ? 22.772  -12.439 4.360   1.00 48.96  ? 123 LEU D CD1 1 
ATOM   9383  C CD2 . LEU D 2 123 ? 22.221  -12.639 1.930   1.00 53.91  ? 123 LEU D CD2 1 
ATOM   9384  N N   . THR D 2 124 ? 22.473  -17.816 2.767   1.00 62.48  ? 124 THR D N   1 
ATOM   9385  C CA  . THR D 2 124 ? 23.169  -19.094 2.698   1.00 77.08  ? 124 THR D CA  1 
ATOM   9386  C C   . THR D 2 124 ? 22.870  -19.806 1.380   1.00 76.81  ? 124 THR D C   1 
ATOM   9387  O O   . THR D 2 124 ? 23.724  -20.518 0.850   1.00 82.95  ? 124 THR D O   1 
ATOM   9388  C CB  . THR D 2 124 ? 22.790  -20.008 3.872   1.00 80.52  ? 124 THR D CB  1 
ATOM   9389  O OG1 . THR D 2 124 ? 21.367  -20.158 3.920   1.00 78.69  ? 124 THR D OG1 1 
ATOM   9390  C CG2 . THR D 2 124 ? 23.281  -19.415 5.188   1.00 76.61  ? 124 THR D CG2 1 
ATOM   9391  N N   . GLU D 2 125 ? 21.655  -19.628 0.863   1.00 66.30  ? 125 GLU D N   1 
ATOM   9392  C CA  . GLU D 2 125 ? 21.324  -20.128 -0.470  1.00 75.17  ? 125 GLU D CA  1 
ATOM   9393  C C   . GLU D 2 125 ? 22.292  -19.553 -1.497  1.00 64.00  ? 125 GLU D C   1 
ATOM   9394  O O   . GLU D 2 125 ? 22.874  -20.279 -2.318  1.00 68.27  ? 125 GLU D O   1 
ATOM   9395  C CB  . GLU D 2 125 ? 19.888  -19.763 -0.850  1.00 78.20  ? 125 GLU D CB  1 
ATOM   9396  C CG  . GLU D 2 125 ? 19.279  -20.645 -1.923  1.00 79.87  ? 125 GLU D CG  1 
ATOM   9397  C CD  . GLU D 2 125 ? 17.937  -20.126 -2.399  1.00 112.39 ? 125 GLU D CD  1 
ATOM   9398  O OE1 . GLU D 2 125 ? 17.358  -19.256 -1.714  1.00 102.86 ? 125 GLU D OE1 1 
ATOM   9399  O OE2 . GLU D 2 125 ? 17.478  -20.562 -3.476  1.00 125.97 ? 125 GLU D OE2 1 
ATOM   9400  N N   . VAL D 2 126 ? 22.465  -18.236 -1.425  1.00 62.80  ? 126 VAL D N   1 
ATOM   9401  C CA  . VAL D 2 126 ? 23.397  -17.531 -2.294  1.00 54.50  ? 126 VAL D CA  1 
ATOM   9402  C C   . VAL D 2 126 ? 24.821  -18.062 -2.135  1.00 65.89  ? 126 VAL D C   1 
ATOM   9403  O O   . VAL D 2 126 ? 25.503  -18.320 -3.127  1.00 67.49  ? 126 VAL D O   1 
ATOM   9404  C CB  . VAL D 2 126 ? 23.376  -16.020 -2.015  1.00 57.29  ? 126 VAL D CB  1 
ATOM   9405  C CG1 . VAL D 2 126 ? 24.530  -15.331 -2.719  1.00 52.43  ? 126 VAL D CG1 1 
ATOM   9406  C CG2 . VAL D 2 126 ? 22.047  -15.428 -2.452  1.00 67.84  ? 126 VAL D CG2 1 
ATOM   9407  N N   . SER D 2 127 ? 25.257  -18.228 -0.889  1.00 67.39  ? 127 SER D N   1 
ATOM   9408  C CA  . SER D 2 127 ? 26.585  -18.763 -0.591  1.00 63.02  ? 127 SER D CA  1 
ATOM   9409  C C   . SER D 2 127 ? 26.814  -20.123 -1.253  1.00 66.53  ? 127 SER D C   1 
ATOM   9410  O O   . SER D 2 127 ? 27.813  -20.329 -1.955  1.00 75.49  ? 127 SER D O   1 
ATOM   9411  C CB  . SER D 2 127 ? 26.782  -18.878 0.924   1.00 59.70  ? 127 SER D CB  1 
ATOM   9412  O OG  . SER D 2 127 ? 28.007  -19.517 1.241   1.00 80.00  ? 127 SER D OG  1 
ATOM   9413  N N   . THR D 2 128 ? 25.889  -21.049 -1.019  1.00 55.33  ? 128 THR D N   1 
ATOM   9414  C CA  . THR D 2 128 ? 26.005  -22.399 -1.563  1.00 73.87  ? 128 THR D CA  1 
ATOM   9415  C C   . THR D 2 128 ? 26.030  -22.390 -3.088  1.00 73.84  ? 128 THR D C   1 
ATOM   9416  O O   . THR D 2 128 ? 26.904  -23.002 -3.705  1.00 62.54  ? 128 THR D O   1 
ATOM   9417  C CB  . THR D 2 128 ? 24.863  -23.312 -1.068  1.00 76.62  ? 128 THR D CB  1 
ATOM   9418  O OG1 . THR D 2 128 ? 23.596  -22.721 -1.381  1.00 80.66  ? 128 THR D OG1 1 
ATOM   9419  C CG2 . THR D 2 128 ? 24.962  -23.505 0.433   1.00 67.26  ? 128 THR D CG2 1 
ATOM   9420  N N   . LEU D 2 129 ? 25.076  -21.694 -3.699  1.00 67.37  ? 129 LEU D N   1 
ATOM   9421  C CA  . LEU D 2 129 ? 25.067  -21.578 -5.156  1.00 61.72  ? 129 LEU D CA  1 
ATOM   9422  C C   . LEU D 2 129 ? 26.393  -21.018 -5.675  1.00 64.55  ? 129 LEU D C   1 
ATOM   9423  O O   . LEU D 2 129 ? 26.919  -21.477 -6.697  1.00 66.49  ? 129 LEU D O   1 
ATOM   9424  C CB  . LEU D 2 129 ? 23.893  -20.710 -5.617  1.00 59.15  ? 129 LEU D CB  1 
ATOM   9425  C CG  . LEU D 2 129 ? 22.553  -21.446 -5.485  1.00 59.44  ? 129 LEU D CG  1 
ATOM   9426  C CD1 . LEU D 2 129 ? 21.346  -20.542 -5.731  1.00 51.46  ? 129 LEU D CD1 1 
ATOM   9427  C CD2 . LEU D 2 129 ? 22.532  -22.659 -6.409  1.00 67.97  ? 129 LEU D CD2 1 
ATOM   9428  N N   . LYS D 2 130 ? 26.947  -20.058 -4.941  1.00 56.14  ? 130 LYS D N   1 
ATOM   9429  C CA  . LYS D 2 130 ? 28.239  -19.480 -5.282  1.00 52.12  ? 130 LYS D CA  1 
ATOM   9430  C C   . LYS D 2 130 ? 29.366  -20.511 -5.238  1.00 56.91  ? 130 LYS D C   1 
ATOM   9431  O O   . LYS D 2 130 ? 30.229  -20.524 -6.120  1.00 63.24  ? 130 LYS D O   1 
ATOM   9432  C CB  . LYS D 2 130 ? 28.572  -18.316 -4.341  1.00 44.35  ? 130 LYS D CB  1 
ATOM   9433  C CG  . LYS D 2 130 ? 29.965  -17.732 -4.540  1.00 46.48  ? 130 LYS D CG  1 
ATOM   9434  C CD  . LYS D 2 130 ? 30.276  -16.647 -3.518  1.00 46.09  ? 130 LYS D CD  1 
ATOM   9435  C CE  . LYS D 2 130 ? 31.639  -16.021 -3.776  1.00 37.88  ? 130 LYS D CE  1 
ATOM   9436  N NZ  . LYS D 2 130 ? 32.311  -15.580 -2.523  1.00 60.51  ? 130 LYS D NZ  1 
ATOM   9437  N N   . ASP D 2 131 ? 29.364  -21.385 -4.231  1.00 74.91  ? 131 ASP D N   1 
ATOM   9438  C CA  . ASP D 2 131 ? 30.475  -22.335 -4.112  1.00 71.47  ? 131 ASP D CA  1 
ATOM   9439  C C   . ASP D 2 131 ? 30.343  -23.459 -5.142  1.00 68.76  ? 131 ASP D C   1 
ATOM   9440  O O   . ASP D 2 131 ? 31.352  -23.985 -5.626  1.00 68.56  ? 131 ASP D O   1 
ATOM   9441  C CB  . ASP D 2 131 ? 30.607  -22.875 -2.664  1.00 71.11  ? 131 ASP D CB  1 
ATOM   9442  C CG  . ASP D 2 131 ? 29.511  -23.870 -2.249  1.00 102.88 ? 131 ASP D CG  1 
ATOM   9443  O OD1 . ASP D 2 131 ? 28.913  -24.574 -3.088  1.00 107.70 ? 131 ASP D OD1 1 
ATOM   9444  O OD2 . ASP D 2 131 ? 29.228  -23.917 -1.032  1.00 119.98 ? 131 ASP D OD2 1 
ATOM   9445  N N   . LEU D 2 132 ? 29.108  -23.800 -5.508  1.00 65.52  ? 132 LEU D N   1 
ATOM   9446  C CA  . LEU D 2 132 ? 28.916  -24.803 -6.552  1.00 62.65  ? 132 LEU D CA  1 
ATOM   9447  C C   . LEU D 2 132 ? 29.316  -24.240 -7.910  1.00 61.11  ? 132 LEU D C   1 
ATOM   9448  O O   . LEU D 2 132 ? 29.910  -24.946 -8.733  1.00 55.16  ? 132 LEU D O   1 
ATOM   9449  C CB  . LEU D 2 132 ? 27.464  -25.289 -6.607  1.00 59.59  ? 132 LEU D CB  1 
ATOM   9450  C CG  . LEU D 2 132 ? 26.722  -25.662 -5.324  1.00 70.00  ? 132 LEU D CG  1 
ATOM   9451  C CD1 . LEU D 2 132 ? 25.248  -25.906 -5.618  1.00 66.07  ? 132 LEU D CD1 1 
ATOM   9452  C CD2 . LEU D 2 132 ? 27.351  -26.887 -4.691  1.00 65.05  ? 132 LEU D CD2 1 
ATOM   9453  N N   . PHE D 2 133 ? 29.019  -22.962 -8.131  1.00 62.42  ? 133 PHE D N   1 
ATOM   9454  C CA  . PHE D 2 133 ? 29.472  -22.287 -9.342  1.00 63.45  ? 133 PHE D CA  1 
ATOM   9455  C C   . PHE D 2 133 ? 30.996  -22.250 -9.393  1.00 65.17  ? 133 PHE D C   1 
ATOM   9456  O O   . PHE D 2 133 ? 31.597  -22.459 -10.451 1.00 68.14  ? 133 PHE D O   1 
ATOM   9457  C CB  . PHE D 2 133 ? 28.898  -20.871 -9.422  1.00 56.40  ? 133 PHE D CB  1 
ATOM   9458  C CG  . PHE D 2 133 ? 29.588  -19.996 -10.427 1.00 63.34  ? 133 PHE D CG  1 
ATOM   9459  C CD1 . PHE D 2 133 ? 29.419  -20.209 -11.786 1.00 71.86  ? 133 PHE D CD1 1 
ATOM   9460  C CD2 . PHE D 2 133 ? 30.400  -18.954 -10.013 1.00 59.44  ? 133 PHE D CD2 1 
ATOM   9461  C CE1 . PHE D 2 133 ? 30.053  -19.402 -12.713 1.00 62.98  ? 133 PHE D CE1 1 
ATOM   9462  C CE2 . PHE D 2 133 ? 31.037  -18.145 -10.935 1.00 72.63  ? 133 PHE D CE2 1 
ATOM   9463  C CZ  . PHE D 2 133 ? 30.862  -18.368 -12.286 1.00 69.62  ? 133 PHE D CZ  1 
ATOM   9464  N N   . GLY D 2 134 ? 31.615  -21.994 -8.244  1.00 56.10  ? 134 GLY D N   1 
ATOM   9465  C CA  . GLY D 2 134 ? 33.064  -21.972 -8.145  1.00 57.64  ? 134 GLY D CA  1 
ATOM   9466  C C   . GLY D 2 134 ? 33.718  -23.301 -8.484  1.00 60.08  ? 134 GLY D C   1 
ATOM   9467  O O   . GLY D 2 134 ? 34.625  -23.363 -9.326  1.00 66.32  ? 134 GLY D O   1 
ATOM   9468  N N   . LEU D 2 135 ? 33.258  -24.371 -7.839  1.00 63.11  ? 135 LEU D N   1 
ATOM   9469  C CA  . LEU D 2 135 ? 33.832  -25.693 -8.080  1.00 67.74  ? 135 LEU D CA  1 
ATOM   9470  C C   . LEU D 2 135 ? 33.585  -26.165 -9.514  1.00 69.66  ? 135 LEU D C   1 
ATOM   9471  O O   . LEU D 2 135 ? 34.477  -26.745 -10.146 1.00 69.36  ? 135 LEU D O   1 
ATOM   9472  C CB  . LEU D 2 135 ? 33.271  -26.715 -7.087  1.00 67.45  ? 135 LEU D CB  1 
ATOM   9473  C CG  . LEU D 2 135 ? 33.656  -26.506 -5.620  1.00 78.13  ? 135 LEU D CG  1 
ATOM   9474  C CD1 . LEU D 2 135 ? 33.028  -27.576 -4.738  1.00 84.61  ? 135 LEU D CD1 1 
ATOM   9475  C CD2 . LEU D 2 135 ? 35.169  -26.490 -5.459  1.00 66.48  ? 135 LEU D CD2 1 
ATOM   9476  N N   . ALA D 2 136 ? 32.384  -25.904 -10.028 1.00 65.13  ? 136 ALA D N   1 
ATOM   9477  C CA  . ALA D 2 136 ? 32.066  -26.247 -11.412 1.00 53.70  ? 136 ALA D CA  1 
ATOM   9478  C C   . ALA D 2 136 ? 32.996  -25.510 -12.376 1.00 59.88  ? 136 ALA D C   1 
ATOM   9479  O O   . ALA D 2 136 ? 33.476  -26.083 -13.362 1.00 52.14  ? 136 ALA D O   1 
ATOM   9480  C CB  . ALA D 2 136 ? 30.616  -25.925 -11.720 1.00 32.23  ? 136 ALA D CB  1 
ATOM   9481  N N   . SER D 2 137 ? 33.247  -24.239 -12.074 1.00 56.28  ? 137 SER D N   1 
ATOM   9482  C CA  . SER D 2 137 ? 34.171  -23.424 -12.855 1.00 58.42  ? 137 SER D CA  1 
ATOM   9483  C C   . SER D 2 137 ? 35.570  -24.036 -12.869 1.00 67.83  ? 137 SER D C   1 
ATOM   9484  O O   . SER D 2 137 ? 36.177  -24.185 -13.933 1.00 69.71  ? 137 SER D O   1 
ATOM   9485  C CB  . SER D 2 137 ? 34.223  -21.998 -12.305 1.00 59.80  ? 137 SER D CB  1 
ATOM   9486  O OG  . SER D 2 137 ? 35.329  -21.286 -12.831 1.00 74.08  ? 137 SER D OG  1 
ATOM   9487  N N   . ASN D 2 138 ? 36.077  -24.385 -11.687 1.00 64.25  ? 138 ASN D N   1 
ATOM   9488  C CA  . ASN D 2 138 ? 37.387  -25.029 -11.576 1.00 66.01  ? 138 ASN D CA  1 
ATOM   9489  C C   . ASN D 2 138 ? 37.480  -26.300 -12.420 1.00 66.54  ? 138 ASN D C   1 
ATOM   9490  O O   . ASN D 2 138 ? 38.435  -26.493 -13.192 1.00 69.68  ? 138 ASN D O   1 
ATOM   9491  C CB  . ASN D 2 138 ? 37.695  -25.363 -10.116 1.00 72.32  ? 138 ASN D CB  1 
ATOM   9492  C CG  . ASN D 2 138 ? 38.016  -24.134 -9.290  1.00 75.53  ? 138 ASN D CG  1 
ATOM   9493  O OD1 . ASN D 2 138 ? 38.543  -23.148 -9.804  1.00 79.61  ? 138 ASN D OD1 1 
ATOM   9494  N ND2 . ASN D 2 138 ? 37.701  -24.189 -8.001  1.00 77.91  ? 138 ASN D ND2 1 
ATOM   9495  N N   . GLU D 2 139 ? 36.473  -27.158 -12.268 1.00 61.14  ? 139 GLU D N   1 
ATOM   9496  C CA  . GLU D 2 139 ? 36.407  -28.416 -13.005 1.00 70.33  ? 139 GLU D CA  1 
ATOM   9497  C C   . GLU D 2 139 ? 36.453  -28.181 -14.512 1.00 72.14  ? 139 GLU D C   1 
ATOM   9498  O O   . GLU D 2 139 ? 37.207  -28.845 -15.236 1.00 69.69  ? 139 GLU D O   1 
ATOM   9499  C CB  . GLU D 2 139 ? 35.135  -29.180 -12.634 1.00 75.40  ? 139 GLU D CB  1 
ATOM   9500  C CG  . GLU D 2 139 ? 35.169  -29.814 -11.252 1.00 81.27  ? 139 GLU D CG  1 
ATOM   9501  C CD  . GLU D 2 139 ? 33.804  -30.293 -10.796 1.00 103.30 ? 139 GLU D CD  1 
ATOM   9502  O OE1 . GLU D 2 139 ? 33.544  -30.272 -9.574  1.00 98.71  ? 139 GLU D OE1 1 
ATOM   9503  O OE2 . GLU D 2 139 ? 32.994  -30.695 -11.657 1.00 101.46 ? 139 GLU D OE2 1 
ATOM   9504  N N   . HIS D 2 140 ? 35.655  -27.224 -14.978 1.00 66.55  ? 140 HIS D N   1 
ATOM   9505  C CA  . HIS D 2 140 ? 35.645  -26.883 -16.395 1.00 63.46  ? 140 HIS D CA  1 
ATOM   9506  C C   . HIS D 2 140 ? 37.014  -26.386 -16.854 1.00 59.76  ? 140 HIS D C   1 
ATOM   9507  O O   . HIS D 2 140 ? 37.466  -26.729 -17.945 1.00 58.56  ? 140 HIS D O   1 
ATOM   9508  C CB  . HIS D 2 140 ? 34.580  -25.829 -16.694 1.00 60.76  ? 140 HIS D CB  1 
ATOM   9509  C CG  . HIS D 2 140 ? 34.389  -25.560 -18.155 1.00 70.91  ? 140 HIS D CG  1 
ATOM   9510  N ND1 . HIS D 2 140 ? 33.889  -24.371 -18.636 1.00 80.37  ? 140 HIS D ND1 1 
ATOM   9511  C CD2 . HIS D 2 140 ? 34.624  -26.337 -19.242 1.00 73.36  ? 140 HIS D CD2 1 
ATOM   9512  C CE1 . HIS D 2 140 ? 33.829  -24.421 -19.957 1.00 71.75  ? 140 HIS D CE1 1 
ATOM   9513  N NE2 . HIS D 2 140 ? 34.269  -25.603 -20.347 1.00 68.07  ? 140 HIS D NE2 1 
ATOM   9514  N N   . ASP D 2 141 ? 37.669  -25.577 -16.024 1.00 62.26  ? 141 ASP D N   1 
ATOM   9515  C CA  . ASP D 2 141 ? 38.995  -25.062 -16.362 1.00 65.10  ? 141 ASP D CA  1 
ATOM   9516  C C   . ASP D 2 141 ? 40.037  -26.169 -16.536 1.00 67.04  ? 141 ASP D C   1 
ATOM   9517  O O   . ASP D 2 141 ? 40.768  -26.181 -17.531 1.00 65.45  ? 141 ASP D O   1 
ATOM   9518  C CB  . ASP D 2 141 ? 39.471  -24.067 -15.301 1.00 66.95  ? 141 ASP D CB  1 
ATOM   9519  C CG  . ASP D 2 141 ? 38.619  -22.813 -15.253 1.00 74.19  ? 141 ASP D CG  1 
ATOM   9520  O OD1 . ASP D 2 141 ? 38.086  -22.415 -16.311 1.00 78.34  ? 141 ASP D OD1 1 
ATOM   9521  O OD2 . ASP D 2 141 ? 38.486  -22.223 -14.161 1.00 80.18  ? 141 ASP D OD2 1 
ATOM   9522  N N   . LEU D 2 142 ? 40.105  -27.097 -15.582 1.00 78.53  ? 142 LEU D N   1 
ATOM   9523  C CA  . LEU D 2 142 ? 41.034  -28.224 -15.715 1.00 74.57  ? 142 LEU D CA  1 
ATOM   9524  C C   . LEU D 2 142 ? 40.708  -29.055 -16.956 1.00 70.69  ? 142 LEU D C   1 
ATOM   9525  O O   . LEU D 2 142 ? 41.598  -29.430 -17.735 1.00 69.75  ? 142 LEU D O   1 
ATOM   9526  C CB  . LEU D 2 142 ? 41.008  -29.111 -14.468 1.00 71.33  ? 142 LEU D CB  1 
ATOM   9527  C CG  . LEU D 2 142 ? 41.582  -28.526 -13.176 1.00 80.91  ? 142 LEU D CG  1 
ATOM   9528  C CD1 . LEU D 2 142 ? 41.264  -29.423 -11.990 1.00 82.47  ? 142 LEU D CD1 1 
ATOM   9529  C CD2 . LEU D 2 142 ? 43.086  -28.328 -13.308 1.00 75.26  ? 142 LEU D CD2 1 
ATOM   9530  N N   . SER D 2 143 ? 39.418  -29.328 -17.130 1.00 63.76  ? 143 SER D N   1 
ATOM   9531  C CA  . SER D 2 143 ? 38.938  -30.113 -18.258 1.00 66.81  ? 143 SER D CA  1 
ATOM   9532  C C   . SER D 2 143 ? 39.380  -29.519 -19.600 1.00 72.56  ? 143 SER D C   1 
ATOM   9533  O O   . SER D 2 143 ? 39.939  -30.220 -20.452 1.00 62.06  ? 143 SER D O   1 
ATOM   9534  C CB  . SER D 2 143 ? 37.414  -30.217 -18.193 1.00 64.82  ? 143 SER D CB  1 
ATOM   9535  O OG  . SER D 2 143 ? 36.850  -30.295 -19.484 1.00 79.37  ? 143 SER D OG  1 
ATOM   9536  N N   . MET D 2 144 ? 39.151  -28.219 -19.767 1.00 77.48  ? 144 MET D N   1 
ATOM   9537  C CA  . MET D 2 144 ? 39.566  -27.511 -20.973 1.00 66.64  ? 144 MET D CA  1 
ATOM   9538  C C   . MET D 2 144 ? 41.082  -27.487 -21.110 1.00 69.13  ? 144 MET D C   1 
ATOM   9539  O O   . MET D 2 144 ? 41.611  -27.515 -22.224 1.00 65.80  ? 144 MET D O   1 
ATOM   9540  C CB  . MET D 2 144 ? 39.037  -26.074 -20.979 1.00 54.02  ? 144 MET D CB  1 
ATOM   9541  C CG  . MET D 2 144 ? 37.557  -25.940 -21.273 1.00 61.43  ? 144 MET D CG  1 
ATOM   9542  S SD  . MET D 2 144 ? 37.048  -24.211 -21.316 1.00 67.00  ? 144 MET D SD  1 
ATOM   9543  C CE  . MET D 2 144 ? 37.342  -23.724 -19.619 1.00 81.80  ? 144 MET D CE  1 
ATOM   9544  N N   . ALA D 2 145 ? 41.777  -27.433 -19.976 1.00 68.83  ? 145 ALA D N   1 
ATOM   9545  C CA  . ALA D 2 145 ? 43.234  -27.452 -19.990 1.00 59.79  ? 145 ALA D CA  1 
ATOM   9546  C C   . ALA D 2 145 ? 43.762  -28.743 -20.602 1.00 72.57  ? 145 ALA D C   1 
ATOM   9547  O O   . ALA D 2 145 ? 44.632  -28.705 -21.474 1.00 77.09  ? 145 ALA D O   1 
ATOM   9548  C CB  . ALA D 2 145 ? 43.783  -27.268 -18.585 1.00 63.32  ? 145 ALA D CB  1 
ATOM   9549  N N   . LYS D 2 146 ? 43.230  -29.885 -20.166 1.00 76.41  ? 146 LYS D N   1 
ATOM   9550  C CA  . LYS D 2 146 ? 43.752  -31.163 -20.654 1.00 79.92  ? 146 LYS D CA  1 
ATOM   9551  C C   . LYS D 2 146 ? 43.144  -31.536 -22.010 1.00 75.29  ? 146 LYS D C   1 
ATOM   9552  O O   . LYS D 2 146 ? 43.658  -32.421 -22.701 1.00 89.22  ? 146 LYS D O   1 
ATOM   9553  C CB  . LYS D 2 146 ? 43.547  -32.291 -19.626 1.00 72.70  ? 146 LYS D CB  1 
ATOM   9554  C CG  . LYS D 2 146 ? 42.484  -33.331 -19.904 1.00 72.82  ? 146 LYS D CG  1 
ATOM   9555  C CD  . LYS D 2 146 ? 42.802  -34.583 -19.083 1.00 77.19  ? 146 LYS D CD  1 
ATOM   9556  C CE  . LYS D 2 146 ? 42.797  -34.282 -17.587 1.00 97.54  ? 146 LYS D CE  1 
ATOM   9557  N NZ  . LYS D 2 146 ? 43.103  -35.480 -16.749 1.00 94.95  ? 146 LYS D NZ  1 
ATOM   9558  N N   . TYR D 2 147 ? 42.052  -30.871 -22.387 1.00 75.73  ? 147 TYR D N   1 
ATOM   9559  C CA  . TYR D 2 147 ? 41.565  -30.956 -23.765 1.00 74.22  ? 147 TYR D CA  1 
ATOM   9560  C C   . TYR D 2 147 ? 42.512  -30.241 -24.718 1.00 70.40  ? 147 TYR D C   1 
ATOM   9561  O O   . TYR D 2 147 ? 42.840  -30.758 -25.786 1.00 70.40  ? 147 TYR D O   1 
ATOM   9562  C CB  . TYR D 2 147 ? 40.161  -30.365 -23.909 1.00 61.42  ? 147 TYR D CB  1 
ATOM   9563  C CG  . TYR D 2 147 ? 39.598  -30.496 -25.316 1.00 71.37  ? 147 TYR D CG  1 
ATOM   9564  C CD1 . TYR D 2 147 ? 39.806  -29.496 -26.265 1.00 73.79  ? 147 TYR D CD1 1 
ATOM   9565  C CD2 . TYR D 2 147 ? 38.880  -31.620 -25.702 1.00 76.17  ? 147 TYR D CD2 1 
ATOM   9566  C CE1 . TYR D 2 147 ? 39.308  -29.609 -27.552 1.00 62.70  ? 147 TYR D CE1 1 
ATOM   9567  C CE2 . TYR D 2 147 ? 38.375  -31.740 -26.992 1.00 77.55  ? 147 TYR D CE2 1 
ATOM   9568  C CZ  . TYR D 2 147 ? 38.593  -30.730 -27.911 1.00 87.15  ? 147 TYR D CZ  1 
ATOM   9569  O OH  . TYR D 2 147 ? 38.096  -30.842 -29.193 1.00 87.60  ? 147 TYR D OH  1 
ATOM   9570  N N   . SER D 2 148 ? 42.913  -29.033 -24.335 1.00 77.59  ? 148 SER D N   1 
ATOM   9571  C CA  . SER D 2 148 ? 43.877  -28.246 -25.097 1.00 70.32  ? 148 SER D CA  1 
ATOM   9572  C C   . SER D 2 148 ? 45.120  -29.048 -25.476 1.00 73.49  ? 148 SER D C   1 
ATOM   9573  O O   . SER D 2 148 ? 45.633  -28.930 -26.588 1.00 85.81  ? 148 SER D O   1 
ATOM   9574  C CB  . SER D 2 148 ? 44.287  -27.006 -24.300 1.00 70.24  ? 148 SER D CB  1 
ATOM   9575  O OG  . SER D 2 148 ? 45.539  -26.509 -24.737 1.00 85.77  ? 148 SER D OG  1 
ATOM   9576  N N   . ARG D 2 149 ? 45.599  -29.855 -24.538 1.00 81.96  ? 149 ARG D N   1 
ATOM   9577  C CA  . ARG D 2 149 ? 46.853  -30.582 -24.695 1.00 86.98  ? 149 ARG D CA  1 
ATOM   9578  C C   . ARG D 2 149 ? 46.791  -31.763 -25.673 1.00 93.73  ? 149 ARG D C   1 
ATOM   9579  O O   . ARG D 2 149 ? 47.821  -32.371 -25.966 1.00 89.61  ? 149 ARG D O   1 
ATOM   9580  C CB  . ARG D 2 149 ? 47.321  -31.064 -23.321 1.00 75.49  ? 149 ARG D CB  1 
ATOM   9581  C CG  . ARG D 2 149 ? 47.694  -29.913 -22.399 1.00 67.17  ? 149 ARG D CG  1 
ATOM   9582  C CD  . ARG D 2 149 ? 48.395  -30.368 -21.133 1.00 72.27  ? 149 ARG D CD  1 
ATOM   9583  N NE  . ARG D 2 149 ? 47.711  -29.857 -19.949 1.00 83.31  ? 149 ARG D NE  1 
ATOM   9584  C CZ  . ARG D 2 149 ? 46.935  -30.593 -19.161 1.00 85.15  ? 149 ARG D CZ  1 
ATOM   9585  N NH1 . ARG D 2 149 ? 46.768  -31.882 -19.416 1.00 80.18  ? 149 ARG D NH1 1 
ATOM   9586  N NH2 . ARG D 2 149 ? 46.341  -30.047 -18.109 1.00 88.13  ? 149 ARG D NH2 1 
ATOM   9587  N N   . LEU D 2 150 ? 45.598  -32.093 -26.167 1.00 79.90  ? 150 LEU D N   1 
ATOM   9588  C CA  . LEU D 2 150 ? 45.445  -33.208 -27.106 1.00 79.47  ? 150 LEU D CA  1 
ATOM   9589  C C   . LEU D 2 150 ? 46.301  -33.019 -28.366 1.00 105.78 ? 150 LEU D C   1 
ATOM   9590  O O   . LEU D 2 150 ? 46.441  -31.901 -28.863 1.00 103.46 ? 150 LEU D O   1 
ATOM   9591  C CB  . LEU D 2 150 ? 43.970  -33.380 -27.486 1.00 82.10  ? 150 LEU D CB  1 
ATOM   9592  C CG  . LEU D 2 150 ? 43.049  -33.890 -26.374 1.00 74.40  ? 150 LEU D CG  1 
ATOM   9593  C CD1 . LEU D 2 150 ? 41.632  -34.094 -26.892 1.00 71.49  ? 150 LEU D CD1 1 
ATOM   9594  C CD2 . LEU D 2 150 ? 43.594  -35.176 -25.770 1.00 78.44  ? 150 LEU D CD2 1 
ATOM   9595  N N   . PRO D 2 151 ? 46.871  -34.121 -28.887 1.00 114.61 ? 151 PRO D N   1 
ATOM   9596  C CA  . PRO D 2 151 ? 47.826  -34.081 -30.002 1.00 102.45 ? 151 PRO D CA  1 
ATOM   9597  C C   . PRO D 2 151 ? 47.215  -33.960 -31.399 1.00 101.80 ? 151 PRO D C   1 
ATOM   9598  O O   . PRO D 2 151 ? 46.144  -34.507 -31.667 1.00 101.03 ? 151 PRO D O   1 
ATOM   9599  C CB  . PRO D 2 151 ? 48.570  -35.415 -29.863 1.00 101.98 ? 151 PRO D CB  1 
ATOM   9600  C CG  . PRO D 2 151 ? 47.668  -36.307 -29.033 1.00 111.91 ? 151 PRO D CG  1 
ATOM   9601  C CD  . PRO D 2 151 ? 46.493  -35.504 -28.553 1.00 109.65 ? 151 PRO D CD  1 
ATOM   9602  N N   . LYS D 2 152 ? 47.907  -33.237 -32.275 1.00 98.26  ? 152 LYS D N   1 
ATOM   9603  C CA  . LYS D 2 152 ? 47.512  -33.107 -33.674 1.00 103.38 ? 152 LYS D CA  1 
ATOM   9604  C C   . LYS D 2 152 ? 48.018  -34.284 -34.512 1.00 104.91 ? 152 LYS D C   1 
ATOM   9605  O O   . LYS D 2 152 ? 47.259  -34.908 -35.254 1.00 87.69  ? 152 LYS D O   1 
ATOM   9606  C CB  . LYS D 2 152 ? 48.028  -31.790 -34.257 1.00 83.79  ? 152 LYS D CB  1 
ATOM   9607  N N   . LYS D 2 153 ? 49.311  -34.571 -34.382 1.00 111.27 ? 153 LYS D N   1 
ATOM   9608  C CA  . LYS D 2 153 ? 49.996  -35.554 -35.223 1.00 117.67 ? 153 LYS D CA  1 
ATOM   9609  C C   . LYS D 2 153 ? 49.531  -36.992 -35.002 1.00 127.16 ? 153 LYS D C   1 
ATOM   9610  O O   . LYS D 2 153 ? 49.166  -37.690 -35.948 1.00 125.52 ? 153 LYS D O   1 
ATOM   9611  C CB  . LYS D 2 153 ? 51.507  -35.468 -34.994 1.00 76.39  ? 153 LYS D CB  1 
ATOM   9612  N N   . LYS D 2 154 ? 49.546  -37.424 -33.747 1.00 127.51 ? 154 LYS D N   1 
ATOM   9613  C CA  . LYS D 2 154 ? 49.140  -38.776 -33.384 1.00 120.66 ? 154 LYS D CA  1 
ATOM   9614  C C   . LYS D 2 154 ? 47.753  -38.728 -32.761 1.00 126.28 ? 154 LYS D C   1 
ATOM   9615  O O   . LYS D 2 154 ? 47.583  -38.217 -31.654 1.00 128.59 ? 154 LYS D O   1 
ATOM   9616  C CB  . LYS D 2 154 ? 50.143  -39.411 -32.419 1.00 84.56  ? 154 LYS D CB  1 
ATOM   9617  N N   . GLU D 2 155 ? 46.761  -39.282 -33.451 1.00 118.40 ? 155 GLU D N   1 
ATOM   9618  C CA  . GLU D 2 155 ? 45.392  -39.102 -32.996 1.00 111.93 ? 155 GLU D CA  1 
ATOM   9619  C C   . GLU D 2 155 ? 44.867  -40.342 -32.310 1.00 122.61 ? 155 GLU D C   1 
ATOM   9620  O O   . GLU D 2 155 ? 44.681  -41.408 -32.910 1.00 124.27 ? 155 GLU D O   1 
ATOM   9621  C CB  . GLU D 2 155 ? 44.480  -38.729 -34.162 1.00 114.09 ? 155 GLU D CB  1 
ATOM   9622  N N   . ASN D 2 156 ? 44.621  -40.141 -31.020 1.00 128.54 ? 156 ASN D N   1 
ATOM   9623  C CA  . ASN D 2 156 ? 43.972  -41.088 -30.133 1.00 123.72 ? 156 ASN D CA  1 
ATOM   9624  C C   . ASN D 2 156 ? 42.458  -40.884 -30.185 1.00 113.22 ? 156 ASN D C   1 
ATOM   9625  O O   . ASN D 2 156 ? 41.970  -39.935 -29.577 1.00 121.33 ? 156 ASN D O   1 
ATOM   9626  C CB  . ASN D 2 156 ? 44.503  -40.841 -28.715 1.00 113.06 ? 156 ASN D CB  1 
ATOM   9627  C CG  . ASN D 2 156 ? 44.707  -42.105 -27.927 1.00 112.69 ? 156 ASN D CG  1 
ATOM   9628  O OD1 . ASN D 2 156 ? 43.993  -43.088 -28.103 1.00 111.65 ? 156 ASN D OD1 1 
ATOM   9629  N ND2 . ASN D 2 156 ? 45.699  -42.085 -27.041 1.00 106.59 ? 156 ASN D ND2 1 
ATOM   9630  N N   . GLU D 2 157 ? 41.703  -41.747 -30.868 1.00 106.53 ? 157 GLU D N   1 
ATOM   9631  C CA  . GLU D 2 157 ? 40.270  -41.476 -31.002 1.00 109.13 ? 157 GLU D CA  1 
ATOM   9632  C C   . GLU D 2 157 ? 39.524  -41.648 -29.680 1.00 115.61 ? 157 GLU D C   1 
ATOM   9633  O O   . GLU D 2 157 ? 38.615  -40.876 -29.361 1.00 111.27 ? 157 GLU D O   1 
ATOM   9634  C CB  . GLU D 2 157 ? 39.640  -42.377 -32.072 1.00 101.39 ? 157 GLU D CB  1 
ATOM   9635  C CG  . GLU D 2 157 ? 39.588  -41.772 -33.477 1.00 124.54 ? 157 GLU D CG  1 
ATOM   9636  C CD  . GLU D 2 157 ? 38.432  -40.802 -33.652 1.00 141.32 ? 157 GLU D CD  1 
ATOM   9637  O OE1 . GLU D 2 157 ? 37.709  -40.553 -32.663 1.00 140.57 ? 157 GLU D OE1 1 
ATOM   9638  O OE2 . GLU D 2 157 ? 38.251  -40.287 -34.777 1.00 141.23 ? 157 GLU D OE2 1 
ATOM   9639  N N   . LYS D 2 158 ? 39.944  -42.637 -28.897 1.00 113.71 ? 158 LYS D N   1 
ATOM   9640  C CA  . LYS D 2 158 ? 39.295  -42.929 -27.626 1.00 119.69 ? 158 LYS D CA  1 
ATOM   9641  C C   . LYS D 2 158 ? 39.519  -41.834 -26.592 1.00 112.77 ? 158 LYS D C   1 
ATOM   9642  O O   . LYS D 2 158 ? 38.564  -41.286 -26.034 1.00 112.42 ? 158 LYS D O   1 
ATOM   9643  C CB  . LYS D 2 158 ? 39.786  -44.268 -27.071 1.00 117.23 ? 158 LYS D CB  1 
ATOM   9644  N N   . VAL D 2 159 ? 40.787  -41.528 -26.339 1.00 100.31 ? 159 VAL D N   1 
ATOM   9645  C CA  . VAL D 2 159 ? 41.157  -40.461 -25.420 1.00 102.40 ? 159 VAL D CA  1 
ATOM   9646  C C   . VAL D 2 159 ? 40.531  -39.128 -25.836 1.00 107.00 ? 159 VAL D C   1 
ATOM   9647  O O   . VAL D 2 159 ? 39.991  -38.408 -25.000 1.00 113.38 ? 159 VAL D O   1 
ATOM   9648  C CB  . VAL D 2 159 ? 42.686  -40.312 -25.324 1.00 95.71  ? 159 VAL D CB  1 
ATOM   9649  C CG1 . VAL D 2 159 ? 43.040  -39.142 -24.417 1.00 78.38  ? 159 VAL D CG1 1 
ATOM   9650  C CG2 . VAL D 2 159 ? 43.294  -41.588 -24.756 1.00 88.38  ? 159 VAL D CG2 1 
ATOM   9651  N N   . LYS D 2 160 ? 40.597  -38.807 -27.126 1.00 104.21 ? 160 LYS D N   1 
ATOM   9652  C CA  . LYS D 2 160 ? 40.050  -37.546 -27.624 1.00 94.14  ? 160 LYS D CA  1 
ATOM   9653  C C   . LYS D 2 160 ? 38.543  -37.462 -27.400 1.00 95.14  ? 160 LYS D C   1 
ATOM   9654  O O   . LYS D 2 160 ? 38.036  -36.442 -26.923 1.00 102.37 ? 160 LYS D O   1 
ATOM   9655  C CB  . LYS D 2 160 ? 40.363  -37.365 -29.111 1.00 98.84  ? 160 LYS D CB  1 
ATOM   9656  N N   . THR D 2 161 ? 37.829  -38.535 -27.730 1.00 96.97  ? 161 THR D N   1 
ATOM   9657  C CA  . THR D 2 161 ? 36.374  -38.522 -27.606 1.00 99.84  ? 161 THR D CA  1 
ATOM   9658  C C   . THR D 2 161 ? 35.931  -38.494 -26.141 1.00 102.20 ? 161 THR D C   1 
ATOM   9659  O O   . THR D 2 161 ? 34.964  -37.810 -25.786 1.00 106.71 ? 161 THR D O   1 
ATOM   9660  C CB  . THR D 2 161 ? 35.738  -39.740 -28.305 1.00 106.07 ? 161 THR D CB  1 
ATOM   9661  O OG1 . THR D 2 161 ? 36.261  -39.860 -29.634 1.00 101.96 ? 161 THR D OG1 1 
ATOM   9662  C CG2 . THR D 2 161 ? 34.225  -39.591 -28.371 1.00 79.40  ? 161 THR D CG2 1 
ATOM   9663  N N   . GLU D 2 162 ? 36.659  -39.209 -25.286 1.00 99.78  ? 162 GLU D N   1 
ATOM   9664  C CA  . GLU D 2 162 ? 36.319  -39.259 -23.866 1.00 94.83  ? 162 GLU D CA  1 
ATOM   9665  C C   . GLU D 2 162 ? 36.609  -37.931 -23.169 1.00 98.81  ? 162 GLU D C   1 
ATOM   9666  O O   . GLU D 2 162 ? 35.792  -37.441 -22.379 1.00 103.05 ? 162 GLU D O   1 
ATOM   9667  C CB  . GLU D 2 162 ? 37.087  -40.389 -23.175 1.00 80.00  ? 162 GLU D CB  1 
ATOM   9668  N N   . VAL D 2 163 ? 37.759  -37.343 -23.485 1.00 84.17  ? 163 VAL D N   1 
ATOM   9669  C CA  . VAL D 2 163 ? 38.110  -36.024 -22.973 1.00 82.99  ? 163 VAL D CA  1 
ATOM   9670  C C   . VAL D 2 163 ? 37.080  -35.004 -23.439 1.00 83.51  ? 163 VAL D C   1 
ATOM   9671  O O   . VAL D 2 163 ? 36.653  -34.146 -22.666 1.00 90.86  ? 163 VAL D O   1 
ATOM   9672  C CB  . VAL D 2 163 ? 39.525  -35.592 -23.419 1.00 85.52  ? 163 VAL D CB  1 
ATOM   9673  C CG1 . VAL D 2 163 ? 39.730  -34.103 -23.201 1.00 79.51  ? 163 VAL D CG1 1 
ATOM   9674  C CG2 . VAL D 2 163 ? 40.578  -36.386 -22.664 1.00 86.89  ? 163 VAL D CG2 1 
ATOM   9675  N N   . GLY D 2 164 ? 36.667  -35.115 -24.698 1.00 74.48  ? 164 GLY D N   1 
ATOM   9676  C CA  . GLY D 2 164 ? 35.620  -34.257 -25.221 1.00 78.61  ? 164 GLY D CA  1 
ATOM   9677  C C   . GLY D 2 164 ? 34.322  -34.388 -24.440 1.00 85.53  ? 164 GLY D C   1 
ATOM   9678  O O   . GLY D 2 164 ? 33.659  -33.387 -24.142 1.00 86.43  ? 164 GLY D O   1 
ATOM   9679  N N   . LYS D 2 165 ? 33.966  -35.622 -24.090 1.00 92.71  ? 165 LYS D N   1 
ATOM   9680  C CA  . LYS D 2 165 ? 32.745  -35.870 -23.325 1.00 82.81  ? 165 LYS D CA  1 
ATOM   9681  C C   . LYS D 2 165 ? 32.804  -35.233 -21.938 1.00 93.09  ? 165 LYS D C   1 
ATOM   9682  O O   . LYS D 2 165 ? 31.866  -34.552 -21.510 1.00 90.47  ? 165 LYS D O   1 
ATOM   9683  C CB  . LYS D 2 165 ? 32.502  -37.374 -23.192 1.00 66.71  ? 165 LYS D CB  1 
ATOM   9684  N N   . GLU D 2 166 ? 33.913  -35.472 -21.243 1.00 81.94  ? 166 GLU D N   1 
ATOM   9685  C CA  . GLU D 2 166 ? 34.226  -34.772 -19.998 1.00 80.08  ? 166 GLU D CA  1 
ATOM   9686  C C   . GLU D 2 166 ? 34.067  -33.253 -20.118 1.00 80.03  ? 166 GLU D C   1 
ATOM   9687  O O   . GLU D 2 166 ? 33.427  -32.625 -19.269 1.00 83.29  ? 166 GLU D O   1 
ATOM   9688  C CB  . GLU D 2 166 ? 35.631  -35.155 -19.540 1.00 79.33  ? 166 GLU D CB  1 
ATOM   9689  C CG  . GLU D 2 166 ? 35.772  -36.667 -19.381 1.00 104.86 ? 166 GLU D CG  1 
ATOM   9690  C CD  . GLU D 2 166 ? 37.185  -37.115 -19.072 1.00 123.57 ? 166 GLU D CD  1 
ATOM   9691  O OE1 . GLU D 2 166 ? 38.061  -36.246 -18.864 1.00 125.58 ? 166 GLU D OE1 1 
ATOM   9692  O OE2 . GLU D 2 166 ? 37.408  -38.342 -18.981 1.00 122.96 ? 166 GLU D OE2 1 
ATOM   9693  N N   . VAL D 2 167 ? 34.664  -32.669 -21.156 1.00 84.84  ? 167 VAL D N   1 
ATOM   9694  C CA  . VAL D 2 167 ? 34.579  -31.230 -21.380 1.00 78.18  ? 167 VAL D CA  1 
ATOM   9695  C C   . VAL D 2 167 ? 33.121  -30.795 -21.485 1.00 70.82  ? 167 VAL D C   1 
ATOM   9696  O O   . VAL D 2 167 ? 32.708  -29.809 -20.865 1.00 80.13  ? 167 VAL D O   1 
ATOM   9697  C CB  . VAL D 2 167 ? 35.322  -30.801 -22.664 1.00 72.65  ? 167 VAL D CB  1 
ATOM   9698  C CG1 . VAL D 2 167 ? 35.007  -29.350 -23.000 1.00 61.67  ? 167 VAL D CG1 1 
ATOM   9699  C CG2 . VAL D 2 167 ? 36.823  -30.996 -22.515 1.00 73.63  ? 167 VAL D CG2 1 
ATOM   9700  N N   . ALA D 2 168 ? 32.342  -31.543 -22.263 1.00 71.91  ? 168 ALA D N   1 
ATOM   9701  C CA  . ALA D 2 168 ? 30.922  -31.246 -22.422 1.00 71.28  ? 168 ALA D CA  1 
ATOM   9702  C C   . ALA D 2 168 ? 30.189  -31.271 -21.081 1.00 72.65  ? 168 ALA D C   1 
ATOM   9703  O O   . ALA D 2 168 ? 29.399  -30.371 -20.775 1.00 70.34  ? 168 ALA D O   1 
ATOM   9704  C CB  . ALA D 2 168 ? 30.282  -32.227 -23.394 1.00 62.37  ? 168 ALA D CB  1 
ATOM   9705  N N   . ALA D 2 169 ? 30.469  -32.295 -20.278 1.00 75.33  ? 169 ALA D N   1 
ATOM   9706  C CA  . ALA D 2 169 ? 29.825  -32.452 -18.976 1.00 74.19  ? 169 ALA D CA  1 
ATOM   9707  C C   . ALA D 2 169 ? 30.154  -31.299 -18.027 1.00 75.52  ? 169 ALA D C   1 
ATOM   9708  O O   . ALA D 2 169 ? 29.255  -30.680 -17.442 1.00 71.77  ? 169 ALA D O   1 
ATOM   9709  C CB  . ALA D 2 169 ? 30.230  -33.779 -18.350 1.00 73.89  ? 169 ALA D CB  1 
ATOM   9710  N N   . ALA D 2 170 ? 31.447  -31.014 -17.886 1.00 68.86  ? 170 ALA D N   1 
ATOM   9711  C CA  . ALA D 2 170 ? 31.916  -29.938 -17.020 1.00 70.95  ? 170 ALA D CA  1 
ATOM   9712  C C   . ALA D 2 170 ? 31.316  -28.600 -17.440 1.00 84.85  ? 170 ALA D C   1 
ATOM   9713  O O   . ALA D 2 170 ? 30.883  -27.804 -16.597 1.00 83.00  ? 170 ALA D O   1 
ATOM   9714  C CB  . ALA D 2 170 ? 33.437  -29.868 -17.039 1.00 57.61  ? 170 ALA D CB  1 
ATOM   9715  N N   . ARG D 2 171 ? 31.287  -28.366 -18.749 1.00 71.44  ? 171 ARG D N   1 
ATOM   9716  C CA  . ARG D 2 171 ? 30.711  -27.144 -19.294 1.00 63.34  ? 171 ARG D CA  1 
ATOM   9717  C C   . ARG D 2 171 ? 29.223  -27.040 -18.961 1.00 68.95  ? 171 ARG D C   1 
ATOM   9718  O O   . ARG D 2 171 ? 28.734  -25.962 -18.605 1.00 64.31  ? 171 ARG D O   1 
ATOM   9719  C CB  . ARG D 2 171 ? 30.942  -27.074 -20.802 1.00 61.71  ? 171 ARG D CB  1 
ATOM   9720  C CG  . ARG D 2 171 ? 30.438  -25.801 -21.453 1.00 67.13  ? 171 ARG D CG  1 
ATOM   9721  C CD  . ARG D 2 171 ? 30.973  -25.698 -22.863 1.00 66.86  ? 171 ARG D CD  1 
ATOM   9722  N NE  . ARG D 2 171 ? 32.427  -25.576 -22.839 1.00 76.11  ? 171 ARG D NE  1 
ATOM   9723  C CZ  . ARG D 2 171 ? 33.205  -25.591 -23.915 1.00 74.39  ? 171 ARG D CZ  1 
ATOM   9724  N NH1 . ARG D 2 171 ? 32.673  -25.733 -25.121 1.00 71.61  ? 171 ARG D NH1 1 
ATOM   9725  N NH2 . ARG D 2 171 ? 34.518  -25.470 -23.781 1.00 59.84  ? 171 ARG D NH2 1 
ATOM   9726  N N   . ARG D 2 172 ? 28.507  -28.157 -19.064 1.00 63.44  ? 172 ARG D N   1 
ATOM   9727  C CA  . ARG D 2 172 ? 27.088  -28.154 -18.723 1.00 65.78  ? 172 ARG D CA  1 
ATOM   9728  C C   . ARG D 2 172 ? 26.894  -27.789 -17.258 1.00 74.76  ? 172 ARG D C   1 
ATOM   9729  O O   . ARG D 2 172 ? 26.060  -26.939 -16.922 1.00 62.80  ? 172 ARG D O   1 
ATOM   9730  C CB  . ARG D 2 172 ? 26.443  -29.513 -18.983 1.00 70.44  ? 172 ARG D CB  1 
ATOM   9731  C CG  . ARG D 2 172 ? 24.964  -29.543 -18.622 1.00 76.76  ? 172 ARG D CG  1 
ATOM   9732  C CD  . ARG D 2 172 ? 24.360  -30.912 -18.833 1.00 89.61  ? 172 ARG D CD  1 
ATOM   9733  N NE  . ARG D 2 172 ? 24.584  -31.404 -20.185 1.00 97.56  ? 172 ARG D NE  1 
ATOM   9734  C CZ  . ARG D 2 172 ? 23.735  -31.239 -21.191 1.00 98.81  ? 172 ARG D CZ  1 
ATOM   9735  N NH1 . ARG D 2 172 ? 22.594  -30.588 -21.006 1.00 101.09 ? 172 ARG D NH1 1 
ATOM   9736  N NH2 . ARG D 2 172 ? 24.030  -31.727 -22.386 1.00 86.39  ? 172 ARG D NH2 1 
ATOM   9737  N N   . LYS D 2 173 ? 27.679  -28.425 -16.392 1.00 75.41  ? 173 LYS D N   1 
ATOM   9738  C CA  . LYS D 2 173 ? 27.560  -28.184 -14.960 1.00 67.01  ? 173 LYS D CA  1 
ATOM   9739  C C   . LYS D 2 173 ? 27.848  -26.731 -14.604 1.00 72.02  ? 173 LYS D C   1 
ATOM   9740  O O   . LYS D 2 173 ? 27.115  -26.129 -13.811 1.00 75.33  ? 173 LYS D O   1 
ATOM   9741  C CB  . LYS D 2 173 ? 28.494  -29.100 -14.167 1.00 46.50  ? 173 LYS D CB  1 
ATOM   9742  C CG  . LYS D 2 173 ? 28.171  -29.114 -12.682 1.00 69.47  ? 173 LYS D CG  1 
ATOM   9743  C CD  . LYS D 2 173 ? 29.215  -29.844 -11.861 1.00 76.07  ? 173 LYS D CD  1 
ATOM   9744  C CE  . LYS D 2 173 ? 29.242  -31.327 -12.178 1.00 85.99  ? 173 LYS D CE  1 
ATOM   9745  N NZ  . LYS D 2 173 ? 30.196  -32.049 -11.291 1.00 80.62  ? 173 LYS D NZ  1 
ATOM   9746  N N   . GLN D 2 174 ? 28.897  -26.161 -15.194 1.00 62.78  ? 174 GLN D N   1 
ATOM   9747  C CA  . GLN D 2 174 ? 29.222  -24.768 -14.907 1.00 57.37  ? 174 GLN D CA  1 
ATOM   9748  C C   . GLN D 2 174 ? 28.126  -23.850 -15.428 1.00 56.66  ? 174 GLN D C   1 
ATOM   9749  O O   . GLN D 2 174 ? 27.791  -22.858 -14.782 1.00 59.14  ? 174 GLN D O   1 
ATOM   9750  C CB  . GLN D 2 174 ? 30.574  -24.360 -15.506 1.00 50.29  ? 174 GLN D CB  1 
ATOM   9751  C CG  . GLN D 2 174 ? 30.662  -22.858 -15.780 1.00 40.97  ? 174 GLN D CG  1 
ATOM   9752  C CD  . GLN D 2 174 ? 32.042  -22.393 -16.180 1.00 63.16  ? 174 GLN D CD  1 
ATOM   9753  O OE1 . GLN D 2 174 ? 32.931  -23.198 -16.445 1.00 74.20  ? 174 GLN D OE1 1 
ATOM   9754  N NE2 . GLN D 2 174 ? 32.231  -21.079 -16.221 1.00 77.16  ? 174 GLN D NE2 1 
ATOM   9755  N N   . HIS D 2 175 ? 27.555  -24.184 -16.581 1.00 56.22  ? 175 HIS D N   1 
ATOM   9756  C CA  . HIS D 2 175 ? 26.468  -23.371 -17.115 1.00 62.04  ? 175 HIS D CA  1 
ATOM   9757  C C   . HIS D 2 175 ? 25.255  -23.358 -16.188 1.00 64.58  ? 175 HIS D C   1 
ATOM   9758  O O   . HIS D 2 175 ? 24.715  -22.294 -15.877 1.00 66.86  ? 175 HIS D O   1 
ATOM   9759  C CB  . HIS D 2 175 ? 26.041  -23.853 -18.500 1.00 55.05  ? 175 HIS D CB  1 
ATOM   9760  C CG  . HIS D 2 175 ? 25.050  -22.949 -19.164 1.00 42.46  ? 175 HIS D CG  1 
ATOM   9761  N ND1 . HIS D 2 175 ? 24.051  -23.415 -19.993 1.00 56.18  ? 175 HIS D ND1 1 
ATOM   9762  C CD2 . HIS D 2 175 ? 24.896  -21.604 -19.112 1.00 49.60  ? 175 HIS D CD2 1 
ATOM   9763  C CE1 . HIS D 2 175 ? 23.330  -22.398 -20.426 1.00 62.66  ? 175 HIS D CE1 1 
ATOM   9764  N NE2 . HIS D 2 175 ? 23.822  -21.286 -19.906 1.00 59.53  ? 175 HIS D NE2 1 
ATOM   9765  N N   . LEU D 2 176 ? 24.838  -24.536 -15.733 1.00 70.33  ? 176 LEU D N   1 
ATOM   9766  C CA  . LEU D 2 176 ? 23.667  -24.623 -14.864 1.00 70.55  ? 176 LEU D CA  1 
ATOM   9767  C C   . LEU D 2 176 ? 23.911  -23.959 -13.508 1.00 69.65  ? 176 LEU D C   1 
ATOM   9768  O O   . LEU D 2 176 ? 23.060  -23.206 -13.012 1.00 66.49  ? 176 LEU D O   1 
ATOM   9769  C CB  . LEU D 2 176 ? 23.246  -26.082 -14.677 1.00 72.96  ? 176 LEU D CB  1 
ATOM   9770  C CG  . LEU D 2 176 ? 23.005  -26.854 -15.978 1.00 76.94  ? 176 LEU D CG  1 
ATOM   9771  C CD1 . LEU D 2 176 ? 23.114  -28.353 -15.750 1.00 71.75  ? 176 LEU D CD1 1 
ATOM   9772  C CD2 . LEU D 2 176 ? 21.660  -26.488 -16.592 1.00 75.29  ? 176 LEU D CD2 1 
ATOM   9773  N N   . SER D 2 177 ? 25.076  -24.224 -12.922 1.00 56.55  ? 177 SER D N   1 
ATOM   9774  C CA  . SER D 2 177 ? 25.433  -23.619 -11.642 1.00 53.94  ? 177 SER D CA  1 
ATOM   9775  C C   . SER D 2 177 ? 25.471  -22.097 -11.756 1.00 61.96  ? 177 SER D C   1 
ATOM   9776  O O   . SER D 2 177 ? 25.013  -21.386 -10.859 1.00 81.71  ? 177 SER D O   1 
ATOM   9777  C CB  . SER D 2 177 ? 26.783  -24.146 -11.151 1.00 57.41  ? 177 SER D CB  1 
ATOM   9778  O OG  . SER D 2 177 ? 27.821  -23.816 -12.056 1.00 77.52  ? 177 SER D OG  1 
ATOM   9779  N N   . SER D 2 178 ? 26.015  -21.607 -12.866 1.00 72.87  ? 178 SER D N   1 
ATOM   9780  C CA  . SER D 2 178 ? 26.091  -20.171 -13.117 1.00 63.09  ? 178 SER D CA  1 
ATOM   9781  C C   . SER D 2 178 ? 24.704  -19.559 -13.274 1.00 62.79  ? 178 SER D C   1 
ATOM   9782  O O   . SER D 2 178 ? 24.446  -18.472 -12.765 1.00 63.80  ? 178 SER D O   1 
ATOM   9783  C CB  . SER D 2 178 ? 26.934  -19.880 -14.359 1.00 50.62  ? 178 SER D CB  1 
ATOM   9784  O OG  . SER D 2 178 ? 26.406  -20.531 -15.499 1.00 70.35  ? 178 SER D OG  1 
ATOM   9785  N N   . LEU D 2 179 ? 23.818  -20.248 -13.989 1.00 49.72  ? 179 LEU D N   1 
ATOM   9786  C CA  . LEU D 2 179 ? 22.446  -19.771 -14.147 1.00 62.82  ? 179 LEU D CA  1 
ATOM   9787  C C   . LEU D 2 179 ? 21.746  -19.658 -12.795 1.00 81.62  ? 179 LEU D C   1 
ATOM   9788  O O   . LEU D 2 179 ? 21.118  -18.636 -12.489 1.00 71.30  ? 179 LEU D O   1 
ATOM   9789  C CB  . LEU D 2 179 ? 21.651  -20.695 -15.072 1.00 61.12  ? 179 LEU D CB  1 
ATOM   9790  C CG  . LEU D 2 179 ? 22.005  -20.655 -16.559 1.00 65.97  ? 179 LEU D CG  1 
ATOM   9791  C CD1 . LEU D 2 179 ? 21.177  -21.670 -17.332 1.00 63.40  ? 179 LEU D CD1 1 
ATOM   9792  C CD2 . LEU D 2 179 ? 21.801  -19.256 -17.118 1.00 61.24  ? 179 LEU D CD2 1 
ATOM   9793  N N   . GLN D 2 180 ? 21.871  -20.707 -11.985 1.00 75.10  ? 180 GLN D N   1 
ATOM   9794  C CA  . GLN D 2 180 ? 21.270  -20.716 -10.655 1.00 80.91  ? 180 GLN D CA  1 
ATOM   9795  C C   . GLN D 2 180 ? 21.820  -19.584 -9.791  1.00 76.27  ? 180 GLN D C   1 
ATOM   9796  O O   . GLN D 2 180 ? 21.065  -18.885 -9.112  1.00 78.21  ? 180 GLN D O   1 
ATOM   9797  C CB  . GLN D 2 180 ? 21.501  -22.063 -9.968  1.00 75.06  ? 180 GLN D CB  1 
ATOM   9798  C CG  . GLN D 2 180 ? 20.777  -23.223 -10.629 1.00 76.28  ? 180 GLN D CG  1 
ATOM   9799  C CD  . GLN D 2 180 ? 19.277  -23.014 -10.685 1.00 86.96  ? 180 GLN D CD  1 
ATOM   9800  O OE1 . GLN D 2 180 ? 18.614  -22.910 -9.654  1.00 89.28  ? 180 GLN D OE1 1 
ATOM   9801  N NE2 . GLN D 2 180 ? 18.733  -22.948 -11.896 1.00 74.77  ? 180 GLN D NE2 1 
ATOM   9802  N N   . TYR D 2 181 ? 23.137  -19.411 -9.827  1.00 65.01  ? 181 TYR D N   1 
ATOM   9803  C CA  . TYR D 2 181 ? 23.804  -18.366 -9.057  1.00 62.36  ? 181 TYR D CA  1 
ATOM   9804  C C   . TYR D 2 181 ? 23.336  -16.969 -9.475  1.00 70.55  ? 181 TYR D C   1 
ATOM   9805  O O   . TYR D 2 181 ? 23.025  -16.128 -8.626  1.00 55.64  ? 181 TYR D O   1 
ATOM   9806  C CB  . TYR D 2 181 ? 25.322  -18.479 -9.223  1.00 66.53  ? 181 TYR D CB  1 
ATOM   9807  C CG  . TYR D 2 181 ? 26.125  -17.610 -8.281  1.00 58.85  ? 181 TYR D CG  1 
ATOM   9808  C CD1 . TYR D 2 181 ? 25.554  -17.087 -7.128  1.00 55.50  ? 181 TYR D CD1 1 
ATOM   9809  C CD2 . TYR D 2 181 ? 27.452  -17.305 -8.551  1.00 52.51  ? 181 TYR D CD2 1 
ATOM   9810  C CE1 . TYR D 2 181 ? 26.281  -16.295 -6.269  1.00 48.46  ? 181 TYR D CE1 1 
ATOM   9811  C CE2 . TYR D 2 181 ? 28.188  -16.509 -7.696  1.00 57.58  ? 181 TYR D CE2 1 
ATOM   9812  C CZ  . TYR D 2 181 ? 27.595  -16.005 -6.558  1.00 51.14  ? 181 TYR D CZ  1 
ATOM   9813  O OH  . TYR D 2 181 ? 28.317  -15.216 -5.697  1.00 60.87  ? 181 TYR D OH  1 
ATOM   9814  N N   . TYR D 2 182 ? 23.280  -16.731 -10.783 1.00 62.89  ? 182 TYR D N   1 
ATOM   9815  C CA  . TYR D 2 182 ? 22.910  -15.419 -11.308 1.00 56.68  ? 182 TYR D CA  1 
ATOM   9816  C C   . TYR D 2 182 ? 21.465  -15.095 -10.954 1.00 63.09  ? 182 TYR D C   1 
ATOM   9817  O O   . TYR D 2 182 ? 21.150  -13.974 -10.535 1.00 61.71  ? 182 TYR D O   1 
ATOM   9818  C CB  . TYR D 2 182 ? 23.092  -15.360 -12.829 1.00 61.67  ? 182 TYR D CB  1 
ATOM   9819  C CG  . TYR D 2 182 ? 24.521  -15.452 -13.332 1.00 69.20  ? 182 TYR D CG  1 
ATOM   9820  C CD1 . TYR D 2 182 ? 25.589  -15.622 -12.460 1.00 70.04  ? 182 TYR D CD1 1 
ATOM   9821  C CD2 . TYR D 2 182 ? 24.795  -15.368 -14.691 1.00 62.81  ? 182 TYR D CD2 1 
ATOM   9822  C CE1 . TYR D 2 182 ? 26.889  -15.708 -12.930 1.00 54.16  ? 182 TYR D CE1 1 
ATOM   9823  C CE2 . TYR D 2 182 ? 26.088  -15.451 -15.169 1.00 78.33  ? 182 TYR D CE2 1 
ATOM   9824  C CZ  . TYR D 2 182 ? 27.131  -15.621 -14.285 1.00 69.36  ? 182 TYR D CZ  1 
ATOM   9825  O OH  . TYR D 2 182 ? 28.420  -15.704 -14.762 1.00 76.21  ? 182 TYR D OH  1 
ATOM   9826  N N   . CYS D 2 183 ? 20.590  -16.085 -11.122 1.00 63.87  ? 183 CYS D N   1 
ATOM   9827  C CA  . CYS D 2 183 ? 19.192  -15.936 -10.733 1.00 70.75  ? 183 CYS D CA  1 
ATOM   9828  C C   . CYS D 2 183 ? 19.091  -15.618 -9.247  1.00 75.14  ? 183 CYS D C   1 
ATOM   9829  O O   . CYS D 2 183 ? 18.294  -14.775 -8.835  1.00 76.81  ? 183 CYS D O   1 
ATOM   9830  C CB  . CYS D 2 183 ? 18.395  -17.200 -11.059 1.00 82.57  ? 183 CYS D CB  1 
ATOM   9831  S SG  . CYS D 2 183 ? 16.600  -16.961 -11.075 1.00 92.74  ? 183 CYS D SG  1 
ATOM   9832  N N   . ALA D 2 184 ? 19.910  -16.299 -8.451  1.00 70.04  ? 184 ALA D N   1 
ATOM   9833  C CA  . ALA D 2 184 ? 19.947  -16.081 -7.010  1.00 54.32  ? 184 ALA D CA  1 
ATOM   9834  C C   . ALA D 2 184 ? 20.343  -14.652 -6.649  1.00 60.07  ? 184 ALA D C   1 
ATOM   9835  O O   . ALA D 2 184 ? 19.739  -14.051 -5.768  1.00 73.33  ? 184 ALA D O   1 
ATOM   9836  C CB  . ALA D 2 184 ? 20.894  -17.065 -6.351  1.00 57.24  ? 184 ALA D CB  1 
ATOM   9837  N N   . LEU D 2 185 ? 21.371  -14.121 -7.306  1.00 55.57  ? 185 LEU D N   1 
ATOM   9838  C CA  . LEU D 2 185 ? 21.842  -12.766 -7.015  1.00 50.65  ? 185 LEU D CA  1 
ATOM   9839  C C   . LEU D 2 185 ? 20.834  -11.706 -7.446  1.00 55.81  ? 185 LEU D C   1 
ATOM   9840  O O   . LEU D 2 185 ? 20.526  -10.767 -6.690  1.00 67.34  ? 185 LEU D O   1 
ATOM   9841  C CB  . LEU D 2 185 ? 23.187  -12.516 -7.693  1.00 44.20  ? 185 LEU D CB  1 
ATOM   9842  C CG  . LEU D 2 185 ? 24.300  -13.439 -7.204  1.00 54.18  ? 185 LEU D CG  1 
ATOM   9843  C CD1 . LEU D 2 185 ? 25.598  -13.135 -7.919  1.00 49.90  ? 185 LEU D CD1 1 
ATOM   9844  C CD2 . LEU D 2 185 ? 24.464  -13.294 -5.704  1.00 53.87  ? 185 LEU D CD2 1 
ATOM   9845  N N   . ASN D 2 186 ? 20.318  -11.869 -8.662  1.00 66.30  ? 186 ASN D N   1 
ATOM   9846  C CA  . ASN D 2 186 ? 19.277  -10.991 -9.176  1.00 69.16  ? 186 ASN D CA  1 
ATOM   9847  C C   . ASN D 2 186 ? 18.086  -10.994 -8.225  1.00 68.84  ? 186 ASN D C   1 
ATOM   9848  O O   . ASN D 2 186 ? 17.443  -9.965  -8.013  1.00 67.95  ? 186 ASN D O   1 
ATOM   9849  C CB  . ASN D 2 186 ? 18.838  -11.419 -10.575 1.00 68.25  ? 186 ASN D CB  1 
ATOM   9850  C CG  . ASN D 2 186 ? 19.888  -11.144 -11.637 1.00 63.35  ? 186 ASN D CG  1 
ATOM   9851  O OD1 . ASN D 2 186 ? 20.579  -10.128 -11.603 1.00 59.28  ? 186 ASN D OD1 1 
ATOM   9852  N ND2 . ASN D 2 186 ? 20.000  -12.053 -12.599 1.00 60.37  ? 186 ASN D ND2 1 
ATOM   9853  N N   . ALA D 2 187 ? 17.805  -12.165 -7.656  1.00 67.14  ? 187 ALA D N   1 
ATOM   9854  C CA  . ALA D 2 187 ? 16.766  -12.304 -6.642  1.00 68.30  ? 187 ALA D CA  1 
ATOM   9855  C C   . ALA D 2 187 ? 17.099  -11.562 -5.357  1.00 70.67  ? 187 ALA D C   1 
ATOM   9856  O O   . ALA D 2 187 ? 16.247  -10.891 -4.752  1.00 67.54  ? 187 ALA D O   1 
ATOM   9857  C CB  . ALA D 2 187 ? 16.524  -13.784 -6.344  1.00 72.29  ? 187 ALA D CB  1 
ATOM   9858  N N   . LEU D 2 188 ? 18.359  -11.686 -4.967  1.00 64.03  ? 188 LEU D N   1 
ATOM   9859  C CA  . LEU D 2 188 ? 18.860  -11.113 -3.738  1.00 62.97  ? 188 LEU D CA  1 
ATOM   9860  C C   . LEU D 2 188 ? 18.716  -9.601  -3.753  1.00 65.13  ? 188 LEU D C   1 
ATOM   9861  O O   . LEU D 2 188 ? 18.440  -8.996  -2.727  1.00 73.44  ? 188 LEU D O   1 
ATOM   9862  C CB  . LEU D 2 188 ? 20.322  -11.513 -3.521  1.00 63.79  ? 188 LEU D CB  1 
ATOM   9863  C CG  . LEU D 2 188 ? 20.955  -11.072 -2.201  1.00 52.45  ? 188 LEU D CG  1 
ATOM   9864  C CD1 . LEU D 2 188 ? 20.285  -11.800 -1.046  1.00 55.61  ? 188 LEU D CD1 1 
ATOM   9865  C CD2 . LEU D 2 188 ? 22.446  -11.350 -2.216  1.00 57.26  ? 188 LEU D CD2 1 
ATOM   9866  N N   . GLN D 2 189 ? 18.871  -8.997  -4.929  1.00 73.23  ? 189 GLN D N   1 
ATOM   9867  C CA  . GLN D 2 189 ? 18.764  -7.537  -5.045  1.00 77.59  ? 189 GLN D CA  1 
ATOM   9868  C C   . GLN D 2 189 ? 17.452  -6.928  -4.527  1.00 69.80  ? 189 GLN D C   1 
ATOM   9869  O O   . GLN D 2 189 ? 17.474  -5.933  -3.801  1.00 78.50  ? 189 GLN D O   1 
ATOM   9870  C CB  . GLN D 2 189 ? 18.966  -7.123  -6.502  1.00 62.85  ? 189 GLN D CB  1 
ATOM   9871  C CG  . GLN D 2 189 ? 20.320  -7.499  -7.038  1.00 62.78  ? 189 GLN D CG  1 
ATOM   9872  C CD  . GLN D 2 189 ? 21.421  -6.909  -6.188  1.00 71.49  ? 189 GLN D CD  1 
ATOM   9873  O OE1 . GLN D 2 189 ? 21.381  -5.729  -5.836  1.00 75.63  ? 189 GLN D OE1 1 
ATOM   9874  N NE2 . GLN D 2 189 ? 22.397  -7.729  -5.831  1.00 70.13  ? 189 GLN D NE2 1 
ATOM   9875  N N   . TYR D 2 190 ? 16.334  -7.543  -4.895  1.00 74.20  ? 190 TYR D N   1 
ATOM   9876  C CA  . TYR D 2 190 ? 14.992  -7.165  -4.463  1.00 74.48  ? 190 TYR D CA  1 
ATOM   9877  C C   . TYR D 2 190 ? 14.739  -7.680  -3.029  1.00 73.81  ? 190 TYR D C   1 
ATOM   9878  O O   . TYR D 2 190 ? 14.137  -6.999  -2.165  1.00 78.75  ? 190 TYR D O   1 
ATOM   9879  C CB  . TYR D 2 190 ? 13.985  -7.754  -5.429  1.00 81.86  ? 190 TYR D CB  1 
ATOM   9880  C CG  . TYR D 2 190 ? 14.128  -7.346  -6.892  1.00 103.08 ? 190 TYR D CG  1 
ATOM   9881  C CD1 . TYR D 2 190 ? 13.396  -6.262  -7.432  1.00 105.02 ? 190 TYR D CD1 1 
ATOM   9882  C CD2 . TYR D 2 190 ? 15.042  -8.011  -7.733  1.00 109.51 ? 190 TYR D CD2 1 
ATOM   9883  C CE1 . TYR D 2 190 ? 13.531  -5.893  -8.786  1.00 107.88 ? 190 TYR D CE1 1 
ATOM   9884  C CE2 . TYR D 2 190 ? 15.192  -7.619  -9.062  1.00 121.16 ? 190 TYR D CE2 1 
ATOM   9885  C CZ  . TYR D 2 190 ? 14.437  -6.564  -9.583  1.00 116.03 ? 190 TYR D CZ  1 
ATOM   9886  O OH  . TYR D 2 190 ? 14.591  -6.181  -10.918 1.00 117.59 ? 190 TYR D OH  1 
ATOM   9887  N N   . ARG D 2 191 ? 15.224  -8.894  -2.769  1.00 85.30  ? 191 ARG D N   1 
ATOM   9888  C CA  . ARG D 2 191 ? 15.004  -9.512  -1.464  1.00 72.20  ? 191 ARG D CA  1 
ATOM   9889  C C   . ARG D 2 191 ? 15.678  -8.734  -0.328  1.00 73.99  ? 191 ARG D C   1 
ATOM   9890  O O   . ARG D 2 191 ? 15.260  -8.833  0.819   1.00 65.10  ? 191 ARG D O   1 
ATOM   9891  C CB  . ARG D 2 191 ? 15.496  -10.957 -1.468  1.00 68.11  ? 191 ARG D CB  1 
ATOM   9892  C CG  . ARG D 2 191 ? 14.429  -11.953 -1.873  1.00 79.80  ? 191 ARG D CG  1 
ATOM   9893  C CD  . ARG D 2 191 ? 15.031  -13.290 -2.269  1.00 79.95  ? 191 ARG D CD  1 
ATOM   9894  N NE  . ARG D 2 191 ? 14.015  -14.311 -2.513  1.00 82.71  ? 191 ARG D NE  1 
ATOM   9895  C CZ  . ARG D 2 191 ? 14.275  -15.522 -2.996  1.00 93.17  ? 191 ARG D CZ  1 
ATOM   9896  N NH1 . ARG D 2 191 ? 15.520  -15.867 -3.300  1.00 95.81  ? 191 ARG D NH1 1 
ATOM   9897  N NH2 . ARG D 2 191 ? 13.288  -16.386 -3.187  1.00 92.74  ? 191 ARG D NH2 1 
ATOM   9898  N N   . LYS D 2 192 ? 16.721  -7.974  -0.655  1.00 82.20  ? 192 LYS D N   1 
ATOM   9899  C CA  . LYS D 2 192 ? 17.323  -7.027  0.282   1.00 78.20  ? 192 LYS D CA  1 
ATOM   9900  C C   . LYS D 2 192 ? 16.273  -6.019  0.701   1.00 65.71  ? 192 LYS D C   1 
ATOM   9901  O O   . LYS D 2 192 ? 16.110  -5.713  1.885   1.00 66.10  ? 192 LYS D O   1 
ATOM   9902  C CB  . LYS D 2 192 ? 18.516  -6.299  -0.343  1.00 81.41  ? 192 LYS D CB  1 
ATOM   9903  C CG  . LYS D 2 192 ? 19.696  -7.186  -0.664  1.00 72.47  ? 192 LYS D CG  1 
ATOM   9904  N N   . GLN D 2 193 ? 15.570  -5.501  -0.301  1.00 81.30  ? 193 GLN D N   1 
ATOM   9905  C CA  . GLN D 2 193 ? 14.531  -4.510  -0.089  1.00 75.72  ? 193 GLN D CA  1 
ATOM   9906  C C   . GLN D 2 193 ? 13.466  -5.033  0.848   1.00 76.80  ? 193 GLN D C   1 
ATOM   9907  O O   . GLN D 2 193 ? 13.170  -4.406  1.865   1.00 72.13  ? 193 GLN D O   1 
ATOM   9908  C CB  . GLN D 2 193 ? 13.880  -4.122  -1.418  1.00 77.52  ? 193 GLN D CB  1 
ATOM   9909  C CG  . GLN D 2 193 ? 14.815  -3.561  -2.469  1.00 62.42  ? 193 GLN D CG  1 
ATOM   9910  C CD  . GLN D 2 193 ? 14.093  -3.273  -3.775  1.00 99.03  ? 193 GLN D CD  1 
ATOM   9911  O OE1 . GLN D 2 193 ? 13.444  -2.239  -3.922  1.00 108.72 ? 193 GLN D OE1 1 
ATOM   9912  N NE2 . GLN D 2 193 ? 14.258  -4.157  -4.751  1.00 96.62  ? 193 GLN D NE2 1 
ATOM   9913  N N   . MET D 2 194 ? 12.901  -6.192  0.524   1.00 78.55  ? 194 MET D N   1 
ATOM   9914  C CA  . MET D 2 194 ? 11.853  -6.741  1.397   1.00 74.13  ? 194 MET D CA  1 
ATOM   9915  C C   . MET D 2 194 ? 12.325  -7.160  2.791   1.00 73.97  ? 194 MET D C   1 
ATOM   9916  O O   . MET D 2 194 ? 11.632  -6.926  3.785   1.00 83.57  ? 194 MET D O   1 
ATOM   9917  C CB  . MET D 2 194 ? 11.166  -7.930  0.732   1.00 77.97  ? 194 MET D CB  1 
ATOM   9918  C CG  . MET D 2 194 ? 10.479  -7.584  -0.561  1.00 83.23  ? 194 MET D CG  1 
ATOM   9919  S SD  . MET D 2 194 ? 10.085  -9.037  -1.545  1.00 128.96 ? 194 MET D SD  1 
ATOM   9920  C CE  . MET D 2 194 ? 9.576   -10.188 -0.269  1.00 87.71  ? 194 MET D CE  1 
ATOM   9921  N N   . ALA D 2 195 ? 13.488  -7.797  2.852   1.00 78.43  ? 195 ALA D N   1 
ATOM   9922  C CA  . ALA D 2 195 ? 13.993  -8.346  4.102   1.00 72.12  ? 195 ALA D CA  1 
ATOM   9923  C C   . ALA D 2 195 ? 14.203  -7.292  5.173   1.00 66.55  ? 195 ALA D C   1 
ATOM   9924  O O   . ALA D 2 195 ? 14.091  -7.599  6.357   1.00 96.19  ? 195 ALA D O   1 
ATOM   9925  C CB  . ALA D 2 195 ? 15.292  -9.087  3.863   1.00 72.07  ? 195 ALA D CB  1 
ATOM   9926  N N   . MET D 2 196 ? 14.550  -6.071  4.784   1.00 47.25  ? 196 MET D N   1 
ATOM   9927  C CA  . MET D 2 196 ? 14.756  -5.037  5.792   1.00 73.73  ? 196 MET D CA  1 
ATOM   9928  C C   . MET D 2 196 ? 13.548  -4.121  6.011   1.00 68.02  ? 196 MET D C   1 
ATOM   9929  O O   . MET D 2 196 ? 13.548  -3.325  6.946   1.00 69.42  ? 196 MET D O   1 
ATOM   9930  C CB  . MET D 2 196 ? 15.990  -4.194  5.461   1.00 89.18  ? 196 MET D CB  1 
ATOM   9931  C CG  . MET D 2 196 ? 17.320  -4.830  5.875   1.00 98.55  ? 196 MET D CG  1 
ATOM   9932  S SD  . MET D 2 196 ? 18.768  -4.066  5.101   1.00 127.81 ? 196 MET D SD  1 
ATOM   9933  C CE  . MET D 2 196 ? 18.933  -5.003  3.581   1.00 101.46 ? 196 MET D CE  1 
ATOM   9934  N N   . MET D 2 197 ? 12.534  -4.213  5.154   1.00 65.29  ? 197 MET D N   1 
ATOM   9935  C CA  . MET D 2 197 ? 11.285  -3.480  5.382   1.00 59.10  ? 197 MET D CA  1 
ATOM   9936  C C   . MET D 2 197 ? 10.314  -4.247  6.283   1.00 63.97  ? 197 MET D C   1 
ATOM   9937  O O   . MET D 2 197 ? 9.526   -3.644  7.011   1.00 60.45  ? 197 MET D O   1 
ATOM   9938  C CB  . MET D 2 197 ? 10.609  -3.116  4.059   1.00 54.56  ? 197 MET D CB  1 
ATOM   9939  C CG  . MET D 2 197 ? 11.363  -2.059  3.262   1.00 73.28  ? 197 MET D CG  1 
ATOM   9940  S SD  . MET D 2 197 ? 10.456  -1.450  1.827   1.00 84.96  ? 197 MET D SD  1 
ATOM   9941  C CE  . MET D 2 197 ? 10.295  -2.949  0.863   1.00 68.09  ? 197 MET D CE  1 
ATOM   9942  N N   . GLU D 2 198 ? 10.356  -5.575  6.206   1.00 65.24  ? 198 GLU D N   1 
ATOM   9943  C CA  . GLU D 2 198 ? 9.542   -6.441  7.064   1.00 69.39  ? 198 GLU D CA  1 
ATOM   9944  C C   . GLU D 2 198 ? 9.737   -6.184  8.572   1.00 67.91  ? 198 GLU D C   1 
ATOM   9945  O O   . GLU D 2 198 ? 8.753   -6.065  9.319   1.00 73.77  ? 198 GLU D O   1 
ATOM   9946  C CB  . GLU D 2 198 ? 9.834   -7.914  6.746   1.00 71.18  ? 198 GLU D CB  1 
ATOM   9947  C CG  . GLU D 2 198 ? 8.787   -8.613  5.883   1.00 92.85  ? 198 GLU D CG  1 
ATOM   9948  C CD  . GLU D 2 198 ? 7.462   -8.844  6.595   1.00 122.13 ? 198 GLU D CD  1 
ATOM   9949  O OE1 . GLU D 2 198 ? 7.301   -8.405  7.754   1.00 130.16 ? 198 GLU D OE1 1 
ATOM   9950  O OE2 . GLU D 2 198 ? 6.575   -9.480  5.988   1.00 122.12 ? 198 GLU D OE2 1 
ATOM   9951  N N   . PRO D 2 199 ? 11.000  -6.106  9.039   1.00 74.67  ? 199 PRO D N   1 
ATOM   9952  C CA  . PRO D 2 199 ? 11.151  -5.841  10.470  1.00 71.90  ? 199 PRO D CA  1 
ATOM   9953  C C   . PRO D 2 199 ? 10.646  -4.450  10.821  1.00 65.91  ? 199 PRO D C   1 
ATOM   9954  O O   . PRO D 2 199 ? 10.182  -4.238  11.934  1.00 77.74  ? 199 PRO D O   1 
ATOM   9955  C CB  . PRO D 2 199 ? 12.666  -5.955  10.696  1.00 67.18  ? 199 PRO D CB  1 
ATOM   9956  C CG  . PRO D 2 199 ? 13.176  -6.700  9.507   1.00 73.87  ? 199 PRO D CG  1 
ATOM   9957  C CD  . PRO D 2 199 ? 12.315  -6.234  8.391   1.00 72.67  ? 199 PRO D CD  1 
ATOM   9958  N N   . MET D 2 200 ? 10.750  -3.518  9.879   1.00 63.73  ? 200 MET D N   1 
ATOM   9959  C CA  . MET D 2 200 ? 10.235  -2.168  10.078  1.00 65.29  ? 200 MET D CA  1 
ATOM   9960  C C   . MET D 2 200 ? 8.722   -2.143  10.315  1.00 73.10  ? 200 MET D C   1 
ATOM   9961  O O   . MET D 2 200 ? 8.253   -1.498  11.255  1.00 72.20  ? 200 MET D O   1 
ATOM   9962  C CB  . MET D 2 200 ? 10.589  -1.287  8.879   1.00 67.92  ? 200 MET D CB  1 
ATOM   9963  C CG  . MET D 2 200 ? 12.080  -1.043  8.706   1.00 78.34  ? 200 MET D CG  1 
ATOM   9964  S SD  . MET D 2 200 ? 12.473  -0.086  7.228   1.00 97.93  ? 200 MET D SD  1 
ATOM   9965  N N   . ILE D 2 201 ? 7.959   -2.842  9.476   1.00 71.47  ? 201 ILE D N   1 
ATOM   9966  C CA  . ILE D 2 201 ? 6.508   -2.880  9.654   1.00 68.47  ? 201 ILE D CA  1 
ATOM   9967  C C   . ILE D 2 201 ? 6.143   -3.634  10.929  1.00 74.95  ? 201 ILE D C   1 
ATOM   9968  O O   . ILE D 2 201 ? 5.253   -3.205  11.670  1.00 80.42  ? 201 ILE D O   1 
ATOM   9969  C CB  . ILE D 2 201 ? 5.759   -3.507  8.442   1.00 78.88  ? 201 ILE D CB  1 
ATOM   9970  C CG1 . ILE D 2 201 ? 6.394   -4.822  7.996   1.00 85.15  ? 201 ILE D CG1 1 
ATOM   9971  C CG2 . ILE D 2 201 ? 5.711   -2.532  7.282   1.00 74.06  ? 201 ILE D CG2 1 
ATOM   9972  C CD1 . ILE D 2 201 ? 5.719   -5.456  6.795   1.00 70.38  ? 201 ILE D CD1 1 
ATOM   9973  N N   . GLY D 2 202 ? 6.824   -4.749  11.189  1.00 60.52  ? 202 GLY D N   1 
ATOM   9974  C CA  . GLY D 2 202 ? 6.545   -5.509  12.398  1.00 66.19  ? 202 GLY D CA  1 
ATOM   9975  C C   . GLY D 2 202 ? 6.768   -4.678  13.652  1.00 70.42  ? 202 GLY D C   1 
ATOM   9976  O O   . GLY D 2 202 ? 5.922   -4.629  14.553  1.00 70.97  ? 202 GLY D O   1 
ATOM   9977  N N   . PHE D 2 203 ? 7.915   -4.008  13.687  1.00 67.13  ? 203 PHE D N   1 
ATOM   9978  C CA  . PHE D 2 203 ? 8.290   -3.107  14.771  1.00 61.40  ? 203 PHE D CA  1 
ATOM   9979  C C   . PHE D 2 203 ? 7.285   -1.969  14.940  1.00 66.15  ? 203 PHE D C   1 
ATOM   9980  O O   . PHE D 2 203 ? 6.879   -1.650  16.061  1.00 67.02  ? 203 PHE D O   1 
ATOM   9981  C CB  . PHE D 2 203 ? 9.695   -2.551  14.508  1.00 47.94  ? 203 PHE D CB  1 
ATOM   9982  C CG  . PHE D 2 203 ? 10.110  -1.450  15.441  1.00 50.19  ? 203 PHE D CG  1 
ATOM   9983  C CD1 . PHE D 2 203 ? 9.969   -0.122  15.071  1.00 43.46  ? 203 PHE D CD1 1 
ATOM   9984  C CD2 . PHE D 2 203 ? 10.672  -1.742  16.672  1.00 69.55  ? 203 PHE D CD2 1 
ATOM   9985  C CE1 . PHE D 2 203 ? 10.359  0.894   15.919  1.00 50.21  ? 203 PHE D CE1 1 
ATOM   9986  C CE2 . PHE D 2 203 ? 11.064  -0.728  17.527  1.00 55.10  ? 203 PHE D CE2 1 
ATOM   9987  C CZ  . PHE D 2 203 ? 10.908  0.591   17.148  1.00 56.99  ? 203 PHE D CZ  1 
ATOM   9988  N N   . ALA D 2 204 ? 6.884   -1.367  13.824  1.00 63.43  ? 204 ALA D N   1 
ATOM   9989  C CA  . ALA D 2 204 ? 5.927   -0.266  13.850  1.00 66.67  ? 204 ALA D CA  1 
ATOM   9990  C C   . ALA D 2 204 ? 4.588   -0.700  14.438  1.00 66.76  ? 204 ALA D C   1 
ATOM   9991  O O   . ALA D 2 204 ? 4.017   -0.006  15.285  1.00 61.48  ? 204 ALA D O   1 
ATOM   9992  C CB  . ALA D 2 204 ? 5.733   0.296   12.451  1.00 61.79  ? 204 ALA D CB  1 
ATOM   9993  N N   . HIS D 2 205 ? 4.097   -1.855  13.993  1.00 62.12  ? 205 HIS D N   1 
ATOM   9994  C CA  . HIS D 2 205 ? 2.837   -2.394  14.497  1.00 64.07  ? 205 HIS D CA  1 
ATOM   9995  C C   . HIS D 2 205 ? 2.918   -2.704  15.990  1.00 63.30  ? 205 HIS D C   1 
ATOM   9996  O O   . HIS D 2 205 ? 2.016   -2.350  16.762  1.00 68.50  ? 205 HIS D O   1 
ATOM   9997  C CB  . HIS D 2 205 ? 2.440   -3.648  13.717  1.00 64.43  ? 205 HIS D CB  1 
ATOM   9998  C CG  . HIS D 2 205 ? 1.819   -3.359  12.388  1.00 78.90  ? 205 HIS D CG  1 
ATOM   9999  N ND1 . HIS D 2 205 ? 0.644   -2.646  12.254  1.00 77.86  ? 205 HIS D ND1 1 
ATOM   10000 C CD2 . HIS D 2 205 ? 2.204   -3.681  11.130  1.00 90.45  ? 205 HIS D CD2 1 
ATOM   10001 C CE1 . HIS D 2 205 ? 0.336   -2.544  10.976  1.00 72.56  ? 205 HIS D CE1 1 
ATOM   10002 N NE2 . HIS D 2 205 ? 1.267   -3.165  10.271  1.00 77.78  ? 205 HIS D NE2 1 
ATOM   10003 N N   . GLY D 2 206 ? 4.001   -3.364  16.392  1.00 65.50  ? 206 GLY D N   1 
ATOM   10004 C CA  . GLY D 2 206 ? 4.224   -3.660  17.796  1.00 57.49  ? 206 GLY D CA  1 
ATOM   10005 C C   . GLY D 2 206 ? 4.193   -2.401  18.642  1.00 52.66  ? 206 GLY D C   1 
ATOM   10006 O O   . GLY D 2 206 ? 3.553   -2.357  19.700  1.00 47.56  ? 206 GLY D O   1 
ATOM   10007 N N   . GLN D 2 207 ? 4.872   -1.364  18.160  1.00 46.32  ? 207 GLN D N   1 
ATOM   10008 C CA  . GLN D 2 207 ? 4.957   -0.104  18.888  1.00 50.22  ? 207 GLN D CA  1 
ATOM   10009 C C   . GLN D 2 207 ? 3.613   0.619   18.985  1.00 54.25  ? 207 GLN D C   1 
ATOM   10010 O O   . GLN D 2 207 ? 3.264   1.124   20.056  1.00 60.09  ? 207 GLN D O   1 
ATOM   10011 C CB  . GLN D 2 207 ? 6.001   0.811   18.246  1.00 49.84  ? 207 GLN D CB  1 
ATOM   10012 C CG  . GLN D 2 207 ? 7.445   0.407   18.537  1.00 60.48  ? 207 GLN D CG  1 
ATOM   10013 C CD  . GLN D 2 207 ? 7.714   0.164   20.015  1.00 70.20  ? 207 GLN D CD  1 
ATOM   10014 O OE1 . GLN D 2 207 ? 7.190   0.867   20.881  1.00 72.39  ? 207 GLN D OE1 1 
ATOM   10015 N NE2 . GLN D 2 207 ? 8.534   -0.839  20.309  1.00 60.30  ? 207 GLN D NE2 1 
ATOM   10016 N N   . ILE D 2 208 ? 2.850   0.670   17.892  1.00 55.75  ? 208 ILE D N   1 
ATOM   10017 C CA  . ILE D 2 208 ? 1.569   1.376   17.949  1.00 55.44  ? 208 ILE D CA  1 
ATOM   10018 C C   . ILE D 2 208 ? 0.597   0.622   18.844  1.00 59.73  ? 208 ILE D C   1 
ATOM   10019 O O   . ILE D 2 208 ? -0.188  1.241   19.562  1.00 60.35  ? 208 ILE D O   1 
ATOM   10020 C CB  . ILE D 2 208 ? 0.910   1.591   16.557  1.00 64.73  ? 208 ILE D CB  1 
ATOM   10021 C CG1 . ILE D 2 208 ? 0.891   0.307   15.728  1.00 73.76  ? 208 ILE D CG1 1 
ATOM   10022 C CG2 . ILE D 2 208 ? 1.592   2.709   15.804  1.00 58.03  ? 208 ILE D CG2 1 
ATOM   10023 C CD1 . ILE D 2 208 ? -0.456  -0.384  15.697  1.00 55.46  ? 208 ILE D CD1 1 
ATOM   10024 N N   . ASN D 2 209 ? 0.658   -0.707  18.823  1.00 58.85  ? 209 ASN D N   1 
ATOM   10025 C CA  . ASN D 2 209 ? -0.222  -1.482  19.689  1.00 62.17  ? 209 ASN D CA  1 
ATOM   10026 C C   . ASN D 2 209 ? 0.132   -1.277  21.157  1.00 61.55  ? 209 ASN D C   1 
ATOM   10027 O O   . ASN D 2 209 ? -0.749  -1.045  21.999  1.00 62.93  ? 209 ASN D O   1 
ATOM   10028 C CB  . ASN D 2 209 ? -0.146  -2.969  19.341  1.00 58.27  ? 209 ASN D CB  1 
ATOM   10029 C CG  . ASN D 2 209 ? -0.938  -3.319  18.099  1.00 73.60  ? 209 ASN D CG  1 
ATOM   10030 O OD1 . ASN D 2 209 ? -1.978  -2.722  17.824  1.00 72.94  ? 209 ASN D OD1 1 
ATOM   10031 N ND2 . ASN D 2 209 ? -0.448  -4.293  17.340  1.00 82.84  ? 209 ASN D ND2 1 
ATOM   10032 N N   . PHE D 2 210 ? 1.430   -1.322  21.447  1.00 60.15  ? 210 PHE D N   1 
ATOM   10033 C CA  . PHE D 2 210 ? 1.925   -1.130  22.805  1.00 54.65  ? 210 PHE D CA  1 
ATOM   10034 C C   . PHE D 2 210 ? 1.548   0.242   23.357  1.00 50.34  ? 210 PHE D C   1 
ATOM   10035 O O   . PHE D 2 210 ? 1.057   0.353   24.480  1.00 49.50  ? 210 PHE D O   1 
ATOM   10036 C CB  . PHE D 2 210 ? 3.445   -1.321  22.851  1.00 62.29  ? 210 PHE D CB  1 
ATOM   10037 C CG  . PHE D 2 210 ? 4.069   -0.934  24.163  1.00 58.48  ? 210 PHE D CG  1 
ATOM   10038 C CD1 . PHE D 2 210 ? 4.041   -1.805  25.240  1.00 61.34  ? 210 PHE D CD1 1 
ATOM   10039 C CD2 . PHE D 2 210 ? 4.699   0.292   24.314  1.00 48.81  ? 210 PHE D CD2 1 
ATOM   10040 C CE1 . PHE D 2 210 ? 4.616   -1.456  26.447  1.00 57.06  ? 210 PHE D CE1 1 
ATOM   10041 C CE2 . PHE D 2 210 ? 5.277   0.646   25.518  1.00 46.91  ? 210 PHE D CE2 1 
ATOM   10042 C CZ  . PHE D 2 210 ? 5.236   -0.229  26.585  1.00 57.47  ? 210 PHE D CZ  1 
ATOM   10043 N N   . PHE D 2 211 ? 1.772   1.283   22.561  1.00 56.23  ? 211 PHE D N   1 
ATOM   10044 C CA  . PHE D 2 211 ? 1.505   2.644   23.013  1.00 47.18  ? 211 PHE D CA  1 
ATOM   10045 C C   . PHE D 2 211 ? 0.018   2.978   23.057  1.00 48.76  ? 211 PHE D C   1 
ATOM   10046 O O   . PHE D 2 211 ? -0.407  3.799   23.868  1.00 55.06  ? 211 PHE D O   1 
ATOM   10047 C CB  . PHE D 2 211 ? 2.235   3.652   22.126  1.00 52.20  ? 211 PHE D CB  1 
ATOM   10048 C CG  . PHE D 2 211 ? 3.653   3.902   22.544  1.00 54.44  ? 211 PHE D CG  1 
ATOM   10049 C CD1 . PHE D 2 211 ? 3.946   4.854   23.506  1.00 55.83  ? 211 PHE D CD1 1 
ATOM   10050 C CD2 . PHE D 2 211 ? 4.691   3.179   21.985  1.00 53.88  ? 211 PHE D CD2 1 
ATOM   10051 C CE1 . PHE D 2 211 ? 5.250   5.084   23.897  1.00 53.30  ? 211 PHE D CE1 1 
ATOM   10052 C CE2 . PHE D 2 211 ? 5.996   3.403   22.372  1.00 64.92  ? 211 PHE D CE2 1 
ATOM   10053 C CZ  . PHE D 2 211 ? 6.276   4.358   23.329  1.00 68.39  ? 211 PHE D CZ  1 
ATOM   10054 N N   . LYS D 2 212 ? -0.772  2.357   22.185  1.00 57.72  ? 212 LYS D N   1 
ATOM   10055 C CA  . LYS D 2 212 ? -2.209  2.612   22.185  1.00 64.71  ? 212 LYS D CA  1 
ATOM   10056 C C   . LYS D 2 212 ? -2.873  1.942   23.382  1.00 60.24  ? 212 LYS D C   1 
ATOM   10057 O O   . LYS D 2 212 ? -3.645  2.576   24.111  1.00 53.26  ? 212 LYS D O   1 
ATOM   10058 C CB  . LYS D 2 212 ? -2.853  2.130   20.883  1.00 63.24  ? 212 LYS D CB  1 
ATOM   10059 C CG  . LYS D 2 212 ? -4.322  2.506   20.744  1.00 61.34  ? 212 LYS D CG  1 
ATOM   10060 C CD  . LYS D 2 212 ? -4.874  2.102   19.386  1.00 57.72  ? 212 LYS D CD  1 
ATOM   10061 N N   . LYS D 2 213 ? -2.561  0.666   23.600  1.00 53.44  ? 213 LYS D N   1 
ATOM   10062 C CA  . LYS D 2 213 ? -3.128  -0.037  24.746  1.00 38.19  ? 213 LYS D CA  1 
ATOM   10063 C C   . LYS D 2 213 ? -2.565  0.519   26.050  1.00 65.49  ? 213 LYS D C   1 
ATOM   10064 O O   . LYS D 2 213 ? -3.233  0.496   27.083  1.00 56.51  ? 213 LYS D O   1 
ATOM   10065 C CB  . LYS D 2 213 ? -2.881  -1.543  24.652  1.00 28.83  ? 213 LYS D CB  1 
ATOM   10066 C CG  . LYS D 2 213 ? -3.771  -2.251  23.643  1.00 56.22  ? 213 LYS D CG  1 
ATOM   10067 C CD  . LYS D 2 213 ? -3.935  -3.725  23.986  1.00 66.53  ? 213 LYS D CD  1 
ATOM   10068 C CE  . LYS D 2 213 ? -2.641  -4.498  23.800  1.00 92.71  ? 213 LYS D CE  1 
ATOM   10069 N NZ  . LYS D 2 213 ? -2.785  -5.919  24.225  1.00 73.78  ? 213 LYS D NZ  1 
ATOM   10070 N N   . GLY D 2 214 ? -1.328  1.005   26.000  1.00 62.67  ? 214 GLY D N   1 
ATOM   10071 C CA  . GLY D 2 214 ? -0.734  1.693   27.131  1.00 54.15  ? 214 GLY D CA  1 
ATOM   10072 C C   . GLY D 2 214 ? -1.467  2.980   27.452  1.00 62.18  ? 214 GLY D C   1 
ATOM   10073 O O   . GLY D 2 214 ? -1.722  3.289   28.617  1.00 57.00  ? 214 GLY D O   1 
ATOM   10074 N N   . ALA D 2 215 ? -1.801  3.734   26.408  1.00 54.48  ? 215 ALA D N   1 
ATOM   10075 C CA  . ALA D 2 215 ? -2.568  4.964   26.555  1.00 53.60  ? 215 ALA D CA  1 
ATOM   10076 C C   . ALA D 2 215 ? -3.932  4.661   27.159  1.00 71.62  ? 215 ALA D C   1 
ATOM   10077 O O   . ALA D 2 215 ? -4.438  5.419   27.987  1.00 60.69  ? 215 ALA D O   1 
ATOM   10078 C CB  . ALA D 2 215 ? -2.720  5.665   25.215  1.00 54.11  ? 215 ALA D CB  1 
ATOM   10079 N N   . GLU D 2 216 ? -4.528  3.553   26.729  1.00 65.52  ? 216 GLU D N   1 
ATOM   10080 C CA  . GLU D 2 216 ? -5.796  3.106   27.295  1.00 68.96  ? 216 GLU D CA  1 
ATOM   10081 C C   . GLU D 2 216 ? -5.645  2.750   28.774  1.00 71.04  ? 216 GLU D C   1 
ATOM   10082 O O   . GLU D 2 216 ? -6.502  3.087   29.592  1.00 62.11  ? 216 GLU D O   1 
ATOM   10083 C CB  . GLU D 2 216 ? -6.335  1.903   26.518  1.00 64.86  ? 216 GLU D CB  1 
ATOM   10084 N N   . MET D 2 217 ? -4.550  2.072   29.106  1.00 78.29  ? 217 MET D N   1 
ATOM   10085 C CA  . MET D 2 217 ? -4.275  1.665   30.482  1.00 67.72  ? 217 MET D CA  1 
ATOM   10086 C C   . MET D 2 217 ? -4.144  2.855   31.414  1.00 53.89  ? 217 MET D C   1 
ATOM   10087 O O   . MET D 2 217 ? -4.827  2.924   32.436  1.00 72.41  ? 217 MET D O   1 
ATOM   10088 C CB  . MET D 2 217 ? -3.005  0.821   30.558  1.00 78.53  ? 217 MET D CB  1 
ATOM   10089 C CG  . MET D 2 217 ? -3.256  -0.631  30.912  1.00 76.16  ? 217 MET D CG  1 
ATOM   10090 S SD  . MET D 2 217 ? -1.756  -1.461  31.459  1.00 72.91  ? 217 MET D SD  1 
ATOM   10091 C CE  . MET D 2 217 ? -1.463  -0.640  33.023  1.00 61.69  ? 217 MET D CE  1 
ATOM   10092 N N   . PHE D 2 218 ? -3.274  3.799   31.073  1.00 52.25  ? 218 PHE D N   1 
ATOM   10093 C CA  . PHE D 2 218 ? -3.130  4.949   31.942  1.00 53.66  ? 218 PHE D CA  1 
ATOM   10094 C C   . PHE D 2 218 ? -3.959  6.069   31.340  1.00 51.67  ? 218 PHE D C   1 
ATOM   10095 O O   . PHE D 2 218 ? -3.524  6.798   30.449  1.00 75.19  ? 218 PHE D O   1 
ATOM   10096 C CB  . PHE D 2 218 ? -1.658  5.345   32.082  1.00 59.20  ? 218 PHE D CB  1 
ATOM   10097 C CG  . PHE D 2 218 ? -0.810  4.294   32.747  1.00 45.70  ? 218 PHE D CG  1 
ATOM   10098 C CD1 . PHE D 2 218 ? -0.526  4.365   34.101  1.00 57.76  ? 218 PHE D CD1 1 
ATOM   10099 C CD2 . PHE D 2 218 ? -0.311  3.226   32.020  1.00 46.84  ? 218 PHE D CD2 1 
ATOM   10100 C CE1 . PHE D 2 218 ? 0.247   3.393   34.714  1.00 56.44  ? 218 PHE D CE1 1 
ATOM   10101 C CE2 . PHE D 2 218 ? 0.463   2.254   32.627  1.00 43.38  ? 218 PHE D CE2 1 
ATOM   10102 C CZ  . PHE D 2 218 ? 0.741   2.337   33.975  1.00 51.95  ? 218 PHE D CZ  1 
ATOM   10103 N N   . SER D 2 219 ? -5.167  6.185   31.877  1.00 71.95  ? 219 SER D N   1 
ATOM   10104 C CA  . SER D 2 219 ? -6.176  7.133   31.436  1.00 64.67  ? 219 SER D CA  1 
ATOM   10105 C C   . SER D 2 219 ? -6.248  8.340   32.355  1.00 71.41  ? 219 SER D C   1 
ATOM   10106 O O   . SER D 2 219 ? -5.381  8.547   33.203  1.00 88.90  ? 219 SER D O   1 
ATOM   10107 C CB  . SER D 2 219 ? -7.541  6.450   31.350  1.00 73.73  ? 219 SER D CB  1 
ATOM   10108 O OG  . SER D 2 219 ? -7.852  5.787   32.562  1.00 73.34  ? 219 SER D OG  1 
ATOM   10109 N N   . LYS D 2 220 ? -7.294  9.136   32.172  1.00 82.30  ? 220 LYS D N   1 
ATOM   10110 C CA  . LYS D 2 220 ? -7.588  10.227  33.086  1.00 73.32  ? 220 LYS D CA  1 
ATOM   10111 C C   . LYS D 2 220 ? -8.108  9.646   34.401  1.00 75.55  ? 220 LYS D C   1 
ATOM   10112 O O   . LYS D 2 220 ? -7.945  10.245  35.463  1.00 84.89  ? 220 LYS D O   1 
ATOM   10113 C CB  . LYS D 2 220 ? -8.610  11.188  32.475  1.00 64.16  ? 220 LYS D CB  1 
ATOM   10114 C CG  . LYS D 2 220 ? -8.803  12.475  33.260  1.00 77.06  ? 220 LYS D CG  1 
ATOM   10115 N N   . ARG D 2 221 ? -8.739  8.477   34.315  1.00 59.03  ? 221 ARG D N   1 
ATOM   10116 C CA  . ARG D 2 221 ? -9.230  7.759   35.491  1.00 59.86  ? 221 ARG D CA  1 
ATOM   10117 C C   . ARG D 2 221 ? -8.083  7.301   36.391  1.00 76.30  ? 221 ARG D C   1 
ATOM   10118 O O   . ARG D 2 221 ? -8.124  7.476   37.612  1.00 74.22  ? 221 ARG D O   1 
ATOM   10119 C CB  . ARG D 2 221 ? -10.076 6.555   35.071  1.00 49.07  ? 221 ARG D CB  1 
ATOM   10120 N N   . MET D 2 222 ? -7.075  6.686   35.779  1.00 80.48  ? 222 MET D N   1 
ATOM   10121 C CA  . MET D 2 222 ? -5.885  6.244   36.498  1.00 67.35  ? 222 MET D CA  1 
ATOM   10122 C C   . MET D 2 222 ? -5.200  7.424   37.180  1.00 60.94  ? 222 MET D C   1 
ATOM   10123 O O   . MET D 2 222 ? -4.638  7.290   38.266  1.00 73.90  ? 222 MET D O   1 
ATOM   10124 C CB  . MET D 2 222 ? -4.912  5.541   35.547  1.00 60.77  ? 222 MET D CB  1 
ATOM   10125 C CG  . MET D 2 222 ? -3.636  5.044   36.211  1.00 74.96  ? 222 MET D CG  1 
ATOM   10126 S SD  . MET D 2 222 ? -3.931  3.695   37.372  1.00 104.16 ? 222 MET D SD  1 
ATOM   10127 C CE  . MET D 2 222 ? -4.987  2.622   36.401  1.00 77.28  ? 222 MET D CE  1 
ATOM   10128 N N   . ASP D 2 223 ? -5.279  8.589   36.547  1.00 59.41  ? 223 ASP D N   1 
ATOM   10129 C CA  . ASP D 2 223 ? -4.577  9.772   37.022  1.00 73.34  ? 223 ASP D CA  1 
ATOM   10130 C C   . ASP D 2 223 ? -5.419  10.379  38.144  1.00 67.68  ? 223 ASP D C   1 
ATOM   10131 O O   . ASP D 2 223 ? -4.898  11.006  39.074  1.00 76.12  ? 223 ASP D O   1 
ATOM   10132 C CB  . ASP D 2 223 ? -4.370  10.756  35.857  1.00 76.20  ? 223 ASP D CB  1 
ATOM   10133 C CG  . ASP D 2 223 ? -3.835  12.117  36.292  1.00 103.67 ? 223 ASP D CG  1 
ATOM   10134 O OD1 . ASP D 2 223 ? -3.329  12.254  37.424  1.00 106.04 ? 223 ASP D OD1 1 
ATOM   10135 O OD2 . ASP D 2 223 ? -3.929  13.067  35.482  1.00 91.31  ? 223 ASP D OD2 1 
ATOM   10136 N N   . SER D 2 224 ? -6.725  10.137  38.080  1.00 66.17  ? 224 SER D N   1 
ATOM   10137 C CA  . SER D 2 224 ? -7.616  10.485  39.180  1.00 77.73  ? 224 SER D CA  1 
ATOM   10138 C C   . SER D 2 224 ? -7.293  9.668   40.424  1.00 68.01  ? 224 SER D C   1 
ATOM   10139 O O   . SER D 2 224 ? -7.157  10.202  41.535  1.00 66.26  ? 224 SER D O   1 
ATOM   10140 C CB  . SER D 2 224 ? -9.075  10.266  38.764  1.00 73.19  ? 224 SER D CB  1 
ATOM   10141 O OG  . SER D 2 224 ? -9.980  10.929  39.628  1.00 87.14  ? 224 SER D OG  1 
ATOM   10142 N N   . PHE D 2 225 ? -7.118  8.369   40.212  1.00 58.72  ? 225 PHE D N   1 
ATOM   10143 C CA  . PHE D 2 225 ? -6.742  7.460   41.287  1.00 56.33  ? 225 PHE D CA  1 
ATOM   10144 C C   . PHE D 2 225 ? -5.413  7.875   41.904  1.00 63.00  ? 225 PHE D C   1 
ATOM   10145 O O   . PHE D 2 225 ? -5.276  7.945   43.127  1.00 61.26  ? 225 PHE D O   1 
ATOM   10146 C CB  . PHE D 2 225 ? -6.680  6.018   40.774  1.00 59.03  ? 225 PHE D CB  1 
ATOM   10147 C CG  . PHE D 2 225 ? -6.365  5.014   41.839  1.00 62.27  ? 225 PHE D CG  1 
ATOM   10148 C CD1 . PHE D 2 225 ? -5.057  4.684   42.138  1.00 68.33  ? 225 PHE D CD1 1 
ATOM   10149 C CD2 . PHE D 2 225 ? -7.385  4.409   42.553  1.00 58.30  ? 225 PHE D CD2 1 
ATOM   10150 C CE1 . PHE D 2 225 ? -4.771  3.763   43.125  1.00 62.21  ? 225 PHE D CE1 1 
ATOM   10151 C CE2 . PHE D 2 225 ? -7.105  3.485   43.539  1.00 60.90  ? 225 PHE D CE2 1 
ATOM   10152 C CZ  . PHE D 2 225 ? -5.797  3.164   43.827  1.00 62.55  ? 225 PHE D CZ  1 
ATOM   10153 N N   . LEU D 2 226 ? -4.439  8.153   41.044  1.00 62.81  ? 226 LEU D N   1 
ATOM   10154 C CA  . LEU D 2 226 ? -3.121  8.591   41.490  1.00 58.29  ? 226 LEU D CA  1 
ATOM   10155 C C   . LEU D 2 226 ? -3.193  9.896   42.275  1.00 64.39  ? 226 LEU D C   1 
ATOM   10156 O O   . LEU D 2 226 ? -2.424  10.103  43.214  1.00 65.24  ? 226 LEU D O   1 
ATOM   10157 C CB  . LEU D 2 226 ? -2.180  8.756   40.298  1.00 56.05  ? 226 LEU D CB  1 
ATOM   10158 C CG  . LEU D 2 226 ? -1.758  7.461   39.608  1.00 69.67  ? 226 LEU D CG  1 
ATOM   10159 C CD1 . LEU D 2 226 ? -0.743  7.760   38.521  1.00 74.91  ? 226 LEU D CD1 1 
ATOM   10160 C CD2 . LEU D 2 226 ? -1.210  6.461   40.616  1.00 52.90  ? 226 LEU D CD2 1 
ATOM   10161 N N   . SER D 2 227 ? -4.112  10.776  41.892  1.00 64.32  ? 227 SER D N   1 
ATOM   10162 C CA  . SER D 2 227 ? -4.296  12.022  42.629  1.00 61.03  ? 227 SER D CA  1 
ATOM   10163 C C   . SER D 2 227 ? -4.840  11.726  44.026  1.00 70.20  ? 227 SER D C   1 
ATOM   10164 O O   . SER D 2 227 ? -4.418  12.342  45.017  1.00 68.24  ? 227 SER D O   1 
ATOM   10165 C CB  . SER D 2 227 ? -5.229  12.970  41.874  1.00 60.73  ? 227 SER D CB  1 
ATOM   10166 O OG  . SER D 2 227 ? -4.633  13.412  40.667  1.00 94.79  ? 227 SER D OG  1 
ATOM   10167 N N   . SER D 2 228 ? -5.756  10.762  44.106  1.00 59.57  ? 228 SER D N   1 
ATOM   10168 C CA  . SER D 2 228 ? -6.286  10.342  45.402  1.00 67.80  ? 228 SER D CA  1 
ATOM   10169 C C   . SER D 2 228 ? -5.174  9.790   46.296  1.00 74.01  ? 228 SER D C   1 
ATOM   10170 O O   . SER D 2 228 ? -5.065  10.157  47.472  1.00 71.08  ? 228 SER D O   1 
ATOM   10171 C CB  . SER D 2 228 ? -7.383  9.292   45.224  1.00 65.33  ? 228 SER D CB  1 
ATOM   10172 O OG  . SER D 2 228 ? -6.840  8.044   44.826  1.00 72.76  ? 228 SER D OG  1 
ATOM   10173 N N   . VAL D 2 229 ? -4.351  8.911   45.727  1.00 70.67  ? 229 VAL D N   1 
ATOM   10174 C CA  . VAL D 2 229 ? -3.215  8.336   46.441  1.00 68.95  ? 229 VAL D CA  1 
ATOM   10175 C C   . VAL D 2 229 ? -2.262  9.426   46.929  1.00 63.06  ? 229 VAL D C   1 
ATOM   10176 O O   . VAL D 2 229 ? -1.787  9.390   48.068  1.00 70.19  ? 229 VAL D O   1 
ATOM   10177 C CB  . VAL D 2 229 ? -2.434  7.342   45.548  1.00 54.87  ? 229 VAL D CB  1 
ATOM   10178 C CG1 . VAL D 2 229 ? -1.140  6.911   46.221  1.00 70.34  ? 229 VAL D CG1 1 
ATOM   10179 C CG2 . VAL D 2 229 ? -3.294  6.136   45.218  1.00 51.53  ? 229 VAL D CG2 1 
ATOM   10180 N N   . ALA D 2 230 ? -2.007  10.403  46.062  1.00 56.12  ? 230 ALA D N   1 
ATOM   10181 C CA  . ALA D 2 230 ? -1.131  11.522  46.389  1.00 61.50  ? 230 ALA D CA  1 
ATOM   10182 C C   . ALA D 2 230 ? -1.653  12.330  47.571  1.00 63.59  ? 230 ALA D C   1 
ATOM   10183 O O   . ALA D 2 230 ? -0.890  12.703  48.465  1.00 68.89  ? 230 ALA D O   1 
ATOM   10184 C CB  . ALA D 2 230 ? -0.959  12.422  45.175  1.00 51.53  ? 230 ALA D CB  1 
ATOM   10185 N N   . ASP D 2 231 ? -2.958  12.587  47.582  1.00 68.97  ? 231 ASP D N   1 
ATOM   10186 C CA  . ASP D 2 231 ? -3.554  13.357  48.670  1.00 70.56  ? 231 ASP D CA  1 
ATOM   10187 C C   . ASP D 2 231 ? -3.596  12.552  49.971  1.00 67.36  ? 231 ASP D C   1 
ATOM   10188 O O   . ASP D 2 231 ? -3.535  13.125  51.063  1.00 74.49  ? 231 ASP D O   1 
ATOM   10189 C CB  . ASP D 2 231 ? -4.951  13.840  48.288  1.00 62.15  ? 231 ASP D CB  1 
ATOM   10190 C CG  . ASP D 2 231 ? -4.943  15.256  47.742  1.00 96.25  ? 231 ASP D CG  1 
ATOM   10191 O OD1 . ASP D 2 231 ? -4.364  16.143  48.402  1.00 98.17  ? 231 ASP D OD1 1 
ATOM   10192 O OD2 . ASP D 2 231 ? -5.502  15.478  46.648  1.00 114.46 ? 231 ASP D OD2 1 
ATOM   10193 N N   . MET D 2 232 ? -3.726  11.232  49.852  1.00 60.14  ? 232 MET D N   1 
ATOM   10194 C CA  . MET D 2 232 ? -3.603  10.348  51.009  1.00 59.30  ? 232 MET D CA  1 
ATOM   10195 C C   . MET D 2 232 ? -2.203  10.498  51.604  1.00 62.39  ? 232 MET D C   1 
ATOM   10196 O O   . MET D 2 232 ? -2.030  10.638  52.825  1.00 62.75  ? 232 MET D O   1 
ATOM   10197 C CB  . MET D 2 232 ? -3.871  8.895   50.614  1.00 59.83  ? 232 MET D CB  1 
ATOM   10198 C CG  . MET D 2 232 ? -3.292  7.865   51.573  1.00 68.03  ? 232 MET D CG  1 
ATOM   10199 S SD  . MET D 2 232 ? -3.704  6.170   51.110  1.00 89.39  ? 232 MET D SD  1 
ATOM   10200 C CE  . MET D 2 232 ? -2.844  5.244   52.380  1.00 86.17  ? 232 MET D CE  1 
ATOM   10201 N N   . VAL D 2 233 ? -1.209  10.475  50.718  1.00 59.83  ? 233 VAL D N   1 
ATOM   10202 C CA  . VAL D 2 233 ? 0.186   10.694  51.087  1.00 55.09  ? 233 VAL D CA  1 
ATOM   10203 C C   . VAL D 2 233 ? 0.323   12.041  51.793  1.00 61.41  ? 233 VAL D C   1 
ATOM   10204 O O   . VAL D 2 233 ? 1.102   12.186  52.739  1.00 78.98  ? 233 VAL D O   1 
ATOM   10205 C CB  . VAL D 2 233 ? 1.122   10.644  49.858  1.00 59.70  ? 233 VAL D CB  1 
ATOM   10206 C CG1 . VAL D 2 233 ? 2.510   11.154  50.212  1.00 40.51  ? 233 VAL D CG1 1 
ATOM   10207 C CG2 . VAL D 2 233 ? 1.205   9.228   49.306  1.00 51.70  ? 233 VAL D CG2 1 
ATOM   10208 N N   . GLN D 2 234 ? -0.455  13.023  51.343  1.00 59.21  ? 234 GLN D N   1 
ATOM   10209 C CA  . GLN D 2 234 ? -0.356  14.367  51.898  1.00 70.54  ? 234 GLN D CA  1 
ATOM   10210 C C   . GLN D 2 234 ? -1.038  14.494  53.263  1.00 72.21  ? 234 GLN D C   1 
ATOM   10211 O O   . GLN D 2 234 ? -0.614  15.291  54.096  1.00 73.21  ? 234 GLN D O   1 
ATOM   10212 C CB  . GLN D 2 234 ? -0.968  15.378  50.920  1.00 60.20  ? 234 GLN D CB  1 
ATOM   10213 C CG  . GLN D 2 234 ? -1.084  16.806  51.452  1.00 72.16  ? 234 GLN D CG  1 
ATOM   10214 C CD  . GLN D 2 234 ? 0.257   17.494  51.619  1.00 78.62  ? 234 GLN D CD  1 
ATOM   10215 O OE1 . GLN D 2 234 ? 1.235   17.144  50.958  1.00 81.00  ? 234 GLN D OE1 1 
ATOM   10216 N NE2 . GLN D 2 234 ? 0.308   18.483  52.504  1.00 83.26  ? 234 GLN D NE2 1 
ATOM   10217 N N   . SER D 2 235 ? -2.069  13.691  53.509  1.00 63.27  ? 235 SER D N   1 
ATOM   10218 C CA  . SER D 2 235 ? -2.621  13.555  54.857  1.00 65.90  ? 235 SER D CA  1 
ATOM   10219 C C   . SER D 2 235 ? -1.613  12.919  55.813  1.00 74.93  ? 235 SER D C   1 
ATOM   10220 O O   . SER D 2 235 ? -1.329  13.447  56.904  1.00 80.68  ? 235 SER D O   1 
ATOM   10221 C CB  . SER D 2 235 ? -3.911  12.735  54.828  1.00 65.95  ? 235 SER D CB  1 
ATOM   10222 O OG  . SER D 2 235 ? -3.643  11.392  54.470  1.00 81.12  ? 235 SER D OG  1 
ATOM   10223 N N   . ILE D 2 236 ? -1.074  11.776  55.393  1.00 65.70  ? 236 ILE D N   1 
ATOM   10224 C CA  . ILE D 2 236 ? -0.059  11.074  56.176  1.00 69.33  ? 236 ILE D CA  1 
ATOM   10225 C C   . ILE D 2 236 ? 1.072   12.026  56.532  1.00 61.35  ? 236 ILE D C   1 
ATOM   10226 O O   . ILE D 2 236 ? 1.579   12.046  57.666  1.00 63.84  ? 236 ILE D O   1 
ATOM   10227 C CB  . ILE D 2 236 ? 0.514   9.868   55.407  1.00 58.47  ? 236 ILE D CB  1 
ATOM   10228 C CG1 . ILE D 2 236 ? -0.581  8.837   55.127  1.00 51.33  ? 236 ILE D CG1 1 
ATOM   10229 C CG2 . ILE D 2 236 ? 1.648   9.228   56.181  1.00 42.45  ? 236 ILE D CG2 1 
ATOM   10230 C CD1 . ILE D 2 236 ? -0.127  7.697   54.241  1.00 60.11  ? 236 ILE D CD1 1 
ATOM   10231 N N   . GLN D 2 237 ? 1.430   12.841  55.548  1.00 67.74  ? 237 GLN D N   1 
ATOM   10232 C CA  . GLN D 2 237 ? 2.453   13.857  55.726  1.00 67.98  ? 237 GLN D CA  1 
ATOM   10233 C C   . GLN D 2 237 ? 2.043   14.908  56.770  1.00 61.49  ? 237 GLN D C   1 
ATOM   10234 O O   . GLN D 2 237 ? 2.780   15.106  57.747  1.00 76.98  ? 237 GLN D O   1 
ATOM   10235 C CB  . GLN D 2 237 ? 2.779   14.522  54.382  1.00 66.60  ? 237 GLN D CB  1 
ATOM   10236 C CG  . GLN D 2 237 ? 4.128   15.246  54.321  1.00 78.78  ? 237 GLN D CG  1 
ATOM   10237 C CD  . GLN D 2 237 ? 5.321   14.331  54.157  1.00 80.20  ? 237 GLN D CD  1 
ATOM   10238 O OE1 . GLN D 2 237 ? 5.405   13.563  53.200  1.00 77.33  ? 237 GLN D OE1 1 
ATOM   10239 N NE2 . GLN D 2 237 ? 6.266   14.426  55.085  1.00 70.10  ? 237 GLN D NE2 1 
ATOM   10240 N N   . VAL D 2 238 ? 0.868   15.534  56.608  1.00 60.82  ? 238 VAL D N   1 
ATOM   10241 C CA  . VAL D 2 238 ? 0.477   16.606  57.530  1.00 73.32  ? 238 VAL D CA  1 
ATOM   10242 C C   . VAL D 2 238 ? 0.391   16.124  58.982  1.00 79.50  ? 238 VAL D C   1 
ATOM   10243 O O   . VAL D 2 238 ? 0.812   16.846  59.903  1.00 71.86  ? 238 VAL D O   1 
ATOM   10244 C CB  . VAL D 2 238 ? -0.849  17.306  57.103  1.00 67.60  ? 238 VAL D CB  1 
ATOM   10245 C CG1 . VAL D 2 238 ? -0.730  17.875  55.690  1.00 79.38  ? 238 VAL D CG1 1 
ATOM   10246 C CG2 . VAL D 2 238 ? -2.051  16.384  57.232  1.00 66.62  ? 238 VAL D CG2 1 
ATOM   10247 N N   . GLU D 2 239 ? -0.065  14.895  59.206  1.00 71.80  ? 239 GLU D N   1 
ATOM   10248 C CA  . GLU D 2 239 ? -0.064  14.422  60.585  1.00 75.87  ? 239 GLU D CA  1 
ATOM   10249 C C   . GLU D 2 239 ? 1.356   14.031  61.022  1.00 77.53  ? 239 GLU D C   1 
ATOM   10250 O O   . GLU D 2 239 ? 1.682   14.080  62.217  1.00 88.08  ? 239 GLU D O   1 
ATOM   10251 C CB  . GLU D 2 239 ? -1.044  13.266  60.782  1.00 77.69  ? 239 GLU D CB  1 
ATOM   10252 C CG  . GLU D 2 239 ? -2.397  13.783  61.253  1.00 91.58  ? 239 GLU D CG  1 
ATOM   10253 C CD  . GLU D 2 239 ? -3.222  12.746  61.978  1.00 116.36 ? 239 GLU D CD  1 
ATOM   10254 O OE1 . GLU D 2 239 ? -2.803  11.572  62.011  1.00 114.02 ? 239 GLU D OE1 1 
ATOM   10255 O OE2 . GLU D 2 239 ? -4.285  13.111  62.528  1.00 122.17 ? 239 GLU D OE2 1 
ATOM   10256 N N   . LEU D 2 240 ? 2.202   13.654  60.063  1.00 73.60  ? 240 LEU D N   1 
ATOM   10257 C CA  . LEU D 2 240 ? 3.599   13.384  60.387  1.00 64.13  ? 240 LEU D CA  1 
ATOM   10258 C C   . LEU D 2 240 ? 4.291   14.637  60.933  1.00 77.96  ? 240 LEU D C   1 
ATOM   10259 O O   . LEU D 2 240 ? 4.867   14.584  62.014  1.00 89.31  ? 240 LEU D O   1 
ATOM   10260 C CB  . LEU D 2 240 ? 4.351   12.843  59.160  1.00 61.56  ? 240 LEU D CB  1 
ATOM   10261 C CG  . LEU D 2 240 ? 5.862   12.536  59.205  1.00 59.84  ? 240 LEU D CG  1 
ATOM   10262 C CD1 . LEU D 2 240 ? 6.254   11.556  58.103  1.00 78.47  ? 240 LEU D CD1 1 
ATOM   10263 C CD2 . LEU D 2 240 ? 6.775   13.768  59.125  1.00 61.36  ? 240 LEU D CD2 1 
ATOM   10264 N N   . GLU D 2 241 ? 4.244   15.770  60.235  1.00 74.81  ? 241 GLU D N   1 
ATOM   10265 C CA  . GLU D 2 241 ? 4.958   16.918  60.808  1.00 81.07  ? 241 GLU D CA  1 
ATOM   10266 C C   . GLU D 2 241 ? 4.203   17.463  62.038  1.00 85.19  ? 241 GLU D C   1 
ATOM   10267 O O   . GLU D 2 241 ? 4.831   17.973  62.972  1.00 91.41  ? 241 GLU D O   1 
ATOM   10268 C CB  . GLU D 2 241 ? 5.198   18.051  59.806  1.00 87.67  ? 241 GLU D CB  1 
ATOM   10269 C CG  . GLU D 2 241 ? 5.359   17.664  58.366  1.00 89.84  ? 241 GLU D CG  1 
ATOM   10270 C CD  . GLU D 2 241 ? 4.025   17.627  57.693  1.00 104.04 ? 241 GLU D CD  1 
ATOM   10271 O OE1 . GLU D 2 241 ? 3.025   17.883  58.398  1.00 113.03 ? 241 GLU D OE1 1 
ATOM   10272 O OE2 . GLU D 2 241 ? 3.973   17.393  56.469  1.00 102.44 ? 241 GLU D OE2 1 
ATOM   10273 N N   . ALA D 2 242 ? 2.873   17.348  62.068  1.00 77.24  ? 242 ALA D N   1 
ATOM   10274 C CA  . ALA D 2 242 ? 2.163   17.866  63.245  1.00 81.14  ? 242 ALA D CA  1 
ATOM   10275 C C   . ALA D 2 242 ? 2.606   17.121  64.506  1.00 92.83  ? 242 ALA D C   1 
ATOM   10276 O O   . ALA D 2 242 ? 3.020   17.737  65.503  1.00 94.41  ? 242 ALA D O   1 
ATOM   10277 C CB  . ALA D 2 242 ? 0.650   17.766  63.064  1.00 57.65  ? 242 ALA D CB  1 
ATOM   10278 N N   . GLU D 2 243 ? 2.566   15.795  64.440  1.00 86.10  ? 243 GLU D N   1 
ATOM   10279 C CA  . GLU D 2 243 ? 2.949   14.970  65.578  1.00 77.06  ? 243 GLU D CA  1 
ATOM   10280 C C   . GLU D 2 243 ? 4.447   15.106  65.835  1.00 80.67  ? 243 GLU D C   1 
ATOM   10281 O O   . GLU D 2 243 ? 4.918   14.965  66.969  1.00 94.00  ? 243 GLU D O   1 
ATOM   10282 C CB  . GLU D 2 243 ? 2.576   13.509  65.325  1.00 71.24  ? 243 GLU D CB  1 
ATOM   10283 C CG  . GLU D 2 243 ? 1.078   13.282  65.196  1.00 89.62  ? 243 GLU D CG  1 
ATOM   10284 C CD  . GLU D 2 243 ? 0.313   13.724  66.424  1.00 115.06 ? 243 GLU D CD  1 
ATOM   10285 O OE1 . GLU D 2 243 ? 0.801   13.479  67.547  1.00 119.86 ? 243 GLU D OE1 1 
ATOM   10286 O OE2 . GLU D 2 243 ? -0.770  14.327  66.266  1.00 123.20 ? 243 GLU D OE2 1 
ATOM   10287 N N   . ALA D 2 244 ? 5.187   15.413  64.774  1.00 85.35  ? 244 ALA D N   1 
ATOM   10288 C CA  . ALA D 2 244 ? 6.622   15.637  64.878  1.00 73.92  ? 244 ALA D CA  1 
ATOM   10289 C C   . ALA D 2 244 ? 6.928   16.862  65.730  1.00 78.02  ? 244 ALA D C   1 
ATOM   10290 O O   . ALA D 2 244 ? 7.829   16.827  66.569  1.00 83.83  ? 244 ALA D O   1 
ATOM   10291 C CB  . ALA D 2 244 ? 7.248   15.787  63.499  1.00 79.85  ? 244 ALA D CB  1 
ATOM   10292 N N   . GLU D 2 245 ? 6.181   17.942  65.530  1.00 88.13  ? 245 GLU D N   1 
ATOM   10293 C CA  . GLU D 2 245 ? 6.480   19.165  66.257  1.00 96.97  ? 245 GLU D CA  1 
ATOM   10294 C C   . GLU D 2 245 ? 5.867   19.140  67.661  1.00 95.49  ? 245 GLU D C   1 
ATOM   10295 O O   . GLU D 2 245 ? 6.428   19.727  68.605  1.00 94.26  ? 245 GLU D O   1 
ATOM   10296 C CB  . GLU D 2 245 ? 5.970   20.376  65.460  1.00 101.23 ? 245 GLU D CB  1 
ATOM   10297 C CG  . GLU D 2 245 ? 5.724   21.636  66.274  1.00 98.98  ? 245 GLU D CG  1 
ATOM   10298 C CD  . GLU D 2 245 ? 7.015   22.355  66.633  1.00 101.49 ? 245 GLU D CD  1 
ATOM   10299 O OE1 . GLU D 2 245 ? 8.091   21.945  66.144  1.00 106.16 ? 245 GLU D OE1 1 
ATOM   10300 O OE2 . GLU D 2 245 ? 6.955   23.331  67.409  1.00 87.69  ? 245 GLU D OE2 1 
ATOM   10301 N N   . LYS D 2 246 ? 4.779   18.388  67.831  1.00 85.14  ? 246 LYS D N   1 
ATOM   10302 C CA  . LYS D 2 246 ? 4.273   18.140  69.184  1.00 79.85  ? 246 LYS D CA  1 
ATOM   10303 C C   . LYS D 2 246 ? 5.262   17.341  70.033  1.00 86.97  ? 246 LYS D C   1 
ATOM   10304 O O   . LYS D 2 246 ? 5.538   17.688  71.189  1.00 87.76  ? 246 LYS D O   1 
ATOM   10305 C CB  . LYS D 2 246 ? 2.927   17.413  69.146  1.00 70.49  ? 246 LYS D CB  1 
ATOM   10306 C CG  . LYS D 2 246 ? 2.273   17.293  70.521  1.00 89.41  ? 246 LYS D CG  1 
ATOM   10307 C CD  . LYS D 2 246 ? 1.158   16.255  70.557  1.00 88.39  ? 246 LYS D CD  1 
ATOM   10308 C CE  . LYS D 2 246 ? 0.452   16.122  69.219  1.00 97.93  ? 246 LYS D CE  1 
ATOM   10309 N NZ  . LYS D 2 246 ? -0.760  15.263  69.330  1.00 92.30  ? 246 LYS D NZ  1 
ATOM   10310 N N   . MET D 2 247 ? 5.807   16.276  69.453  1.00 86.65  ? 247 MET D N   1 
ATOM   10311 C CA  . MET D 2 247 ? 6.780   15.458  70.166  1.00 78.84  ? 247 MET D CA  1 
ATOM   10312 C C   . MET D 2 247 ? 8.108   16.195  70.306  1.00 83.43  ? 247 MET D C   1 
ATOM   10313 O O   . MET D 2 247 ? 8.905   15.886  71.188  1.00 85.14  ? 247 MET D O   1 
ATOM   10314 C CB  . MET D 2 247 ? 6.971   14.110  69.474  1.00 71.14  ? 247 MET D CB  1 
ATOM   10315 C CG  . MET D 2 247 ? 8.080   14.051  68.445  1.00 91.11  ? 247 MET D CG  1 
ATOM   10316 S SD  . MET D 2 247 ? 8.242   12.360  67.850  1.00 98.26  ? 247 MET D SD  1 
ATOM   10317 C CE  . MET D 2 247 ? 7.931   11.467  69.372  1.00 53.91  ? 247 MET D CE  1 
ATOM   10318 N N   . ARG D 2 248 ? 8.349   17.154  69.417  1.00 80.08  ? 248 ARG D N   1 
ATOM   10319 C CA  . ARG D 2 248 ? 9.532   18.007  69.514  1.00 76.56  ? 248 ARG D CA  1 
ATOM   10320 C C   . ARG D 2 248 ? 9.460   18.900  70.755  1.00 86.48  ? 248 ARG D C   1 
ATOM   10321 O O   . ARG D 2 248 ? 10.405  18.952  71.572  1.00 81.93  ? 248 ARG D O   1 
ATOM   10322 C CB  . ARG D 2 248 ? 9.686   18.860  68.255  1.00 72.70  ? 248 ARG D CB  1 
ATOM   10323 N N   . VAL D 2 249 ? 8.320   19.566  70.936  1.00 87.98  ? 249 VAL D N   1 
ATOM   10324 C CA  . VAL D 2 249 ? 8.217   20.479  72.072  1.00 91.18  ? 249 VAL D CA  1 
ATOM   10325 C C   . VAL D 2 249 ? 8.008   19.733  73.392  1.00 82.17  ? 249 VAL D C   1 
ATOM   10326 O O   . VAL D 2 249 ? 8.465   20.182  74.460  1.00 87.81  ? 249 VAL D O   1 
ATOM   10327 C CB  . VAL D 2 249 ? 7.056   21.485  71.866  1.00 88.06  ? 249 VAL D CB  1 
ATOM   10328 C CG1 . VAL D 2 249 ? 5.713   20.761  71.769  1.00 63.82  ? 249 VAL D CG1 1 
ATOM   10329 C CG2 . VAL D 2 249 ? 7.029   22.501  72.986  1.00 91.13  ? 249 VAL D CG2 1 
ATOM   10330 N N   . SER D 2 250 ? 7.398   18.555  73.313  1.00 76.71  ? 250 SER D N   1 
ATOM   10331 C CA  . SER D 2 250 ? 7.378   17.654  74.455  1.00 82.18  ? 250 SER D CA  1 
ATOM   10332 C C   . SER D 2 250 ? 8.791   17.204  74.814  1.00 86.68  ? 250 SER D C   1 
ATOM   10333 O O   . SER D 2 250 ? 9.149   17.122  75.992  1.00 95.84  ? 250 SER D O   1 
ATOM   10334 C CB  . SER D 2 250 ? 6.485   16.444  74.180  1.00 83.47  ? 250 SER D CB  1 
ATOM   10335 O OG  . SER D 2 250 ? 6.350   15.643  75.342  1.00 93.50  ? 250 SER D OG  1 
ATOM   10336 N N   . GLN D 2 251 ? 9.593   16.916  73.790  1.00 86.64  ? 251 GLN D N   1 
ATOM   10337 C CA  . GLN D 2 251 ? 10.981  16.523  74.005  1.00 82.78  ? 251 GLN D CA  1 
ATOM   10338 C C   . GLN D 2 251 ? 11.782  17.585  74.732  1.00 86.91  ? 251 GLN D C   1 
ATOM   10339 O O   . GLN D 2 251 ? 12.489  17.268  75.682  1.00 89.15  ? 251 GLN D O   1 
ATOM   10340 C CB  . GLN D 2 251 ? 11.686  16.183  72.691  1.00 85.93  ? 251 GLN D CB  1 
ATOM   10341 C CG  . GLN D 2 251 ? 13.195  16.047  72.874  1.00 87.07  ? 251 GLN D CG  1 
ATOM   10342 C CD  . GLN D 2 251 ? 13.880  15.342  71.728  1.00 93.17  ? 251 GLN D CD  1 
ATOM   10343 O OE1 . GLN D 2 251 ? 13.453  14.273  71.298  1.00 86.72  ? 251 GLN D OE1 1 
ATOM   10344 N NE2 . GLN D 2 251 ? 14.957  15.936  71.227  1.00 99.72  ? 251 GLN D NE2 1 
ATOM   10345 N N   . GLN D 2 252 ? 11.685  18.843  74.310  1.00 93.81  ? 252 GLN D N   1 
ATOM   10346 C CA  . GLN D 2 252 ? 12.538  19.843  74.956  1.00 90.70  ? 252 GLN D CA  1 
ATOM   10347 C C   . GLN D 2 252 ? 11.873  20.326  76.244  1.00 92.14  ? 252 GLN D C   1 
ATOM   10348 O O   . GLN D 2 252 ? 12.470  21.073  77.029  1.00 109.53 ? 252 GLN D O   1 
ATOM   10349 C CB  . GLN D 2 252 ? 12.850  21.019  74.027  1.00 88.81  ? 252 GLN D CB  1 
ATOM   10350 C CG  . GLN D 2 252 ? 12.091  22.301  74.321  1.00 88.89  ? 252 GLN D CG  1 
ATOM   10351 C CD  . GLN D 2 252 ? 12.689  23.497  73.607  1.00 116.44 ? 252 GLN D CD  1 
ATOM   10352 O OE1 . GLN D 2 252 ? 13.902  23.708  73.637  1.00 122.57 ? 252 GLN D OE1 1 
ATOM   10353 N NE2 . GLN D 2 252 ? 11.840  24.289  72.963  1.00 114.52 ? 252 GLN D NE2 1 
ATOM   10354 N N   . GLU D 2 253 ? 10.655  19.848  76.489  1.00 95.70  ? 253 GLU D N   1 
ATOM   10355 C CA  . GLU D 2 253 ? 10.057  20.005  77.808  1.00 93.20  ? 253 GLU D CA  1 
ATOM   10356 C C   . GLU D 2 253 ? 10.585  18.954  78.789  1.00 90.94  ? 253 GLU D C   1 
ATOM   10357 O O   . GLU D 2 253 ? 10.803  19.245  79.966  1.00 98.97  ? 253 GLU D O   1 
ATOM   10358 C CB  . GLU D 2 253 ? 8.534   19.909  77.711  1.00 95.74  ? 253 GLU D CB  1 
ATOM   10359 C CG  . GLU D 2 253 ? 7.814   19.871  79.054  1.00 102.23 ? 253 GLU D CG  1 
ATOM   10360 C CD  . GLU D 2 253 ? 6.304   19.851  78.906  1.00 120.66 ? 253 GLU D CD  1 
ATOM   10361 O OE1 . GLU D 2 253 ? 5.791   19.019  78.128  1.00 117.32 ? 253 GLU D OE1 1 
ATOM   10362 O OE2 . GLU D 2 253 ? 5.628   20.657  79.578  1.00 119.09 ? 253 GLU D OE2 1 
ATOM   10363 N N   . LEU D 2 254 ? 10.814  17.740  78.299  1.00 87.60  ? 254 LEU D N   1 
ATOM   10364 C CA  . LEU D 2 254 ? 11.277  16.651  79.159  1.00 71.57  ? 254 LEU D CA  1 
ATOM   10365 C C   . LEU D 2 254 ? 12.790  16.661  79.368  1.00 78.91  ? 254 LEU D C   1 
ATOM   10366 O O   . LEU D 2 254 ? 13.283  16.271  80.425  1.00 72.98  ? 254 LEU D O   1 
ATOM   10367 C CB  . LEU D 2 254 ? 10.853  15.303  78.572  1.00 74.59  ? 254 LEU D CB  1 
ATOM   10368 C CG  . LEU D 2 254 ? 9.361   14.972  78.633  1.00 84.16  ? 254 LEU D CG  1 
ATOM   10369 C CD1 . LEU D 2 254 ? 9.001   14.012  77.520  1.00 90.53  ? 254 LEU D CD1 1 
ATOM   10370 C CD2 . LEU D 2 254 ? 9.000   14.380  79.986  1.00 73.42  ? 254 LEU D CD2 1 
ATOM   10371 N N   . LEU D 2 255 ? 13.517  17.121  78.355  1.00 93.11  ? 255 LEU D N   1 
ATOM   10372 C CA  . LEU D 2 255 ? 14.975  17.139  78.382  1.00 84.48  ? 255 LEU D CA  1 
ATOM   10373 C C   . LEU D 2 255 ? 15.520  18.348  79.127  1.00 88.71  ? 255 LEU D C   1 
ATOM   10374 O O   . LEU D 2 255 ? 16.710  18.407  79.439  1.00 72.74  ? 255 LEU D O   1 
ATOM   10375 C CB  . LEU D 2 255 ? 15.543  17.107  76.961  1.00 79.35  ? 255 LEU D CB  1 
ATOM   10376 C CG  . LEU D 2 255 ? 15.438  15.769  76.227  1.00 89.10  ? 255 LEU D CG  1 
ATOM   10377 C CD1 . LEU D 2 255 ? 16.260  15.791  74.945  1.00 82.48  ? 255 LEU D CD1 1 
ATOM   10378 C CD2 . LEU D 2 255 ? 15.871  14.624  77.132  1.00 65.28  ? 255 LEU D CD2 1 
ATOM   10379 N N   . SER D 2 256 ? 14.653  19.313  79.411  1.00 91.03  ? 256 SER D N   1 
ATOM   10380 C CA  . SER D 2 256 ? 15.071  20.468  80.185  1.00 97.99  ? 256 SER D CA  1 
ATOM   10381 C C   . SER D 2 256 ? 14.609  20.281  81.617  1.00 104.10 ? 256 SER D C   1 
ATOM   10382 O O   . SER D 2 256 ? 13.428  20.442  81.934  1.00 112.54 ? 256 SER D O   1 
ATOM   10383 C CB  . SER D 2 256 ? 14.504  21.763  79.599  1.00 93.60  ? 256 SER D CB  1 
ATOM   10384 O OG  . SER D 2 256 ? 14.781  22.869  80.439  1.00 99.45  ? 256 SER D OG  1 
ATOM   10385 N N   . VAL D 2 257 ? 15.563  19.960  82.482  1.00 100.15 ? 257 VAL D N   1 
ATOM   10386 C CA  . VAL D 2 257 ? 15.290  19.696  83.886  1.00 96.66  ? 257 VAL D CA  1 
ATOM   10387 C C   . VAL D 2 257 ? 16.438  20.187  84.737  1.00 100.42 ? 257 VAL D C   1 
ATOM   10388 O O   . VAL D 2 257 ? 17.449  20.675  84.227  1.00 88.83  ? 257 VAL D O   1 
ATOM   10389 C CB  . VAL D 2 257 ? 15.059  18.194  84.171  1.00 86.44  ? 257 VAL D CB  1 
ATOM   10390 C CG1 . VAL D 2 257 ? 13.722  17.729  83.607  1.00 81.07  ? 257 VAL D CG1 1 
ATOM   10391 C CG2 . VAL D 2 257 ? 16.208  17.368  83.630  1.00 72.44  ? 257 VAL D CG2 1 
ATOM   10392 N N   . ASP D 2 258 ? 16.273  20.048  86.044  1.00 96.40  ? 258 ASP D N   1 
ATOM   10393 C CA  . ASP D 2 258 ? 17.302  20.447  86.981  1.00 97.25  ? 258 ASP D CA  1 
ATOM   10394 C C   . ASP D 2 258 ? 18.391  19.373  87.060  1.00 87.87  ? 258 ASP D C   1 
ATOM   10395 O O   . ASP D 2 258 ? 18.119  18.183  86.875  1.00 84.07  ? 258 ASP D O   1 
ATOM   10396 C CB  . ASP D 2 258 ? 16.651  20.719  88.340  1.00 90.00  ? 258 ASP D CB  1 
ATOM   10397 C CG  . ASP D 2 258 ? 17.637  20.730  89.472  1.00 96.63  ? 258 ASP D CG  1 
ATOM   10398 O OD1 . ASP D 2 258 ? 18.448  21.677  89.562  1.00 97.94  ? 258 ASP D OD1 1 
ATOM   10399 O OD2 . ASP D 2 258 ? 17.582  19.792  90.287  1.00 91.05  ? 258 ASP D OD2 1 
ATOM   10400 N N   . GLU D 2 259 ? 19.622  19.812  87.314  1.00 86.40  ? 259 GLU D N   1 
ATOM   10401 C CA  . GLU D 2 259 ? 20.784  18.929  87.321  1.00 77.29  ? 259 GLU D CA  1 
ATOM   10402 C C   . GLU D 2 259 ? 20.569  17.718  88.238  1.00 82.53  ? 259 GLU D C   1 
ATOM   10403 O O   . GLU D 2 259 ? 21.008  16.612  87.921  1.00 77.42  ? 259 GLU D O   1 
ATOM   10404 C CB  . GLU D 2 259 ? 22.056  19.712  87.679  1.00 75.25  ? 259 GLU D CB  1 
ATOM   10405 C CG  . GLU D 2 259 ? 23.333  18.938  87.370  1.00 82.46  ? 259 GLU D CG  1 
ATOM   10406 C CD  . GLU D 2 259 ? 24.610  19.643  87.791  1.00 98.66  ? 259 GLU D CD  1 
ATOM   10407 O OE1 . GLU D 2 259 ? 24.736  20.032  88.970  1.00 90.38  ? 259 GLU D OE1 1 
ATOM   10408 O OE2 . GLU D 2 259 ? 25.508  19.778  86.931  1.00 107.96 ? 259 GLU D OE2 1 
ATOM   10409 N N   . SER D 2 260 ? 19.891  17.938  89.364  1.00 71.61  ? 260 SER D N   1 
ATOM   10410 C CA  . SER D 2 260 ? 19.747  16.928  90.412  1.00 77.19  ? 260 SER D CA  1 
ATOM   10411 C C   . SER D 2 260 ? 19.024  15.672  89.924  1.00 70.55  ? 260 SER D C   1 
ATOM   10412 O O   . SER D 2 260 ? 19.207  14.592  90.487  1.00 81.63  ? 260 SER D O   1 
ATOM   10413 C CB  . SER D 2 260 ? 18.994  17.502  91.615  1.00 70.72  ? 260 SER D CB  1 
ATOM   10414 O OG  . SER D 2 260 ? 17.606  17.615  91.350  1.00 63.22  ? 260 SER D OG  1 
ATOM   10415 N N   . VAL D 2 261 ? 18.190  15.818  88.897  1.00 59.67  ? 261 VAL D N   1 
ATOM   10416 C CA  . VAL D 2 261 ? 17.433  14.689  88.364  1.00 65.75  ? 261 VAL D CA  1 
ATOM   10417 C C   . VAL D 2 261 ? 18.343  13.576  87.843  1.00 65.53  ? 261 VAL D C   1 
ATOM   10418 O O   . VAL D 2 261 ? 18.051  12.393  88.023  1.00 60.50  ? 261 VAL D O   1 
ATOM   10419 C CB  . VAL D 2 261 ? 16.491  15.135  87.222  1.00 76.10  ? 261 VAL D CB  1 
ATOM   10420 C CG1 . VAL D 2 261 ? 15.640  13.969  86.741  1.00 72.26  ? 261 VAL D CG1 1 
ATOM   10421 C CG2 . VAL D 2 261 ? 15.607  16.286  87.678  1.00 84.76  ? 261 VAL D CG2 1 
ATOM   10422 N N   . TYR D 2 262 ? 19.453  13.952  87.215  1.00 65.07  ? 262 TYR D N   1 
ATOM   10423 C CA  . TYR D 2 262 ? 20.405  12.961  86.723  1.00 59.21  ? 262 TYR D CA  1 
ATOM   10424 C C   . TYR D 2 262 ? 21.484  12.620  87.748  1.00 57.10  ? 262 TYR D C   1 
ATOM   10425 O O   . TYR D 2 262 ? 22.211  11.639  87.588  1.00 51.07  ? 262 TYR D O   1 
ATOM   10426 C CB  . TYR D 2 262 ? 21.061  13.445  85.430  1.00 57.27  ? 262 TYR D CB  1 
ATOM   10427 C CG  . TYR D 2 262 ? 20.078  13.749  84.326  1.00 62.89  ? 262 TYR D CG  1 
ATOM   10428 C CD1 . TYR D 2 262 ? 19.411  12.727  83.664  1.00 56.51  ? 262 TYR D CD1 1 
ATOM   10429 C CD2 . TYR D 2 262 ? 19.828  15.056  83.934  1.00 64.66  ? 262 TYR D CD2 1 
ATOM   10430 C CE1 . TYR D 2 262 ? 18.512  13.000  82.651  1.00 57.56  ? 262 TYR D CE1 1 
ATOM   10431 C CE2 . TYR D 2 262 ? 18.934  15.339  82.921  1.00 55.31  ? 262 TYR D CE2 1 
ATOM   10432 C CZ  . TYR D 2 262 ? 18.278  14.308  82.283  1.00 59.77  ? 262 TYR D CZ  1 
ATOM   10433 O OH  . TYR D 2 262 ? 17.385  14.585  81.274  1.00 63.17  ? 262 TYR D OH  1 
ATOM   10434 N N   . THR D 2 263 ? 21.585  13.427  88.800  1.00 60.76  ? 263 THR D N   1 
ATOM   10435 C CA  . THR D 2 263 ? 22.626  13.237  89.805  1.00 59.29  ? 263 THR D CA  1 
ATOM   10436 C C   . THR D 2 263 ? 22.148  12.343  90.941  1.00 60.15  ? 263 THR D C   1 
ATOM   10437 O O   . THR D 2 263 ? 21.173  12.666  91.620  1.00 71.46  ? 263 THR D O   1 
ATOM   10438 C CB  . THR D 2 263 ? 23.098  14.580  90.394  1.00 59.28  ? 263 THR D CB  1 
ATOM   10439 O OG1 . THR D 2 263 ? 23.440  15.479  89.333  1.00 72.91  ? 263 THR D OG1 1 
ATOM   10440 C CG2 . THR D 2 263 ? 24.311  14.372  91.287  1.00 50.77  ? 263 THR D CG2 1 
ATOM   10441 N N   . PRO D 2 264 ? 22.838  11.213  91.154  1.00 61.20  ? 264 PRO D N   1 
ATOM   10442 C CA  . PRO D 2 264 ? 22.476  10.304  92.244  1.00 55.57  ? 264 PRO D CA  1 
ATOM   10443 C C   . PRO D 2 264 ? 22.785  10.914  93.605  1.00 57.14  ? 264 PRO D C   1 
ATOM   10444 O O   . PRO D 2 264 ? 23.856  11.496  93.790  1.00 52.82  ? 264 PRO D O   1 
ATOM   10445 C CB  . PRO D 2 264 ? 23.347  9.075   91.979  1.00 52.37  ? 264 PRO D CB  1 
ATOM   10446 C CG  . PRO D 2 264 ? 24.536  9.621   91.264  1.00 53.93  ? 264 PRO D CG  1 
ATOM   10447 C CD  . PRO D 2 264 ? 24.001  10.724  90.393  1.00 53.25  ? 264 PRO D CD  1 
ATOM   10448 N N   . ASP D 2 265 ? 21.846  10.777  94.536  1.00 77.64  ? 265 ASP D N   1 
ATOM   10449 C CA  . ASP D 2 265 ? 21.957  11.344  95.878  1.00 65.11  ? 265 ASP D CA  1 
ATOM   10450 C C   . ASP D 2 265 ? 22.214  12.849  95.864  1.00 63.91  ? 265 ASP D C   1 
ATOM   10451 O O   . ASP D 2 265 ? 22.924  13.369  96.718  1.00 78.40  ? 265 ASP D O   1 
ATOM   10452 C CB  . ASP D 2 265 ? 23.067  10.645  96.664  1.00 54.01  ? 265 ASP D CB  1 
ATOM   10453 C CG  . ASP D 2 265 ? 22.653  10.311  98.080  1.00 74.10  ? 265 ASP D CG  1 
ATOM   10454 O OD1 . ASP D 2 265 ? 21.506  10.628  98.459  1.00 79.08  ? 265 ASP D OD1 1 
ATOM   10455 O OD2 . ASP D 2 265 ? 23.486  9.749   98.820  1.00 61.09  ? 265 ASP D OD2 1 
ATOM   10456 N N   . SER D 2 266 ? 21.664  13.534  94.868  1.00 71.16  ? 266 SER D N   1 
ATOM   10457 C CA  . SER D 2 266 ? 21.565  14.990  94.874  1.00 73.52  ? 266 SER D CA  1 
ATOM   10458 C C   . SER D 2 266 ? 20.930  15.457  96.177  1.00 74.21  ? 266 SER D C   1 
ATOM   10459 O O   . SER D 2 266 ? 21.480  16.271  96.920  1.00 73.71  ? 266 SER D O   1 
ATOM   10460 C CB  . SER D 2 266 ? 20.752  15.473  93.683  1.00 65.16  ? 266 SER D CB  1 
ATOM   10461 O OG  . SER D 2 266 ? 19.370  15.230  93.886  1.00 74.66  ? 266 SER D OG  1 
ATOM   10462 N N   . ASP D 2 267 ? 19.747  14.910  96.415  1.00 88.34  ? 267 ASP D N   1 
ATOM   10463 C CA  . ASP D 2 267 ? 18.917  15.160  97.585  1.00 84.91  ? 267 ASP D CA  1 
ATOM   10464 C C   . ASP D 2 267 ? 19.593  15.015  98.953  1.00 84.67  ? 267 ASP D C   1 
ATOM   10465 O O   . ASP D 2 267 ? 19.083  15.538  99.942  1.00 90.35  ? 267 ASP D O   1 
ATOM   10466 C CB  . ASP D 2 267 ? 17.740  14.198  97.525  1.00 88.90  ? 267 ASP D CB  1 
ATOM   10467 C CG  . ASP D 2 267 ? 18.162  12.818  97.042  1.00 101.76 ? 267 ASP D CG  1 
ATOM   10468 O OD1 . ASP D 2 267 ? 18.956  12.741  96.077  1.00 103.98 ? 267 ASP D OD1 1 
ATOM   10469 O OD2 . ASP D 2 267 ? 17.732  11.810  97.631  1.00 97.97  ? 267 ASP D OD2 1 
ATOM   10470 N N   . VAL D 2 268 ? 20.730  14.322  99.000  1.00 85.28  ? 268 VAL D N   1 
ATOM   10471 C CA  . VAL D 2 268 ? 21.308  13.800  100.248 1.00 84.34  ? 268 VAL D CA  1 
ATOM   10472 C C   . VAL D 2 268 ? 21.376  14.804  101.409 1.00 96.15  ? 268 VAL D C   1 
ATOM   10473 O O   . VAL D 2 268 ? 21.216  14.421  102.569 1.00 88.81  ? 268 VAL D O   1 
ATOM   10474 C CB  . VAL D 2 268 ? 22.738  13.240  100.001 1.00 80.82  ? 268 VAL D CB  1 
ATOM   10475 C CG1 . VAL D 2 268 ? 23.685  14.343  99.551  1.00 65.41  ? 268 VAL D CG1 1 
ATOM   10476 C CG2 . VAL D 2 268 ? 23.281  12.541  101.245 1.00 61.61  ? 268 VAL D CG2 1 
ATOM   10477 N N   . ALA D 2 269 ? 21.607  16.077  101.100 1.00 99.82  ? 269 ALA D N   1 
ATOM   10478 C CA  . ALA D 2 269 ? 21.697  17.108  102.131 1.00 97.32  ? 269 ALA D CA  1 
ATOM   10479 C C   . ALA D 2 269 ? 20.384  17.244  102.896 1.00 101.31 ? 269 ALA D C   1 
ATOM   10480 O O   . ALA D 2 269 ? 20.375  17.334  104.124 1.00 103.12 ? 269 ALA D O   1 
ATOM   10481 C CB  . ALA D 2 269 ? 22.090  18.440  101.513 1.00 72.18  ? 269 ALA D CB  1 
ATOM   10482 N N   . ALA D 2 270 ? 19.276  17.254  102.163 1.00 90.72  ? 270 ALA D N   1 
ATOM   10483 C CA  . ALA D 2 270 ? 17.953  17.283  102.775 1.00 94.87  ? 270 ALA D CA  1 
ATOM   10484 C C   . ALA D 2 270 ? 16.979  16.437  101.962 1.00 98.28  ? 270 ALA D C   1 
ATOM   10485 O O   . ALA D 2 270 ? 16.151  16.973  101.223 1.00 92.53  ? 270 ALA D O   1 
ATOM   10486 C CB  . ALA D 2 270 ? 17.451  18.712  102.898 1.00 101.91 ? 270 ALA D CB  1 
ATOM   10487 N N   . PRO D 2 271 ? 17.079  15.105  102.099 1.00 103.48 ? 271 PRO D N   1 
ATOM   10488 C CA  . PRO D 2 271 ? 16.293  14.141  101.321 1.00 98.78  ? 271 PRO D CA  1 
ATOM   10489 C C   . PRO D 2 271 ? 14.800  14.258  101.586 1.00 103.93 ? 271 PRO D C   1 
ATOM   10490 O O   . PRO D 2 271 ? 14.380  14.426  102.732 1.00 108.52 ? 271 PRO D O   1 
ATOM   10491 C CB  . PRO D 2 271 ? 16.825  12.784  101.793 1.00 95.41  ? 271 PRO D CB  1 
ATOM   10492 C CG  . PRO D 2 271 ? 18.163  13.076  102.378 1.00 100.94 ? 271 PRO D CG  1 
ATOM   10493 C CD  . PRO D 2 271 ? 18.035  14.431  102.991 1.00 99.66  ? 271 PRO D CD  1 
ATOM   10494 N N   . GLN D 2 272 ? 14.009  14.168  100.524 1.00 96.91  ? 272 GLN D N   1 
ATOM   10495 C CA  . GLN D 2 272 ? 12.566  14.282  100.646 1.00 104.01 ? 272 GLN D CA  1 
ATOM   10496 C C   . GLN D 2 272 ? 11.995  12.871  100.590 1.00 92.89  ? 272 GLN D C   1 
ATOM   10497 O O   . GLN D 2 272 ? 11.906  12.277  99.518  1.00 91.20  ? 272 GLN D O   1 
ATOM   10498 C CB  . GLN D 2 272 ? 12.019  15.140  99.508  1.00 111.46 ? 272 GLN D CB  1 
ATOM   10499 C CG  . GLN D 2 272 ? 13.056  16.122  98.960  1.00 113.04 ? 272 GLN D CG  1 
ATOM   10500 C CD  . GLN D 2 272 ? 12.453  17.212  98.100  1.00 132.65 ? 272 GLN D CD  1 
ATOM   10501 O OE1 . GLN D 2 272 ? 11.558  17.936  98.534  1.00 136.25 ? 272 GLN D OE1 1 
ATOM   10502 N NE2 . GLN D 2 272 ? 12.931  17.324  96.863  1.00 126.84 ? 272 GLN D NE2 1 
ATOM   10503 N N   . ILE D 2 273 ? 11.593  12.340  101.739 1.00 77.91  ? 273 ILE D N   1 
ATOM   10504 C CA  . ILE D 2 273 ? 11.287  10.917  101.825 1.00 74.95  ? 273 ILE D CA  1 
ATOM   10505 C C   . ILE D 2 273 ? 9.810   10.624  102.058 1.00 68.14  ? 273 ILE D C   1 
ATOM   10506 O O   . ILE D 2 273 ? 9.186   11.196  102.952 1.00 91.89  ? 273 ILE D O   1 
ATOM   10507 C CB  . ILE D 2 273 ? 12.117  10.247  102.939 1.00 73.86  ? 273 ILE D CB  1 
ATOM   10508 C CG1 . ILE D 2 273 ? 13.610  10.344  102.615 1.00 68.63  ? 273 ILE D CG1 1 
ATOM   10509 C CG2 . ILE D 2 273 ? 11.712  8.794   103.115 1.00 71.50  ? 273 ILE D CG2 1 
ATOM   10510 C CD1 . ILE D 2 273 ? 14.513  9.965   103.769 1.00 69.25  ? 273 ILE D CD1 1 
ATOM   10511 N N   . ASN D 2 274 ? 9.257   9.725   101.250 1.00 68.04  ? 274 ASN D N   1 
ATOM   10512 C CA  . ASN D 2 274 ? 7.900   9.249   101.469 1.00 75.76  ? 274 ASN D CA  1 
ATOM   10513 C C   . ASN D 2 274 ? 7.916   7.897   102.177 1.00 73.06  ? 274 ASN D C   1 
ATOM   10514 O O   . ASN D 2 274 ? 8.279   6.879   101.588 1.00 56.36  ? 274 ASN D O   1 
ATOM   10515 C CB  . ASN D 2 274 ? 7.146   9.149   100.142 1.00 57.77  ? 274 ASN D CB  1 
ATOM   10516 C CG  . ASN D 2 274 ? 5.685   8.779   100.324 1.00 71.46  ? 274 ASN D CG  1 
ATOM   10517 O OD1 . ASN D 2 274 ? 5.145   8.844   101.430 1.00 66.51  ? 274 ASN D OD1 1 
ATOM   10518 N ND2 . ASN D 2 274 ? 5.034   8.396   99.232  1.00 65.03  ? 274 ASN D ND2 1 
ATOM   10519 N N   . ARG D 2 275 ? 7.509   7.897   103.441 1.00 63.81  ? 275 ARG D N   1 
ATOM   10520 C CA  . ARG D 2 275 ? 7.559   6.700   104.272 1.00 64.93  ? 275 ARG D CA  1 
ATOM   10521 C C   . ARG D 2 275 ? 6.246   5.938   104.187 1.00 62.27  ? 275 ARG D C   1 
ATOM   10522 O O   . ARG D 2 275 ? 6.087   4.873   104.784 1.00 41.52  ? 275 ARG D O   1 
ATOM   10523 C CB  . ARG D 2 275 ? 7.849   7.076   105.724 1.00 65.06  ? 275 ARG D CB  1 
ATOM   10524 C CG  . ARG D 2 275 ? 9.167   7.787   105.927 1.00 75.00  ? 275 ARG D CG  1 
ATOM   10525 C CD  . ARG D 2 275 ? 9.590   7.743   107.380 1.00 93.45  ? 275 ARG D CD  1 
ATOM   10526 N NE  . ARG D 2 275 ? 10.777  6.916   107.568 1.00 106.39 ? 275 ARG D NE  1 
ATOM   10527 C CZ  . ARG D 2 275 ? 12.013  7.396   107.646 1.00 108.74 ? 275 ARG D CZ  1 
ATOM   10528 N NH1 . ARG D 2 275 ? 12.226  8.701   107.553 1.00 104.06 ? 275 ARG D NH1 1 
ATOM   10529 N NH2 . ARG D 2 275 ? 13.036  6.570   107.816 1.00 106.55 ? 275 ARG D NH2 1 
ATOM   10530 N N   . ASN D 2 276 ? 5.308   6.502   103.437 1.00 74.28  ? 276 ASN D N   1 
ATOM   10531 C CA  . ASN D 2 276 ? 3.978   5.929   103.294 1.00 66.54  ? 276 ASN D CA  1 
ATOM   10532 C C   . ASN D 2 276 ? 3.747   5.131   102.009 1.00 53.20  ? 276 ASN D C   1 
ATOM   10533 O O   . ASN D 2 276 ? 2.612   4.769   101.697 1.00 61.99  ? 276 ASN D O   1 
ATOM   10534 C CB  . ASN D 2 276 ? 2.954   7.055   103.390 1.00 53.40  ? 276 ASN D CB  1 
ATOM   10535 C CG  . ASN D 2 276 ? 3.047   7.808   104.701 1.00 57.38  ? 276 ASN D CG  1 
ATOM   10536 O OD1 . ASN D 2 276 ? 3.294   7.218   105.754 1.00 50.98  ? 276 ASN D OD1 1 
ATOM   10537 N ND2 . ASN D 2 276 ? 2.859   9.121   104.643 1.00 58.30  ? 276 ASN D ND2 1 
ATOM   10538 N N   . LEU D 2 277 ? 4.817   4.862   101.267 1.00 57.18  ? 277 LEU D N   1 
ATOM   10539 C CA  . LEU D 2 277 ? 4.713   4.104   100.022 1.00 57.15  ? 277 LEU D CA  1 
ATOM   10540 C C   . LEU D 2 277 ? 4.253   2.665   100.230 1.00 57.27  ? 277 LEU D C   1 
ATOM   10541 O O   . LEU D 2 277 ? 4.800   1.935   101.058 1.00 54.17  ? 277 LEU D O   1 
ATOM   10542 C CB  . LEU D 2 277 ? 6.056   4.094   99.290  1.00 50.74  ? 277 LEU D CB  1 
ATOM   10543 C CG  . LEU D 2 277 ? 6.554   5.406   98.687  1.00 44.73  ? 277 LEU D CG  1 
ATOM   10544 C CD1 . LEU D 2 277 ? 8.053   5.334   98.453  1.00 58.60  ? 277 LEU D CD1 1 
ATOM   10545 C CD2 . LEU D 2 277 ? 5.820   5.710   97.394  1.00 41.77  ? 277 LEU D CD2 1 
ATOM   10546 N N   . ILE D 2 278 ? 3.233   2.270   99.476  1.00 61.61  ? 278 ILE D N   1 
ATOM   10547 C CA  . ILE D 2 278 ? 2.782   0.885   99.453  1.00 64.99  ? 278 ILE D CA  1 
ATOM   10548 C C   . ILE D 2 278 ? 3.282   0.153   98.216  1.00 56.25  ? 278 ILE D C   1 
ATOM   10549 O O   . ILE D 2 278 ? 3.082   -1.053  98.069  1.00 55.81  ? 278 ILE D O   1 
ATOM   10550 C CB  . ILE D 2 278 ? 1.267   0.822   99.445  1.00 61.40  ? 278 ILE D CB  1 
ATOM   10551 C CG1 . ILE D 2 278 ? 0.761   1.759   98.349  1.00 61.93  ? 278 ILE D CG1 1 
ATOM   10552 C CG2 . ILE D 2 278 ? 0.703   1.207   100.802 1.00 56.72  ? 278 ILE D CG2 1 
ATOM   10553 C CD1 . ILE D 2 278 ? -0.698  1.886   98.294  1.00 71.43  ? 278 ILE D CD1 1 
ATOM   10554 N N   . GLN D 2 279 ? 3.923   0.895   97.321  1.00 58.62  ? 279 GLN D N   1 
ATOM   10555 C CA  . GLN D 2 279 ? 4.390   0.338   96.059  1.00 61.77  ? 279 GLN D CA  1 
ATOM   10556 C C   . GLN D 2 279 ? 5.617   1.098   95.577  1.00 55.97  ? 279 GLN D C   1 
ATOM   10557 O O   . GLN D 2 279 ? 5.682   2.322   95.698  1.00 58.12  ? 279 GLN D O   1 
ATOM   10558 C CB  . GLN D 2 279 ? 3.272   0.370   95.011  1.00 62.19  ? 279 GLN D CB  1 
ATOM   10559 C CG  . GLN D 2 279 ? 3.716   0.070   93.586  1.00 58.41  ? 279 GLN D CG  1 
ATOM   10560 C CD  . GLN D 2 279 ? 3.985   1.326   92.783  1.00 63.69  ? 279 GLN D CD  1 
ATOM   10561 O OE1 . GLN D 2 279 ? 3.252   2.309   92.885  1.00 72.94  ? 279 GLN D OE1 1 
ATOM   10562 N NE2 . GLN D 2 279 ? 5.042   1.300   91.979  1.00 64.70  ? 279 GLN D NE2 1 
ATOM   10563 N N   . LYS D 2 280 ? 6.588   0.379   95.028  1.00 44.04  ? 280 LYS D N   1 
ATOM   10564 C CA  . LYS D 2 280 ? 7.789   1.022   94.518  1.00 46.01  ? 280 LYS D CA  1 
ATOM   10565 C C   . LYS D 2 280 ? 8.405   0.235   93.371  1.00 45.72  ? 280 LYS D C   1 
ATOM   10566 O O   . LYS D 2 280 ? 8.381   -0.996  93.361  1.00 40.34  ? 280 LYS D O   1 
ATOM   10567 C CB  . LYS D 2 280 ? 8.818   1.204   95.635  1.00 44.65  ? 280 LYS D CB  1 
ATOM   10568 C CG  . LYS D 2 280 ? 9.893   2.228   95.313  1.00 56.09  ? 280 LYS D CG  1 
ATOM   10569 C CD  . LYS D 2 280 ? 10.656  2.644   96.556  1.00 56.19  ? 280 LYS D CD  1 
ATOM   10570 C CE  . LYS D 2 280 ? 11.846  3.521   96.202  1.00 57.24  ? 280 LYS D CE  1 
ATOM   10571 N NZ  . LYS D 2 280 ? 11.449  4.716   95.409  1.00 69.54  ? 280 LYS D NZ  1 
ATOM   10572 N N   . ALA D 2 281 ? 8.953   0.961   92.404  1.00 42.17  ? 281 ALA D N   1 
ATOM   10573 C CA  . ALA D 2 281 ? 9.648   0.350   91.283  1.00 44.10  ? 281 ALA D CA  1 
ATOM   10574 C C   . ALA D 2 281 ? 10.901  1.149   90.951  1.00 50.93  ? 281 ALA D C   1 
ATOM   10575 O O   . ALA D 2 281 ? 10.885  2.380   90.973  1.00 61.04  ? 281 ALA D O   1 
ATOM   10576 C CB  . ALA D 2 281 ? 8.734   0.259   90.073  1.00 48.90  ? 281 ALA D CB  1 
ATOM   10577 N N   . GLY D 2 282 ? 11.987  0.447   90.646  1.00 36.98  ? 282 GLY D N   1 
ATOM   10578 C CA  . GLY D 2 282 ? 13.223  1.105   90.265  1.00 41.75  ? 282 GLY D CA  1 
ATOM   10579 C C   . GLY D 2 282 ? 14.386  0.138   90.196  1.00 37.57  ? 282 GLY D C   1 
ATOM   10580 O O   . GLY D 2 282 ? 14.246  -1.032  90.537  1.00 35.89  ? 282 GLY D O   1 
ATOM   10581 N N   . TYR D 2 283 ? 15.543  0.631   89.770  1.00 42.48  ? 283 TYR D N   1 
ATOM   10582 C CA  . TYR D 2 283 ? 16.735  -0.205  89.679  1.00 35.21  ? 283 TYR D CA  1 
ATOM   10583 C C   . TYR D 2 283 ? 17.442  -0.384  91.017  1.00 53.27  ? 283 TYR D C   1 
ATOM   10584 O O   . TYR D 2 283 ? 17.679  0.579   91.748  1.00 42.26  ? 283 TYR D O   1 
ATOM   10585 C CB  . TYR D 2 283 ? 17.710  0.376   88.655  1.00 35.46  ? 283 TYR D CB  1 
ATOM   10586 C CG  . TYR D 2 283 ? 17.321  0.086   87.228  1.00 44.36  ? 283 TYR D CG  1 
ATOM   10587 C CD1 . TYR D 2 283 ? 17.468  -1.188  86.697  1.00 37.24  ? 283 TYR D CD1 1 
ATOM   10588 C CD2 . TYR D 2 283 ? 16.796  1.080   86.413  1.00 33.70  ? 283 TYR D CD2 1 
ATOM   10589 C CE1 . TYR D 2 283 ? 17.111  -1.464  85.395  1.00 34.96  ? 283 TYR D CE1 1 
ATOM   10590 C CE2 . TYR D 2 283 ? 16.436  0.814   85.109  1.00 39.60  ? 283 TYR D CE2 1 
ATOM   10591 C CZ  . TYR D 2 283 ? 16.596  -0.460  84.606  1.00 44.20  ? 283 TYR D CZ  1 
ATOM   10592 O OH  . TYR D 2 283 ? 16.238  -0.732  83.307  1.00 49.36  ? 283 TYR D OH  1 
ATOM   10593 N N   . LEU D 2 284 ? 17.773  -1.633  91.324  1.00 47.86  ? 284 LEU D N   1 
ATOM   10594 C CA  . LEU D 2 284 ? 18.554  -1.961  92.510  1.00 30.76  ? 284 LEU D CA  1 
ATOM   10595 C C   . LEU D 2 284 ? 19.672  -2.926  92.139  1.00 46.29  ? 284 LEU D C   1 
ATOM   10596 O O   . LEU D 2 284 ? 19.621  -3.573  91.092  1.00 41.47  ? 284 LEU D O   1 
ATOM   10597 C CB  . LEU D 2 284 ? 17.670  -2.573  93.597  1.00 38.85  ? 284 LEU D CB  1 
ATOM   10598 C CG  . LEU D 2 284 ? 16.577  -1.703  94.220  1.00 44.25  ? 284 LEU D CG  1 
ATOM   10599 C CD1 . LEU D 2 284 ? 15.725  -2.531  95.168  1.00 51.00  ? 284 LEU D CD1 1 
ATOM   10600 C CD2 . LEU D 2 284 ? 17.184  -0.513  94.946  1.00 39.61  ? 284 LEU D CD2 1 
ATOM   10601 N N   . ASN D 2 285 ? 20.686  -3.020  92.991  1.00 40.80  ? 285 ASN D N   1 
ATOM   10602 C CA  . ASN D 2 285 ? 21.733  -4.010  92.789  1.00 43.09  ? 285 ASN D CA  1 
ATOM   10603 C C   . ASN D 2 285 ? 21.473  -5.235  93.652  1.00 41.70  ? 285 ASN D C   1 
ATOM   10604 O O   . ASN D 2 285 ? 21.423  -5.148  94.878  1.00 50.97  ? 285 ASN D O   1 
ATOM   10605 C CB  . ASN D 2 285 ? 23.110  -3.421  93.093  1.00 43.87  ? 285 ASN D CB  1 
ATOM   10606 C CG  . ASN D 2 285 ? 23.553  -2.410  92.053  1.00 46.70  ? 285 ASN D CG  1 
ATOM   10607 O OD1 . ASN D 2 285 ? 23.171  -2.495  90.886  1.00 35.51  ? 285 ASN D OD1 1 
ATOM   10608 N ND2 . ASN D 2 285 ? 24.365  -1.447  92.471  1.00 46.77  ? 285 ASN D ND2 1 
ATOM   10609 N N   . LEU D 2 286 ? 21.301  -6.375  92.996  1.00 38.37  ? 286 LEU D N   1 
ATOM   10610 C CA  . LEU D 2 286 ? 21.033  -7.628  93.682  1.00 35.45  ? 286 LEU D CA  1 
ATOM   10611 C C   . LEU D 2 286 ? 22.346  -8.362  93.903  1.00 43.19  ? 286 LEU D C   1 
ATOM   10612 O O   . LEU D 2 286 ? 23.105  -8.595  92.958  1.00 52.61  ? 286 LEU D O   1 
ATOM   10613 C CB  . LEU D 2 286 ? 20.049  -8.480  92.868  1.00 45.18  ? 286 LEU D CB  1 
ATOM   10614 C CG  . LEU D 2 286 ? 19.549  -9.838  93.379  1.00 37.87  ? 286 LEU D CG  1 
ATOM   10615 C CD1 . LEU D 2 286 ? 20.510  -10.981 93.060  1.00 37.39  ? 286 LEU D CD1 1 
ATOM   10616 C CD2 . LEU D 2 286 ? 19.271  -9.773  94.869  1.00 38.52  ? 286 LEU D CD2 1 
ATOM   10617 N N   . ARG D 2 287 ? 22.620  -8.706  95.157  1.00 50.41  ? 287 ARG D N   1 
ATOM   10618 C CA  . ARG D 2 287 ? 23.816  -9.466  95.485  1.00 46.56  ? 287 ARG D CA  1 
ATOM   10619 C C   . ARG D 2 287 ? 23.546  -10.956 95.355  1.00 52.64  ? 287 ARG D C   1 
ATOM   10620 O O   . ARG D 2 287 ? 22.530  -11.458 95.835  1.00 64.86  ? 287 ARG D O   1 
ATOM   10621 C CB  . ARG D 2 287 ? 24.303  -9.146  96.900  1.00 51.48  ? 287 ARG D CB  1 
ATOM   10622 C CG  . ARG D 2 287 ? 25.689  -9.700  97.203  1.00 60.19  ? 287 ARG D CG  1 
ATOM   10623 C CD  . ARG D 2 287 ? 26.067  -9.526  98.666  1.00 68.96  ? 287 ARG D CD  1 
ATOM   10624 N NE  . ARG D 2 287 ? 25.558  -10.608 99.504  1.00 72.41  ? 287 ARG D NE  1 
ATOM   10625 C CZ  . ARG D 2 287 ? 26.303  -11.301 100.360 1.00 66.72  ? 287 ARG D CZ  1 
ATOM   10626 N NH1 . ARG D 2 287 ? 27.593  -11.025 100.492 1.00 44.16  ? 287 ARG D NH1 1 
ATOM   10627 N NH2 . ARG D 2 287 ? 25.758  -12.269 101.084 1.00 70.75  ? 287 ARG D NH2 1 
ATOM   10628 N N   . ASN D 2 288 ? 24.462  -11.659 94.702  1.00 62.80  ? 288 ASN D N   1 
ATOM   10629 C CA  . ASN D 2 288 ? 24.388  -13.106 94.616  1.00 63.13  ? 288 ASN D CA  1 
ATOM   10630 C C   . ASN D 2 288 ? 25.679  -13.713 95.145  1.00 68.42  ? 288 ASN D C   1 
ATOM   10631 O O   . ASN D 2 288 ? 26.767  -13.452 94.622  1.00 71.39  ? 288 ASN D O   1 
ATOM   10632 C CB  . ASN D 2 288 ? 24.124  -13.556 93.178  1.00 70.73  ? 288 ASN D CB  1 
ATOM   10633 C CG  . ASN D 2 288 ? 23.792  -15.032 93.081  1.00 77.04  ? 288 ASN D CG  1 
ATOM   10634 O OD1 . ASN D 2 288 ? 24.682  -15.883 93.076  1.00 69.23  ? 288 ASN D OD1 1 
ATOM   10635 N ND2 . ASN D 2 288 ? 22.503  -15.344 93.007  1.00 84.96  ? 288 ASN D ND2 1 
ATOM   10636 N N   . LYS D 2 289 ? 25.547  -14.509 96.199  1.00 66.25  ? 289 LYS D N   1 
ATOM   10637 C CA  . LYS D 2 289 ? 26.687  -15.143 96.847  1.00 70.99  ? 289 LYS D CA  1 
ATOM   10638 C C   . LYS D 2 289 ? 26.575  -16.654 96.706  1.00 78.48  ? 289 LYS D C   1 
ATOM   10639 O O   . LYS D 2 289 ? 25.715  -17.277 97.328  1.00 79.51  ? 289 LYS D O   1 
ATOM   10640 C CB  . LYS D 2 289 ? 26.751  -14.743 98.321  1.00 78.49  ? 289 LYS D CB  1 
ATOM   10641 C CG  . LYS D 2 289 ? 27.787  -15.494 99.132  1.00 80.63  ? 289 LYS D CG  1 
ATOM   10642 C CD  . LYS D 2 289 ? 29.029  -14.646 99.341  1.00 78.99  ? 289 LYS D CD  1 
ATOM   10643 C CE  . LYS D 2 289 ? 29.810  -15.111 100.555 1.00 72.42  ? 289 LYS D CE  1 
ATOM   10644 N NZ  . LYS D 2 289 ? 30.727  -14.065 101.088 1.00 58.35  ? 289 LYS D NZ  1 
ATOM   10645 N N   . THR D 2 290 ? 27.432  -17.249 95.882  1.00 89.44  ? 290 THR D N   1 
ATOM   10646 C CA  . THR D 2 290 ? 27.377  -18.693 95.687  1.00 107.52 ? 290 THR D CA  1 
ATOM   10647 C C   . THR D 2 290 ? 28.232  -19.490 96.669  1.00 105.91 ? 290 THR D C   1 
ATOM   10648 O O   . THR D 2 290 ? 27.902  -20.628 97.006  1.00 104.71 ? 290 THR D O   1 
ATOM   10649 C CB  . THR D 2 290 ? 27.820  -19.062 94.245  1.00 102.66 ? 290 THR D CB  1 
ATOM   10650 O OG1 . THR D 2 290 ? 27.627  -20.462 94.017  1.00 120.81 ? 290 THR D OG1 1 
ATOM   10651 C CG2 . THR D 2 290 ? 29.291  -18.698 94.005  1.00 85.95  ? 290 THR D CG2 1 
ATOM   10652 N N   . GLY D 2 291 ? 29.304  -18.874 97.155  1.00 102.53 ? 291 GLY D N   1 
ATOM   10653 C CA  . GLY D 2 291 ? 30.171  -19.496 98.135  1.00 104.27 ? 291 GLY D CA  1 
ATOM   10654 C C   . GLY D 2 291 ? 30.180  -18.874 99.512  1.00 96.04  ? 291 GLY D C   1 
ATOM   10655 O O   . GLY D 2 291 ? 29.221  -18.234 99.940  1.00 81.69  ? 291 GLY D O   1 
ATOM   10656 N N   . LEU D 2 292 ? 31.299  -19.074 100.200 1.00 89.63  ? 292 LEU D N   1 
ATOM   10657 C CA  . LEU D 2 292 ? 31.568  -18.436 101.478 1.00 70.41  ? 292 LEU D CA  1 
ATOM   10658 C C   . LEU D 2 292 ? 32.424  -17.191 101.273 1.00 76.26  ? 292 LEU D C   1 
ATOM   10659 O O   . LEU D 2 292 ? 32.681  -16.437 102.211 1.00 69.04  ? 292 LEU D O   1 
ATOM   10660 C CB  . LEU D 2 292 ? 32.287  -19.412 102.403 1.00 75.64  ? 292 LEU D CB  1 
ATOM   10661 C CG  . LEU D 2 292 ? 31.533  -20.687 102.769 1.00 86.33  ? 292 LEU D CG  1 
ATOM   10662 C CD1 . LEU D 2 292 ? 32.403  -21.532 103.670 1.00 78.95  ? 292 LEU D CD1 1 
ATOM   10663 C CD2 . LEU D 2 292 ? 30.209  -20.360 103.442 1.00 66.85  ? 292 LEU D CD2 1 
ATOM   10664 N N   . VAL D 2 293 ? 32.865  -16.986 100.036 1.00 71.04  ? 293 VAL D N   1 
ATOM   10665 C CA  . VAL D 2 293 ? 33.784  -15.899 99.715  1.00 61.46  ? 293 VAL D CA  1 
ATOM   10666 C C   . VAL D 2 293 ? 33.276  -15.047 98.557  1.00 66.86  ? 293 VAL D C   1 
ATOM   10667 O O   . VAL D 2 293 ? 33.040  -13.848 98.708  1.00 62.77  ? 293 VAL D O   1 
ATOM   10668 C CB  . VAL D 2 293 ? 35.187  -16.431 99.356  1.00 60.43  ? 293 VAL D CB  1 
ATOM   10669 C CG1 . VAL D 2 293 ? 36.075  -15.293 98.870  1.00 52.44  ? 293 VAL D CG1 1 
ATOM   10670 C CG2 . VAL D 2 293 ? 35.817  -17.125 100.552 1.00 65.34  ? 293 VAL D CG2 1 
ATOM   10671 N N   . THR D 2 294 ? 33.113  -15.683 97.400  1.00 83.20  ? 294 THR D N   1 
ATOM   10672 C CA  . THR D 2 294 ? 32.876  -14.982 96.142  1.00 81.49  ? 294 THR D CA  1 
ATOM   10673 C C   . THR D 2 294 ? 31.468  -14.394 96.062  1.00 76.28  ? 294 THR D C   1 
ATOM   10674 O O   . THR D 2 294 ? 30.485  -15.050 96.407  1.00 68.49  ? 294 THR D O   1 
ATOM   10675 C CB  . THR D 2 294 ? 33.107  -15.928 94.938  1.00 78.06  ? 294 THR D CB  1 
ATOM   10676 O OG1 . THR D 2 294 ? 34.514  -16.114 94.741  1.00 66.88  ? 294 THR D OG1 1 
ATOM   10677 C CG2 . THR D 2 294 ? 32.495  -15.365 93.663  1.00 65.75  ? 294 THR D CG2 1 
ATOM   10678 N N   . THR D 2 295 ? 31.387  -13.148 95.604  1.00 63.41  ? 295 THR D N   1 
ATOM   10679 C CA  . THR D 2 295 ? 30.129  -12.417 95.544  1.00 56.78  ? 295 THR D CA  1 
ATOM   10680 C C   . THR D 2 295 ? 30.007  -11.627 94.241  1.00 61.69  ? 295 THR D C   1 
ATOM   10681 O O   . THR D 2 295 ? 31.003  -11.143 93.700  1.00 65.84  ? 295 THR D O   1 
ATOM   10682 C CB  . THR D 2 295 ? 29.987  -11.457 96.742  1.00 63.45  ? 295 THR D CB  1 
ATOM   10683 O OG1 . THR D 2 295 ? 28.688  -10.852 96.722  1.00 83.56  ? 295 THR D OG1 1 
ATOM   10684 C CG2 . THR D 2 295 ? 31.047  -10.368 96.684  1.00 63.29  ? 295 THR D CG2 1 
ATOM   10685 N N   . THR D 2 296 ? 28.786  -11.521 93.725  1.00 64.73  ? 296 THR D N   1 
ATOM   10686 C CA  . THR D 2 296 ? 28.540  -10.708 92.536  1.00 65.32  ? 296 THR D CA  1 
ATOM   10687 C C   . THR D 2 296 ? 27.393  -9.733  92.771  1.00 48.49  ? 296 THR D C   1 
ATOM   10688 O O   . THR D 2 296 ? 26.526  -9.974  93.606  1.00 58.74  ? 296 THR D O   1 
ATOM   10689 C CB  . THR D 2 296 ? 28.212  -11.573 91.298  1.00 57.09  ? 296 THR D CB  1 
ATOM   10690 O OG1 . THR D 2 296 ? 26.919  -12.172 91.458  1.00 60.30  ? 296 THR D OG1 1 
ATOM   10691 C CG2 . THR D 2 296 ? 29.257  -12.662 91.101  1.00 47.32  ? 296 THR D CG2 1 
ATOM   10692 N N   . TRP D 2 297 ? 27.393  -8.627  92.035  1.00 43.63  ? 297 TRP D N   1 
ATOM   10693 C CA  . TRP D 2 297 ? 26.290  -7.679  92.097  1.00 44.37  ? 297 TRP D CA  1 
ATOM   10694 C C   . TRP D 2 297 ? 25.718  -7.468  90.701  1.00 47.51  ? 297 TRP D C   1 
ATOM   10695 O O   . TRP D 2 297 ? 26.463  -7.338  89.731  1.00 62.46  ? 297 TRP D O   1 
ATOM   10696 C CB  . TRP D 2 297 ? 26.750  -6.351  92.703  1.00 50.78  ? 297 TRP D CB  1 
ATOM   10697 C CG  . TRP D 2 297 ? 27.199  -6.469  94.133  1.00 52.51  ? 297 TRP D CG  1 
ATOM   10698 C CD1 . TRP D 2 297 ? 28.418  -6.893  94.576  1.00 44.98  ? 297 TRP D CD1 1 
ATOM   10699 C CD2 . TRP D 2 297 ? 26.433  -6.156  95.307  1.00 59.45  ? 297 TRP D CD2 1 
ATOM   10700 N NE1 . TRP D 2 297 ? 28.458  -6.867  95.949  1.00 46.73  ? 297 TRP D NE1 1 
ATOM   10701 C CE2 . TRP D 2 297 ? 27.257  -6.419  96.421  1.00 46.08  ? 297 TRP D CE2 1 
ATOM   10702 C CE3 . TRP D 2 297 ? 25.136  -5.682  95.520  1.00 57.86  ? 297 TRP D CE3 1 
ATOM   10703 C CZ2 . TRP D 2 297 ? 26.820  -6.220  97.731  1.00 44.21  ? 297 TRP D CZ2 1 
ATOM   10704 C CZ3 . TRP D 2 297 ? 24.706  -5.486  96.823  1.00 47.63  ? 297 TRP D CZ3 1 
ATOM   10705 C CH2 . TRP D 2 297 ? 25.547  -5.756  97.911  1.00 50.88  ? 297 TRP D CH2 1 
ATOM   10706 N N   . GLU D 2 298 ? 24.394  -7.434  90.604  1.00 47.85  ? 298 GLU D N   1 
ATOM   10707 C CA  . GLU D 2 298 ? 23.733  -7.313  89.309  1.00 38.48  ? 298 GLU D CA  1 
ATOM   10708 C C   . GLU D 2 298 ? 22.643  -6.248  89.339  1.00 52.94  ? 298 GLU D C   1 
ATOM   10709 O O   . GLU D 2 298 ? 21.727  -6.318  90.155  1.00 48.05  ? 298 GLU D O   1 
ATOM   10710 C CB  . GLU D 2 298 ? 23.143  -8.663  88.892  1.00 40.50  ? 298 GLU D CB  1 
ATOM   10711 C CG  . GLU D 2 298 ? 23.177  -8.932  87.397  1.00 71.58  ? 298 GLU D CG  1 
ATOM   10712 C CD  . GLU D 2 298 ? 22.220  -10.035 86.986  1.00 84.37  ? 298 GLU D CD  1 
ATOM   10713 O OE1 . GLU D 2 298 ? 21.824  -10.835 87.860  1.00 66.07  ? 298 GLU D OE1 1 
ATOM   10714 O OE2 . GLU D 2 298 ? 21.865  -10.103 85.789  1.00 81.80  ? 298 GLU D OE2 1 
ATOM   10715 N N   . ARG D 2 299 ? 22.724  -5.270  88.442  1.00 52.93  ? 299 ARG D N   1 
ATOM   10716 C CA  . ARG D 2 299 ? 21.712  -4.223  88.410  1.00 38.50  ? 299 ARG D CA  1 
ATOM   10717 C C   . ARG D 2 299 ? 20.462  -4.746  87.719  1.00 45.21  ? 299 ARG D C   1 
ATOM   10718 O O   . ARG D 2 299 ? 20.486  -5.094  86.539  1.00 47.63  ? 299 ARG D O   1 
ATOM   10719 C CB  . ARG D 2 299 ? 22.234  -2.973  87.699  1.00 21.88  ? 299 ARG D CB  1 
ATOM   10720 C CG  . ARG D 2 299 ? 21.284  -1.785  87.757  1.00 36.33  ? 299 ARG D CG  1 
ATOM   10721 C CD  . ARG D 2 299 ? 22.047  -0.471  87.858  1.00 42.58  ? 299 ARG D CD  1 
ATOM   10722 N NE  . ARG D 2 299 ? 21.158  0.688   87.865  1.00 48.64  ? 299 ARG D NE  1 
ATOM   10723 C CZ  . ARG D 2 299 ? 20.647  1.250   86.773  1.00 54.95  ? 299 ARG D CZ  1 
ATOM   10724 N NH1 . ARG D 2 299 ? 19.849  2.304   86.880  1.00 57.09  ? 299 ARG D NH1 1 
ATOM   10725 N NH2 . ARG D 2 299 ? 20.931  0.759   85.573  1.00 44.94  ? 299 ARG D NH2 1 
ATOM   10726 N N   . LEU D 2 300 ? 19.366  -4.787  88.469  1.00 48.08  ? 300 LEU D N   1 
ATOM   10727 C CA  . LEU D 2 300 ? 18.110  -5.337  87.982  1.00 32.73  ? 300 LEU D CA  1 
ATOM   10728 C C   . LEU D 2 300 ? 16.963  -4.407  88.349  1.00 41.56  ? 300 LEU D C   1 
ATOM   10729 O O   . LEU D 2 300 ? 17.093  -3.578  89.255  1.00 46.14  ? 300 LEU D O   1 
ATOM   10730 C CB  . LEU D 2 300 ? 17.877  -6.734  88.565  1.00 37.63  ? 300 LEU D CB  1 
ATOM   10731 C CG  . LEU D 2 300 ? 19.016  -7.741  88.367  1.00 49.85  ? 300 LEU D CG  1 
ATOM   10732 C CD1 . LEU D 2 300 ? 18.762  -9.037  89.118  1.00 43.92  ? 300 LEU D CD1 1 
ATOM   10733 C CD2 . LEU D 2 300 ? 19.228  -8.020  86.889  1.00 53.97  ? 300 LEU D CD2 1 
ATOM   10734 N N   . TYR D 2 301 ? 15.843  -4.536  87.646  1.00 45.52  ? 301 TYR D N   1 
ATOM   10735 C CA  . TYR D 2 301 ? 14.668  -3.750  87.989  1.00 43.51  ? 301 TYR D CA  1 
ATOM   10736 C C   . TYR D 2 301 ? 13.873  -4.481  89.059  1.00 47.32  ? 301 TYR D C   1 
ATOM   10737 O O   . TYR D 2 301 ? 13.668  -5.687  88.975  1.00 48.91  ? 301 TYR D O   1 
ATOM   10738 C CB  . TYR D 2 301 ? 13.801  -3.494  86.760  1.00 37.49  ? 301 TYR D CB  1 
ATOM   10739 C CG  . TYR D 2 301 ? 12.933  -2.257  86.854  1.00 46.57  ? 301 TYR D CG  1 
ATOM   10740 C CD1 . TYR D 2 301 ? 13.496  -0.988  86.796  1.00 40.31  ? 301 TYR D CD1 1 
ATOM   10741 C CD2 . TYR D 2 301 ? 11.554  -2.356  86.989  1.00 40.02  ? 301 TYR D CD2 1 
ATOM   10742 C CE1 . TYR D 2 301 ? 12.711  0.147   86.873  1.00 38.99  ? 301 TYR D CE1 1 
ATOM   10743 C CE2 . TYR D 2 301 ? 10.761  -1.225  87.069  1.00 31.96  ? 301 TYR D CE2 1 
ATOM   10744 C CZ  . TYR D 2 301 ? 11.345  0.024   87.011  1.00 36.53  ? 301 TYR D CZ  1 
ATOM   10745 O OH  . TYR D 2 301 ? 10.562  1.153   87.090  1.00 47.64  ? 301 TYR D OH  1 
ATOM   10746 N N   . PHE D 2 302 ? 13.438  -3.746  90.072  1.00 50.32  ? 302 PHE D N   1 
ATOM   10747 C CA  . PHE D 2 302 ? 12.655  -4.326  91.149  1.00 49.93  ? 302 PHE D CA  1 
ATOM   10748 C C   . PHE D 2 302 ? 11.362  -3.550  91.296  1.00 50.27  ? 302 PHE D C   1 
ATOM   10749 O O   . PHE D 2 302 ? 11.368  -2.318  91.321  1.00 49.02  ? 302 PHE D O   1 
ATOM   10750 C CB  . PHE D 2 302 ? 13.438  -4.315  92.464  1.00 43.81  ? 302 PHE D CB  1 
ATOM   10751 C CG  . PHE D 2 302 ? 14.539  -5.333  92.523  1.00 42.38  ? 302 PHE D CG  1 
ATOM   10752 C CD1 . PHE D 2 302 ? 15.801  -5.038  92.035  1.00 44.36  ? 302 PHE D CD1 1 
ATOM   10753 C CD2 . PHE D 2 302 ? 14.313  -6.584  93.073  1.00 44.02  ? 302 PHE D CD2 1 
ATOM   10754 C CE1 . PHE D 2 302 ? 16.817  -5.974  92.090  1.00 48.57  ? 302 PHE D CE1 1 
ATOM   10755 C CE2 . PHE D 2 302 ? 15.324  -7.524  93.132  1.00 44.46  ? 302 PHE D CE2 1 
ATOM   10756 C CZ  . PHE D 2 302 ? 16.577  -7.219  92.638  1.00 53.63  ? 302 PHE D CZ  1 
ATOM   10757 N N   . PHE D 2 303 ? 10.251  -4.270  91.379  1.00 49.24  ? 303 PHE D N   1 
ATOM   10758 C CA  . PHE D 2 303 ? 8.969   -3.620  91.607  1.00 49.30  ? 303 PHE D CA  1 
ATOM   10759 C C   . PHE D 2 303 ? 8.112   -4.478  92.521  1.00 49.90  ? 303 PHE D C   1 
ATOM   10760 O O   . PHE D 2 303 ? 8.215   -5.702  92.509  1.00 36.40  ? 303 PHE D O   1 
ATOM   10761 C CB  . PHE D 2 303 ? 8.244   -3.341  90.283  1.00 49.32  ? 303 PHE D CB  1 
ATOM   10762 C CG  . PHE D 2 303 ? 8.051   -4.555  89.414  1.00 56.35  ? 303 PHE D CG  1 
ATOM   10763 C CD1 . PHE D 2 303 ? 9.068   -5.006  88.588  1.00 53.41  ? 303 PHE D CD1 1 
ATOM   10764 C CD2 . PHE D 2 303 ? 6.838   -5.226  89.401  1.00 53.52  ? 303 PHE D CD2 1 
ATOM   10765 C CE1 . PHE D 2 303 ? 8.888   -6.116  87.783  1.00 57.28  ? 303 PHE D CE1 1 
ATOM   10766 C CE2 . PHE D 2 303 ? 6.651   -6.335  88.595  1.00 59.24  ? 303 PHE D CE2 1 
ATOM   10767 C CZ  . PHE D 2 303 ? 7.678   -6.781  87.786  1.00 47.74  ? 303 PHE D CZ  1 
ATOM   10768 N N   . THR D 2 304 ? 7.268   -3.833  93.317  1.00 51.45  ? 304 THR D N   1 
ATOM   10769 C CA  . THR D 2 304 ? 6.361   -4.566  94.184  1.00 48.93  ? 304 THR D CA  1 
ATOM   10770 C C   . THR D 2 304 ? 5.054   -4.832  93.454  1.00 52.90  ? 304 THR D C   1 
ATOM   10771 O O   . THR D 2 304 ? 4.450   -3.915  92.898  1.00 50.48  ? 304 THR D O   1 
ATOM   10772 C CB  . THR D 2 304 ? 6.069   -3.786  95.470  1.00 46.13  ? 304 THR D CB  1 
ATOM   10773 O OG1 . THR D 2 304 ? 5.337   -2.597  95.148  1.00 43.26  ? 304 THR D OG1 1 
ATOM   10774 C CG2 . THR D 2 304 ? 7.367   -3.402  96.166  1.00 45.13  ? 304 THR D CG2 1 
ATOM   10775 N N   . GLN D 2 305 ? 4.622   -6.089  93.446  1.00 53.59  ? 305 GLN D N   1 
ATOM   10776 C CA  . GLN D 2 305 ? 3.344   -6.435  92.840  1.00 66.88  ? 305 GLN D CA  1 
ATOM   10777 C C   . GLN D 2 305 ? 2.563   -7.454  93.673  1.00 74.77  ? 305 GLN D C   1 
ATOM   10778 O O   . GLN D 2 305 ? 3.007   -8.587  93.853  1.00 65.69  ? 305 GLN D O   1 
ATOM   10779 C CB  . GLN D 2 305 ? 3.579   -6.952  91.420  1.00 59.40  ? 305 GLN D CB  1 
ATOM   10780 C CG  . GLN D 2 305 ? 2.406   -7.660  90.779  1.00 58.91  ? 305 GLN D CG  1 
ATOM   10781 C CD  . GLN D 2 305 ? 2.834   -8.491  89.587  1.00 86.62  ? 305 GLN D CD  1 
ATOM   10782 O OE1 . GLN D 2 305 ? 3.009   -9.704  89.692  1.00 100.89 ? 305 GLN D OE1 1 
ATOM   10783 N NE2 . GLN D 2 305 ? 3.019   -7.836  88.445  1.00 61.80  ? 305 GLN D NE2 1 
ATOM   10784 N N   . GLY D 2 306 ? 1.400   -7.046  94.173  1.00 67.86  ? 306 GLY D N   1 
ATOM   10785 C CA  . GLY D 2 306 ? 0.563   -7.915  94.983  1.00 65.60  ? 306 GLY D CA  1 
ATOM   10786 C C   . GLY D 2 306 ? 1.184   -8.371  96.291  1.00 70.08  ? 306 GLY D C   1 
ATOM   10787 O O   . GLY D 2 306 ? 0.987   -9.510  96.716  1.00 56.07  ? 306 GLY D O   1 
ATOM   10788 N N   . GLY D 2 307 ? 1.930   -7.481  96.936  1.00 62.14  ? 307 GLY D N   1 
ATOM   10789 C CA  . GLY D 2 307 ? 2.577   -7.808  98.193  1.00 72.58  ? 307 GLY D CA  1 
ATOM   10790 C C   . GLY D 2 307 ? 3.774   -8.705  97.954  1.00 62.52  ? 307 GLY D C   1 
ATOM   10791 O O   . GLY D 2 307 ? 4.292   -9.340  98.872  1.00 60.21  ? 307 GLY D O   1 
ATOM   10792 N N   . ASN D 2 308 ? 4.205   -8.759  96.700  1.00 70.96  ? 308 ASN D N   1 
ATOM   10793 C CA  . ASN D 2 308 ? 5.345   -9.568  96.302  1.00 68.86  ? 308 ASN D CA  1 
ATOM   10794 C C   . ASN D 2 308 ? 6.450   -8.680  95.754  1.00 54.06  ? 308 ASN D C   1 
ATOM   10795 O O   . ASN D 2 308 ? 6.177   -7.657  95.127  1.00 46.58  ? 308 ASN D O   1 
ATOM   10796 C CB  . ASN D 2 308 ? 4.938   -10.605 95.254  1.00 62.11  ? 308 ASN D CB  1 
ATOM   10797 C CG  . ASN D 2 308 ? 4.055   -11.697 95.821  1.00 74.30  ? 308 ASN D CG  1 
ATOM   10798 O OD1 . ASN D 2 308 ? 4.531   -12.776 96.174  1.00 76.43  ? 308 ASN D OD1 1 
ATOM   10799 N ND2 . ASN D 2 308 ? 2.758   -11.424 95.909  1.00 88.27  ? 308 ASN D ND2 1 
ATOM   10800 N N   . LEU D 2 309 ? 7.697   -9.066  95.988  1.00 62.14  ? 309 LEU D N   1 
ATOM   10801 C CA  . LEU D 2 309 ? 8.815   -8.359  95.390  1.00 59.86  ? 309 LEU D CA  1 
ATOM   10802 C C   . LEU D 2 309 ? 9.243   -9.099  94.131  1.00 54.14  ? 309 LEU D C   1 
ATOM   10803 O O   . LEU D 2 309 ? 9.662   -10.268 94.178  1.00 45.79  ? 309 LEU D O   1 
ATOM   10804 C CB  . LEU D 2 309 ? 9.985   -8.224  96.365  1.00 50.69  ? 309 LEU D CB  1 
ATOM   10805 C CG  . LEU D 2 309 ? 11.092  -7.291  95.865  1.00 42.06  ? 309 LEU D CG  1 
ATOM   10806 C CD1 . LEU D 2 309 ? 10.545  -5.892  95.618  1.00 43.54  ? 309 LEU D CD1 1 
ATOM   10807 C CD2 . LEU D 2 309 ? 12.255  -7.248  96.838  1.00 45.89  ? 309 LEU D CD2 1 
ATOM   10808 N N   . MET D 2 310 ? 9.108   -8.392  93.013  1.00 43.72  ? 310 MET D N   1 
ATOM   10809 C CA  . MET D 2 310 ? 9.348   -8.921  91.680  1.00 56.63  ? 310 MET D CA  1 
ATOM   10810 C C   . MET D 2 310 ? 10.621  -8.327  91.091  1.00 52.89  ? 310 MET D C   1 
ATOM   10811 O O   . MET D 2 310 ? 10.912  -7.139  91.278  1.00 47.89  ? 310 MET D O   1 
ATOM   10812 C CB  . MET D 2 310 ? 8.164   -8.616  90.759  1.00 71.47  ? 310 MET D CB  1 
ATOM   10813 C CG  . MET D 2 310 ? 6.830   -9.195  91.201  1.00 52.56  ? 310 MET D CG  1 
ATOM   10814 S SD  . MET D 2 310 ? 6.716   -10.972 90.928  1.00 69.74  ? 310 MET D SD  1 
ATOM   10815 C CE  . MET D 2 310 ? 5.149   -11.338 91.714  1.00 81.76  ? 310 MET D CE  1 
ATOM   10816 N N   . CYS D 2 311 ? 11.356  -9.152  90.353  1.00 56.55  ? 311 CYS D N   1 
ATOM   10817 C CA  . CYS D 2 311 ? 12.619  -8.732  89.762  1.00 59.16  ? 311 CYS D CA  1 
ATOM   10818 C C   . CYS D 2 311 ? 12.702  -9.039  88.269  1.00 61.47  ? 311 CYS D C   1 
ATOM   10819 O O   . CYS D 2 311 ? 12.641  -10.196 87.854  1.00 63.95  ? 311 CYS D O   1 
ATOM   10820 C CB  . CYS D 2 311 ? 13.785  -9.400  90.486  1.00 55.07  ? 311 CYS D CB  1 
ATOM   10821 S SG  . CYS D 2 311 ? 15.351  -9.246  89.618  1.00 84.90  ? 311 CYS D SG  1 
ATOM   10822 N N   . GLN D 2 312 ? 12.843  -7.986  87.471  1.00 57.06  ? 312 GLN D N   1 
ATOM   10823 C CA  . GLN D 2 312 ? 12.982  -8.117  86.028  1.00 60.05  ? 312 GLN D CA  1 
ATOM   10824 C C   . GLN D 2 312 ? 14.338  -7.592  85.565  1.00 49.92  ? 312 GLN D C   1 
ATOM   10825 O O   . GLN D 2 312 ? 14.640  -6.405  85.725  1.00 57.11  ? 312 GLN D O   1 
ATOM   10826 C CB  . GLN D 2 312 ? 11.856  -7.370  85.314  1.00 63.93  ? 312 GLN D CB  1 
ATOM   10827 C CG  . GLN D 2 312 ? 11.912  -7.455  83.799  1.00 58.65  ? 312 GLN D CG  1 
ATOM   10828 C CD  . GLN D 2 312 ? 10.739  -6.760  83.141  1.00 63.59  ? 312 GLN D CD  1 
ATOM   10829 O OE1 . GLN D 2 312 ? 10.014  -6.001  83.784  1.00 59.69  ? 312 GLN D OE1 1 
ATOM   10830 N NE2 . GLN D 2 312 ? 10.544  -7.017  81.853  1.00 73.46  ? 312 GLN D NE2 1 
ATOM   10831 N N   . PRO D 2 313 ? 15.173  -8.483  85.011  1.00 52.80  ? 313 PRO D N   1 
ATOM   10832 C CA  . PRO D 2 313 ? 16.437  -8.063  84.402  1.00 55.12  ? 313 PRO D CA  1 
ATOM   10833 C C   . PRO D 2 313 ? 16.204  -7.383  83.059  1.00 54.79  ? 313 PRO D C   1 
ATOM   10834 O O   . PRO D 2 313 ? 15.280  -7.755  82.336  1.00 53.52  ? 313 PRO D O   1 
ATOM   10835 C CB  . PRO D 2 313 ? 17.196  -9.381  84.227  1.00 41.72  ? 313 PRO D CB  1 
ATOM   10836 C CG  . PRO D 2 313 ? 16.125  -10.405 84.099  1.00 52.97  ? 313 PRO D CG  1 
ATOM   10837 C CD  . PRO D 2 313 ? 15.016  -9.948  85.005  1.00 55.28  ? 313 PRO D CD  1 
ATOM   10838 N N   . ARG D 2 314 ? 17.026  -6.392  82.737  1.00 58.28  ? 314 ARG D N   1 
ATOM   10839 C CA  . ARG D 2 314 ? 16.903  -5.691  81.468  1.00 62.15  ? 314 ARG D CA  1 
ATOM   10840 C C   . ARG D 2 314 ? 17.201  -6.642  80.312  1.00 62.85  ? 314 ARG D C   1 
ATOM   10841 O O   . ARG D 2 314 ? 18.212  -7.344  80.319  1.00 58.50  ? 314 ARG D O   1 
ATOM   10842 C CB  . ARG D 2 314 ? 17.831  -4.477  81.438  1.00 66.74  ? 314 ARG D CB  1 
ATOM   10843 C CG  . ARG D 2 314 ? 17.266  -3.296  80.677  1.00 68.16  ? 314 ARG D CG  1 
ATOM   10844 C CD  . ARG D 2 314 ? 17.998  -2.012  81.028  1.00 76.02  ? 314 ARG D CD  1 
ATOM   10845 N NE  . ARG D 2 314 ? 19.401  -2.026  80.629  1.00 71.44  ? 314 ARG D NE  1 
ATOM   10846 C CZ  . ARG D 2 314 ? 20.282  -1.096  80.981  1.00 65.99  ? 314 ARG D CZ  1 
ATOM   10847 N NH1 . ARG D 2 314 ? 19.905  -0.078  81.743  1.00 74.56  ? 314 ARG D NH1 1 
ATOM   10848 N NH2 . ARG D 2 314 ? 21.540  -1.183  80.574  1.00 65.31  ? 314 ARG D NH2 1 
ATOM   10849 N N   . GLY D 2 315 ? 16.313  -6.662  79.324  1.00 64.31  ? 315 GLY D N   1 
ATOM   10850 C CA  . GLY D 2 315 ? 16.419  -7.592  78.215  1.00 62.37  ? 315 GLY D CA  1 
ATOM   10851 C C   . GLY D 2 315 ? 15.442  -8.747  78.341  1.00 69.95  ? 315 GLY D C   1 
ATOM   10852 O O   . GLY D 2 315 ? 15.341  -9.588  77.447  1.00 75.90  ? 315 GLY D O   1 
ATOM   10853 N N   . ALA D 2 316 ? 14.727  -8.793  79.461  1.00 80.30  ? 316 ALA D N   1 
ATOM   10854 C CA  . ALA D 2 316 ? 13.709  -9.814  79.682  1.00 66.68  ? 316 ALA D CA  1 
ATOM   10855 C C   . ALA D 2 316 ? 12.319  -9.222  79.481  1.00 74.51  ? 316 ALA D C   1 
ATOM   10856 O O   . ALA D 2 316 ? 12.043  -8.109  79.930  1.00 83.33  ? 316 ALA D O   1 
ATOM   10857 C CB  . ALA D 2 316 ? 13.841  -10.410 81.074  1.00 65.04  ? 316 ALA D CB  1 
ATOM   10858 N N   . VAL D 2 317 ? 11.449  -9.962  78.802  1.00 84.58  ? 317 VAL D N   1 
ATOM   10859 C CA  . VAL D 2 317 ? 10.106  -9.474  78.505  1.00 89.45  ? 317 VAL D CA  1 
ATOM   10860 C C   . VAL D 2 317 ? 9.248   -9.421  79.773  1.00 72.98  ? 317 VAL D C   1 
ATOM   10861 O O   . VAL D 2 317 ? 8.428   -8.517  79.941  1.00 76.14  ? 317 VAL D O   1 
ATOM   10862 C CB  . VAL D 2 317 ? 9.412   -10.346 77.423  1.00 80.00  ? 317 VAL D CB  1 
ATOM   10863 C CG1 . VAL D 2 317 ? 9.352   -11.809 77.846  1.00 82.68  ? 317 VAL D CG1 1 
ATOM   10864 C CG2 . VAL D 2 317 ? 8.022   -9.809  77.101  1.00 76.76  ? 317 VAL D CG2 1 
ATOM   10865 N N   . ALA D 2 318 ? 9.456   -10.380 80.671  1.00 77.53  ? 318 ALA D N   1 
ATOM   10866 C CA  . ALA D 2 318 ? 8.654   -10.485 81.886  1.00 84.80  ? 318 ALA D CA  1 
ATOM   10867 C C   . ALA D 2 318 ? 9.525   -10.572 83.137  1.00 83.52  ? 318 ALA D C   1 
ATOM   10868 O O   . ALA D 2 318 ? 10.646  -11.083 83.092  1.00 81.00  ? 318 ALA D O   1 
ATOM   10869 C CB  . ALA D 2 318 ? 7.729   -11.689 81.804  1.00 71.32  ? 318 ALA D CB  1 
ATOM   10870 N N   . GLY D 2 319 ? 9.008   -10.061 84.250  1.00 75.60  ? 319 GLY D N   1 
ATOM   10871 C CA  . GLY D 2 319 ? 9.695   -10.166 85.524  1.00 76.46  ? 319 GLY D CA  1 
ATOM   10872 C C   . GLY D 2 319 ? 9.275   -11.378 86.333  1.00 63.85  ? 319 GLY D C   1 
ATOM   10873 O O   . GLY D 2 319 ? 8.144   -11.850 86.223  1.00 79.35  ? 319 GLY D O   1 
ATOM   10874 N N   . GLY D 2 320 ? 10.195  -11.884 87.148  1.00 79.41  ? 320 GLY D N   1 
ATOM   10875 C CA  . GLY D 2 320 ? 9.919   -13.020 88.009  1.00 68.97  ? 320 GLY D CA  1 
ATOM   10876 C C   . GLY D 2 320 ? 9.787   -12.623 89.466  1.00 69.16  ? 320 GLY D C   1 
ATOM   10877 O O   . GLY D 2 320 ? 10.109  -11.496 89.839  1.00 74.69  ? 320 GLY D O   1 
ATOM   10878 N N   . LEU D 2 321 ? 9.313   -13.552 90.292  1.00 71.03  ? 321 LEU D N   1 
ATOM   10879 C CA  . LEU D 2 321 ? 9.246   -13.329 91.732  1.00 64.35  ? 321 LEU D CA  1 
ATOM   10880 C C   . LEU D 2 321 ? 10.602  -13.530 92.399  1.00 68.57  ? 321 LEU D C   1 
ATOM   10881 O O   . LEU D 2 321 ? 11.137  -14.639 92.395  1.00 61.61  ? 321 LEU D O   1 
ATOM   10882 C CB  . LEU D 2 321 ? 8.221   -14.281 92.355  1.00 71.26  ? 321 LEU D CB  1 
ATOM   10883 C CG  . LEU D 2 321 ? 8.037   -14.226 93.871  1.00 72.85  ? 321 LEU D CG  1 
ATOM   10884 C CD1 . LEU D 2 321 ? 7.474   -12.883 94.275  1.00 73.93  ? 321 LEU D CD1 1 
ATOM   10885 C CD2 . LEU D 2 321 ? 7.143   -15.360 94.356  1.00 61.57  ? 321 LEU D CD2 1 
ATOM   10886 N N   . ILE D 2 322 ? 11.159  -12.469 92.978  1.00 68.26  ? 322 ILE D N   1 
ATOM   10887 C CA  . ILE D 2 322 ? 12.378  -12.623 93.764  1.00 57.84  ? 322 ILE D CA  1 
ATOM   10888 C C   . ILE D 2 322 ? 12.055  -12.998 95.212  1.00 53.58  ? 322 ILE D C   1 
ATOM   10889 O O   . ILE D 2 322 ? 12.754  -13.819 95.806  1.00 70.38  ? 322 ILE D O   1 
ATOM   10890 C CB  . ILE D 2 322 ? 13.288  -11.354 93.713  1.00 46.67  ? 322 ILE D CB  1 
ATOM   10891 C CG1 . ILE D 2 322 ? 14.696  -11.690 94.214  1.00 32.20  ? 322 ILE D CG1 1 
ATOM   10892 C CG2 . ILE D 2 322 ? 12.713  -10.192 94.499  1.00 35.70  ? 322 ILE D CG2 1 
ATOM   10893 N N   . GLN D 2 323 ? 11.001  -12.412 95.781  1.00 58.36  ? 323 GLN D N   1 
ATOM   10894 C CA  . GLN D 2 323 ? 10.674  -12.698 97.181  1.00 55.54  ? 323 GLN D CA  1 
ATOM   10895 C C   . GLN D 2 323 ? 9.202   -12.476 97.517  1.00 55.71  ? 323 GLN D C   1 
ATOM   10896 O O   . GLN D 2 323 ? 8.561   -11.604 96.950  1.00 55.56  ? 323 GLN D O   1 
ATOM   10897 C CB  . GLN D 2 323 ? 11.555  -11.836 98.099  1.00 63.19  ? 323 GLN D CB  1 
ATOM   10898 C CG  . GLN D 2 323 ? 11.193  -11.873 99.581  1.00 61.74  ? 323 GLN D CG  1 
ATOM   10899 C CD  . GLN D 2 323 ? 11.630  -13.154 100.264 1.00 63.15  ? 323 GLN D CD  1 
ATOM   10900 O OE1 . GLN D 2 323 ? 10.971  -13.634 101.187 1.00 59.40  ? 323 GLN D OE1 1 
ATOM   10901 N NE2 . GLN D 2 323 ? 12.748  -13.712 99.816  1.00 75.95  ? 323 GLN D NE2 1 
ATOM   10902 N N   . ASP D 2 324 ? 8.669   -13.261 98.449  1.00 71.07  ? 324 ASP D N   1 
ATOM   10903 C CA  . ASP D 2 324 ? 7.333   -12.999 98.966  1.00 77.90  ? 324 ASP D CA  1 
ATOM   10904 C C   . ASP D 2 324 ? 7.468   -12.093 100.184 1.00 69.17  ? 324 ASP D C   1 
ATOM   10905 O O   . ASP D 2 324 ? 8.172   -12.427 101.137 1.00 53.62  ? 324 ASP D O   1 
ATOM   10906 C CB  . ASP D 2 324 ? 6.608   -14.293 99.339  1.00 79.95  ? 324 ASP D CB  1 
ATOM   10907 C CG  . ASP D 2 324 ? 5.248   -14.038 99.960  1.00 84.98  ? 324 ASP D CG  1 
ATOM   10908 O OD1 . ASP D 2 324 ? 4.536   -13.133 99.476  1.00 89.45  ? 324 ASP D OD1 1 
ATOM   10909 O OD2 . ASP D 2 324 ? 4.898   -14.728 100.941 1.00 97.52  ? 324 ASP D OD2 1 
ATOM   10910 N N   . LEU D 2 325 ? 6.784   -10.955 100.156 1.00 62.01  ? 325 LEU D N   1 
ATOM   10911 C CA  . LEU D 2 325 ? 7.004   -9.908  101.149 1.00 51.20  ? 325 LEU D CA  1 
ATOM   10912 C C   . LEU D 2 325 ? 6.045   -10.033 102.321 1.00 78.00  ? 325 LEU D C   1 
ATOM   10913 O O   . LEU D 2 325 ? 6.016   -9.171  103.201 1.00 82.72  ? 325 LEU D O   1 
ATOM   10914 C CB  . LEU D 2 325 ? 6.892   -8.516  100.525 1.00 48.29  ? 325 LEU D CB  1 
ATOM   10915 C CG  . LEU D 2 325 ? 7.954   -8.164  99.486  1.00 64.23  ? 325 LEU D CG  1 
ATOM   10916 C CD1 . LEU D 2 325 ? 7.633   -6.822  98.855  1.00 60.25  ? 325 LEU D CD1 1 
ATOM   10917 C CD2 . LEU D 2 325 ? 9.338   -8.150  100.123 1.00 53.20  ? 325 LEU D CD2 1 
ATOM   10918 N N   . ASP D 2 326 ? 5.272   -11.112 102.342 1.00 79.79  ? 326 ASP D N   1 
ATOM   10919 C CA  . ASP D 2 326 ? 4.226   -11.261 103.340 1.00 96.69  ? 326 ASP D CA  1 
ATOM   10920 C C   . ASP D 2 326 ? 4.921   -11.687 104.615 1.00 89.59  ? 326 ASP D C   1 
ATOM   10921 O O   . ASP D 2 326 ? 5.652   -12.681 104.639 1.00 71.15  ? 326 ASP D O   1 
ATOM   10922 C CB  . ASP D 2 326 ? 3.175   -12.291 102.917 1.00 94.75  ? 326 ASP D CB  1 
ATOM   10923 C CG  . ASP D 2 326 ? 1.951   -12.284 103.820 1.00 123.34 ? 326 ASP D CG  1 
ATOM   10924 O OD1 . ASP D 2 326 ? 1.441   -11.189 104.138 1.00 111.04 ? 326 ASP D OD1 1 
ATOM   10925 O OD2 . ASP D 2 326 ? 1.497   -13.381 104.210 1.00 129.25 ? 326 ASP D OD2 1 
ATOM   10926 N N   . ASN D 2 327 ? 4.701   -10.895 105.660 1.00 82.21  ? 327 ASN D N   1 
ATOM   10927 C CA  . ASN D 2 327 ? 5.114   -11.224 107.016 1.00 94.67  ? 327 ASN D CA  1 
ATOM   10928 C C   . ASN D 2 327 ? 6.641   -11.215 107.085 1.00 90.56  ? 327 ASN D C   1 
ATOM   10929 O O   . ASN D 2 327 ? 7.248   -11.965 107.850 1.00 81.79  ? 327 ASN D O   1 
ATOM   10930 C CB  . ASN D 2 327 ? 4.551   -12.588 107.436 1.00 88.54  ? 327 ASN D CB  1 
ATOM   10931 C CG  . ASN D 2 327 ? 4.024   -12.593 108.849 1.00 88.20  ? 327 ASN D CG  1 
ATOM   10932 O OD1 . ASN D 2 327 ? 4.499   -11.846 109.703 1.00 102.76 ? 327 ASN D OD1 1 
ATOM   10933 N ND2 . ASN D 2 327 ? 3.032   -13.438 109.106 1.00 99.60  ? 327 ASN D ND2 1 
ATOM   10934 N N   . CYS D 2 328 ? 7.247   -10.337 106.288 1.00 86.08  ? 328 CYS D N   1 
ATOM   10935 C CA  . CYS D 2 328 ? 8.699   -10.167 106.262 1.00 77.64  ? 328 CYS D CA  1 
ATOM   10936 C C   . CYS D 2 328 ? 9.187   -8.928  107.006 1.00 79.16  ? 328 CYS D C   1 
ATOM   10937 O O   . CYS D 2 328 ? 8.392   -8.131  107.508 1.00 65.38  ? 328 CYS D O   1 
ATOM   10938 C CB  . CYS D 2 328 ? 9.196   -10.107 104.815 1.00 68.40  ? 328 CYS D CB  1 
ATOM   10939 S SG  . CYS D 2 328 ? 9.278   -11.700 103.979 1.00 80.16  ? 328 CYS D SG  1 
ATOM   10940 N N   . SER D 2 329 ? 10.508  -8.775  107.060 1.00 69.69  ? 329 SER D N   1 
ATOM   10941 C CA  . SER D 2 329 ? 11.130  -7.580  107.622 1.00 64.63  ? 329 SER D CA  1 
ATOM   10942 C C   . SER D 2 329 ? 12.203  -7.034  106.680 1.00 64.88  ? 329 SER D C   1 
ATOM   10943 O O   . SER D 2 329 ? 12.717  -7.761  105.839 1.00 59.20  ? 329 SER D O   1 
ATOM   10944 C CB  . SER D 2 329 ? 11.733  -7.886  108.993 1.00 58.09  ? 329 SER D CB  1 
ATOM   10945 O OG  . SER D 2 329 ? 12.826  -7.028  109.275 1.00 71.75  ? 329 SER D OG  1 
ATOM   10946 N N   . VAL D 2 330 ? 12.520  -5.749  106.803 1.00 59.17  ? 330 VAL D N   1 
ATOM   10947 C CA  . VAL D 2 330 ? 13.593  -5.156  106.009 1.00 54.60  ? 330 VAL D CA  1 
ATOM   10948 C C   . VAL D 2 330 ? 14.358  -4.106  106.820 1.00 54.45  ? 330 VAL D C   1 
ATOM   10949 O O   . VAL D 2 330 ? 13.763  -3.363  107.604 1.00 67.71  ? 330 VAL D O   1 
ATOM   10950 C CB  . VAL D 2 330 ? 13.051  -4.537  104.696 1.00 55.07  ? 330 VAL D CB  1 
ATOM   10951 C CG1 . VAL D 2 330 ? 12.260  -3.272  104.972 1.00 49.71  ? 330 VAL D CG1 1 
ATOM   10952 C CG2 . VAL D 2 330 ? 14.188  -4.265  103.720 1.00 47.78  ? 330 VAL D CG2 1 
ATOM   10953 N N   . MET D 2 331 ? 15.679  -4.068  106.668 1.00 52.01  ? 331 MET D N   1 
ATOM   10954 C CA  . MET D 2 331 ? 16.475  -3.080  107.398 1.00 45.13  ? 331 MET D CA  1 
ATOM   10955 C C   . MET D 2 331 ? 17.756  -2.694  106.663 1.00 54.99  ? 331 MET D C   1 
ATOM   10956 O O   . MET D 2 331 ? 18.316  -3.492  105.917 1.00 49.27  ? 331 MET D O   1 
ATOM   10957 C CB  . MET D 2 331 ? 16.820  -3.598  108.797 1.00 36.59  ? 331 MET D CB  1 
ATOM   10958 C CG  . MET D 2 331 ? 17.901  -4.666  108.829 1.00 45.44  ? 331 MET D CG  1 
ATOM   10959 S SD  . MET D 2 331 ? 18.427  -5.057  110.510 1.00 84.62  ? 331 MET D SD  1 
ATOM   10960 C CE  . MET D 2 331 ? 19.249  -3.533  110.971 1.00 55.40  ? 331 MET D CE  1 
ATOM   10961 N N   . ALA D 2 332 ? 18.213  -1.464  106.877 1.00 52.06  ? 332 ALA D N   1 
ATOM   10962 C CA  . ALA D 2 332 ? 19.486  -1.017  106.321 1.00 47.54  ? 332 ALA D CA  1 
ATOM   10963 C C   . ALA D 2 332 ? 20.633  -1.837  106.901 1.00 38.48  ? 332 ALA D C   1 
ATOM   10964 O O   . ALA D 2 332 ? 20.667  -2.106  108.100 1.00 49.99  ? 332 ALA D O   1 
ATOM   10965 C CB  . ALA D 2 332 ? 19.698  0.464   106.591 1.00 40.23  ? 332 ALA D CB  1 
ATOM   10966 N N   . VAL D 2 333 ? 21.568  -2.240  106.046 1.00 54.18  ? 333 VAL D N   1 
ATOM   10967 C CA  . VAL D 2 333 ? 22.716  -3.025  106.488 1.00 56.89  ? 333 VAL D CA  1 
ATOM   10968 C C   . VAL D 2 333 ? 24.017  -2.525  105.873 1.00 56.18  ? 333 VAL D C   1 
ATOM   10969 O O   . VAL D 2 333 ? 24.020  -1.599  105.062 1.00 52.72  ? 333 VAL D O   1 
ATOM   10970 C CB  . VAL D 2 333 ? 22.560  -4.522  106.131 1.00 47.60  ? 333 VAL D CB  1 
ATOM   10971 C CG1 . VAL D 2 333 ? 21.299  -5.106  106.756 1.00 38.55  ? 333 VAL D CG1 1 
ATOM   10972 C CG2 . VAL D 2 333 ? 22.562  -4.711  104.618 1.00 48.81  ? 333 VAL D CG2 1 
ATOM   10973 N N   . ASP D 2 334 ? 25.122  -3.148  106.270 1.00 59.16  ? 334 ASP D N   1 
ATOM   10974 C CA  . ASP D 2 334 ? 26.423  -2.858  105.684 1.00 53.90  ? 334 ASP D CA  1 
ATOM   10975 C C   . ASP D 2 334 ? 26.953  -4.102  104.986 1.00 50.44  ? 334 ASP D C   1 
ATOM   10976 O O   . ASP D 2 334 ? 27.072  -5.161  105.601 1.00 61.29  ? 334 ASP D O   1 
ATOM   10977 C CB  . ASP D 2 334 ? 27.413  -2.387  106.751 1.00 49.25  ? 334 ASP D CB  1 
ATOM   10978 C CG  . ASP D 2 334 ? 27.082  -1.011  107.289 1.00 58.42  ? 334 ASP D CG  1 
ATOM   10979 O OD1 . ASP D 2 334 ? 27.505  -0.013  106.669 1.00 77.70  ? 334 ASP D OD1 1 
ATOM   10980 O OD2 . ASP D 2 334 ? 26.402  -0.925  108.333 1.00 77.70  ? 334 ASP D OD2 1 
ATOM   10981 N N   . CYS D 2 335 ? 27.264  -3.979  103.701 1.00 51.31  ? 335 CYS D N   1 
ATOM   10982 C CA  . CYS D 2 335 ? 27.808  -5.107  102.957 1.00 50.08  ? 335 CYS D CA  1 
ATOM   10983 C C   . CYS D 2 335 ? 28.955  -4.679  102.050 1.00 52.17  ? 335 CYS D C   1 
ATOM   10984 O O   . CYS D 2 335 ? 28.768  -3.862  101.148 1.00 56.70  ? 335 CYS D O   1 
ATOM   10985 C CB  . CYS D 2 335 ? 26.708  -5.778  102.134 1.00 48.84  ? 335 CYS D CB  1 
ATOM   10986 S SG  . CYS D 2 335 ? 27.156  -7.395  101.463 1.00 55.83  ? 335 CYS D SG  1 
ATOM   10987 N N   . GLU D 2 336 ? 30.135  -5.240  102.301 1.00 50.83  ? 336 GLU D N   1 
ATOM   10988 C CA  . GLU D 2 336 ? 31.313  -5.030  101.459 1.00 44.19  ? 336 GLU D CA  1 
ATOM   10989 C C   . GLU D 2 336 ? 31.636  -3.555  101.248 1.00 45.18  ? 336 GLU D C   1 
ATOM   10990 O O   . GLU D 2 336 ? 32.038  -3.150  100.156 1.00 63.71  ? 336 GLU D O   1 
ATOM   10991 C CB  . GLU D 2 336 ? 31.125  -5.727  100.111 1.00 48.86  ? 336 GLU D CB  1 
ATOM   10992 C CG  . GLU D 2 336 ? 31.083  -7.239  100.221 1.00 58.49  ? 336 GLU D CG  1 
ATOM   10993 C CD  . GLU D 2 336 ? 30.429  -7.894  99.026  1.00 61.96  ? 336 GLU D CD  1 
ATOM   10994 O OE1 . GLU D 2 336 ? 30.593  -7.382  97.899  1.00 66.34  ? 336 GLU D OE1 1 
ATOM   10995 O OE2 . GLU D 2 336 ? 29.749  -8.924  99.218  1.00 84.11  ? 336 GLU D OE2 1 
ATOM   10996 N N   . ASP D 2 337 ? 31.454  -2.768  102.306 1.00 41.70  ? 337 ASP D N   1 
ATOM   10997 C CA  . ASP D 2 337 ? 31.755  -1.339  102.301 1.00 44.70  ? 337 ASP D CA  1 
ATOM   10998 C C   . ASP D 2 337 ? 31.021  -0.622  101.169 1.00 47.06  ? 337 ASP D C   1 
ATOM   10999 O O   . ASP D 2 337 ? 31.544  0.313   100.563 1.00 47.84  ? 337 ASP D O   1 
ATOM   11000 C CB  . ASP D 2 337 ? 33.266  -1.109  102.194 1.00 53.61  ? 337 ASP D CB  1 
ATOM   11001 C CG  . ASP D 2 337 ? 33.675  0.293   102.606 1.00 66.68  ? 337 ASP D CG  1 
ATOM   11002 O OD1 . ASP D 2 337 ? 32.876  0.972   103.284 1.00 64.78  ? 337 ASP D OD1 1 
ATOM   11003 O OD2 . ASP D 2 337 ? 34.797  0.712   102.255 1.00 72.63  ? 337 ASP D OD2 1 
ATOM   11004 N N   . ARG D 2 338 ? 29.800  -1.069  100.892 1.00 47.26  ? 338 ARG D N   1 
ATOM   11005 C CA  . ARG D 2 338 ? 28.983  -0.466  99.847  1.00 44.43  ? 338 ARG D CA  1 
ATOM   11006 C C   . ARG D 2 338 ? 27.941  0.454   100.463 1.00 51.07  ? 338 ARG D C   1 
ATOM   11007 O O   . ARG D 2 338 ? 27.432  0.193   101.553 1.00 55.16  ? 338 ARG D O   1 
ATOM   11008 C CB  . ARG D 2 338 ? 28.303  -1.538  98.994  1.00 33.44  ? 338 ARG D CB  1 
ATOM   11009 C CG  . ARG D 2 338 ? 29.099  -1.961  97.774  1.00 31.07  ? 338 ARG D CG  1 
ATOM   11010 C CD  . ARG D 2 338 ? 28.380  -3.053  97.001  1.00 37.55  ? 338 ARG D CD  1 
ATOM   11011 N NE  . ARG D 2 338 ? 29.236  -3.651  95.981  1.00 58.23  ? 338 ARG D NE  1 
ATOM   11012 C CZ  . ARG D 2 338 ? 29.079  -3.464  94.674  1.00 40.09  ? 338 ARG D CZ  1 
ATOM   11013 N NH1 . ARG D 2 338 ? 28.096  -2.695  94.227  1.00 36.95  ? 338 ARG D NH1 1 
ATOM   11014 N NH2 . ARG D 2 338 ? 29.905  -4.045  93.815  1.00 44.09  ? 338 ARG D NH2 1 
ATOM   11015 N N   . ARG D 2 339 ? 27.626  1.531   99.755  1.00 35.69  ? 339 ARG D N   1 
ATOM   11016 C CA  . ARG D 2 339 ? 26.683  2.522   100.251 1.00 43.57  ? 339 ARG D CA  1 
ATOM   11017 C C   . ARG D 2 339 ? 25.242  2.125   99.954  1.00 44.99  ? 339 ARG D C   1 
ATOM   11018 O O   . ARG D 2 339 ? 24.945  1.597   98.882  1.00 37.70  ? 339 ARG D O   1 
ATOM   11019 C CB  . ARG D 2 339 ? 26.990  3.891   99.642  1.00 43.35  ? 339 ARG D CB  1 
ATOM   11020 C CG  . ARG D 2 339 ? 28.256  4.526   100.187 1.00 36.85  ? 339 ARG D CG  1 
ATOM   11021 C