data_5CHG
# 
_entry.id   5CHG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5CHG         
WWPDB D_1000211634 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        
'5CA7 contains Human DNA polymerase lambda- complex with MgdGTP and complex with 6 paired DNA' 
_pdbx_database_related.db_id          5CA7 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5CHG 
_pdbx_database_status.recvd_initial_deposition_date   2015-07-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, M.S.'  1 
'Tsai, M.D.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_id_ASTM           JACSAT 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1520-5126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            138 
_citation.language                  ? 
_citation.page_first                2389 
_citation.page_last                 2398 
_citation.title                     'Structural Mechanism for the Fidelity Modulation of DNA Polymerase lambda' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/jacs.5b13368 
_citation.pdbx_database_id_PubMed   26836966 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, M.S.'  1 
primary 'Tsai, H.Y.' 2 
primary 'Liu, X.X.'  3 
primary 'Ho, M.C.'   4 
primary 'Wu, W.J.'   5 
primary 'Tsai, M.D.' 6 
# 
_cell.entry_id           5CHG 
_cell.length_a           83.893 
_cell.length_b           83.893 
_cell.length_c           398.646 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5CHG 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase lambda'             37306.477 2  2.7.7.7 L431A 'UNP residues 242-575' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*GP*TP*AP*C)-3')
;
1793.219  1  ?       ?     ?                      ? 
3 polymer     syn 
;DNA (5'-D(P*GP*TP*AP*CP*TP*G)-3')
;
1824.228  1  ?       ?     ?                      ? 
4 non-polymer syn 'MAGNESIUM ION'                     24.305    2  ?       ?     ?                      ? 
5 non-polymer syn 'SULFATE ION'                       96.063    1  ?       ?     ?                      ? 
6 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" 507.181   1  ?       ?     ?                      ? 
7 water       nat water                               18.015    18 ?       ?     ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol Lambda,DNA polymerase beta-2,Pol beta2,DNA polymerase kappa' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;AQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGH
LRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQK
AAQAFNSGLLCVACGSYRRGKATCGDVDVAITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPG
PGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFR
LLGLPYREPAERDW
;
;AQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGH
LRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQK
AAQAFNSGLLCVACGSYRRGKATCGDVDVAITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPG
PGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFR
LLGLPYREPAERDW
;
A,B ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DG)(DT)(DA)(DC)' CAGTAC P   ? 
3 polydeoxyribonucleotide no no '(DG)(DT)(DA)(DC)(DT)(DG)' GTACTG T   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   GLN n 
1 3   PRO n 
1 4   SER n 
1 5   SER n 
1 6   GLN n 
1 7   LYS n 
1 8   ALA n 
1 9   THR n 
1 10  ASN n 
1 11  HIS n 
1 12  ASN n 
1 13  LEU n 
1 14  HIS n 
1 15  ILE n 
1 16  THR n 
1 17  GLU n 
1 18  LYS n 
1 19  LEU n 
1 20  GLU n 
1 21  VAL n 
1 22  LEU n 
1 23  ALA n 
1 24  LYS n 
1 25  ALA n 
1 26  TYR n 
1 27  SER n 
1 28  VAL n 
1 29  GLN n 
1 30  GLY n 
1 31  ASP n 
1 32  LYS n 
1 33  TRP n 
1 34  ARG n 
1 35  ALA n 
1 36  LEU n 
1 37  GLY n 
1 38  TYR n 
1 39  ALA n 
1 40  LYS n 
1 41  ALA n 
1 42  ILE n 
1 43  ASN n 
1 44  ALA n 
1 45  LEU n 
1 46  LYS n 
1 47  SER n 
1 48  PHE n 
1 49  HIS n 
1 50  LYS n 
1 51  PRO n 
1 52  VAL n 
1 53  THR n 
1 54  SER n 
1 55  TYR n 
1 56  GLN n 
1 57  GLU n 
1 58  ALA n 
1 59  CYS n 
1 60  SER n 
1 61  ILE n 
1 62  PRO n 
1 63  GLY n 
1 64  ILE n 
1 65  GLY n 
1 66  LYS n 
1 67  ARG n 
1 68  MET n 
1 69  ALA n 
1 70  GLU n 
1 71  LYS n 
1 72  ILE n 
1 73  ILE n 
1 74  GLU n 
1 75  ILE n 
1 76  LEU n 
1 77  GLU n 
1 78  SER n 
1 79  GLY n 
1 80  HIS n 
1 81  LEU n 
1 82  ARG n 
1 83  LYS n 
1 84  LEU n 
1 85  ASP n 
1 86  HIS n 
1 87  ILE n 
1 88  SER n 
1 89  GLU n 
1 90  SER n 
1 91  VAL n 
1 92  PRO n 
1 93  VAL n 
1 94  LEU n 
1 95  GLU n 
1 96  LEU n 
1 97  PHE n 
1 98  SER n 
1 99  ASN n 
1 100 ILE n 
1 101 TRP n 
1 102 GLY n 
1 103 ALA n 
1 104 GLY n 
1 105 THR n 
1 106 LYS n 
1 107 THR n 
1 108 ALA n 
1 109 GLN n 
1 110 MET n 
1 111 TRP n 
1 112 TYR n 
1 113 GLN n 
1 114 GLN n 
1 115 GLY n 
1 116 PHE n 
1 117 ARG n 
1 118 SER n 
1 119 LEU n 
1 120 GLU n 
1 121 ASP n 
1 122 ILE n 
1 123 ARG n 
1 124 SER n 
1 125 GLN n 
1 126 ALA n 
1 127 SER n 
1 128 LEU n 
1 129 THR n 
1 130 THR n 
1 131 GLN n 
1 132 GLN n 
1 133 ALA n 
1 134 ILE n 
1 135 GLY n 
1 136 LEU n 
1 137 LYS n 
1 138 HIS n 
1 139 TYR n 
1 140 SER n 
1 141 ASP n 
1 142 PHE n 
1 143 LEU n 
1 144 GLU n 
1 145 ARG n 
1 146 MET n 
1 147 PRO n 
1 148 ARG n 
1 149 GLU n 
1 150 GLU n 
1 151 ALA n 
1 152 THR n 
1 153 GLU n 
1 154 ILE n 
1 155 GLU n 
1 156 GLN n 
1 157 THR n 
1 158 VAL n 
1 159 GLN n 
1 160 LYS n 
1 161 ALA n 
1 162 ALA n 
1 163 GLN n 
1 164 ALA n 
1 165 PHE n 
1 166 ASN n 
1 167 SER n 
1 168 GLY n 
1 169 LEU n 
1 170 LEU n 
1 171 CYS n 
1 172 VAL n 
1 173 ALA n 
1 174 CYS n 
1 175 GLY n 
1 176 SER n 
1 177 TYR n 
1 178 ARG n 
1 179 ARG n 
1 180 GLY n 
1 181 LYS n 
1 182 ALA n 
1 183 THR n 
1 184 CYS n 
1 185 GLY n 
1 186 ASP n 
1 187 VAL n 
1 188 ASP n 
1 189 VAL n 
1 190 ALA n 
1 191 ILE n 
1 192 THR n 
1 193 HIS n 
1 194 PRO n 
1 195 ASP n 
1 196 GLY n 
1 197 ARG n 
1 198 SER n 
1 199 HIS n 
1 200 ARG n 
1 201 GLY n 
1 202 ILE n 
1 203 PHE n 
1 204 SER n 
1 205 ARG n 
1 206 LEU n 
1 207 LEU n 
1 208 ASP n 
1 209 SER n 
1 210 LEU n 
1 211 ARG n 
1 212 GLN n 
1 213 GLU n 
1 214 GLY n 
1 215 PHE n 
1 216 LEU n 
1 217 THR n 
1 218 ASP n 
1 219 ASP n 
1 220 LEU n 
1 221 VAL n 
1 222 SER n 
1 223 GLN n 
1 224 GLU n 
1 225 GLU n 
1 226 ASN n 
1 227 GLY n 
1 228 GLN n 
1 229 GLN n 
1 230 GLN n 
1 231 LYS n 
1 232 TYR n 
1 233 LEU n 
1 234 GLY n 
1 235 VAL n 
1 236 CYS n 
1 237 ARG n 
1 238 LEU n 
1 239 PRO n 
1 240 GLY n 
1 241 PRO n 
1 242 GLY n 
1 243 ARG n 
1 244 ARG n 
1 245 HIS n 
1 246 ARG n 
1 247 ARG n 
1 248 LEU n 
1 249 ASP n 
1 250 ILE n 
1 251 ILE n 
1 252 VAL n 
1 253 VAL n 
1 254 PRO n 
1 255 TYR n 
1 256 SER n 
1 257 GLU n 
1 258 PHE n 
1 259 ALA n 
1 260 CYS n 
1 261 ALA n 
1 262 LEU n 
1 263 LEU n 
1 264 TYR n 
1 265 PHE n 
1 266 THR n 
1 267 GLY n 
1 268 SER n 
1 269 ALA n 
1 270 HIS n 
1 271 PHE n 
1 272 ASN n 
1 273 ARG n 
1 274 SER n 
1 275 MET n 
1 276 ARG n 
1 277 ALA n 
1 278 LEU n 
1 279 ALA n 
1 280 LYS n 
1 281 THR n 
1 282 LYS n 
1 283 GLY n 
1 284 MET n 
1 285 SER n 
1 286 LEU n 
1 287 SER n 
1 288 GLU n 
1 289 HIS n 
1 290 ALA n 
1 291 LEU n 
1 292 SER n 
1 293 THR n 
1 294 ALA n 
1 295 VAL n 
1 296 VAL n 
1 297 ARG n 
1 298 ASN n 
1 299 THR n 
1 300 HIS n 
1 301 GLY n 
1 302 CYS n 
1 303 LYS n 
1 304 VAL n 
1 305 GLY n 
1 306 PRO n 
1 307 GLY n 
1 308 ARG n 
1 309 VAL n 
1 310 LEU n 
1 311 PRO n 
1 312 THR n 
1 313 PRO n 
1 314 THR n 
1 315 GLU n 
1 316 LYS n 
1 317 ASP n 
1 318 VAL n 
1 319 PHE n 
1 320 ARG n 
1 321 LEU n 
1 322 LEU n 
1 323 GLY n 
1 324 LEU n 
1 325 PRO n 
1 326 TYR n 
1 327 ARG n 
1 328 GLU n 
1 329 PRO n 
1 330 ALA n 
1 331 GLU n 
1 332 ARG n 
1 333 ASP n 
1 334 TRP n 
2 1   DC  n 
2 2   DA  n 
2 3   DG  n 
2 4   DT  n 
2 5   DA  n 
2 6   DC  n 
3 1   DG  n 
3 2   DT  n 
3 3   DA  n 
3 4   DC  n 
3 5   DT  n 
3 6   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   334 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 POLL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 6 'synthetic construct' ? 32630 ? 
3 1 sample 1 6 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.details 
_struct_ref.entity_id 
_struct_ref.id 
_struct_ref.seq_align 
_struct_ref.seq_dif 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_align_end 
DPOLL_HUMAN UNP ? 1 1 ? ? Q9UGP5 ? 
;AQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGH
LRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQK
AAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPG
PGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFR
LLGLPYREPAERDW
;
242 ? 
5CHG        PDB ? 2 2 ? ? 5CHG   ? ? 1   ? 
5CHG        PDB ? 3 3 ? ? 5CHG   ? ? 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5CHG A 1 ? 334 ? Q9UGP5 242 ? 575 ? 242 575 
2 1 5CHG B 1 ? 334 ? Q9UGP5 242 ? 575 ? 242 575 
3 2 5CHG P 1 ? 6   ? 5CHG   1   ? 6   ? 1   6   
4 3 5CHG T 1 ? 6   ? 5CHG   6   ? 11  ? 6   11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5CHG ALA A 190 ? UNP Q9UGP5 LEU 431 'engineered mutation' 431 1 
2 5CHG ALA B 190 ? UNP Q9UGP5 LEU 431 'engineered mutation' 431 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"  ? 'C10 H16 N5 O13 P3' 507.181 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5CHG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.59 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.48 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M Lithium Sulfate monohydrate, 0.1M HEPES-Sodium, 0.1M Potassium Sodium Tartrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-06-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSRRC BEAMLINE BL15A1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL15A1 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5CHG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.900 
_reflns.d_resolution_low                 30.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       19664 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.900 
_reflns.pdbx_Rmerge_I_obs                0.170 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         17.852 
_reflns.pdbx_netI_over_sigmaI            7.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.000 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         272760 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.900 3.000  ? ? ? ? ? 1902 ? 100.000 ? ? ? ? 0.879 ? ? ? ? ? ? ? ? 14.400 ? 1.001 ? ? ? ? 0 1  1 ? ? 
3.000 3.120  ? ? ? ? ? 1891 ? 100.000 ? ? ? ? 0.683 ? ? ? ? ? ? ? ? 14.400 ? 1.000 ? ? ? ? 0 2  1 ? ? 
3.120 3.270  ? ? ? ? ? 1903 ? 100.000 ? ? ? ? 0.489 ? ? ? ? ? ? ? ? 14.300 ? 1.000 ? ? ? ? 0 3  1 ? ? 
3.270 3.440  ? ? ? ? ? 1905 ? 100.000 ? ? ? ? 0.316 ? ? ? ? ? ? ? ? 14.300 ? 1.000 ? ? ? ? 0 4  1 ? ? 
3.440 3.650  ? ? ? ? ? 1950 ? 100.000 ? ? ? ? 0.246 ? ? ? ? ? ? ? ? 14.100 ? 1.000 ? ? ? ? 0 5  1 ? ? 
3.650 3.930  ? ? ? ? ? 1922 ? 100.000 ? ? ? ? 0.178 ? ? ? ? ? ? ? ? 14.000 ? 1.000 ? ? ? ? 0 6  1 ? ? 
3.930 4.330  ? ? ? ? ? 1961 ? 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 14.000 ? 1.000 ? ? ? ? 0 7  1 ? ? 
4.330 4.950  ? ? ? ? ? 1987 ? 100.000 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 13.800 ? 1.000 ? ? ? ? 0 8  1 ? ? 
4.950 6.230  ? ? ? ? ? 2022 ? 100.000 ? ? ? ? 0.108 ? ? ? ? ? ? ? ? 13.400 ? 1.000 ? ? ? ? 0 9  1 ? ? 
6.230 30.000 ? ? ? ? ? 2221 ? 99.600  ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 12.200 ? 1.000 ? ? ? ? 0 10 1 ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5CHG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     19520 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.892 
_refine.ls_d_res_high                            2.900 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_R_factor_obs                          0.2093 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2051 
_refine.ls_R_factor_R_free                       0.2474 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.00 
_refine.ls_number_reflns_R_free                  1952 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1XSL 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.30 
_refine.pdbx_overall_phase_error                 22.62 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3845 
_refine_hist.pdbx_number_atoms_nucleic_acid   243 
_refine_hist.pdbx_number_atoms_ligand         38 
_refine_hist.number_atoms_solvent             18 
_refine_hist.number_atoms_total               4144 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        26.892 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 4234 'X-RAY DIFFRACTION' ? 
f_angle_d          0.860  ? ? 5773 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.248 ? ? 1600 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.030  ? ? 622  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 711  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.9000 2.9724  1200 0.2698 100.00 0.2839 . . 134 . . 
'X-RAY DIFFRACTION' . 2.9724 3.0527  1215 0.2616 100.00 0.3474 . . 134 . . 
'X-RAY DIFFRACTION' . 3.0527 3.1424  1217 0.2458 100.00 0.3395 . . 135 . . 
'X-RAY DIFFRACTION' . 3.1424 3.2437  1228 0.2518 100.00 0.2749 . . 137 . . 
'X-RAY DIFFRACTION' . 3.2437 3.3594  1236 0.2397 100.00 0.2759 . . 138 . . 
'X-RAY DIFFRACTION' . 3.3594 3.4936  1225 0.2365 100.00 0.2897 . . 135 . . 
'X-RAY DIFFRACTION' . 3.4936 3.6522  1232 0.2169 100.00 0.2845 . . 138 . . 
'X-RAY DIFFRACTION' . 3.6522 3.8443  1226 0.2105 100.00 0.2437 . . 135 . . 
'X-RAY DIFFRACTION' . 3.8443 4.0844  1232 0.1833 100.00 0.2159 . . 138 . . 
'X-RAY DIFFRACTION' . 4.0844 4.3985  1272 0.1802 100.00 0.1939 . . 141 . . 
'X-RAY DIFFRACTION' . 4.3985 4.8388  1258 0.1696 100.00 0.2168 . . 140 . . 
'X-RAY DIFFRACTION' . 4.8388 5.5337  1282 0.1817 100.00 0.2251 . . 142 . . 
'X-RAY DIFFRACTION' . 5.5337 6.9518  1319 0.1988 100.00 0.2515 . . 147 . . 
'X-RAY DIFFRACTION' . 6.9518 26.8934 1426 0.1862 100.00 0.2172 . . 158 . . 
# 
_struct.entry_id                     5CHG 
_struct.title                        'Human DNA polymerase lambda L431A mutant- MgdGTP binary and complex with 6 paired DNA' 
_struct.pdbx_descriptor              'DNA polymerase lambda/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5CHG 
_struct_keywords.text            'DNA polymerase lambda, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 4 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 89  ? ASN A 99  ? GLU A 330 ASN A 340 1 ? 11 
HELX_P HELX_P2  AA2 GLY A 104 ? GLY A 115 ? GLY A 345 GLY A 356 1 ? 12 
HELX_P HELX_P3  AA3 SER A 118 ? ALA A 126 ? SER A 359 ALA A 367 1 ? 9  
HELX_P HELX_P4  AA4 THR A 129 ? HIS A 138 ? THR A 370 HIS A 379 1 ? 10 
HELX_P HELX_P5  AA5 HIS A 138 ? GLU A 144 ? HIS A 379 GLU A 385 1 ? 7  
HELX_P HELX_P6  AA6 ARG A 148 ? ALA A 164 ? ARG A 389 ALA A 405 1 ? 17 
HELX_P HELX_P7  AA7 GLY A 201 ? GLU A 213 ? GLY A 442 GLU A 454 1 ? 13 
HELX_P HELX_P8  AA8 PRO A 254 ? SER A 256 ? PRO A 495 SER A 497 5 ? 3  
HELX_P HELX_P9  AA9 GLU A 257 ? GLY A 267 ? GLU A 498 GLY A 508 1 ? 11 
HELX_P HELX_P10 AB1 SER A 268 ? LYS A 282 ? SER A 509 LYS A 523 1 ? 15 
HELX_P HELX_P11 AB2 THR A 314 ? LEU A 322 ? THR A 555 LEU A 563 1 ? 9  
HELX_P HELX_P12 AB3 GLU A 328 ? ARG A 332 ? GLU A 569 ARG A 573 5 ? 5  
HELX_P HELX_P13 AB4 VAL B 93  ? ASN B 99  ? VAL B 334 ASN B 340 1 ? 7  
HELX_P HELX_P14 AB5 LYS B 106 ? GLN B 113 ? LYS B 347 GLN B 354 1 ? 8  
HELX_P HELX_P15 AB6 SER B 118 ? ALA B 126 ? SER B 359 ALA B 367 1 ? 9  
HELX_P HELX_P16 AB7 THR B 129 ? HIS B 138 ? THR B 370 HIS B 379 1 ? 10 
HELX_P HELX_P17 AB8 SER B 140 ? GLU B 144 ? SER B 381 GLU B 385 5 ? 5  
HELX_P HELX_P18 AB9 ARG B 148 ? ASN B 166 ? ARG B 389 ASN B 407 1 ? 19 
HELX_P HELX_P19 AC1 ILE B 202 ? GLU B 213 ? ILE B 443 GLU B 454 1 ? 12 
HELX_P HELX_P20 AC2 PRO B 254 ? SER B 256 ? PRO B 495 SER B 497 5 ? 3  
HELX_P HELX_P21 AC3 GLU B 257 ? GLY B 267 ? GLU B 498 GLY B 508 1 ? 11 
HELX_P HELX_P22 AC4 SER B 268 ? LYS B 282 ? SER B 509 LYS B 523 1 ? 15 
HELX_P HELX_P23 AC5 THR B 314 ? LEU B 322 ? THR B 555 LEU B 563 1 ? 9  
HELX_P HELX_P24 AC6 GLU B 328 ? ARG B 332 ? GLU B 569 ARG B 573 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 302 SG  ? ? ? 1_555 B CYS 302 SG  ? ? A CYS 543 B CYS 543 6_664 ? ? ? ? ? ? ?            2.040 ? 
metalc1  metalc ? ? A SER 98  O   ? ? ? 1_555 E MG  .   MG  ? ? A SER 339 A MG  601 1_555 ? ? ? ? ? ? ?            2.408 ? 
metalc2  metalc ? ? A ILE 100 O   ? ? ? 1_555 E MG  .   MG  ? ? A ILE 341 A MG  601 1_555 ? ? ? ? ? ? ?            2.510 ? 
metalc3  metalc ? ? A ALA 103 O   ? ? ? 1_555 E MG  .   MG  ? ? A ALA 344 A MG  601 1_555 ? ? ? ? ? ? ?            2.478 ? 
metalc4  metalc ? ? B ASP 186 OD1 ? ? ? 1_555 G MG  .   MG  ? ? B ASP 427 B MG  602 1_555 ? ? ? ? ? ? ?            2.050 ? 
metalc5  metalc ? ? B ASP 188 OD1 ? ? ? 1_555 G MG  .   MG  ? ? B ASP 429 B MG  602 1_555 ? ? ? ? ? ? ?            1.903 ? 
metalc6  metalc ? ? C DT  4   OP1 ? ? ? 1_555 E MG  .   MG  ? ? P DT  4   A MG  601 1_555 ? ? ? ? ? ? ?            2.585 ? 
metalc7  metalc ? ? G MG  .   MG  ? ? ? 1_555 H DGT .   O2G ? ? B MG  602 B DGT 603 1_555 ? ? ? ? ? ? ?            2.380 ? 
metalc8  metalc ? ? G MG  .   MG  ? ? ? 1_555 H DGT .   O2B ? ? B MG  602 B DGT 603 1_555 ? ? ? ? ? ? ?            1.989 ? 
metalc9  metalc ? ? G MG  .   MG  ? ? ? 1_555 H DGT .   O1A ? ? B MG  602 B DGT 603 1_555 ? ? ? ? ? ? ?            2.302 ? 
hydrog1  hydrog ? ? C DC  1   N3  ? ? ? 1_555 D DG  6   N1  ? ? P DC  1   T DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DC  1   N4  ? ? ? 1_555 D DG  6   O6  ? ? P DC  1   T DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DC  1   O2  ? ? ? 1_555 D DG  6   N2  ? ? P DC  1   T DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DA  2   N1  ? ? ? 1_555 D DT  5   N3  ? ? P DA  2   T DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DA  2   N6  ? ? ? 1_555 D DT  5   O4  ? ? P DA  2   T DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DG  3   N1  ? ? ? 1_555 D DC  4   N3  ? ? P DG  3   T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DG  3   N2  ? ? ? 1_555 D DC  4   O2  ? ? P DG  3   T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG  3   O6  ? ? ? 1_555 D DC  4   N4  ? ? P DG  3   T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DT  4   N3  ? ? ? 1_555 D DA  3   N1  ? ? P DT  4   T DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DT  4   O4  ? ? ? 1_555 D DA  3   N6  ? ? P DT  4   T DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DA  5   N1  ? ? ? 1_555 D DT  2   N3  ? ? P DA  5   T DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DA  5   N6  ? ? ? 1_555 D DT  2   O4  ? ? P DA  5   T DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DC  6   N3  ? ? ? 1_555 D DG  1   N1  ? ? P DC  6   T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DC  6   N4  ? ? ? 1_555 D DG  1   O6  ? ? P DC  6   T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DC  6   O2  ? ? ? 1_555 D DG  1   N2  ? ? P DC  6   T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 267 A . ? GLY 508 A SER 268 A ? SER 509 A 1 0.97 
2 GLY 267 B . ? GLY 508 B SER 268 B ? SER 509 B 1 1.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 5 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? parallel      
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? parallel      
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 146 ? PRO A 147 ? MET A 387 PRO A 388 
AA1 2 THR A 183 ? CYS A 184 ? THR A 424 CYS A 425 
AA2 1 LEU A 170 ? ALA A 173 ? LEU A 411 ALA A 414 
AA2 2 VAL A 187 ? THR A 192 ? VAL A 428 THR A 433 
AA2 3 ARG A 246 ? VAL A 252 ? ARG A 487 VAL A 493 
AA2 4 GLN A 229 ? CYS A 236 ? GLN A 470 CYS A 477 
AA2 5 LEU A 216 ? LEU A 220 ? LEU A 457 LEU A 461 
AA3 1 LEU A 170 ? ALA A 173 ? LEU A 411 ALA A 414 
AA3 2 VAL A 187 ? THR A 192 ? VAL A 428 THR A 433 
AA3 3 ARG A 246 ? VAL A 252 ? ARG A 487 VAL A 493 
AA3 4 GLN A 229 ? CYS A 236 ? GLN A 470 CYS A 477 
AA3 5 GLU A 225 ? ASN A 226 ? GLU A 466 ASN A 467 
AA4 1 SER A 285 ? LEU A 286 ? SER A 526 LEU A 527 
AA4 2 LEU A 291 ? THR A 293 ? LEU A 532 THR A 534 
AA4 3 ARG A 308 ? LEU A 310 ? ARG A 549 LEU A 551 
AA5 1 MET B 146 ? PRO B 147 ? MET B 387 PRO B 388 
AA5 2 THR B 183 ? CYS B 184 ? THR B 424 CYS B 425 
AA6 1 LEU B 170 ? CYS B 174 ? LEU B 411 CYS B 415 
AA6 2 VAL B 187 ? THR B 192 ? VAL B 428 THR B 433 
AA6 3 ARG B 246 ? VAL B 252 ? ARG B 487 VAL B 493 
AA6 4 GLN B 229 ? CYS B 236 ? GLN B 470 CYS B 477 
AA6 5 LEU B 216 ? VAL B 221 ? LEU B 457 VAL B 462 
AA7 1 LEU B 170 ? CYS B 174 ? LEU B 411 CYS B 415 
AA7 2 VAL B 187 ? THR B 192 ? VAL B 428 THR B 433 
AA7 3 ARG B 246 ? VAL B 252 ? ARG B 487 VAL B 493 
AA7 4 GLN B 229 ? CYS B 236 ? GLN B 470 CYS B 477 
AA7 5 GLU B 225 ? ASN B 226 ? GLU B 466 ASN B 467 
AA8 1 MET B 284 ? LEU B 286 ? MET B 525 LEU B 527 
AA8 2 LEU B 291 ? THR B 293 ? LEU B 532 THR B 534 
AA8 3 VAL B 309 ? LEU B 310 ? VAL B 550 LEU B 551 
AA9 1 VAL B 295 ? ARG B 297 ? VAL B 536 ARG B 538 
AA9 2 LYS B 303 ? PRO B 306 ? LYS B 544 PRO B 547 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 146 ? N MET A 387 O CYS A 184 ? O CYS A 425 
AA2 1 2 N LEU A 170 ? N LEU A 411 O THR A 192 ? O THR A 433 
AA2 2 3 N VAL A 189 ? N VAL A 430 O ASP A 249 ? O ASP A 490 
AA2 3 4 O LEU A 248 ? O LEU A 489 N GLY A 234 ? N GLY A 475 
AA2 4 5 O VAL A 235 ? O VAL A 476 N THR A 217 ? N THR A 458 
AA3 1 2 N LEU A 170 ? N LEU A 411 O THR A 192 ? O THR A 433 
AA3 2 3 N VAL A 189 ? N VAL A 430 O ASP A 249 ? O ASP A 490 
AA3 3 4 O LEU A 248 ? O LEU A 489 N GLY A 234 ? N GLY A 475 
AA3 4 5 O GLN A 229 ? O GLN A 470 N ASN A 226 ? N ASN A 467 
AA4 1 2 N SER A 285 ? N SER A 526 O SER A 292 ? O SER A 533 
AA4 2 3 N LEU A 291 ? N LEU A 532 O LEU A 310 ? O LEU A 551 
AA5 1 2 N MET B 146 ? N MET B 387 O CYS B 184 ? O CYS B 425 
AA6 1 2 N CYS B 174 ? N CYS B 415 O ASP B 188 ? O ASP B 429 
AA6 2 3 N VAL B 189 ? N VAL B 430 O ASP B 249 ? O ASP B 490 
AA6 3 4 O ILE B 250 ? O ILE B 491 N TYR B 232 ? N TYR B 473 
AA6 4 5 O VAL B 235 ? O VAL B 476 N ASP B 218 ? N ASP B 459 
AA7 1 2 N CYS B 174 ? N CYS B 415 O ASP B 188 ? O ASP B 429 
AA7 2 3 N VAL B 189 ? N VAL B 430 O ASP B 249 ? O ASP B 490 
AA7 3 4 O ILE B 250 ? O ILE B 491 N TYR B 232 ? N TYR B 473 
AA7 4 5 O GLN B 229 ? O GLN B 470 N ASN B 226 ? N ASN B 467 
AA8 1 2 N SER B 285 ? N SER B 526 O SER B 292 ? O SER B 533 
AA8 2 3 N LEU B 291 ? N LEU B 532 O LEU B 310 ? O LEU B 551 
AA9 1 2 N VAL B 296 ? N VAL B 537 O VAL B 304 ? O VAL B 545 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  601 ? 4  'binding site for residue MG A 601'  
AC2 Software B SO4 601 ? 3  'binding site for residue SO4 B 601' 
AC3 Software B MG  602 ? 3  'binding site for residue MG B 602'  
AC4 Software B DGT 603 ? 13 'binding site for residue DGT B 603' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  SER A 98  ? SER A 339 . ? 1_555 ? 
2  AC1 4  ILE A 100 ? ILE A 341 . ? 1_555 ? 
3  AC1 4  ALA A 103 ? ALA A 344 . ? 1_555 ? 
4  AC1 4  DT  C 4   ? DT  P 4   . ? 1_555 ? 
5  AC2 3  ARG B 273 ? ARG B 514 . ? 1_555 ? 
6  AC2 3  ARG B 276 ? ARG B 517 . ? 1_555 ? 
7  AC2 3  DGT H .   ? DGT B 603 . ? 1_555 ? 
8  AC3 3  ASP B 186 ? ASP B 427 . ? 1_555 ? 
9  AC3 3  ASP B 188 ? ASP B 429 . ? 1_555 ? 
10 AC3 3  DGT H .   ? DGT B 603 . ? 1_555 ? 
11 AC4 13 ARG B 145 ? ARG B 386 . ? 1_555 ? 
12 AC4 13 GLY B 175 ? GLY B 416 . ? 1_555 ? 
13 AC4 13 SER B 176 ? SER B 417 . ? 1_555 ? 
14 AC4 13 ARG B 179 ? ARG B 420 . ? 1_555 ? 
15 AC4 13 GLY B 185 ? GLY B 426 . ? 1_555 ? 
16 AC4 13 ASP B 186 ? ASP B 427 . ? 1_555 ? 
17 AC4 13 ASP B 188 ? ASP B 429 . ? 1_555 ? 
18 AC4 13 TYR B 264 ? TYR B 505 . ? 1_555 ? 
19 AC4 13 PHE B 265 ? PHE B 506 . ? 1_555 ? 
20 AC4 13 GLY B 267 ? GLY B 508 . ? 1_555 ? 
21 AC4 13 ASN B 272 ? ASN B 513 . ? 1_555 ? 
22 AC4 13 SO4 F .   ? SO4 B 601 . ? 1_555 ? 
23 AC4 13 MG  G .   ? MG  B 602 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5CHG 
_atom_sites.fract_transf_matrix[1][1]   0.011920 
_atom_sites.fract_transf_matrix[1][2]   0.006882 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013764 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002508 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 89  ? -22.661 65.884 23.363 1.00 37.05  ? 330 GLU A N     1 
ATOM   2    C  CA    . GLU A 1 89  ? -23.245 64.744 22.660 1.00 49.00  ? 330 GLU A CA    1 
ATOM   3    C  C     . GLU A 1 89  ? -22.346 64.191 21.544 1.00 45.08  ? 330 GLU A C     1 
ATOM   4    O  O     . GLU A 1 89  ? -22.797 63.394 20.720 1.00 40.37  ? 330 GLU A O     1 
ATOM   5    C  CB    . GLU A 1 89  ? -24.604 65.121 22.065 1.00 44.54  ? 330 GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 89  ? -24.528 65.927 20.778 1.00 41.90  ? 330 GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 89  ? -25.797 65.808 19.959 1.00 64.08  ? 330 GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 89  ? -26.788 65.254 20.486 1.00 68.53  ? 330 GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 89  ? -25.806 66.258 18.792 1.00 57.89  ? 330 GLU A OE2   1 
ATOM   10   N  N     . SER A 1 90  ? -21.080 64.601 21.520 1.00 39.83  ? 331 SER A N     1 
ATOM   11   C  CA    . SER A 1 90  ? -20.137 64.088 20.528 1.00 33.46  ? 331 SER A CA    1 
ATOM   12   C  C     . SER A 1 90  ? -19.915 62.578 20.679 1.00 34.99  ? 331 SER A C     1 
ATOM   13   O  O     . SER A 1 90  ? -19.976 61.833 19.700 1.00 34.68  ? 331 SER A O     1 
ATOM   14   C  CB    . SER A 1 90  ? -18.799 64.825 20.627 1.00 33.19  ? 331 SER A CB    1 
ATOM   15   O  OG    . SER A 1 90  ? -18.148 64.558 21.861 1.00 40.10  ? 331 SER A OG    1 
ATOM   16   N  N     . VAL A 1 91  ? -19.664 62.132 21.906 1.00 36.17  ? 332 VAL A N     1 
ATOM   17   C  CA    . VAL A 1 91  ? -19.414 60.717 22.176 1.00 30.40  ? 332 VAL A CA    1 
ATOM   18   C  C     . VAL A 1 91  ? -20.578 59.810 21.741 1.00 33.28  ? 332 VAL A C     1 
ATOM   19   O  O     . VAL A 1 91  ? -20.345 58.787 21.093 1.00 30.05  ? 332 VAL A O     1 
ATOM   20   C  CB    . VAL A 1 91  ? -19.098 60.485 23.674 1.00 23.46  ? 332 VAL A CB    1 
ATOM   21   C  CG1   . VAL A 1 91  ? -18.988 59.005 23.976 1.00 26.50  ? 332 VAL A CG1   1 
ATOM   22   C  CG2   . VAL A 1 91  ? -17.817 61.210 24.057 1.00 21.45  ? 332 VAL A CG2   1 
ATOM   23   N  N     . PRO A 1 92  ? -21.832 60.171 22.082 1.00 39.52  ? 333 PRO A N     1 
ATOM   24   C  CA    . PRO A 1 92  ? -22.921 59.350 21.538 1.00 34.83  ? 333 PRO A CA    1 
ATOM   25   C  C     . PRO A 1 92  ? -22.956 59.318 20.011 1.00 30.13  ? 333 PRO A C     1 
ATOM   26   O  O     . PRO A 1 92  ? -23.188 58.254 19.436 1.00 31.45  ? 333 PRO A O     1 
ATOM   27   C  CB    . PRO A 1 92  ? -24.176 60.033 22.087 1.00 29.61  ? 333 PRO A CB    1 
ATOM   28   C  CG    . PRO A 1 92  ? -23.727 60.662 23.345 1.00 30.44  ? 333 PRO A CG    1 
ATOM   29   C  CD    . PRO A 1 92  ? -22.337 61.142 23.073 1.00 33.05  ? 333 PRO A CD    1 
ATOM   30   N  N     . VAL A 1 93  ? -22.724 60.461 19.372 1.00 29.53  ? 334 VAL A N     1 
ATOM   31   C  CA    . VAL A 1 93  ? -22.777 60.551 17.913 1.00 27.48  ? 334 VAL A CA    1 
ATOM   32   C  C     . VAL A 1 93  ? -21.708 59.675 17.249 1.00 26.68  ? 334 VAL A C     1 
ATOM   33   O  O     . VAL A 1 93  ? -21.990 58.986 16.272 1.00 27.10  ? 334 VAL A O     1 
ATOM   34   C  CB    . VAL A 1 93  ? -22.623 62.013 17.441 1.00 27.63  ? 334 VAL A CB    1 
ATOM   35   C  CG1   . VAL A 1 93  ? -22.341 62.075 15.947 1.00 28.38  ? 334 VAL A CG1   1 
ATOM   36   C  CG2   . VAL A 1 93  ? -23.871 62.802 17.774 1.00 26.34  ? 334 VAL A CG2   1 
ATOM   37   N  N     . LEU A 1 94  ? -20.490 59.689 17.787 1.00 26.42  ? 335 LEU A N     1 
ATOM   38   C  CA    . LEU A 1 94  ? -19.433 58.817 17.282 1.00 21.10  ? 335 LEU A CA    1 
ATOM   39   C  C     . LEU A 1 94  ? -19.833 57.349 17.404 1.00 26.43  ? 335 LEU A C     1 
ATOM   40   O  O     . LEU A 1 94  ? -19.632 56.574 16.471 1.00 26.53  ? 335 LEU A O     1 
ATOM   41   C  CB    . LEU A 1 94  ? -18.119 59.071 18.016 1.00 18.64  ? 335 LEU A CB    1 
ATOM   42   C  CG    . LEU A 1 94  ? -17.477 60.444 17.797 1.00 21.86  ? 335 LEU A CG    1 
ATOM   43   C  CD1   . LEU A 1 94  ? -16.164 60.551 18.550 1.00 17.49  ? 335 LEU A CD1   1 
ATOM   44   C  CD2   . LEU A 1 94  ? -17.269 60.735 16.317 1.00 20.82  ? 335 LEU A CD2   1 
ATOM   45   N  N     . GLU A 1 95  ? -20.409 56.970 18.544 1.00 33.45  ? 336 GLU A N     1 
ATOM   46   C  CA    . GLU A 1 95  ? -20.914 55.607 18.727 1.00 31.82  ? 336 GLU A CA    1 
ATOM   47   C  C     . GLU A 1 95  ? -21.986 55.273 17.693 1.00 29.52  ? 336 GLU A C     1 
ATOM   48   O  O     . GLU A 1 95  ? -21.955 54.204 17.085 1.00 29.79  ? 336 GLU A O     1 
ATOM   49   C  CB    . GLU A 1 95  ? -21.471 55.414 20.140 1.00 27.42  ? 336 GLU A CB    1 
ATOM   50   C  CG    . GLU A 1 95  ? -20.466 54.823 21.124 1.00 44.97  ? 336 GLU A CG    1 
ATOM   51   C  CD    . GLU A 1 95  ? -20.669 55.328 22.546 1.00 59.32  ? 336 GLU A CD    1 
ATOM   52   O  OE1   . GLU A 1 95  ? -21.834 55.583 22.929 1.00 59.62  ? 336 GLU A OE1   1 
ATOM   53   O  OE2   . GLU A 1 95  ? -19.658 55.492 23.270 1.00 39.19  ? 336 GLU A OE2   1 
ATOM   54   N  N     . LEU A 1 96  ? -22.922 56.195 17.496 1.00 24.76  ? 337 LEU A N     1 
ATOM   55   C  CA    . LEU A 1 96  ? -23.987 56.022 16.517 1.00 22.47  ? 337 LEU A CA    1 
ATOM   56   C  C     . LEU A 1 96  ? -23.423 55.687 15.145 1.00 26.58  ? 337 LEU A C     1 
ATOM   57   O  O     . LEU A 1 96  ? -23.869 54.745 14.494 1.00 26.95  ? 337 LEU A O     1 
ATOM   58   C  CB    . LEU A 1 96  ? -24.840 57.284 16.433 1.00 22.92  ? 337 LEU A CB    1 
ATOM   59   C  CG    . LEU A 1 96  ? -26.119 57.220 15.604 1.00 22.26  ? 337 LEU A CG    1 
ATOM   60   C  CD1   . LEU A 1 96  ? -27.081 56.220 16.207 1.00 19.70  ? 337 LEU A CD1   1 
ATOM   61   C  CD2   . LEU A 1 96  ? -26.761 58.592 15.538 1.00 23.63  ? 337 LEU A CD2   1 
ATOM   62   N  N     . PHE A 1 97  ? -22.424 56.454 14.721 1.00 29.28  ? 338 PHE A N     1 
ATOM   63   C  CA    . PHE A 1 97  ? -21.806 56.255 13.413 1.00 25.39  ? 338 PHE A CA    1 
ATOM   64   C  C     . PHE A 1 97  ? -20.962 54.987 13.376 1.00 25.65  ? 338 PHE A C     1 
ATOM   65   O  O     . PHE A 1 97  ? -20.917 54.299 12.357 1.00 28.75  ? 338 PHE A O     1 
ATOM   66   C  CB    . PHE A 1 97  ? -20.943 57.459 13.034 1.00 19.55  ? 338 PHE A CB    1 
ATOM   67   C  CG    . PHE A 1 97  ? -21.720 58.722 12.810 1.00 18.93  ? 338 PHE A CG    1 
ATOM   68   C  CD1   . PHE A 1 97  ? -23.094 58.691 12.649 1.00 20.98  ? 338 PHE A CD1   1 
ATOM   69   C  CD2   . PHE A 1 97  ? -21.074 59.941 12.745 1.00 20.38  ? 338 PHE A CD2   1 
ATOM   70   C  CE1   . PHE A 1 97  ? -23.810 59.851 12.438 1.00 20.44  ? 338 PHE A CE1   1 
ATOM   71   C  CE2   . PHE A 1 97  ? -21.785 61.103 12.531 1.00 23.57  ? 338 PHE A CE2   1 
ATOM   72   C  CZ    . PHE A 1 97  ? -23.158 61.057 12.378 1.00 22.06  ? 338 PHE A CZ    1 
ATOM   73   N  N     . SER A 1 98  ? -20.299 54.681 14.489 1.00 23.92  ? 339 SER A N     1 
ATOM   74   C  CA    . SER A 1 98  ? -19.399 53.536 14.563 1.00 22.22  ? 339 SER A CA    1 
ATOM   75   C  C     . SER A 1 98  ? -20.131 52.206 14.452 1.00 23.73  ? 339 SER A C     1 
ATOM   76   O  O     . SER A 1 98  ? -19.534 51.187 14.109 1.00 26.90  ? 339 SER A O     1 
ATOM   77   C  CB    . SER A 1 98  ? -18.608 53.566 15.868 1.00 28.73  ? 339 SER A CB    1 
ATOM   78   O  OG    . SER A 1 98  ? -17.815 54.734 15.952 1.00 33.99  ? 339 SER A OG    1 
ATOM   79   N  N     . ASN A 1 99  ? -21.423 52.210 14.749 1.00 24.00  ? 340 ASN A N     1 
ATOM   80   C  CA    . ASN A 1 99  ? -22.202 50.986 14.672 1.00 22.54  ? 340 ASN A CA    1 
ATOM   81   C  C     . ASN A 1 99  ? -22.583 50.662 13.238 1.00 23.46  ? 340 ASN A C     1 
ATOM   82   O  O     . ASN A 1 99  ? -23.247 49.660 12.976 1.00 30.87  ? 340 ASN A O     1 
ATOM   83   C  CB    . ASN A 1 99  ? -23.453 51.080 15.546 1.00 24.09  ? 340 ASN A CB    1 
ATOM   84   C  CG    . ASN A 1 99  ? -23.142 50.941 17.026 1.00 23.28  ? 340 ASN A CG    1 
ATOM   85   O  OD1   . ASN A 1 99  ? -22.166 50.299 17.411 1.00 19.01  ? 340 ASN A OD1   1 
ATOM   86   N  ND2   . ASN A 1 99  ? -23.974 51.545 17.864 1.00 31.05  ? 340 ASN A ND2   1 
ATOM   87   N  N     . ILE A 1 100 ? -22.168 51.512 12.305 1.00 22.36  ? 341 ILE A N     1 
ATOM   88   C  CA    . ILE A 1 100 ? -22.338 51.197 10.896 1.00 22.95  ? 341 ILE A CA    1 
ATOM   89   C  C     . ILE A 1 100 ? -21.233 50.227 10.492 1.00 26.77  ? 341 ILE A C     1 
ATOM   90   O  O     . ILE A 1 100 ? -20.073 50.396 10.883 1.00 23.53  ? 341 ILE A O     1 
ATOM   91   C  CB    . ILE A 1 100 ? -22.302 52.454 10.006 1.00 24.78  ? 341 ILE A CB    1 
ATOM   92   C  CG1   . ILE A 1 100 ? -23.402 53.436 10.415 1.00 27.69  ? 341 ILE A CG1   1 
ATOM   93   C  CG2   . ILE A 1 100 ? -22.475 52.080 8.539  1.00 25.22  ? 341 ILE A CG2   1 
ATOM   94   C  CD1   . ILE A 1 100 ? -23.519 54.644 9.497  1.00 22.29  ? 341 ILE A CD1   1 
ATOM   95   N  N     . TRP A 1 101 ? -21.598 49.191 9.743  1.00 24.49  ? 342 TRP A N     1 
ATOM   96   C  CA    . TRP A 1 101 ? -20.620 48.219 9.286  1.00 20.64  ? 342 TRP A CA    1 
ATOM   97   C  C     . TRP A 1 101 ? -19.746 48.868 8.224  1.00 23.88  ? 342 TRP A C     1 
ATOM   98   O  O     . TRP A 1 101 ? -20.251 49.411 7.245  1.00 28.59  ? 342 TRP A O     1 
ATOM   99   C  CB    . TRP A 1 101 ? -21.305 46.960 8.741  1.00 20.63  ? 342 TRP A CB    1 
ATOM   100  C  CG    . TRP A 1 101 ? -20.396 45.762 8.710  1.00 23.02  ? 342 TRP A CG    1 
ATOM   101  C  CD1   . TRP A 1 101 ? -20.324 44.761 9.639  1.00 24.42  ? 342 TRP A CD1   1 
ATOM   102  C  CD2   . TRP A 1 101 ? -19.419 45.448 7.712  1.00 25.17  ? 342 TRP A CD2   1 
ATOM   103  N  NE1   . TRP A 1 101 ? -19.367 43.846 9.279  1.00 26.18  ? 342 TRP A NE1   1 
ATOM   104  C  CE2   . TRP A 1 101 ? -18.794 44.246 8.094  1.00 25.89  ? 342 TRP A CE2   1 
ATOM   105  C  CE3   . TRP A 1 101 ? -19.009 46.071 6.524  1.00 21.05  ? 342 TRP A CE3   1 
ATOM   106  C  CZ2   . TRP A 1 101 ? -17.786 43.650 7.344  1.00 23.36  ? 342 TRP A CZ2   1 
ATOM   107  C  CZ3   . TRP A 1 101 ? -18.008 45.481 5.781  1.00 25.00  ? 342 TRP A CZ3   1 
ATOM   108  C  CH2   . TRP A 1 101 ? -17.406 44.283 6.193  1.00 25.30  ? 342 TRP A CH2   1 
ATOM   109  N  N     . GLY A 1 102 ? -18.434 48.820 8.420  1.00 24.21  ? 343 GLY A N     1 
ATOM   110  C  CA    . GLY A 1 102 ? -17.510 49.420 7.476  1.00 22.07  ? 343 GLY A CA    1 
ATOM   111  C  C     . GLY A 1 102 ? -17.116 50.824 7.890  1.00 25.68  ? 343 GLY A C     1 
ATOM   112  O  O     . GLY A 1 102 ? -16.342 51.495 7.209  1.00 25.72  ? 343 GLY A O     1 
ATOM   113  N  N     . ALA A 1 103 ? -17.656 51.269 9.018  1.00 28.41  ? 344 ALA A N     1 
ATOM   114  C  CA    . ALA A 1 103 ? -17.315 52.569 9.575  1.00 20.60  ? 344 ALA A CA    1 
ATOM   115  C  C     . ALA A 1 103 ? -16.693 52.422 10.962 1.00 20.29  ? 344 ALA A C     1 
ATOM   116  O  O     . ALA A 1 103 ? -17.278 51.798 11.842 1.00 25.81  ? 344 ALA A O     1 
ATOM   117  C  CB    . ALA A 1 103 ? -18.545 53.453 9.636  1.00 20.22  ? 344 ALA A CB    1 
ATOM   118  N  N     . GLY A 1 104 ? -15.502 52.986 11.146 1.00 20.01  ? 345 GLY A N     1 
ATOM   119  C  CA    . GLY A 1 104 ? -14.822 52.974 12.433 1.00 22.37  ? 345 GLY A CA    1 
ATOM   120  C  C     . GLY A 1 104 ? -14.717 54.364 13.034 1.00 20.81  ? 345 GLY A C     1 
ATOM   121  O  O     . GLY A 1 104 ? -15.441 55.272 12.632 1.00 24.08  ? 345 GLY A O     1 
ATOM   122  N  N     . THR A 1 105 ? -13.818 54.555 13.990 1.00 16.39  ? 346 THR A N     1 
ATOM   123  C  CA    . THR A 1 105 ? -13.728 55.865 14.625 1.00 23.59  ? 346 THR A CA    1 
ATOM   124  C  C     . THR A 1 105 ? -13.153 56.936 13.692 1.00 25.26  ? 346 THR A C     1 
ATOM   125  O  O     . THR A 1 105 ? -13.490 58.110 13.830 1.00 27.80  ? 346 THR A O     1 
ATOM   126  C  CB    . THR A 1 105 ? -12.890 55.825 15.915 1.00 17.64  ? 346 THR A CB    1 
ATOM   127  O  OG1   . THR A 1 105 ? -11.728 55.023 15.704 1.00 28.38  ? 346 THR A OG1   1 
ATOM   128  C  CG2   . THR A 1 105 ? -13.704 55.224 17.047 1.00 25.17  ? 346 THR A CG2   1 
ATOM   129  N  N     . LYS A 1 106 ? -12.308 56.543 12.742 1.00 20.71  ? 347 LYS A N     1 
ATOM   130  C  CA    . LYS A 1 106 ? -11.721 57.514 11.816 1.00 19.04  ? 347 LYS A CA    1 
ATOM   131  C  C     . LYS A 1 106 ? -12.770 58.166 10.916 1.00 18.71  ? 347 LYS A C     1 
ATOM   132  O  O     . LYS A 1 106 ? -12.764 59.380 10.723 1.00 18.70  ? 347 LYS A O     1 
ATOM   133  C  CB    . LYS A 1 106 ? -10.647 56.859 10.952 1.00 21.35  ? 347 LYS A CB    1 
ATOM   134  C  CG    . LYS A 1 106 ? -9.362  56.546 11.684 1.00 22.87  ? 347 LYS A CG    1 
ATOM   135  C  CD    . LYS A 1 106 ? -8.766  57.786 12.303 1.00 19.21  ? 347 LYS A CD    1 
ATOM   136  C  CE    . LYS A 1 106 ? -7.564  57.426 13.159 1.00 26.71  ? 347 LYS A CE    1 
ATOM   137  N  NZ    . LYS A 1 106 ? -7.070  58.588 13.955 1.00 37.28  ? 347 LYS A NZ    1 
ATOM   138  N  N     . THR A 1 107 ? -13.667 57.358 10.363 1.00 20.12  ? 348 THR A N     1 
ATOM   139  C  CA    . THR A 1 107 ? -14.697 57.874 9.472  1.00 20.10  ? 348 THR A CA    1 
ATOM   140  C  C     . THR A 1 107 ? -15.800 58.572 10.272 1.00 21.35  ? 348 THR A C     1 
ATOM   141  O  O     . THR A 1 107 ? -16.367 59.568 9.824  1.00 21.07  ? 348 THR A O     1 
ATOM   142  C  CB    . THR A 1 107 ? -15.297 56.750 8.589  1.00 17.34  ? 348 THR A CB    1 
ATOM   143  O  OG1   . THR A 1 107 ? -16.405 57.254 7.837  1.00 25.59  ? 348 THR A OG1   1 
ATOM   144  C  CG2   . THR A 1 107 ? -15.804 55.657 9.433  1.00 23.67  ? 348 THR A CG2   1 
ATOM   145  N  N     . ALA A 1 108 ? -16.092 58.064 11.463 1.00 21.44  ? 349 ALA A N     1 
ATOM   146  C  CA    . ALA A 1 108 ? -17.102 58.686 12.309 1.00 21.85  ? 349 ALA A CA    1 
ATOM   147  C  C     . ALA A 1 108 ? -16.649 60.092 12.704 1.00 27.33  ? 349 ALA A C     1 
ATOM   148  O  O     . ALA A 1 108 ? -17.440 61.041 12.674 1.00 24.54  ? 349 ALA A O     1 
ATOM   149  C  CB    . ALA A 1 108 ? -17.370 57.836 13.538 1.00 18.77  ? 349 ALA A CB    1 
ATOM   150  N  N     . GLN A 1 109 ? -15.369 60.220 13.057 1.00 22.03  ? 350 GLN A N     1 
ATOM   151  C  CA    . GLN A 1 109 ? -14.790 61.517 13.385 1.00 20.61  ? 350 GLN A CA    1 
ATOM   152  C  C     . GLN A 1 109 ? -14.835 62.451 12.183 1.00 24.38  ? 350 GLN A C     1 
ATOM   153  O  O     . GLN A 1 109 ? -15.050 63.655 12.335 1.00 29.43  ? 350 GLN A O     1 
ATOM   154  C  CB    . GLN A 1 109 ? -13.350 61.362 13.877 1.00 18.91  ? 350 GLN A CB    1 
ATOM   155  C  CG    . GLN A 1 109 ? -13.243 60.912 15.318 1.00 22.97  ? 350 GLN A CG    1 
ATOM   156  C  CD    . GLN A 1 109 ? -11.820 60.615 15.739 1.00 30.69  ? 350 GLN A CD    1 
ATOM   157  O  OE1   . GLN A 1 109 ? -11.436 59.454 15.879 1.00 38.26  ? 350 GLN A OE1   1 
ATOM   158  N  NE2   . GLN A 1 109 ? -11.031 61.663 15.958 1.00 34.91  ? 350 GLN A NE2   1 
ATOM   159  N  N     . MET A 1 110 ? -14.638 61.897 10.990 1.00 20.59  ? 351 MET A N     1 
ATOM   160  C  CA    . MET A 1 110 ? -14.719 62.692 9.771  1.00 19.80  ? 351 MET A CA    1 
ATOM   161  C  C     . MET A 1 110 ? -16.153 63.173 9.553  1.00 22.62  ? 351 MET A C     1 
ATOM   162  O  O     . MET A 1 110 ? -16.391 64.362 9.327  1.00 24.58  ? 351 MET A O     1 
ATOM   163  C  CB    . MET A 1 110 ? -14.237 61.892 8.559  1.00 16.58  ? 351 MET A CB    1 
ATOM   164  C  CG    . MET A 1 110 ? -13.829 62.761 7.382  1.00 16.41  ? 351 MET A CG    1 
ATOM   165  S  SD    . MET A 1 110 ? -13.815 61.885 5.800  1.00 32.04  ? 351 MET A SD    1 
ATOM   166  C  CE    . MET A 1 110 ? -15.570 61.731 5.478  1.00 17.15  ? 351 MET A CE    1 
ATOM   167  N  N     . TRP A 1 111 ? -17.105 62.246 9.632  1.00 19.71  ? 352 TRP A N     1 
ATOM   168  C  CA    . TRP A 1 111 ? -18.511 62.584 9.462  1.00 20.91  ? 352 TRP A CA    1 
ATOM   169  C  C     . TRP A 1 111 ? -18.967 63.624 10.480 1.00 23.61  ? 352 TRP A C     1 
ATOM   170  O  O     . TRP A 1 111 ? -19.792 64.486 10.171 1.00 20.81  ? 352 TRP A O     1 
ATOM   171  C  CB    . TRP A 1 111 ? -19.382 61.333 9.573  1.00 23.22  ? 352 TRP A CB    1 
ATOM   172  C  CG    . TRP A 1 111 ? -19.276 60.418 8.393  1.00 22.47  ? 352 TRP A CG    1 
ATOM   173  C  CD1   . TRP A 1 111 ? -18.784 60.724 7.162  1.00 20.32  ? 352 TRP A CD1   1 
ATOM   174  C  CD2   . TRP A 1 111 ? -19.659 59.039 8.342  1.00 22.03  ? 352 TRP A CD2   1 
ATOM   175  N  NE1   . TRP A 1 111 ? -18.843 59.626 6.343  1.00 19.52  ? 352 TRP A NE1   1 
ATOM   176  C  CE2   . TRP A 1 111 ? -19.373 58.577 7.044  1.00 21.06  ? 352 TRP A CE2   1 
ATOM   177  C  CE3   . TRP A 1 111 ? -20.214 58.150 9.269  1.00 20.97  ? 352 TRP A CE3   1 
ATOM   178  C  CZ2   . TRP A 1 111 ? -19.625 57.266 6.647  1.00 26.14  ? 352 TRP A CZ2   1 
ATOM   179  C  CZ3   . TRP A 1 111 ? -20.465 56.849 8.873  1.00 24.27  ? 352 TRP A CZ3   1 
ATOM   180  C  CH2   . TRP A 1 111 ? -20.170 56.419 7.572  1.00 26.46  ? 352 TRP A CH2   1 
ATOM   181  N  N     . TYR A 1 112 ? -18.429 63.541 11.694 1.00 20.71  ? 353 TYR A N     1 
ATOM   182  C  CA    . TYR A 1 112 ? -18.791 64.493 12.730 1.00 20.31  ? 353 TYR A CA    1 
ATOM   183  C  C     . TYR A 1 112 ? -18.314 65.896 12.368 1.00 25.12  ? 353 TYR A C     1 
ATOM   184  O  O     . TYR A 1 112 ? -19.015 66.884 12.595 1.00 23.90  ? 353 TYR A O     1 
ATOM   185  C  CB    . TYR A 1 112 ? -18.214 64.080 14.078 1.00 19.68  ? 353 TYR A CB    1 
ATOM   186  C  CG    . TYR A 1 112 ? -18.691 64.965 15.204 1.00 20.47  ? 353 TYR A CG    1 
ATOM   187  C  CD1   . TYR A 1 112 ? -17.943 66.054 15.625 1.00 21.51  ? 353 TYR A CD1   1 
ATOM   188  C  CD2   . TYR A 1 112 ? -19.908 64.727 15.824 1.00 24.88  ? 353 TYR A CD2   1 
ATOM   189  C  CE1   . TYR A 1 112 ? -18.385 66.872 16.649 1.00 25.93  ? 353 TYR A CE1   1 
ATOM   190  C  CE2   . TYR A 1 112 ? -20.359 65.532 16.847 1.00 25.92  ? 353 TYR A CE2   1 
ATOM   191  C  CZ    . TYR A 1 112 ? -19.597 66.608 17.255 1.00 29.93  ? 353 TYR A CZ    1 
ATOM   192  O  OH    . TYR A 1 112 ? -20.049 67.415 18.276 1.00 28.33  ? 353 TYR A OH    1 
ATOM   193  N  N     . GLN A 1 113 ? -17.118 65.984 11.801 1.00 22.95  ? 354 GLN A N     1 
ATOM   194  C  CA    . GLN A 1 113 ? -16.566 67.279 11.450 1.00 21.30  ? 354 GLN A CA    1 
ATOM   195  C  C     . GLN A 1 113 ? -17.352 67.914 10.305 1.00 23.14  ? 354 GLN A C     1 
ATOM   196  O  O     . GLN A 1 113 ? -17.434 69.139 10.206 1.00 26.66  ? 354 GLN A O     1 
ATOM   197  C  CB    . GLN A 1 113 ? -15.090 67.152 11.084 1.00 20.71  ? 354 GLN A CB    1 
ATOM   198  C  CG    . GLN A 1 113 ? -14.422 68.488 10.847 1.00 22.70  ? 354 GLN A CG    1 
ATOM   199  C  CD    . GLN A 1 113 ? -12.920 68.393 10.851 1.00 25.24  ? 354 GLN A CD    1 
ATOM   200  O  OE1   . GLN A 1 113 ? -12.354 67.309 10.987 1.00 30.57  ? 354 GLN A OE1   1 
ATOM   201  N  NE2   . GLN A 1 113 ? -12.259 69.532 10.705 1.00 28.41  ? 354 GLN A NE2   1 
ATOM   202  N  N     . GLN A 1 114 ? -17.942 67.081 9.452  1.00 24.13  ? 355 GLN A N     1 
ATOM   203  C  CA    . GLN A 1 114 ? -18.774 67.570 8.354  1.00 22.17  ? 355 GLN A CA    1 
ATOM   204  C  C     . GLN A 1 114 ? -20.089 68.142 8.871  1.00 21.21  ? 355 GLN A C     1 
ATOM   205  O  O     . GLN A 1 114 ? -20.779 68.862 8.153  1.00 22.88  ? 355 GLN A O     1 
ATOM   206  C  CB    . GLN A 1 114 ? -19.050 66.456 7.338  1.00 20.60  ? 355 GLN A CB    1 
ATOM   207  C  CG    . GLN A 1 114 ? -17.805 65.909 6.658  1.00 19.20  ? 355 GLN A CG    1 
ATOM   208  C  CD    . GLN A 1 114 ? -18.118 65.091 5.417  1.00 21.19  ? 355 GLN A CD    1 
ATOM   209  O  OE1   . GLN A 1 114 ? -17.907 63.883 5.395  1.00 25.70  ? 355 GLN A OE1   1 
ATOM   210  N  NE2   . GLN A 1 114 ? -18.606 65.746 4.378  1.00 18.66  ? 355 GLN A NE2   1 
ATOM   211  N  N     . GLY A 1 115 ? -20.429 67.819 10.117 1.00 21.82  ? 356 GLY A N     1 
ATOM   212  C  CA    . GLY A 1 115 ? -21.613 68.372 10.750 1.00 19.49  ? 356 GLY A CA    1 
ATOM   213  C  C     . GLY A 1 115 ? -22.778 67.411 10.845 1.00 22.47  ? 356 GLY A C     1 
ATOM   214  O  O     . GLY A 1 115 ? -23.888 67.798 11.214 1.00 22.68  ? 356 GLY A O     1 
ATOM   215  N  N     . PHE A 1 116 ? -22.528 66.154 10.501 1.00 27.45  ? 357 PHE A N     1 
ATOM   216  C  CA    . PHE A 1 116 ? -23.559 65.130 10.563 1.00 27.45  ? 357 PHE A CA    1 
ATOM   217  C  C     . PHE A 1 116 ? -23.786 64.721 12.014 1.00 24.78  ? 357 PHE A C     1 
ATOM   218  O  O     . PHE A 1 116 ? -22.834 64.624 12.787 1.00 22.43  ? 357 PHE A O     1 
ATOM   219  C  CB    . PHE A 1 116 ? -23.166 63.922 9.707  1.00 27.80  ? 357 PHE A CB    1 
ATOM   220  C  CG    . PHE A 1 116 ? -22.799 64.270 8.283  1.00 26.72  ? 357 PHE A CG    1 
ATOM   221  C  CD1   . PHE A 1 116 ? -23.423 65.318 7.618  1.00 25.05  ? 357 PHE A CD1   1 
ATOM   222  C  CD2   . PHE A 1 116 ? -21.836 63.535 7.606  1.00 25.62  ? 357 PHE A CD2   1 
ATOM   223  C  CE1   . PHE A 1 116 ? -23.082 65.631 6.312  1.00 26.74  ? 357 PHE A CE1   1 
ATOM   224  C  CE2   . PHE A 1 116 ? -21.490 63.840 6.299  1.00 23.52  ? 357 PHE A CE2   1 
ATOM   225  C  CZ    . PHE A 1 116 ? -22.113 64.890 5.651  1.00 27.49  ? 357 PHE A CZ    1 
ATOM   226  N  N     . ARG A 1 117 ? -25.045 64.513 12.389 1.00 27.47  ? 358 ARG A N     1 
ATOM   227  C  CA    . ARG A 1 117 ? -25.388 64.127 13.755 1.00 26.85  ? 358 ARG A CA    1 
ATOM   228  C  C     . ARG A 1 117 ? -26.298 62.897 13.775 1.00 28.78  ? 358 ARG A C     1 
ATOM   229  O  O     . ARG A 1 117 ? -26.338 62.163 14.765 1.00 36.99  ? 358 ARG A O     1 
ATOM   230  C  CB    . ARG A 1 117 ? -26.056 65.295 14.488 1.00 25.86  ? 358 ARG A CB    1 
ATOM   231  C  CG    . ARG A 1 117 ? -25.167 66.526 14.676 1.00 23.59  ? 358 ARG A CG    1 
ATOM   232  C  CD    . ARG A 1 117 ? -23.986 66.196 15.577 1.00 26.22  ? 358 ARG A CD    1 
ATOM   233  N  NE    . ARG A 1 117 ? -23.090 67.326 15.792 1.00 22.49  ? 358 ARG A NE    1 
ATOM   234  C  CZ    . ARG A 1 117 ? -22.022 67.575 15.042 1.00 21.21  ? 358 ARG A CZ    1 
ATOM   235  N  NH1   . ARG A 1 117 ? -21.724 66.790 14.012 1.00 22.40  ? 358 ARG A NH1   1 
ATOM   236  N  NH2   . ARG A 1 117 ? -21.250 68.610 15.313 1.00 20.57  ? 358 ARG A NH2   1 
ATOM   237  N  N     . SER A 1 118 ? -27.006 62.663 12.674 1.00 23.83  ? 359 SER A N     1 
ATOM   238  C  CA    . SER A 1 118 ? -27.972 61.571 12.588 1.00 23.62  ? 359 SER A CA    1 
ATOM   239  C  C     . SER A 1 118 ? -27.670 60.596 11.452 1.00 28.03  ? 359 SER A C     1 
ATOM   240  O  O     . SER A 1 118 ? -26.929 60.926 10.525 1.00 25.40  ? 359 SER A O     1 
ATOM   241  C  CB    . SER A 1 118 ? -29.378 62.140 12.404 1.00 24.79  ? 359 SER A CB    1 
ATOM   242  O  OG    . SER A 1 118 ? -29.489 62.841 11.168 1.00 25.57  ? 359 SER A OG    1 
ATOM   243  N  N     . LEU A 1 119 ? -28.249 59.399 11.532 1.00 32.81  ? 360 LEU A N     1 
ATOM   244  C  CA    . LEU A 1 119 ? -28.145 58.407 10.464 1.00 26.40  ? 360 LEU A CA    1 
ATOM   245  C  C     . LEU A 1 119 ? -28.735 58.952 9.170  1.00 27.22  ? 360 LEU A C     1 
ATOM   246  O  O     . LEU A 1 119 ? -28.287 58.605 8.079  1.00 29.11  ? 360 LEU A O     1 
ATOM   247  C  CB    . LEU A 1 119 ? -28.858 57.108 10.855 1.00 24.83  ? 360 LEU A CB    1 
ATOM   248  C  CG    . LEU A 1 119 ? -28.223 56.286 11.977 1.00 28.26  ? 360 LEU A CG    1 
ATOM   249  C  CD1   . LEU A 1 119 ? -29.064 55.071 12.303 1.00 29.39  ? 360 LEU A CD1   1 
ATOM   250  C  CD2   . LEU A 1 119 ? -26.827 55.862 11.596 1.00 28.92  ? 360 LEU A CD2   1 
ATOM   251  N  N     . GLU A 1 120 ? -29.744 59.807 9.291  1.00 27.36  ? 361 GLU A N     1 
ATOM   252  C  CA    . GLU A 1 120 ? -30.356 60.410 8.113  1.00 31.11  ? 361 GLU A CA    1 
ATOM   253  C  C     . GLU A 1 120 ? -29.372 61.344 7.404  1.00 30.17  ? 361 GLU A C     1 
ATOM   254  O  O     . GLU A 1 120 ? -29.290 61.373 6.176  1.00 26.76  ? 361 GLU A O     1 
ATOM   255  C  CB    . GLU A 1 120 ? -31.632 61.163 8.498  1.00 28.52  ? 361 GLU A CB    1 
ATOM   256  C  CG    . GLU A 1 120 ? -32.316 61.846 7.328  1.00 32.18  ? 361 GLU A CG    1 
ATOM   257  C  CD    . GLU A 1 120 ? -32.653 60.886 6.200  1.00 43.85  ? 361 GLU A CD    1 
ATOM   258  O  OE1   . GLU A 1 120 ? -32.794 59.670 6.467  1.00 39.86  ? 361 GLU A OE1   1 
ATOM   259  O  OE2   . GLU A 1 120 ? -32.762 61.352 5.043  1.00 36.89  ? 361 GLU A OE2   1 
ATOM   260  N  N     . ASP A 1 121 ? -28.621 62.098 8.198  1.00 28.42  ? 362 ASP A N     1 
ATOM   261  C  CA    . ASP A 1 121 ? -27.565 62.955 7.685  1.00 28.41  ? 362 ASP A CA    1 
ATOM   262  C  C     . ASP A 1 121 ? -26.549 62.153 6.875  1.00 27.91  ? 362 ASP A C     1 
ATOM   263  O  O     . ASP A 1 121 ? -26.134 62.569 5.794  1.00 29.92  ? 362 ASP A O     1 
ATOM   264  C  CB    . ASP A 1 121 ? -26.872 63.669 8.840  1.00 27.95  ? 362 ASP A CB    1 
ATOM   265  C  CG    . ASP A 1 121 ? -27.687 64.813 9.381  1.00 33.28  ? 362 ASP A CG    1 
ATOM   266  O  OD1   . ASP A 1 121 ? -28.607 65.278 8.670  1.00 36.02  ? 362 ASP A OD1   1 
ATOM   267  O  OD2   . ASP A 1 121 ? -27.414 65.232 10.528 1.00 37.04  ? 362 ASP A OD2   1 
ATOM   268  N  N     . ILE A 1 122 ? -26.162 60.995 7.400  1.00 26.58  ? 363 ILE A N     1 
ATOM   269  C  CA    . ILE A 1 122 ? -25.200 60.129 6.728  1.00 28.22  ? 363 ILE A CA    1 
ATOM   270  C  C     . ILE A 1 122 ? -25.768 59.631 5.400  1.00 28.20  ? 363 ILE A C     1 
ATOM   271  O  O     . ILE A 1 122 ? -25.073 59.607 4.386  1.00 27.09  ? 363 ILE A O     1 
ATOM   272  C  CB    . ILE A 1 122 ? -24.818 58.930 7.615  1.00 21.11  ? 363 ILE A CB    1 
ATOM   273  C  CG1   . ILE A 1 122 ? -24.103 59.413 8.878  1.00 24.09  ? 363 ILE A CG1   1 
ATOM   274  C  CG2   . ILE A 1 122 ? -23.907 57.971 6.871  1.00 19.60  ? 363 ILE A CG2   1 
ATOM   275  C  CD1   . ILE A 1 122 ? -22.947 60.355 8.612  1.00 20.99  ? 363 ILE A CD1   1 
ATOM   276  N  N     . ARG A 1 123 ? -27.045 59.266 5.412  1.00 29.96  ? 364 ARG A N     1 
ATOM   277  C  CA    . ARG A 1 123 ? -27.696 58.684 4.247  1.00 30.18  ? 364 ARG A CA    1 
ATOM   278  C  C     . ARG A 1 123 ? -27.866 59.671 3.103  1.00 29.35  ? 364 ARG A C     1 
ATOM   279  O  O     . ARG A 1 123 ? -27.815 59.286 1.939  1.00 34.78  ? 364 ARG A O     1 
ATOM   280  C  CB    . ARG A 1 123 ? -29.069 58.128 4.629  1.00 32.65  ? 364 ARG A CB    1 
ATOM   281  C  CG    . ARG A 1 123 ? -29.583 57.040 3.697  1.00 32.45  ? 364 ARG A CG    1 
ATOM   282  C  CD    . ARG A 1 123 ? -31.095 56.940 3.762  1.00 41.23  ? 364 ARG A CD    1 
ATOM   283  N  NE    . ARG A 1 123 ? -31.704 58.262 3.647  1.00 45.23  ? 364 ARG A NE    1 
ATOM   284  C  CZ    . ARG A 1 123 ? -32.031 58.843 2.494  1.00 46.52  ? 364 ARG A CZ    1 
ATOM   285  N  NH1   . ARG A 1 123 ? -31.811 58.225 1.338  1.00 41.63  ? 364 ARG A NH1   1 
ATOM   286  N  NH2   . ARG A 1 123 ? -32.574 60.054 2.495  1.00 41.22  ? 364 ARG A NH2   1 
ATOM   287  N  N     . SER A 1 124 ? -28.074 60.943 3.421  1.00 28.73  ? 365 SER A N     1 
ATOM   288  C  CA    . SER A 1 124 ? -28.410 61.896 2.370  1.00 31.39  ? 365 SER A CA    1 
ATOM   289  C  C     . SER A 1 124 ? -27.206 62.666 1.852  1.00 32.85  ? 365 SER A C     1 
ATOM   290  O  O     . SER A 1 124 ? -27.189 63.055 0.685  1.00 42.35  ? 365 SER A O     1 
ATOM   291  C  CB    . SER A 1 124 ? -29.471 62.890 2.851  1.00 30.12  ? 365 SER A CB    1 
ATOM   292  O  OG    . SER A 1 124 ? -29.105 63.503 4.074  1.00 30.30  ? 365 SER A OG    1 
ATOM   293  N  N     . GLN A 1 125 ? -26.200 62.873 2.700  1.00 29.64  ? 366 GLN A N     1 
ATOM   294  C  CA    . GLN A 1 125 ? -25.080 63.741 2.339  1.00 30.12  ? 366 GLN A CA    1 
ATOM   295  C  C     . GLN A 1 125 ? -23.710 63.062 2.278  1.00 30.41  ? 366 GLN A C     1 
ATOM   296  O  O     . GLN A 1 125 ? -22.838 63.490 1.522  1.00 30.61  ? 366 GLN A O     1 
ATOM   297  C  CB    . GLN A 1 125 ? -25.001 64.905 3.321  1.00 27.56  ? 366 GLN A CB    1 
ATOM   298  C  CG    . GLN A 1 125 ? -26.293 65.664 3.460  1.00 32.27  ? 366 GLN A CG    1 
ATOM   299  C  CD    . GLN A 1 125 ? -26.220 66.702 4.551  1.00 39.62  ? 366 GLN A CD    1 
ATOM   300  O  OE1   . GLN A 1 125 ? -25.342 67.567 4.538  1.00 39.82  ? 366 GLN A OE1   1 
ATOM   301  N  NE2   . GLN A 1 125 ? -27.134 66.617 5.516  1.00 32.36  ? 366 GLN A NE2   1 
ATOM   302  N  N     . ALA A 1 126 ? -23.510 62.019 3.076  1.00 32.02  ? 367 ALA A N     1 
ATOM   303  C  CA    . ALA A 1 126 ? -22.185 61.417 3.204  1.00 28.62  ? 367 ALA A CA    1 
ATOM   304  C  C     . ALA A 1 126 ? -21.856 60.473 2.053  1.00 26.09  ? 367 ALA A C     1 
ATOM   305  O  O     . ALA A 1 126 ? -22.736 59.786 1.532  1.00 30.41  ? 367 ALA A O     1 
ATOM   306  C  CB    . ALA A 1 126 ? -22.068 60.680 4.530  1.00 23.26  ? 367 ALA A CB    1 
ATOM   307  N  N     . SER A 1 127 ? -20.584 60.455 1.663  1.00 24.45  ? 368 SER A N     1 
ATOM   308  C  CA    . SER A 1 127 ? -20.078 59.501 0.680  1.00 22.44  ? 368 SER A CA    1 
ATOM   309  C  C     . SER A 1 127 ? -19.922 58.131 1.312  1.00 26.13  ? 368 SER A C     1 
ATOM   310  O  O     . SER A 1 127 ? -19.236 57.977 2.321  1.00 30.10  ? 368 SER A O     1 
ATOM   311  C  CB    . SER A 1 127 ? -18.735 59.958 0.109  1.00 21.16  ? 368 SER A CB    1 
ATOM   312  O  OG    . SER A 1 127 ? -18.847 61.239 -0.478 1.00 28.80  ? 368 SER A OG    1 
ATOM   313  N  N     . LEU A 1 128 ? -20.554 57.133 0.710  1.00 31.21  ? 369 LEU A N     1 
ATOM   314  C  CA    . LEU A 1 128 ? -20.559 55.794 1.276  1.00 27.36  ? 369 LEU A CA    1 
ATOM   315  C  C     . LEU A 1 128 ? -19.976 54.762 0.327  1.00 28.12  ? 369 LEU A C     1 
ATOM   316  O  O     . LEU A 1 128 ? -20.198 54.817 -0.883 1.00 23.94  ? 369 LEU A O     1 
ATOM   317  C  CB    . LEU A 1 128 ? -21.981 55.383 1.647  1.00 24.23  ? 369 LEU A CB    1 
ATOM   318  C  CG    . LEU A 1 128 ? -22.737 56.279 2.616  1.00 20.94  ? 369 LEU A CG    1 
ATOM   319  C  CD1   . LEU A 1 128 ? -24.160 55.783 2.746  1.00 22.12  ? 369 LEU A CD1   1 
ATOM   320  C  CD2   . LEU A 1 128 ? -22.039 56.271 3.955  1.00 25.84  ? 369 LEU A CD2   1 
ATOM   321  N  N     . THR A 1 129 ? -19.235 53.813 0.887  1.00 26.45  ? 370 THR A N     1 
ATOM   322  C  CA    . THR A 1 129 ? -18.867 52.621 0.151  1.00 22.62  ? 370 THR A CA    1 
ATOM   323  C  C     . THR A 1 129 ? -20.121 51.764 0.020  1.00 29.71  ? 370 THR A C     1 
ATOM   324  O  O     . THR A 1 129 ? -21.113 52.008 0.706  1.00 30.10  ? 370 THR A O     1 
ATOM   325  C  CB    . THR A 1 129 ? -17.762 51.835 0.859  1.00 27.67  ? 370 THR A CB    1 
ATOM   326  O  OG1   . THR A 1 129 ? -18.302 51.178 2.013  1.00 37.13  ? 370 THR A OG1   1 
ATOM   327  C  CG2   . THR A 1 129 ? -16.663 52.767 1.299  1.00 23.53  ? 370 THR A CG2   1 
ATOM   328  N  N     . THR A 1 130 ? -20.094 50.767 -0.855 1.00 32.16  ? 371 THR A N     1 
ATOM   329  C  CA    . THR A 1 130 ? -21.241 49.880 -0.976 1.00 32.59  ? 371 THR A CA    1 
ATOM   330  C  C     . THR A 1 130 ? -21.453 49.174 0.353  1.00 27.93  ? 371 THR A C     1 
ATOM   331  O  O     . THR A 1 130 ? -22.588 48.953 0.771  1.00 28.50  ? 371 THR A O     1 
ATOM   332  C  CB    . THR A 1 130 ? -21.060 48.849 -2.095 1.00 30.77  ? 371 THR A CB    1 
ATOM   333  O  OG1   . THR A 1 130 ? -19.925 48.026 -1.802 1.00 39.66  ? 371 THR A OG1   1 
ATOM   334  C  CG2   . THR A 1 130 ? -20.843 49.550 -3.423 1.00 24.84  ? 371 THR A CG2   1 
ATOM   335  N  N     . GLN A 1 131 ? -20.351 48.838 1.019  1.00 27.67  ? 372 GLN A N     1 
ATOM   336  C  CA    . GLN A 1 131 ? -20.412 48.233 2.344  1.00 28.90  ? 372 GLN A CA    1 
ATOM   337  C  C     . GLN A 1 131 ? -21.193 49.127 3.294  1.00 31.72  ? 372 GLN A C     1 
ATOM   338  O  O     . GLN A 1 131 ? -22.282 48.765 3.754  1.00 28.67  ? 372 GLN A O     1 
ATOM   339  C  CB    . GLN A 1 131 ? -19.010 47.984 2.904  1.00 30.01  ? 372 GLN A CB    1 
ATOM   340  C  CG    . GLN A 1 131 ? -18.297 46.781 2.325  1.00 30.25  ? 372 GLN A CG    1 
ATOM   341  C  CD    . GLN A 1 131 ? -17.873 46.998 0.891  1.00 43.30  ? 372 GLN A CD    1 
ATOM   342  O  OE1   . GLN A 1 131 ? -17.836 48.133 0.405  1.00 35.17  ? 372 GLN A OE1   1 
ATOM   343  N  NE2   . GLN A 1 131 ? -17.557 45.906 0.198  1.00 43.36  ? 372 GLN A NE2   1 
ATOM   344  N  N     . GLN A 1 132 ? -20.631 50.302 3.562  1.00 27.97  ? 373 GLN A N     1 
ATOM   345  C  CA    . GLN A 1 132 ? -21.235 51.282 4.457  1.00 27.07  ? 373 GLN A CA    1 
ATOM   346  C  C     . GLN A 1 132 ? -22.693 51.584 4.107  1.00 27.19  ? 373 GLN A C     1 
ATOM   347  O  O     . GLN A 1 132 ? -23.508 51.827 4.994  1.00 26.99  ? 373 GLN A O     1 
ATOM   348  C  CB    . GLN A 1 132 ? -20.408 52.568 4.447  1.00 26.29  ? 373 GLN A CB    1 
ATOM   349  C  CG    . GLN A 1 132 ? -19.015 52.383 5.031  1.00 26.52  ? 373 GLN A CG    1 
ATOM   350  C  CD    . GLN A 1 132 ? -18.075 53.514 4.680  1.00 23.84  ? 373 GLN A CD    1 
ATOM   351  O  OE1   . GLN A 1 132 ? -18.418 54.398 3.898  1.00 30.55  ? 373 GLN A OE1   1 
ATOM   352  N  NE2   . GLN A 1 132 ? -16.877 53.488 5.250  1.00 17.80  ? 373 GLN A NE2   1 
ATOM   353  N  N     . ALA A 1 133 ? -23.021 51.548 2.820  1.00 29.73  ? 374 ALA A N     1 
ATOM   354  C  CA    . ALA A 1 133 ? -24.395 51.763 2.379  1.00 29.10  ? 374 ALA A CA    1 
ATOM   355  C  C     . ALA A 1 133 ? -25.298 50.636 2.865  1.00 27.70  ? 374 ALA A C     1 
ATOM   356  O  O     . ALA A 1 133 ? -26.423 50.872 3.314  1.00 27.54  ? 374 ALA A O     1 
ATOM   357  C  CB    . ALA A 1 133 ? -24.457 51.877 0.865  1.00 26.84  ? 374 ALA A CB    1 
ATOM   358  N  N     . ILE A 1 134 ? -24.794 49.411 2.773  1.00 22.65  ? 375 ILE A N     1 
ATOM   359  C  CA    . ILE A 1 134 ? -25.546 48.244 3.203  1.00 26.94  ? 375 ILE A CA    1 
ATOM   360  C  C     . ILE A 1 134 ? -25.750 48.254 4.719  1.00 33.13  ? 375 ILE A C     1 
ATOM   361  O  O     . ILE A 1 134 ? -26.867 48.053 5.205  1.00 34.98  ? 375 ILE A O     1 
ATOM   362  C  CB    . ILE A 1 134 ? -24.843 46.942 2.772  1.00 27.67  ? 375 ILE A CB    1 
ATOM   363  C  CG1   . ILE A 1 134 ? -24.928 46.786 1.252  1.00 23.99  ? 375 ILE A CG1   1 
ATOM   364  C  CG2   . ILE A 1 134 ? -25.460 45.735 3.468  1.00 23.31  ? 375 ILE A CG2   1 
ATOM   365  C  CD1   . ILE A 1 134 ? -24.091 45.670 0.702  1.00 25.01  ? 375 ILE A CD1   1 
ATOM   366  N  N     . GLY A 1 135 ? -24.676 48.511 5.460  1.00 25.89  ? 376 GLY A N     1 
ATOM   367  C  CA    . GLY A 1 135 ? -24.744 48.555 6.908  1.00 21.45  ? 376 GLY A CA    1 
ATOM   368  C  C     . GLY A 1 135 ? -25.669 49.638 7.423  1.00 26.62  ? 376 GLY A C     1 
ATOM   369  O  O     . GLY A 1 135 ? -26.240 49.524 8.505  1.00 27.18  ? 376 GLY A O     1 
ATOM   370  N  N     . LEU A 1 136 ? -25.820 50.698 6.639  1.00 31.08  ? 377 LEU A N     1 
ATOM   371  C  CA    . LEU A 1 136 ? -26.688 51.806 7.019  1.00 30.09  ? 377 LEU A CA    1 
ATOM   372  C  C     . LEU A 1 136 ? -28.169 51.446 6.881  1.00 33.31  ? 377 LEU A C     1 
ATOM   373  O  O     . LEU A 1 136 ? -28.998 51.914 7.659  1.00 33.61  ? 377 LEU A O     1 
ATOM   374  C  CB    . LEU A 1 136 ? -26.365 53.037 6.176  1.00 23.39  ? 377 LEU A CB    1 
ATOM   375  C  CG    . LEU A 1 136 ? -27.167 54.301 6.465  1.00 20.99  ? 377 LEU A CG    1 
ATOM   376  C  CD1   . LEU A 1 136 ? -27.049 54.687 7.924  1.00 23.73  ? 377 LEU A CD1   1 
ATOM   377  C  CD2   . LEU A 1 136 ? -26.688 55.426 5.564  1.00 24.97  ? 377 LEU A CD2   1 
ATOM   378  N  N     . LYS A 1 137 ? -28.506 50.611 5.901  1.00 31.49  ? 378 LYS A N     1 
ATOM   379  C  CA    . LYS A 1 137 ? -29.901 50.240 5.705  1.00 34.96  ? 378 LYS A CA    1 
ATOM   380  C  C     . LYS A 1 137 ? -30.288 49.015 6.533  1.00 36.19  ? 378 LYS A C     1 
ATOM   381  O  O     . LYS A 1 137 ? -31.469 48.680 6.635  1.00 41.33  ? 378 LYS A O     1 
ATOM   382  C  CB    . LYS A 1 137 ? -30.197 49.998 4.219  1.00 38.52  ? 378 LYS A CB    1 
ATOM   383  C  CG    . LYS A 1 137 ? -29.856 48.619 3.696  1.00 35.07  ? 378 LYS A CG    1 
ATOM   384  C  CD    . LYS A 1 137 ? -30.367 48.448 2.268  1.00 31.57  ? 378 LYS A CD    1 
ATOM   385  C  CE    . LYS A 1 137 ? -30.004 47.080 1.711  1.00 41.44  ? 378 LYS A CE    1 
ATOM   386  N  NZ    . LYS A 1 137 ? -30.550 46.862 0.342  1.00 53.68  ? 378 LYS A NZ    1 
ATOM   387  N  N     . HIS A 1 138 ? -29.297 48.354 7.126  1.00 31.97  ? 379 HIS A N     1 
ATOM   388  C  CA    . HIS A 1 138 ? -29.556 47.227 8.023  1.00 34.13  ? 379 HIS A CA    1 
ATOM   389  C  C     . HIS A 1 138 ? -29.086 47.564 9.434  1.00 36.84  ? 379 HIS A C     1 
ATOM   390  O  O     . HIS A 1 138 ? -28.907 46.674 10.278 1.00 31.47  ? 379 HIS A O     1 
ATOM   391  C  CB    . HIS A 1 138 ? -28.869 45.954 7.520  1.00 30.30  ? 379 HIS A CB    1 
ATOM   392  C  CG    . HIS A 1 138 ? -29.435 45.427 6.239  1.00 33.25  ? 379 HIS A CG    1 
ATOM   393  N  ND1   . HIS A 1 138 ? -30.736 45.666 5.844  1.00 36.38  ? 379 HIS A ND1   1 
ATOM   394  C  CD2   . HIS A 1 138 ? -28.878 44.681 5.256  1.00 30.70  ? 379 HIS A CD2   1 
ATOM   395  C  CE1   . HIS A 1 138 ? -30.954 45.086 4.679  1.00 36.46  ? 379 HIS A CE1   1 
ATOM   396  N  NE2   . HIS A 1 138 ? -29.841 44.481 4.298  1.00 31.54  ? 379 HIS A NE2   1 
ATOM   397  N  N     . TYR A 1 139 ? -28.899 48.862 9.672  1.00 36.98  ? 380 TYR A N     1 
ATOM   398  C  CA    . TYR A 1 139 ? -28.379 49.376 10.934 1.00 27.76  ? 380 TYR A CA    1 
ATOM   399  C  C     . TYR A 1 139 ? -29.120 48.818 12.130 1.00 30.87  ? 380 TYR A C     1 
ATOM   400  O  O     . TYR A 1 139 ? -28.505 48.362 13.090 1.00 38.62  ? 380 TYR A O     1 
ATOM   401  C  CB    . TYR A 1 139 ? -28.454 50.903 10.960 1.00 27.52  ? 380 TYR A CB    1 
ATOM   402  C  CG    . TYR A 1 139 ? -27.824 51.511 12.193 1.00 28.66  ? 380 TYR A CG    1 
ATOM   403  C  CD1   . TYR A 1 139 ? -26.468 51.801 12.229 1.00 24.57  ? 380 TYR A CD1   1 
ATOM   404  C  CD2   . TYR A 1 139 ? -28.583 51.792 13.320 1.00 26.17  ? 380 TYR A CD2   1 
ATOM   405  C  CE1   . TYR A 1 139 ? -25.887 52.350 13.344 1.00 26.34  ? 380 TYR A CE1   1 
ATOM   406  C  CE2   . TYR A 1 139 ? -28.009 52.343 14.443 1.00 28.66  ? 380 TYR A CE2   1 
ATOM   407  C  CZ    . TYR A 1 139 ? -26.659 52.620 14.453 1.00 30.59  ? 380 TYR A CZ    1 
ATOM   408  O  OH    . TYR A 1 139 ? -26.075 53.170 15.575 1.00 27.09  ? 380 TYR A OH    1 
ATOM   409  N  N     . SER A 1 140 ? -30.445 48.863 12.069 1.00 33.82  ? 381 SER A N     1 
ATOM   410  C  CA    . SER A 1 140 ? -31.268 48.379 13.164 1.00 31.75  ? 381 SER A CA    1 
ATOM   411  C  C     . SER A 1 140 ? -31.097 46.871 13.348 1.00 35.19  ? 381 SER A C     1 
ATOM   412  O  O     . SER A 1 140 ? -30.745 46.410 14.435 1.00 33.54  ? 381 SER A O     1 
ATOM   413  C  CB    . SER A 1 140 ? -32.733 48.728 12.919 1.00 33.08  ? 381 SER A CB    1 
ATOM   414  O  OG    . SER A 1 140 ? -33.522 48.391 14.045 1.00 49.03  ? 381 SER A OG    1 
ATOM   415  N  N     . ASP A 1 141 ? -31.330 46.113 12.279 1.00 34.07  ? 382 ASP A N     1 
ATOM   416  C  CA    . ASP A 1 141 ? -31.214 44.658 12.327 1.00 32.02  ? 382 ASP A CA    1 
ATOM   417  C  C     . ASP A 1 141 ? -29.829 44.191 12.756 1.00 31.79  ? 382 ASP A C     1 
ATOM   418  O  O     . ASP A 1 141 ? -29.700 43.200 13.471 1.00 33.75  ? 382 ASP A O     1 
ATOM   419  C  CB    . ASP A 1 141 ? -31.552 44.041 10.967 1.00 31.45  ? 382 ASP A CB    1 
ATOM   420  C  CG    . ASP A 1 141 ? -33.044 43.938 10.723 1.00 38.33  ? 382 ASP A CG    1 
ATOM   421  O  OD1   . ASP A 1 141 ? -33.815 44.197 11.671 1.00 46.54  ? 382 ASP A OD1   1 
ATOM   422  O  OD2   . ASP A 1 141 ? -33.446 43.587 9.589  1.00 32.28  ? 382 ASP A OD2   1 
ATOM   423  N  N     . PHE A 1 142 ? -28.791 44.895 12.318 1.00 29.67  ? 383 PHE A N     1 
ATOM   424  C  CA    . PHE A 1 142 ? -27.431 44.436 12.591 1.00 29.77  ? 383 PHE A CA    1 
ATOM   425  C  C     . PHE A 1 142 ? -27.039 44.597 14.052 1.00 28.51  ? 383 PHE A C     1 
ATOM   426  O  O     . PHE A 1 142 ? -26.082 43.977 14.511 1.00 29.94  ? 383 PHE A O     1 
ATOM   427  C  CB    . PHE A 1 142 ? -26.427 45.167 11.707 1.00 28.34  ? 383 PHE A CB    1 
ATOM   428  C  CG    . PHE A 1 142 ? -26.348 44.627 10.309 1.00 30.45  ? 383 PHE A CG    1 
ATOM   429  C  CD1   . PHE A 1 142 ? -27.136 43.558 9.919  1.00 30.63  ? 383 PHE A CD1   1 
ATOM   430  C  CD2   . PHE A 1 142 ? -25.477 45.179 9.389  1.00 30.26  ? 383 PHE A CD2   1 
ATOM   431  C  CE1   . PHE A 1 142 ? -27.063 43.056 8.636  1.00 32.36  ? 383 PHE A CE1   1 
ATOM   432  C  CE2   . PHE A 1 142 ? -25.399 44.680 8.103  1.00 32.96  ? 383 PHE A CE2   1 
ATOM   433  C  CZ    . PHE A 1 142 ? -26.192 43.618 7.726  1.00 32.27  ? 383 PHE A CZ    1 
ATOM   434  N  N     . LEU A 1 143 ? -27.785 45.423 14.776 1.00 32.13  ? 384 LEU A N     1 
ATOM   435  C  CA    . LEU A 1 143 ? -27.508 45.681 16.185 1.00 32.47  ? 384 LEU A CA    1 
ATOM   436  C  C     . LEU A 1 143 ? -28.021 44.573 17.093 1.00 33.45  ? 384 LEU A C     1 
ATOM   437  O  O     . LEU A 1 143 ? -27.564 44.432 18.225 1.00 30.19  ? 384 LEU A O     1 
ATOM   438  C  CB    . LEU A 1 143 ? -28.128 47.009 16.611 1.00 33.85  ? 384 LEU A CB    1 
ATOM   439  C  CG    . LEU A 1 143 ? -27.360 48.261 16.209 1.00 33.47  ? 384 LEU A CG    1 
ATOM   440  C  CD1   . LEU A 1 143 ? -28.116 49.491 16.666 1.00 34.68  ? 384 LEU A CD1   1 
ATOM   441  C  CD2   . LEU A 1 143 ? -25.957 48.227 16.803 1.00 26.59  ? 384 LEU A CD2   1 
ATOM   442  N  N     . GLU A 1 144 ? -28.978 43.798 16.594 1.00 36.90  ? 385 GLU A N     1 
ATOM   443  C  CA    . GLU A 1 144 ? -29.606 42.755 17.394 1.00 32.48  ? 385 GLU A CA    1 
ATOM   444  C  C     . GLU A 1 144 ? -28.796 41.470 17.379 1.00 33.36  ? 385 GLU A C     1 
ATOM   445  O  O     . GLU A 1 144 ? -28.287 41.059 16.339 1.00 37.84  ? 385 GLU A O     1 
ATOM   446  C  CB    . GLU A 1 144 ? -31.027 42.470 16.894 1.00 33.89  ? 385 GLU A CB    1 
ATOM   447  C  CG    . GLU A 1 144 ? -31.869 43.707 16.624 1.00 38.71  ? 385 GLU A CG    1 
ATOM   448  C  CD    . GLU A 1 144 ? -31.897 44.675 17.796 1.00 54.80  ? 385 GLU A CD    1 
ATOM   449  O  OE1   . GLU A 1 144 ? -32.037 44.217 18.955 1.00 54.74  ? 385 GLU A OE1   1 
ATOM   450  O  OE2   . GLU A 1 144 ? -31.774 45.900 17.554 1.00 52.52  ? 385 GLU A OE2   1 
ATOM   451  N  N     . ARG A 1 145 ? -28.666 40.845 18.544 1.00 38.61  ? 386 ARG A N     1 
ATOM   452  C  CA    . ARG A 1 145 ? -28.175 39.478 18.616 1.00 37.54  ? 386 ARG A CA    1 
ATOM   453  C  C     . ARG A 1 145 ? -29.321 38.578 18.175 1.00 41.73  ? 386 ARG A C     1 
ATOM   454  O  O     . ARG A 1 145 ? -30.472 39.013 18.121 1.00 43.16  ? 386 ARG A O     1 
ATOM   455  C  CB    . ARG A 1 145 ? -27.714 39.114 20.031 1.00 44.07  ? 386 ARG A CB    1 
ATOM   456  C  CG    . ARG A 1 145 ? -26.741 40.096 20.673 1.00 44.90  ? 386 ARG A CG    1 
ATOM   457  C  CD    . ARG A 1 145 ? -25.299 39.794 20.296 1.00 46.67  ? 386 ARG A CD    1 
ATOM   458  N  NE    . ARG A 1 145 ? -24.869 38.475 20.752 1.00 46.00  ? 386 ARG A NE    1 
ATOM   459  C  CZ    . ARG A 1 145 ? -23.637 37.995 20.599 1.00 50.42  ? 386 ARG A CZ    1 
ATOM   460  N  NH1   . ARG A 1 145 ? -22.704 38.724 20.001 1.00 56.26  ? 386 ARG A NH1   1 
ATOM   461  N  NH2   . ARG A 1 145 ? -23.336 36.783 21.038 1.00 51.87  ? 386 ARG A NH2   1 
ATOM   462  N  N     . MET A 1 146 ? -29.018 37.326 17.857 1.00 44.85  ? 387 MET A N     1 
ATOM   463  C  CA    . MET A 1 146 ? -30.063 36.392 17.462 1.00 40.44  ? 387 MET A CA    1 
ATOM   464  C  C     . MET A 1 146 ? -30.070 35.185 18.392 1.00 39.51  ? 387 MET A C     1 
ATOM   465  O  O     . MET A 1 146 ? -29.043 34.844 18.978 1.00 37.91  ? 387 MET A O     1 
ATOM   466  C  CB    . MET A 1 146 ? -29.869 35.952 16.010 1.00 37.49  ? 387 MET A CB    1 
ATOM   467  C  CG    . MET A 1 146 ? -28.837 34.861 15.826 1.00 35.69  ? 387 MET A CG    1 
ATOM   468  S  SD    . MET A 1 146 ? -28.539 34.480 14.096 1.00 38.29  ? 387 MET A SD    1 
ATOM   469  C  CE    . MET A 1 146 ? -27.403 35.792 13.654 1.00 40.78  ? 387 MET A CE    1 
ATOM   470  N  N     . PRO A 1 147 ? -31.236 34.545 18.551 1.00 40.91  ? 388 PRO A N     1 
ATOM   471  C  CA    . PRO A 1 147 ? -31.265 33.284 19.297 1.00 37.58  ? 388 PRO A CA    1 
ATOM   472  C  C     . PRO A 1 147 ? -30.493 32.216 18.535 1.00 37.55  ? 388 PRO A C     1 
ATOM   473  O  O     . PRO A 1 147 ? -30.561 32.204 17.307 1.00 40.44  ? 388 PRO A O     1 
ATOM   474  C  CB    . PRO A 1 147 ? -32.757 32.953 19.373 1.00 37.11  ? 388 PRO A CB    1 
ATOM   475  C  CG    . PRO A 1 147 ? -33.363 33.670 18.211 1.00 39.43  ? 388 PRO A CG    1 
ATOM   476  C  CD    . PRO A 1 147 ? -32.571 34.933 18.064 1.00 40.27  ? 388 PRO A CD    1 
ATOM   477  N  N     . ARG A 1 148 ? -29.776 31.340 19.234 1.00 36.63  ? 389 ARG A N     1 
ATOM   478  C  CA    . ARG A 1 148 ? -28.956 30.335 18.562 1.00 38.43  ? 389 ARG A CA    1 
ATOM   479  C  C     . ARG A 1 148 ? -29.804 29.382 17.720 1.00 45.87  ? 389 ARG A C     1 
ATOM   480  O  O     . ARG A 1 148 ? -29.279 28.678 16.857 1.00 49.66  ? 389 ARG A O     1 
ATOM   481  C  CB    . ARG A 1 148 ? -28.124 29.541 19.573 1.00 40.65  ? 389 ARG A CB    1 
ATOM   482  C  CG    . ARG A 1 148 ? -28.923 28.579 20.435 1.00 47.88  ? 389 ARG A CG    1 
ATOM   483  C  CD    . ARG A 1 148 ? -28.015 27.701 21.295 1.00 43.56  ? 389 ARG A CD    1 
ATOM   484  N  NE    . ARG A 1 148 ? -27.250 26.747 20.498 1.00 42.04  ? 389 ARG A NE    1 
ATOM   485  C  CZ    . ARG A 1 148 ? -25.941 26.830 20.282 1.00 46.13  ? 389 ARG A CZ    1 
ATOM   486  N  NH1   . ARG A 1 148 ? -25.238 27.821 20.819 1.00 43.74  ? 389 ARG A NH1   1 
ATOM   487  N  NH2   . ARG A 1 148 ? -25.331 25.914 19.537 1.00 38.85  ? 389 ARG A NH2   1 
ATOM   488  N  N     . GLU A 1 149 ? -31.111 29.365 17.961 1.00 43.15  ? 390 GLU A N     1 
ATOM   489  C  CA    . GLU A 1 149 ? -32.007 28.532 17.175 1.00 42.33  ? 390 GLU A CA    1 
ATOM   490  C  C     . GLU A 1 149 ? -32.083 29.057 15.749 1.00 45.91  ? 390 GLU A C     1 
ATOM   491  O  O     . GLU A 1 149 ? -32.096 28.282 14.793 1.00 50.97  ? 390 GLU A O     1 
ATOM   492  C  CB    . GLU A 1 149 ? -33.408 28.484 17.797 1.00 52.86  ? 390 GLU A CB    1 
ATOM   493  C  CG    . GLU A 1 149 ? -33.521 27.894 19.226 1.00 73.34  ? 390 GLU A CG    1 
ATOM   494  C  CD    . GLU A 1 149 ? -32.377 26.966 19.651 1.00 86.31  ? 390 GLU A CD    1 
ATOM   495  O  OE1   . GLU A 1 149 ? -31.977 26.073 18.864 1.00 85.19  ? 390 GLU A OE1   1 
ATOM   496  O  OE2   . GLU A 1 149 ? -31.899 27.119 20.802 1.00 69.55  ? 390 GLU A OE2   1 
ATOM   497  N  N     . GLU A 1 150 ? -32.138 30.379 15.613 1.00 46.85  ? 391 GLU A N     1 
ATOM   498  C  CA    . GLU A 1 150 ? -32.174 31.018 14.300 1.00 44.25  ? 391 GLU A CA    1 
ATOM   499  C  C     . GLU A 1 150 ? -30.850 30.780 13.585 1.00 42.56  ? 391 GLU A C     1 
ATOM   500  O  O     . GLU A 1 150 ? -30.815 30.569 12.372 1.00 44.05  ? 391 GLU A O     1 
ATOM   501  C  CB    . GLU A 1 150 ? -32.462 32.519 14.432 1.00 39.64  ? 391 GLU A CB    1 
ATOM   502  C  CG    . GLU A 1 150 ? -32.585 33.262 13.101 1.00 40.18  ? 391 GLU A CG    1 
ATOM   503  C  CD    . GLU A 1 150 ? -33.021 34.709 13.274 1.00 43.47  ? 391 GLU A CD    1 
ATOM   504  O  OE1   . GLU A 1 150 ? -33.309 35.114 14.420 1.00 48.25  ? 391 GLU A OE1   1 
ATOM   505  O  OE2   . GLU A 1 150 ? -33.073 35.446 12.266 1.00 44.36  ? 391 GLU A OE2   1 
ATOM   506  N  N     . ALA A 1 151 ? -29.763 30.805 14.350 1.00 36.28  ? 392 ALA A N     1 
ATOM   507  C  CA    . ALA A 1 151 ? -28.444 30.515 13.813 1.00 38.12  ? 392 ALA A CA    1 
ATOM   508  C  C     . ALA A 1 151 ? -28.405 29.110 13.227 1.00 43.49  ? 392 ALA A C     1 
ATOM   509  O  O     . ALA A 1 151 ? -27.833 28.891 12.162 1.00 43.70  ? 392 ALA A O     1 
ATOM   510  C  CB    . ALA A 1 151 ? -27.388 30.670 14.889 1.00 38.83  ? 392 ALA A CB    1 
ATOM   511  N  N     . THR A 1 152 ? -29.019 28.162 13.928 1.00 44.12  ? 393 THR A N     1 
ATOM   512  C  CA    . THR A 1 152 ? -29.094 26.789 13.447 1.00 46.22  ? 393 THR A CA    1 
ATOM   513  C  C     . THR A 1 152 ? -29.789 26.738 12.087 1.00 44.90  ? 393 THR A C     1 
ATOM   514  O  O     . THR A 1 152 ? -29.289 26.109 11.151 1.00 47.89  ? 393 THR A O     1 
ATOM   515  C  CB    . THR A 1 152 ? -29.838 25.870 14.445 1.00 44.12  ? 393 THR A CB    1 
ATOM   516  O  OG1   . THR A 1 152 ? -29.079 25.764 15.655 1.00 44.39  ? 393 THR A OG1   1 
ATOM   517  C  CG2   . THR A 1 152 ? -30.016 24.480 13.863 1.00 42.57  ? 393 THR A CG2   1 
ATOM   518  N  N     . GLU A 1 153 ? -30.929 27.417 11.982 1.00 37.68  ? 394 GLU A N     1 
ATOM   519  C  CA    . GLU A 1 153 ? -31.691 27.465 10.738 1.00 40.81  ? 394 GLU A CA    1 
ATOM   520  C  C     . GLU A 1 153 ? -30.848 27.993 9.588  1.00 43.42  ? 394 GLU A C     1 
ATOM   521  O  O     . GLU A 1 153 ? -30.961 27.527 8.453  1.00 42.52  ? 394 GLU A O     1 
ATOM   522  C  CB    . GLU A 1 153 ? -32.934 28.342 10.894 1.00 47.21  ? 394 GLU A CB    1 
ATOM   523  C  CG    . GLU A 1 153 ? -34.020 27.778 11.788 1.00 49.54  ? 394 GLU A CG    1 
ATOM   524  C  CD    . GLU A 1 153 ? -35.313 28.568 11.675 1.00 63.00  ? 394 GLU A CD    1 
ATOM   525  O  OE1   . GLU A 1 153 ? -35.764 29.133 12.697 1.00 67.81  ? 394 GLU A OE1   1 
ATOM   526  O  OE2   . GLU A 1 153 ? -35.875 28.630 10.559 1.00 58.13  ? 394 GLU A OE2   1 
ATOM   527  N  N     . ILE A 1 154 ? -30.008 28.976 9.891  1.00 43.38  ? 395 ILE A N     1 
ATOM   528  C  CA    . ILE A 1 154 ? -29.136 29.575 8.891  1.00 42.81  ? 395 ILE A CA    1 
ATOM   529  C  C     . ILE A 1 154 ? -28.052 28.590 8.452  1.00 38.92  ? 395 ILE A C     1 
ATOM   530  O  O     . ILE A 1 154 ? -27.738 28.495 7.268  1.00 41.09  ? 395 ILE A O     1 
ATOM   531  C  CB    . ILE A 1 154 ? -28.504 30.876 9.424  1.00 39.11  ? 395 ILE A CB    1 
ATOM   532  C  CG1   . ILE A 1 154 ? -29.571 31.968 9.514  1.00 30.93  ? 395 ILE A CG1   1 
ATOM   533  C  CG2   . ILE A 1 154 ? -27.350 31.330 8.539  1.00 36.74  ? 395 ILE A CG2   1 
ATOM   534  C  CD1   . ILE A 1 154 ? -29.073 33.264 10.098 1.00 33.31  ? 395 ILE A CD1   1 
ATOM   535  N  N     . GLU A 1 155 ? -27.499 27.841 9.400  1.00 38.06  ? 396 GLU A N     1 
ATOM   536  C  CA    . GLU A 1 155 ? -26.485 26.848 9.073  1.00 40.50  ? 396 GLU A CA    1 
ATOM   537  C  C     . GLU A 1 155 ? -27.063 25.763 8.181  1.00 43.38  ? 396 GLU A C     1 
ATOM   538  O  O     . GLU A 1 155 ? -26.393 25.271 7.277  1.00 48.31  ? 396 GLU A O     1 
ATOM   539  C  CB    . GLU A 1 155 ? -25.902 26.218 10.336 1.00 48.24  ? 396 GLU A CB    1 
ATOM   540  C  CG    . GLU A 1 155 ? -24.786 25.215 10.062 1.00 48.87  ? 396 GLU A CG    1 
ATOM   541  C  CD    . GLU A 1 155 ? -24.564 24.255 11.220 1.00 60.39  ? 396 GLU A CD    1 
ATOM   542  O  OE1   . GLU A 1 155 ? -25.543 23.939 11.933 1.00 54.01  ? 396 GLU A OE1   1 
ATOM   543  O  OE2   . GLU A 1 155 ? -23.408 23.818 11.418 1.00 62.14  ? 396 GLU A OE2   1 
ATOM   544  N  N     . GLN A 1 156 ? -28.311 25.390 8.438  1.00 43.54  ? 397 GLN A N     1 
ATOM   545  C  CA    . GLN A 1 156 ? -28.951 24.344 7.652  1.00 49.88  ? 397 GLN A CA    1 
ATOM   546  C  C     . GLN A 1 156 ? -29.359 24.852 6.273  1.00 44.66  ? 397 GLN A C     1 
ATOM   547  O  O     . GLN A 1 156 ? -29.357 24.095 5.304  1.00 46.89  ? 397 GLN A O     1 
ATOM   548  C  CB    . GLN A 1 156 ? -30.164 23.781 8.389  1.00 48.55  ? 397 GLN A CB    1 
ATOM   549  C  CG    . GLN A 1 156 ? -29.812 22.981 9.630  1.00 53.28  ? 397 GLN A CG    1 
ATOM   550  C  CD    . GLN A 1 156 ? -31.020 22.287 10.228 1.00 68.72  ? 397 GLN A CD    1 
ATOM   551  O  OE1   . GLN A 1 156 ? -31.974 21.956 9.516  1.00 65.25  ? 397 GLN A OE1   1 
ATOM   552  N  NE2   . GLN A 1 156 ? -30.991 22.068 11.541 1.00 54.84  ? 397 GLN A NE2   1 
ATOM   553  N  N     . THR A 1 157 ? -29.705 26.132 6.188  1.00 42.22  ? 398 THR A N     1 
ATOM   554  C  CA    . THR A 1 157 ? -30.058 26.737 4.909  1.00 40.47  ? 398 THR A CA    1 
ATOM   555  C  C     . THR A 1 157 ? -28.842 26.743 3.991  1.00 47.24  ? 398 THR A C     1 
ATOM   556  O  O     . THR A 1 157 ? -28.963 26.607 2.772  1.00 47.59  ? 398 THR A O     1 
ATOM   557  C  CB    . THR A 1 157 ? -30.577 28.166 5.082  1.00 32.91  ? 398 THR A CB    1 
ATOM   558  O  OG1   . THR A 1 157 ? -31.557 28.190 6.123  1.00 43.72  ? 398 THR A OG1   1 
ATOM   559  C  CG2   . THR A 1 157 ? -31.210 28.661 3.795  1.00 36.53  ? 398 THR A CG2   1 
ATOM   560  N  N     . VAL A 1 158 ? -27.667 26.889 4.593  1.00 42.80  ? 399 VAL A N     1 
ATOM   561  C  CA    . VAL A 1 158 ? -26.420 26.837 3.850  1.00 41.19  ? 399 VAL A CA    1 
ATOM   562  C  C     . VAL A 1 158 ? -26.046 25.389 3.547  1.00 43.24  ? 399 VAL A C     1 
ATOM   563  O  O     . VAL A 1 158 ? -25.658 25.063 2.425  1.00 45.20  ? 399 VAL A O     1 
ATOM   564  C  CB    . VAL A 1 158 ? -25.278 27.526 4.623  1.00 36.53  ? 399 VAL A CB    1 
ATOM   565  C  CG1   . VAL A 1 158 ? -23.942 27.286 3.939  1.00 38.18  ? 399 VAL A CG1   1 
ATOM   566  C  CG2   . VAL A 1 158 ? -25.552 29.013 4.744  1.00 33.92  ? 399 VAL A CG2   1 
ATOM   567  N  N     . GLN A 1 159 ? -26.188 24.523 4.545  1.00 44.09  ? 400 GLN A N     1 
ATOM   568  C  CA    . GLN A 1 159 ? -25.810 23.120 4.405  1.00 46.62  ? 400 GLN A CA    1 
ATOM   569  C  C     . GLN A 1 159 ? -26.636 22.397 3.343  1.00 47.62  ? 400 GLN A C     1 
ATOM   570  O  O     . GLN A 1 159 ? -26.092 21.629 2.550  1.00 47.86  ? 400 GLN A O     1 
ATOM   571  C  CB    . GLN A 1 159 ? -25.936 22.397 5.748  1.00 47.49  ? 400 GLN A CB    1 
ATOM   572  C  CG    . GLN A 1 159 ? -25.065 21.156 5.850  1.00 57.54  ? 400 GLN A CG    1 
ATOM   573  C  CD    . GLN A 1 159 ? -24.772 20.765 7.285  1.00 68.26  ? 400 GLN A CD    1 
ATOM   574  O  OE1   . GLN A 1 159 ? -25.368 21.301 8.222  1.00 64.94  ? 400 GLN A OE1   1 
ATOM   575  N  NE2   . GLN A 1 159 ? -23.833 19.839 7.467  1.00 68.99  ? 400 GLN A NE2   1 
ATOM   576  N  N     . LYS A 1 160 ? -27.944 22.640 3.329  1.00 43.91  ? 401 LYS A N     1 
ATOM   577  C  CA    . LYS A 1 160 ? -28.806 22.043 2.316  1.00 45.37  ? 401 LYS A CA    1 
ATOM   578  C  C     . LYS A 1 160 ? -28.367 22.465 0.922  1.00 46.01  ? 401 LYS A C     1 
ATOM   579  O  O     . LYS A 1 160 ? -28.143 21.621 0.057  1.00 49.50  ? 401 LYS A O     1 
ATOM   580  C  CB    . LYS A 1 160 ? -30.274 22.424 2.537  1.00 45.97  ? 401 LYS A CB    1 
ATOM   581  C  CG    . LYS A 1 160 ? -30.979 21.623 3.622  1.00 52.30  ? 401 LYS A CG    1 
ATOM   582  C  CD    . LYS A 1 160 ? -32.442 22.034 3.765  1.00 53.31  ? 401 LYS A CD    1 
ATOM   583  C  CE    . LYS A 1 160 ? -33.097 21.342 4.957  1.00 56.56  ? 401 LYS A CE    1 
ATOM   584  N  NZ    . LYS A 1 160 ? -34.477 21.839 5.218  1.00 56.88  ? 401 LYS A NZ    1 
ATOM   585  N  N     . ALA A 1 161 ? -28.232 23.772 0.714  1.00 47.02  ? 402 ALA A N     1 
ATOM   586  C  CA    . ALA A 1 161 ? -27.894 24.308 -0.600 1.00 47.35  ? 402 ALA A CA    1 
ATOM   587  C  C     . ALA A 1 161 ? -26.513 23.847 -1.046 1.00 46.86  ? 402 ALA A C     1 
ATOM   588  O  O     . ALA A 1 161 ? -26.245 23.732 -2.245 1.00 44.66  ? 402 ALA A O     1 
ATOM   589  C  CB    . ALA A 1 161 ? -27.970 25.827 -0.591 1.00 42.82  ? 402 ALA A CB    1 
ATOM   590  N  N     . ALA A 1 162 ? -25.645 23.574 -0.074 1.00 42.73  ? 403 ALA A N     1 
ATOM   591  C  CA    . ALA A 1 162 ? -24.301 23.078 -0.353 1.00 42.85  ? 403 ALA A CA    1 
ATOM   592  C  C     . ALA A 1 162 ? -24.333 21.626 -0.801 1.00 47.91  ? 403 ALA A C     1 
ATOM   593  O  O     . ALA A 1 162 ? -23.780 21.274 -1.842 1.00 49.74  ? 403 ALA A O     1 
ATOM   594  C  CB    . ALA A 1 162 ? -23.415 23.226 0.870  1.00 41.27  ? 403 ALA A CB    1 
ATOM   595  N  N     . GLN A 1 163 ? -24.994 20.787 -0.008 1.00 52.09  ? 404 GLN A N     1 
ATOM   596  C  CA    . GLN A 1 163 ? -25.060 19.353 -0.279 1.00 52.11  ? 404 GLN A CA    1 
ATOM   597  C  C     . GLN A 1 163 ? -25.849 19.042 -1.545 1.00 48.96  ? 404 GLN A C     1 
ATOM   598  O  O     . GLN A 1 163 ? -25.837 17.917 -2.031 1.00 57.90  ? 404 GLN A O     1 
ATOM   599  C  CB    . GLN A 1 163 ? -25.669 18.616 0.915  1.00 51.49  ? 404 GLN A CB    1 
ATOM   600  C  CG    . GLN A 1 163 ? -24.782 18.632 2.154  1.00 57.48  ? 404 GLN A CG    1 
ATOM   601  C  CD    . GLN A 1 163 ? -25.501 18.147 3.400  1.00 65.01  ? 404 GLN A CD    1 
ATOM   602  O  OE1   . GLN A 1 163 ? -26.731 18.035 3.423  1.00 54.28  ? 404 GLN A OE1   1 
ATOM   603  N  NE2   . GLN A 1 163 ? -24.735 17.866 4.451  1.00 64.51  ? 404 GLN A NE2   1 
ATOM   604  N  N     . ALA A 1 164 ? -26.528 20.047 -2.084 1.00 47.55  ? 405 ALA A N     1 
ATOM   605  C  CA    . ALA A 1 164 ? -27.243 19.891 -3.340 1.00 46.96  ? 405 ALA A CA    1 
ATOM   606  C  C     . ALA A 1 164 ? -26.256 19.791 -4.490 1.00 50.70  ? 405 ALA A C     1 
ATOM   607  O  O     . ALA A 1 164 ? -26.627 19.438 -5.607 1.00 55.95  ? 405 ALA A O     1 
ATOM   608  C  CB    . ALA A 1 164 ? -28.201 21.048 -3.559 1.00 50.55  ? 405 ALA A CB    1 
ATOM   609  N  N     . PHE A 1 165 ? -24.998 20.118 -4.211 1.00 48.25  ? 406 PHE A N     1 
ATOM   610  C  CA    . PHE A 1 165 ? -23.937 19.992 -5.203 1.00 54.52  ? 406 PHE A CA    1 
ATOM   611  C  C     . PHE A 1 165 ? -23.114 18.742 -4.928 1.00 56.55  ? 406 PHE A C     1 
ATOM   612  O  O     . PHE A 1 165 ? -22.737 18.018 -5.848 1.00 62.92  ? 406 PHE A O     1 
ATOM   613  C  CB    . PHE A 1 165 ? -23.038 21.232 -5.204 1.00 50.32  ? 406 PHE A CB    1 
ATOM   614  C  CG    . PHE A 1 165 ? -23.715 22.471 -5.714 1.00 48.76  ? 406 PHE A CG    1 
ATOM   615  C  CD1   . PHE A 1 165 ? -23.727 22.762 -7.067 1.00 50.53  ? 406 PHE A CD1   1 
ATOM   616  C  CD2   . PHE A 1 165 ? -24.346 23.342 -4.841 1.00 48.35  ? 406 PHE A CD2   1 
ATOM   617  C  CE1   . PHE A 1 165 ? -24.353 23.901 -7.542 1.00 51.44  ? 406 PHE A CE1   1 
ATOM   618  C  CE2   . PHE A 1 165 ? -24.973 24.482 -5.310 1.00 45.44  ? 406 PHE A CE2   1 
ATOM   619  C  CZ    . PHE A 1 165 ? -24.976 24.761 -6.661 1.00 42.49  ? 406 PHE A CZ    1 
ATOM   620  N  N     . ASN A 1 166 ? -22.846 18.496 -3.651 1.00 52.65  ? 407 ASN A N     1 
ATOM   621  C  CA    . ASN A 1 166 ? -22.092 17.325 -3.234 1.00 49.47  ? 407 ASN A CA    1 
ATOM   622  C  C     . ASN A 1 166 ? -22.516 16.893 -1.839 1.00 52.36  ? 407 ASN A C     1 
ATOM   623  O  O     . ASN A 1 166 ? -22.316 17.618 -0.869 1.00 58.08  ? 407 ASN A O     1 
ATOM   624  C  CB    . ASN A 1 166 ? -20.590 17.613 -3.278 1.00 52.57  ? 407 ASN A CB    1 
ATOM   625  C  CG    . ASN A 1 166 ? -19.747 16.379 -3.001 1.00 63.06  ? 407 ASN A CG    1 
ATOM   626  O  OD1   . ASN A 1 166 ? -19.913 15.706 -1.980 1.00 58.27  ? 407 ASN A OD1   1 
ATOM   627  N  ND2   . ASN A 1 166 ? -18.829 16.078 -3.914 1.00 66.68  ? 407 ASN A ND2   1 
ATOM   628  N  N     . SER A 1 167 ? -23.093 15.700 -1.749 1.00 59.27  ? 408 SER A N     1 
ATOM   629  C  CA    . SER A 1 167 ? -23.645 15.193 -0.497 1.00 57.81  ? 408 SER A CA    1 
ATOM   630  C  C     . SER A 1 167 ? -22.592 15.060 0.601  1.00 56.24  ? 408 SER A C     1 
ATOM   631  O  O     . SER A 1 167 ? -22.901 15.174 1.789  1.00 57.56  ? 408 SER A O     1 
ATOM   632  C  CB    . SER A 1 167 ? -24.315 13.839 -0.734 1.00 56.99  ? 408 SER A CB    1 
ATOM   633  O  OG    . SER A 1 167 ? -25.146 13.879 -1.881 1.00 54.57  ? 408 SER A OG    1 
ATOM   634  N  N     . GLY A 1 168 ? -21.348 14.824 0.200  1.00 53.64  ? 409 GLY A N     1 
ATOM   635  C  CA    . GLY A 1 168 ? -20.284 14.566 1.151  1.00 60.89  ? 409 GLY A CA    1 
ATOM   636  C  C     . GLY A 1 168 ? -19.692 15.815 1.772  1.00 61.97  ? 409 GLY A C     1 
ATOM   637  O  O     . GLY A 1 168 ? -18.759 15.731 2.570  1.00 61.00  ? 409 GLY A O     1 
ATOM   638  N  N     . LEU A 1 169 ? -20.237 16.974 1.406  1.00 63.47  ? 410 LEU A N     1 
ATOM   639  C  CA    . LEU A 1 169 ? -19.745 18.257 1.906  1.00 57.97  ? 410 LEU A CA    1 
ATOM   640  C  C     . LEU A 1 169 ? -20.066 18.472 3.380  1.00 53.26  ? 410 LEU A C     1 
ATOM   641  O  O     . LEU A 1 169 ? -21.181 18.203 3.829  1.00 52.67  ? 410 LEU A O     1 
ATOM   642  C  CB    . LEU A 1 169 ? -20.327 19.410 1.083  1.00 51.77  ? 410 LEU A CB    1 
ATOM   643  C  CG    . LEU A 1 169 ? -19.667 19.698 -0.264 1.00 50.12  ? 410 LEU A CG    1 
ATOM   644  C  CD1   . LEU A 1 169 ? -20.454 20.746 -1.029 1.00 45.80  ? 410 LEU A CD1   1 
ATOM   645  C  CD2   . LEU A 1 169 ? -18.229 20.147 -0.064 1.00 50.34  ? 410 LEU A CD2   1 
ATOM   646  N  N     . LEU A 1 170 ? -19.078 18.969 4.120  1.00 51.78  ? 411 LEU A N     1 
ATOM   647  C  CA    . LEU A 1 170 ? -19.232 19.253 5.545  1.00 57.27  ? 411 LEU A CA    1 
ATOM   648  C  C     . LEU A 1 170 ? -19.429 20.742 5.815  1.00 53.13  ? 411 LEU A C     1 
ATOM   649  O  O     . LEU A 1 170 ? -18.624 21.568 5.391  1.00 49.15  ? 411 LEU A O     1 
ATOM   650  C  CB    . LEU A 1 170 ? -18.013 18.752 6.320  1.00 56.15  ? 411 LEU A CB    1 
ATOM   651  C  CG    . LEU A 1 170 ? -18.166 17.448 7.099  1.00 62.18  ? 411 LEU A CG    1 
ATOM   652  C  CD1   . LEU A 1 170 ? -18.578 16.303 6.180  1.00 64.31  ? 411 LEU A CD1   1 
ATOM   653  C  CD2   . LEU A 1 170 ? -16.869 17.129 7.823  1.00 64.33  ? 411 LEU A CD2   1 
ATOM   654  N  N     . CYS A 1 171 ? -20.498 21.079 6.528  1.00 55.89  ? 412 CYS A N     1 
ATOM   655  C  CA    . CYS A 1 171 ? -20.762 22.468 6.889  1.00 53.44  ? 412 CYS A CA    1 
ATOM   656  C  C     . CYS A 1 171 ? -20.937 22.611 8.392  1.00 49.95  ? 412 CYS A C     1 
ATOM   657  O  O     . CYS A 1 171 ? -21.874 22.064 8.974  1.00 51.68  ? 412 CYS A O     1 
ATOM   658  C  CB    . CYS A 1 171 ? -22.006 22.996 6.173  1.00 53.01  ? 412 CYS A CB    1 
ATOM   659  S  SG    . CYS A 1 171 ? -21.997 22.790 4.382  1.00 62.32  ? 412 CYS A SG    1 
ATOM   660  N  N     . VAL A 1 172 ? -20.031 23.357 9.014  1.00 47.65  ? 413 VAL A N     1 
ATOM   661  C  CA    . VAL A 1 172 ? -20.050 23.555 10.456 1.00 43.11  ? 413 VAL A CA    1 
ATOM   662  C  C     . VAL A 1 172 ? -20.106 25.029 10.827 1.00 42.90  ? 413 VAL A C     1 
ATOM   663  O  O     . VAL A 1 172 ? -19.287 25.820 10.360 1.00 37.88  ? 413 VAL A O     1 
ATOM   664  C  CB    . VAL A 1 172 ? -18.813 22.945 11.114 1.00 38.53  ? 413 VAL A CB    1 
ATOM   665  C  CG1   . VAL A 1 172 ? -18.857 23.170 12.611 1.00 44.12  ? 413 VAL A CG1   1 
ATOM   666  C  CG2   . VAL A 1 172 ? -18.716 21.469 10.790 1.00 43.20  ? 413 VAL A CG2   1 
ATOM   667  N  N     . ALA A 1 173 ? -21.066 25.391 11.673 1.00 42.03  ? 414 ALA A N     1 
ATOM   668  C  CA    . ALA A 1 173 ? -21.180 26.758 12.170 1.00 37.45  ? 414 ALA A CA    1 
ATOM   669  C  C     . ALA A 1 173 ? -20.170 26.994 13.290 1.00 41.60  ? 414 ALA A C     1 
ATOM   670  O  O     . ALA A 1 173 ? -20.175 26.276 14.286 1.00 49.46  ? 414 ALA A O     1 
ATOM   671  C  CB    . ALA A 1 173 ? -22.591 27.028 12.654 1.00 32.94  ? 414 ALA A CB    1 
ATOM   672  N  N     . CYS A 1 174 ? -19.301 27.989 13.137 1.00 38.79  ? 415 CYS A N     1 
ATOM   673  C  CA    . CYS A 1 174 ? -18.252 28.212 14.132 1.00 45.24  ? 415 CYS A CA    1 
ATOM   674  C  C     . CYS A 1 174 ? -18.196 29.650 14.624 1.00 48.68  ? 415 CYS A C     1 
ATOM   675  O  O     . CYS A 1 174 ? -17.229 30.353 14.361 1.00 50.37  ? 415 CYS A O     1 
ATOM   676  C  CB    . CYS A 1 174 ? -16.879 27.846 13.561 1.00 38.95  ? 415 CYS A CB    1 
ATOM   677  S  SG    . CYS A 1 174 ? -16.928 26.643 12.254 1.00 46.05  ? 415 CYS A SG    1 
ATOM   678  N  N     . GLY A 1 175 ? -19.212 30.109 15.333 1.00 41.51  ? 416 GLY A N     1 
ATOM   679  C  CA    . GLY A 1 175 ? -19.160 31.479 15.796 1.00 50.38  ? 416 GLY A CA    1 
ATOM   680  C  C     . GLY A 1 175 ? -19.225 31.560 17.300 1.00 50.32  ? 416 GLY A C     1 
ATOM   681  O  O     . GLY A 1 175 ? -18.460 30.911 18.011 1.00 43.01  ? 416 GLY A O     1 
ATOM   682  N  N     . SER A 1 176 ? -20.144 32.388 17.779 1.00 56.74  ? 417 SER A N     1 
ATOM   683  C  CA    . SER A 1 176 ? -20.550 32.345 19.166 1.00 49.83  ? 417 SER A CA    1 
ATOM   684  C  C     . SER A 1 176 ? -21.302 31.030 19.318 1.00 49.91  ? 417 SER A C     1 
ATOM   685  O  O     . SER A 1 176 ? -21.349 30.434 20.394 1.00 52.23  ? 417 SER A O     1 
ATOM   686  C  CB    . SER A 1 176 ? -21.435 33.544 19.521 1.00 51.87  ? 417 SER A CB    1 
ATOM   687  O  OG    . SER A 1 176 ? -21.063 34.700 18.782 1.00 57.87  ? 417 SER A OG    1 
ATOM   688  N  N     . TYR A 1 177 ? -21.871 30.588 18.200 1.00 43.66  ? 418 TYR A N     1 
ATOM   689  C  CA    . TYR A 1 177 ? -22.693 29.389 18.124 1.00 43.50  ? 418 TYR A CA    1 
ATOM   690  C  C     . TYR A 1 177 ? -21.958 28.147 18.604 1.00 46.62  ? 418 TYR A C     1 
ATOM   691  O  O     . TYR A 1 177 ? -22.433 27.450 19.501 1.00 49.82  ? 418 TYR A O     1 
ATOM   692  C  CB    . TYR A 1 177 ? -23.174 29.192 16.687 1.00 39.08  ? 418 TYR A CB    1 
ATOM   693  C  CG    . TYR A 1 177 ? -24.124 28.040 16.482 1.00 34.03  ? 418 TYR A CG    1 
ATOM   694  C  CD1   . TYR A 1 177 ? -23.661 26.803 16.053 1.00 38.96  ? 418 TYR A CD1   1 
ATOM   695  C  CD2   . TYR A 1 177 ? -25.485 28.193 16.695 1.00 40.35  ? 418 TYR A CD2   1 
ATOM   696  C  CE1   . TYR A 1 177 ? -24.529 25.744 15.849 1.00 45.59  ? 418 TYR A CE1   1 
ATOM   697  C  CE2   . TYR A 1 177 ? -26.363 27.139 16.497 1.00 47.78  ? 418 TYR A CE2   1 
ATOM   698  C  CZ    . TYR A 1 177 ? -25.879 25.915 16.072 1.00 47.47  ? 418 TYR A CZ    1 
ATOM   699  O  OH    . TYR A 1 177 ? -26.741 24.860 15.868 1.00 39.93  ? 418 TYR A OH    1 
ATOM   700  N  N     . ARG A 1 178 ? -20.799 27.874 18.012 1.00 46.33  ? 419 ARG A N     1 
ATOM   701  C  CA    . ARG A 1 178 ? -20.036 26.683 18.366 1.00 44.27  ? 419 ARG A CA    1 
ATOM   702  C  C     . ARG A 1 178 ? -19.579 26.741 19.814 1.00 38.17  ? 419 ARG A C     1 
ATOM   703  O  O     . ARG A 1 178 ? -19.465 25.714 20.471 1.00 43.68  ? 419 ARG A O     1 
ATOM   704  C  CB    . ARG A 1 178 ? -18.829 26.509 17.440 1.00 42.15  ? 419 ARG A CB    1 
ATOM   705  C  CG    . ARG A 1 178 ? -18.068 25.204 17.649 1.00 37.22  ? 419 ARG A CG    1 
ATOM   706  C  CD    . ARG A 1 178 ? -17.241 24.852 16.425 1.00 42.97  ? 419 ARG A CD    1 
ATOM   707  N  NE    . ARG A 1 178 ? -16.610 23.538 16.528 1.00 42.64  ? 419 ARG A NE    1 
ATOM   708  C  CZ    . ARG A 1 178 ? -15.314 23.341 16.751 1.00 41.94  ? 419 ARG A CZ    1 
ATOM   709  N  NH1   . ARG A 1 178 ? -14.498 24.376 16.893 1.00 43.13  ? 419 ARG A NH1   1 
ATOM   710  N  NH2   . ARG A 1 178 ? -14.830 22.109 16.827 1.00 41.40  ? 419 ARG A NH2   1 
ATOM   711  N  N     . ARG A 1 179 ? -19.334 27.944 20.316 1.00 37.31  ? 420 ARG A N     1 
ATOM   712  C  CA    . ARG A 1 179 ? -18.895 28.101 21.697 1.00 46.74  ? 420 ARG A CA    1 
ATOM   713  C  C     . ARG A 1 179 ? -20.061 27.934 22.679 1.00 48.13  ? 420 ARG A C     1 
ATOM   714  O  O     . ARG A 1 179 ? -19.876 27.983 23.897 1.00 44.68  ? 420 ARG A O     1 
ATOM   715  C  CB    . ARG A 1 179 ? -18.213 29.457 21.892 1.00 42.35  ? 420 ARG A CB    1 
ATOM   716  C  CG    . ARG A 1 179 ? -16.955 29.628 21.056 1.00 36.83  ? 420 ARG A CG    1 
ATOM   717  C  CD    . ARG A 1 179 ? -16.036 30.696 21.628 1.00 41.49  ? 420 ARG A CD    1 
ATOM   718  N  NE    . ARG A 1 179 ? -16.729 31.968 21.794 1.00 48.85  ? 420 ARG A NE    1 
ATOM   719  C  CZ    . ARG A 1 179 ? -16.839 32.891 20.845 1.00 49.17  ? 420 ARG A CZ    1 
ATOM   720  N  NH1   . ARG A 1 179 ? -16.296 32.691 19.651 1.00 41.46  ? 420 ARG A NH1   1 
ATOM   721  N  NH2   . ARG A 1 179 ? -17.496 34.016 21.093 1.00 50.88  ? 420 ARG A NH2   1 
ATOM   722  N  N     . GLY A 1 180 ? -21.259 27.732 22.139 1.00 44.11  ? 421 GLY A N     1 
ATOM   723  C  CA    . GLY A 1 180 ? -22.416 27.404 22.950 1.00 43.08  ? 421 GLY A CA    1 
ATOM   724  C  C     . GLY A 1 180 ? -23.204 28.591 23.466 1.00 46.11  ? 421 GLY A C     1 
ATOM   725  O  O     . GLY A 1 180 ? -24.156 28.412 24.223 1.00 51.67  ? 421 GLY A O     1 
ATOM   726  N  N     . LYS A 1 181 ? -22.812 29.797 23.065 1.00 46.01  ? 422 LYS A N     1 
ATOM   727  C  CA    . LYS A 1 181 ? -23.510 31.013 23.479 1.00 40.36  ? 422 LYS A CA    1 
ATOM   728  C  C     . LYS A 1 181 ? -24.995 30.939 23.140 1.00 46.10  ? 422 LYS A C     1 
ATOM   729  O  O     . LYS A 1 181 ? -25.383 30.379 22.113 1.00 45.52  ? 422 LYS A O     1 
ATOM   730  C  CB    . LYS A 1 181 ? -22.884 32.243 22.821 1.00 44.18  ? 422 LYS A CB    1 
ATOM   731  C  CG    . LYS A 1 181 ? -21.506 32.606 23.351 1.00 50.90  ? 422 LYS A CG    1 
ATOM   732  C  CD    . LYS A 1 181 ? -21.583 33.742 24.355 1.00 60.16  ? 422 LYS A CD    1 
ATOM   733  C  CE    . LYS A 1 181 ? -22.147 35.001 23.708 1.00 59.10  ? 422 LYS A CE    1 
ATOM   734  N  NZ    . LYS A 1 181 ? -22.282 36.127 24.678 1.00 69.06  ? 422 LYS A NZ    1 
ATOM   735  N  N     . ALA A 1 182 ? -25.823 31.496 24.016 1.00 51.86  ? 423 ALA A N     1 
ATOM   736  C  CA    . ALA A 1 182 ? -27.268 31.460 23.830 1.00 49.17  ? 423 ALA A CA    1 
ATOM   737  C  C     . ALA A 1 182 ? -27.683 32.435 22.741 1.00 45.69  ? 423 ALA A C     1 
ATOM   738  O  O     . ALA A 1 182 ? -28.775 32.332 22.181 1.00 42.84  ? 423 ALA A O     1 
ATOM   739  C  CB    . ALA A 1 182 ? -27.983 31.779 25.134 1.00 47.74  ? 423 ALA A CB    1 
ATOM   740  N  N     . THR A 1 183 ? -26.797 33.383 22.452 1.00 48.49  ? 424 THR A N     1 
ATOM   741  C  CA    . THR A 1 183 ? -27.030 34.378 21.413 1.00 47.00  ? 424 THR A CA    1 
ATOM   742  C  C     . THR A 1 183 ? -25.856 34.467 20.453 1.00 47.08  ? 424 THR A C     1 
ATOM   743  O  O     . THR A 1 183 ? -24.720 34.164 20.811 1.00 51.44  ? 424 THR A O     1 
ATOM   744  C  CB    . THR A 1 183 ? -27.273 35.770 22.006 1.00 46.56  ? 424 THR A CB    1 
ATOM   745  O  OG1   . THR A 1 183 ? -26.202 36.097 22.902 1.00 52.99  ? 424 THR A OG1   1 
ATOM   746  C  CG2   . THR A 1 183 ? -28.595 35.804 22.754 1.00 49.86  ? 424 THR A CG2   1 
ATOM   747  N  N     . CYS A 1 184 ? -26.140 34.897 19.230 1.00 48.43  ? 425 CYS A N     1 
ATOM   748  C  CA    . CYS A 1 184 ? -25.111 35.059 18.217 1.00 44.95  ? 425 CYS A CA    1 
ATOM   749  C  C     . CYS A 1 184 ? -25.244 36.413 17.538 1.00 40.62  ? 425 CYS A C     1 
ATOM   750  O  O     . CYS A 1 184 ? -26.332 36.792 17.114 1.00 42.13  ? 425 CYS A O     1 
ATOM   751  C  CB    . CYS A 1 184 ? -25.201 33.940 17.179 1.00 45.16  ? 425 CYS A CB    1 
ATOM   752  S  SG    . CYS A 1 184 ? -24.995 32.280 17.852 1.00 42.41  ? 425 CYS A SG    1 
ATOM   753  N  N     . GLY A 1 185 ? -24.137 37.141 17.442 1.00 39.15  ? 426 GLY A N     1 
ATOM   754  C  CA    . GLY A 1 185 ? -24.128 38.409 16.739 1.00 37.39  ? 426 GLY A CA    1 
ATOM   755  C  C     . GLY A 1 185 ? -24.128 38.191 15.238 1.00 38.83  ? 426 GLY A C     1 
ATOM   756  O  O     . GLY A 1 185 ? -24.560 39.046 14.470 1.00 41.31  ? 426 GLY A O     1 
ATOM   757  N  N     . ASP A 1 186 ? -23.639 37.029 14.825 1.00 39.39  ? 427 ASP A N     1 
ATOM   758  C  CA    . ASP A 1 186 ? -23.570 36.678 13.416 1.00 39.29  ? 427 ASP A CA    1 
ATOM   759  C  C     . ASP A 1 186 ? -23.351 35.180 13.292 1.00 41.68  ? 427 ASP A C     1 
ATOM   760  O  O     . ASP A 1 186 ? -23.052 34.511 14.279 1.00 43.84  ? 427 ASP A O     1 
ATOM   761  C  CB    . ASP A 1 186 ? -22.448 37.451 12.711 1.00 43.61  ? 427 ASP A CB    1 
ATOM   762  C  CG    . ASP A 1 186 ? -21.053 36.976 13.114 1.00 50.04  ? 427 ASP A CG    1 
ATOM   763  O  OD1   . ASP A 1 186 ? -20.863 36.545 14.274 1.00 50.40  ? 427 ASP A OD1   1 
ATOM   764  O  OD2   . ASP A 1 186 ? -20.140 37.039 12.258 1.00 48.43  ? 427 ASP A OD2   1 
ATOM   765  N  N     . VAL A 1 187 ? -23.496 34.652 12.082 1.00 40.78  ? 428 VAL A N     1 
ATOM   766  C  CA    . VAL A 1 187 ? -23.275 33.232 11.855 1.00 34.56  ? 428 VAL A CA    1 
ATOM   767  C  C     . VAL A 1 187 ? -22.054 33.005 10.974 1.00 36.71  ? 428 VAL A C     1 
ATOM   768  O  O     . VAL A 1 187 ? -21.950 33.556 9.881  1.00 38.46  ? 428 VAL A O     1 
ATOM   769  C  CB    . VAL A 1 187 ? -24.501 32.569 11.213 1.00 33.95  ? 428 VAL A CB    1 
ATOM   770  C  CG1   . VAL A 1 187 ? -24.242 31.089 11.000 1.00 34.09  ? 428 VAL A CG1   1 
ATOM   771  C  CG2   . VAL A 1 187 ? -25.729 32.778 12.085 1.00 34.04  ? 428 VAL A CG2   1 
ATOM   772  N  N     . ASP A 1 188 ? -21.127 32.190 11.463 1.00 40.37  ? 429 ASP A N     1 
ATOM   773  C  CA    . ASP A 1 188 ? -19.905 31.889 10.732 1.00 39.73  ? 429 ASP A CA    1 
ATOM   774  C  C     . ASP A 1 188 ? -19.866 30.411 10.342 1.00 41.96  ? 429 ASP A C     1 
ATOM   775  O  O     . ASP A 1 188 ? -19.794 29.544 11.210 1.00 44.83  ? 429 ASP A O     1 
ATOM   776  C  CB    . ASP A 1 188 ? -18.686 32.258 11.576 1.00 38.56  ? 429 ASP A CB    1 
ATOM   777  C  CG    . ASP A 1 188 ? -18.786 33.657 12.166 1.00 51.54  ? 429 ASP A CG    1 
ATOM   778  O  OD1   . ASP A 1 188 ? -19.246 33.792 13.323 1.00 51.29  ? 429 ASP A OD1   1 
ATOM   779  O  OD2   . ASP A 1 188 ? -18.409 34.625 11.468 1.00 54.55  ? 429 ASP A OD2   1 
ATOM   780  N  N     . VAL A 1 189 ? -19.914 30.124 9.043  1.00 37.02  ? 430 VAL A N     1 
ATOM   781  C  CA    . VAL A 1 189 ? -20.001 28.740 8.573  1.00 33.04  ? 430 VAL A CA    1 
ATOM   782  C  C     . VAL A 1 189 ? -18.769 28.257 7.816  1.00 33.08  ? 430 VAL A C     1 
ATOM   783  O  O     . VAL A 1 189 ? -18.436 28.787 6.761  1.00 37.96  ? 430 VAL A O     1 
ATOM   784  C  CB    . VAL A 1 189 ? -21.206 28.537 7.650  1.00 34.19  ? 430 VAL A CB    1 
ATOM   785  C  CG1   . VAL A 1 189 ? -21.316 27.071 7.262  1.00 34.77  ? 430 VAL A CG1   1 
ATOM   786  C  CG2   . VAL A 1 189 ? -22.485 29.027 8.317  1.00 33.67  ? 430 VAL A CG2   1 
ATOM   787  N  N     . ALA A 1 190 ? -18.109 27.233 8.350  1.00 40.34  ? 431 ALA A N     1 
ATOM   788  C  CA    . ALA A 1 190 ? -16.959 26.623 7.687  1.00 39.62  ? 431 ALA A CA    1 
ATOM   789  C  C     . ALA A 1 190 ? -17.395 25.448 6.803  1.00 38.33  ? 431 ALA A C     1 
ATOM   790  O  O     . ALA A 1 190 ? -18.284 24.679 7.166  1.00 39.57  ? 431 ALA A O     1 
ATOM   791  C  CB    . ALA A 1 190 ? -15.933 26.170 8.716  1.00 30.04  ? 431 ALA A CB    1 
ATOM   792  N  N     . ILE A 1 191 ? -16.774 25.321 5.636  1.00 39.14  ? 432 ILE A N     1 
ATOM   793  C  CA    . ILE A 1 191 ? -17.163 24.294 4.673  1.00 40.98  ? 432 ILE A CA    1 
ATOM   794  C  C     . ILE A 1 191 ? -15.959 23.548 4.106  1.00 43.53  ? 432 ILE A C     1 
ATOM   795  O  O     . ILE A 1 191 ? -14.984 24.157 3.664  1.00 42.47  ? 432 ILE A O     1 
ATOM   796  C  CB    . ILE A 1 191 ? -17.969 24.896 3.510  1.00 33.80  ? 432 ILE A CB    1 
ATOM   797  C  CG1   . ILE A 1 191 ? -19.295 25.451 4.025  1.00 32.79  ? 432 ILE A CG1   1 
ATOM   798  C  CG2   . ILE A 1 191 ? -18.210 23.853 2.429  1.00 33.59  ? 432 ILE A CG2   1 
ATOM   799  C  CD1   . ILE A 1 191 ? -20.201 25.968 2.947  1.00 27.36  ? 432 ILE A CD1   1 
ATOM   800  N  N     . THR A 1 192 ? -16.030 22.223 4.126  1.00 43.38  ? 433 THR A N     1 
ATOM   801  C  CA    . THR A 1 192 ? -14.964 21.406 3.567  1.00 50.64  ? 433 THR A CA    1 
ATOM   802  C  C     . THR A 1 192 ? -15.505 20.081 3.058  1.00 56.38  ? 433 THR A C     1 
ATOM   803  O  O     . THR A 1 192 ? -16.697 19.792 3.184  1.00 56.50  ? 433 THR A O     1 
ATOM   804  C  CB    . THR A 1 192 ? -13.860 21.127 4.598  1.00 47.60  ? 433 THR A CB    1 
ATOM   805  O  OG1   . THR A 1 192 ? -12.766 20.461 3.959  1.00 49.07  ? 433 THR A OG1   1 
ATOM   806  C  CG2   . THR A 1 192 ? -14.393 20.252 5.718  1.00 48.53  ? 433 THR A CG2   1 
ATOM   807  N  N     . HIS A 1 193 ? -14.619 19.282 2.474  1.00 58.77  ? 434 HIS A N     1 
ATOM   808  C  CA    . HIS A 1 193 ? -14.968 17.931 2.062  1.00 60.70  ? 434 HIS A CA    1 
ATOM   809  C  C     . HIS A 1 193 ? -13.856 16.967 2.455  1.00 63.51  ? 434 HIS A C     1 
ATOM   810  O  O     . HIS A 1 193 ? -12.676 17.254 2.234  1.00 59.38  ? 434 HIS A O     1 
ATOM   811  C  CB    . HIS A 1 193 ? -15.222 17.861 0.557  1.00 57.95  ? 434 HIS A CB    1 
ATOM   812  C  CG    . HIS A 1 193 ? -16.003 16.655 0.139  1.00 59.82  ? 434 HIS A CG    1 
ATOM   813  N  ND1   . HIS A 1 193 ? -15.539 15.371 0.315  1.00 59.06  ? 434 HIS A ND1   1 
ATOM   814  C  CD2   . HIS A 1 193 ? -17.222 16.542 -0.440 1.00 61.35  ? 434 HIS A CD2   1 
ATOM   815  C  CE1   . HIS A 1 193 ? -16.442 14.515 -0.133 1.00 65.85  ? 434 HIS A CE1   1 
ATOM   816  N  NE2   . HIS A 1 193 ? -17.469 15.200 -0.600 1.00 65.69  ? 434 HIS A NE2   1 
ATOM   817  N  N     . PRO A 1 194 ? -14.233 15.825 3.054  1.00 64.83  ? 435 PRO A N     1 
ATOM   818  C  CA    . PRO A 1 194 ? -13.281 14.794 3.480  1.00 59.55  ? 435 PRO A CA    1 
ATOM   819  C  C     . PRO A 1 194 ? -12.345 14.308 2.371  1.00 57.11  ? 435 PRO A C     1 
ATOM   820  O  O     . PRO A 1 194 ? -11.192 14.005 2.675  1.00 60.70  ? 435 PRO A O     1 
ATOM   821  C  CB    . PRO A 1 194 ? -14.193 13.662 3.957  1.00 57.32  ? 435 PRO A CB    1 
ATOM   822  C  CG    . PRO A 1 194 ? -15.414 14.359 4.440  1.00 52.95  ? 435 PRO A CG    1 
ATOM   823  C  CD    . PRO A 1 194 ? -15.603 15.527 3.510  1.00 57.25  ? 435 PRO A CD    1 
ATOM   824  N  N     . ASP A 1 195 ? -12.806 14.242 1.123  1.00 52.60  ? 436 ASP A N     1 
ATOM   825  C  CA    . ASP A 1 195 ? -11.957 13.704 0.060  1.00 59.80  ? 436 ASP A CA    1 
ATOM   826  C  C     . ASP A 1 195 ? -10.815 14.659 -0.291 1.00 64.77  ? 436 ASP A C     1 
ATOM   827  O  O     . ASP A 1 195 ? -9.824  14.258 -0.902 1.00 72.61  ? 436 ASP A O     1 
ATOM   828  C  CB    . ASP A 1 195 ? -12.780 13.357 -1.194 1.00 59.25  ? 436 ASP A CB    1 
ATOM   829  C  CG    . ASP A 1 195 ? -13.380 14.575 -1.888 1.00 64.40  ? 436 ASP A CG    1 
ATOM   830  O  OD1   . ASP A 1 195 ? -12.719 15.628 -2.004 1.00 69.54  ? 436 ASP A OD1   1 
ATOM   831  O  OD2   . ASP A 1 195 ? -14.530 14.463 -2.357 1.00 63.67  ? 436 ASP A OD2   1 
ATOM   832  N  N     . GLY A 1 196 ? -10.968 15.924 0.085  1.00 62.07  ? 437 GLY A N     1 
ATOM   833  C  CA    . GLY A 1 196 ? -9.916  16.905 -0.095 1.00 57.65  ? 437 GLY A CA    1 
ATOM   834  C  C     . GLY A 1 196 ? -9.830  17.497 -1.488 1.00 58.56  ? 437 GLY A C     1 
ATOM   835  O  O     . GLY A 1 196 ? -8.874  18.200 -1.810 1.00 61.93  ? 437 GLY A O     1 
ATOM   836  N  N     . ARG A 1 197 ? -10.823 17.217 -2.322 1.00 55.38  ? 438 ARG A N     1 
ATOM   837  C  CA    . ARG A 1 197 ? -10.841 17.775 -3.667 1.00 59.07  ? 438 ARG A CA    1 
ATOM   838  C  C     . ARG A 1 197 ? -12.163 18.474 -3.951 1.00 60.06  ? 438 ARG A C     1 
ATOM   839  O  O     . ARG A 1 197 ? -12.190 19.547 -4.555 1.00 59.46  ? 438 ARG A O     1 
ATOM   840  C  CB    . ARG A 1 197 ? -10.606 16.685 -4.720 1.00 64.55  ? 438 ARG A CB    1 
ATOM   841  C  CG    . ARG A 1 197 ? -9.521  15.676 -4.378 1.00 69.55  ? 438 ARG A CG    1 
ATOM   842  C  CD    . ARG A 1 197 ? -9.365  14.637 -5.489 1.00 78.95  ? 438 ARG A CD    1 
ATOM   843  N  NE    . ARG A 1 197 ? -10.643 14.047 -5.888 1.00 81.31  ? 438 ARG A NE    1 
ATOM   844  C  CZ    . ARG A 1 197 ? -11.142 12.922 -5.380 1.00 79.61  ? 438 ARG A CZ    1 
ATOM   845  N  NH1   . ARG A 1 197 ? -10.475 12.259 -4.443 1.00 80.37  ? 438 ARG A NH1   1 
ATOM   846  N  NH2   . ARG A 1 197 ? -12.312 12.461 -5.806 1.00 68.19  ? 438 ARG A NH2   1 
ATOM   847  N  N     . SER A 1 198 ? -13.255 17.863 -3.501 1.00 57.54  ? 439 SER A N     1 
ATOM   848  C  CA    . SER A 1 198 ? -14.597 18.269 -3.912 1.00 60.85  ? 439 SER A CA    1 
ATOM   849  C  C     . SER A 1 198 ? -15.016 19.641 -3.385 1.00 61.61  ? 439 SER A C     1 
ATOM   850  O  O     . SER A 1 198 ? -16.045 20.178 -3.794 1.00 65.40  ? 439 SER A O     1 
ATOM   851  C  CB    . SER A 1 198 ? -15.615 17.216 -3.475 1.00 65.34  ? 439 SER A CB    1 
ATOM   852  O  OG    . SER A 1 198 ? -15.311 15.954 -4.047 1.00 64.64  ? 439 SER A OG    1 
ATOM   853  N  N     . HIS A 1 199 ? -14.219 20.208 -2.487 1.00 53.84  ? 440 HIS A N     1 
ATOM   854  C  CA    . HIS A 1 199 ? -14.486 21.544 -1.977 1.00 48.37  ? 440 HIS A CA    1 
ATOM   855  C  C     . HIS A 1 199 ? -14.306 22.602 -3.064 1.00 53.35  ? 440 HIS A C     1 
ATOM   856  O  O     . HIS A 1 199 ? -14.880 23.688 -2.986 1.00 55.67  ? 440 HIS A O     1 
ATOM   857  C  CB    . HIS A 1 199 ? -13.574 21.848 -0.792 1.00 52.77  ? 440 HIS A CB    1 
ATOM   858  C  CG    . HIS A 1 199 ? -12.117 21.852 -1.135 1.00 55.22  ? 440 HIS A CG    1 
ATOM   859  N  ND1   . HIS A 1 199 ? -11.515 22.893 -1.807 1.00 56.20  ? 440 HIS A ND1   1 
ATOM   860  C  CD2   . HIS A 1 199 ? -11.140 20.947 -0.889 1.00 52.42  ? 440 HIS A CD2   1 
ATOM   861  C  CE1   . HIS A 1 199 ? -10.229 22.629 -1.964 1.00 54.18  ? 440 HIS A CE1   1 
ATOM   862  N  NE2   . HIS A 1 199 ? -9.977  21.455 -1.416 1.00 54.02  ? 440 HIS A NE2   1 
ATOM   863  N  N     . ARG A 1 200 ? -13.506 22.274 -4.075 1.00 52.80  ? 441 ARG A N     1 
ATOM   864  C  CA    . ARG A 1 200 ? -13.225 23.186 -5.181 1.00 53.78  ? 441 ARG A CA    1 
ATOM   865  C  C     . ARG A 1 200 ? -14.454 23.456 -6.040 1.00 52.35  ? 441 ARG A C     1 
ATOM   866  O  O     . ARG A 1 200 ? -15.214 22.541 -6.353 1.00 53.33  ? 441 ARG A O     1 
ATOM   867  C  CB    . ARG A 1 200 ? -12.113 22.622 -6.070 1.00 55.85  ? 441 ARG A CB    1 
ATOM   868  C  CG    . ARG A 1 200 ? -10.795 22.406 -5.362 1.00 57.84  ? 441 ARG A CG    1 
ATOM   869  C  CD    . ARG A 1 200 ? -9.797  21.676 -6.248 1.00 62.83  ? 441 ARG A CD    1 
ATOM   870  N  NE    . ARG A 1 200 ? -8.675  21.155 -5.469 1.00 74.90  ? 441 ARG A NE    1 
ATOM   871  C  CZ    . ARG A 1 200 ? -7.395  21.330 -5.784 1.00 85.57  ? 441 ARG A CZ    1 
ATOM   872  N  NH1   . ARG A 1 200 ? -7.062  22.014 -6.873 1.00 87.25  ? 441 ARG A NH1   1 
ATOM   873  N  NH2   . ARG A 1 200 ? -6.445  20.821 -5.007 1.00 78.02  ? 441 ARG A NH2   1 
ATOM   874  N  N     . GLY A 1 201 ? -14.633 24.713 -6.435 1.00 50.40  ? 442 GLY A N     1 
ATOM   875  C  CA    . GLY A 1 201 ? -15.696 25.082 -7.353 1.00 47.23  ? 442 GLY A CA    1 
ATOM   876  C  C     . GLY A 1 201 ? -17.038 25.291 -6.683 1.00 53.45  ? 442 GLY A C     1 
ATOM   877  O  O     . GLY A 1 201 ? -17.998 25.725 -7.322 1.00 58.11  ? 442 GLY A O     1 
ATOM   878  N  N     . ILE A 1 202 ? -17.105 24.986 -5.391 1.00 53.67  ? 443 ILE A N     1 
ATOM   879  C  CA    . ILE A 1 202 ? -18.347 25.104 -4.634 1.00 48.18  ? 443 ILE A CA    1 
ATOM   880  C  C     . ILE A 1 202 ? -18.683 26.554 -4.312 1.00 47.46  ? 443 ILE A C     1 
ATOM   881  O  O     . ILE A 1 202 ? -19.832 26.976 -4.447 1.00 48.64  ? 443 ILE A O     1 
ATOM   882  C  CB    . ILE A 1 202 ? -18.277 24.309 -3.319 1.00 43.53  ? 443 ILE A CB    1 
ATOM   883  C  CG1   . ILE A 1 202 ? -18.078 22.824 -3.613 1.00 47.22  ? 443 ILE A CG1   1 
ATOM   884  C  CG2   . ILE A 1 202 ? -19.539 24.518 -2.504 1.00 36.63  ? 443 ILE A CG2   1 
ATOM   885  C  CD1   . ILE A 1 202 ? -19.229 22.203 -4.377 1.00 47.40  ? 443 ILE A CD1   1 
ATOM   886  N  N     . PHE A 1 203 ? -17.664 27.303 -3.898 1.00 48.01  ? 444 PHE A N     1 
ATOM   887  C  CA    . PHE A 1 203 ? -17.816 28.669 -3.404 1.00 41.07  ? 444 PHE A CA    1 
ATOM   888  C  C     . PHE A 1 203 ? -18.731 29.534 -4.264 1.00 44.56  ? 444 PHE A C     1 
ATOM   889  O  O     . PHE A 1 203 ? -19.727 30.069 -3.776 1.00 44.72  ? 444 PHE A O     1 
ATOM   890  C  CB    . PHE A 1 203 ? -16.441 29.330 -3.288 1.00 45.61  ? 444 PHE A CB    1 
ATOM   891  C  CG    . PHE A 1 203 ? -16.465 30.663 -2.602 1.00 46.98  ? 444 PHE A CG    1 
ATOM   892  C  CD1   . PHE A 1 203 ? -16.628 30.746 -1.229 1.00 43.11  ? 444 PHE A CD1   1 
ATOM   893  C  CD2   . PHE A 1 203 ? -16.312 31.835 -3.327 1.00 49.54  ? 444 PHE A CD2   1 
ATOM   894  C  CE1   . PHE A 1 203 ? -16.648 31.973 -0.594 1.00 39.78  ? 444 PHE A CE1   1 
ATOM   895  C  CE2   . PHE A 1 203 ? -16.330 33.066 -2.698 1.00 43.76  ? 444 PHE A CE2   1 
ATOM   896  C  CZ    . PHE A 1 203 ? -16.497 33.134 -1.331 1.00 42.96  ? 444 PHE A CZ    1 
ATOM   897  N  N     . SER A 1 204 ? -18.404 29.656 -5.546 1.00 48.75  ? 445 SER A N     1 
ATOM   898  C  CA    . SER A 1 204 ? -19.153 30.541 -6.430 1.00 43.23  ? 445 SER A CA    1 
ATOM   899  C  C     . SER A 1 204 ? -20.572 30.037 -6.676 1.00 42.41  ? 445 SER A C     1 
ATOM   900  O  O     . SER A 1 204 ? -21.519 30.824 -6.709 1.00 42.55  ? 445 SER A O     1 
ATOM   901  C  CB    . SER A 1 204 ? -18.421 30.711 -7.759 1.00 42.74  ? 445 SER A CB    1 
ATOM   902  O  OG    . SER A 1 204 ? -19.002 31.755 -8.521 1.00 56.55  ? 445 SER A OG    1 
ATOM   903  N  N     . ARG A 1 205 ? -20.718 28.725 -6.841 1.00 42.69  ? 446 ARG A N     1 
ATOM   904  C  CA    . ARG A 1 205 ? -22.026 28.138 -7.125 1.00 44.16  ? 446 ARG A CA    1 
ATOM   905  C  C     . ARG A 1 205 ? -22.934 28.152 -5.902 1.00 45.67  ? 446 ARG A C     1 
ATOM   906  O  O     . ARG A 1 205 ? -24.150 28.312 -6.025 1.00 47.25  ? 446 ARG A O     1 
ATOM   907  C  CB    . ARG A 1 205 ? -21.871 26.709 -7.645 1.00 46.75  ? 446 ARG A CB    1 
ATOM   908  C  CG    . ARG A 1 205 ? -21.206 26.619 -9.014 1.00 56.44  ? 446 ARG A CG    1 
ATOM   909  C  CD    . ARG A 1 205 ? -21.168 25.186 -9.510 1.00 61.35  ? 446 ARG A CD    1 
ATOM   910  N  NE    . ARG A 1 205 ? -20.483 24.313 -8.562 1.00 62.60  ? 446 ARG A NE    1 
ATOM   911  C  CZ    . ARG A 1 205 ? -20.425 22.991 -8.670 1.00 57.77  ? 446 ARG A CZ    1 
ATOM   912  N  NH1   . ARG A 1 205 ? -21.016 22.384 -9.692 1.00 53.20  ? 446 ARG A NH1   1 
ATOM   913  N  NH2   . ARG A 1 205 ? -19.778 22.278 -7.757 1.00 55.36  ? 446 ARG A NH2   1 
ATOM   914  N  N     . LEU A 1 206 ? -22.338 27.984 -4.725 1.00 40.75  ? 447 LEU A N     1 
ATOM   915  C  CA    . LEU A 1 206 ? -23.081 28.016 -3.472 1.00 36.04  ? 447 LEU A CA    1 
ATOM   916  C  C     . LEU A 1 206 ? -23.689 29.389 -3.201 1.00 40.73  ? 447 LEU A C     1 
ATOM   917  O  O     . LEU A 1 206 ? -24.849 29.498 -2.797 1.00 39.17  ? 447 LEU A O     1 
ATOM   918  C  CB    . LEU A 1 206 ? -22.177 27.620 -2.313 1.00 38.77  ? 447 LEU A CB    1 
ATOM   919  C  CG    . LEU A 1 206 ? -22.819 27.739 -0.935 1.00 35.25  ? 447 LEU A CG    1 
ATOM   920  C  CD1   . LEU A 1 206 ? -24.082 26.892 -0.858 1.00 37.20  ? 447 LEU A CD1   1 
ATOM   921  C  CD2   . LEU A 1 206 ? -21.823 27.317 0.116  1.00 28.60  ? 447 LEU A CD2   1 
ATOM   922  N  N     . LEU A 1 207 ? -22.893 30.433 -3.413 1.00 40.30  ? 448 LEU A N     1 
ATOM   923  C  CA    . LEU A 1 207 ? -23.371 31.803 -3.279 1.00 38.31  ? 448 LEU A CA    1 
ATOM   924  C  C     . LEU A 1 207 ? -24.460 32.099 -4.299 1.00 39.76  ? 448 LEU A C     1 
ATOM   925  O  O     . LEU A 1 207 ? -25.477 32.716 -3.978 1.00 35.14  ? 448 LEU A O     1 
ATOM   926  C  CB    . LEU A 1 207 ? -22.219 32.794 -3.443 1.00 39.68  ? 448 LEU A CB    1 
ATOM   927  C  CG    . LEU A 1 207 ? -21.135 32.737 -2.368 1.00 38.15  ? 448 LEU A CG    1 
ATOM   928  C  CD1   . LEU A 1 207 ? -20.020 33.726 -2.677 1.00 36.95  ? 448 LEU A CD1   1 
ATOM   929  C  CD2   . LEU A 1 207 ? -21.736 33.003 -0.995 1.00 29.71  ? 448 LEU A CD2   1 
ATOM   930  N  N     . ASP A 1 208 ? -24.282 31.627 -5.504 1.00 44.15  ? 449 ASP A N     1 
ATOM   931  C  CA    . ASP A 1 208 ? -25.255 31.811 -6.541 1.00 43.88  ? 449 ASP A CA    1 
ATOM   932  C  C     . ASP A 1 208 ? -26.514 31.103 -6.156 1.00 44.04  ? 449 ASP A C     1 
ATOM   933  O  O     . ASP A 1 208 ? -27.583 31.599 -6.374 1.00 43.99  ? 449 ASP A O     1 
ATOM   934  C  CB    . ASP A 1 208 ? -24.702 31.239 -7.821 1.00 48.23  ? 449 ASP A CB    1 
ATOM   935  C  CG    . ASP A 1 208 ? -25.579 31.486 -9.013 1.00 60.35  ? 449 ASP A CG    1 
ATOM   936  O  OD1   . ASP A 1 208 ? -25.473 32.565 -9.587 1.00 61.64  ? 449 ASP A OD1   1 
ATOM   937  O  OD2   . ASP A 1 208 ? -26.335 30.590 -9.419 1.00 61.71  ? 449 ASP A OD2   1 
ATOM   938  N  N     . SER A 1 209 ? -26.393 29.924 -5.579 1.00 42.54  ? 450 SER A N     1 
ATOM   939  C  CA    . SER A 1 209 ? -27.559 29.170 -5.187 1.00 43.15  ? 450 SER A CA    1 
ATOM   940  C  C     . SER A 1 209 ? -28.366 29.881 -4.146 1.00 42.61  ? 450 SER A C     1 
ATOM   941  O  O     . SER A 1 209 ? -29.558 29.928 -4.218 1.00 39.67  ? 450 SER A O     1 
ATOM   942  C  CB    . SER A 1 209 ? -27.129 27.824 -4.643 1.00 35.61  ? 450 SER A CB    1 
ATOM   943  O  OG    . SER A 1 209 ? -28.213 26.939 -4.532 1.00 38.03  ? 450 SER A OG    1 
ATOM   944  N  N     . LEU A 1 210 ? -27.689 30.438 -3.165 1.00 40.35  ? 451 LEU A N     1 
ATOM   945  C  CA    . LEU A 1 210 ? -28.315 31.152 -2.091 1.00 36.22  ? 451 LEU A CA    1 
ATOM   946  C  C     . LEU A 1 210 ? -28.994 32.401 -2.556 1.00 39.45  ? 451 LEU A C     1 
ATOM   947  O  O     . LEU A 1 210 ? -30.008 32.776 -2.038 1.00 40.25  ? 451 LEU A O     1 
ATOM   948  C  CB    . LEU A 1 210 ? -27.320 31.431 -1.010 1.00 33.38  ? 451 LEU A CB    1 
ATOM   949  C  CG    . LEU A 1 210 ? -26.872 30.176 -0.313 1.00 36.46  ? 451 LEU A CG    1 
ATOM   950  C  CD1   . LEU A 1 210 ? -25.817 30.457 0.711  1.00 37.25  ? 451 LEU A CD1   1 
ATOM   951  C  CD2   . LEU A 1 210 ? -28.054 29.521 0.338  1.00 36.39  ? 451 LEU A CD2   1 
ATOM   952  N  N     . ARG A 1 211 ? -28.407 33.076 -3.513 1.00 39.54  ? 452 ARG A N     1 
ATOM   953  C  CA    . ARG A 1 211 ? -28.997 34.277 -4.037 1.00 40.83  ? 452 ARG A CA    1 
ATOM   954  C  C     . ARG A 1 211 ? -30.309 34.049 -4.730 1.00 42.24  ? 452 ARG A C     1 
ATOM   955  O  O     . ARG A 1 211 ? -31.210 34.842 -4.613 1.00 42.70  ? 452 ARG A O     1 
ATOM   956  C  CB    . ARG A 1 211 ? -28.046 34.955 -4.970 1.00 41.21  ? 452 ARG A CB    1 
ATOM   957  C  CG    . ARG A 1 211 ? -26.783 35.372 -4.305 1.00 33.89  ? 452 ARG A CG    1 
ATOM   958  C  CD    . ARG A 1 211 ? -26.091 36.450 -5.065 1.00 32.66  ? 452 ARG A CD    1 
ATOM   959  N  NE    . ARG A 1 211 ? -24.784 36.649 -4.506 1.00 34.02  ? 452 ARG A NE    1 
ATOM   960  C  CZ    . ARG A 1 211 ? -23.691 36.175 -5.040 1.00 36.36  ? 452 ARG A CZ    1 
ATOM   961  N  NH1   . ARG A 1 211 ? -23.752 35.504 -6.144 1.00 39.44  ? 452 ARG A NH1   1 
ATOM   962  N  NH2   . ARG A 1 211 ? -22.550 36.365 -4.472 1.00 37.17  ? 452 ARG A NH2   1 
ATOM   963  N  N     . GLN A 1 212 ? -30.404 32.963 -5.473 1.00 45.45  ? 453 GLN A N     1 
ATOM   964  C  CA    . GLN A 1 212 ? -31.606 32.597 -6.199 1.00 44.59  ? 453 GLN A CA    1 
ATOM   965  C  C     . GLN A 1 212 ? -32.739 32.338 -5.273 1.00 43.41  ? 453 GLN A C     1 
ATOM   966  O  O     . GLN A 1 212 ? -33.841 32.682 -5.548 1.00 43.97  ? 453 GLN A O     1 
ATOM   967  C  CB    . GLN A 1 212 ? -31.344 31.367 -7.020 1.00 46.75  ? 453 GLN A CB    1 
ATOM   968  C  CG    . GLN A 1 212 ? -30.086 31.460 -7.838 1.00 51.53  ? 453 GLN A CG    1 
ATOM   969  C  CD    . GLN A 1 212 ? -29.998 30.397 -8.882 1.00 51.70  ? 453 GLN A CD    1 
ATOM   970  O  OE1   . GLN A 1 212 ? -30.980 29.792 -9.227 1.00 50.69  ? 453 GLN A OE1   1 
ATOM   971  N  NE2   . GLN A 1 212 ? -28.812 30.168 -9.390 1.00 51.81  ? 453 GLN A NE2   1 
ATOM   972  N  N     . GLU A 1 213 ? -32.442 31.708 -4.163 1.00 41.82  ? 454 GLU A N     1 
ATOM   973  C  CA    . GLU A 1 213 ? -33.393 31.403 -3.125 1.00 38.42  ? 454 GLU A CA    1 
ATOM   974  C  C     . GLU A 1 213 ? -33.901 32.648 -2.513 1.00 42.99  ? 454 GLU A C     1 
ATOM   975  O  O     . GLU A 1 213 ? -34.928 32.666 -1.895 1.00 47.73  ? 454 GLU A O     1 
ATOM   976  C  CB    . GLU A 1 213 ? -32.691 30.725 -1.996 1.00 39.85  ? 454 GLU A CB    1 
ATOM   977  C  CG    . GLU A 1 213 ? -32.745 29.240 -1.967 1.00 43.52  ? 454 GLU A CG    1 
ATOM   978  C  CD    . GLU A 1 213 ? -32.280 28.736 -0.655 1.00 53.52  ? 454 GLU A CD    1 
ATOM   979  O  OE1   . GLU A 1 213 ? -32.770 29.201 0.357  1.00 50.10  ? 454 GLU A OE1   1 
ATOM   980  O  OE2   . GLU A 1 213 ? -31.413 27.887 -0.622 1.00 59.94  ? 454 GLU A OE2   1 
ATOM   981  N  N     . GLY A 1 214 ? -33.132 33.701 -2.627 1.00 43.16  ? 455 GLY A N     1 
ATOM   982  C  CA    . GLY A 1 214 ? -33.485 34.949 -2.004 1.00 39.06  ? 455 GLY A CA    1 
ATOM   983  C  C     . GLY A 1 214 ? -32.914 35.018 -0.618 1.00 38.04  ? 455 GLY A C     1 
ATOM   984  O  O     . GLY A 1 214 ? -33.213 35.895 0.123  1.00 36.39  ? 455 GLY A O     1 
ATOM   985  N  N     . PHE A 1 215 ? -32.108 34.042 -0.268 1.00 38.89  ? 456 PHE A N     1 
ATOM   986  C  CA    . PHE A 1 215 ? -31.466 33.991 1.010  1.00 36.87  ? 456 PHE A CA    1 
ATOM   987  C  C     . PHE A 1 215 ? -30.406 35.040 1.234  1.00 37.18  ? 456 PHE A C     1 
ATOM   988  O  O     . PHE A 1 215 ? -30.374 35.651 2.258  1.00 39.69  ? 456 PHE A O     1 
ATOM   989  C  CB    . PHE A 1 215 ? -30.876 32.613 1.213  1.00 34.75  ? 456 PHE A CB    1 
ATOM   990  C  CG    . PHE A 1 215 ? -30.382 32.377 2.580  1.00 35.85  ? 456 PHE A CG    1 
ATOM   991  C  CD1   . PHE A 1 215 ? -31.217 32.482 3.633  1.00 34.83  ? 456 PHE A CD1   1 
ATOM   992  C  CD2   . PHE A 1 215 ? -29.094 32.060 2.796  1.00 33.94  ? 456 PHE A CD2   1 
ATOM   993  C  CE1   . PHE A 1 215 ? -30.777 32.278 4.892  1.00 34.21  ? 456 PHE A CE1   1 
ATOM   994  C  CE2   . PHE A 1 215 ? -28.637 31.853 4.049  1.00 35.73  ? 456 PHE A CE2   1 
ATOM   995  C  CZ    . PHE A 1 215 ? -29.483 31.959 5.103  1.00 33.65  ? 456 PHE A CZ    1 
ATOM   996  N  N     . LEU A 1 216 ? -29.544 35.258 0.261  1.00 30.37  ? 457 LEU A N     1 
ATOM   997  C  CA    . LEU A 1 216 ? -28.501 36.235 0.407  1.00 33.81  ? 457 LEU A CA    1 
ATOM   998  C  C     . LEU A 1 216 ? -29.027 37.494 -0.180 1.00 35.79  ? 457 LEU A C     1 
ATOM   999  O  O     . LEU A 1 216 ? -29.429 37.520 -1.314 1.00 36.33  ? 457 LEU A O     1 
ATOM   1000 C  CB    . LEU A 1 216 ? -27.259 35.810 -0.311 1.00 29.64  ? 457 LEU A CB    1 
ATOM   1001 C  CG    . LEU A 1 216 ? -26.451 34.666 0.209  1.00 31.74  ? 457 LEU A CG    1 
ATOM   1002 C  CD1   . LEU A 1 216 ? -25.322 34.472 -0.749 1.00 34.59  ? 457 LEU A CD1   1 
ATOM   1003 C  CD2   . LEU A 1 216 ? -25.884 35.019 1.550  1.00 32.38  ? 457 LEU A CD2   1 
ATOM   1004 N  N     . THR A 1 217 ? -29.042 38.542 0.622  1.00 32.64  ? 458 THR A N     1 
ATOM   1005 C  CA    . THR A 1 217 ? -29.580 39.791 0.199  1.00 29.64  ? 458 THR A CA    1 
ATOM   1006 C  C     . THR A 1 217 ? -28.606 40.823 -0.276 1.00 31.63  ? 458 THR A C     1 
ATOM   1007 O  O     . THR A 1 217 ? -28.898 41.524 -1.202 1.00 40.10  ? 458 THR A O     1 
ATOM   1008 C  CB    . THR A 1 217 ? -30.421 40.379 1.310  1.00 32.81  ? 458 THR A CB    1 
ATOM   1009 O  OG1   . THR A 1 217 ? -29.652 40.415 2.476  1.00 36.75  ? 458 THR A OG1   1 
ATOM   1010 C  CG2   . THR A 1 217 ? -31.513 39.491 1.624  1.00 32.31  ? 458 THR A CG2   1 
ATOM   1011 N  N     . ASP A 1 218 ? -27.451 40.919 0.346  1.00 31.94  ? 459 ASP A N     1 
ATOM   1012 C  CA    . ASP A 1 218 ? -26.465 41.902 -0.018 1.00 27.68  ? 459 ASP A CA    1 
ATOM   1013 C  C     . ASP A 1 218 ? -25.127 41.289 0.174  1.00 28.49  ? 459 ASP A C     1 
ATOM   1014 O  O     . ASP A 1 218 ? -25.003 40.399 0.955  1.00 32.94  ? 459 ASP A O     1 
ATOM   1015 C  CB    . ASP A 1 218 ? -26.611 43.088 0.906  1.00 31.91  ? 459 ASP A CB    1 
ATOM   1016 C  CG    . ASP A 1 218 ? -27.954 43.737 0.815  1.00 39.50  ? 459 ASP A CG    1 
ATOM   1017 O  OD1   . ASP A 1 218 ? -28.176 44.493 -0.121 1.00 39.83  ? 459 ASP A OD1   1 
ATOM   1018 O  OD2   . ASP A 1 218 ? -28.784 43.527 1.690  1.00 35.94  ? 459 ASP A OD2   1 
ATOM   1019 N  N     . ASP A 1 219 ? -24.121 41.773 -0.536 1.00 33.21  ? 460 ASP A N     1 
ATOM   1020 C  CA    . ASP A 1 219 ? -22.756 41.262 -0.426 1.00 34.85  ? 460 ASP A CA    1 
ATOM   1021 C  C     . ASP A 1 219 ? -21.786 42.327 0.129  1.00 33.61  ? 460 ASP A C     1 
ATOM   1022 O  O     . ASP A 1 219 ? -21.737 43.441 -0.377 1.00 40.78  ? 460 ASP A O     1 
ATOM   1023 C  CB    . ASP A 1 219 ? -22.274 40.748 -1.792 1.00 35.77  ? 460 ASP A CB    1 
ATOM   1024 C  CG    . ASP A 1 219 ? -23.065 39.538 -2.283 1.00 41.16  ? 460 ASP A CG    1 
ATOM   1025 O  OD1   . ASP A 1 219 ? -23.492 38.722 -1.441 1.00 41.14  ? 460 ASP A OD1   1 
ATOM   1026 O  OD2   . ASP A 1 219 ? -23.246 39.393 -3.512 1.00 37.39  ? 460 ASP A OD2   1 
ATOM   1027 N  N     . LEU A 1 220 ? -21.052 41.986 1.191  1.00 31.97  ? 461 LEU A N     1 
ATOM   1028 C  CA    . LEU A 1 220 ? -19.965 42.822 1.718  1.00 35.30  ? 461 LEU A CA    1 
ATOM   1029 C  C     . LEU A 1 220 ? -18.693 42.035 1.566  1.00 39.79  ? 461 LEU A C     1 
ATOM   1030 O  O     . LEU A 1 220 ? -18.670 40.877 1.963  1.00 45.83  ? 461 LEU A O     1 
ATOM   1031 C  CB    . LEU A 1 220 ? -20.137 43.151 3.201  1.00 26.00  ? 461 LEU A CB    1 
ATOM   1032 C  CG    . LEU A 1 220 ? -21.513 43.303 3.830  1.00 27.18  ? 461 LEU A CG    1 
ATOM   1033 C  CD1   . LEU A 1 220 ? -21.421 42.965 5.306  1.00 27.61  ? 461 LEU A CD1   1 
ATOM   1034 C  CD2   . LEU A 1 220 ? -22.069 44.696 3.637  1.00 27.41  ? 461 LEU A CD2   1 
ATOM   1035 N  N     . VAL A 1 221 ? -17.648 42.605 1.034  1.00 37.86  ? 462 VAL A N     1 
ATOM   1036 C  CA    . VAL A 1 221 ? -16.442 41.826 0.955  1.00 41.75  ? 462 VAL A CA    1 
ATOM   1037 C  C     . VAL A 1 221 ? -16.790 40.508 0.374  1.00 39.85  ? 462 VAL A C     1 
ATOM   1038 O  O     . VAL A 1 221 ? -16.564 39.474 0.902  1.00 32.01  ? 462 VAL A O     1 
ATOM   1039 C  CB    . VAL A 1 221 ? -15.794 41.658 2.279  1.00 31.96  ? 462 VAL A CB    1 
ATOM   1040 C  CG1   . VAL A 1 221 ? -14.521 40.914 2.060  1.00 46.20  ? 462 VAL A CG1   1 
ATOM   1041 C  CG2   . VAL A 1 221 ? -15.499 42.999 2.850  1.00 37.23  ? 462 VAL A CG2   1 
ATOM   1042 N  N     . SER A 1 222 ? -17.328 40.621 -0.800 1.00 55.63  ? 463 SER A N     1 
ATOM   1043 C  CA    . SER A 1 222 ? -17.862 39.556 -1.583 1.00 59.49  ? 463 SER A CA    1 
ATOM   1044 C  C     . SER A 1 222 ? -16.780 38.570 -1.937 1.00 59.06  ? 463 SER A C     1 
ATOM   1045 O  O     . SER A 1 222 ? -17.045 37.555 -2.573 1.00 51.19  ? 463 SER A O     1 
ATOM   1046 C  CB    . SER A 1 222 ? -18.452 40.170 -2.852 1.00 62.59  ? 463 SER A CB    1 
ATOM   1047 O  OG    . SER A 1 222 ? -18.542 41.584 -2.748 1.00 55.72  ? 463 SER A OG    1 
ATOM   1048 N  N     . GLN A 1 223 ? -15.556 38.899 -1.593 1.00 42.72  ? 464 GLN A N     1 
ATOM   1049 C  CA    . GLN A 1 223 ? -14.476 38.059 -1.972 1.00 48.70  ? 464 GLN A CA    1 
ATOM   1050 C  C     . GLN A 1 223 ? -13.299 37.960 -1.106 1.00 48.73  ? 464 GLN A C     1 
ATOM   1051 O  O     . GLN A 1 223 ? -12.950 38.887 -0.468 1.00 47.78  ? 464 GLN A O     1 
ATOM   1052 C  CB    . GLN A 1 223 ? -13.907 38.757 -3.175 1.00 68.47  ? 464 GLN A CB    1 
ATOM   1053 C  CG    . GLN A 1 223 ? -13.516 40.200 -2.840 1.00 60.99  ? 464 GLN A CG    1 
ATOM   1054 C  CD    . GLN A 1 223 ? -12.722 40.873 -3.899 1.00 61.77  ? 464 GLN A CD    1 
ATOM   1055 O  OE1   . GLN A 1 223 ? -11.517 40.971 -3.810 1.00 63.40  ? 464 GLN A OE1   1 
ATOM   1056 N  NE2   . GLN A 1 223 ? -13.395 41.341 -4.908 1.00 68.96  ? 464 GLN A NE2   1 
ATOM   1057 N  N     . GLU A 1 224 ? -12.660 36.821 -1.133 1.00 47.91  ? 465 GLU A N     1 
ATOM   1058 C  CA    . GLU A 1 224 ? -11.378 36.626 -0.541 1.00 48.97  ? 465 GLU A CA    1 
ATOM   1059 C  C     . GLU A 1 224 ? -10.965 35.369 -1.231 1.00 58.21  ? 465 GLU A C     1 
ATOM   1060 O  O     . GLU A 1 224 ? -11.722 34.451 -1.228 1.00 62.15  ? 465 GLU A O     1 
ATOM   1061 C  CB    . GLU A 1 224 ? -11.427 36.520 0.961  1.00 43.57  ? 465 GLU A CB    1 
ATOM   1062 C  CG    . GLU A 1 224 ? -11.580 37.864 1.626  1.00 44.57  ? 465 GLU A CG    1 
ATOM   1063 C  CD    . GLU A 1 224 ? -11.270 37.841 3.091  1.00 45.76  ? 465 GLU A CD    1 
ATOM   1064 O  OE1   . GLU A 1 224 ? -10.881 36.813 3.592  1.00 47.93  ? 465 GLU A OE1   1 
ATOM   1065 O  OE2   . GLU A 1 224 ? -11.400 38.858 3.752  1.00 43.32  ? 465 GLU A OE2   1 
ATOM   1066 N  N     . GLU A 1 225 ? -9.803  35.311 -1.859 1.00 61.98  ? 466 GLU A N     1 
ATOM   1067 C  CA    . GLU A 1 225 ? -9.354  34.087 -2.531 1.00 62.99  ? 466 GLU A CA    1 
ATOM   1068 C  C     . GLU A 1 225 ? -7.932  33.883 -2.060 1.00 65.62  ? 466 GLU A C     1 
ATOM   1069 O  O     . GLU A 1 225 ? -6.974  33.966 -2.803 1.00 59.61  ? 466 GLU A O     1 
ATOM   1070 C  CB    . GLU A 1 225 ? -9.449  34.178 -4.037 1.00 45.36  ? 466 GLU A CB    1 
ATOM   1071 C  CG    . GLU A 1 225 ? -10.716 33.587 -4.612 1.00 54.57  ? 466 GLU A CG    1 
ATOM   1072 C  CD    . GLU A 1 225 ? -11.881 34.552 -4.640 1.00 63.62  ? 466 GLU A CD    1 
ATOM   1073 O  OE1   . GLU A 1 225 ? -12.567 34.682 -5.664 1.00 61.13  ? 466 GLU A OE1   1 
ATOM   1074 O  OE2   . GLU A 1 225 ? -12.134 35.189 -3.634 1.00 58.43  ? 466 GLU A OE2   1 
ATOM   1075 N  N     . ASN A 1 226 ? -7.875  33.577 -0.777 1.00 63.29  ? 467 ASN A N     1 
ATOM   1076 C  CA    . ASN A 1 226 ? -6.695  33.415 0.040  1.00 58.19  ? 467 ASN A CA    1 
ATOM   1077 C  C     . ASN A 1 226 ? -6.218  32.030 0.070  1.00 54.61  ? 467 ASN A C     1 
ATOM   1078 O  O     . ASN A 1 226 ? -6.836  31.175 0.648  1.00 54.00  ? 467 ASN A O     1 
ATOM   1079 C  CB    . ASN A 1 226 ? -7.001  33.731 1.516  1.00 51.22  ? 467 ASN A CB    1 
ATOM   1080 C  CG    . ASN A 1 226 ? -8.288  34.465 1.722  1.00 51.43  ? 467 ASN A CG    1 
ATOM   1081 O  OD1   . ASN A 1 226 ? -9.122  34.046 2.483  1.00 47.83  ? 467 ASN A OD1   1 
ATOM   1082 N  ND2   . ASN A 1 226 ? -8.482  35.502 0.962  1.00 55.17  ? 467 ASN A ND2   1 
ATOM   1083 N  N     . GLY A 1 227 ? -5.078  31.809 -0.529 1.00 53.90  ? 468 GLY A N     1 
ATOM   1084 C  CA    . GLY A 1 227 ? -4.514  30.499 -0.559 1.00 53.27  ? 468 GLY A CA    1 
ATOM   1085 C  C     . GLY A 1 227 ? -5.516  29.577 -1.177 1.00 56.32  ? 468 GLY A C     1 
ATOM   1086 O  O     . GLY A 1 227 ? -6.051  29.844 -2.235 1.00 51.05  ? 468 GLY A O     1 
ATOM   1087 N  N     . GLN A 1 228 ? -5.761  28.489 -0.473 1.00 55.50  ? 469 GLN A N     1 
ATOM   1088 C  CA    . GLN A 1 228 ? -6.673  27.462 -0.894 1.00 56.78  ? 469 GLN A CA    1 
ATOM   1089 C  C     . GLN A 1 228 ? -8.044  27.682 -0.323 1.00 53.58  ? 469 GLN A C     1 
ATOM   1090 O  O     . GLN A 1 228 ? -8.969  26.960 -0.634 1.00 51.45  ? 469 GLN A O     1 
ATOM   1091 C  CB    . GLN A 1 228 ? -6.134  26.136 -0.418 1.00 60.37  ? 469 GLN A CB    1 
ATOM   1092 C  CG    . GLN A 1 228 ? -4.976  25.632 -1.232 1.00 60.02  ? 469 GLN A CG    1 
ATOM   1093 C  CD    . GLN A 1 228 ? -5.363  25.490 -2.675 1.00 75.33  ? 469 GLN A CD    1 
ATOM   1094 O  OE1   . GLN A 1 228 ? -6.389  24.903 -2.993 1.00 68.51  ? 469 GLN A OE1   1 
ATOM   1095 N  NE2   . GLN A 1 228 ? -4.555  26.041 -3.560 1.00 79.81  ? 469 GLN A NE2   1 
ATOM   1096 N  N     . GLN A 1 229 ? -8.157  28.698 0.517  1.00 53.24  ? 470 GLN A N     1 
ATOM   1097 C  CA    . GLN A 1 229 ? -9.393  29.035 1.181  1.00 46.96  ? 470 GLN A CA    1 
ATOM   1098 C  C     . GLN A 1 229 ? -10.090 30.195 0.529  1.00 51.83  ? 470 GLN A C     1 
ATOM   1099 O  O     . GLN A 1 229 ? -9.480  30.970 -0.141 1.00 51.46  ? 470 GLN A O     1 
ATOM   1100 C  CB    . GLN A 1 229 ? -9.108  29.405 2.615  1.00 46.89  ? 470 GLN A CB    1 
ATOM   1101 C  CG    . GLN A 1 229 ? -8.605  28.293 3.495  1.00 46.27  ? 470 GLN A CG    1 
ATOM   1102 C  CD    . GLN A 1 229 ? -8.388  28.760 4.909  1.00 48.76  ? 470 GLN A CD    1 
ATOM   1103 O  OE1   . GLN A 1 229 ? -8.868  29.796 5.301  1.00 44.90  ? 470 GLN A OE1   1 
ATOM   1104 N  NE2   . GLN A 1 229 ? -7.669  27.996 5.670  1.00 47.75  ? 470 GLN A NE2   1 
ATOM   1105 N  N     . GLN A 1 230 ? -11.388 30.299 0.732  1.00 47.61  ? 471 GLN A N     1 
ATOM   1106 C  CA    . GLN A 1 230 ? -12.171 31.371 0.181  1.00 43.19  ? 471 GLN A CA    1 
ATOM   1107 C  C     . GLN A 1 230 ? -13.074 31.881 1.238  1.00 46.22  ? 471 GLN A C     1 
ATOM   1108 O  O     . GLN A 1 230 ? -13.532 31.119 2.019  1.00 46.88  ? 471 GLN A O     1 
ATOM   1109 C  CB    . GLN A 1 230 ? -12.968 30.850 -0.960 1.00 45.29  ? 471 GLN A CB    1 
ATOM   1110 C  CG    . GLN A 1 230 ? -12.129 30.784 -2.190 1.00 53.13  ? 471 GLN A CG    1 
ATOM   1111 C  CD    . GLN A 1 230 ? -12.617 29.756 -3.133 1.00 61.92  ? 471 GLN A CD    1 
ATOM   1112 O  OE1   . GLN A 1 230 ? -12.769 28.601 -2.776 1.00 59.59  ? 471 GLN A OE1   1 
ATOM   1113 N  NE2   . GLN A 1 230 ? -12.870 30.163 -4.354 1.00 63.80  ? 471 GLN A NE2   1 
ATOM   1114 N  N     . LYS A 1 231 ? -13.328 33.177 1.281  1.00 46.85  ? 472 LYS A N     1 
ATOM   1115 C  CA    . LYS A 1 231 ? -14.182 33.736 2.304  1.00 40.05  ? 472 LYS A CA    1 
ATOM   1116 C  C     . LYS A 1 231 ? -15.173 34.694 1.751  1.00 35.14  ? 472 LYS A C     1 
ATOM   1117 O  O     . LYS A 1 231 ? -14.855 35.447 0.895  1.00 33.25  ? 472 LYS A O     1 
ATOM   1118 C  CB    . LYS A 1 231 ? -13.318 34.456 3.307  1.00 40.72  ? 472 LYS A CB    1 
ATOM   1119 C  CG    . LYS A 1 231 ? -13.933 34.695 4.649  1.00 37.13  ? 472 LYS A CG    1 
ATOM   1120 C  CD    . LYS A 1 231 ? -12.855 35.156 5.584  1.00 42.95  ? 472 LYS A CD    1 
ATOM   1121 C  CE    . LYS A 1 231 ? -13.421 35.717 6.859  1.00 46.53  ? 472 LYS A CE    1 
ATOM   1122 N  NZ    . LYS A 1 231 ? -12.299 36.102 7.729  1.00 46.97  ? 472 LYS A NZ    1 
ATOM   1123 N  N     . TYR A 1 232 ? -16.383 34.654 2.269  1.00 36.97  ? 473 TYR A N     1 
ATOM   1124 C  CA    . TYR A 1 232 ? -17.459 35.533 1.874  1.00 34.68  ? 473 TYR A CA    1 
ATOM   1125 C  C     . TYR A 1 232 ? -18.027 36.196 3.104  1.00 34.73  ? 473 TYR A C     1 
ATOM   1126 O  O     . TYR A 1 232 ? -18.171 35.543 4.067  1.00 39.14  ? 473 TYR A O     1 
ATOM   1127 C  CB    . TYR A 1 232 ? -18.535 34.716 1.198  1.00 25.91  ? 473 TYR A CB    1 
ATOM   1128 C  CG    . TYR A 1 232 ? -19.819 35.422 1.005  1.00 26.48  ? 473 TYR A CG    1 
ATOM   1129 C  CD1   . TYR A 1 232 ? -19.980 36.321 0.014  1.00 27.46  ? 473 TYR A CD1   1 
ATOM   1130 C  CD2   . TYR A 1 232 ? -20.881 35.161 1.805  1.00 30.33  ? 473 TYR A CD2   1 
ATOM   1131 C  CE1   . TYR A 1 232 ? -21.161 36.964 -0.155 1.00 29.01  ? 473 TYR A CE1   1 
ATOM   1132 C  CE2   . TYR A 1 232 ? -22.066 35.800 1.631  1.00 28.85  ? 473 TYR A CE2   1 
ATOM   1133 C  CZ    . TYR A 1 232 ? -22.187 36.699 0.646  1.00 29.59  ? 473 TYR A CZ    1 
ATOM   1134 O  OH    . TYR A 1 232 ? -23.353 37.341 0.467  1.00 28.80  ? 473 TYR A OH    1 
ATOM   1135 N  N     . LEU A 1 233 ? -18.320 37.491 3.069  1.00 32.45  ? 474 LEU A N     1 
ATOM   1136 C  CA    . LEU A 1 233 ? -18.931 38.220 4.165  1.00 31.99  ? 474 LEU A CA    1 
ATOM   1137 C  C     . LEU A 1 233 ? -20.167 38.735 3.530  1.00 30.29  ? 474 LEU A C     1 
ATOM   1138 O  O     . LEU A 1 233 ? -20.079 39.265 2.482  1.00 34.37  ? 474 LEU A O     1 
ATOM   1139 C  CB    . LEU A 1 233 ? -18.086 39.377 4.628  1.00 32.95  ? 474 LEU A CB    1 
ATOM   1140 C  CG    . LEU A 1 233 ? -16.648 39.136 5.002  1.00 36.79  ? 474 LEU A CG    1 
ATOM   1141 C  CD1   . LEU A 1 233 ? -16.240 40.133 6.029  1.00 30.80  ? 474 LEU A CD1   1 
ATOM   1142 C  CD2   . LEU A 1 233 ? -16.487 37.769 5.572  1.00 41.88  ? 474 LEU A CD2   1 
ATOM   1143 N  N     . GLY A 1 234 ? -21.324 38.593 4.147  1.00 32.57  ? 475 GLY A N     1 
ATOM   1144 C  CA    . GLY A 1 234 ? -22.558 38.969 3.486  1.00 28.78  ? 475 GLY A CA    1 
ATOM   1145 C  C     . GLY A 1 234 ? -23.761 39.066 4.390  1.00 27.19  ? 475 GLY A C     1 
ATOM   1146 O  O     . GLY A 1 234 ? -23.667 38.886 5.600  1.00 29.81  ? 475 GLY A O     1 
ATOM   1147 N  N     . VAL A 1 235 ? -24.902 39.359 3.786  1.00 25.19  ? 476 VAL A N     1 
ATOM   1148 C  CA    . VAL A 1 235 ? -26.135 39.527 4.531  1.00 28.44  ? 476 VAL A CA    1 
ATOM   1149 C  C     . VAL A 1 235 ? -27.183 38.532 4.071  1.00 31.88  ? 476 VAL A C     1 
ATOM   1150 O  O     . VAL A 1 235 ? -27.521 38.482 2.887  1.00 34.45  ? 476 VAL A O     1 
ATOM   1151 C  CB    . VAL A 1 235 ? -26.694 40.946 4.369  1.00 30.43  ? 476 VAL A CB    1 
ATOM   1152 C  CG1   . VAL A 1 235 ? -27.861 41.159 5.315  1.00 30.47  ? 476 VAL A CG1   1 
ATOM   1153 C  CG2   . VAL A 1 235 ? -25.602 41.970 4.621  1.00 36.95  ? 476 VAL A CG2   1 
ATOM   1154 N  N     . CYS A 1 236 ? -27.706 37.742 5.001  1.00 26.93  ? 477 CYS A N     1 
ATOM   1155 C  CA    . CYS A 1 236 ? -28.769 36.807 4.662  1.00 31.06  ? 477 CYS A CA    1 
ATOM   1156 C  C     . CYS A 1 236 ? -30.043 37.132 5.422  1.00 30.54  ? 477 CYS A C     1 
ATOM   1157 O  O     . CYS A 1 236 ? -30.051 37.997 6.298  1.00 31.92  ? 477 CYS A O     1 
ATOM   1158 C  CB    . CYS A 1 236 ? -28.343 35.371 4.957  1.00 34.70  ? 477 CYS A CB    1 
ATOM   1159 S  SG    . CYS A 1 236 ? -28.168 35.021 6.710  1.00 30.58  ? 477 CYS A SG    1 
ATOM   1160 N  N     . ARG A 1 237 ? -31.120 36.437 5.071  1.00 31.88  ? 478 ARG A N     1 
ATOM   1161 C  CA    . ARG A 1 237 ? -32.391 36.571 5.771  1.00 30.48  ? 478 ARG A CA    1 
ATOM   1162 C  C     . ARG A 1 237 ? -33.260 35.337 5.560  1.00 34.49  ? 478 ARG A C     1 
ATOM   1163 O  O     . ARG A 1 237 ? -33.513 34.933 4.423  1.00 41.90  ? 478 ARG A O     1 
ATOM   1164 C  CB    . ARG A 1 237 ? -33.141 37.819 5.310  1.00 26.51  ? 478 ARG A CB    1 
ATOM   1165 C  CG    . ARG A 1 237 ? -34.434 38.036 6.074  1.00 33.12  ? 478 ARG A CG    1 
ATOM   1166 C  CD    . ARG A 1 237 ? -35.157 39.284 5.619  1.00 35.67  ? 478 ARG A CD    1 
ATOM   1167 N  NE    . ARG A 1 237 ? -35.449 39.257 4.190  1.00 39.54  ? 478 ARG A NE    1 
ATOM   1168 C  CZ    . ARG A 1 237 ? -36.334 40.053 3.600  1.00 39.99  ? 478 ARG A CZ    1 
ATOM   1169 N  NH1   . ARG A 1 237 ? -37.019 40.931 4.323  1.00 35.16  ? 478 ARG A NH1   1 
ATOM   1170 N  NH2   . ARG A 1 237 ? -36.540 39.966 2.292  1.00 39.65  ? 478 ARG A NH2   1 
ATOM   1171 N  N     . LEU A 1 238 ? -33.713 34.738 6.656  1.00 33.09  ? 479 LEU A N     1 
ATOM   1172 C  CA    . LEU A 1 238 ? -34.562 33.554 6.581  1.00 38.50  ? 479 LEU A CA    1 
ATOM   1173 C  C     . LEU A 1 238 ? -35.925 33.900 5.987  1.00 36.85  ? 479 LEU A C     1 
ATOM   1174 O  O     . LEU A 1 238 ? -36.406 35.020 6.145  1.00 32.79  ? 479 LEU A O     1 
ATOM   1175 C  CB    . LEU A 1 238 ? -34.726 32.926 7.966  1.00 34.16  ? 479 LEU A CB    1 
ATOM   1176 C  CG    . LEU A 1 238 ? -33.447 32.330 8.552  1.00 33.04  ? 479 LEU A CG    1 
ATOM   1177 C  CD1   . LEU A 1 238 ? -33.692 31.784 9.941  1.00 37.71  ? 479 LEU A CD1   1 
ATOM   1178 C  CD2   . LEU A 1 238 ? -32.909 31.246 7.642  1.00 36.34  ? 479 LEU A CD2   1 
ATOM   1179 N  N     . PRO A 1 239 ? -36.549 32.937 5.287  1.00 43.60  ? 480 PRO A N     1 
ATOM   1180 C  CA    . PRO A 1 239 ? -37.865 33.179 4.683  1.00 41.39  ? 480 PRO A CA    1 
ATOM   1181 C  C     . PRO A 1 239 ? -38.959 33.317 5.733  1.00 42.82  ? 480 PRO A C     1 
ATOM   1182 O  O     . PRO A 1 239 ? -38.865 32.715 6.803  1.00 45.04  ? 480 PRO A O     1 
ATOM   1183 C  CB    . PRO A 1 239 ? -38.090 31.934 3.823  1.00 37.30  ? 480 PRO A CB    1 
ATOM   1184 C  CG    . PRO A 1 239 ? -37.279 30.870 4.496  1.00 39.48  ? 480 PRO A CG    1 
ATOM   1185 C  CD    . PRO A 1 239 ? -36.062 31.569 5.023  1.00 36.47  ? 480 PRO A CD    1 
ATOM   1186 N  N     . GLY A 1 240 ? -39.983 34.107 5.431  1.00 44.09  ? 481 GLY A N     1 
ATOM   1187 C  CA    . GLY A 1 240 ? -41.103 34.259 6.341  1.00 50.07  ? 481 GLY A CA    1 
ATOM   1188 C  C     . GLY A 1 240 ? -41.276 35.681 6.826  1.00 54.65  ? 481 GLY A C     1 
ATOM   1189 O  O     . GLY A 1 240 ? -40.462 36.548 6.515  1.00 58.94  ? 481 GLY A O     1 
ATOM   1190 N  N     . PRO A 1 241 ? -42.340 35.929 7.603  1.00 64.10  ? 482 PRO A N     1 
ATOM   1191 C  CA    . PRO A 1 241 ? -42.653 37.274 8.090  1.00 62.10  ? 482 PRO A CA    1 
ATOM   1192 C  C     . PRO A 1 241 ? -41.971 37.585 9.419  1.00 54.69  ? 482 PRO A C     1 
ATOM   1193 O  O     . PRO A 1 241 ? -41.815 36.696 10.258 1.00 55.61  ? 482 PRO A O     1 
ATOM   1194 C  CB    . PRO A 1 241 ? -44.176 37.236 8.246  1.00 65.55  ? 482 PRO A CB    1 
ATOM   1195 C  CG    . PRO A 1 241 ? -44.518 35.754 8.433  1.00 60.43  ? 482 PRO A CG    1 
ATOM   1196 C  CD    . PRO A 1 241 ? -43.289 34.931 8.126  1.00 56.25  ? 482 PRO A CD    1 
ATOM   1197 N  N     . GLY A 1 242 ? -41.561 38.836 9.600  1.00 49.95  ? 483 GLY A N     1 
ATOM   1198 C  CA    . GLY A 1 242 ? -40.918 39.254 10.834 1.00 50.93  ? 483 GLY A CA    1 
ATOM   1199 C  C     . GLY A 1 242 ? -39.506 38.719 10.997 1.00 54.99  ? 483 GLY A C     1 
ATOM   1200 O  O     . GLY A 1 242 ? -39.081 38.384 12.105 1.00 51.17  ? 483 GLY A O     1 
ATOM   1201 N  N     . ARG A 1 243 ? -38.776 38.643 9.888  1.00 53.46  ? 484 ARG A N     1 
ATOM   1202 C  CA    . ARG A 1 243 ? -37.400 38.159 9.902  1.00 42.99  ? 484 ARG A CA    1 
ATOM   1203 C  C     . ARG A 1 243 ? -36.408 39.303 9.727  1.00 43.12  ? 484 ARG A C     1 
ATOM   1204 O  O     . ARG A 1 243 ? -36.574 40.147 8.847  1.00 46.81  ? 484 ARG A O     1 
ATOM   1205 C  CB    . ARG A 1 243 ? -37.194 37.122 8.803  1.00 39.14  ? 484 ARG A CB    1 
ATOM   1206 C  CG    . ARG A 1 243 ? -38.011 35.865 8.984  1.00 41.63  ? 484 ARG A CG    1 
ATOM   1207 C  CD    . ARG A 1 243 ? -37.541 35.085 10.196 1.00 42.93  ? 484 ARG A CD    1 
ATOM   1208 N  NE    . ARG A 1 243 ? -37.497 33.651 9.923  1.00 46.87  ? 484 ARG A NE    1 
ATOM   1209 C  CZ    . ARG A 1 243 ? -37.111 32.731 10.801 1.00 49.95  ? 484 ARG A CZ    1 
ATOM   1210 N  NH1   . ARG A 1 243 ? -36.733 33.090 12.023 1.00 44.26  ? 484 ARG A NH1   1 
ATOM   1211 N  NH2   . ARG A 1 243 ? -37.103 31.450 10.454 1.00 49.64  ? 484 ARG A NH2   1 
ATOM   1212 N  N     . ARG A 1 244 ? -35.376 39.329 10.564 1.00 41.17  ? 485 ARG A N     1 
ATOM   1213 C  CA    . ARG A 1 244 ? -34.340 40.352 10.462 1.00 38.40  ? 485 ARG A CA    1 
ATOM   1214 C  C     . ARG A 1 244 ? -33.220 39.910 9.524  1.00 35.71  ? 485 ARG A C     1 
ATOM   1215 O  O     . ARG A 1 244 ? -32.994 38.717 9.339  1.00 41.32  ? 485 ARG A O     1 
ATOM   1216 C  CB    . ARG A 1 244 ? -33.758 40.676 11.840 1.00 36.28  ? 485 ARG A CB    1 
ATOM   1217 C  CG    . ARG A 1 244 ? -34.729 41.325 12.810 1.00 34.16  ? 485 ARG A CG    1 
ATOM   1218 C  CD    . ARG A 1 244 ? -33.986 41.839 14.036 1.00 40.17  ? 485 ARG A CD    1 
ATOM   1219 N  NE    . ARG A 1 244 ? -34.880 42.394 15.050 1.00 46.37  ? 485 ARG A NE    1 
ATOM   1220 C  CZ    . ARG A 1 244 ? -35.221 43.676 15.126 1.00 46.26  ? 485 ARG A CZ    1 
ATOM   1221 N  NH1   . ARG A 1 244 ? -34.745 44.548 14.244 1.00 42.28  ? 485 ARG A NH1   1 
ATOM   1222 N  NH2   . ARG A 1 244 ? -36.039 44.087 16.084 1.00 47.41  ? 485 ARG A NH2   1 
ATOM   1223 N  N     . HIS A 1 245 ? -32.524 40.871 8.930  1.00 32.46  ? 486 HIS A N     1 
ATOM   1224 C  CA    . HIS A 1 245 ? -31.339 40.560 8.142  1.00 29.99  ? 486 HIS A CA    1 
ATOM   1225 C  C     . HIS A 1 245 ? -30.196 40.180 9.079  1.00 32.00  ? 486 HIS A C     1 
ATOM   1226 O  O     . HIS A 1 245 ? -30.003 40.813 10.116 1.00 34.96  ? 486 HIS A O     1 
ATOM   1227 C  CB    . HIS A 1 245 ? -30.945 41.745 7.259  1.00 29.05  ? 486 HIS A CB    1 
ATOM   1228 C  CG    . HIS A 1 245 ? -31.899 42.007 6.134  1.00 30.03  ? 486 HIS A CG    1 
ATOM   1229 N  ND1   . HIS A 1 245 ? -33.101 42.655 6.312  1.00 34.06  ? 486 HIS A ND1   1 
ATOM   1230 C  CD2   . HIS A 1 245 ? -31.827 41.704 4.816  1.00 32.94  ? 486 HIS A CD2   1 
ATOM   1231 C  CE1   . HIS A 1 245 ? -33.729 42.741 5.152  1.00 31.26  ? 486 HIS A CE1   1 
ATOM   1232 N  NE2   . HIS A 1 245 ? -32.977 42.171 4.229  1.00 32.34  ? 486 HIS A NE2   1 
ATOM   1233 N  N     . ARG A 1 246 ? -29.449 39.138 8.729  1.00 29.03  ? 487 ARG A N     1 
ATOM   1234 C  CA    . ARG A 1 246 ? -28.353 38.690 9.579  1.00 27.94  ? 487 ARG A CA    1 
ATOM   1235 C  C     . ARG A 1 246 ? -27.026 38.747 8.853  1.00 27.53  ? 487 ARG A C     1 
ATOM   1236 O  O     . ARG A 1 246 ? -26.963 38.575 7.638  1.00 34.24  ? 487 ARG A O     1 
ATOM   1237 C  CB    . ARG A 1 246 ? -28.596 37.266 10.078 1.00 29.12  ? 487 ARG A CB    1 
ATOM   1238 C  CG    . ARG A 1 246 ? -29.888 37.081 10.837 1.00 34.48  ? 487 ARG A CG    1 
ATOM   1239 C  CD    . ARG A 1 246 ? -29.944 37.946 12.080 1.00 32.49  ? 487 ARG A CD    1 
ATOM   1240 N  NE    . ARG A 1 246 ? -31.187 37.718 12.810 1.00 36.85  ? 487 ARG A NE    1 
ATOM   1241 C  CZ    . ARG A 1 246 ? -31.524 38.337 13.936 1.00 38.93  ? 487 ARG A CZ    1 
ATOM   1242 N  NH1   . ARG A 1 246 ? -30.712 39.235 14.480 1.00 35.17  ? 487 ARG A NH1   1 
ATOM   1243 N  NH2   . ARG A 1 246 ? -32.677 38.052 14.519 1.00 40.88  ? 487 ARG A NH2   1 
ATOM   1244 N  N     . ARG A 1 247 ? -25.962 38.987 9.606  1.00 27.40  ? 488 ARG A N     1 
ATOM   1245 C  CA    . ARG A 1 247 ? -24.619 38.933 9.056  1.00 30.70  ? 488 ARG A CA    1 
ATOM   1246 C  C     . ARG A 1 247 ? -24.179 37.484 8.922  1.00 32.69  ? 488 ARG A C     1 
ATOM   1247 O  O     . ARG A 1 247 ? -24.262 36.706 9.875  1.00 35.26  ? 488 ARG A O     1 
ATOM   1248 C  CB    . ARG A 1 247 ? -23.643 39.712 9.936  1.00 31.86  ? 488 ARG A CB    1 
ATOM   1249 C  CG    . ARG A 1 247 ? -23.645 41.209 9.688  1.00 28.53  ? 488 ARG A CG    1 
ATOM   1250 C  CD    . ARG A 1 247 ? -22.753 41.572 8.518  1.00 31.62  ? 488 ARG A CD    1 
ATOM   1251 N  NE    . ARG A 1 247 ? -21.361 41.199 8.763  1.00 35.22  ? 488 ARG A NE    1 
ATOM   1252 C  CZ    . ARG A 1 247 ? -20.756 40.147 8.218  1.00 34.75  ? 488 ARG A CZ    1 
ATOM   1253 N  NH1   . ARG A 1 247 ? -21.416 39.359 7.380  1.00 35.23  ? 488 ARG A NH1   1 
ATOM   1254 N  NH2   . ARG A 1 247 ? -19.488 39.886 8.507  1.00 35.76  ? 488 ARG A NH2   1 
ATOM   1255 N  N     . LEU A 1 248 ? -23.711 37.130 7.733  1.00 32.72  ? 489 LEU A N     1 
ATOM   1256 C  CA    . LEU A 1 248 ? -23.326 35.760 7.430  1.00 31.89  ? 489 LEU A CA    1 
ATOM   1257 C  C     . LEU A 1 248 ? -21.947 35.688 6.787  1.00 33.28  ? 489 LEU A C     1 
ATOM   1258 O  O     . LEU A 1 248 ? -21.690 36.333 5.769  1.00 33.58  ? 489 LEU A O     1 
ATOM   1259 C  CB    . LEU A 1 248 ? -24.364 35.117 6.509  1.00 30.77  ? 489 LEU A CB    1 
ATOM   1260 C  CG    . LEU A 1 248 ? -24.034 33.727 5.971  1.00 29.25  ? 489 LEU A CG    1 
ATOM   1261 C  CD1   . LEU A 1 248 ? -23.769 32.773 7.115  1.00 31.56  ? 489 LEU A CD1   1 
ATOM   1262 C  CD2   . LEU A 1 248 ? -25.174 33.228 5.109  1.00 30.15  ? 489 LEU A CD2   1 
ATOM   1263 N  N     . ASP A 1 249 ? -21.064 34.901 7.392  1.00 33.71  ? 490 ASP A N     1 
ATOM   1264 C  CA    . ASP A 1 249 ? -19.753 34.632 6.819  1.00 29.69  ? 490 ASP A CA    1 
ATOM   1265 C  C     . ASP A 1 249 ? -19.658 33.176 6.396  1.00 35.82  ? 490 ASP A C     1 
ATOM   1266 O  O     . ASP A 1 249 ? -20.145 32.282 7.086  1.00 39.54  ? 490 ASP A O     1 
ATOM   1267 C  CB    . ASP A 1 249 ? -18.639 34.955 7.811  1.00 39.70  ? 490 ASP A CB    1 
ATOM   1268 C  CG    . ASP A 1 249 ? -18.617 36.414 8.206  1.00 47.59  ? 490 ASP A CG    1 
ATOM   1269 O  OD1   . ASP A 1 249 ? -19.032 37.257 7.381  1.00 43.23  ? 490 ASP A OD1   1 
ATOM   1270 O  OD2   . ASP A 1 249 ? -18.194 36.714 9.345  1.00 51.95  ? 490 ASP A OD2   1 
ATOM   1271 N  N     . ILE A 1 250 ? -19.031 32.948 5.252  1.00 37.22  ? 491 ILE A N     1 
ATOM   1272 C  CA    . ILE A 1 250 ? -18.830 31.606 4.732  1.00 33.16  ? 491 ILE A CA    1 
ATOM   1273 C  C     . ILE A 1 250 ? -17.386 31.457 4.298  1.00 37.57  ? 491 ILE A C     1 
ATOM   1274 O  O     . ILE A 1 250 ? -16.861 32.298 3.569  1.00 40.93  ? 491 ILE A O     1 
ATOM   1275 C  CB    . ILE A 1 250 ? -19.756 31.308 3.543  1.00 32.10  ? 491 ILE A CB    1 
ATOM   1276 C  CG1   . ILE A 1 250 ? -21.220 31.397 3.965  1.00 28.52  ? 491 ILE A CG1   1 
ATOM   1277 C  CG2   . ILE A 1 250 ? -19.451 29.943 2.951  1.00 29.27  ? 491 ILE A CG2   1 
ATOM   1278 C  CD1   . ILE A 1 250 ? -22.175 31.109 2.838  1.00 29.31  ? 491 ILE A CD1   1 
ATOM   1279 N  N     . ILE A 1 251 ? -16.741 30.393 4.758  1.00 39.96  ? 492 ILE A N     1 
ATOM   1280 C  CA    . ILE A 1 251 ? -15.365 30.119 4.381  1.00 38.41  ? 492 ILE A CA    1 
ATOM   1281 C  C     . ILE A 1 251 ? -15.271 28.693 3.842  1.00 42.31  ? 492 ILE A C     1 
ATOM   1282 O  O     . ILE A 1 251 ? -15.964 27.798 4.324  1.00 40.58  ? 492 ILE A O     1 
ATOM   1283 C  CB    . ILE A 1 251 ? -14.406 30.323 5.574  1.00 37.58  ? 492 ILE A CB    1 
ATOM   1284 C  CG1   . ILE A 1 251 ? -12.955 30.094 5.162  1.00 44.48  ? 492 ILE A CG1   1 
ATOM   1285 C  CG2   . ILE A 1 251 ? -14.772 29.405 6.724  1.00 51.68  ? 492 ILE A CG2   1 
ATOM   1286 C  CD1   . ILE A 1 251 ? -11.985 30.190 6.316  1.00 42.74  ? 492 ILE A CD1   1 
ATOM   1287 N  N     . VAL A 1 252 ? -14.446 28.490 2.817  1.00 42.93  ? 493 VAL A N     1 
ATOM   1288 C  CA    . VAL A 1 252 ? -14.250 27.161 2.245  1.00 39.11  ? 493 VAL A CA    1 
ATOM   1289 C  C     . VAL A 1 252 ? -12.784 26.751 2.279  1.00 44.23  ? 493 VAL A C     1 
ATOM   1290 O  O     . VAL A 1 252 ? -11.935 27.437 1.719  1.00 47.28  ? 493 VAL A O     1 
ATOM   1291 C  CB    . VAL A 1 252 ? -14.737 27.085 0.799  1.00 37.36  ? 493 VAL A CB    1 
ATOM   1292 C  CG1   . VAL A 1 252 ? -14.592 25.664 0.284  1.00 43.67  ? 493 VAL A CG1   1 
ATOM   1293 C  CG2   . VAL A 1 252 ? -16.178 27.555 0.694  1.00 39.18  ? 493 VAL A CG2   1 
ATOM   1294 N  N     . VAL A 1 253 ? -12.485 25.631 2.931  1.00 45.02  ? 494 VAL A N     1 
ATOM   1295 C  CA    . VAL A 1 253 ? -11.100 25.192 3.079  1.00 44.20  ? 494 VAL A CA    1 
ATOM   1296 C  C     . VAL A 1 253 ? -10.897 23.748 2.610  1.00 46.87  ? 494 VAL A C     1 
ATOM   1297 O  O     . VAL A 1 253 ? -11.853 22.973 2.541  1.00 44.00  ? 494 VAL A O     1 
ATOM   1298 C  CB    . VAL A 1 253 ? -10.635 25.313 4.548  1.00 43.71  ? 494 VAL A CB    1 
ATOM   1299 C  CG1   . VAL A 1 253 ? -11.106 26.629 5.145  1.00 46.23  ? 494 VAL A CG1   1 
ATOM   1300 C  CG2   . VAL A 1 253 ? -11.153 24.147 5.372  1.00 46.32  ? 494 VAL A CG2   1 
ATOM   1301 N  N     . PRO A 1 254 ? -9.647  23.388 2.263  1.00 51.88  ? 495 PRO A N     1 
ATOM   1302 C  CA    . PRO A 1 254 ? -9.306  21.980 2.036  1.00 51.53  ? 495 PRO A CA    1 
ATOM   1303 C  C     . PRO A 1 254 ? -9.243  21.206 3.351  1.00 50.58  ? 495 PRO A C     1 
ATOM   1304 O  O     . PRO A 1 254 ? -8.872  21.782 4.376  1.00 52.11  ? 495 PRO A O     1 
ATOM   1305 C  CB    . PRO A 1 254 ? -7.925  22.055 1.381  1.00 47.09  ? 495 PRO A CB    1 
ATOM   1306 C  CG    . PRO A 1 254 ? -7.350  23.333 1.877  1.00 43.49  ? 495 PRO A CG    1 
ATOM   1307 C  CD    . PRO A 1 254 ? -8.517  24.278 1.941  1.00 51.74  ? 495 PRO A CD    1 
ATOM   1308 N  N     . TYR A 1 255 ? -9.585  19.920 3.315  1.00 47.31  ? 496 TYR A N     1 
ATOM   1309 C  CA    . TYR A 1 255 ? -9.646  19.100 4.521  1.00 46.10  ? 496 TYR A CA    1 
ATOM   1310 C  C     . TYR A 1 255 ? -8.330  19.106 5.298  1.00 44.87  ? 496 TYR A C     1 
ATOM   1311 O  O     . TYR A 1 255 ? -8.324  18.951 6.519  1.00 46.01  ? 496 TYR A O     1 
ATOM   1312 C  CB    . TYR A 1 255 ? -10.035 17.661 4.165  1.00 49.05  ? 496 TYR A CB    1 
ATOM   1313 C  CG    . TYR A 1 255 ? -10.512 16.844 5.345  1.00 55.07  ? 496 TYR A CG    1 
ATOM   1314 C  CD1   . TYR A 1 255 ? -11.825 16.938 5.794  1.00 59.30  ? 496 TYR A CD1   1 
ATOM   1315 C  CD2   . TYR A 1 255 ? -9.651  15.984 6.015  1.00 56.76  ? 496 TYR A CD2   1 
ATOM   1316 C  CE1   . TYR A 1 255 ? -12.270 16.194 6.876  1.00 56.28  ? 496 TYR A CE1   1 
ATOM   1317 C  CE2   . TYR A 1 255 ? -10.086 15.238 7.100  1.00 65.51  ? 496 TYR A CE2   1 
ATOM   1318 C  CZ    . TYR A 1 255 ? -11.396 15.346 7.524  1.00 60.17  ? 496 TYR A CZ    1 
ATOM   1319 O  OH    . TYR A 1 255 ? -11.830 14.605 8.598  1.00 53.08  ? 496 TYR A OH    1 
ATOM   1320 N  N     . SER A 1 256 ? -7.219  19.295 4.594  1.00 40.09  ? 497 SER A N     1 
ATOM   1321 C  CA    . SER A 1 256 ? -5.910  19.289 5.237  1.00 45.70  ? 497 SER A CA    1 
ATOM   1322 C  C     . SER A 1 256 ? -5.705  20.520 6.116  1.00 46.24  ? 497 SER A C     1 
ATOM   1323 O  O     . SER A 1 256 ? -4.828  20.535 6.983  1.00 41.38  ? 497 SER A O     1 
ATOM   1324 C  CB    . SER A 1 256 ? -4.798  19.203 4.190  1.00 49.33  ? 497 SER A CB    1 
ATOM   1325 O  OG    . SER A 1 256 ? -4.828  20.312 3.311  1.00 50.87  ? 497 SER A OG    1 
ATOM   1326 N  N     . GLU A 1 257 ? -6.519  21.548 5.888  1.00 46.11  ? 498 GLU A N     1 
ATOM   1327 C  CA    . GLU A 1 257 ? -6.439  22.780 6.669  1.00 48.87  ? 498 GLU A CA    1 
ATOM   1328 C  C     . GLU A 1 257 ? -7.689  22.999 7.511  1.00 43.17  ? 498 GLU A C     1 
ATOM   1329 O  O     . GLU A 1 257 ? -7.837  24.031 8.157  1.00 45.95  ? 498 GLU A O     1 
ATOM   1330 C  CB    . GLU A 1 257 ? -6.222  23.983 5.751  1.00 45.10  ? 498 GLU A CB    1 
ATOM   1331 C  CG    . GLU A 1 257 ? -4.922  23.940 4.976  1.00 47.48  ? 498 GLU A CG    1 
ATOM   1332 C  CD    . GLU A 1 257 ? -4.798  25.079 3.985  1.00 52.45  ? 498 GLU A CD    1 
ATOM   1333 O  OE1   . GLU A 1 257 ? -5.827  25.715 3.677  1.00 52.69  ? 498 GLU A OE1   1 
ATOM   1334 O  OE2   . GLU A 1 257 ? -3.672  25.335 3.509  1.00 60.34  ? 498 GLU A OE2   1 
ATOM   1335 N  N     . PHE A 1 258 ? -8.582  22.018 7.504  1.00 46.53  ? 499 PHE A N     1 
ATOM   1336 C  CA    . PHE A 1 258 ? -9.867  22.135 8.182  1.00 45.27  ? 499 PHE A CA    1 
ATOM   1337 C  C     . PHE A 1 258 ? -9.722  22.383 9.682  1.00 39.82  ? 499 PHE A C     1 
ATOM   1338 O  O     . PHE A 1 258 ? -10.527 23.099 10.272 1.00 38.14  ? 499 PHE A O     1 
ATOM   1339 C  CB    . PHE A 1 258 ? -10.700 20.873 7.933  1.00 46.97  ? 499 PHE A CB    1 
ATOM   1340 C  CG    . PHE A 1 258 ? -12.098 20.950 8.469  1.00 44.71  ? 499 PHE A CG    1 
ATOM   1341 C  CD1   . PHE A 1 258 ? -12.864 22.089 8.285  1.00 41.97  ? 499 PHE A CD1   1 
ATOM   1342 C  CD2   . PHE A 1 258 ? -12.658 19.870 9.130  1.00 46.37  ? 499 PHE A CD2   1 
ATOM   1343 C  CE1   . PHE A 1 258 ? -14.158 22.160 8.768  1.00 43.53  ? 499 PHE A CE1   1 
ATOM   1344 C  CE2   . PHE A 1 258 ? -13.953 19.932 9.614  1.00 50.98  ? 499 PHE A CE2   1 
ATOM   1345 C  CZ    . PHE A 1 258 ? -14.705 21.080 9.432  1.00 49.55  ? 499 PHE A CZ    1 
ATOM   1346 N  N     . ALA A 1 259 ? -8.694  21.802 10.293 1.00 40.09  ? 500 ALA A N     1 
ATOM   1347 C  CA    . ALA A 1 259 ? -8.513  21.916 11.738 1.00 41.43  ? 500 ALA A CA    1 
ATOM   1348 C  C     . ALA A 1 259 ? -8.156  23.336 12.136 1.00 39.45  ? 500 ALA A C     1 
ATOM   1349 O  O     . ALA A 1 259 ? -8.757  23.908 13.044 1.00 43.42  ? 500 ALA A O     1 
ATOM   1350 C  CB    . ALA A 1 259 ? -7.448  20.959 12.218 1.00 44.12  ? 500 ALA A CB    1 
ATOM   1351 N  N     . CYS A 1 260 ? -7.172  23.902 11.450 1.00 38.49  ? 501 CYS A N     1 
ATOM   1352 C  CA    . CYS A 1 260 ? -6.740  25.260 11.731 1.00 38.26  ? 501 CYS A CA    1 
ATOM   1353 C  C     . CYS A 1 260 ? -7.810  26.283 11.372 1.00 36.85  ? 501 CYS A C     1 
ATOM   1354 O  O     . CYS A 1 260 ? -7.857  27.372 11.944 1.00 37.22  ? 501 CYS A O     1 
ATOM   1355 C  CB    . CYS A 1 260 ? -5.445  25.560 10.987 1.00 36.75  ? 501 CYS A CB    1 
ATOM   1356 S  SG    . CYS A 1 260 ? -4.022  24.790 11.768 1.00 48.38  ? 501 CYS A SG    1 
ATOM   1357 N  N     . ALA A 1 261 ? -8.673  25.922 10.432 1.00 33.23  ? 502 ALA A N     1 
ATOM   1358 C  CA    . ALA A 1 261 ? -9.762  26.795 10.028 1.00 35.37  ? 502 ALA A CA    1 
ATOM   1359 C  C     . ALA A 1 261 ? -10.833 26.852 11.111 1.00 37.71  ? 502 ALA A C     1 
ATOM   1360 O  O     . ALA A 1 261 ? -11.271 27.936 11.500 1.00 40.22  ? 502 ALA A O     1 
ATOM   1361 C  CB    . ALA A 1 261 ? -10.358 26.330 8.714  1.00 35.49  ? 502 ALA A CB    1 
ATOM   1362 N  N     . LEU A 1 262 ? -11.258 25.683 11.585 1.00 37.61  ? 503 LEU A N     1 
ATOM   1363 C  CA    . LEU A 1 262 ? -12.240 25.594 12.661 1.00 36.36  ? 503 LEU A CA    1 
ATOM   1364 C  C     . LEU A 1 262 ? -11.756 26.357 13.880 1.00 39.66  ? 503 LEU A C     1 
ATOM   1365 O  O     . LEU A 1 262 ? -12.502 27.130 14.474 1.00 43.58  ? 503 LEU A O     1 
ATOM   1366 C  CB    . LEU A 1 262 ? -12.508 24.139 13.043 1.00 42.81  ? 503 LEU A CB    1 
ATOM   1367 C  CG    . LEU A 1 262 ? -13.326 23.265 12.095 1.00 42.65  ? 503 LEU A CG    1 
ATOM   1368 C  CD1   . LEU A 1 262 ? -13.350 21.839 12.609 1.00 45.29  ? 503 LEU A CD1   1 
ATOM   1369 C  CD2   . LEU A 1 262 ? -14.732 23.797 11.961 1.00 38.30  ? 503 LEU A CD2   1 
ATOM   1370 N  N     . LEU A 1 263 ? -10.499 26.133 14.243 1.00 35.39  ? 504 LEU A N     1 
ATOM   1371 C  CA    . LEU A 1 263 ? -9.894  26.805 15.380 1.00 35.98  ? 504 LEU A CA    1 
ATOM   1372 C  C     . LEU A 1 263 ? -10.024 28.320 15.265 1.00 40.55  ? 504 LEU A C     1 
ATOM   1373 O  O     . LEU A 1 263 ? -10.470 28.992 16.199 1.00 43.33  ? 504 LEU A O     1 
ATOM   1374 C  CB    . LEU A 1 263 ? -8.425  26.418 15.492 1.00 35.09  ? 504 LEU A CB    1 
ATOM   1375 C  CG    . LEU A 1 263 ? -7.901  26.272 16.911 1.00 40.82  ? 504 LEU A CG    1 
ATOM   1376 C  CD1   . LEU A 1 263 ? -8.614  25.117 17.580 1.00 45.71  ? 504 LEU A CD1   1 
ATOM   1377 C  CD2   . LEU A 1 263 ? -6.405  26.041 16.881 1.00 44.71  ? 504 LEU A CD2   1 
ATOM   1378 N  N     . TYR A 1 264 ? -9.646  28.847 14.105 1.00 40.55  ? 505 TYR A N     1 
ATOM   1379 C  CA    . TYR A 1 264 ? -9.637  30.286 13.884 1.00 36.96  ? 505 TYR A CA    1 
ATOM   1380 C  C     . TYR A 1 264 ? -11.050 30.870 13.910 1.00 39.15  ? 505 TYR A C     1 
ATOM   1381 O  O     . TYR A 1 264 ? -11.294 31.864 14.593 1.00 38.43  ? 505 TYR A O     1 
ATOM   1382 C  CB    . TYR A 1 264 ? -8.933  30.615 12.560 1.00 34.86  ? 505 TYR A CB    1 
ATOM   1383 C  CG    . TYR A 1 264 ? -9.306  31.956 11.964 1.00 35.69  ? 505 TYR A CG    1 
ATOM   1384 C  CD1   . TYR A 1 264 ? -8.997  33.144 12.610 1.00 33.86  ? 505 TYR A CD1   1 
ATOM   1385 C  CD2   . TYR A 1 264 ? -9.961  32.031 10.749 1.00 37.92  ? 505 TYR A CD2   1 
ATOM   1386 C  CE1   . TYR A 1 264 ? -9.344  34.364 12.065 1.00 31.24  ? 505 TYR A CE1   1 
ATOM   1387 C  CE2   . TYR A 1 264 ? -10.302 33.242 10.195 1.00 36.92  ? 505 TYR A CE2   1 
ATOM   1388 C  CZ    . TYR A 1 264 ? -10.000 34.404 10.854 1.00 36.20  ? 505 TYR A CZ    1 
ATOM   1389 O  OH    . TYR A 1 264 ? -10.357 35.607 10.286 1.00 39.19  ? 505 TYR A OH    1 
ATOM   1390 N  N     . PHE A 1 265 ? -11.981 30.250 13.189 1.00 35.32  ? 506 PHE A N     1 
ATOM   1391 C  CA    . PHE A 1 265 ? -13.344 30.774 13.116 1.00 36.78  ? 506 PHE A CA    1 
ATOM   1392 C  C     . PHE A 1 265 ? -14.149 30.571 14.404 1.00 40.21  ? 506 PHE A C     1 
ATOM   1393 O  O     . PHE A 1 265 ? -14.950 31.429 14.767 1.00 44.22  ? 506 PHE A O     1 
ATOM   1394 C  CB    . PHE A 1 265 ? -14.094 30.157 11.930 1.00 39.43  ? 506 PHE A CB    1 
ATOM   1395 C  CG    . PHE A 1 265 ? -14.280 31.107 10.777 1.00 48.79  ? 506 PHE A CG    1 
ATOM   1396 C  CD1   . PHE A 1 265 ? -15.510 31.253 10.157 1.00 52.18  ? 506 PHE A CD1   1 
ATOM   1397 C  CD2   . PHE A 1 265 ? -13.222 31.877 10.333 1.00 56.47  ? 506 PHE A CD2   1 
ATOM   1398 C  CE1   . PHE A 1 265 ? -15.668 32.141 9.103  1.00 53.80  ? 506 PHE A CE1   1 
ATOM   1399 C  CE2   . PHE A 1 265 ? -13.372 32.764 9.283  1.00 57.33  ? 506 PHE A CE2   1 
ATOM   1400 C  CZ    . PHE A 1 265 ? -14.593 32.897 8.667  1.00 60.28  ? 506 PHE A CZ    1 
ATOM   1401 N  N     . THR A 1 266 ? -13.933 29.458 15.099 1.00 40.85  ? 507 THR A N     1 
ATOM   1402 C  CA    . THR A 1 266 ? -14.641 29.186 16.352 1.00 39.41  ? 507 THR A CA    1 
ATOM   1403 C  C     . THR A 1 266 ? -14.306 30.214 17.430 1.00 39.86  ? 507 THR A C     1 
ATOM   1404 O  O     . THR A 1 266 ? -15.164 30.612 18.219 1.00 39.75  ? 507 THR A O     1 
ATOM   1405 C  CB    . THR A 1 266 ? -14.311 27.791 16.889 1.00 39.83  ? 507 THR A CB    1 
ATOM   1406 O  OG1   . THR A 1 266 ? -14.530 26.825 15.855 1.00 46.01  ? 507 THR A OG1   1 
ATOM   1407 C  CG2   . THR A 1 266 ? -15.179 27.454 18.087 1.00 42.03  ? 507 THR A CG2   1 
ATOM   1408 N  N     . GLY A 1 267 ? -13.050 30.638 17.460 1.00 39.36  ? 508 GLY A N     1 
ATOM   1409 C  CA    . GLY A 1 267 ? -12.633 31.687 18.366 1.00 39.92  ? 508 GLY A CA    1 
ATOM   1410 C  C     . GLY A 1 267 ? -12.388 31.187 19.771 1.00 42.48  ? 508 GLY A C     1 
ATOM   1411 O  O     . GLY A 1 267 ? -12.100 30.007 19.966 1.00 46.23  ? 508 GLY A O     1 
ATOM   1412 N  N     . SER A 1 268 ? -12.500 32.077 20.753 1.00 42.79  ? 509 SER A N     1 
ATOM   1413 C  CA    . SER A 1 268 ? -12.862 33.473 20.521 1.00 39.92  ? 509 SER A CA    1 
ATOM   1414 C  C     . SER A 1 268 ? -11.677 34.294 20.022 1.00 39.27  ? 509 SER A C     1 
ATOM   1415 O  O     . SER A 1 268 ? -10.566 33.782 19.893 1.00 41.01  ? 509 SER A O     1 
ATOM   1416 C  CB    . SER A 1 268 ? -13.412 34.099 21.804 1.00 50.51  ? 509 SER A CB    1 
ATOM   1417 O  OG    . SER A 1 268 ? -12.389 34.257 22.777 1.00 50.05  ? 509 SER A OG    1 
ATOM   1418 N  N     . ALA A 1 269 ? -11.928 35.568 19.742 1.00 41.15  ? 510 ALA A N     1 
ATOM   1419 C  CA    . ALA A 1 269 ? -10.900 36.457 19.218 1.00 37.67  ? 510 ALA A CA    1 
ATOM   1420 C  C     . ALA A 1 269 ? -9.746  36.579 20.197 1.00 39.93  ? 510 ALA A C     1 
ATOM   1421 O  O     . ALA A 1 269 ? -8.581  36.519 19.810 1.00 42.21  ? 510 ALA A O     1 
ATOM   1422 C  CB    . ALA A 1 269 ? -11.483 37.824 18.915 1.00 30.79  ? 510 ALA A CB    1 
ATOM   1423 N  N     . HIS A 1 270 ? -10.075 36.744 21.471 1.00 41.55  ? 511 HIS A N     1 
ATOM   1424 C  CA    . HIS A 1 270 ? -9.054  36.863 22.499 1.00 42.80  ? 511 HIS A CA    1 
ATOM   1425 C  C     . HIS A 1 270 ? -8.346  35.520 22.678 1.00 47.82  ? 511 HIS A C     1 
ATOM   1426 O  O     . HIS A 1 270 ? -7.161  35.468 23.012 1.00 48.14  ? 511 HIS A O     1 
ATOM   1427 C  CB    . HIS A 1 270 ? -9.674  37.343 23.813 1.00 46.09  ? 511 HIS A CB    1 
ATOM   1428 C  CG    . HIS A 1 270 ? -8.678  37.580 24.905 1.00 64.38  ? 511 HIS A CG    1 
ATOM   1429 N  ND1   . HIS A 1 270 ? -7.889  38.709 24.962 1.00 71.99  ? 511 HIS A ND1   1 
ATOM   1430 C  CD2   . HIS A 1 270 ? -8.344  36.831 25.984 1.00 62.21  ? 511 HIS A CD2   1 
ATOM   1431 C  CE1   . HIS A 1 270 ? -7.111  38.645 26.030 1.00 69.68  ? 511 HIS A CE1   1 
ATOM   1432 N  NE2   . HIS A 1 270 ? -7.368  37.516 26.666 1.00 60.95  ? 511 HIS A NE2   1 
ATOM   1433 N  N     . PHE A 1 271 ? -9.077  34.435 22.439 1.00 44.04  ? 512 PHE A N     1 
ATOM   1434 C  CA    . PHE A 1 271 ? -8.504  33.100 22.534 1.00 40.88  ? 512 PHE A CA    1 
ATOM   1435 C  C     . PHE A 1 271 ? -7.495  32.861 21.421 1.00 38.50  ? 512 PHE A C     1 
ATOM   1436 O  O     . PHE A 1 271 ? -6.397  32.360 21.662 1.00 40.43  ? 512 PHE A O     1 
ATOM   1437 C  CB    . PHE A 1 271 ? -9.599  32.035 22.486 1.00 47.74  ? 512 PHE A CB    1 
ATOM   1438 C  CG    . PHE A 1 271 ? -9.072  30.633 22.383 1.00 47.16  ? 512 PHE A CG    1 
ATOM   1439 C  CD1   . PHE A 1 271 ? -8.516  30.005 23.487 1.00 43.71  ? 512 PHE A CD1   1 
ATOM   1440 C  CD2   . PHE A 1 271 ? -9.129  29.944 21.181 1.00 44.17  ? 512 PHE A CD2   1 
ATOM   1441 C  CE1   . PHE A 1 271 ? -8.028  28.719 23.393 1.00 48.01  ? 512 PHE A CE1   1 
ATOM   1442 C  CE2   . PHE A 1 271 ? -8.642  28.655 21.081 1.00 41.11  ? 512 PHE A CE2   1 
ATOM   1443 C  CZ    . PHE A 1 271 ? -8.092  28.042 22.187 1.00 47.89  ? 512 PHE A CZ    1 
ATOM   1444 N  N     . ASN A 1 272 ? -7.874  33.220 20.200 1.00 37.88  ? 513 ASN A N     1 
ATOM   1445 C  CA    . ASN A 1 272 ? -6.979  33.090 19.058 1.00 37.52  ? 513 ASN A CA    1 
ATOM   1446 C  C     . ASN A 1 272 ? -5.668  33.865 19.244 1.00 35.06  ? 513 ASN A C     1 
ATOM   1447 O  O     . ASN A 1 272 ? -4.594  33.328 18.986 1.00 31.12  ? 513 ASN A O     1 
ATOM   1448 C  CB    . ASN A 1 272 ? -7.690  33.542 17.781 1.00 33.90  ? 513 ASN A CB    1 
ATOM   1449 C  CG    . ASN A 1 272 ? -8.777  32.568 17.345 1.00 43.09  ? 513 ASN A CG    1 
ATOM   1450 O  OD1   . ASN A 1 272 ? -9.112  31.630 18.070 1.00 44.38  ? 513 ASN A OD1   1 
ATOM   1451 N  ND2   . ASN A 1 272 ? -9.337  32.791 16.159 1.00 34.18  ? 513 ASN A ND2   1 
ATOM   1452 N  N     . ARG A 1 273 ? -5.749  35.112 19.702 1.00 32.84  ? 514 ARG A N     1 
ATOM   1453 C  CA    . ARG A 1 273 ? -4.542  35.898 19.944 1.00 32.50  ? 514 ARG A CA    1 
ATOM   1454 C  C     . ARG A 1 273 ? -3.660  35.199 20.962 1.00 35.64  ? 514 ARG A C     1 
ATOM   1455 O  O     . ARG A 1 273 ? -2.459  35.063 20.766 1.00 34.35  ? 514 ARG A O     1 
ATOM   1456 C  CB    . ARG A 1 273 ? -4.878  37.306 20.441 1.00 38.50  ? 514 ARG A CB    1 
ATOM   1457 C  CG    . ARG A 1 273 ? -5.820  38.090 19.548 1.00 41.80  ? 514 ARG A CG    1 
ATOM   1458 C  CD    . ARG A 1 273 ? -5.995  39.521 20.041 1.00 41.22  ? 514 ARG A CD    1 
ATOM   1459 N  NE    . ARG A 1 273 ? -7.201  40.140 19.492 1.00 45.49  ? 514 ARG A NE    1 
ATOM   1460 C  CZ    . ARG A 1 273 ? -8.326  40.329 20.177 1.00 48.66  ? 514 ARG A CZ    1 
ATOM   1461 N  NH1   . ARG A 1 273 ? -8.404  39.959 21.450 1.00 54.55  ? 514 ARG A NH1   1 
ATOM   1462 N  NH2   . ARG A 1 273 ? -9.372  40.900 19.592 1.00 47.45  ? 514 ARG A NH2   1 
ATOM   1463 N  N     . SER A 1 274 ? -4.276  34.755 22.050 1.00 44.79  ? 515 SER A N     1 
ATOM   1464 C  CA    . SER A 1 274 ? -3.563  34.082 23.126 1.00 42.01  ? 515 SER A CA    1 
ATOM   1465 C  C     . SER A 1 274 ? -2.834  32.845 22.617 1.00 41.38  ? 515 SER A C     1 
ATOM   1466 O  O     . SER A 1 274 ? -1.657  32.638 22.907 1.00 45.61  ? 515 SER A O     1 
ATOM   1467 C  CB    . SER A 1 274 ? -4.535  33.700 24.243 1.00 45.91  ? 515 SER A CB    1 
ATOM   1468 O  OG    . SER A 1 274 ? -3.895  32.922 25.238 1.00 60.70  ? 515 SER A OG    1 
ATOM   1469 N  N     . MET A 1 275 ? -3.544  32.032 21.845 1.00 36.46  ? 516 MET A N     1 
ATOM   1470 C  CA    . MET A 1 275 ? -2.987  30.800 21.310 1.00 40.80  ? 516 MET A CA    1 
ATOM   1471 C  C     . MET A 1 275 ? -1.827  31.079 20.352 1.00 47.99  ? 516 MET A C     1 
ATOM   1472 O  O     . MET A 1 275 ? -0.778  30.438 20.433 1.00 48.48  ? 516 MET A O     1 
ATOM   1473 C  CB    . MET A 1 275 ? -4.081  29.998 20.609 1.00 35.21  ? 516 MET A CB    1 
ATOM   1474 C  CG    . MET A 1 275 ? -3.730  28.556 20.369 1.00 39.03  ? 516 MET A CG    1 
ATOM   1475 S  SD    . MET A 1 275 ? -5.220  27.549 20.312 1.00 67.68  ? 516 MET A SD    1 
ATOM   1476 C  CE    . MET A 1 275 ? -4.524  25.920 20.048 1.00 52.33  ? 516 MET A CE    1 
ATOM   1477 N  N     . ARG A 1 276 ? -2.016  32.050 19.462 1.00 44.96  ? 517 ARG A N     1 
ATOM   1478 C  CA    . ARG A 1 276 ? -0.993  32.424 18.489 1.00 35.69  ? 517 ARG A CA    1 
ATOM   1479 C  C     . ARG A 1 276 ? 0.167   33.186 19.120 1.00 37.53  ? 517 ARG A C     1 
ATOM   1480 O  O     . ARG A 1 276 ? 1.312   33.039 18.705 1.00 42.30  ? 517 ARG A O     1 
ATOM   1481 C  CB    . ARG A 1 276 ? -1.619  33.255 17.372 1.00 37.18  ? 517 ARG A CB    1 
ATOM   1482 C  CG    . ARG A 1 276 ? -2.673  32.493 16.591 1.00 41.15  ? 517 ARG A CG    1 
ATOM   1483 C  CD    . ARG A 1 276 ? -3.347  33.352 15.540 1.00 34.87  ? 517 ARG A CD    1 
ATOM   1484 N  NE    . ARG A 1 276 ? -4.403  32.603 14.868 1.00 35.64  ? 517 ARG A NE    1 
ATOM   1485 C  CZ    . ARG A 1 276 ? -5.020  33.006 13.763 1.00 44.31  ? 517 ARG A CZ    1 
ATOM   1486 N  NH1   . ARG A 1 276 ? -4.684  34.156 13.191 1.00 44.88  ? 517 ARG A NH1   1 
ATOM   1487 N  NH2   . ARG A 1 276 ? -5.968  32.251 13.224 1.00 44.33  ? 517 ARG A NH2   1 
ATOM   1488 N  N     . ALA A 1 277 ? -0.125  34.000 20.125 1.00 45.20  ? 518 ALA A N     1 
ATOM   1489 C  CA    . ALA A 1 277 ? 0.934   34.681 20.856 1.00 45.76  ? 518 ALA A CA    1 
ATOM   1490 C  C     . ALA A 1 277 ? 1.833   33.632 21.497 1.00 46.46  ? 518 ALA A C     1 
ATOM   1491 O  O     . ALA A 1 277 ? 3.053   33.773 21.524 1.00 50.95  ? 518 ALA A O     1 
ATOM   1492 C  CB    . ALA A 1 277 ? 0.359   35.616 21.901 1.00 38.05  ? 518 ALA A CB    1 
ATOM   1493 N  N     . LEU A 1 278 ? 1.216   32.569 22.000 1.00 44.82  ? 519 LEU A N     1 
ATOM   1494 C  CA    . LEU A 1 278 ? 1.957   31.484 22.635 1.00 47.24  ? 519 LEU A CA    1 
ATOM   1495 C  C     . LEU A 1 278 ? 2.815   30.687 21.648 1.00 47.12  ? 519 LEU A C     1 
ATOM   1496 O  O     . LEU A 1 278 ? 3.993   30.462 21.901 1.00 52.40  ? 519 LEU A O     1 
ATOM   1497 C  CB    . LEU A 1 278 ? 1.001   30.539 23.359 1.00 53.81  ? 519 LEU A CB    1 
ATOM   1498 C  CG    . LEU A 1 278 ? 1.699   29.347 24.025 1.00 57.56  ? 519 LEU A CG    1 
ATOM   1499 C  CD1   . LEU A 1 278 ? 2.462   29.786 25.276 1.00 50.75  ? 519 LEU A CD1   1 
ATOM   1500 C  CD2   . LEU A 1 278 ? 0.746   28.199 24.346 1.00 45.47  ? 519 LEU A CD2   1 
ATOM   1501 N  N     . ALA A 1 279 ? 2.229   30.260 20.532 1.00 48.55  ? 520 ALA A N     1 
ATOM   1502 C  CA    . ALA A 1 279 ? 2.978   29.528 19.509 1.00 49.56  ? 520 ALA A CA    1 
ATOM   1503 C  C     . ALA A 1 279 ? 4.225   30.302 19.092 1.00 52.07  ? 520 ALA A C     1 
ATOM   1504 O  O     . ALA A 1 279 ? 5.275   29.717 18.835 1.00 53.22  ? 520 ALA A O     1 
ATOM   1505 C  CB    . ALA A 1 279 ? 2.099   29.248 18.302 1.00 45.49  ? 520 ALA A CB    1 
ATOM   1506 N  N     . LYS A 1 280 ? 4.091   31.623 19.040 1.00 49.38  ? 521 LYS A N     1 
ATOM   1507 C  CA    . LYS A 1 280 ? 5.200   32.520 18.744 1.00 49.18  ? 521 LYS A CA    1 
ATOM   1508 C  C     . LYS A 1 280 ? 6.356   32.320 19.737 1.00 53.58  ? 521 LYS A C     1 
ATOM   1509 O  O     . LYS A 1 280 ? 7.524   32.356 19.351 1.00 56.35  ? 521 LYS A O     1 
ATOM   1510 C  CB    . LYS A 1 280 ? 4.698   33.968 18.762 1.00 45.29  ? 521 LYS A CB    1 
ATOM   1511 C  CG    . LYS A 1 280 ? 5.667   35.041 18.254 1.00 47.75  ? 521 LYS A CG    1 
ATOM   1512 C  CD    . LYS A 1 280 ? 5.036   36.425 18.424 1.00 50.78  ? 521 LYS A CD    1 
ATOM   1513 C  CE    . LYS A 1 280 ? 5.735   37.507 17.621 1.00 59.98  ? 521 LYS A CE    1 
ATOM   1514 N  NZ    . LYS A 1 280 ? 4.832   38.678 17.411 1.00 60.81  ? 521 LYS A NZ    1 
ATOM   1515 N  N     . THR A 1 281 ? 6.019   32.091 21.008 1.00 54.82  ? 522 THR A N     1 
ATOM   1516 C  CA    . THR A 1 281 ? 7.022   31.893 22.058 1.00 52.45  ? 522 THR A CA    1 
ATOM   1517 C  C     . THR A 1 281 ? 7.797   30.602 21.812 1.00 52.27  ? 522 THR A C     1 
ATOM   1518 O  O     . THR A 1 281 ? 8.985   30.519 22.108 1.00 47.31  ? 522 THR A O     1 
ATOM   1519 C  CB    . THR A 1 281 ? 6.398   31.810 23.477 1.00 49.33  ? 522 THR A CB    1 
ATOM   1520 O  OG1   . THR A 1 281 ? 5.643   30.598 23.599 1.00 58.45  ? 522 THR A OG1   1 
ATOM   1521 C  CG2   . THR A 1 281 ? 5.472   32.982 23.741 1.00 46.29  ? 522 THR A CG2   1 
ATOM   1522 N  N     . LYS A 1 282 ? 7.110   29.598 21.269 1.00 54.47  ? 523 LYS A N     1 
ATOM   1523 C  CA    . LYS A 1 282 ? 7.685   28.266 21.070 1.00 56.17  ? 523 LYS A CA    1 
ATOM   1524 C  C     . LYS A 1 282 ? 8.392   28.116 19.729 1.00 55.62  ? 523 LYS A C     1 
ATOM   1525 O  O     . LYS A 1 282 ? 8.749   27.006 19.332 1.00 58.90  ? 523 LYS A O     1 
ATOM   1526 C  CB    . LYS A 1 282 ? 6.596   27.192 21.187 1.00 59.00  ? 523 LYS A CB    1 
ATOM   1527 C  CG    . LYS A 1 282 ? 5.967   27.074 22.574 1.00 54.58  ? 523 LYS A CG    1 
ATOM   1528 C  CD    . LYS A 1 282 ? 5.153   25.791 22.710 1.00 59.70  ? 523 LYS A CD    1 
ATOM   1529 C  CE    . LYS A 1 282 ? 4.655   25.586 24.136 1.00 69.77  ? 523 LYS A CE    1 
ATOM   1530 N  NZ    . LYS A 1 282 ? 5.737   25.111 25.042 1.00 69.87  ? 523 LYS A NZ    1 
ATOM   1531 N  N     . GLY A 1 283 ? 8.600   29.233 19.039 1.00 54.56  ? 524 GLY A N     1 
ATOM   1532 C  CA    . GLY A 1 283 ? 9.235   29.212 17.734 1.00 53.60  ? 524 GLY A CA    1 
ATOM   1533 C  C     . GLY A 1 283 ? 8.334   28.605 16.676 1.00 51.40  ? 524 GLY A C     1 
ATOM   1534 O  O     . GLY A 1 283 ? 8.803   27.967 15.737 1.00 56.24  ? 524 GLY A O     1 
ATOM   1535 N  N     . MET A 1 284 ? 7.030   28.797 16.840 1.00 52.90  ? 525 MET A N     1 
ATOM   1536 C  CA    . MET A 1 284 ? 6.043   28.252 15.919 1.00 47.70  ? 525 MET A CA    1 
ATOM   1537 C  C     . MET A 1 284 ? 5.128   29.366 15.408 1.00 47.12  ? 525 MET A C     1 
ATOM   1538 O  O     . MET A 1 284 ? 5.283   30.521 15.802 1.00 49.44  ? 525 MET A O     1 
ATOM   1539 C  CB    . MET A 1 284 ? 5.241   27.141 16.604 1.00 50.53  ? 525 MET A CB    1 
ATOM   1540 C  CG    . MET A 1 284 ? 6.067   25.899 16.946 1.00 56.92  ? 525 MET A CG    1 
ATOM   1541 S  SD    . MET A 1 284 ? 5.335   24.775 18.165 1.00 54.78  ? 525 MET A SD    1 
ATOM   1542 C  CE    . MET A 1 284 ? 4.107   23.909 17.192 1.00 44.35  ? 525 MET A CE    1 
ATOM   1543 N  N     . SER A 1 285 ? 4.205   29.037 14.508 1.00 44.16  ? 526 SER A N     1 
ATOM   1544 C  CA    . SER A 1 285 ? 3.223   30.014 14.044 1.00 45.03  ? 526 SER A CA    1 
ATOM   1545 C  C     . SER A 1 285 ? 1.870   29.360 13.805 1.00 48.96  ? 526 SER A C     1 
ATOM   1546 O  O     . SER A 1 285 ? 1.790   28.219 13.336 1.00 45.49  ? 526 SER A O     1 
ATOM   1547 C  CB    . SER A 1 285 ? 3.688   30.702 12.760 1.00 41.60  ? 526 SER A CB    1 
ATOM   1548 O  OG    . SER A 1 285 ? 3.411   29.899 11.620 1.00 56.97  ? 526 SER A OG    1 
ATOM   1549 N  N     . LEU A 1 286 ? 0.807   30.089 14.126 1.00 48.46  ? 527 LEU A N     1 
ATOM   1550 C  CA    . LEU A 1 286 ? -0.546  29.580 13.946 1.00 43.02  ? 527 LEU A CA    1 
ATOM   1551 C  C     . LEU A 1 286 ? -1.371  30.495 13.058 1.00 37.13  ? 527 LEU A C     1 
ATOM   1552 O  O     . LEU A 1 286 ? -1.353  31.710 13.222 1.00 38.67  ? 527 LEU A O     1 
ATOM   1553 C  CB    . LEU A 1 286 ? -1.236  29.404 15.298 1.00 38.21  ? 527 LEU A CB    1 
ATOM   1554 C  CG    . LEU A 1 286 ? -2.624  28.766 15.247 1.00 38.41  ? 527 LEU A CG    1 
ATOM   1555 C  CD1   . LEU A 1 286 ? -2.583  27.476 14.443 1.00 37.92  ? 527 LEU A CD1   1 
ATOM   1556 C  CD2   . LEU A 1 286 ? -3.160  28.505 16.645 1.00 43.67  ? 527 LEU A CD2   1 
ATOM   1557 N  N     . SER A 1 287 ? -2.083  29.906 12.107 1.00 36.77  ? 528 SER A N     1 
ATOM   1558 C  CA    . SER A 1 287 ? -2.986  30.660 11.249 1.00 37.17  ? 528 SER A CA    1 
ATOM   1559 C  C     . SER A 1 287 ? -4.237  29.841 10.981 1.00 38.87  ? 528 SER A C     1 
ATOM   1560 O  O     . SER A 1 287 ? -4.443  28.788 11.581 1.00 48.49  ? 528 SER A O     1 
ATOM   1561 C  CB    . SER A 1 287 ? -2.307  31.038 9.932  1.00 37.70  ? 528 SER A CB    1 
ATOM   1562 O  OG    . SER A 1 287 ? -2.045  29.889 9.142  1.00 42.89  ? 528 SER A OG    1 
ATOM   1563 N  N     . GLU A 1 288 ? -5.077  30.330 10.081 1.00 36.55  ? 529 GLU A N     1 
ATOM   1564 C  CA    . GLU A 1 288 ? -6.267  29.595 9.688  1.00 39.25  ? 529 GLU A CA    1 
ATOM   1565 C  C     . GLU A 1 288 ? -5.894  28.522 8.676  1.00 41.93  ? 529 GLU A C     1 
ATOM   1566 O  O     . GLU A 1 288 ? -6.724  27.695 8.301  1.00 42.81  ? 529 GLU A O     1 
ATOM   1567 C  CB    . GLU A 1 288 ? -7.322  30.540 9.104  1.00 42.49  ? 529 GLU A CB    1 
ATOM   1568 C  CG    . GLU A 1 288 ? -6.907  31.260 7.820  1.00 47.32  ? 529 GLU A CG    1 
ATOM   1569 C  CD    . GLU A 1 288 ? -5.999  32.460 8.061  1.00 51.65  ? 529 GLU A CD    1 
ATOM   1570 O  OE1   . GLU A 1 288 ? -5.253  32.466 9.066  1.00 57.29  ? 529 GLU A OE1   1 
ATOM   1571 O  OE2   . GLU A 1 288 ? -6.032  33.401 7.239  1.00 51.38  ? 529 GLU A OE2   1 
ATOM   1572 N  N     . HIS A 1 289 ? -4.637  28.543 8.242  1.00 43.44  ? 530 HIS A N     1 
ATOM   1573 C  CA    . HIS A 1 289 ? -4.154  27.608 7.235  1.00 43.53  ? 530 HIS A CA    1 
ATOM   1574 C  C     . HIS A 1 289 ? -3.391  26.439 7.855  1.00 45.04  ? 530 HIS A C     1 
ATOM   1575 O  O     . HIS A 1 289 ? -3.674  25.279 7.559  1.00 44.15  ? 530 HIS A O     1 
ATOM   1576 C  CB    . HIS A 1 289 ? -3.263  28.329 6.224  1.00 41.93  ? 530 HIS A CB    1 
ATOM   1577 C  CG    . HIS A 1 289 ? -3.991  29.331 5.382  1.00 46.48  ? 530 HIS A CG    1 
ATOM   1578 N  ND1   . HIS A 1 289 ? -4.798  28.968 4.326  1.00 45.24  ? 530 HIS A ND1   1 
ATOM   1579 C  CD2   . HIS A 1 289 ? -4.023  30.683 5.434  1.00 46.46  ? 530 HIS A CD2   1 
ATOM   1580 C  CE1   . HIS A 1 289 ? -5.302  30.055 3.768  1.00 45.10  ? 530 HIS A CE1   1 
ATOM   1581 N  NE2   . HIS A 1 289 ? -4.847  31.109 4.421  1.00 40.15  ? 530 HIS A NE2   1 
ATOM   1582 N  N     . ALA A 1 290 ? -2.430  26.741 8.722  1.00 42.71  ? 531 ALA A N     1 
ATOM   1583 C  CA    . ALA A 1 290 ? -1.574  25.692 9.256  1.00 47.53  ? 531 ALA A CA    1 
ATOM   1584 C  C     . ALA A 1 290 ? -0.781  26.109 10.489 1.00 51.25  ? 531 ALA A C     1 
ATOM   1585 O  O     . ALA A 1 290 ? -0.458  27.283 10.680 1.00 50.06  ? 531 ALA A O     1 
ATOM   1586 C  CB    . ALA A 1 290 ? -0.618  25.209 8.173  1.00 47.76  ? 531 ALA A CB    1 
ATOM   1587 N  N     . LEU A 1 291 ? -0.476  25.121 11.324 1.00 50.02  ? 532 LEU A N     1 
ATOM   1588 C  CA    . LEU A 1 291 ? 0.483   25.288 12.402 1.00 44.41  ? 532 LEU A CA    1 
ATOM   1589 C  C     . LEU A 1 291 ? 1.857   24.929 11.869 1.00 47.55  ? 532 LEU A C     1 
ATOM   1590 O  O     . LEU A 1 291 ? 2.025   23.891 11.231 1.00 48.60  ? 532 LEU A O     1 
ATOM   1591 C  CB    . LEU A 1 291 ? 0.119   24.408 13.594 1.00 47.88  ? 532 LEU A CB    1 
ATOM   1592 C  CG    . LEU A 1 291 ? 1.175   24.279 14.692 1.00 49.52  ? 532 LEU A CG    1 
ATOM   1593 C  CD1   . LEU A 1 291 ? 1.355   25.594 15.431 1.00 45.41  ? 532 LEU A CD1   1 
ATOM   1594 C  CD2   . LEU A 1 291 ? 0.810   23.156 15.654 1.00 51.42  ? 532 LEU A CD2   1 
ATOM   1595 N  N     . SER A 1 292 ? 2.839   25.787 12.112 1.00 50.10  ? 533 SER A N     1 
ATOM   1596 C  CA    . SER A 1 292 ? 4.173   25.570 11.563 1.00 52.14  ? 533 SER A CA    1 
ATOM   1597 C  C     . SER A 1 292 ? 5.218   25.573 12.666 1.00 52.47  ? 533 SER A C     1 
ATOM   1598 O  O     . SER A 1 292 ? 5.056   26.255 13.671 1.00 54.58  ? 533 SER A O     1 
ATOM   1599 C  CB    . SER A 1 292 ? 4.503   26.640 10.517 1.00 49.94  ? 533 SER A CB    1 
ATOM   1600 O  OG    . SER A 1 292 ? 3.483   26.730 9.535  1.00 45.36  ? 533 SER A OG    1 
ATOM   1601 N  N     . THR A 1 293 ? 6.287   24.804 12.484 1.00 55.91  ? 534 THR A N     1 
ATOM   1602 C  CA    . THR A 1 293 ? 7.390   24.817 13.441 1.00 57.69  ? 534 THR A CA    1 
ATOM   1603 C  C     . THR A 1 293 ? 8.671   25.285 12.762 1.00 54.39  ? 534 THR A C     1 
ATOM   1604 O  O     . THR A 1 293 ? 8.708   25.442 11.540 1.00 54.75  ? 534 THR A O     1 
ATOM   1605 C  CB    . THR A 1 293 ? 7.617   23.430 14.080 1.00 54.55  ? 534 THR A CB    1 
ATOM   1606 O  OG1   . THR A 1 293 ? 8.616   23.531 15.104 1.00 42.70  ? 534 THR A OG1   1 
ATOM   1607 C  CG2   . THR A 1 293 ? 8.055   22.416 13.031 1.00 55.16  ? 534 THR A CG2   1 
ATOM   1608 N  N     . ALA A 1 294 ? 9.699   25.527 13.526 1.00 56.61  ? 535 ALA A N     1 
ATOM   1609 C  CA    . ALA A 1 294 ? 10.912  25.975 12.926 1.00 54.01  ? 535 ALA A CA    1 
ATOM   1610 C  C     . ALA A 1 294 ? 10.709  27.287 12.223 1.00 55.09  ? 535 ALA A C     1 
ATOM   1611 O  O     . ALA A 1 294 ? 11.221  27.511 11.148 1.00 59.61  ? 535 ALA A O     1 
ATOM   1612 C  CB    . ALA A 1 294 ? 11.379  24.937 11.950 1.00 45.66  ? 535 ALA A CB    1 
ATOM   1613 N  N     . VAL A 1 295 ? 9.954   28.171 12.840 1.00 54.18  ? 536 VAL A N     1 
ATOM   1614 C  CA    . VAL A 1 295 ? 9.725   29.464 12.248 1.00 51.84  ? 536 VAL A CA    1 
ATOM   1615 C  C     . VAL A 1 295 ? 10.847  30.351 12.710 1.00 50.40  ? 536 VAL A C     1 
ATOM   1616 O  O     . VAL A 1 295 ? 10.988  30.630 13.871 1.00 57.65  ? 536 VAL A O     1 
ATOM   1617 C  CB    . VAL A 1 295 ? 8.375   30.010 12.692 1.00 48.31  ? 536 VAL A CB    1 
ATOM   1618 C  CG1   . VAL A 1 295 ? 8.139   31.363 12.104 1.00 45.64  ? 536 VAL A CG1   1 
ATOM   1619 C  CG2   . VAL A 1 295 ? 7.283   29.097 12.228 1.00 49.26  ? 536 VAL A CG2   1 
ATOM   1620 N  N     . VAL A 1 296 ? 11.664  30.783 11.778 1.00 49.11  ? 537 VAL A N     1 
ATOM   1621 C  CA    . VAL A 1 296 ? 12.799  31.634 12.076 1.00 51.28  ? 537 VAL A CA    1 
ATOM   1622 C  C     . VAL A 1 296 ? 12.388  33.022 12.427 1.00 52.18  ? 537 VAL A C     1 
ATOM   1623 O  O     . VAL A 1 296 ? 11.525  33.565 11.807 1.00 53.52  ? 537 VAL A O     1 
ATOM   1624 C  CB    . VAL A 1 296 ? 13.675  31.790 10.854 1.00 49.67  ? 537 VAL A CB    1 
ATOM   1625 C  CG1   . VAL A 1 296 ? 14.907  32.586 11.174 1.00 52.67  ? 537 VAL A CG1   1 
ATOM   1626 C  CG2   . VAL A 1 296 ? 14.042  30.450 10.290 1.00 54.09  ? 537 VAL A CG2   1 
ATOM   1627 N  N     . ARG A 1 297 ? 13.034  33.606 13.409 1.00 48.81  ? 538 ARG A N     1 
ATOM   1628 C  CA    . ARG A 1 297 ? 12.721  34.946 13.786 1.00 53.49  ? 538 ARG A CA    1 
ATOM   1629 C  C     . ARG A 1 297 ? 14.036  35.593 14.059 1.00 57.61  ? 538 ARG A C     1 
ATOM   1630 O  O     . ARG A 1 297 ? 14.984  34.933 14.372 1.00 56.33  ? 538 ARG A O     1 
ATOM   1631 C  CB    . ARG A 1 297 ? 11.794  34.971 14.985 1.00 58.79  ? 538 ARG A CB    1 
ATOM   1632 C  CG    . ARG A 1 297 ? 10.353  34.614 14.646 1.00 56.51  ? 538 ARG A CG    1 
ATOM   1633 C  CD    . ARG A 1 297 ? 9.354   35.068 15.690 1.00 52.94  ? 538 ARG A CD    1 
ATOM   1634 N  NE    . ARG A 1 297 ? 7.998   34.732 15.299 1.00 49.62  ? 538 ARG A NE    1 
ATOM   1635 C  CZ    . ARG A 1 297 ? 7.519   33.499 15.321 1.00 54.70  ? 538 ARG A CZ    1 
ATOM   1636 N  NH1   . ARG A 1 297 ? 8.289   32.516 15.704 1.00 50.90  ? 538 ARG A NH1   1 
ATOM   1637 N  NH2   . ARG A 1 297 ? 6.281   33.243 14.958 1.00 45.72  ? 538 ARG A NH2   1 
ATOM   1638 N  N     . ASN A 1 298 ? 14.105  36.893 13.891 1.00 59.56  ? 539 ASN A N     1 
ATOM   1639 C  CA    . ASN A 1 298 ? 15.329  37.623 14.121 1.00 66.36  ? 539 ASN A CA    1 
ATOM   1640 C  C     . ASN A 1 298 ? 15.384  38.128 15.525 1.00 72.73  ? 539 ASN A C     1 
ATOM   1641 O  O     . ASN A 1 298 ? 14.497  37.885 16.317 1.00 66.55  ? 539 ASN A O     1 
ATOM   1642 C  CB    . ASN A 1 298 ? 15.463  38.782 13.165 1.00 65.39  ? 539 ASN A CB    1 
ATOM   1643 C  CG    . ASN A 1 298 ? 14.412  39.819 13.378 1.00 71.33  ? 539 ASN A CG    1 
ATOM   1644 O  OD1   . ASN A 1 298 ? 13.381  39.555 13.962 1.00 69.62  ? 539 ASN A OD1   1 
ATOM   1645 N  ND2   . ASN A 1 298 ? 14.668  41.007 12.908 1.00 72.71  ? 539 ASN A ND2   1 
ATOM   1646 N  N     . THR A 1 299 ? 16.429  38.865 15.832 1.00 74.37  ? 540 THR A N     1 
ATOM   1647 C  CA    . THR A 1 299 ? 16.592  39.369 17.166 1.00 75.91  ? 540 THR A CA    1 
ATOM   1648 C  C     . THR A 1 299 ? 15.413  40.218 17.553 1.00 75.60  ? 540 THR A C     1 
ATOM   1649 O  O     . THR A 1 299 ? 14.968  40.146 18.673 1.00 85.17  ? 540 THR A O     1 
ATOM   1650 C  CB    . THR A 1 299 ? 17.831  40.240 17.268 1.00 77.24  ? 540 THR A CB    1 
ATOM   1651 O  OG1   . THR A 1 299 ? 17.605  41.432 16.537 1.00 79.94  ? 540 THR A OG1   1 
ATOM   1652 C  CG2   . THR A 1 299 ? 18.993  39.546 16.665 1.00 73.66  ? 540 THR A CG2   1 
ATOM   1653 N  N     . HIS A 1 300 ? 14.894  41.019 16.646 1.00 76.40  ? 541 HIS A N     1 
ATOM   1654 C  CA    . HIS A 1 300 ? 13.753  41.857 16.981 1.00 74.00  ? 541 HIS A CA    1 
ATOM   1655 C  C     . HIS A 1 300 ? 12.512  41.039 17.112 1.00 69.75  ? 541 HIS A C     1 
ATOM   1656 O  O     . HIS A 1 300 ? 11.490  41.525 17.549 1.00 61.67  ? 541 HIS A O     1 
ATOM   1657 C  CB    . HIS A 1 300 ? 13.564  42.966 15.986 1.00 75.42  ? 541 HIS A CB    1 
ATOM   1658 C  CG    . HIS A 1 300 ? 14.729  43.888 15.914 1.00 77.16  ? 541 HIS A CG    1 
ATOM   1659 N  ND1   . HIS A 1 300 ? 16.017  43.433 15.798 1.00 79.87  ? 541 HIS A ND1   1 
ATOM   1660 C  CD2   . HIS A 1 300 ? 14.805  45.235 15.937 1.00 81.78  ? 541 HIS A CD2   1 
ATOM   1661 C  CE1   . HIS A 1 300 ? 16.840  44.458 15.753 1.00 84.76  ? 541 HIS A CE1   1 
ATOM   1662 N  NE2   . HIS A 1 300 ? 16.129  45.563 15.836 1.00 88.15  ? 541 HIS A NE2   1 
ATOM   1663 N  N     . GLY A 1 301 ? 12.608  39.786 16.714 1.00 66.67  ? 542 GLY A N     1 
ATOM   1664 C  CA    . GLY A 1 301 ? 11.485  38.889 16.795 1.00 62.72  ? 542 GLY A CA    1 
ATOM   1665 C  C     . GLY A 1 301 ? 10.675  38.870 15.550 1.00 62.28  ? 542 GLY A C     1 
ATOM   1666 O  O     . GLY A 1 301 ? 9.666   38.221 15.488 1.00 62.83  ? 542 GLY A O     1 
ATOM   1667 N  N     . CYS A 1 302 ? 11.130  39.595 14.553 1.00 63.81  ? 543 CYS A N     1 
ATOM   1668 C  CA    . CYS A 1 302 ? 10.448  39.635 13.292 1.00 63.08  ? 543 CYS A CA    1 
ATOM   1669 C  C     . CYS A 1 302 ? 10.590  38.267 12.648 1.00 60.04  ? 543 CYS A C     1 
ATOM   1670 O  O     . CYS A 1 302 ? 11.593  37.620 12.801 1.00 55.97  ? 543 CYS A O     1 
ATOM   1671 C  CB    . CYS A 1 302 ? 11.041  40.719 12.423 1.00 58.82  ? 543 CYS A CB    1 
ATOM   1672 S  SG    . CYS A 1 302 ? 11.027  42.340 13.160 1.00 65.85  ? 543 CYS A SG    1 
ATOM   1673 N  N     . LYS A 1 303 ? 9.580   37.830 11.927 1.00 55.04  ? 544 LYS A N     1 
ATOM   1674 C  CA    . LYS A 1 303 ? 9.624   36.530 11.303 1.00 47.92  ? 544 LYS A CA    1 
ATOM   1675 C  C     . LYS A 1 303 ? 10.288  36.616 9.965  1.00 48.64  ? 544 LYS A C     1 
ATOM   1676 O  O     . LYS A 1 303 ? 9.856   37.337 9.110  1.00 51.05  ? 544 LYS A O     1 
ATOM   1677 C  CB    . LYS A 1 303 ? 8.211   36.026 11.145 1.00 41.62  ? 544 LYS A CB    1 
ATOM   1678 C  CG    . LYS A 1 303 ? 8.042   34.880 10.203 1.00 42.07  ? 544 LYS A CG    1 
ATOM   1679 C  CD    . LYS A 1 303 ? 6.590   34.607 10.021 1.00 42.88  ? 544 LYS A CD    1 
ATOM   1680 C  CE    . LYS A 1 303 ? 6.366   33.896 8.719  1.00 51.58  ? 544 LYS A CE    1 
ATOM   1681 N  NZ    . LYS A 1 303 ? 5.024   33.272 8.673  1.00 59.91  ? 544 LYS A NZ    1 
ATOM   1682 N  N     . VAL A 1 304 ? 11.360  35.875 9.792  1.00 45.40  ? 545 VAL A N     1 
ATOM   1683 C  CA    . VAL A 1 304 ? 12.067  35.892 8.549  1.00 45.60  ? 545 VAL A CA    1 
ATOM   1684 C  C     . VAL A 1 304 ? 12.084  34.555 7.849  1.00 46.09  ? 545 VAL A C     1 
ATOM   1685 O  O     . VAL A 1 304 ? 12.626  34.440 6.784  1.00 35.76  ? 545 VAL A O     1 
ATOM   1686 C  CB    . VAL A 1 304 ? 13.481  36.369 8.788  1.00 42.07  ? 545 VAL A CB    1 
ATOM   1687 C  CG1   . VAL A 1 304 ? 13.442  37.758 9.343  1.00 48.70  ? 545 VAL A CG1   1 
ATOM   1688 C  CG2   . VAL A 1 304 ? 14.158  35.464 9.772  1.00 41.02  ? 545 VAL A CG2   1 
ATOM   1689 N  N     . GLY A 1 305 ? 11.507  33.545 8.474  1.00 45.92  ? 546 GLY A N     1 
ATOM   1690 C  CA    . GLY A 1 305 ? 11.461  32.217 7.916  1.00 40.71  ? 546 GLY A CA    1 
ATOM   1691 C  C     . GLY A 1 305 ? 10.124  31.636 8.180  1.00 49.75  ? 546 GLY A C     1 
ATOM   1692 O  O     . GLY A 1 305 ? 9.651   31.717 9.277  1.00 48.20  ? 546 GLY A O     1 
ATOM   1693 N  N     . PRO A 1 306 ? 9.518   31.007 7.114  1.00 53.12  ? 547 PRO A N     1 
ATOM   1694 C  CA    . PRO A 1 306 ? 8.176   30.503 7.386  1.00 55.90  ? 547 PRO A CA    1 
ATOM   1695 C  C     . PRO A 1 306 ? 8.110   29.198 8.095  1.00 52.01  ? 547 PRO A C     1 
ATOM   1696 O  O     . PRO A 1 306 ? 7.055   28.796 8.465  1.00 53.07  ? 547 PRO A O     1 
ATOM   1697 C  CB    . PRO A 1 306 ? 7.615   30.317 6.008  1.00 51.77  ? 547 PRO A CB    1 
ATOM   1698 C  CG    . PRO A 1 306 ? 8.738   29.723 5.309  1.00 52.54  ? 547 PRO A CG    1 
ATOM   1699 C  CD    . PRO A 1 306 ? 9.837   30.636 5.671  1.00 49.74  ? 547 PRO A CD    1 
ATOM   1700 N  N     . GLY A 1 307 ? 9.229   28.537 8.245  1.00 56.94  ? 548 GLY A N     1 
ATOM   1701 C  CA    . GLY A 1 307 ? 9.277   27.235 8.888  1.00 52.65  ? 548 GLY A CA    1 
ATOM   1702 C  C     . GLY A 1 307 ? 8.629   26.165 8.031  1.00 53.83  ? 548 GLY A C     1 
ATOM   1703 O  O     . GLY A 1 307 ? 8.589   26.283 6.805  1.00 58.28  ? 548 GLY A O     1 
ATOM   1704 N  N     . ARG A 1 308 ? 8.117   25.118 8.671  1.00 47.95  ? 549 ARG A N     1 
ATOM   1705 C  CA    . ARG A 1 308 ? 7.488   24.018 7.946  1.00 50.20  ? 549 ARG A CA    1 
ATOM   1706 C  C     . ARG A 1 308 ? 6.162   23.615 8.586  1.00 49.32  ? 549 ARG A C     1 
ATOM   1707 O  O     . ARG A 1 308 ? 6.008   23.662 9.805  1.00 51.38  ? 549 ARG A O     1 
ATOM   1708 C  CB    . ARG A 1 308 ? 8.432   22.815 7.874  1.00 54.07  ? 549 ARG A CB    1 
ATOM   1709 C  CG    . ARG A 1 308 ? 8.889   22.314 9.231  1.00 54.82  ? 549 ARG A CG    1 
ATOM   1710 C  CD    . ARG A 1 308 ? 9.898   21.190 9.110  1.00 52.19  ? 549 ARG A CD    1 
ATOM   1711 N  NE    . ARG A 1 308 ? 10.235  20.646 10.422 1.00 61.54  ? 549 ARG A NE    1 
ATOM   1712 C  CZ    . ARG A 1 308 ? 9.579   19.647 11.005 1.00 65.73  ? 549 ARG A CZ    1 
ATOM   1713 N  NH1   . ARG A 1 308 ? 8.553   19.073 10.386 1.00 57.07  ? 549 ARG A NH1   1 
ATOM   1714 N  NH2   . ARG A 1 308 ? 9.952   19.217 12.205 1.00 54.11  ? 549 ARG A NH2   1 
ATOM   1715 N  N     . VAL A 1 309 ? 5.213   23.210 7.751  1.00 46.71  ? 550 VAL A N     1 
ATOM   1716 C  CA    . VAL A 1 309 ? 3.862   22.894 8.203  1.00 46.25  ? 550 VAL A CA    1 
ATOM   1717 C  C     . VAL A 1 309 ? 3.742   21.515 8.848  1.00 45.65  ? 550 VAL A C     1 
ATOM   1718 O  O     . VAL A 1 309 ? 4.099   20.505 8.243  1.00 47.62  ? 550 VAL A O     1 
ATOM   1719 C  CB    . VAL A 1 309 ? 2.862   22.971 7.032  1.00 42.23  ? 550 VAL A CB    1 
ATOM   1720 C  CG1   . VAL A 1 309 ? 1.510   22.406 7.440  1.00 38.28  ? 550 VAL A CG1   1 
ATOM   1721 C  CG2   . VAL A 1 309 ? 2.735   24.404 6.539  1.00 38.71  ? 550 VAL A CG2   1 
ATOM   1722 N  N     . LEU A 1 310 ? 3.231   21.483 10.076 1.00 50.39  ? 551 LEU A N     1 
ATOM   1723 C  CA    . LEU A 1 310 ? 2.924   20.225 10.750 1.00 51.07  ? 551 LEU A CA    1 
ATOM   1724 C  C     . LEU A 1 310 ? 1.502   19.773 10.424 1.00 53.23  ? 551 LEU A C     1 
ATOM   1725 O  O     . LEU A 1 310 ? 0.555   20.545 10.565 1.00 53.56  ? 551 LEU A O     1 
ATOM   1726 C  CB    . LEU A 1 310 ? 3.091   20.362 12.264 1.00 40.55  ? 551 LEU A CB    1 
ATOM   1727 C  CG    . LEU A 1 310 ? 4.491   20.688 12.785 1.00 47.78  ? 551 LEU A CG    1 
ATOM   1728 C  CD1   . LEU A 1 310 ? 4.434   21.846 13.763 1.00 49.96  ? 551 LEU A CD1   1 
ATOM   1729 C  CD2   . LEU A 1 310 ? 5.118   19.471 13.440 1.00 53.68  ? 551 LEU A CD2   1 
ATOM   1730 N  N     . PRO A 1 311 ? 1.349   18.512 9.989  1.00 61.51  ? 552 PRO A N     1 
ATOM   1731 C  CA    . PRO A 1 311 ? 0.028   17.959 9.667  1.00 53.69  ? 552 PRO A CA    1 
ATOM   1732 C  C     . PRO A 1 311 ? -0.877  17.913 10.894 1.00 58.30  ? 552 PRO A C     1 
ATOM   1733 O  O     . PRO A 1 311 ? -0.522  17.299 11.902 1.00 59.05  ? 552 PRO A O     1 
ATOM   1734 C  CB    . PRO A 1 311 ? 0.351   16.547 9.171  1.00 52.96  ? 552 PRO A CB    1 
ATOM   1735 C  CG    . PRO A 1 311 ? 1.660   16.214 9.811  1.00 55.81  ? 552 PRO A CG    1 
ATOM   1736 C  CD    . PRO A 1 311 ? 2.418   17.507 9.851  1.00 58.10  ? 552 PRO A CD    1 
ATOM   1737 N  N     . THR A 1 312 ? -2.029  18.569 10.811 1.00 52.30  ? 553 THR A N     1 
ATOM   1738 C  CA    . THR A 1 312 ? -2.956  18.624 11.935 1.00 48.14  ? 553 THR A CA    1 
ATOM   1739 C  C     . THR A 1 312 ? -4.363  18.261 11.482 1.00 52.84  ? 553 THR A C     1 
ATOM   1740 O  O     . THR A 1 312 ? -5.141  19.136 11.115 1.00 54.05  ? 553 THR A O     1 
ATOM   1741 C  CB    . THR A 1 312 ? -2.975  20.017 12.581 1.00 46.96  ? 553 THR A CB    1 
ATOM   1742 O  OG1   . THR A 1 312 ? -3.371  20.990 11.608 1.00 49.25  ? 553 THR A OG1   1 
ATOM   1743 C  CG2   . THR A 1 312 ? -1.597  20.383 13.110 1.00 49.11  ? 553 THR A CG2   1 
ATOM   1744 N  N     . PRO A 1 313 ? -4.688  16.960 11.491 1.00 58.76  ? 554 PRO A N     1 
ATOM   1745 C  CA    . PRO A 1 313 ? -5.994  16.473 11.031 1.00 47.30  ? 554 PRO A CA    1 
ATOM   1746 C  C     . PRO A 1 313 ? -7.165  17.025 11.845 1.00 48.19  ? 554 PRO A C     1 
ATOM   1747 O  O     . PRO A 1 313 ? -8.185  17.387 11.265 1.00 55.90  ? 554 PRO A O     1 
ATOM   1748 C  CB    . PRO A 1 313 ? -5.883  14.956 11.203 1.00 47.66  ? 554 PRO A CB    1 
ATOM   1749 C  CG    . PRO A 1 313 ? -4.413  14.677 11.179 1.00 48.02  ? 554 PRO A CG    1 
ATOM   1750 C  CD    . PRO A 1 313 ? -3.777  15.855 11.841 1.00 50.69  ? 554 PRO A CD    1 
ATOM   1751 N  N     . THR A 1 314 ? -7.019  17.084 13.166 1.00 49.34  ? 555 THR A N     1 
ATOM   1752 C  CA    . THR A 1 314 ? -8.088  17.570 14.039 1.00 52.54  ? 555 THR A CA    1 
ATOM   1753 C  C     . THR A 1 314 ? -7.600  18.670 14.975 1.00 52.82  ? 555 THR A C     1 
ATOM   1754 O  O     . THR A 1 314 ? -6.395  18.823 15.187 1.00 56.31  ? 555 THR A O     1 
ATOM   1755 C  CB    . THR A 1 314 ? -8.688  16.436 14.904 1.00 52.98  ? 555 THR A CB    1 
ATOM   1756 O  OG1   . THR A 1 314 ? -7.726  16.013 15.881 1.00 55.24  ? 555 THR A OG1   1 
ATOM   1757 C  CG2   . THR A 1 314 ? -9.103  15.252 14.043 1.00 34.54  ? 555 THR A CG2   1 
ATOM   1758 N  N     . GLU A 1 315 ? -8.543  19.421 15.539 1.00 48.30  ? 556 GLU A N     1 
ATOM   1759 C  CA    . GLU A 1 315 ? -8.227  20.482 16.493 1.00 48.67  ? 556 GLU A CA    1 
ATOM   1760 C  C     . GLU A 1 315 ? -7.324  19.996 17.619 1.00 48.30  ? 556 GLU A C     1 
ATOM   1761 O  O     . GLU A 1 315 ? -6.362  20.666 17.987 1.00 49.63  ? 556 GLU A O     1 
ATOM   1762 C  CB    . GLU A 1 315 ? -9.506  21.063 17.098 1.00 49.66  ? 556 GLU A CB    1 
ATOM   1763 C  CG    . GLU A 1 315 ? -10.282 21.993 16.191 1.00 44.29  ? 556 GLU A CG    1 
ATOM   1764 C  CD    . GLU A 1 315 ? -11.556 22.489 16.843 1.00 45.52  ? 556 GLU A CD    1 
ATOM   1765 O  OE1   . GLU A 1 315 ? -11.732 23.720 16.955 1.00 47.87  ? 556 GLU A OE1   1 
ATOM   1766 O  OE2   . GLU A 1 315 ? -12.381 21.647 17.251 1.00 43.86  ? 556 GLU A OE2   1 
ATOM   1767 N  N     . LYS A 1 316 ? -7.644  18.820 18.153 1.00 54.74  ? 557 LYS A N     1 
ATOM   1768 C  CA    . LYS A 1 316 ? -6.954  18.270 19.317 1.00 59.05  ? 557 LYS A CA    1 
ATOM   1769 C  C     . LYS A 1 316 ? -5.454  18.111 19.068 1.00 54.56  ? 557 LYS A C     1 
ATOM   1770 O  O     . LYS A 1 316 ? -4.644  18.212 19.993 1.00 49.21  ? 557 LYS A O     1 
ATOM   1771 C  CB    . LYS A 1 316 ? -7.580  16.927 19.707 1.00 62.99  ? 557 LYS A CB    1 
ATOM   1772 C  CG    . LYS A 1 316 ? -9.110  16.951 19.730 1.00 64.43  ? 557 LYS A CG    1 
ATOM   1773 C  CD    . LYS A 1 316 ? -9.709  15.549 19.747 1.00 65.20  ? 557 LYS A CD    1 
ATOM   1774 C  CE    . LYS A 1 316 ? -9.457  14.851 21.077 1.00 70.58  ? 557 LYS A CE    1 
ATOM   1775 N  NZ    . LYS A 1 316 ? -10.148 15.527 22.210 1.00 59.15  ? 557 LYS A NZ    1 
ATOM   1776 N  N     . ASP A 1 317 ? -5.089  17.883 17.810 1.00 53.85  ? 558 ASP A N     1 
ATOM   1777 C  CA    . ASP A 1 317 ? -3.686  17.748 17.432 1.00 56.95  ? 558 ASP A CA    1 
ATOM   1778 C  C     . ASP A 1 317 ? -2.937  19.066 17.567 1.00 53.03  ? 558 ASP A C     1 
ATOM   1779 O  O     . ASP A 1 317 ? -1.779  19.097 17.988 1.00 49.86  ? 558 ASP A O     1 
ATOM   1780 C  CB    . ASP A 1 317 ? -3.569  17.229 16.001 1.00 53.96  ? 558 ASP A CB    1 
ATOM   1781 C  CG    . ASP A 1 317 ? -4.185  15.862 15.833 1.00 56.94  ? 558 ASP A CG    1 
ATOM   1782 O  OD1   . ASP A 1 317 ? -3.959  14.997 16.709 1.00 56.75  ? 558 ASP A OD1   1 
ATOM   1783 O  OD2   . ASP A 1 317 ? -4.900  15.656 14.832 1.00 59.53  ? 558 ASP A OD2   1 
ATOM   1784 N  N     . VAL A 1 318 ? -3.604  20.155 17.202 1.00 51.07  ? 559 VAL A N     1 
ATOM   1785 C  CA    . VAL A 1 318 ? -3.001  21.475 17.288 1.00 49.38  ? 559 VAL A CA    1 
ATOM   1786 C  C     . VAL A 1 318 ? -2.692  21.817 18.741 1.00 49.83  ? 559 VAL A C     1 
ATOM   1787 O  O     . VAL A 1 318 ? -1.601  22.297 19.055 1.00 50.40  ? 559 VAL A O     1 
ATOM   1788 C  CB    . VAL A 1 318 ? -3.916  22.551 16.677 1.00 45.16  ? 559 VAL A CB    1 
ATOM   1789 C  CG1   . VAL A 1 318 ? -3.230  23.903 16.693 1.00 42.19  ? 559 VAL A CG1   1 
ATOM   1790 C  CG2   . VAL A 1 318 ? -4.300  22.167 15.258 1.00 46.16  ? 559 VAL A CG2   1 
ATOM   1791 N  N     . PHE A 1 319 ? -3.653  21.554 19.624 1.00 48.37  ? 560 PHE A N     1 
ATOM   1792 C  CA    . PHE A 1 319 ? -3.470  21.791 21.053 1.00 48.93  ? 560 PHE A CA    1 
ATOM   1793 C  C     . PHE A 1 319 ? -2.300  20.979 21.601 1.00 54.21  ? 560 PHE A C     1 
ATOM   1794 O  O     . PHE A 1 319 ? -1.516  21.468 22.417 1.00 50.31  ? 560 PHE A O     1 
ATOM   1795 C  CB    . PHE A 1 319 ? -4.740  21.441 21.826 1.00 50.97  ? 560 PHE A CB    1 
ATOM   1796 C  CG    . PHE A 1 319 ? -5.736  22.561 21.917 1.00 49.75  ? 560 PHE A CG    1 
ATOM   1797 C  CD1   . PHE A 1 319 ? -6.886  22.547 21.148 1.00 48.41  ? 560 PHE A CD1   1 
ATOM   1798 C  CD2   . PHE A 1 319 ? -5.532  23.617 22.790 1.00 49.44  ? 560 PHE A CD2   1 
ATOM   1799 C  CE1   . PHE A 1 319 ? -7.811  23.569 21.241 1.00 50.96  ? 560 PHE A CE1   1 
ATOM   1800 C  CE2   . PHE A 1 319 ? -6.453  24.642 22.888 1.00 45.72  ? 560 PHE A CE2   1 
ATOM   1801 C  CZ    . PHE A 1 319 ? -7.594  24.618 22.112 1.00 49.10  ? 560 PHE A CZ    1 
ATOM   1802 N  N     . ARG A 1 320 ? -2.197  19.735 21.139 1.00 53.61  ? 561 ARG A N     1 
ATOM   1803 C  CA    . ARG A 1 320 ? -1.170  18.806 21.598 1.00 50.71  ? 561 ARG A CA    1 
ATOM   1804 C  C     . ARG A 1 320 ? 0.234   19.257 21.198 1.00 54.57  ? 561 ARG A C     1 
ATOM   1805 O  O     . ARG A 1 320 ? 1.158   19.240 22.017 1.00 50.28  ? 561 ARG A O     1 
ATOM   1806 C  CB    . ARG A 1 320 ? -1.454  17.404 21.048 1.00 53.04  ? 561 ARG A CB    1 
ATOM   1807 C  CG    . ARG A 1 320 ? -0.344  16.386 21.278 1.00 46.95  ? 561 ARG A CG    1 
ATOM   1808 C  CD    . ARG A 1 320 ? -0.716  15.028 20.695 1.00 43.17  ? 561 ARG A CD    1 
ATOM   1809 N  NE    . ARG A 1 320 ? -1.128  15.123 19.296 1.00 48.71  ? 561 ARG A NE    1 
ATOM   1810 C  CZ    . ARG A 1 320 ? -0.294  15.068 18.261 1.00 52.40  ? 561 ARG A CZ    1 
ATOM   1811 N  NH1   . ARG A 1 320 ? 1.010   14.916 18.461 1.00 48.81  ? 561 ARG A NH1   1 
ATOM   1812 N  NH2   . ARG A 1 320 ? -0.762  15.167 17.024 1.00 51.19  ? 561 ARG A NH2   1 
ATOM   1813 N  N     . LEU A 1 321 ? 0.387   19.669 19.941 1.00 49.77  ? 562 LEU A N     1 
ATOM   1814 C  CA    . LEU A 1 321 ? 1.691   20.073 19.418 1.00 49.91  ? 562 LEU A CA    1 
ATOM   1815 C  C     . LEU A 1 321 ? 2.158   21.401 20.004 1.00 50.08  ? 562 LEU A C     1 
ATOM   1816 O  O     . LEU A 1 321 ? 3.314   21.790 19.840 1.00 52.65  ? 562 LEU A O     1 
ATOM   1817 C  CB    . LEU A 1 321 ? 1.648   20.165 17.893 1.00 49.71  ? 562 LEU A CB    1 
ATOM   1818 C  CG    . LEU A 1 321 ? 1.327   18.856 17.171 1.00 52.25  ? 562 LEU A CG    1 
ATOM   1819 C  CD1   . LEU A 1 321 ? 1.096   19.094 15.690 1.00 43.59  ? 562 LEU A CD1   1 
ATOM   1820 C  CD2   . LEU A 1 321 ? 2.446   17.853 17.388 1.00 51.46  ? 562 LEU A CD2   1 
ATOM   1821 N  N     . LEU A 1 322 ? 1.253   22.094 20.685 1.00 49.75  ? 563 LEU A N     1 
ATOM   1822 C  CA    . LEU A 1 322 ? 1.573   23.369 21.310 1.00 50.21  ? 563 LEU A CA    1 
ATOM   1823 C  C     . LEU A 1 322 ? 1.770   23.222 22.818 1.00 57.05  ? 563 LEU A C     1 
ATOM   1824 O  O     . LEU A 1 322 ? 1.961   24.212 23.525 1.00 52.87  ? 563 LEU A O     1 
ATOM   1825 C  CB    . LEU A 1 322 ? 0.472   24.392 21.021 1.00 57.08  ? 563 LEU A CB    1 
ATOM   1826 C  CG    . LEU A 1 322 ? 0.442   25.026 19.627 1.00 51.66  ? 563 LEU A CG    1 
ATOM   1827 C  CD1   . LEU A 1 322 ? -0.770  25.928 19.474 1.00 48.76  ? 563 LEU A CD1   1 
ATOM   1828 C  CD2   . LEU A 1 322 ? 1.716   25.809 19.369 1.00 45.09  ? 563 LEU A CD2   1 
ATOM   1829 N  N     . GLY A 1 323 ? 1.723   21.986 23.306 1.00 57.16  ? 564 GLY A N     1 
ATOM   1830 C  CA    . GLY A 1 323 ? 1.899   21.718 24.723 1.00 52.00  ? 564 GLY A CA    1 
ATOM   1831 C  C     . GLY A 1 323 ? 0.800   22.347 25.555 1.00 58.25  ? 564 GLY A C     1 
ATOM   1832 O  O     . GLY A 1 323 ? 1.066   23.056 26.528 1.00 59.40  ? 564 GLY A O     1 
ATOM   1833 N  N     . LEU A 1 324 ? -0.443  22.086 25.164 1.00 57.28  ? 565 LEU A N     1 
ATOM   1834 C  CA    . LEU A 1 324 ? -1.601  22.678 25.821 1.00 57.82  ? 565 LEU A CA    1 
ATOM   1835 C  C     . LEU A 1 324 ? -2.707  21.664 26.059 1.00 52.93  ? 565 LEU A C     1 
ATOM   1836 O  O     . LEU A 1 324 ? -2.964  20.804 25.216 1.00 46.95  ? 565 LEU A O     1 
ATOM   1837 C  CB    . LEU A 1 324 ? -2.157  23.829 24.986 1.00 58.48  ? 565 LEU A CB    1 
ATOM   1838 C  CG    . LEU A 1 324 ? -1.340  25.108 24.853 1.00 58.98  ? 565 LEU A CG    1 
ATOM   1839 C  CD1   . LEU A 1 324 ? -1.957  25.974 23.768 1.00 62.31  ? 565 LEU A CD1   1 
ATOM   1840 C  CD2   . LEU A 1 324 ? -1.298  25.844 26.179 1.00 62.56  ? 565 LEU A CD2   1 
ATOM   1841 N  N     . PRO A 1 325 ? -3.374  21.770 27.214 1.00 52.93  ? 566 PRO A N     1 
ATOM   1842 C  CA    . PRO A 1 325 ? -4.574  20.976 27.473 1.00 52.72  ? 566 PRO A CA    1 
ATOM   1843 C  C     . PRO A 1 325 ? -5.686  21.373 26.514 1.00 56.22  ? 566 PRO A C     1 
ATOM   1844 O  O     . PRO A 1 325 ? -6.009  22.557 26.416 1.00 56.72  ? 566 PRO A O     1 
ATOM   1845 C  CB    . PRO A 1 325 ? -4.935  21.336 28.917 1.00 59.54  ? 566 PRO A CB    1 
ATOM   1846 C  CG    . PRO A 1 325 ? -3.675  21.883 29.503 1.00 66.43  ? 566 PRO A CG    1 
ATOM   1847 C  CD    . PRO A 1 325 ? -2.989  22.582 28.377 1.00 61.79  ? 566 PRO A CD    1 
ATOM   1848 N  N     . TYR A 1 326 ? -6.247  20.398 25.810 1.00 55.23  ? 567 TYR A N     1 
ATOM   1849 C  CA    . TYR A 1 326 ? -7.329  20.654 24.870 1.00 50.33  ? 567 TYR A CA    1 
ATOM   1850 C  C     . TYR A 1 326 ? -8.504  21.357 25.543 1.00 55.87  ? 567 TYR A C     1 
ATOM   1851 O  O     . TYR A 1 326 ? -8.938  20.968 26.627 1.00 59.58  ? 567 TYR A O     1 
ATOM   1852 C  CB    . TYR A 1 326 ? -7.798  19.345 24.233 1.00 51.01  ? 567 TYR A CB    1 
ATOM   1853 C  CG    . TYR A 1 326 ? -9.026  19.493 23.365 1.00 56.29  ? 567 TYR A CG    1 
ATOM   1854 C  CD1   . TYR A 1 326 ? -8.922  19.929 22.052 1.00 55.20  ? 567 TYR A CD1   1 
ATOM   1855 C  CD2   . TYR A 1 326 ? -10.289 19.190 23.855 1.00 53.26  ? 567 TYR A CD2   1 
ATOM   1856 C  CE1   . TYR A 1 326 ? -10.041 20.065 21.252 1.00 57.82  ? 567 TYR A CE1   1 
ATOM   1857 C  CE2   . TYR A 1 326 ? -11.413 19.322 23.062 1.00 57.30  ? 567 TYR A CE2   1 
ATOM   1858 C  CZ    . TYR A 1 326 ? -11.284 19.759 21.762 1.00 57.95  ? 567 TYR A CZ    1 
ATOM   1859 O  OH    . TYR A 1 326 ? -12.402 19.892 20.969 1.00 52.59  ? 567 TYR A OH    1 
ATOM   1860 N  N     . ARG A 1 327 ? -9.011  22.400 24.895 1.00 56.32  ? 568 ARG A N     1 
ATOM   1861 C  CA    . ARG A 1 327 ? -10.191 23.097 25.382 1.00 50.75  ? 568 ARG A CA    1 
ATOM   1862 C  C     . ARG A 1 327 ? -11.357 22.893 24.424 1.00 54.40  ? 568 ARG A C     1 
ATOM   1863 O  O     . ARG A 1 327 ? -11.221 23.098 23.218 1.00 53.57  ? 568 ARG A O     1 
ATOM   1864 C  CB    . ARG A 1 327 ? -9.911  24.590 25.552 1.00 43.01  ? 568 ARG A CB    1 
ATOM   1865 C  CG    . ARG A 1 327 ? -8.717  24.913 26.426 1.00 46.54  ? 568 ARG A CG    1 
ATOM   1866 C  CD    . ARG A 1 327 ? -8.932  24.439 27.844 1.00 54.96  ? 568 ARG A CD    1 
ATOM   1867 N  NE    . ARG A 1 327 ? -7.934  24.988 28.757 1.00 68.08  ? 568 ARG A NE    1 
ATOM   1868 C  CZ    . ARG A 1 327 ? -7.907  24.745 30.065 1.00 73.46  ? 568 ARG A CZ    1 
ATOM   1869 N  NH1   . ARG A 1 327 ? -8.825  23.960 30.616 1.00 69.17  ? 568 ARG A NH1   1 
ATOM   1870 N  NH2   . ARG A 1 327 ? -6.963  25.288 30.823 1.00 68.81  ? 568 ARG A NH2   1 
ATOM   1871 N  N     . GLU A 1 328 ? -12.499 22.474 24.960 1.00 59.34  ? 569 GLU A N     1 
ATOM   1872 C  CA    . GLU A 1 328 ? -13.731 22.414 24.183 1.00 52.42  ? 569 GLU A CA    1 
ATOM   1873 C  C     . GLU A 1 328 ? -14.126 23.839 23.798 1.00 50.90  ? 569 GLU A C     1 
ATOM   1874 O  O     . GLU A 1 328 ? -13.804 24.780 24.524 1.00 49.26  ? 569 GLU A O     1 
ATOM   1875 C  CB    . GLU A 1 328 ? -14.846 21.733 24.987 1.00 53.26  ? 569 GLU A CB    1 
ATOM   1876 C  CG    . GLU A 1 328 ? -15.597 20.640 24.237 1.00 56.43  ? 569 GLU A CG    1 
ATOM   1877 C  CD    . GLU A 1 328 ? -14.762 19.390 24.031 1.00 63.03  ? 569 GLU A CD    1 
ATOM   1878 O  OE1   . GLU A 1 328 ? -13.998 19.029 24.951 1.00 59.75  ? 569 GLU A OE1   1 
ATOM   1879 O  OE2   . GLU A 1 328 ? -14.868 18.769 22.949 1.00 60.57  ? 569 GLU A OE2   1 
ATOM   1880 N  N     . PRO A 1 329 ? -14.805 24.008 22.648 1.00 51.50  ? 570 PRO A N     1 
ATOM   1881 C  CA    . PRO A 1 329 ? -15.284 25.315 22.183 1.00 49.30  ? 570 PRO A CA    1 
ATOM   1882 C  C     . PRO A 1 329 ? -15.877 26.203 23.281 1.00 49.56  ? 570 PRO A C     1 
ATOM   1883 O  O     . PRO A 1 329 ? -15.611 27.405 23.299 1.00 47.71  ? 570 PRO A O     1 
ATOM   1884 C  CB    . PRO A 1 329 ? -16.354 24.933 21.163 1.00 44.34  ? 570 PRO A CB    1 
ATOM   1885 C  CG    . PRO A 1 329 ? -15.818 23.684 20.556 1.00 43.35  ? 570 PRO A CG    1 
ATOM   1886 C  CD    . PRO A 1 329 ? -15.081 22.953 21.656 1.00 49.55  ? 570 PRO A CD    1 
ATOM   1887 N  N     . ALA A 1 330 ? -16.648 25.617 24.192 1.00 54.70  ? 571 ALA A N     1 
ATOM   1888 C  CA    . ALA A 1 330 ? -17.276 26.381 25.266 1.00 45.68  ? 571 ALA A CA    1 
ATOM   1889 C  C     . ALA A 1 330 ? -16.247 26.885 26.281 1.00 46.85  ? 571 ALA A C     1 
ATOM   1890 O  O     . ALA A 1 330 ? -16.535 27.776 27.082 1.00 50.98  ? 571 ALA A O     1 
ATOM   1891 C  CB    . ALA A 1 330 ? -18.335 25.543 25.956 1.00 37.31  ? 571 ALA A CB    1 
ATOM   1892 N  N     . GLU A 1 331 ? -15.046 26.318 26.242 1.00 44.17  ? 572 GLU A N     1 
ATOM   1893 C  CA    . GLU A 1 331 ? -13.972 26.749 27.128 1.00 43.42  ? 572 GLU A CA    1 
ATOM   1894 C  C     . GLU A 1 331 ? -13.067 27.759 26.438 1.00 44.13  ? 572 GLU A C     1 
ATOM   1895 O  O     . GLU A 1 331 ? -12.062 28.188 27.005 1.00 45.27  ? 572 GLU A O     1 
ATOM   1896 C  CB    . GLU A 1 331 ? -13.144 25.551 27.594 1.00 50.28  ? 572 GLU A CB    1 
ATOM   1897 C  CG    . GLU A 1 331 ? -13.948 24.478 28.307 1.00 56.60  ? 572 GLU A CG    1 
ATOM   1898 C  CD    . GLU A 1 331 ? -13.149 23.211 28.541 1.00 59.81  ? 572 GLU A CD    1 
ATOM   1899 O  OE1   . GLU A 1 331 ? -12.102 23.275 29.225 1.00 58.65  ? 572 GLU A OE1   1 
ATOM   1900 O  OE2   . GLU A 1 331 ? -13.570 22.150 28.033 1.00 61.02  ? 572 GLU A OE2   1 
ATOM   1901 N  N     . ARG A 1 332 ? -13.422 28.129 25.211 1.00 47.67  ? 573 ARG A N     1 
ATOM   1902 C  CA    . ARG A 1 332 ? -12.605 29.050 24.426 1.00 48.21  ? 573 ARG A CA    1 
ATOM   1903 C  C     . ARG A 1 332 ? -13.214 30.448 24.385 1.00 48.46  ? 573 ARG A C     1 
ATOM   1904 O  O     . ARG A 1 332 ? -12.748 31.309 23.640 1.00 50.51  ? 573 ARG A O     1 
ATOM   1905 C  CB    . ARG A 1 332 ? -12.418 28.528 22.997 1.00 43.81  ? 573 ARG A CB    1 
ATOM   1906 C  CG    . ARG A 1 332 ? -11.870 27.110 22.889 1.00 41.60  ? 573 ARG A CG    1 
ATOM   1907 C  CD    . ARG A 1 332 ? -11.705 26.708 21.428 1.00 44.99  ? 573 ARG A CD    1 
ATOM   1908 N  NE    . ARG A 1 332 ? -11.690 25.260 21.233 1.00 44.49  ? 573 ARG A NE    1 
ATOM   1909 C  CZ    . ARG A 1 332 ? -11.690 24.668 20.042 1.00 46.11  ? 573 ARG A CZ    1 
ATOM   1910 N  NH1   . ARG A 1 332 ? -11.703 25.401 18.935 1.00 47.30  ? 573 ARG A NH1   1 
ATOM   1911 N  NH2   . ARG A 1 332 ? -11.679 23.346 19.952 1.00 46.03  ? 573 ARG A NH2   1 
ATOM   1912 N  N     . ASP A 1 333 ? -14.249 30.671 25.189 1.00 47.43  ? 574 ASP A N     1 
ATOM   1913 C  CA    . ASP A 1 333 ? -14.969 31.941 25.179 1.00 44.95  ? 574 ASP A CA    1 
ATOM   1914 C  C     . ASP A 1 333 ? -14.259 32.998 26.019 1.00 48.27  ? 574 ASP A C     1 
ATOM   1915 O  O     . ASP A 1 333 ? -14.783 33.424 27.041 1.00 54.54  ? 574 ASP A O     1 
ATOM   1916 C  CB    . ASP A 1 333 ? -16.400 31.743 25.693 1.00 43.13  ? 574 ASP A CB    1 
ATOM   1917 C  CG    . ASP A 1 333 ? -17.334 32.870 25.285 1.00 49.81  ? 574 ASP A CG    1 
ATOM   1918 O  OD1   . ASP A 1 333 ? -16.839 33.929 24.844 1.00 55.03  ? 574 ASP A OD1   1 
ATOM   1919 O  OD2   . ASP A 1 333 ? -18.567 32.697 25.401 1.00 49.15  ? 574 ASP A OD2   1 
ATOM   1920 N  N     . TRP A 1 334 ? -13.077 33.431 25.586 1.00 47.84  ? 575 TRP A N     1 
ATOM   1921 C  CA    . TRP A 1 334 ? -12.309 34.417 26.346 1.00 42.82  ? 575 TRP A CA    1 
ATOM   1922 C  C     . TRP A 1 334 ? -12.596 35.840 25.877 1.00 41.62  ? 575 TRP A C     1 
ATOM   1923 O  O     . TRP A 1 334 ? -13.717 36.165 25.492 1.00 48.87  ? 575 TRP A O     1 
ATOM   1924 C  CB    . TRP A 1 334 ? -10.811 34.142 26.238 1.00 49.24  ? 575 TRP A CB    1 
ATOM   1925 C  CG    . TRP A 1 334 ? -10.391 32.776 26.679 1.00 49.37  ? 575 TRP A CG    1 
ATOM   1926 C  CD1   . TRP A 1 334 ? -11.195 31.769 27.124 1.00 50.01  ? 575 TRP A CD1   1 
ATOM   1927 C  CD2   . TRP A 1 334 ? -9.054  32.263 26.706 1.00 57.23  ? 575 TRP A CD2   1 
ATOM   1928 N  NE1   . TRP A 1 334 ? -10.443 30.661 27.429 1.00 55.30  ? 575 TRP A NE1   1 
ATOM   1929 C  CE2   . TRP A 1 334 ? -9.125  30.937 27.181 1.00 58.04  ? 575 TRP A CE2   1 
ATOM   1930 C  CE3   . TRP A 1 334 ? -7.804  32.795 26.372 1.00 59.90  ? 575 TRP A CE3   1 
ATOM   1931 C  CZ2   . TRP A 1 334 ? -7.994  30.136 27.332 1.00 65.91  ? 575 TRP A CZ2   1 
ATOM   1932 C  CZ3   . TRP A 1 334 ? -6.680  31.998 26.523 1.00 63.65  ? 575 TRP A CZ3   1 
ATOM   1933 C  CH2   . TRP A 1 334 ? -6.783  30.683 26.999 1.00 71.14  ? 575 TRP A CH2   1 
ATOM   1934 N  N     . PRO B 1 92  ? 2.130   38.146 47.076 1.00 100.62 ? 333 PRO B N     1 
ATOM   1935 C  CA    . PRO B 1 92  ? 2.602   38.801 45.860 1.00 100.16 ? 333 PRO B CA    1 
ATOM   1936 C  C     . PRO B 1 92  ? 1.790   38.322 44.669 1.00 93.36  ? 333 PRO B C     1 
ATOM   1937 O  O     . PRO B 1 92  ? 0.717   38.826 44.429 1.00 87.09  ? 333 PRO B O     1 
ATOM   1938 C  CB    . PRO B 1 92  ? 4.048   38.332 45.780 1.00 95.45  ? 333 PRO B CB    1 
ATOM   1939 C  CG    . PRO B 1 92  ? 4.007   36.977 46.376 1.00 93.55  ? 333 PRO B CG    1 
ATOM   1940 C  CD    . PRO B 1 92  ? 2.991   37.020 47.466 1.00 91.02  ? 333 PRO B CD    1 
ATOM   1941 N  N     . VAL B 1 93  ? 2.308   37.361 43.929 1.00 96.97  ? 334 VAL B N     1 
ATOM   1942 C  CA    . VAL B 1 93  ? 1.608   36.807 42.796 1.00 100.07 ? 334 VAL B CA    1 
ATOM   1943 C  C     . VAL B 1 93  ? 0.412   36.032 43.277 1.00 98.68  ? 334 VAL B C     1 
ATOM   1944 O  O     . VAL B 1 93  ? -0.566  35.879 42.574 1.00 92.17  ? 334 VAL B O     1 
ATOM   1945 C  CB    . VAL B 1 93  ? 2.493   35.884 41.953 1.00 96.77  ? 334 VAL B CB    1 
ATOM   1946 C  CG1   . VAL B 1 93  ? 2.772   34.577 42.667 1.00 96.26  ? 334 VAL B CG1   1 
ATOM   1947 C  CG2   . VAL B 1 93  ? 1.827   35.617 40.625 1.00 87.45  ? 334 VAL B CG2   1 
ATOM   1948 N  N     . LEU B 1 94  ? 0.522   35.517 44.485 1.00 95.37  ? 335 LEU B N     1 
ATOM   1949 C  CA    . LEU B 1 94  ? -0.527  34.698 45.030 1.00 94.52  ? 335 LEU B CA    1 
ATOM   1950 C  C     . LEU B 1 94  ? -1.822  35.451 45.115 1.00 94.18  ? 335 LEU B C     1 
ATOM   1951 O  O     . LEU B 1 94  ? -2.868  34.911 44.812 1.00 93.13  ? 335 LEU B O     1 
ATOM   1952 C  CB    . LEU B 1 94  ? -0.131  34.227 46.411 1.00 99.66  ? 335 LEU B CB    1 
ATOM   1953 C  CG    . LEU B 1 94  ? -1.145  33.363 47.142 1.00 98.35  ? 335 LEU B CG    1 
ATOM   1954 C  CD1   . LEU B 1 94  ? -0.766  31.894 47.025 1.00 94.69  ? 335 LEU B CD1   1 
ATOM   1955 C  CD2   . LEU B 1 94  ? -1.168  33.790 48.600 1.00 89.94  ? 335 LEU B CD2   1 
ATOM   1956 N  N     . GLU B 1 95  ? -1.763  36.704 45.517 1.00 92.74  ? 336 GLU B N     1 
ATOM   1957 C  CA    . GLU B 1 95  ? -2.979  37.483 45.627 1.00 87.71  ? 336 GLU B CA    1 
ATOM   1958 C  C     . GLU B 1 95  ? -3.640  37.646 44.295 1.00 88.56  ? 336 GLU B C     1 
ATOM   1959 O  O     . GLU B 1 95  ? -4.846  37.584 44.195 1.00 88.41  ? 336 GLU B O     1 
ATOM   1960 C  CB    . GLU B 1 95  ? -2.735  38.827 46.298 1.00 88.23  ? 336 GLU B CB    1 
ATOM   1961 C  CG    . GLU B 1 95  ? -2.621  38.723 47.807 1.00 95.47  ? 336 GLU B CG    1 
ATOM   1962 C  CD    . GLU B 1 95  ? -3.595  37.730 48.411 1.00 101.73 ? 336 GLU B CD    1 
ATOM   1963 O  OE1   . GLU B 1 95  ? -3.554  36.537 48.077 1.00 102.04 ? 336 GLU B OE1   1 
ATOM   1964 O  OE2   . GLU B 1 95  ? -4.406  38.132 49.250 1.00 107.77 ? 336 GLU B OE2   1 
ATOM   1965 N  N     . LEU B 1 96  ? -2.836  37.827 43.265 1.00 88.81  ? 337 LEU B N     1 
ATOM   1966 C  CA    . LEU B 1 96  ? -3.358  38.022 41.944 1.00 77.85  ? 337 LEU B CA    1 
ATOM   1967 C  C     . LEU B 1 96  ? -4.170  36.820 41.615 1.00 75.94  ? 337 LEU B C     1 
ATOM   1968 O  O     . LEU B 1 96  ? -5.212  36.926 41.020 1.00 76.70  ? 337 LEU B O     1 
ATOM   1969 C  CB    . LEU B 1 96  ? -2.210  38.097 40.962 1.00 76.06  ? 337 LEU B CB    1 
ATOM   1970 C  CG    . LEU B 1 96  ? -2.607  38.297 39.514 1.00 70.07  ? 337 LEU B CG    1 
ATOM   1971 C  CD1   . LEU B 1 96  ? -2.771  39.769 39.271 1.00 71.82  ? 337 LEU B CD1   1 
ATOM   1972 C  CD2   . LEU B 1 96  ? -1.520  37.776 38.614 1.00 73.57  ? 337 LEU B CD2   1 
ATOM   1973 N  N     . PHE B 1 97  ? -3.664  35.668 41.993 1.00 70.83  ? 338 PHE B N     1 
ATOM   1974 C  CA    . PHE B 1 97  ? -4.346  34.426 41.759 1.00 75.41  ? 338 PHE B CA    1 
ATOM   1975 C  C     . PHE B 1 97  ? -5.626  34.268 42.536 1.00 73.67  ? 338 PHE B C     1 
ATOM   1976 O  O     . PHE B 1 97  ? -6.584  33.732 42.054 1.00 75.12  ? 338 PHE B O     1 
ATOM   1977 C  CB    . PHE B 1 97  ? -3.436  33.274 42.100 1.00 80.95  ? 338 PHE B CB    1 
ATOM   1978 C  CG    . PHE B 1 97  ? -2.476  32.930 41.019 1.00 88.60  ? 338 PHE B CG    1 
ATOM   1979 C  CD1   . PHE B 1 97  ? -1.976  33.908 40.196 1.00 88.16  ? 338 PHE B CD1   1 
ATOM   1980 C  CD2   . PHE B 1 97  ? -2.059  31.633 40.842 1.00 90.01  ? 338 PHE B CD2   1 
ATOM   1981 C  CE1   . PHE B 1 97  ? -1.084  33.597 39.205 1.00 86.93  ? 338 PHE B CE1   1 
ATOM   1982 C  CE2   . PHE B 1 97  ? -1.170  31.312 39.854 1.00 89.14  ? 338 PHE B CE2   1 
ATOM   1983 C  CZ    . PHE B 1 97  ? -0.682  32.297 39.037 1.00 91.14  ? 338 PHE B CZ    1 
ATOM   1984 N  N     . SER B 1 98  ? -5.623  34.715 43.767 1.00 73.61  ? 339 SER B N     1 
ATOM   1985 C  CA    . SER B 1 98  ? -6.769  34.563 44.631 1.00 75.95  ? 339 SER B CA    1 
ATOM   1986 C  C     . SER B 1 98  ? -7.946  35.437 44.312 1.00 71.87  ? 339 SER B C     1 
ATOM   1987 O  O     . SER B 1 98  ? -9.020  35.246 44.860 1.00 65.29  ? 339 SER B O     1 
ATOM   1988 C  CB    . SER B 1 98  ? -6.346  34.786 46.070 1.00 82.60  ? 339 SER B CB    1 
ATOM   1989 O  OG    . SER B 1 98  ? -5.630  33.675 46.540 1.00 84.27  ? 339 SER B OG    1 
ATOM   1990 N  N     . ASN B 1 99  ? -7.732  36.409 43.444 1.00 69.26  ? 340 ASN B N     1 
ATOM   1991 C  CA    . ASN B 1 99  ? -8.764  37.344 43.071 1.00 64.96  ? 340 ASN B CA    1 
ATOM   1992 C  C     . ASN B 1 99  ? -9.590  36.863 41.937 1.00 60.54  ? 340 ASN B C     1 
ATOM   1993 O  O     . ASN B 1 99  ? -10.400 37.575 41.409 1.00 61.81  ? 340 ASN B O     1 
ATOM   1994 C  CB    . ASN B 1 99  ? -8.207  38.711 42.808 1.00 64.85  ? 340 ASN B CB    1 
ATOM   1995 C  CG    . ASN B 1 99  ? -7.629  39.306 44.043 1.00 70.58  ? 340 ASN B CG    1 
ATOM   1996 O  OD1   . ASN B 1 99  ? -7.094  38.593 44.854 1.00 75.19  ? 340 ASN B OD1   1 
ATOM   1997 N  ND2   . ASN B 1 99  ? -7.757  40.598 44.209 1.00 72.94  ? 340 ASN B ND2   1 
ATOM   1998 N  N     . ILE B 1 100 ? -9.368  35.629 41.559 1.00 61.95  ? 341 ILE B N     1 
ATOM   1999 C  CA    . ILE B 1 100 ? -10.131 35.028 40.514 1.00 59.19  ? 341 ILE B CA    1 
ATOM   2000 C  C     . ILE B 1 100 ? -11.356 34.510 41.187 1.00 53.44  ? 341 ILE B C     1 
ATOM   2001 O  O     . ILE B 1 100 ? -11.270 33.843 42.176 1.00 53.21  ? 341 ILE B O     1 
ATOM   2002 C  CB    . ILE B 1 100 ? -9.351  33.875 39.921 1.00 61.04  ? 341 ILE B CB    1 
ATOM   2003 C  CG1   . ILE B 1 100 ? -7.989  34.371 39.489 1.00 56.40  ? 341 ILE B CG1   1 
ATOM   2004 C  CG2   . ILE B 1 100 ? -10.083 33.276 38.747 1.00 57.96  ? 341 ILE B CG2   1 
ATOM   2005 C  CD1   . ILE B 1 100 ? -6.982  33.272 39.421 1.00 61.06  ? 341 ILE B CD1   1 
ATOM   2006 N  N     . TRP B 1 101 ? -12.510 34.824 40.649 1.00 53.06  ? 342 TRP B N     1 
ATOM   2007 C  CA    . TRP B 1 101 ? -13.746 34.378 41.239 1.00 53.81  ? 342 TRP B CA    1 
ATOM   2008 C  C     . TRP B 1 101 ? -13.795 32.877 41.262 1.00 55.39  ? 342 TRP B C     1 
ATOM   2009 O  O     . TRP B 1 101 ? -13.633 32.242 40.263 1.00 61.35  ? 342 TRP B O     1 
ATOM   2010 C  CB    . TRP B 1 101 ? -14.902 34.938 40.439 1.00 53.64  ? 342 TRP B CB    1 
ATOM   2011 C  CG    . TRP B 1 101 ? -16.217 34.763 41.030 1.00 53.89  ? 342 TRP B CG    1 
ATOM   2012 C  CD1   . TRP B 1 101 ? -16.533 34.823 42.325 1.00 57.33  ? 342 TRP B CD1   1 
ATOM   2013 C  CD2   . TRP B 1 101 ? -17.425 34.560 40.332 1.00 52.21  ? 342 TRP B CD2   1 
ATOM   2014 N  NE1   . TRP B 1 101 ? -17.861 34.640 42.496 1.00 51.75  ? 342 TRP B NE1   1 
ATOM   2015 C  CE2   . TRP B 1 101 ? -18.431 34.470 41.271 1.00 55.35  ? 342 TRP B CE2   1 
ATOM   2016 C  CE3   . TRP B 1 101 ? -17.750 34.419 38.993 1.00 55.82  ? 342 TRP B CE3   1 
ATOM   2017 C  CZ2   . TRP B 1 101 ? -19.739 34.252 40.922 1.00 65.20  ? 342 TRP B CZ2   1 
ATOM   2018 C  CZ3   . TRP B 1 101 ? -19.049 34.204 38.652 1.00 56.48  ? 342 TRP B CZ3   1 
ATOM   2019 C  CH2   . TRP B 1 101 ? -20.026 34.127 39.601 1.00 64.68  ? 342 TRP B CH2   1 
ATOM   2020 N  N     . GLY B 1 102 ? -14.032 32.305 42.420 1.00 56.56  ? 343 GLY B N     1 
ATOM   2021 C  CA    . GLY B 1 102 ? -14.102 30.862 42.560 1.00 57.71  ? 343 GLY B CA    1 
ATOM   2022 C  C     . GLY B 1 102 ? -12.758 30.229 42.867 1.00 61.54  ? 343 GLY B C     1 
ATOM   2023 O  O     . GLY B 1 102 ? -12.575 29.024 42.682 1.00 54.09  ? 343 GLY B O     1 
ATOM   2024 N  N     . ALA B 1 103 ? -11.818 31.044 43.340 1.00 60.62  ? 344 ALA B N     1 
ATOM   2025 C  CA    . ALA B 1 103 ? -10.485 30.561 43.684 1.00 62.90  ? 344 ALA B CA    1 
ATOM   2026 C  C     . ALA B 1 103 ? -10.103 30.941 45.111 1.00 69.89  ? 344 ALA B C     1 
ATOM   2027 O  O     . ALA B 1 103 ? -9.913  32.119 45.423 1.00 63.94  ? 344 ALA B O     1 
ATOM   2028 C  CB    . ALA B 1 103 ? -9.458  31.100 42.703 1.00 64.50  ? 344 ALA B CB    1 
ATOM   2029 N  N     . GLY B 1 104 ? -9.993  29.931 45.969 1.00 79.99  ? 345 GLY B N     1 
ATOM   2030 C  CA    . GLY B 1 104 ? -9.604  30.132 47.353 1.00 87.89  ? 345 GLY B CA    1 
ATOM   2031 C  C     . GLY B 1 104 ? -8.102  30.277 47.485 1.00 89.39  ? 345 GLY B C     1 
ATOM   2032 O  O     . GLY B 1 104 ? -7.358  29.910 46.575 1.00 86.64  ? 345 GLY B O     1 
ATOM   2033 N  N     . THR B 1 105 ? -7.656  30.804 48.623 1.00 92.61  ? 346 THR B N     1 
ATOM   2034 C  CA    . THR B 1 105 ? -6.236  31.069 48.851 1.00 92.99  ? 346 THR B CA    1 
ATOM   2035 C  C     . THR B 1 105 ? -5.417  29.779 48.851 1.00 87.50  ? 346 THR B C     1 
ATOM   2036 O  O     . THR B 1 105 ? -4.210  29.798 48.607 1.00 81.93  ? 346 THR B O     1 
ATOM   2037 C  CB    . THR B 1 105 ? -6.009  31.814 50.186 1.00 88.24  ? 346 THR B CB    1 
ATOM   2038 O  OG1   . THR B 1 105 ? -7.028  32.806 50.363 1.00 87.37  ? 346 THR B OG1   1 
ATOM   2039 C  CG2   . THR B 1 105 ? -4.641  32.489 50.204 1.00 78.31  ? 346 THR B CG2   1 
ATOM   2040 N  N     . LYS B 1 106 ? -6.083  28.659 49.116 1.00 88.93  ? 347 LYS B N     1 
ATOM   2041 C  CA    . LYS B 1 106 ? -5.420  27.361 49.137 1.00 93.42  ? 347 LYS B CA    1 
ATOM   2042 C  C     . LYS B 1 106 ? -5.413  26.716 47.755 1.00 93.44  ? 347 LYS B C     1 
ATOM   2043 O  O     . LYS B 1 106 ? -4.586  25.848 47.469 1.00 99.15  ? 347 LYS B O     1 
ATOM   2044 C  CB    . LYS B 1 106 ? -6.093  26.439 50.154 1.00 90.18  ? 347 LYS B CB    1 
ATOM   2045 C  CG    . LYS B 1 106 ? -7.605  26.547 50.174 1.00 93.99  ? 347 LYS B CG    1 
ATOM   2046 C  CD    . LYS B 1 106 ? -8.156  26.093 51.515 1.00 94.04  ? 347 LYS B CD    1 
ATOM   2047 C  CE    . LYS B 1 106 ? -9.637  26.399 51.634 1.00 82.71  ? 347 LYS B CE    1 
ATOM   2048 N  NZ    . LYS B 1 106 ? -10.084 26.358 53.051 1.00 78.70  ? 347 LYS B NZ    1 
ATOM   2049 N  N     . THR B 1 107 ? -6.338  27.143 46.902 1.00 91.84  ? 348 THR B N     1 
ATOM   2050 C  CA    . THR B 1 107 ? -6.343  26.707 45.513 1.00 91.38  ? 348 THR B CA    1 
ATOM   2051 C  C     . THR B 1 107 ? -5.309  27.523 44.738 1.00 86.02  ? 348 THR B C     1 
ATOM   2052 O  O     . THR B 1 107 ? -4.728  27.051 43.761 1.00 86.54  ? 348 THR B O     1 
ATOM   2053 C  CB    . THR B 1 107 ? -7.743  26.848 44.873 1.00 82.17  ? 348 THR B CB    1 
ATOM   2054 O  OG1   . THR B 1 107 ? -8.639  25.913 45.485 1.00 88.47  ? 348 THR B OG1   1 
ATOM   2055 C  CG2   . THR B 1 107 ? -7.692  26.560 43.378 1.00 73.06  ? 348 THR B CG2   1 
ATOM   2056 N  N     . ALA B 1 108 ? -5.062  28.744 45.201 1.00 83.21  ? 349 ALA B N     1 
ATOM   2057 C  CA    . ALA B 1 108 ? -4.060  29.603 44.585 1.00 87.27  ? 349 ALA B CA    1 
ATOM   2058 C  C     . ALA B 1 108 ? -2.672  28.990 44.700 1.00 91.78  ? 349 ALA B C     1 
ATOM   2059 O  O     . ALA B 1 108 ? -1.806  29.212 43.857 1.00 94.48  ? 349 ALA B O     1 
ATOM   2060 C  CB    . ALA B 1 108 ? -4.075  30.975 45.221 1.00 81.04  ? 349 ALA B CB    1 
ATOM   2061 N  N     . GLN B 1 109 ? -2.462  28.219 45.759 1.00 93.83  ? 350 GLN B N     1 
ATOM   2062 C  CA    . GLN B 1 109 ? -1.144  27.642 46.007 1.00 94.25  ? 350 GLN B CA    1 
ATOM   2063 C  C     . GLN B 1 109 ? -0.844  26.417 45.199 1.00 93.03  ? 350 GLN B C     1 
ATOM   2064 O  O     . GLN B 1 109 ? 0.285   26.217 44.754 1.00 92.29  ? 350 GLN B O     1 
ATOM   2065 C  CB    . GLN B 1 109 ? -0.958  27.309 47.488 1.00 96.67  ? 350 GLN B CB    1 
ATOM   2066 C  CG    . GLN B 1 109 ? -0.892  28.515 48.386 1.00 95.61  ? 350 GLN B CG    1 
ATOM   2067 C  CD    . GLN B 1 109 ? -0.702  29.744 47.602 1.00 103.11 ? 350 GLN B CD    1 
ATOM   2068 O  OE1   . GLN B 1 109 ? -1.642  30.543 47.415 1.00 100.81 ? 350 GLN B OE1   1 
ATOM   2069 N  NE2   . GLN B 1 109 ? 0.553   29.899 47.058 1.00 104.17 ? 350 GLN B NE2   1 
ATOM   2070 N  N     . MET B 1 110 ? -1.854  25.576 45.057 1.00 90.29  ? 351 MET B N     1 
ATOM   2071 C  CA    . MET B 1 110 ? -1.704  24.353 44.306 1.00 95.41  ? 351 MET B CA    1 
ATOM   2072 C  C     . MET B 1 110 ? -1.444  24.685 42.830 1.00 93.66  ? 351 MET B C     1 
ATOM   2073 O  O     . MET B 1 110 ? -0.886  23.875 42.091 1.00 89.98  ? 351 MET B O     1 
ATOM   2074 C  CB    . MET B 1 110 ? -2.937  23.475 44.491 1.00 90.87  ? 351 MET B CB    1 
ATOM   2075 C  CG    . MET B 1 110 ? -3.992  23.646 43.428 1.00 97.75  ? 351 MET B CG    1 
ATOM   2076 S  SD    . MET B 1 110 ? -5.284  22.422 43.671 1.00 126.73 ? 351 MET B SD    1 
ATOM   2077 C  CE    . MET B 1 110 ? -6.096  23.071 45.132 1.00 102.95 ? 351 MET B CE    1 
ATOM   2078 N  N     . TRP B 1 111 ? -1.817  25.895 42.419 1.00 94.07  ? 352 TRP B N     1 
ATOM   2079 C  CA    . TRP B 1 111 ? -1.444  26.403 41.100 1.00 92.38  ? 352 TRP B CA    1 
ATOM   2080 C  C     . TRP B 1 111 ? -0.006  26.917 41.107 1.00 92.03  ? 352 TRP B C     1 
ATOM   2081 O  O     . TRP B 1 111 ? 0.701   26.829 40.102 1.00 89.22  ? 352 TRP B O     1 
ATOM   2082 C  CB    . TRP B 1 111 ? -2.394  27.515 40.648 1.00 84.67  ? 352 TRP B CB    1 
ATOM   2083 C  CG    . TRP B 1 111 ? -3.704  27.020 40.110 1.00 81.46  ? 352 TRP B CG    1 
ATOM   2084 C  CD1   . TRP B 1 111 ? -3.970  25.778 39.605 1.00 79.78  ? 352 TRP B CD1   1 
ATOM   2085 C  CD2   . TRP B 1 111 ? -4.929  27.759 40.024 1.00 76.15  ? 352 TRP B CD2   1 
ATOM   2086 N  NE1   . TRP B 1 111 ? -5.285  25.699 39.211 1.00 74.44  ? 352 TRP B NE1   1 
ATOM   2087 C  CE2   . TRP B 1 111 ? -5.896  26.901 39.458 1.00 71.49  ? 352 TRP B CE2   1 
ATOM   2088 C  CE3   . TRP B 1 111 ? -5.304  29.061 40.372 1.00 66.50  ? 352 TRP B CE3   1 
ATOM   2089 C  CZ2   . TRP B 1 111 ? -7.211  27.304 39.235 1.00 62.13  ? 352 TRP B CZ2   1 
ATOM   2090 C  CZ3   . TRP B 1 111 ? -6.608  29.458 40.148 1.00 65.26  ? 352 TRP B CZ3   1 
ATOM   2091 C  CH2   . TRP B 1 111 ? -7.546  28.583 39.585 1.00 64.12  ? 352 TRP B CH2   1 
ATOM   2092 N  N     . TYR B 1 112 ? 0.414   27.456 42.248 1.00 92.83  ? 353 TYR B N     1 
ATOM   2093 C  CA    . TYR B 1 112 ? 1.776   27.953 42.423 1.00 97.13  ? 353 TYR B CA    1 
ATOM   2094 C  C     . TYR B 1 112 ? 2.767   26.791 42.464 1.00 94.98  ? 353 TYR B C     1 
ATOM   2095 O  O     . TYR B 1 112 ? 3.951   26.957 42.168 1.00 88.65  ? 353 TYR B O     1 
ATOM   2096 C  CB    . TYR B 1 112 ? 1.873   28.786 43.704 1.00 93.56  ? 353 TYR B CB    1 
ATOM   2097 C  CG    . TYR B 1 112 ? 3.042   29.746 43.752 1.00 94.71  ? 353 TYR B CG    1 
ATOM   2098 C  CD1   . TYR B 1 112 ? 4.147   29.489 44.554 1.00 98.55  ? 353 TYR B CD1   1 
ATOM   2099 C  CD2   . TYR B 1 112 ? 3.035   30.914 43.003 1.00 92.73  ? 353 TYR B CD2   1 
ATOM   2100 C  CE1   . TYR B 1 112 ? 5.215   30.370 44.605 1.00 99.02  ? 353 TYR B CE1   1 
ATOM   2101 C  CE2   . TYR B 1 112 ? 4.096   31.796 43.046 1.00 96.93  ? 353 TYR B CE2   1 
ATOM   2102 C  CZ    . TYR B 1 112 ? 5.184   31.523 43.848 1.00 99.95  ? 353 TYR B CZ    1 
ATOM   2103 O  OH    . TYR B 1 112 ? 6.241   32.405 43.891 1.00 95.65  ? 353 TYR B OH    1 
ATOM   2104 N  N     . GLN B 1 113 ? 2.262   25.615 42.830 1.00 96.00  ? 354 GLN B N     1 
ATOM   2105 C  CA    . GLN B 1 113 ? 3.066   24.397 42.891 1.00 95.71  ? 354 GLN B CA    1 
ATOM   2106 C  C     . GLN B 1 113 ? 3.192   23.739 41.519 1.00 95.60  ? 354 GLN B C     1 
ATOM   2107 O  O     . GLN B 1 113 ? 3.708   22.627 41.402 1.00 95.91  ? 354 GLN B O     1 
ATOM   2108 C  CB    . GLN B 1 113 ? 2.459   23.402 43.889 1.00 97.32  ? 354 GLN B CB    1 
ATOM   2109 C  CG    . GLN B 1 113 ? 2.326   23.932 45.314 1.00 99.21  ? 354 GLN B CG    1 
ATOM   2110 C  CD    . GLN B 1 113 ? 1.526   23.007 46.218 1.00 102.88 ? 354 GLN B CD    1 
ATOM   2111 O  OE1   . GLN B 1 113 ? 1.074   21.941 45.793 1.00 104.20 ? 354 GLN B OE1   1 
ATOM   2112 N  NE2   . GLN B 1 113 ? 1.335   23.419 47.469 1.00 89.37  ? 354 GLN B NE2   1 
ATOM   2113 N  N     . GLN B 1 114 ? 2.715   24.426 40.485 1.00 94.67  ? 355 GLN B N     1 
ATOM   2114 C  CA    . GLN B 1 114 ? 2.767   23.899 39.125 1.00 90.85  ? 355 GLN B CA    1 
ATOM   2115 C  C     . GLN B 1 114 ? 3.587   24.802 38.208 1.00 88.72  ? 355 GLN B C     1 
ATOM   2116 O  O     . GLN B 1 114 ? 3.767   24.502 37.026 1.00 86.04  ? 355 GLN B O     1 
ATOM   2117 C  CB    . GLN B 1 114 ? 1.356   23.724 38.563 1.00 88.71  ? 355 GLN B CB    1 
ATOM   2118 C  CG    . GLN B 1 114 ? 0.450   22.852 39.414 1.00 87.67  ? 355 GLN B CG    1 
ATOM   2119 C  CD    . GLN B 1 114 ? -0.928  22.685 38.808 1.00 83.27  ? 355 GLN B CD    1 
ATOM   2120 O  OE1   . GLN B 1 114 ? -1.066  22.225 37.675 1.00 92.98  ? 355 GLN B OE1   1 
ATOM   2121 N  NE2   . GLN B 1 114 ? -1.957  23.068 39.556 1.00 76.63  ? 355 GLN B NE2   1 
ATOM   2122 N  N     . GLY B 1 115 ? 4.077   25.909 38.756 1.00 87.03  ? 356 GLY B N     1 
ATOM   2123 C  CA    . GLY B 1 115 ? 4.957   26.800 38.021 1.00 89.22  ? 356 GLY B CA    1 
ATOM   2124 C  C     . GLY B 1 115 ? 4.256   27.992 37.397 1.00 93.67  ? 356 GLY B C     1 
ATOM   2125 O  O     . GLY B 1 115 ? 4.887   28.818 36.734 1.00 89.05  ? 356 GLY B O     1 
ATOM   2126 N  N     . PHE B 1 116 ? 2.947   28.085 37.610 1.00 93.09  ? 357 PHE B N     1 
ATOM   2127 C  CA    . PHE B 1 116 ? 2.159   29.172 37.042 1.00 86.05  ? 357 PHE B CA    1 
ATOM   2128 C  C     . PHE B 1 116 ? 2.443   30.469 37.788 1.00 85.57  ? 357 PHE B C     1 
ATOM   2129 O  O     . PHE B 1 116 ? 2.316   30.529 39.012 1.00 88.07  ? 357 PHE B O     1 
ATOM   2130 C  CB    . PHE B 1 116 ? 0.666   28.843 37.094 1.00 82.82  ? 357 PHE B CB    1 
ATOM   2131 C  CG    . PHE B 1 116 ? 0.316   27.500 36.513 1.00 79.18  ? 357 PHE B CG    1 
ATOM   2132 C  CD1   . PHE B 1 116 ? 1.044   26.970 35.461 1.00 82.40  ? 357 PHE B CD1   1 
ATOM   2133 C  CD2   . PHE B 1 116 ? -0.741  26.765 37.024 1.00 79.79  ? 357 PHE B CD2   1 
ATOM   2134 C  CE1   . PHE B 1 116 ? 0.724   25.734 34.932 1.00 86.45  ? 357 PHE B CE1   1 
ATOM   2135 C  CE2   . PHE B 1 116 ? -1.068  25.529 36.497 1.00 76.16  ? 357 PHE B CE2   1 
ATOM   2136 C  CZ    . PHE B 1 116 ? -0.336  25.013 35.451 1.00 78.83  ? 357 PHE B CZ    1 
ATOM   2137 N  N     . ARG B 1 117 ? 2.833   31.503 37.050 1.00 83.49  ? 358 ARG B N     1 
ATOM   2138 C  CA    . ARG B 1 117 ? 3.201   32.775 37.662 1.00 87.81  ? 358 ARG B CA    1 
ATOM   2139 C  C     . ARG B 1 117 ? 2.504   33.959 36.998 1.00 87.36  ? 358 ARG B C     1 
ATOM   2140 O  O     . ARG B 1 117 ? 2.972   35.094 37.096 1.00 90.93  ? 358 ARG B O     1 
ATOM   2141 C  CB    . ARG B 1 117 ? 4.719   32.974 37.605 1.00 92.97  ? 358 ARG B CB    1 
ATOM   2142 C  CG    . ARG B 1 117 ? 5.529   31.883 38.295 1.00 91.92  ? 358 ARG B CG    1 
ATOM   2143 C  CD    . ARG B 1 117 ? 5.448   31.999 39.809 1.00 92.38  ? 358 ARG B CD    1 
ATOM   2144 N  NE    . ARG B 1 117 ? 6.242   30.971 40.478 1.00 92.41  ? 358 ARG B NE    1 
ATOM   2145 C  CZ    . ARG B 1 117 ? 5.778   29.773 40.821 1.00 90.51  ? 358 ARG B CZ    1 
ATOM   2146 N  NH1   . ARG B 1 117 ? 4.520   29.445 40.559 1.00 91.71  ? 358 ARG B NH1   1 
ATOM   2147 N  NH2   . ARG B 1 117 ? 6.572   28.900 41.425 1.00 87.01  ? 358 ARG B NH2   1 
ATOM   2148 N  N     . SER B 1 118 ? 1.390   33.695 36.324 1.00 86.17  ? 359 SER B N     1 
ATOM   2149 C  CA    . SER B 1 118 ? 0.631   34.755 35.664 1.00 87.56  ? 359 SER B CA    1 
ATOM   2150 C  C     . SER B 1 118 ? -0.818  34.344 35.429 1.00 86.50  ? 359 SER B C     1 
ATOM   2151 O  O     . SER B 1 118 ? -1.221  33.229 35.763 1.00 81.78  ? 359 SER B O     1 
ATOM   2152 C  CB    . SER B 1 118 ? 1.278   35.135 34.331 1.00 85.73  ? 359 SER B CB    1 
ATOM   2153 O  OG    . SER B 1 118 ? 1.033   34.143 33.346 1.00 86.51  ? 359 SER B OG    1 
ATOM   2154 N  N     . LEU B 1 119 ? -1.597  35.249 34.848 1.00 82.22  ? 360 LEU B N     1 
ATOM   2155 C  CA    . LEU B 1 119 ? -2.983  34.948 34.524 1.00 77.43  ? 360 LEU B CA    1 
ATOM   2156 C  C     . LEU B 1 119 ? -3.057  34.115 33.252 1.00 71.73  ? 360 LEU B C     1 
ATOM   2157 O  O     . LEU B 1 119 ? -3.916  33.245 33.120 1.00 73.43  ? 360 LEU B O     1 
ATOM   2158 C  CB    . LEU B 1 119 ? -3.797  36.235 34.367 1.00 82.02  ? 360 LEU B CB    1 
ATOM   2159 C  CG    . LEU B 1 119 ? -3.975  37.102 35.617 1.00 77.95  ? 360 LEU B CG    1 
ATOM   2160 C  CD1   . LEU B 1 119 ? -4.897  38.282 35.330 1.00 60.89  ? 360 LEU B CD1   1 
ATOM   2161 C  CD2   . LEU B 1 119 ? -4.498  36.274 36.786 1.00 65.61  ? 360 LEU B CD2   1 
ATOM   2162 N  N     . GLU B 1 120 ? -2.146  34.382 32.322 1.00 73.96  ? 361 GLU B N     1 
ATOM   2163 C  CA    . GLU B 1 120 ? -2.120  33.662 31.056 1.00 78.85  ? 361 GLU B CA    1 
ATOM   2164 C  C     . GLU B 1 120 ? -1.798  32.189 31.287 1.00 77.83  ? 361 GLU B C     1 
ATOM   2165 O  O     . GLU B 1 120 ? -2.442  31.304 30.720 1.00 70.97  ? 361 GLU B O     1 
ATOM   2166 C  CB    . GLU B 1 120 ? -1.101  34.285 30.097 1.00 80.08  ? 361 GLU B CB    1 
ATOM   2167 C  CG    . GLU B 1 120 ? -1.499  34.206 28.627 1.00 79.59  ? 361 GLU B CG    1 
ATOM   2168 C  CD    . GLU B 1 120 ? -2.616  35.177 28.268 1.00 89.15  ? 361 GLU B CD    1 
ATOM   2169 O  OE1   . GLU B 1 120 ? -2.373  36.405 28.296 1.00 85.58  ? 361 GLU B OE1   1 
ATOM   2170 O  OE2   . GLU B 1 120 ? -3.738  34.714 27.963 1.00 79.85  ? 361 GLU B OE2   1 
ATOM   2171 N  N     . ASP B 1 121 ? -0.803  31.935 32.130 1.00 75.13  ? 362 ASP B N     1 
ATOM   2172 C  CA    . ASP B 1 121 ? -0.408  30.571 32.452 1.00 78.41  ? 362 ASP B CA    1 
ATOM   2173 C  C     . ASP B 1 121 ? -1.572  29.803 33.070 1.00 78.32  ? 362 ASP B C     1 
ATOM   2174 O  O     . ASP B 1 121 ? -1.815  28.648 32.723 1.00 78.90  ? 362 ASP B O     1 
ATOM   2175 C  CB    . ASP B 1 121 ? 0.795   30.568 33.396 1.00 83.11  ? 362 ASP B CB    1 
ATOM   2176 C  CG    . ASP B 1 121 ? 1.972   31.343 32.838 1.00 82.82  ? 362 ASP B CG    1 
ATOM   2177 O  OD1   . ASP B 1 121 ? 1.903   31.766 31.665 1.00 78.31  ? 362 ASP B OD1   1 
ATOM   2178 O  OD2   . ASP B 1 121 ? 2.966   31.528 33.572 1.00 83.30  ? 362 ASP B OD2   1 
ATOM   2179 N  N     . ILE B 1 122 ? -2.297  30.456 33.974 1.00 74.26  ? 363 ILE B N     1 
ATOM   2180 C  CA    . ILE B 1 122 ? -3.461  29.848 34.612 1.00 77.37  ? 363 ILE B CA    1 
ATOM   2181 C  C     . ILE B 1 122 ? -4.554  29.535 33.593 1.00 75.75  ? 363 ILE B C     1 
ATOM   2182 O  O     . ILE B 1 122 ? -5.182  28.474 33.637 1.00 74.43  ? 363 ILE B O     1 
ATOM   2183 C  CB    . ILE B 1 122 ? -4.045  30.763 35.707 1.00 77.72  ? 363 ILE B CB    1 
ATOM   2184 C  CG1   . ILE B 1 122 ? -3.074  30.877 36.882 1.00 82.94  ? 363 ILE B CG1   1 
ATOM   2185 C  CG2   . ILE B 1 122 ? -5.378  30.226 36.201 1.00 70.17  ? 363 ILE B CG2   1 
ATOM   2186 C  CD1   . ILE B 1 122 ? -2.848  29.572 37.609 1.00 82.28  ? 363 ILE B CD1   1 
ATOM   2187 N  N     . ARG B 1 123 ? -4.757  30.460 32.663 1.00 69.99  ? 364 ARG B N     1 
ATOM   2188 C  CA    . ARG B 1 123 ? -5.849  30.368 31.703 1.00 72.60  ? 364 ARG B CA    1 
ATOM   2189 C  C     . ARG B 1 123 ? -5.653  29.262 30.660 1.00 72.96  ? 364 ARG B C     1 
ATOM   2190 O  O     . ARG B 1 123 ? -6.626  28.719 30.135 1.00 72.22  ? 364 ARG B O     1 
ATOM   2191 C  CB    . ARG B 1 123 ? -6.029  31.719 31.003 1.00 68.75  ? 364 ARG B CB    1 
ATOM   2192 C  CG    . ARG B 1 123 ? -7.397  31.936 30.378 1.00 63.52  ? 364 ARG B CG    1 
ATOM   2193 C  CD    . ARG B 1 123 ? -7.504  33.335 29.789 1.00 71.41  ? 364 ARG B CD    1 
ATOM   2194 N  NE    . ARG B 1 123 ? -7.424  34.381 30.808 1.00 69.58  ? 364 ARG B NE    1 
ATOM   2195 C  CZ    . ARG B 1 123 ? -7.004  35.622 30.577 1.00 67.64  ? 364 ARG B CZ    1 
ATOM   2196 N  NH1   . ARG B 1 123 ? -6.965  36.510 31.561 1.00 64.33  ? 364 ARG B NH1   1 
ATOM   2197 N  NH2   . ARG B 1 123 ? -6.615  35.974 29.360 1.00 76.08  ? 364 ARG B NH2   1 
ATOM   2198 N  N     . SER B 1 124 ? -4.405  28.918 30.363 1.00 77.41  ? 365 SER B N     1 
ATOM   2199 C  CA    . SER B 1 124 ? -4.131  28.006 29.254 1.00 79.62  ? 365 SER B CA    1 
ATOM   2200 C  C     . SER B 1 124 ? -3.532  26.667 29.680 1.00 79.35  ? 365 SER B C     1 
ATOM   2201 O  O     . SER B 1 124 ? -3.480  25.728 28.884 1.00 74.05  ? 365 SER B O     1 
ATOM   2202 C  CB    . SER B 1 124 ? -3.197  28.677 28.244 1.00 75.89  ? 365 SER B CB    1 
ATOM   2203 O  OG    . SER B 1 124 ? -1.937  28.958 28.829 1.00 76.75  ? 365 SER B OG    1 
ATOM   2204 N  N     . GLN B 1 125 ? -3.082  26.573 30.927 1.00 78.37  ? 366 GLN B N     1 
ATOM   2205 C  CA    . GLN B 1 125 ? -2.390  25.371 31.383 1.00 78.96  ? 366 GLN B CA    1 
ATOM   2206 C  C     . GLN B 1 125 ? -3.168  24.578 32.428 1.00 76.48  ? 366 GLN B C     1 
ATOM   2207 O  O     . GLN B 1 125 ? -3.161  23.346 32.414 1.00 73.17  ? 366 GLN B O     1 
ATOM   2208 C  CB    . GLN B 1 125 ? -1.014  25.738 31.943 1.00 80.28  ? 366 GLN B CB    1 
ATOM   2209 C  CG    . GLN B 1 125 ? 0.047   25.993 30.887 1.00 80.32  ? 366 GLN B CG    1 
ATOM   2210 C  CD    . GLN B 1 125 ? 0.504   24.716 30.211 1.00 80.94  ? 366 GLN B CD    1 
ATOM   2211 O  OE1   . GLN B 1 125 ? -0.077  24.284 29.215 1.00 77.25  ? 366 GLN B OE1   1 
ATOM   2212 N  NE2   . GLN B 1 125 ? 1.548   24.100 30.756 1.00 83.80  ? 366 GLN B NE2   1 
ATOM   2213 N  N     . ALA B 1 126 ? -3.838  25.283 33.334 1.00 77.72  ? 367 ALA B N     1 
ATOM   2214 C  CA    . ALA B 1 126 ? -4.474  24.638 34.478 1.00 76.85  ? 367 ALA B CA    1 
ATOM   2215 C  C     . ALA B 1 126 ? -5.851  24.076 34.147 1.00 70.17  ? 367 ALA B C     1 
ATOM   2216 O  O     . ALA B 1 126 ? -6.505  24.514 33.201 1.00 68.05  ? 367 ALA B O     1 
ATOM   2217 C  CB    . ALA B 1 126 ? -4.575  25.616 35.640 1.00 74.93  ? 367 ALA B CB    1 
ATOM   2218 N  N     . SER B 1 127 ? -6.278  23.091 34.932 1.00 72.09  ? 368 SER B N     1 
ATOM   2219 C  CA    . SER B 1 127 ? -7.649  22.605 34.873 1.00 67.06  ? 368 SER B CA    1 
ATOM   2220 C  C     . SER B 1 127 ? -8.510  23.516 35.734 1.00 64.71  ? 368 SER B C     1 
ATOM   2221 O  O     . SER B 1 127 ? -8.180  23.774 36.890 1.00 64.39  ? 368 SER B O     1 
ATOM   2222 C  CB    . SER B 1 127 ? -7.743  21.156 35.351 1.00 57.42  ? 368 SER B CB    1 
ATOM   2223 O  OG    . SER B 1 127 ? -9.090  20.717 35.370 1.00 55.54  ? 368 SER B OG    1 
ATOM   2224 N  N     . LEU B 1 128 ? -9.605  24.012 35.169 1.00 66.82  ? 369 LEU B N     1 
ATOM   2225 C  CA    . LEU B 1 128 ? -10.425 25.007 35.854 1.00 63.73  ? 369 LEU B CA    1 
ATOM   2226 C  C     . LEU B 1 128 ? -11.869 24.554 36.025 1.00 58.89  ? 369 LEU B C     1 
ATOM   2227 O  O     . LEU B 1 128 ? -12.366 23.720 35.268 1.00 55.00  ? 369 LEU B O     1 
ATOM   2228 C  CB    . LEU B 1 128 ? -10.396 26.332 35.089 1.00 63.81  ? 369 LEU B CB    1 
ATOM   2229 C  CG    . LEU B 1 128 ? -9.025  26.824 34.622 1.00 67.79  ? 369 LEU B CG    1 
ATOM   2230 C  CD1   . LEU B 1 128 ? -9.161  28.088 33.790 1.00 61.11  ? 369 LEU B CD1   1 
ATOM   2231 C  CD2   . LEU B 1 128 ? -8.106  27.058 35.810 1.00 70.56  ? 369 LEU B CD2   1 
ATOM   2232 N  N     . THR B 1 129 ? -12.542 25.104 37.028 1.00 57.75  ? 370 THR B N     1 
ATOM   2233 C  CA    . THR B 1 129 ? -13.973 24.889 37.158 1.00 64.53  ? 370 THR B CA    1 
ATOM   2234 C  C     . THR B 1 129 ? -14.681 25.956 36.333 1.00 63.69  ? 370 THR B C     1 
ATOM   2235 O  O     . THR B 1 129 ? -14.071 26.963 35.969 1.00 64.08  ? 370 THR B O     1 
ATOM   2236 C  CB    . THR B 1 129 ? -14.445 24.942 38.625 1.00 59.89  ? 370 THR B CB    1 
ATOM   2237 O  OG1   . THR B 1 129 ? -15.807 24.506 38.707 1.00 73.65  ? 370 THR B OG1   1 
ATOM   2238 C  CG2   . THR B 1 129 ? -14.344 26.348 39.172 1.00 51.62  ? 370 THR B CG2   1 
ATOM   2239 N  N     . THR B 1 130 ? -15.954 25.725 36.026 1.00 63.21  ? 371 THR B N     1 
ATOM   2240 C  CA    . THR B 1 130 ? -16.747 26.664 35.238 1.00 60.67  ? 371 THR B CA    1 
ATOM   2241 C  C     . THR B 1 130 ? -16.659 28.079 35.801 1.00 59.13  ? 371 THR B C     1 
ATOM   2242 O  O     . THR B 1 130 ? -16.450 29.038 35.060 1.00 61.13  ? 371 THR B O     1 
ATOM   2243 C  CB    . THR B 1 130 ? -18.224 26.229 35.172 1.00 64.99  ? 371 THR B CB    1 
ATOM   2244 O  OG1   . THR B 1 130 ? -18.361 25.156 34.233 1.00 67.19  ? 371 THR B OG1   1 
ATOM   2245 C  CG2   . THR B 1 130 ? -19.111 27.384 34.734 1.00 57.57  ? 371 THR B CG2   1 
ATOM   2246 N  N     . GLN B 1 131 ? -16.792 28.197 37.117 1.00 58.89  ? 372 GLN B N     1 
ATOM   2247 C  CA    . GLN B 1 131 ? -16.710 29.492 37.780 1.00 59.32  ? 372 GLN B CA    1 
ATOM   2248 C  C     . GLN B 1 131 ? -15.349 30.152 37.583 1.00 57.99  ? 372 GLN B C     1 
ATOM   2249 O  O     . GLN B 1 131 ? -15.265 31.345 37.292 1.00 54.99  ? 372 GLN B O     1 
ATOM   2250 C  CB    . GLN B 1 131 ? -16.996 29.346 39.273 1.00 59.25  ? 372 GLN B CB    1 
ATOM   2251 C  CG    . GLN B 1 131 ? -16.841 30.634 40.050 1.00 59.71  ? 372 GLN B CG    1 
ATOM   2252 C  CD    . GLN B 1 131 ? -17.384 30.526 41.455 1.00 65.51  ? 372 GLN B CD    1 
ATOM   2253 O  OE1   . GLN B 1 131 ? -17.839 29.462 41.878 1.00 68.73  ? 372 GLN B OE1   1 
ATOM   2254 N  NE2   . GLN B 1 131 ? -17.334 31.630 42.192 1.00 61.79  ? 372 GLN B NE2   1 
ATOM   2255 N  N     . GLN B 1 132 ? -14.287 29.373 37.750 1.00 57.88  ? 373 GLN B N     1 
ATOM   2256 C  CA    . GLN B 1 132 ? -12.932 29.894 37.614 1.00 61.66  ? 373 GLN B CA    1 
ATOM   2257 C  C     . GLN B 1 132 ? -12.668 30.408 36.202 1.00 58.58  ? 373 GLN B C     1 
ATOM   2258 O  O     . GLN B 1 132 ? -11.969 31.406 36.016 1.00 48.88  ? 373 GLN B O     1 
ATOM   2259 C  CB    . GLN B 1 132 ? -11.912 28.819 37.986 1.00 66.17  ? 373 GLN B CB    1 
ATOM   2260 C  CG    . GLN B 1 132 ? -11.731 28.632 39.480 1.00 62.79  ? 373 GLN B CG    1 
ATOM   2261 C  CD    . GLN B 1 132 ? -11.054 27.321 39.818 1.00 63.02  ? 373 GLN B CD    1 
ATOM   2262 O  OE1   . GLN B 1 132 ? -11.118 26.359 39.050 1.00 61.08  ? 373 GLN B OE1   1 
ATOM   2263 N  NE2   . GLN B 1 132 ? -10.393 27.278 40.968 1.00 60.44  ? 373 GLN B NE2   1 
ATOM   2264 N  N     . ALA B 1 133 ? -13.235 29.719 35.214 1.00 59.16  ? 374 ALA B N     1 
ATOM   2265 C  CA    . ALA B 1 133 ? -13.122 30.127 33.818 1.00 55.16  ? 374 ALA B CA    1 
ATOM   2266 C  C     . ALA B 1 133 ? -13.721 31.513 33.611 1.00 54.63  ? 374 ALA B C     1 
ATOM   2267 O  O     . ALA B 1 133 ? -13.110 32.374 32.974 1.00 52.58  ? 374 ALA B O     1 
ATOM   2268 C  CB    . ALA B 1 133 ? -13.801 29.116 32.911 1.00 52.20  ? 374 ALA B CB    1 
ATOM   2269 N  N     . ILE B 1 134 ? -14.918 31.720 34.157 1.00 52.48  ? 375 ILE B N     1 
ATOM   2270 C  CA    . ILE B 1 134 ? -15.589 33.013 34.085 1.00 47.53  ? 375 ILE B CA    1 
ATOM   2271 C  C     . ILE B 1 134 ? -14.824 34.066 34.887 1.00 49.56  ? 375 ILE B C     1 
ATOM   2272 O  O     . ILE B 1 134 ? -14.803 35.242 34.525 1.00 49.12  ? 375 ILE B O     1 
ATOM   2273 C  CB    . ILE B 1 134 ? -17.040 32.931 34.607 1.00 46.55  ? 375 ILE B CB    1 
ATOM   2274 C  CG1   . ILE B 1 134 ? -17.796 31.781 33.943 1.00 47.90  ? 375 ILE B CG1   1 
ATOM   2275 C  CG2   . ILE B 1 134 ? -17.773 34.239 34.359 1.00 47.57  ? 375 ILE B CG2   1 
ATOM   2276 C  CD1   . ILE B 1 134 ? -18.064 31.992 32.470 1.00 59.38  ? 375 ILE B CD1   1 
ATOM   2277 N  N     . GLY B 1 135 ? -14.193 33.635 35.975 1.00 49.95  ? 376 GLY B N     1 
ATOM   2278 C  CA    . GLY B 1 135 ? -13.438 34.538 36.826 1.00 50.66  ? 376 GLY B CA    1 
ATOM   2279 C  C     . GLY B 1 135 ? -12.252 35.154 36.109 1.00 54.60  ? 376 GLY B C     1 
ATOM   2280 O  O     . GLY B 1 135 ? -11.924 36.322 36.320 1.00 49.16  ? 376 GLY B O     1 
ATOM   2281 N  N     . LEU B 1 136 ? -11.604 34.360 35.260 1.00 56.33  ? 377 LEU B N     1 
ATOM   2282 C  CA    . LEU B 1 136 ? -10.472 34.838 34.475 1.00 51.19  ? 377 LEU B CA    1 
ATOM   2283 C  C     . LEU B 1 136 ? -10.951 35.708 33.324 1.00 49.43  ? 377 LEU B C     1 
ATOM   2284 O  O     . LEU B 1 136 ? -10.302 36.689 32.960 1.00 52.35  ? 377 LEU B O     1 
ATOM   2285 C  CB    . LEU B 1 136 ? -9.649  33.664 33.942 1.00 50.87  ? 377 LEU B CB    1 
ATOM   2286 C  CG    . LEU B 1 136 ? -8.774  32.920 34.951 1.00 55.16  ? 377 LEU B CG    1 
ATOM   2287 C  CD1   . LEU B 1 136 ? -8.267  31.613 34.365 1.00 56.12  ? 377 LEU B CD1   1 
ATOM   2288 C  CD2   . LEU B 1 136 ? -7.612  33.801 35.380 1.00 57.03  ? 377 LEU B CD2   1 
ATOM   2289 N  N     . LYS B 1 137 ? -12.097 35.339 32.762 1.00 41.11  ? 378 LYS B N     1 
ATOM   2290 C  CA    . LYS B 1 137 ? -12.660 36.042 31.618 1.00 43.76  ? 378 LYS B CA    1 
ATOM   2291 C  C     . LYS B 1 137 ? -13.006 37.489 31.961 1.00 47.91  ? 378 LYS B C     1 
ATOM   2292 O  O     . LYS B 1 137 ? -12.792 38.397 31.158 1.00 50.37  ? 378 LYS B O     1 
ATOM   2293 C  CB    . LYS B 1 137 ? -13.901 35.307 31.114 1.00 40.19  ? 378 LYS B CB    1 
ATOM   2294 C  CG    . LYS B 1 137 ? -14.537 35.916 29.885 1.00 40.58  ? 378 LYS B CG    1 
ATOM   2295 C  CD    . LYS B 1 137 ? -15.776 35.135 29.481 1.00 44.26  ? 378 LYS B CD    1 
ATOM   2296 C  CE    . LYS B 1 137 ? -16.468 35.765 28.283 1.00 42.29  ? 378 LYS B CE    1 
ATOM   2297 N  NZ    . LYS B 1 137 ? -17.600 34.925 27.810 1.00 45.80  ? 378 LYS B NZ    1 
ATOM   2298 N  N     . HIS B 1 138 ? -13.533 37.694 33.163 1.00 49.57  ? 379 HIS B N     1 
ATOM   2299 C  CA    . HIS B 1 138 ? -13.946 39.018 33.607 1.00 43.77  ? 379 HIS B CA    1 
ATOM   2300 C  C     . HIS B 1 138 ? -13.125 39.478 34.809 1.00 51.22  ? 379 HIS B C     1 
ATOM   2301 O  O     . HIS B 1 138 ? -13.645 40.156 35.699 1.00 48.65  ? 379 HIS B O     1 
ATOM   2302 C  CB    . HIS B 1 138 ? -15.435 39.023 33.963 1.00 38.63  ? 379 HIS B CB    1 
ATOM   2303 C  CG    . HIS B 1 138 ? -16.321 38.455 32.898 1.00 41.59  ? 379 HIS B CG    1 
ATOM   2304 N  ND1   . HIS B 1 138 ? -16.128 38.699 31.555 1.00 44.31  ? 379 HIS B ND1   1 
ATOM   2305 C  CD2   . HIS B 1 138 ? -17.413 37.658 32.980 1.00 41.22  ? 379 HIS B CD2   1 
ATOM   2306 C  CE1   . HIS B 1 138 ? -17.060 38.075 30.857 1.00 43.47  ? 379 HIS B CE1   1 
ATOM   2307 N  NE2   . HIS B 1 138 ? -17.855 37.438 31.698 1.00 40.38  ? 379 HIS B NE2   1 
ATOM   2308 N  N     . TYR B 1 139 ? -11.844 39.113 34.824 1.00 51.06  ? 380 TYR B N     1 
ATOM   2309 C  CA    . TYR B 1 139 ? -10.970 39.373 35.967 1.00 46.79  ? 380 TYR B CA    1 
ATOM   2310 C  C     . TYR B 1 139 ? -10.926 40.841 36.371 1.00 49.47  ? 380 TYR B C     1 
ATOM   2311 O  O     . TYR B 1 139 ? -11.174 41.179 37.528 1.00 53.42  ? 380 TYR B O     1 
ATOM   2312 C  CB    . TYR B 1 139 ? -9.549  38.890 35.673 1.00 49.27  ? 380 TYR B CB    1 
ATOM   2313 C  CG    . TYR B 1 139 ? -8.607  39.019 36.852 1.00 53.59  ? 380 TYR B CG    1 
ATOM   2314 C  CD1   . TYR B 1 139 ? -8.478  37.991 37.777 1.00 56.22  ? 380 TYR B CD1   1 
ATOM   2315 C  CD2   . TYR B 1 139 ? -7.851  40.169 37.043 1.00 51.01  ? 380 TYR B CD2   1 
ATOM   2316 C  CE1   . TYR B 1 139 ? -7.621  38.101 38.858 1.00 57.29  ? 380 TYR B CE1   1 
ATOM   2317 C  CE2   . TYR B 1 139 ? -6.993  40.291 38.121 1.00 59.89  ? 380 TYR B CE2   1 
ATOM   2318 C  CZ    . TYR B 1 139 ? -6.881  39.253 39.024 1.00 63.18  ? 380 TYR B CZ    1 
ATOM   2319 O  OH    . TYR B 1 139 ? -6.024  39.370 40.097 1.00 66.31  ? 380 TYR B OH    1 
ATOM   2320 N  N     . SER B 1 140 ? -10.593 41.706 35.421 1.00 49.89  ? 381 SER B N     1 
ATOM   2321 C  CA    . SER B 1 140 ? -10.455 43.127 35.707 1.00 52.25  ? 381 SER B CA    1 
ATOM   2322 C  C     . SER B 1 140 ? -11.781 43.716 36.175 1.00 54.23  ? 381 SER B C     1 
ATOM   2323 O  O     . SER B 1 140 ? -11.818 44.543 37.090 1.00 54.00  ? 381 SER B O     1 
ATOM   2324 C  CB    . SER B 1 140 ? -9.943  43.874 34.472 1.00 55.90  ? 381 SER B CB    1 
ATOM   2325 O  OG    . SER B 1 140 ? -9.836  45.267 34.717 1.00 59.59  ? 381 SER B OG    1 
ATOM   2326 N  N     . ASP B 1 141 ? -12.869 43.274 35.553 1.00 47.51  ? 382 ASP B N     1 
ATOM   2327 C  CA    . ASP B 1 141 ? -14.192 43.792 35.874 1.00 49.82  ? 382 ASP B CA    1 
ATOM   2328 C  C     . ASP B 1 141 ? -14.689 43.324 37.241 1.00 53.18  ? 382 ASP B C     1 
ATOM   2329 O  O     . ASP B 1 141 ? -15.462 44.019 37.906 1.00 47.43  ? 382 ASP B O     1 
ATOM   2330 C  CB    . ASP B 1 141 ? -15.187 43.391 34.787 1.00 46.45  ? 382 ASP B CB    1 
ATOM   2331 C  CG    . ASP B 1 141 ? -15.457 44.515 33.811 1.00 56.05  ? 382 ASP B CG    1 
ATOM   2332 O  OD1   . ASP B 1 141 ? -14.825 45.586 33.954 1.00 54.75  ? 382 ASP B OD1   1 
ATOM   2333 O  OD2   . ASP B 1 141 ? -16.294 44.328 32.902 1.00 54.58  ? 382 ASP B OD2   1 
ATOM   2334 N  N     . PHE B 1 142 ? -14.238 42.147 37.660 1.00 50.36  ? 383 PHE B N     1 
ATOM   2335 C  CA    . PHE B 1 142 ? -14.667 41.584 38.931 1.00 45.33  ? 383 PHE B CA    1 
ATOM   2336 C  C     . PHE B 1 142 ? -13.841 42.122 40.094 1.00 47.62  ? 383 PHE B C     1 
ATOM   2337 O  O     . PHE B 1 142 ? -13.996 41.680 41.231 1.00 48.38  ? 383 PHE B O     1 
ATOM   2338 C  CB    . PHE B 1 142 ? -14.593 40.060 38.889 1.00 38.21  ? 383 PHE B CB    1 
ATOM   2339 C  CG    . PHE B 1 142 ? -15.723 39.422 38.138 1.00 35.88  ? 383 PHE B CG    1 
ATOM   2340 C  CD1   . PHE B 1 142 ? -16.732 40.194 37.589 1.00 37.59  ? 383 PHE B CD1   1 
ATOM   2341 C  CD2   . PHE B 1 142 ? -15.791 38.046 37.999 1.00 41.85  ? 383 PHE B CD2   1 
ATOM   2342 C  CE1   . PHE B 1 142 ? -17.779 39.606 36.903 1.00 38.02  ? 383 PHE B CE1   1 
ATOM   2343 C  CE2   . PHE B 1 142 ? -16.838 37.451 37.314 1.00 36.99  ? 383 PHE B CE2   1 
ATOM   2344 C  CZ    . PHE B 1 142 ? -17.832 38.231 36.767 1.00 33.51  ? 383 PHE B CZ    1 
ATOM   2345 N  N     . LEU B 1 143 ? -12.963 43.077 39.803 1.00 47.06  ? 384 LEU B N     1 
ATOM   2346 C  CA    . LEU B 1 143 ? -12.173 43.728 40.840 1.00 49.21  ? 384 LEU B CA    1 
ATOM   2347 C  C     . LEU B 1 143 ? -12.867 44.997 41.305 1.00 49.69  ? 384 LEU B C     1 
ATOM   2348 O  O     . LEU B 1 143 ? -12.556 45.534 42.366 1.00 50.52  ? 384 LEU B O     1 
ATOM   2349 C  CB    . LEU B 1 143 ? -10.768 44.057 40.333 1.00 48.84  ? 384 LEU B CB    1 
ATOM   2350 C  CG    . LEU B 1 143 ? -9.835  42.889 40.017 1.00 55.66  ? 384 LEU B CG    1 
ATOM   2351 C  CD1   . LEU B 1 143 ? -8.580  43.396 39.324 1.00 58.15  ? 384 LEU B CD1   1 
ATOM   2352 C  CD2   . LEU B 1 143 ? -9.479  42.117 41.284 1.00 48.69  ? 384 LEU B CD2   1 
ATOM   2353 N  N     . GLU B 1 144 ? -13.813 45.471 40.502 1.00 43.47  ? 385 GLU B N     1 
ATOM   2354 C  CA    . GLU B 1 144 ? -14.470 46.740 40.772 1.00 43.49  ? 385 GLU B CA    1 
ATOM   2355 C  C     . GLU B 1 144 ? -15.846 46.553 41.402 1.00 35.86  ? 385 GLU B C     1 
ATOM   2356 O  O     . GLU B 1 144 ? -16.587 45.643 41.042 1.00 35.13  ? 385 GLU B O     1 
ATOM   2357 C  CB    . GLU B 1 144 ? -14.589 47.555 39.479 1.00 54.16  ? 385 GLU B CB    1 
ATOM   2358 C  CG    . GLU B 1 144 ? -13.258 47.792 38.764 1.00 54.38  ? 385 GLU B CG    1 
ATOM   2359 C  CD    . GLU B 1 144 ? -12.242 48.524 39.633 1.00 61.64  ? 385 GLU B CD    1 
ATOM   2360 O  OE1   . GLU B 1 144 ? -12.651 49.368 40.462 1.00 55.68  ? 385 GLU B OE1   1 
ATOM   2361 O  OE2   . GLU B 1 144 ? -11.031 48.252 39.485 1.00 58.69  ? 385 GLU B OE2   1 
ATOM   2362 N  N     . ARG B 1 145 ? -16.179 47.416 42.354 1.00 30.33  ? 386 ARG B N     1 
ATOM   2363 C  CA    . ARG B 1 145 ? -17.505 47.396 42.954 1.00 31.61  ? 386 ARG B CA    1 
ATOM   2364 C  C     . ARG B 1 145 ? -18.371 48.483 42.329 1.00 35.29  ? 386 ARG B C     1 
ATOM   2365 O  O     . ARG B 1 145 ? -18.005 49.661 42.330 1.00 39.40  ? 386 ARG B O     1 
ATOM   2366 C  CB    . ARG B 1 145 ? -17.426 47.587 44.469 1.00 25.39  ? 386 ARG B CB    1 
ATOM   2367 C  CG    . ARG B 1 145 ? -16.589 46.550 45.182 1.00 24.18  ? 386 ARG B CG    1 
ATOM   2368 C  CD    . ARG B 1 145 ? -16.493 46.861 46.663 1.00 21.44  ? 386 ARG B CD    1 
ATOM   2369 N  NE    . ARG B 1 145 ? -17.811 47.018 47.262 1.00 22.19  ? 386 ARG B NE    1 
ATOM   2370 C  CZ    . ARG B 1 145 ? -18.518 46.018 47.774 1.00 23.05  ? 386 ARG B CZ    1 
ATOM   2371 N  NH1   . ARG B 1 145 ? -18.028 44.782 47.769 1.00 19.45  ? 386 ARG B NH1   1 
ATOM   2372 N  NH2   . ARG B 1 145 ? -19.714 46.254 48.294 1.00 20.87  ? 386 ARG B NH2   1 
ATOM   2373 N  N     . MET B 1 146 ? -19.516 48.082 41.792 1.00 28.25  ? 387 MET B N     1 
ATOM   2374 C  CA    . MET B 1 146 ? -20.437 49.015 41.159 1.00 29.88  ? 387 MET B CA    1 
ATOM   2375 C  C     . MET B 1 146 ? -20.991 50.021 42.158 1.00 32.80  ? 387 MET B C     1 
ATOM   2376 O  O     . MET B 1 146 ? -21.214 49.686 43.320 1.00 31.62  ? 387 MET B O     1 
ATOM   2377 C  CB    . MET B 1 146 ? -21.586 48.252 40.509 1.00 29.60  ? 387 MET B CB    1 
ATOM   2378 C  CG    . MET B 1 146 ? -22.356 47.400 41.497 1.00 34.20  ? 387 MET B CG    1 
ATOM   2379 S  SD    . MET B 1 146 ? -23.243 46.035 40.740 1.00 29.72  ? 387 MET B SD    1 
ATOM   2380 C  CE    . MET B 1 146 ? -24.410 46.938 39.756 1.00 34.70  ? 387 MET B CE    1 
ATOM   2381 N  N     . PRO B 1 147 ? -21.216 51.263 41.712 1.00 32.86  ? 388 PRO B N     1 
ATOM   2382 C  CA    . PRO B 1 147 ? -21.964 52.186 42.567 1.00 32.96  ? 388 PRO B CA    1 
ATOM   2383 C  C     . PRO B 1 147 ? -23.384 51.660 42.723 1.00 33.61  ? 388 PRO B C     1 
ATOM   2384 O  O     . PRO B 1 147 ? -23.855 50.942 41.841 1.00 35.97  ? 388 PRO B O     1 
ATOM   2385 C  CB    . PRO B 1 147 ? -21.930 53.500 41.787 1.00 32.60  ? 388 PRO B CB    1 
ATOM   2386 C  CG    . PRO B 1 147 ? -21.774 53.075 40.360 1.00 31.09  ? 388 PRO B CG    1 
ATOM   2387 C  CD    . PRO B 1 147 ? -20.911 51.846 40.395 1.00 30.25  ? 388 PRO B CD    1 
ATOM   2388 N  N     . ARG B 1 148 ? -24.054 52.001 43.815 1.00 32.68  ? 389 ARG B N     1 
ATOM   2389 C  CA    . ARG B 1 148 ? -25.355 51.411 44.098 1.00 30.34  ? 389 ARG B CA    1 
ATOM   2390 C  C     . ARG B 1 148 ? -26.395 51.798 43.058 1.00 28.93  ? 389 ARG B C     1 
ATOM   2391 O  O     . ARG B 1 148 ? -27.379 51.091 42.879 1.00 34.28  ? 389 ARG B O     1 
ATOM   2392 C  CB    . ARG B 1 148 ? -25.835 51.809 45.493 1.00 28.74  ? 389 ARG B CB    1 
ATOM   2393 C  CG    . ARG B 1 148 ? -26.675 53.065 45.542 1.00 28.54  ? 389 ARG B CG    1 
ATOM   2394 C  CD    . ARG B 1 148 ? -27.021 53.407 46.971 1.00 27.83  ? 389 ARG B CD    1 
ATOM   2395 N  NE    . ARG B 1 148 ? -27.493 52.236 47.699 1.00 29.32  ? 389 ARG B NE    1 
ATOM   2396 C  CZ    . ARG B 1 148 ? -28.770 51.882 47.777 1.00 35.98  ? 389 ARG B CZ    1 
ATOM   2397 N  NH1   . ARG B 1 148 ? -29.695 52.619 47.166 1.00 34.86  ? 389 ARG B NH1   1 
ATOM   2398 N  NH2   . ARG B 1 148 ? -29.121 50.801 48.465 1.00 22.67  ? 389 ARG B NH2   1 
ATOM   2399 N  N     . GLU B 1 149 ? -26.176 52.913 42.367 1.00 31.94  ? 390 GLU B N     1 
ATOM   2400 C  CA    . GLU B 1 149 ? -27.108 53.352 41.333 1.00 32.41  ? 390 GLU B CA    1 
ATOM   2401 C  C     . GLU B 1 149 ? -27.164 52.327 40.200 1.00 33.61  ? 390 GLU B C     1 
ATOM   2402 O  O     . GLU B 1 149 ? -28.230 52.060 39.643 1.00 32.28  ? 390 GLU B O     1 
ATOM   2403 C  CB    . GLU B 1 149 ? -26.712 54.728 40.791 1.00 31.38  ? 390 GLU B CB    1 
ATOM   2404 C  CG    . GLU B 1 149 ? -27.123 55.908 41.672 1.00 33.24  ? 390 GLU B CG    1 
ATOM   2405 C  CD    . GLU B 1 149 ? -26.272 56.049 42.924 1.00 40.37  ? 390 GLU B CD    1 
ATOM   2406 O  OE1   . GLU B 1 149 ? -25.143 55.506 42.947 1.00 40.35  ? 390 GLU B OE1   1 
ATOM   2407 O  OE2   . GLU B 1 149 ? -26.735 56.705 43.885 1.00 36.07  ? 390 GLU B OE2   1 
ATOM   2408 N  N     . GLU B 1 150 ? -26.013 51.746 39.877 1.00 29.97  ? 391 GLU B N     1 
ATOM   2409 C  CA    . GLU B 1 150 ? -25.937 50.709 38.859 1.00 28.97  ? 391 GLU B CA    1 
ATOM   2410 C  C     . GLU B 1 150 ? -26.662 49.449 39.331 1.00 30.82  ? 391 GLU B C     1 
ATOM   2411 O  O     . GLU B 1 150 ? -27.254 48.724 38.531 1.00 34.66  ? 391 GLU B O     1 
ATOM   2412 C  CB    . GLU B 1 150 ? -24.476 50.397 38.513 1.00 28.26  ? 391 GLU B CB    1 
ATOM   2413 C  CG    . GLU B 1 150 ? -24.290 49.517 37.277 1.00 25.38  ? 391 GLU B CG    1 
ATOM   2414 C  CD    . GLU B 1 150 ? -22.835 49.147 37.017 1.00 30.91  ? 391 GLU B CD    1 
ATOM   2415 O  OE1   . GLU B 1 150 ? -21.933 49.888 37.463 1.00 34.94  ? 391 GLU B OE1   1 
ATOM   2416 O  OE2   . GLU B 1 150 ? -22.591 48.105 36.372 1.00 32.45  ? 391 GLU B OE2   1 
ATOM   2417 N  N     . ALA B 1 151 ? -26.617 49.193 40.635 1.00 33.81  ? 392 ALA B N     1 
ATOM   2418 C  CA    . ALA B 1 151 ? -27.309 48.042 41.209 1.00 32.20  ? 392 ALA B CA    1 
ATOM   2419 C  C     . ALA B 1 151 ? -28.813 48.192 41.048 1.00 34.30  ? 392 ALA B C     1 
ATOM   2420 O  O     . ALA B 1 151 ? -29.509 47.232 40.715 1.00 35.56  ? 392 ALA B O     1 
ATOM   2421 C  CB    . ALA B 1 151 ? -26.944 47.874 42.670 1.00 28.60  ? 392 ALA B CB    1 
ATOM   2422 N  N     . THR B 1 152 ? -29.303 49.405 41.283 1.00 32.11  ? 393 THR B N     1 
ATOM   2423 C  CA    . THR B 1 152 ? -30.711 49.718 41.091 1.00 33.24  ? 393 THR B CA    1 
ATOM   2424 C  C     . THR B 1 152 ? -31.142 49.400 39.667 1.00 32.80  ? 393 THR B C     1 
ATOM   2425 O  O     . THR B 1 152 ? -32.186 48.791 39.448 1.00 36.33  ? 393 THR B O     1 
ATOM   2426 C  CB    . THR B 1 152 ? -31.004 51.195 41.384 1.00 34.38  ? 393 THR B CB    1 
ATOM   2427 O  OG1   . THR B 1 152 ? -30.624 51.499 42.733 1.00 26.89  ? 393 THR B OG1   1 
ATOM   2428 C  CG2   . THR B 1 152 ? -32.485 51.490 41.189 1.00 30.08  ? 393 THR B CG2   1 
ATOM   2429 N  N     . GLU B 1 153 ? -30.317 49.807 38.707 1.00 33.91  ? 394 GLU B N     1 
ATOM   2430 C  CA    . GLU B 1 153 ? -30.571 49.547 37.295 1.00 37.01  ? 394 GLU B CA    1 
ATOM   2431 C  C     . GLU B 1 153 ? -30.717 48.054 37.010 1.00 37.43  ? 394 GLU B C     1 
ATOM   2432 O  O     . GLU B 1 153 ? -31.645 47.637 36.311 1.00 34.45  ? 394 GLU B O     1 
ATOM   2433 C  CB    . GLU B 1 153 ? -29.447 50.132 36.438 1.00 37.22  ? 394 GLU B CB    1 
ATOM   2434 C  CG    . GLU B 1 153 ? -29.740 51.511 35.872 1.00 43.23  ? 394 GLU B CG    1 
ATOM   2435 C  CD    . GLU B 1 153 ? -28.551 52.101 35.131 1.00 55.71  ? 394 GLU B CD    1 
ATOM   2436 O  OE1   . GLU B 1 153 ? -28.690 52.403 33.923 1.00 54.19  ? 394 GLU B OE1   1 
ATOM   2437 O  OE2   . GLU B 1 153 ? -27.480 52.270 35.760 1.00 49.33  ? 394 GLU B OE2   1 
ATOM   2438 N  N     . ILE B 1 154 ? -29.799 47.258 37.554 1.00 33.72  ? 395 ILE B N     1 
ATOM   2439 C  CA    . ILE B 1 154 ? -29.833 45.809 37.376 1.00 29.45  ? 395 ILE B CA    1 
ATOM   2440 C  C     . ILE B 1 154 ? -31.072 45.204 38.035 1.00 34.22  ? 395 ILE B C     1 
ATOM   2441 O  O     . ILE B 1 154 ? -31.690 44.294 37.483 1.00 34.09  ? 395 ILE B O     1 
ATOM   2442 C  CB    . ILE B 1 154 ? -28.565 45.149 37.940 1.00 30.46  ? 395 ILE B CB    1 
ATOM   2443 C  CG1   . ILE B 1 154 ? -27.340 45.617 37.150 1.00 29.59  ? 395 ILE B CG1   1 
ATOM   2444 C  CG2   . ILE B 1 154 ? -28.676 43.628 37.913 1.00 25.44  ? 395 ILE B CG2   1 
ATOM   2445 C  CD1   . ILE B 1 154 ? -26.077 44.852 37.462 1.00 23.47  ? 395 ILE B CD1   1 
ATOM   2446 N  N     . GLU B 1 155 ? -31.446 45.716 39.204 1.00 33.93  ? 396 GLU B N     1 
ATOM   2447 C  CA    . GLU B 1 155 ? -32.669 45.265 39.858 1.00 34.00  ? 396 GLU B CA    1 
ATOM   2448 C  C     . GLU B 1 155 ? -33.872 45.523 38.960 1.00 36.89  ? 396 GLU B C     1 
ATOM   2449 O  O     . GLU B 1 155 ? -34.671 44.620 38.710 1.00 36.34  ? 396 GLU B O     1 
ATOM   2450 C  CB    . GLU B 1 155 ? -32.867 45.957 41.208 1.00 38.37  ? 396 GLU B CB    1 
ATOM   2451 C  CG    . GLU B 1 155 ? -34.138 45.526 41.943 1.00 37.00  ? 396 GLU B CG    1 
ATOM   2452 C  CD    . GLU B 1 155 ? -34.508 46.456 43.092 1.00 45.14  ? 396 GLU B CD    1 
ATOM   2453 O  OE1   . GLU B 1 155 ? -34.480 47.691 42.901 1.00 47.41  ? 396 GLU B OE1   1 
ATOM   2454 O  OE2   . GLU B 1 155 ? -34.829 45.952 44.190 1.00 42.79  ? 396 GLU B OE2   1 
ATOM   2455 N  N     . GLN B 1 156 ? -33.986 46.756 38.468 1.00 38.05  ? 397 GLN B N     1 
ATOM   2456 C  CA    . GLN B 1 156 ? -35.110 47.152 37.621 1.00 35.01  ? 397 GLN B CA    1 
ATOM   2457 C  C     . GLN B 1 156 ? -35.171 46.314 36.350 1.00 39.33  ? 397 GLN B C     1 
ATOM   2458 O  O     . GLN B 1 156 ? -36.253 45.967 35.881 1.00 41.27  ? 397 GLN B O     1 
ATOM   2459 C  CB    . GLN B 1 156 ? -35.026 48.640 37.268 1.00 27.49  ? 397 GLN B CB    1 
ATOM   2460 C  CG    . GLN B 1 156 ? -35.278 49.576 38.443 1.00 41.24  ? 397 GLN B CG    1 
ATOM   2461 C  CD    . GLN B 1 156 ? -36.622 49.325 39.123 1.00 60.32  ? 397 GLN B CD    1 
ATOM   2462 O  OE1   . GLN B 1 156 ? -36.720 48.528 40.064 1.00 47.58  ? 397 GLN B OE1   1 
ATOM   2463 N  NE2   . GLN B 1 156 ? -37.662 50.012 38.652 1.00 55.61  ? 397 GLN B NE2   1 
ATOM   2464 N  N     . THR B 1 157 ? -34.006 45.983 35.804 1.00 33.68  ? 398 THR B N     1 
ATOM   2465 C  CA    . THR B 1 157 ? -33.934 45.126 34.633 1.00 32.98  ? 398 THR B CA    1 
ATOM   2466 C  C     . THR B 1 157 ? -34.560 43.762 34.910 1.00 35.73  ? 398 THR B C     1 
ATOM   2467 O  O     . THR B 1 157 ? -35.424 43.310 34.163 1.00 42.87  ? 398 THR B O     1 
ATOM   2468 C  CB    . THR B 1 157 ? -32.482 44.937 34.169 1.00 35.92  ? 398 THR B CB    1 
ATOM   2469 O  OG1   . THR B 1 157 ? -31.956 46.196 33.730 1.00 36.88  ? 398 THR B OG1   1 
ATOM   2470 C  CG2   . THR B 1 157 ? -32.408 43.934 33.030 1.00 32.02  ? 398 THR B CG2   1 
ATOM   2471 N  N     . VAL B 1 158 ? -34.132 43.109 35.986 1.00 37.65  ? 399 VAL B N     1 
ATOM   2472 C  CA    . VAL B 1 158 ? -34.682 41.804 36.345 1.00 39.64  ? 399 VAL B CA    1 
ATOM   2473 C  C     . VAL B 1 158 ? -36.157 41.930 36.727 1.00 42.20  ? 399 VAL B C     1 
ATOM   2474 O  O     . VAL B 1 158 ? -36.970 41.061 36.411 1.00 41.62  ? 399 VAL B O     1 
ATOM   2475 C  CB    . VAL B 1 158 ? -33.898 41.150 37.504 1.00 35.01  ? 399 VAL B CB    1 
ATOM   2476 C  CG1   . VAL B 1 158 ? -34.573 39.865 37.953 1.00 35.84  ? 399 VAL B CG1   1 
ATOM   2477 C  CG2   . VAL B 1 158 ? -32.463 40.867 37.083 1.00 32.69  ? 399 VAL B CG2   1 
ATOM   2478 N  N     . GLN B 1 159 ? -36.503 43.028 37.388 1.00 42.80  ? 400 GLN B N     1 
ATOM   2479 C  CA    . GLN B 1 159 ? -37.880 43.253 37.805 1.00 41.88  ? 400 GLN B CA    1 
ATOM   2480 C  C     . GLN B 1 159 ? -38.793 43.470 36.604 1.00 49.15  ? 400 GLN B C     1 
ATOM   2481 O  O     . GLN B 1 159 ? -39.848 42.845 36.501 1.00 51.07  ? 400 GLN B O     1 
ATOM   2482 C  CB    . GLN B 1 159 ? -37.961 44.444 38.757 1.00 44.21  ? 400 GLN B CB    1 
ATOM   2483 C  CG    . GLN B 1 159 ? -39.368 44.792 39.216 1.00 50.55  ? 400 GLN B CG    1 
ATOM   2484 C  CD    . GLN B 1 159 ? -39.371 45.859 40.298 1.00 56.70  ? 400 GLN B CD    1 
ATOM   2485 O  OE1   . GLN B 1 159 ? -39.078 45.576 41.461 1.00 59.79  ? 400 GLN B OE1   1 
ATOM   2486 N  NE2   . GLN B 1 159 ? -39.688 47.095 39.917 1.00 43.00  ? 400 GLN B NE2   1 
ATOM   2487 N  N     . LYS B 1 160 ? -38.381 44.352 35.696 1.00 51.26  ? 401 LYS B N     1 
ATOM   2488 C  CA    . LYS B 1 160 ? -39.180 44.667 34.513 1.00 46.97  ? 401 LYS B CA    1 
ATOM   2489 C  C     . LYS B 1 160 ? -39.438 43.413 33.688 1.00 47.46  ? 401 LYS B C     1 
ATOM   2490 O  O     . LYS B 1 160 ? -40.567 43.159 33.262 1.00 52.05  ? 401 LYS B O     1 
ATOM   2491 C  CB    . LYS B 1 160 ? -38.489 45.731 33.653 1.00 41.37  ? 401 LYS B CB    1 
ATOM   2492 C  CG    . LYS B 1 160 ? -39.203 46.032 32.345 1.00 47.18  ? 401 LYS B CG    1 
ATOM   2493 C  CD    . LYS B 1 160 ? -38.377 46.941 31.449 1.00 55.64  ? 401 LYS B CD    1 
ATOM   2494 C  CE    . LYS B 1 160 ? -39.007 47.067 30.066 1.00 54.03  ? 401 LYS B CE    1 
ATOM   2495 N  NZ    . LYS B 1 160 ? -38.206 47.930 29.150 1.00 50.55  ? 401 LYS B NZ    1 
ATOM   2496 N  N     . ALA B 1 161 ? -38.385 42.629 33.480 1.00 43.10  ? 402 ALA B N     1 
ATOM   2497 C  CA    . ALA B 1 161 ? -38.485 41.384 32.732 1.00 43.49  ? 402 ALA B CA    1 
ATOM   2498 C  C     . ALA B 1 161 ? -39.468 40.419 33.387 1.00 52.26  ? 402 ALA B C     1 
ATOM   2499 O  O     . ALA B 1 161 ? -40.260 39.768 32.707 1.00 56.94  ? 402 ALA B O     1 
ATOM   2500 C  CB    . ALA B 1 161 ? -37.120 40.740 32.604 1.00 36.28  ? 402 ALA B CB    1 
ATOM   2501 N  N     . ALA B 1 162 ? -39.421 40.343 34.712 1.00 48.98  ? 403 ALA B N     1 
ATOM   2502 C  CA    . ALA B 1 162 ? -40.281 39.431 35.455 1.00 47.76  ? 403 ALA B CA    1 
ATOM   2503 C  C     . ALA B 1 162 ? -41.744 39.875 35.446 1.00 52.32  ? 403 ALA B C     1 
ATOM   2504 O  O     . ALA B 1 162 ? -42.646 39.045 35.532 1.00 54.72  ? 403 ALA B O     1 
ATOM   2505 C  CB    . ALA B 1 162 ? -39.784 39.291 36.886 1.00 47.51  ? 403 ALA B CB    1 
ATOM   2506 N  N     . GLN B 1 163 ? -41.980 41.178 35.340 1.00 54.86  ? 404 GLN B N     1 
ATOM   2507 C  CA    . GLN B 1 163 ? -43.344 41.700 35.396 1.00 59.64  ? 404 GLN B CA    1 
ATOM   2508 C  C     . GLN B 1 163 ? -44.102 41.519 34.077 1.00 60.66  ? 404 GLN B C     1 
ATOM   2509 O  O     . GLN B 1 163 ? -45.318 41.709 34.019 1.00 59.74  ? 404 GLN B O     1 
ATOM   2510 C  CB    . GLN B 1 163 ? -43.333 43.177 35.800 1.00 59.56  ? 404 GLN B CB    1 
ATOM   2511 C  CG    . GLN B 1 163 ? -43.018 43.401 37.276 1.00 60.93  ? 404 GLN B CG    1 
ATOM   2512 C  CD    . GLN B 1 163 ? -43.347 44.807 37.752 1.00 64.20  ? 404 GLN B CD    1 
ATOM   2513 O  OE1   . GLN B 1 163 ? -43.897 45.619 37.006 1.00 66.72  ? 404 GLN B OE1   1 
ATOM   2514 N  NE2   . GLN B 1 163 ? -43.014 45.098 39.006 1.00 56.46  ? 404 GLN B NE2   1 
ATOM   2515 N  N     . ALA B 1 164 ? -43.387 41.150 33.021 1.00 59.09  ? 405 ALA B N     1 
ATOM   2516 C  CA    . ALA B 1 164 ? -44.034 40.843 31.751 1.00 57.68  ? 405 ALA B CA    1 
ATOM   2517 C  C     . ALA B 1 164 ? -44.814 39.542 31.875 1.00 59.34  ? 405 ALA B C     1 
ATOM   2518 O  O     . ALA B 1 164 ? -45.957 39.443 31.435 1.00 65.71  ? 405 ALA B O     1 
ATOM   2519 C  CB    . ALA B 1 164 ? -43.009 40.748 30.631 1.00 53.63  ? 405 ALA B CB    1 
ATOM   2520 N  N     . PHE B 1 165 ? -44.184 38.546 32.486 1.00 56.80  ? 406 PHE B N     1 
ATOM   2521 C  CA    . PHE B 1 165 ? -44.815 37.251 32.696 1.00 56.94  ? 406 PHE B CA    1 
ATOM   2522 C  C     . PHE B 1 165 ? -45.961 37.351 33.693 1.00 60.09  ? 406 PHE B C     1 
ATOM   2523 O  O     . PHE B 1 165 ? -46.985 36.684 33.548 1.00 58.25  ? 406 PHE B O     1 
ATOM   2524 C  CB    . PHE B 1 165 ? -43.788 36.231 33.190 1.00 53.74  ? 406 PHE B CB    1 
ATOM   2525 C  CG    . PHE B 1 165 ? -42.591 36.094 32.297 1.00 55.98  ? 406 PHE B CG    1 
ATOM   2526 C  CD1   . PHE B 1 165 ? -42.579 35.164 31.269 1.00 62.30  ? 406 PHE B CD1   1 
ATOM   2527 C  CD2   . PHE B 1 165 ? -41.474 36.891 32.488 1.00 59.04  ? 406 PHE B CD2   1 
ATOM   2528 C  CE1   . PHE B 1 165 ? -41.476 35.034 30.446 1.00 67.28  ? 406 PHE B CE1   1 
ATOM   2529 C  CE2   . PHE B 1 165 ? -40.366 36.768 31.669 1.00 60.78  ? 406 PHE B CE2   1 
ATOM   2530 C  CZ    . PHE B 1 165 ? -40.367 35.838 30.646 1.00 70.04  ? 406 PHE B CZ    1 
ATOM   2531 N  N     . ASN B 1 166 ? -45.776 38.193 34.704 1.00 63.60  ? 407 ASN B N     1 
ATOM   2532 C  CA    . ASN B 1 166 ? -46.735 38.329 35.794 1.00 57.41  ? 407 ASN B CA    1 
ATOM   2533 C  C     . ASN B 1 166 ? -46.537 39.664 36.507 1.00 58.78  ? 407 ASN B C     1 
ATOM   2534 O  O     . ASN B 1 166 ? -45.500 39.894 37.128 1.00 60.00  ? 407 ASN B O     1 
ATOM   2535 C  CB    . ASN B 1 166 ? -46.587 37.160 36.772 1.00 46.92  ? 407 ASN B CB    1 
ATOM   2536 C  CG    . ASN B 1 166 ? -47.720 37.080 37.775 1.00 52.21  ? 407 ASN B CG    1 
ATOM   2537 O  OD1   . ASN B 1 166 ? -48.110 38.081 38.380 1.00 57.74  ? 407 ASN B OD1   1 
ATOM   2538 N  ND2   . ASN B 1 166 ? -48.252 35.878 37.964 1.00 44.99  ? 407 ASN B ND2   1 
ATOM   2539 N  N     . SER B 1 167 ? -47.531 40.542 36.415 1.00 57.41  ? 408 SER B N     1 
ATOM   2540 C  CA    . SER B 1 167 ? -47.410 41.891 36.959 1.00 54.54  ? 408 SER B CA    1 
ATOM   2541 C  C     . SER B 1 167 ? -47.500 41.914 38.483 1.00 61.41  ? 408 SER B C     1 
ATOM   2542 O  O     . SER B 1 167 ? -47.276 42.950 39.108 1.00 63.92  ? 408 SER B O     1 
ATOM   2543 C  CB    . SER B 1 167 ? -48.484 42.804 36.364 1.00 56.95  ? 408 SER B CB    1 
ATOM   2544 O  OG    . SER B 1 167 ? -49.785 42.345 36.687 1.00 63.15  ? 408 SER B OG    1 
ATOM   2545 N  N     . GLY B 1 168 ? -47.827 40.772 39.079 1.00 56.36  ? 409 GLY B N     1 
ATOM   2546 C  CA    . GLY B 1 168 ? -47.943 40.682 40.522 1.00 58.28  ? 409 GLY B CA    1 
ATOM   2547 C  C     . GLY B 1 168 ? -46.663 40.231 41.206 1.00 59.09  ? 409 GLY B C     1 
ATOM   2548 O  O     . GLY B 1 168 ? -46.566 40.251 42.436 1.00 54.12  ? 409 GLY B O     1 
ATOM   2549 N  N     . LEU B 1 169 ? -45.681 39.819 40.409 1.00 55.86  ? 410 LEU B N     1 
ATOM   2550 C  CA    . LEU B 1 169 ? -44.406 39.349 40.941 1.00 50.83  ? 410 LEU B CA    1 
ATOM   2551 C  C     . LEU B 1 169 ? -43.660 40.456 41.678 1.00 50.11  ? 410 LEU B C     1 
ATOM   2552 O  O     . LEU B 1 169 ? -43.693 41.618 41.276 1.00 50.69  ? 410 LEU B O     1 
ATOM   2553 C  CB    . LEU B 1 169 ? -43.531 38.788 39.820 1.00 44.94  ? 410 LEU B CB    1 
ATOM   2554 C  CG    . LEU B 1 169 ? -43.853 37.370 39.351 1.00 41.74  ? 410 LEU B CG    1 
ATOM   2555 C  CD1   . LEU B 1 169 ? -42.942 36.963 38.205 1.00 46.29  ? 410 LEU B CD1   1 
ATOM   2556 C  CD2   . LEU B 1 169 ? -43.721 36.394 40.502 1.00 43.32  ? 410 LEU B CD2   1 
ATOM   2557 N  N     . LEU B 1 170 ? -42.986 40.085 42.761 1.00 45.20  ? 411 LEU B N     1 
ATOM   2558 C  CA    . LEU B 1 170 ? -42.247 41.048 43.563 1.00 44.24  ? 411 LEU B CA    1 
ATOM   2559 C  C     . LEU B 1 170 ? -40.744 40.760 43.527 1.00 46.46  ? 411 LEU B C     1 
ATOM   2560 O  O     . LEU B 1 170 ? -40.297 39.680 43.913 1.00 46.00  ? 411 LEU B O     1 
ATOM   2561 C  CB    . LEU B 1 170 ? -42.770 41.040 45.001 1.00 41.45  ? 411 LEU B CB    1 
ATOM   2562 C  CG    . LEU B 1 170 ? -42.138 41.985 46.026 1.00 50.86  ? 411 LEU B CG    1 
ATOM   2563 C  CD1   . LEU B 1 170 ? -41.955 43.395 45.465 1.00 48.95  ? 411 LEU B CD1   1 
ATOM   2564 C  CD2   . LEU B 1 170 ? -42.985 42.016 47.293 1.00 35.90  ? 411 LEU B CD2   1 
ATOM   2565 N  N     . CYS B 1 171 ? -39.950 41.735 43.122 1.00 47.41  ? 412 CYS B N     1 
ATOM   2566 C  CA    . CYS B 1 171 ? -38.504 41.596 43.085 1.00 44.89  ? 412 CYS B CA    1 
ATOM   2567 C  C     . CYS B 1 171 ? -37.832 42.563 44.001 1.00 45.63  ? 412 CYS B C     1 
ATOM   2568 O  O     . CYS B 1 171 ? -38.156 43.718 44.000 1.00 46.74  ? 412 CYS B O     1 
ATOM   2569 C  CB    . CYS B 1 171 ? -37.990 41.862 41.701 1.00 43.17  ? 412 CYS B CB    1 
ATOM   2570 S  SG    . CYS B 1 171 ? -38.527 40.643 40.527 1.00 63.69  ? 412 CYS B SG    1 
ATOM   2571 N  N     . VAL B 1 172 ? -36.904 42.073 44.797 1.00 38.60  ? 413 VAL B N     1 
ATOM   2572 C  CA    . VAL B 1 172 ? -36.183 42.911 45.733 1.00 34.24  ? 413 VAL B CA    1 
ATOM   2573 C  C     . VAL B 1 172 ? -34.707 42.686 45.643 1.00 33.47  ? 413 VAL B C     1 
ATOM   2574 O  O     . VAL B 1 172 ? -34.300 41.582 45.680 1.00 33.28  ? 413 VAL B O     1 
ATOM   2575 C  CB    . VAL B 1 172 ? -36.556 42.542 47.150 1.00 34.39  ? 413 VAL B CB    1 
ATOM   2576 C  CG1   . VAL B 1 172 ? -36.135 43.608 48.110 1.00 32.51  ? 413 VAL B CG1   1 
ATOM   2577 C  CG2   . VAL B 1 172 ? -38.032 42.306 47.262 1.00 38.77  ? 413 VAL B CG2   1 
ATOM   2578 N  N     . ALA B 1 173 ? -33.897 43.723 45.549 1.00 29.53  ? 414 ALA B N     1 
ATOM   2579 C  CA    . ALA B 1 173 ? -32.457 43.541 45.525 1.00 29.28  ? 414 ALA B CA    1 
ATOM   2580 C  C     . ALA B 1 173 ? -32.038 43.545 46.964 1.00 32.72  ? 414 ALA B C     1 
ATOM   2581 O  O     . ALA B 1 173 ? -32.479 44.356 47.728 1.00 33.36  ? 414 ALA B O     1 
ATOM   2582 C  CB    . ALA B 1 173 ? -31.771 44.624 44.755 1.00 27.83  ? 414 ALA B CB    1 
ATOM   2583 N  N     . CYS B 1 174 ? -31.206 42.595 47.324 1.00 28.72  ? 415 CYS B N     1 
ATOM   2584 C  CA    . CYS B 1 174 ? -30.766 42.365 48.667 1.00 25.27  ? 415 CYS B CA    1 
ATOM   2585 C  C     . CYS B 1 174 ? -29.303 42.587 48.792 1.00 26.36  ? 415 CYS B C     1 
ATOM   2586 O  O     . CYS B 1 174 ? -28.757 43.325 48.046 1.00 29.71  ? 415 CYS B O     1 
ATOM   2587 C  CB    . CYS B 1 174 ? -31.068 40.926 48.993 1.00 27.76  ? 415 CYS B CB    1 
ATOM   2588 S  SG    . CYS B 1 174 ? -32.765 40.456 49.068 1.00 35.71  ? 415 CYS B SG    1 
ATOM   2589 N  N     . GLY B 1 175 ? -28.675 41.923 49.738 1.00 25.84  ? 416 GLY B N     1 
ATOM   2590 C  CA    . GLY B 1 175 ? -27.265 41.999 49.979 1.00 24.68  ? 416 GLY B CA    1 
ATOM   2591 C  C     . GLY B 1 175 ? -26.784 43.343 50.374 1.00 26.13  ? 416 GLY B C     1 
ATOM   2592 O  O     . GLY B 1 175 ? -27.399 43.964 51.144 1.00 21.39  ? 416 GLY B O     1 
ATOM   2593 N  N     . SER B 1 176 ? -25.683 43.779 49.800 1.00 30.04  ? 417 SER B N     1 
ATOM   2594 C  CA    . SER B 1 176 ? -25.097 45.043 50.114 1.00 27.56  ? 417 SER B CA    1 
ATOM   2595 C  C     . SER B 1 176 ? -26.071 46.100 49.799 1.00 26.82  ? 417 SER B C     1 
ATOM   2596 O  O     . SER B 1 176 ? -26.172 47.043 50.499 1.00 24.88  ? 417 SER B O     1 
ATOM   2597 C  CB    . SER B 1 176 ? -23.901 45.320 49.229 1.00 31.99  ? 417 SER B CB    1 
ATOM   2598 O  OG    . SER B 1 176 ? -23.099 44.220 48.952 1.00 38.72  ? 417 SER B OG    1 
ATOM   2599 N  N     . TYR B 1 177 ? -26.789 45.945 48.711 1.00 23.97  ? 418 TYR B N     1 
ATOM   2600 C  CA    . TYR B 1 177 ? -27.706 46.946 48.279 1.00 22.98  ? 418 TYR B CA    1 
ATOM   2601 C  C     . TYR B 1 177 ? -28.797 47.262 49.243 1.00 22.97  ? 418 TYR B C     1 
ATOM   2602 O  O     . TYR B 1 177 ? -28.987 48.405 49.567 1.00 23.32  ? 418 TYR B O     1 
ATOM   2603 C  CB    . TYR B 1 177 ? -28.312 46.480 46.982 1.00 19.89  ? 418 TYR B CB    1 
ATOM   2604 C  CG    . TYR B 1 177 ? -29.226 47.466 46.383 1.00 20.62  ? 418 TYR B CG    1 
ATOM   2605 C  CD1   . TYR B 1 177 ? -30.564 47.330 46.499 1.00 18.89  ? 418 TYR B CD1   1 
ATOM   2606 C  CD2   . TYR B 1 177 ? -28.749 48.541 45.731 1.00 22.13  ? 418 TYR B CD2   1 
ATOM   2607 C  CE1   . TYR B 1 177 ? -31.405 48.242 45.983 1.00 22.24  ? 418 TYR B CE1   1 
ATOM   2608 C  CE2   . TYR B 1 177 ? -29.592 49.452 45.205 1.00 24.15  ? 418 TYR B CE2   1 
ATOM   2609 C  CZ    . TYR B 1 177 ? -30.913 49.282 45.335 1.00 24.23  ? 418 TYR B CZ    1 
ATOM   2610 O  OH    . TYR B 1 177 ? -31.744 50.188 44.832 1.00 25.67  ? 418 TYR B OH    1 
ATOM   2611 N  N     . ARG B 1 178 ? -29.465 46.261 49.764 1.00 23.19  ? 419 ARG B N     1 
ATOM   2612 C  CA    . ARG B 1 178 ? -30.529 46.481 50.734 1.00 19.03  ? 419 ARG B CA    1 
ATOM   2613 C  C     . ARG B 1 178 ? -29.981 46.994 52.068 1.00 21.59  ? 419 ARG B C     1 
ATOM   2614 O  O     . ARG B 1 178 ? -30.681 47.693 52.806 1.00 19.91  ? 419 ARG B O     1 
ATOM   2615 C  CB    . ARG B 1 178 ? -31.329 45.200 50.958 1.00 16.19  ? 419 ARG B CB    1 
ATOM   2616 C  CG    . ARG B 1 178 ? -32.619 45.452 51.695 1.00 16.89  ? 419 ARG B CG    1 
ATOM   2617 C  CD    . ARG B 1 178 ? -33.537 44.251 51.704 1.00 25.23  ? 419 ARG B CD    1 
ATOM   2618 N  NE    . ARG B 1 178 ? -34.744 44.531 52.474 1.00 21.64  ? 419 ARG B NE    1 
ATOM   2619 C  CZ    . ARG B 1 178 ? -34.983 44.018 53.674 1.00 25.91  ? 419 ARG B CZ    1 
ATOM   2620 N  NH1   . ARG B 1 178 ? -34.106 43.192 54.231 1.00 25.47  ? 419 ARG B NH1   1 
ATOM   2621 N  NH2   . ARG B 1 178 ? -36.094 44.326 54.323 1.00 30.22  ? 419 ARG B NH2   1 
ATOM   2622 N  N     . ARG B 1 179 ? -28.727 46.657 52.369 1.00 19.05  ? 420 ARG B N     1 
ATOM   2623 C  CA    . ARG B 1 179 ? -28.078 47.132 53.590 1.00 19.44  ? 420 ARG B CA    1 
ATOM   2624 C  C     . ARG B 1 179 ? -27.608 48.582 53.444 1.00 25.17  ? 420 ARG B C     1 
ATOM   2625 O  O     . ARG B 1 179 ? -26.965 49.127 54.346 1.00 23.25  ? 420 ARG B O     1 
ATOM   2626 C  CB    . ARG B 1 179 ? -26.890 46.238 53.963 1.00 18.58  ? 420 ARG B CB    1 
ATOM   2627 C  CG    . ARG B 1 179 ? -27.265 44.868 54.508 1.00 21.17  ? 420 ARG B CG    1 
ATOM   2628 C  CD    . ARG B 1 179 ? -26.232 44.330 55.501 1.00 25.08  ? 420 ARG B CD    1 
ATOM   2629 N  NE    . ARG B 1 179 ? -24.869 44.381 54.975 1.00 28.40  ? 420 ARG B NE    1 
ATOM   2630 C  CZ    . ARG B 1 179 ? -24.385 43.517 54.088 1.00 23.24  ? 420 ARG B CZ    1 
ATOM   2631 N  NH1   . ARG B 1 179 ? -25.149 42.545 53.614 1.00 21.21  ? 420 ARG B NH1   1 
ATOM   2632 N  NH2   . ARG B 1 179 ? -23.143 43.629 53.657 1.00 26.00  ? 420 ARG B NH2   1 
ATOM   2633 N  N     . GLY B 1 180 ? -27.923 49.199 52.306 1.00 18.49  ? 421 GLY B N     1 
ATOM   2634 C  CA    . GLY B 1 180 ? -27.651 50.611 52.105 1.00 18.88  ? 421 GLY B CA    1 
ATOM   2635 C  C     . GLY B 1 180 ? -26.204 51.008 51.851 1.00 21.41  ? 421 GLY B C     1 
ATOM   2636 O  O     . GLY B 1 180 ? -25.828 52.158 52.094 1.00 21.67  ? 421 GLY B O     1 
ATOM   2637 N  N     . LYS B 1 181 ? -25.395 50.068 51.363 1.00 21.38  ? 422 LYS B N     1 
ATOM   2638 C  CA    . LYS B 1 181 ? -24.006 50.354 50.995 1.00 18.68  ? 422 LYS B CA    1 
ATOM   2639 C  C     . LYS B 1 181 ? -23.919 51.238 49.763 1.00 22.98  ? 422 LYS B C     1 
ATOM   2640 O  O     . LYS B 1 181 ? -24.832 51.261 48.943 1.00 26.22  ? 422 LYS B O     1 
ATOM   2641 C  CB    . LYS B 1 181 ? -23.225 49.058 50.753 1.00 20.21  ? 422 LYS B CB    1 
ATOM   2642 C  CG    . LYS B 1 181 ? -22.679 48.415 52.024 1.00 24.94  ? 422 LYS B CG    1 
ATOM   2643 C  CD    . LYS B 1 181 ? -21.650 47.334 51.730 1.00 28.22  ? 422 LYS B CD    1 
ATOM   2644 C  CE    . LYS B 1 181 ? -21.200 46.640 53.007 1.00 34.01  ? 422 LYS B CE    1 
ATOM   2645 N  NZ    . LYS B 1 181 ? -20.417 47.560 53.883 1.00 43.79  ? 422 LYS B NZ    1 
ATOM   2646 N  N     . ALA B 1 182 ? -22.824 51.979 49.639 1.00 25.34  ? 423 ALA B N     1 
ATOM   2647 C  CA    . ALA B 1 182 ? -22.617 52.840 48.477 1.00 25.66  ? 423 ALA B CA    1 
ATOM   2648 C  C     . ALA B 1 182 ? -22.075 52.055 47.294 1.00 26.76  ? 423 ALA B C     1 
ATOM   2649 O  O     . ALA B 1 182 ? -22.295 52.434 46.152 1.00 32.94  ? 423 ALA B O     1 
ATOM   2650 C  CB    . ALA B 1 182 ? -21.671 53.978 48.816 1.00 28.88  ? 423 ALA B CB    1 
ATOM   2651 N  N     . THR B 1 183 ? -21.351 50.976 47.568 1.00 22.80  ? 424 THR B N     1 
ATOM   2652 C  CA    . THR B 1 183 ? -20.849 50.127 46.499 1.00 23.85  ? 424 THR B CA    1 
ATOM   2653 C  C     . THR B 1 183 ? -21.223 48.678 46.738 1.00 23.64  ? 424 THR B C     1 
ATOM   2654 O  O     . THR B 1 183 ? -21.231 48.213 47.876 1.00 29.44  ? 424 THR B O     1 
ATOM   2655 C  CB    . THR B 1 183 ? -19.319 50.220 46.353 1.00 27.58  ? 424 THR B CB    1 
ATOM   2656 O  OG1   . THR B 1 183 ? -18.693 49.868 47.593 1.00 38.92  ? 424 THR B OG1   1 
ATOM   2657 C  CG2   . THR B 1 183 ? -18.906 51.626 45.959 1.00 31.22  ? 424 THR B CG2   1 
ATOM   2658 N  N     . CYS B 1 184 ? -21.510 47.959 45.658 1.00 28.06  ? 425 CYS B N     1 
ATOM   2659 C  CA    . CYS B 1 184 ? -21.927 46.564 45.752 1.00 26.68  ? 425 CYS B CA    1 
ATOM   2660 C  C     . CYS B 1 184 ? -20.996 45.642 44.976 1.00 25.90  ? 425 CYS B C     1 
ATOM   2661 O  O     . CYS B 1 184 ? -20.649 45.918 43.829 1.00 32.10  ? 425 CYS B O     1 
ATOM   2662 C  CB    . CYS B 1 184 ? -23.356 46.409 45.240 1.00 24.49  ? 425 CYS B CB    1 
ATOM   2663 S  SG    . CYS B 1 184 ? -24.525 47.528 46.036 1.00 27.84  ? 425 CYS B SG    1 
ATOM   2664 N  N     . GLY B 1 185 ? -20.592 44.548 45.609 1.00 22.92  ? 426 GLY B N     1 
ATOM   2665 C  CA    . GLY B 1 185 ? -19.757 43.560 44.955 1.00 25.97  ? 426 GLY B CA    1 
ATOM   2666 C  C     . GLY B 1 185 ? -20.492 42.903 43.806 1.00 28.34  ? 426 GLY B C     1 
ATOM   2667 O  O     . GLY B 1 185 ? -19.959 42.779 42.705 1.00 35.96  ? 426 GLY B O     1 
ATOM   2668 N  N     . ASP B 1 186 ? -21.723 42.481 44.075 1.00 28.28  ? 427 ASP B N     1 
ATOM   2669 C  CA    . ASP B 1 186 ? -22.598 41.905 43.063 1.00 28.92  ? 427 ASP B CA    1 
ATOM   2670 C  C     . ASP B 1 186 ? -24.027 42.349 43.343 1.00 28.18  ? 427 ASP B C     1 
ATOM   2671 O  O     . ASP B 1 186 ? -24.254 43.176 44.221 1.00 32.80  ? 427 ASP B O     1 
ATOM   2672 C  CB    . ASP B 1 186 ? -22.483 40.379 43.046 1.00 30.50  ? 427 ASP B CB    1 
ATOM   2673 C  CG    . ASP B 1 186 ? -23.192 39.716 44.213 1.00 34.95  ? 427 ASP B CG    1 
ATOM   2674 O  OD1   . ASP B 1 186 ? -23.344 40.347 45.277 1.00 37.46  ? 427 ASP B OD1   1 
ATOM   2675 O  OD2   . ASP B 1 186 ? -23.591 38.542 44.069 1.00 41.83  ? 427 ASP B OD2   1 
ATOM   2676 N  N     . VAL B 1 187 ? -24.990 41.818 42.602 1.00 27.25  ? 428 VAL B N     1 
ATOM   2677 C  CA    . VAL B 1 187 ? -26.388 42.129 42.874 1.00 26.93  ? 428 VAL B CA    1 
ATOM   2678 C  C     . VAL B 1 187 ? -27.150 40.863 43.231 1.00 30.04  ? 428 VAL B C     1 
ATOM   2679 O  O     . VAL B 1 187 ? -27.130 39.891 42.477 1.00 33.91  ? 428 VAL B O     1 
ATOM   2680 C  CB    . VAL B 1 187 ? -27.073 42.807 41.677 1.00 30.69  ? 428 VAL B CB    1 
ATOM   2681 C  CG1   . VAL B 1 187 ? -28.545 43.016 41.966 1.00 27.79  ? 428 VAL B CG1   1 
ATOM   2682 C  CG2   . VAL B 1 187 ? -26.403 44.131 41.356 1.00 34.01  ? 428 VAL B CG2   1 
ATOM   2683 N  N     . ASP B 1 188 ? -27.813 40.873 44.383 1.00 29.94  ? 429 ASP B N     1 
ATOM   2684 C  CA    . ASP B 1 188 ? -28.603 39.729 44.827 1.00 28.63  ? 429 ASP B CA    1 
ATOM   2685 C  C     . ASP B 1 188 ? -30.093 40.053 44.755 1.00 30.61  ? 429 ASP B C     1 
ATOM   2686 O  O     . ASP B 1 188 ? -30.580 40.928 45.470 1.00 32.67  ? 429 ASP B O     1 
ATOM   2687 C  CB    . ASP B 1 188 ? -28.217 39.329 46.249 1.00 31.01  ? 429 ASP B CB    1 
ATOM   2688 C  CG    . ASP B 1 188 ? -26.731 39.090 46.404 1.00 34.38  ? 429 ASP B CG    1 
ATOM   2689 O  OD1   . ASP B 1 188 ? -25.997 40.069 46.650 1.00 33.97  ? 429 ASP B OD1   1 
ATOM   2690 O  OD2   . ASP B 1 188 ? -26.295 37.925 46.292 1.00 35.12  ? 429 ASP B OD2   1 
ATOM   2691 N  N     . VAL B 1 189 ? -30.815 39.352 43.888 1.00 30.48  ? 430 VAL B N     1 
ATOM   2692 C  CA    . VAL B 1 189 ? -32.225 39.648 43.676 1.00 28.96  ? 430 VAL B CA    1 
ATOM   2693 C  C     . VAL B 1 189 ? -33.119 38.506 44.116 1.00 30.16  ? 430 VAL B C     1 
ATOM   2694 O  O     . VAL B 1 189 ? -32.983 37.385 43.637 1.00 38.32  ? 430 VAL B O     1 
ATOM   2695 C  CB    . VAL B 1 189 ? -32.521 39.947 42.204 1.00 34.87  ? 430 VAL B CB    1 
ATOM   2696 C  CG1   . VAL B 1 189 ? -33.959 40.431 42.049 1.00 35.57  ? 430 VAL B CG1   1 
ATOM   2697 C  CG2   . VAL B 1 189 ? -31.539 40.974 41.668 1.00 26.96  ? 430 VAL B CG2   1 
ATOM   2698 N  N     . ALA B 1 190 ? -34.037 38.795 45.028 1.00 34.49  ? 431 ALA B N     1 
ATOM   2699 C  CA    . ALA B 1 190 ? -34.998 37.799 45.479 1.00 32.21  ? 431 ALA B CA    1 
ATOM   2700 C  C     . ALA B 1 190 ? -36.338 38.048 44.803 1.00 33.70  ? 431 ALA B C     1 
ATOM   2701 O  O     . ALA B 1 190 ? -36.769 39.192 44.663 1.00 32.91  ? 431 ALA B O     1 
ATOM   2702 C  CB    . ALA B 1 190 ? -35.138 37.831 46.985 1.00 21.52  ? 431 ALA B CB    1 
ATOM   2703 N  N     . ILE B 1 191 ? -36.985 36.974 44.363 1.00 40.03  ? 432 ILE B N     1 
ATOM   2704 C  CA    . ILE B 1 191 ? -38.253 37.087 43.650 1.00 41.74  ? 432 ILE B CA    1 
ATOM   2705 C  C     . ILE B 1 191 ? -39.323 36.197 44.273 1.00 38.29  ? 432 ILE B C     1 
ATOM   2706 O  O     . ILE B 1 191 ? -39.069 35.033 44.587 1.00 37.35  ? 432 ILE B O     1 
ATOM   2707 C  CB    . ILE B 1 191 ? -38.100 36.716 42.161 1.00 39.51  ? 432 ILE B CB    1 
ATOM   2708 C  CG1   . ILE B 1 191 ? -36.968 37.522 41.518 1.00 40.79  ? 432 ILE B CG1   1 
ATOM   2709 C  CG2   . ILE B 1 191 ? -39.400 36.946 41.420 1.00 38.07  ? 432 ILE B CG2   1 
ATOM   2710 C  CD1   . ILE B 1 191 ? -36.797 37.265 40.037 1.00 44.11  ? 432 ILE B CD1   1 
ATOM   2711 N  N     . THR B 1 192 ? -40.519 36.748 44.454 1.00 36.14  ? 433 THR B N     1 
ATOM   2712 C  CA    . THR B 1 192 ? -41.636 35.970 44.975 1.00 37.75  ? 433 THR B CA    1 
ATOM   2713 C  C     . THR B 1 192 ? -42.970 36.540 44.510 1.00 42.87  ? 433 THR B C     1 
ATOM   2714 O  O     . THR B 1 192 ? -43.016 37.592 43.869 1.00 47.14  ? 433 THR B O     1 
ATOM   2715 C  CB    . THR B 1 192 ? -41.622 35.923 46.511 1.00 39.03  ? 433 THR B CB    1 
ATOM   2716 O  OG1   . THR B 1 192 ? -42.519 34.903 46.965 1.00 41.88  ? 433 THR B OG1   1 
ATOM   2717 C  CG2   . THR B 1 192 ? -42.038 37.268 47.094 1.00 35.78  ? 433 THR B CG2   1 
ATOM   2718 N  N     . HIS B 1 193 ? -44.052 35.837 44.831 1.00 40.89  ? 434 HIS B N     1 
ATOM   2719 C  CA    . HIS B 1 193 ? -45.395 36.335 44.560 1.00 43.27  ? 434 HIS B CA    1 
ATOM   2720 C  C     . HIS B 1 193 ? -46.253 36.201 45.814 1.00 45.18  ? 434 HIS B C     1 
ATOM   2721 O  O     . HIS B 1 193 ? -46.176 35.193 46.518 1.00 44.09  ? 434 HIS B O     1 
ATOM   2722 C  CB    . HIS B 1 193 ? -46.031 35.585 43.387 1.00 45.15  ? 434 HIS B CB    1 
ATOM   2723 C  CG    . HIS B 1 193 ? -47.162 36.324 42.742 1.00 52.51  ? 434 HIS B CG    1 
ATOM   2724 N  ND1   . HIS B 1 193 ? -48.359 36.568 43.384 1.00 52.51  ? 434 HIS B ND1   1 
ATOM   2725 C  CD2   . HIS B 1 193 ? -47.280 36.878 41.511 1.00 55.23  ? 434 HIS B CD2   1 
ATOM   2726 C  CE1   . HIS B 1 193 ? -49.161 37.238 42.579 1.00 53.28  ? 434 HIS B CE1   1 
ATOM   2727 N  NE2   . HIS B 1 193 ? -48.532 37.438 41.434 1.00 55.58  ? 434 HIS B NE2   1 
ATOM   2728 N  N     . PRO B 1 194 ? -47.062 37.228 46.108 1.00 44.31  ? 435 PRO B N     1 
ATOM   2729 C  CA    . PRO B 1 194 ? -47.898 37.216 47.314 1.00 47.48  ? 435 PRO B CA    1 
ATOM   2730 C  C     . PRO B 1 194 ? -49.003 36.156 47.300 1.00 50.19  ? 435 PRO B C     1 
ATOM   2731 O  O     . PRO B 1 194 ? -49.488 35.792 48.371 1.00 48.15  ? 435 PRO B O     1 
ATOM   2732 C  CB    . PRO B 1 194 ? -48.505 38.623 47.330 1.00 44.81  ? 435 PRO B CB    1 
ATOM   2733 C  CG    . PRO B 1 194 ? -47.554 39.454 46.540 1.00 46.46  ? 435 PRO B CG    1 
ATOM   2734 C  CD    . PRO B 1 194 ? -47.053 38.550 45.459 1.00 44.77  ? 435 PRO B CD    1 
ATOM   2735 N  N     . ASP B 1 195 ? -49.395 35.671 46.124 1.00 51.28  ? 436 ASP B N     1 
ATOM   2736 C  CA    . ASP B 1 195 ? -50.482 34.697 46.046 1.00 50.84  ? 436 ASP B CA    1 
ATOM   2737 C  C     . ASP B 1 195 ? -50.038 33.322 46.544 1.00 56.47  ? 436 ASP B C     1 
ATOM   2738 O  O     . ASP B 1 195 ? -50.861 32.484 46.909 1.00 61.97  ? 436 ASP B O     1 
ATOM   2739 C  CB    . ASP B 1 195 ? -51.031 34.602 44.615 1.00 53.28  ? 436 ASP B CB    1 
ATOM   2740 C  CG    . ASP B 1 195 ? -50.070 33.924 43.639 1.00 63.18  ? 436 ASP B CG    1 
ATOM   2741 O  OD1   . ASP B 1 195 ? -48.933 33.565 44.014 1.00 60.29  ? 436 ASP B OD1   1 
ATOM   2742 O  OD2   . ASP B 1 195 ? -50.469 33.752 42.468 1.00 63.65  ? 436 ASP B OD2   1 
ATOM   2743 N  N     . GLY B 1 196 ? -48.728 33.098 46.542 1.00 52.91  ? 437 GLY B N     1 
ATOM   2744 C  CA    . GLY B 1 196 ? -48.163 31.871 47.063 1.00 52.20  ? 437 GLY B CA    1 
ATOM   2745 C  C     . GLY B 1 196 ? -47.987 30.770 46.035 1.00 62.19  ? 437 GLY B C     1 
ATOM   2746 O  O     . GLY B 1 196 ? -47.519 29.680 46.363 1.00 65.28  ? 437 GLY B O     1 
ATOM   2747 N  N     . ARG B 1 197 ? -48.350 31.037 44.786 1.00 61.47  ? 438 ARG B N     1 
ATOM   2748 C  CA    . ARG B 1 197 ? -48.257 29.992 43.774 1.00 66.20  ? 438 ARG B CA    1 
ATOM   2749 C  C     . ARG B 1 197 ? -47.696 30.473 42.435 1.00 60.49  ? 438 ARG B C     1 
ATOM   2750 O  O     . ARG B 1 197 ? -47.113 29.685 41.692 1.00 61.86  ? 438 ARG B O     1 
ATOM   2751 C  CB    . ARG B 1 197 ? -49.632 29.346 43.564 1.00 75.42  ? 438 ARG B CB    1 
ATOM   2752 C  CG    . ARG B 1 197 ? -50.687 30.274 42.981 1.00 77.03  ? 438 ARG B CG    1 
ATOM   2753 C  CD    . ARG B 1 197 ? -52.040 29.580 42.849 1.00 87.77  ? 438 ARG B CD    1 
ATOM   2754 N  NE    . ARG B 1 197 ? -53.031 30.444 42.211 1.00 95.94  ? 438 ARG B NE    1 
ATOM   2755 C  CZ    . ARG B 1 197 ? -53.762 31.349 42.856 1.00 94.50  ? 438 ARG B CZ    1 
ATOM   2756 N  NH1   . ARG B 1 197 ? -53.618 31.512 44.165 1.00 86.96  ? 438 ARG B NH1   1 
ATOM   2757 N  NH2   . ARG B 1 197 ? -54.637 32.093 42.192 1.00 92.71  ? 438 ARG B NH2   1 
ATOM   2758 N  N     . SER B 1 198 ? -47.855 31.757 42.126 1.00 52.93  ? 439 SER B N     1 
ATOM   2759 C  CA    . SER B 1 198 ? -47.424 32.272 40.826 1.00 59.04  ? 439 SER B CA    1 
ATOM   2760 C  C     . SER B 1 198 ? -45.906 32.337 40.688 1.00 58.29  ? 439 SER B C     1 
ATOM   2761 O  O     . SER B 1 198 ? -45.387 32.569 39.597 1.00 64.17  ? 439 SER B O     1 
ATOM   2762 C  CB    . SER B 1 198 ? -48.015 33.660 40.571 1.00 57.31  ? 439 SER B CB    1 
ATOM   2763 O  OG    . SER B 1 198 ? -49.426 33.604 40.454 1.00 55.50  ? 439 SER B OG    1 
ATOM   2764 N  N     . HIS B 1 199 ? -45.197 32.130 41.792 1.00 55.24  ? 440 HIS B N     1 
ATOM   2765 C  CA    . HIS B 1 199 ? -43.746 32.234 41.785 1.00 48.99  ? 440 HIS B CA    1 
ATOM   2766 C  C     . HIS B 1 199 ? -43.104 31.099 40.998 1.00 53.29  ? 440 HIS B C     1 
ATOM   2767 O  O     . HIS B 1 199 ? -42.032 31.269 40.422 1.00 61.84  ? 440 HIS B O     1 
ATOM   2768 C  CB    . HIS B 1 199 ? -43.199 32.259 43.215 1.00 53.88  ? 440 HIS B CB    1 
ATOM   2769 C  CG    . HIS B 1 199 ? -43.442 30.998 43.985 1.00 51.96  ? 440 HIS B CG    1 
ATOM   2770 N  ND1   . HIS B 1 199 ? -44.520 30.838 44.830 1.00 54.75  ? 440 HIS B ND1   1 
ATOM   2771 C  CD2   . HIS B 1 199 ? -42.738 29.843 44.051 1.00 47.16  ? 440 HIS B CD2   1 
ATOM   2772 C  CE1   . HIS B 1 199 ? -44.473 29.635 45.376 1.00 54.46  ? 440 HIS B CE1   1 
ATOM   2773 N  NE2   . HIS B 1 199 ? -43.402 29.011 44.919 1.00 49.73  ? 440 HIS B NE2   1 
ATOM   2774 N  N     . ARG B 1 200 ? -43.754 29.941 40.968 1.00 56.06  ? 441 ARG B N     1 
ATOM   2775 C  CA    . ARG B 1 200 ? -43.213 28.812 40.217 1.00 68.13  ? 441 ARG B CA    1 
ATOM   2776 C  C     . ARG B 1 200 ? -43.679 28.841 38.759 1.00 65.31  ? 441 ARG B C     1 
ATOM   2777 O  O     . ARG B 1 200 ? -44.781 29.304 38.453 1.00 51.14  ? 441 ARG B O     1 
ATOM   2778 C  CB    . ARG B 1 200 ? -43.594 27.482 40.882 1.00 63.79  ? 441 ARG B CB    1 
ATOM   2779 C  CG    . ARG B 1 200 ? -44.885 27.526 41.680 1.00 66.75  ? 441 ARG B CG    1 
ATOM   2780 C  CD    . ARG B 1 200 ? -45.092 26.257 42.495 1.00 70.37  ? 441 ARG B CD    1 
ATOM   2781 N  NE    . ARG B 1 200 ? -46.336 26.301 43.263 1.00 80.39  ? 441 ARG B NE    1 
ATOM   2782 C  CZ    . ARG B 1 200 ? -47.495 25.792 42.850 1.00 85.42  ? 441 ARG B CZ    1 
ATOM   2783 N  NH1   . ARG B 1 200 ? -47.581 25.190 41.670 1.00 79.61  ? 441 ARG B NH1   1 
ATOM   2784 N  NH2   . ARG B 1 200 ? -48.571 25.882 43.620 1.00 86.08  ? 441 ARG B NH2   1 
ATOM   2785 N  N     . GLY B 1 201 ? -42.816 28.368 37.865 1.00 60.15  ? 442 GLY B N     1 
ATOM   2786 C  CA    . GLY B 1 201 ? -43.131 28.311 36.451 1.00 61.61  ? 442 GLY B CA    1 
ATOM   2787 C  C     . GLY B 1 201 ? -42.701 29.535 35.662 1.00 73.39  ? 442 GLY B C     1 
ATOM   2788 O  O     . GLY B 1 201 ? -42.989 29.641 34.467 1.00 76.48  ? 442 GLY B O     1 
ATOM   2789 N  N     . ILE B 1 202 ? -42.009 30.462 36.317 1.00 70.97  ? 443 ILE B N     1 
ATOM   2790 C  CA    . ILE B 1 202 ? -41.572 31.682 35.642 1.00 68.14  ? 443 ILE B CA    1 
ATOM   2791 C  C     . ILE B 1 202 ? -40.052 31.766 35.539 1.00 68.08  ? 443 ILE B C     1 
ATOM   2792 O  O     . ILE B 1 202 ? -39.520 32.428 34.647 1.00 68.35  ? 443 ILE B O     1 
ATOM   2793 C  CB    . ILE B 1 202 ? -42.099 32.947 36.359 1.00 58.85  ? 443 ILE B CB    1 
ATOM   2794 C  CG1   . ILE B 1 202 ? -41.575 33.019 37.795 1.00 57.38  ? 443 ILE B CG1   1 
ATOM   2795 C  CG2   . ILE B 1 202 ? -43.618 32.981 36.344 1.00 61.39  ? 443 ILE B CG2   1 
ATOM   2796 C  CD1   . ILE B 1 202 ? -40.450 34.011 37.992 1.00 54.22  ? 443 ILE B CD1   1 
ATOM   2797 N  N     . PHE B 1 203 ? -39.363 31.083 36.447 1.00 64.49  ? 444 PHE B N     1 
ATOM   2798 C  CA    . PHE B 1 203 ? -37.916 31.210 36.580 1.00 58.37  ? 444 PHE B CA    1 
ATOM   2799 C  C     . PHE B 1 203 ? -37.154 30.885 35.299 1.00 60.75  ? 444 PHE B C     1 
ATOM   2800 O  O     . PHE B 1 203 ? -36.365 31.699 34.821 1.00 61.37  ? 444 PHE B O     1 
ATOM   2801 C  CB    . PHE B 1 203 ? -37.423 30.317 37.712 1.00 57.45  ? 444 PHE B CB    1 
ATOM   2802 C  CG    . PHE B 1 203 ? -35.969 30.483 38.020 1.00 59.48  ? 444 PHE B CG    1 
ATOM   2803 C  CD1   . PHE B 1 203 ? -35.507 31.641 38.616 1.00 52.65  ? 444 PHE B CD1   1 
ATOM   2804 C  CD2   . PHE B 1 203 ? -35.066 29.475 37.732 1.00 69.47  ? 444 PHE B CD2   1 
ATOM   2805 C  CE1   . PHE B 1 203 ? -34.175 31.802 38.911 1.00 54.35  ? 444 PHE B CE1   1 
ATOM   2806 C  CE2   . PHE B 1 203 ? -33.726 29.628 38.027 1.00 71.61  ? 444 PHE B CE2   1 
ATOM   2807 C  CZ    . PHE B 1 203 ? -33.282 30.794 38.619 1.00 68.05  ? 444 PHE B CZ    1 
ATOM   2808 N  N     . SER B 1 204 ? -37.391 29.699 34.746 1.00 66.00  ? 445 SER B N     1 
ATOM   2809 C  CA    . SER B 1 204 ? -36.708 29.279 33.525 1.00 68.60  ? 445 SER B CA    1 
ATOM   2810 C  C     . SER B 1 204 ? -37.027 30.214 32.365 1.00 64.82  ? 445 SER B C     1 
ATOM   2811 O  O     . SER B 1 204 ? -36.143 30.572 31.584 1.00 58.81  ? 445 SER B O     1 
ATOM   2812 C  CB    . SER B 1 204 ? -37.088 27.843 33.164 1.00 61.51  ? 445 SER B CB    1 
ATOM   2813 O  OG    . SER B 1 204 ? -36.613 26.937 34.143 1.00 70.50  ? 445 SER B OG    1 
ATOM   2814 N  N     . ARG B 1 205 ? -38.290 30.614 32.269 1.00 62.10  ? 446 ARG B N     1 
ATOM   2815 C  CA    . ARG B 1 205 ? -38.731 31.522 31.217 1.00 66.29  ? 446 ARG B CA    1 
ATOM   2816 C  C     . ARG B 1 205 ? -38.103 32.901 31.387 1.00 57.30  ? 446 ARG B C     1 
ATOM   2817 O  O     . ARG B 1 205 ? -37.852 33.603 30.409 1.00 53.88  ? 446 ARG B O     1 
ATOM   2818 C  CB    . ARG B 1 205 ? -40.260 31.636 31.210 1.00 76.98  ? 446 ARG B CB    1 
ATOM   2819 C  CG    . ARG B 1 205 ? -40.983 30.361 30.780 1.00 82.48  ? 446 ARG B CG    1 
ATOM   2820 C  CD    . ARG B 1 205 ? -42.501 30.517 30.854 1.00 89.74  ? 446 ARG B CD    1 
ATOM   2821 N  NE    . ARG B 1 205 ? -43.001 31.548 29.945 1.00 100.27 ? 446 ARG B NE    1 
ATOM   2822 C  CZ    . ARG B 1 205 ? -43.287 31.349 28.660 1.00 100.97 ? 446 ARG B CZ    1 
ATOM   2823 N  NH1   . ARG B 1 205 ? -43.126 30.149 28.114 1.00 99.06  ? 446 ARG B NH1   1 
ATOM   2824 N  NH2   . ARG B 1 205 ? -43.736 32.353 27.918 1.00 88.23  ? 446 ARG B NH2   1 
ATOM   2825 N  N     . LEU B 1 206 ? -37.846 33.279 32.634 1.00 61.69  ? 447 LEU B N     1 
ATOM   2826 C  CA    . LEU B 1 206 ? -37.258 34.579 32.938 1.00 60.79  ? 447 LEU B CA    1 
ATOM   2827 C  C     . LEU B 1 206 ? -35.790 34.647 32.535 1.00 58.35  ? 447 LEU B C     1 
ATOM   2828 O  O     . LEU B 1 206 ? -35.344 35.632 31.944 1.00 53.60  ? 447 LEU B O     1 
ATOM   2829 C  CB    . LEU B 1 206 ? -37.393 34.894 34.426 1.00 57.18  ? 447 LEU B CB    1 
ATOM   2830 C  CG    . LEU B 1 206 ? -36.747 36.204 34.876 1.00 50.22  ? 447 LEU B CG    1 
ATOM   2831 C  CD1   . LEU B 1 206 ? -37.325 37.366 34.090 1.00 53.92  ? 447 LEU B CD1   1 
ATOM   2832 C  CD2   . LEU B 1 206 ? -36.947 36.413 36.366 1.00 46.69  ? 447 LEU B CD2   1 
ATOM   2833 N  N     . LEU B 1 207 ? -35.045 33.597 32.865 1.00 54.35  ? 448 LEU B N     1 
ATOM   2834 C  CA    . LEU B 1 207 ? -33.621 33.540 32.568 1.00 52.52  ? 448 LEU B CA    1 
ATOM   2835 C  C     . LEU B 1 207 ? -33.345 33.677 31.073 1.00 59.28  ? 448 LEU B C     1 
ATOM   2836 O  O     . LEU B 1 207 ? -32.550 34.524 30.663 1.00 61.44  ? 448 LEU B O     1 
ATOM   2837 C  CB    . LEU B 1 207 ? -33.018 32.238 33.094 1.00 55.71  ? 448 LEU B CB    1 
ATOM   2838 C  CG    . LEU B 1 207 ? -32.900 32.096 34.612 1.00 54.06  ? 448 LEU B CG    1 
ATOM   2839 C  CD1   . LEU B 1 207 ? -32.193 30.798 34.972 1.00 56.84  ? 448 LEU B CD1   1 
ATOM   2840 C  CD2   . LEU B 1 207 ? -32.172 33.290 35.211 1.00 51.98  ? 448 LEU B CD2   1 
ATOM   2841 N  N     . ASP B 1 208 ? -34.000 32.853 30.259 1.00 57.69  ? 449 ASP B N     1 
ATOM   2842 C  CA    . ASP B 1 208 ? -33.776 32.901 28.817 1.00 60.98  ? 449 ASP B CA    1 
ATOM   2843 C  C     . ASP B 1 208 ? -34.248 34.234 28.242 1.00 59.36  ? 449 ASP B C     1 
ATOM   2844 O  O     . ASP B 1 208 ? -33.649 34.758 27.300 1.00 58.18  ? 449 ASP B O     1 
ATOM   2845 C  CB    . ASP B 1 208 ? -34.474 31.734 28.107 1.00 65.95  ? 449 ASP B CB    1 
ATOM   2846 C  CG    . ASP B 1 208 ? -33.979 30.374 28.583 1.00 77.32  ? 449 ASP B CG    1 
ATOM   2847 O  OD1   . ASP B 1 208 ? -32.801 30.036 28.330 1.00 74.77  ? 449 ASP B OD1   1 
ATOM   2848 O  OD2   . ASP B 1 208 ? -34.775 29.635 29.199 1.00 85.67  ? 449 ASP B OD2   1 
ATOM   2849 N  N     . SER B 1 209 ? -35.311 34.785 28.820 1.00 51.31  ? 450 SER B N     1 
ATOM   2850 C  CA    . SER B 1 209 ? -35.802 36.098 28.419 1.00 50.91  ? 450 SER B CA    1 
ATOM   2851 C  C     . SER B 1 209 ? -34.722 37.154 28.625 1.00 54.48  ? 450 SER B C     1 
ATOM   2852 O  O     . SER B 1 209 ? -34.607 38.106 27.849 1.00 50.12  ? 450 SER B O     1 
ATOM   2853 C  CB    . SER B 1 209 ? -37.060 36.468 29.205 1.00 50.30  ? 450 SER B CB    1 
ATOM   2854 O  OG    . SER B 1 209 ? -37.460 37.800 28.929 1.00 48.03  ? 450 SER B OG    1 
ATOM   2855 N  N     . LEU B 1 210 ? -33.931 36.970 29.677 1.00 51.06  ? 451 LEU B N     1 
ATOM   2856 C  CA    . LEU B 1 210 ? -32.804 37.847 29.957 1.00 49.78  ? 451 LEU B CA    1 
ATOM   2857 C  C     . LEU B 1 210 ? -31.627 37.524 29.042 1.00 51.40  ? 451 LEU B C     1 
ATOM   2858 O  O     . LEU B 1 210 ? -30.806 38.391 28.748 1.00 52.96  ? 451 LEU B O     1 
ATOM   2859 C  CB    . LEU B 1 210 ? -32.384 37.730 31.423 1.00 50.05  ? 451 LEU B CB    1 
ATOM   2860 C  CG    . LEU B 1 210 ? -33.419 38.184 32.455 1.00 52.05  ? 451 LEU B CG    1 
ATOM   2861 C  CD1   . LEU B 1 210 ? -32.993 37.783 33.861 1.00 42.50  ? 451 LEU B CD1   1 
ATOM   2862 C  CD2   . LEU B 1 210 ? -33.648 39.687 32.362 1.00 43.90  ? 451 LEU B CD2   1 
ATOM   2863 N  N     . ARG B 1 211 ? -31.547 36.276 28.594 1.00 49.15  ? 452 ARG B N     1 
ATOM   2864 C  CA    . ARG B 1 211 ? -30.488 35.869 27.678 1.00 49.57  ? 452 ARG B CA    1 
ATOM   2865 C  C     . ARG B 1 211 ? -30.727 36.422 26.278 1.00 52.49  ? 452 ARG B C     1 
ATOM   2866 O  O     . ARG B 1 211 ? -29.808 36.940 25.643 1.00 54.76  ? 452 ARG B O     1 
ATOM   2867 C  CB    . ARG B 1 211 ? -30.378 34.348 27.621 1.00 55.47  ? 452 ARG B CB    1 
ATOM   2868 C  CG    . ARG B 1 211 ? -29.888 33.710 28.903 1.00 51.66  ? 452 ARG B CG    1 
ATOM   2869 C  CD    . ARG B 1 211 ? -29.669 32.224 28.708 1.00 50.10  ? 452 ARG B CD    1 
ATOM   2870 N  NE    . ARG B 1 211 ? -29.243 31.567 29.938 1.00 56.37  ? 452 ARG B NE    1 
ATOM   2871 C  CZ    . ARG B 1 211 ? -30.071 30.981 30.795 1.00 52.20  ? 452 ARG B CZ    1 
ATOM   2872 N  NH1   . ARG B 1 211 ? -31.373 30.967 30.553 1.00 55.36  ? 452 ARG B NH1   1 
ATOM   2873 N  NH2   . ARG B 1 211 ? -29.597 30.405 31.890 1.00 51.10  ? 452 ARG B NH2   1 
ATOM   2874 N  N     . GLN B 1 212 ? -31.962 36.309 25.799 1.00 53.52  ? 453 GLN B N     1 
ATOM   2875 C  CA    . GLN B 1 212 ? -32.312 36.820 24.477 1.00 56.04  ? 453 GLN B CA    1 
ATOM   2876 C  C     . GLN B 1 212 ? -32.080 38.322 24.411 1.00 54.41  ? 453 GLN B C     1 
ATOM   2877 O  O     . GLN B 1 212 ? -31.643 38.849 23.389 1.00 57.31  ? 453 GLN B O     1 
ATOM   2878 C  CB    . GLN B 1 212 ? -33.771 36.504 24.130 1.00 56.94  ? 453 GLN B CB    1 
ATOM   2879 C  CG    . GLN B 1 212 ? -34.141 35.029 24.204 1.00 56.51  ? 453 GLN B CG    1 
ATOM   2880 C  CD    . GLN B 1 212 ? -33.237 34.152 23.366 1.00 53.94  ? 453 GLN B CD    1 
ATOM   2881 O  OE1   . GLN B 1 212 ? -32.881 34.504 22.241 1.00 56.74  ? 453 GLN B OE1   1 
ATOM   2882 N  NE2   . GLN B 1 212 ? -32.852 33.004 23.914 1.00 53.06  ? 453 GLN B NE2   1 
ATOM   2883 N  N     . GLU B 1 213 ? -32.374 39.000 25.518 1.00 60.78  ? 454 GLU B N     1 
ATOM   2884 C  CA    . GLU B 1 213 ? -32.241 40.450 25.607 1.00 60.59  ? 454 GLU B CA    1 
ATOM   2885 C  C     . GLU B 1 213 ? -30.776 40.869 25.574 1.00 55.24  ? 454 GLU B C     1 
ATOM   2886 O  O     . GLU B 1 213 ? -30.459 42.033 25.331 1.00 56.18  ? 454 GLU B O     1 
ATOM   2887 C  CB    . GLU B 1 213 ? -32.911 40.969 26.884 1.00 56.59  ? 454 GLU B CB    1 
ATOM   2888 C  CG    . GLU B 1 213 ? -33.483 42.382 26.778 1.00 75.09  ? 454 GLU B CG    1 
ATOM   2889 C  CD    . GLU B 1 213 ? -33.828 42.984 28.138 1.00 84.91  ? 454 GLU B CD    1 
ATOM   2890 O  OE1   . GLU B 1 213 ? -32.933 43.582 28.778 1.00 68.41  ? 454 GLU B OE1   1 
ATOM   2891 O  OE2   . GLU B 1 213 ? -34.995 42.856 28.570 1.00 88.02  ? 454 GLU B OE2   1 
ATOM   2892 N  N     . GLY B 1 214 ? -29.887 39.910 25.816 1.00 48.74  ? 455 GLY B N     1 
ATOM   2893 C  CA    . GLY B 1 214 ? -28.463 40.178 25.845 1.00 44.26  ? 455 GLY B CA    1 
ATOM   2894 C  C     . GLY B 1 214 ? -27.976 40.571 27.227 1.00 50.21  ? 455 GLY B C     1 
ATOM   2895 O  O     . GLY B 1 214 ? -26.808 40.914 27.404 1.00 50.26  ? 455 GLY B O     1 
ATOM   2896 N  N     . PHE B 1 215 ? -28.870 40.516 28.210 1.00 52.57  ? 456 PHE B N     1 
ATOM   2897 C  CA    . PHE B 1 215 ? -28.543 40.934 29.571 1.00 45.63  ? 456 PHE B CA    1 
ATOM   2898 C  C     . PHE B 1 215 ? -27.680 39.905 30.303 1.00 44.32  ? 456 PHE B C     1 
ATOM   2899 O  O     . PHE B 1 215 ? -26.728 40.269 30.983 1.00 45.69  ? 456 PHE B O     1 
ATOM   2900 C  CB    . PHE B 1 215 ? -29.822 41.207 30.370 1.00 47.71  ? 456 PHE B CB    1 
ATOM   2901 C  CG    . PHE B 1 215 ? -29.569 41.703 31.769 1.00 45.73  ? 456 PHE B CG    1 
ATOM   2902 C  CD1   . PHE B 1 215 ? -29.081 42.982 31.988 1.00 41.15  ? 456 PHE B CD1   1 
ATOM   2903 C  CD2   . PHE B 1 215 ? -29.823 40.893 32.865 1.00 46.12  ? 456 PHE B CD2   1 
ATOM   2904 C  CE1   . PHE B 1 215 ? -28.845 43.443 33.270 1.00 36.87  ? 456 PHE B CE1   1 
ATOM   2905 C  CE2   . PHE B 1 215 ? -29.591 41.349 34.153 1.00 39.39  ? 456 PHE B CE2   1 
ATOM   2906 C  CZ    . PHE B 1 215 ? -29.102 42.625 34.354 1.00 35.73  ? 456 PHE B CZ    1 
ATOM   2907 N  N     . LEU B 1 216 ? -28.017 38.626 30.173 1.00 44.83  ? 457 LEU B N     1 
ATOM   2908 C  CA    . LEU B 1 216 ? -27.235 37.569 30.808 1.00 45.44  ? 457 LEU B CA    1 
ATOM   2909 C  C     . LEU B 1 216 ? -26.149 37.063 29.869 1.00 43.53  ? 457 LEU B C     1 
ATOM   2910 O  O     . LEU B 1 216 ? -26.434 36.451 28.844 1.00 49.69  ? 457 LEU B O     1 
ATOM   2911 C  CB    . LEU B 1 216 ? -28.134 36.411 31.250 1.00 46.76  ? 457 LEU B CB    1 
ATOM   2912 C  CG    . LEU B 1 216 ? -29.041 36.659 32.454 1.00 45.77  ? 457 LEU B CG    1 
ATOM   2913 C  CD1   . LEU B 1 216 ? -29.782 35.390 32.823 1.00 49.39  ? 457 LEU B CD1   1 
ATOM   2914 C  CD2   . LEU B 1 216 ? -28.229 37.158 33.631 1.00 51.36  ? 457 LEU B CD2   1 
ATOM   2915 N  N     . THR B 1 217 ? -24.899 37.316 30.236 1.00 43.05  ? 458 THR B N     1 
ATOM   2916 C  CA    . THR B 1 217 ? -23.762 37.002 29.383 1.00 43.22  ? 458 THR B CA    1 
ATOM   2917 C  C     . THR B 1 217 ? -23.147 35.636 29.690 1.00 40.60  ? 458 THR B C     1 
ATOM   2918 O  O     . THR B 1 217 ? -22.719 34.927 28.786 1.00 43.69  ? 458 THR B O     1 
ATOM   2919 C  CB    . THR B 1 217 ? -22.672 38.079 29.511 1.00 44.98  ? 458 THR B CB    1 
ATOM   2920 O  OG1   . THR B 1 217 ? -21.971 37.910 30.749 1.00 49.87  ? 458 THR B OG1   1 
ATOM   2921 C  CG2   . THR B 1 217 ? -23.287 39.464 29.478 1.00 35.32  ? 458 THR B CG2   1 
ATOM   2922 N  N     . ASP B 1 218 ? -23.050 35.277 30.948 1.00 45.85  ? 459 ASP B N     1 
ATOM   2923 C  CA    . ASP B 1 218 ? -22.471 34.008 31.333 1.00 50.12  ? 459 ASP B CA    1 
ATOM   2924 C  C     . ASP B 1 218 ? -23.237 33.417 32.476 1.00 48.66  ? 459 ASP B C     1 
ATOM   2925 O  O     . ASP B 1 218 ? -23.668 34.132 33.330 1.00 44.85  ? 459 ASP B O     1 
ATOM   2926 C  CB    . ASP B 1 218 ? -21.051 34.214 31.792 1.00 50.25  ? 459 ASP B CB    1 
ATOM   2927 C  CG    . ASP B 1 218 ? -20.177 34.702 30.720 1.00 51.39  ? 459 ASP B CG    1 
ATOM   2928 O  OD1   . ASP B 1 218 ? -19.472 33.881 30.150 1.00 56.25  ? 459 ASP B OD1   1 
ATOM   2929 O  OD2   . ASP B 1 218 ? -20.193 35.898 30.446 1.00 44.08  ? 459 ASP B OD2   1 
ATOM   2930 N  N     . ASP B 1 219 ? -23.376 32.103 32.505 1.00 47.84  ? 460 ASP B N     1 
ATOM   2931 C  CA    . ASP B 1 219 ? -24.114 31.429 33.556 1.00 45.47  ? 460 ASP B CA    1 
ATOM   2932 C  C     . ASP B 1 219 ? -23.212 30.597 34.388 1.00 49.41  ? 460 ASP B C     1 
ATOM   2933 O  O     . ASP B 1 219 ? -22.475 29.822 33.850 1.00 58.63  ? 460 ASP B O     1 
ATOM   2934 C  CB    . ASP B 1 219 ? -25.061 30.412 32.958 1.00 44.76  ? 460 ASP B CB    1 
ATOM   2935 C  CG    . ASP B 1 219 ? -26.298 31.007 32.392 1.00 56.00  ? 460 ASP B CG    1 
ATOM   2936 O  OD1   . ASP B 1 219 ? -26.630 32.140 32.719 1.00 57.73  ? 460 ASP B OD1   1 
ATOM   2937 O  OD2   . ASP B 1 219 ? -26.975 30.326 31.627 1.00 59.24  ? 460 ASP B OD2   1 
ATOM   2938 N  N     . LEU B 1 220 ? -23.264 30.724 35.700 1.00 49.27  ? 461 LEU B N     1 
ATOM   2939 C  CA    . LEU B 1 220 ? -22.435 29.891 36.546 1.00 51.53  ? 461 LEU B CA    1 
ATOM   2940 C  C     . LEU B 1 220 ? -23.237 28.746 37.107 1.00 54.81  ? 461 LEU B C     1 
ATOM   2941 O  O     . LEU B 1 220 ? -22.824 27.621 37.030 1.00 56.16  ? 461 LEU B O     1 
ATOM   2942 C  CB    . LEU B 1 220 ? -21.782 30.701 37.646 1.00 46.32  ? 461 LEU B CB    1 
ATOM   2943 C  CG    . LEU B 1 220 ? -21.304 29.904 38.840 1.00 59.62  ? 461 LEU B CG    1 
ATOM   2944 C  CD1   . LEU B 1 220 ? -20.712 28.589 38.412 1.00 62.59  ? 461 LEU B CD1   1 
ATOM   2945 C  CD2   . LEU B 1 220 ? -20.324 30.686 39.665 1.00 62.02  ? 461 LEU B CD2   1 
ATOM   2946 N  N     . VAL B 1 221 ? -24.393 29.034 37.672 1.00 60.70  ? 462 VAL B N     1 
ATOM   2947 C  CA    . VAL B 1 221 ? -25.244 27.996 38.204 1.00 59.43  ? 462 VAL B CA    1 
ATOM   2948 C  C     . VAL B 1 221 ? -26.505 28.176 37.435 1.00 64.27  ? 462 VAL B C     1 
ATOM   2949 O  O     . VAL B 1 221 ? -27.170 29.164 37.576 1.00 57.09  ? 462 VAL B O     1 
ATOM   2950 C  CB    . VAL B 1 221 ? -25.549 28.238 39.664 1.00 57.21  ? 462 VAL B CB    1 
ATOM   2951 C  CG1   . VAL B 1 221 ? -26.584 27.260 40.135 1.00 69.21  ? 462 VAL B CG1   1 
ATOM   2952 C  CG2   . VAL B 1 221 ? -24.302 28.093 40.491 1.00 56.74  ? 462 VAL B CG2   1 
ATOM   2953 N  N     . SER B 1 222 ? -26.842 27.198 36.626 1.00 74.02  ? 463 SER B N     1 
ATOM   2954 C  CA    . SER B 1 222 ? -27.993 27.298 35.759 1.00 77.98  ? 463 SER B CA    1 
ATOM   2955 C  C     . SER B 1 222 ? -29.325 27.436 36.422 1.00 75.63  ? 463 SER B C     1 
ATOM   2956 O  O     . SER B 1 222 ? -30.115 28.269 36.055 1.00 70.62  ? 463 SER B O     1 
ATOM   2957 C  CB    . SER B 1 222 ? -28.018 26.040 34.923 1.00 79.11  ? 463 SER B CB    1 
ATOM   2958 O  OG    . SER B 1 222 ? -27.505 24.965 35.693 1.00 88.79  ? 463 SER B OG    1 
ATOM   2959 N  N     . GLN B 1 223 ? -29.580 26.601 37.395 1.00 68.16  ? 464 GLN B N     1 
ATOM   2960 C  CA    . GLN B 1 223 ? -30.809 26.657 38.115 1.00 71.17  ? 464 GLN B CA    1 
ATOM   2961 C  C     . GLN B 1 223 ? -30.430 25.747 39.200 1.00 71.66  ? 464 GLN B C     1 
ATOM   2962 O  O     . GLN B 1 223 ? -29.533 24.955 39.024 1.00 69.50  ? 464 GLN B O     1 
ATOM   2963 C  CB    . GLN B 1 223 ? -31.923 26.033 37.300 1.00 71.54  ? 464 GLN B CB    1 
ATOM   2964 C  CG    . GLN B 1 223 ? -33.326 26.238 37.838 1.00 72.51  ? 464 GLN B CG    1 
ATOM   2965 C  CD    . GLN B 1 223 ? -34.388 25.897 36.815 1.00 81.80  ? 464 GLN B CD    1 
ATOM   2966 O  OE1   . GLN B 1 223 ? -35.173 24.977 37.001 1.00 77.63  ? 464 GLN B OE1   1 
ATOM   2967 N  NE2   . GLN B 1 223 ? -34.408 26.633 35.722 1.00 72.33  ? 464 GLN B NE2   1 
ATOM   2968 N  N     . GLU B 1 224 ? -31.101 25.829 40.323 1.00 76.83  ? 465 GLU B N     1 
ATOM   2969 C  CA    . GLU B 1 224 ? -30.797 24.938 41.410 1.00 70.21  ? 465 GLU B CA    1 
ATOM   2970 C  C     . GLU B 1 224 ? -32.013 24.888 42.236 1.00 66.91  ? 465 GLU B C     1 
ATOM   2971 O  O     . GLU B 1 224 ? -32.837 25.753 42.154 1.00 63.41  ? 465 GLU B O     1 
ATOM   2972 C  CB    . GLU B 1 224 ? -29.626 25.430 42.220 1.00 70.82  ? 465 GLU B CB    1 
ATOM   2973 C  CG    . GLU B 1 224 ? -28.988 24.349 43.043 1.00 78.05  ? 465 GLU B CG    1 
ATOM   2974 C  CD    . GLU B 1 224 ? -27.917 24.898 43.928 1.00 84.62  ? 465 GLU B CD    1 
ATOM   2975 O  OE1   . GLU B 1 224 ? -27.278 25.876 43.524 1.00 82.01  ? 465 GLU B OE1   1 
ATOM   2976 O  OE2   . GLU B 1 224 ? -27.720 24.354 45.026 1.00 84.61  ? 465 GLU B OE2   1 
ATOM   2977 N  N     . GLU B 1 225 ? -32.134 23.848 43.021 1.00 71.80  ? 466 GLU B N     1 
ATOM   2978 C  CA    . GLU B 1 225 ? -33.286 23.691 43.850 1.00 73.02  ? 466 GLU B CA    1 
ATOM   2979 C  C     . GLU B 1 225 ? -32.872 23.413 45.263 1.00 70.93  ? 466 GLU B C     1 
ATOM   2980 O  O     . GLU B 1 225 ? -32.127 22.491 45.511 1.00 67.43  ? 466 GLU B O     1 
ATOM   2981 C  CB    . GLU B 1 225 ? -34.128 22.554 43.276 1.00 83.33  ? 466 GLU B CB    1 
ATOM   2982 C  CG    . GLU B 1 225 ? -34.910 21.697 44.257 1.00 87.58  ? 466 GLU B CG    1 
ATOM   2983 C  CD    . GLU B 1 225 ? -35.761 20.660 43.555 1.00 87.84  ? 466 GLU B CD    1 
ATOM   2984 O  OE1   . GLU B 1 225 ? -36.514 21.034 42.632 1.00 78.98  ? 466 GLU B OE1   1 
ATOM   2985 O  OE2   . GLU B 1 225 ? -35.670 19.479 43.928 1.00 84.49  ? 466 GLU B OE2   1 
ATOM   2986 N  N     . ASN B 1 226 ? -33.374 24.230 46.177 1.00 66.96  ? 467 ASN B N     1 
ATOM   2987 C  CA    . ASN B 1 226 ? -33.154 24.089 47.590 1.00 57.78  ? 467 ASN B CA    1 
ATOM   2988 C  C     . ASN B 1 226 ? -34.562 24.210 48.052 1.00 54.54  ? 467 ASN B C     1 
ATOM   2989 O  O     . ASN B 1 226 ? -35.121 25.266 47.978 1.00 52.78  ? 467 ASN B O     1 
ATOM   2990 C  CB    . ASN B 1 226 ? -32.349 25.272 48.056 1.00 53.87  ? 467 ASN B CB    1 
ATOM   2991 C  CG    . ASN B 1 226 ? -31.921 25.170 49.486 1.00 63.16  ? 467 ASN B CG    1 
ATOM   2992 O  OD1   . ASN B 1 226 ? -31.840 24.098 50.050 1.00 65.07  ? 467 ASN B OD1   1 
ATOM   2993 N  ND2   . ASN B 1 226 ? -31.622 26.300 50.078 1.00 56.19  ? 467 ASN B ND2   1 
ATOM   2994 N  N     . GLY B 1 227 ? -35.158 23.134 48.515 1.00 51.24  ? 468 GLY B N     1 
ATOM   2995 C  CA    . GLY B 1 227 ? -36.534 23.187 48.949 1.00 50.74  ? 468 GLY B CA    1 
ATOM   2996 C  C     . GLY B 1 227 ? -37.367 23.734 47.817 1.00 57.56  ? 468 GLY B C     1 
ATOM   2997 O  O     . GLY B 1 227 ? -37.265 23.290 46.704 1.00 56.04  ? 468 GLY B O     1 
ATOM   2998 N  N     . GLN B 1 228 ? -38.203 24.709 48.114 1.00 57.05  ? 469 GLN B N     1 
ATOM   2999 C  CA    . GLN B 1 228 ? -39.009 25.372 47.100 1.00 53.67  ? 469 GLN B CA    1 
ATOM   3000 C  C     . GLN B 1 228 ? -38.261 26.548 46.489 1.00 58.13  ? 469 GLN B C     1 
ATOM   3001 O  O     . GLN B 1 228 ? -38.818 27.283 45.677 1.00 59.71  ? 469 GLN B O     1 
ATOM   3002 C  CB    . GLN B 1 228 ? -40.331 25.865 47.690 1.00 56.21  ? 469 GLN B CB    1 
ATOM   3003 C  CG    . GLN B 1 228 ? -41.155 24.799 48.393 1.00 65.89  ? 469 GLN B CG    1 
ATOM   3004 C  CD    . GLN B 1 228 ? -42.563 25.272 48.727 1.00 68.00  ? 469 GLN B CD    1 
ATOM   3005 O  OE1   . GLN B 1 228 ? -43.398 25.455 47.840 1.00 61.59  ? 469 GLN B OE1   1 
ATOM   3006 N  NE2   . GLN B 1 228 ? -42.827 25.481 50.013 1.00 57.44  ? 469 GLN B NE2   1 
ATOM   3007 N  N     . GLN B 1 229 ? -37.003 26.731 46.882 1.00 58.50  ? 470 GLN B N     1 
ATOM   3008 C  CA    . GLN B 1 229 ? -36.222 27.869 46.401 1.00 51.59  ? 470 GLN B CA    1 
ATOM   3009 C  C     . GLN B 1 229 ? -35.390 27.517 45.175 1.00 49.21  ? 470 GLN B C     1 
ATOM   3010 O  O     . GLN B 1 229 ? -34.709 26.496 45.153 1.00 47.74  ? 470 GLN B O     1 
ATOM   3011 C  CB    . GLN B 1 229 ? -35.306 28.400 47.505 1.00 52.66  ? 470 GLN B CB    1 
ATOM   3012 C  CG    . GLN B 1 229 ? -36.038 29.112 48.623 1.00 50.67  ? 470 GLN B CG    1 
ATOM   3013 C  CD    . GLN B 1 229 ? -35.097 29.847 49.551 1.00 46.80  ? 470 GLN B CD    1 
ATOM   3014 O  OE1   . GLN B 1 229 ? -33.901 29.942 49.288 1.00 49.93  ? 470 GLN B OE1   1 
ATOM   3015 N  NE2   . GLN B 1 229 ? -35.639 30.396 50.628 1.00 39.30  ? 470 GLN B NE2   1 
ATOM   3016 N  N     . GLN B 1 230 ? -35.460 28.372 44.159 1.00 53.18  ? 471 GLN B N     1 
ATOM   3017 C  CA    . GLN B 1 230 ? -34.679 28.206 42.938 1.00 52.13  ? 471 GLN B CA    1 
ATOM   3018 C  C     . GLN B 1 230 ? -33.630 29.301 42.878 1.00 51.13  ? 471 GLN B C     1 
ATOM   3019 O  O     . GLN B 1 230 ? -33.937 30.456 43.166 1.00 51.94  ? 471 GLN B O     1 
ATOM   3020 C  CB    . GLN B 1 230 ? -35.584 28.256 41.706 1.00 51.91  ? 471 GLN B CB    1 
ATOM   3021 C  CG    . GLN B 1 230 ? -36.245 26.931 41.355 1.00 50.98  ? 471 GLN B CG    1 
ATOM   3022 C  CD    . GLN B 1 230 ? -37.399 27.100 40.384 1.00 57.90  ? 471 GLN B CD    1 
ATOM   3023 O  OE1   . GLN B 1 230 ? -38.310 27.890 40.621 1.00 52.71  ? 471 GLN B OE1   1 
ATOM   3024 N  NE2   . GLN B 1 230 ? -37.364 26.357 39.287 1.00 64.06  ? 471 GLN B NE2   1 
ATOM   3025 N  N     . LYS B 1 231 ? -32.394 28.950 42.527 1.00 54.44  ? 472 LYS B N     1 
ATOM   3026 C  CA    . LYS B 1 231 ? -31.319 29.940 42.516 1.00 53.88  ? 472 LYS B CA    1 
ATOM   3027 C  C     . LYS B 1 231 ? -30.509 29.959 41.225 1.00 57.15  ? 472 LYS B C     1 
ATOM   3028 O  O     . LYS B 1 231 ? -30.104 28.919 40.709 1.00 59.80  ? 472 LYS B O     1 
ATOM   3029 C  CB    . LYS B 1 231 ? -30.365 29.724 43.694 1.00 48.29  ? 472 LYS B CB    1 
ATOM   3030 C  CG    . LYS B 1 231 ? -29.334 30.845 43.813 1.00 53.51  ? 472 LYS B CG    1 
ATOM   3031 C  CD    . LYS B 1 231 ? -28.625 30.875 45.158 1.00 61.73  ? 472 LYS B CD    1 
ATOM   3032 C  CE    . LYS B 1 231 ? -27.772 32.139 45.271 1.00 66.13  ? 472 LYS B CE    1 
ATOM   3033 N  NZ    . LYS B 1 231 ? -26.951 32.207 46.514 1.00 54.70  ? 472 LYS B NZ    1 
ATOM   3034 N  N     . TYR B 1 232 ? -30.279 31.166 40.720 1.00 54.04  ? 473 TYR B N     1 
ATOM   3035 C  CA    . TYR B 1 232 ? -29.406 31.393 39.582 1.00 46.52  ? 473 TYR B CA    1 
ATOM   3036 C  C     . TYR B 1 232 ? -28.181 32.180 40.014 1.00 41.74  ? 473 TYR B C     1 
ATOM   3037 O  O     . TYR B 1 232 ? -28.275 33.081 40.846 1.00 47.93  ? 473 TYR B O     1 
ATOM   3038 C  CB    . TYR B 1 232 ? -30.146 32.147 38.481 1.00 49.76  ? 473 TYR B CB    1 
ATOM   3039 C  CG    . TYR B 1 232 ? -29.252 32.640 37.368 1.00 52.28  ? 473 TYR B CG    1 
ATOM   3040 C  CD1   . TYR B 1 232 ? -28.883 31.800 36.328 1.00 52.83  ? 473 TYR B CD1   1 
ATOM   3041 C  CD2   . TYR B 1 232 ? -28.782 33.948 37.354 1.00 49.03  ? 473 TYR B CD2   1 
ATOM   3042 C  CE1   . TYR B 1 232 ? -28.069 32.245 35.311 1.00 52.87  ? 473 TYR B CE1   1 
ATOM   3043 C  CE2   . TYR B 1 232 ? -27.967 34.400 36.342 1.00 50.61  ? 473 TYR B CE2   1 
ATOM   3044 C  CZ    . TYR B 1 232 ? -27.614 33.547 35.321 1.00 54.15  ? 473 TYR B CZ    1 
ATOM   3045 O  OH    . TYR B 1 232 ? -26.803 34.003 34.306 1.00 54.96  ? 473 TYR B OH    1 
ATOM   3046 N  N     . LEU B 1 233 ? -27.033 31.840 39.446 1.00 44.78  ? 474 LEU B N     1 
ATOM   3047 C  CA    . LEU B 1 233 ? -25.812 32.597 39.674 1.00 43.48  ? 474 LEU B CA    1 
ATOM   3048 C  C     . LEU B 1 233 ? -25.072 32.766 38.355 1.00 40.90  ? 474 LEU B C     1 
ATOM   3049 O  O     . LEU B 1 233 ? -24.568 31.801 37.794 1.00 51.30  ? 474 LEU B O     1 
ATOM   3050 C  CB    . LEU B 1 233 ? -24.932 31.902 40.716 1.00 47.14  ? 474 LEU B CB    1 
ATOM   3051 C  CG    . LEU B 1 233 ? -23.492 32.385 40.932 1.00 59.96  ? 474 LEU B CG    1 
ATOM   3052 C  CD1   . LEU B 1 233 ? -23.370 33.908 40.965 1.00 51.28  ? 474 LEU B CD1   1 
ATOM   3053 C  CD2   . LEU B 1 233 ? -22.927 31.775 42.209 1.00 58.42  ? 474 LEU B CD2   1 
ATOM   3054 N  N     . GLY B 1 234 ? -25.015 33.997 37.861 1.00 36.84  ? 475 GLY B N     1 
ATOM   3055 C  CA    . GLY B 1 234 ? -24.367 34.272 36.594 1.00 40.66  ? 475 GLY B CA    1 
ATOM   3056 C  C     . GLY B 1 234 ? -23.766 35.659 36.485 1.00 39.26  ? 475 GLY B C     1 
ATOM   3057 O  O     . GLY B 1 234 ? -23.500 36.314 37.492 1.00 45.93  ? 475 GLY B O     1 
ATOM   3058 N  N     . VAL B 1 235 ? -23.546 36.102 35.250 1.00 37.79  ? 476 VAL B N     1 
ATOM   3059 C  CA    . VAL B 1 235 ? -22.954 37.409 34.980 1.00 39.90  ? 476 VAL B CA    1 
ATOM   3060 C  C     . VAL B 1 235 ? -23.837 38.218 34.040 1.00 45.15  ? 476 VAL B C     1 
ATOM   3061 O  O     . VAL B 1 235 ? -24.349 37.689 33.052 1.00 46.63  ? 476 VAL B O     1 
ATOM   3062 C  CB    . VAL B 1 235 ? -21.552 37.282 34.349 1.00 39.03  ? 476 VAL B CB    1 
ATOM   3063 C  CG1   . VAL B 1 235 ? -20.930 38.655 34.156 1.00 36.40  ? 476 VAL B CG1   1 
ATOM   3064 C  CG2   . VAL B 1 235 ? -20.655 36.403 35.205 1.00 40.60  ? 476 VAL B CG2   1 
ATOM   3065 N  N     . CYS B 1 236 ? -24.013 39.501 34.339 1.00 41.18  ? 477 CYS B N     1 
ATOM   3066 C  CA    . CYS B 1 236 ? -24.821 40.356 33.481 1.00 33.74  ? 477 CYS B CA    1 
ATOM   3067 C  C     . CYS B 1 236 ? -24.076 41.619 33.083 1.00 38.03  ? 477 CYS B C     1 
ATOM   3068 O  O     . CYS B 1 236 ? -23.006 41.920 33.615 1.00 38.99  ? 477 CYS B O     1 
ATOM   3069 C  CB    . CYS B 1 236 ? -26.122 40.736 34.174 1.00 34.60  ? 477 CYS B CB    1 
ATOM   3070 S  SG    . CYS B 1 236 ? -25.904 41.965 35.471 1.00 37.32  ? 477 CYS B SG    1 
ATOM   3071 N  N     . ARG B 1 237 ? -24.651 42.354 32.139 1.00 38.21  ? 478 ARG B N     1 
ATOM   3072 C  CA    . ARG B 1 237 ? -24.113 43.643 31.736 1.00 34.77  ? 478 ARG B CA    1 
ATOM   3073 C  C     . ARG B 1 237 ? -25.230 44.545 31.242 1.00 36.91  ? 478 ARG B C     1 
ATOM   3074 O  O     . ARG B 1 237 ? -26.003 44.166 30.368 1.00 42.84  ? 478 ARG B O     1 
ATOM   3075 C  CB    . ARG B 1 237 ? -23.051 43.481 30.652 1.00 33.71  ? 478 ARG B CB    1 
ATOM   3076 C  CG    . ARG B 1 237 ? -22.551 44.807 30.114 1.00 42.49  ? 478 ARG B CG    1 
ATOM   3077 C  CD    . ARG B 1 237 ? -21.245 44.652 29.358 1.00 48.66  ? 478 ARG B CD    1 
ATOM   3078 N  NE    . ARG B 1 237 ? -21.373 43.750 28.221 1.00 53.27  ? 478 ARG B NE    1 
ATOM   3079 C  CZ    . ARG B 1 237 ? -21.605 44.151 26.977 1.00 60.34  ? 478 ARG B CZ    1 
ATOM   3080 N  NH1   . ARG B 1 237 ? -21.735 45.445 26.710 1.00 59.60  ? 478 ARG B NH1   1 
ATOM   3081 N  NH2   . ARG B 1 237 ? -21.710 43.257 26.002 1.00 61.52  ? 478 ARG B NH2   1 
ATOM   3082 N  N     . LEU B 1 238 ? -25.321 45.734 31.819 1.00 41.22  ? 479 LEU B N     1 
ATOM   3083 C  CA    . LEU B 1 238 ? -26.310 46.705 31.384 1.00 41.05  ? 479 LEU B CA    1 
ATOM   3084 C  C     . LEU B 1 238 ? -26.036 47.095 29.939 1.00 46.26  ? 479 LEU B C     1 
ATOM   3085 O  O     . LEU B 1 238 ? -24.880 47.141 29.515 1.00 47.56  ? 479 LEU B O     1 
ATOM   3086 C  CB    . LEU B 1 238 ? -26.292 47.933 32.295 1.00 42.96  ? 479 LEU B CB    1 
ATOM   3087 C  CG    . LEU B 1 238 ? -26.847 47.718 33.704 1.00 38.15  ? 479 LEU B CG    1 
ATOM   3088 C  CD1   . LEU B 1 238 ? -26.562 48.928 34.564 1.00 40.67  ? 479 LEU B CD1   1 
ATOM   3089 C  CD2   . LEU B 1 238 ? -28.343 47.450 33.654 1.00 34.81  ? 479 LEU B CD2   1 
ATOM   3090 N  N     . PRO B 1 239 ? -27.103 47.361 29.170 1.00 48.96  ? 480 PRO B N     1 
ATOM   3091 C  CA    . PRO B 1 239 ? -26.947 47.725 27.759 1.00 43.32  ? 480 PRO B CA    1 
ATOM   3092 C  C     . PRO B 1 239 ? -26.210 49.046 27.584 1.00 47.34  ? 480 PRO B C     1 
ATOM   3093 O  O     . PRO B 1 239 ? -26.312 49.926 28.438 1.00 45.71  ? 480 PRO B O     1 
ATOM   3094 C  CB    . PRO B 1 239 ? -28.391 47.837 27.265 1.00 43.13  ? 480 PRO B CB    1 
ATOM   3095 C  CG    . PRO B 1 239 ? -29.185 48.136 28.492 1.00 46.37  ? 480 PRO B CG    1 
ATOM   3096 C  CD    . PRO B 1 239 ? -28.517 47.362 29.585 1.00 47.05  ? 480 PRO B CD    1 
ATOM   3097 N  N     . GLY B 1 240 ? -25.468 49.174 26.491 1.00 56.78  ? 481 GLY B N     1 
ATOM   3098 C  CA    . GLY B 1 240 ? -24.797 50.419 26.176 1.00 60.55  ? 481 GLY B CA    1 
ATOM   3099 C  C     . GLY B 1 240 ? -23.286 50.338 26.247 1.00 66.10  ? 481 GLY B C     1 
ATOM   3100 O  O     . GLY B 1 240 ? -22.724 49.261 26.459 1.00 63.86  ? 481 GLY B O     1 
ATOM   3101 N  N     . PRO B 1 241 ? -22.620 51.489 26.073 1.00 70.01  ? 482 PRO B N     1 
ATOM   3102 C  CA    . PRO B 1 241 ? -21.161 51.611 26.036 1.00 65.68  ? 482 PRO B CA    1 
ATOM   3103 C  C     . PRO B 1 241 ? -20.527 51.742 27.419 1.00 62.12  ? 482 PRO B C     1 
ATOM   3104 O  O     . PRO B 1 241 ? -21.161 52.250 28.346 1.00 56.31  ? 482 PRO B O     1 
ATOM   3105 C  CB    . PRO B 1 241 ? -20.954 52.894 25.236 1.00 62.28  ? 482 PRO B CB    1 
ATOM   3106 C  CG    . PRO B 1 241 ? -22.121 53.740 25.635 1.00 57.23  ? 482 PRO B CG    1 
ATOM   3107 C  CD    . PRO B 1 241 ? -23.280 52.788 25.836 1.00 60.76  ? 482 PRO B CD    1 
ATOM   3108 N  N     . GLY B 1 242 ? -19.283 51.288 27.543 1.00 64.18  ? 483 GLY B N     1 
ATOM   3109 C  CA    . GLY B 1 242 ? -18.504 51.478 28.754 1.00 62.11  ? 483 GLY B CA    1 
ATOM   3110 C  C     . GLY B 1 242 ? -19.047 50.808 30.003 1.00 60.30  ? 483 GLY B C     1 
ATOM   3111 O  O     . GLY B 1 242 ? -18.684 51.182 31.117 1.00 60.91  ? 483 GLY B O     1 
ATOM   3112 N  N     . ARG B 1 243 ? -19.916 49.820 29.821 1.00 53.61  ? 484 ARG B N     1 
ATOM   3113 C  CA    . ARG B 1 243 ? -20.478 49.087 30.947 1.00 44.03  ? 484 ARG B CA    1 
ATOM   3114 C  C     . ARG B 1 243 ? -19.581 47.920 31.340 1.00 45.50  ? 484 ARG B C     1 
ATOM   3115 O  O     . ARG B 1 243 ? -18.949 47.298 30.488 1.00 45.48  ? 484 ARG B O     1 
ATOM   3116 C  CB    . ARG B 1 243 ? -21.876 48.576 30.612 1.00 41.64  ? 484 ARG B CB    1 
ATOM   3117 C  CG    . ARG B 1 243 ? -22.909 49.662 30.412 1.00 41.09  ? 484 ARG B CG    1 
ATOM   3118 C  CD    . ARG B 1 243 ? -23.227 50.370 31.706 1.00 36.93  ? 484 ARG B CD    1 
ATOM   3119 N  NE    . ARG B 1 243 ? -24.595 50.878 31.698 1.00 46.19  ? 484 ARG B NE    1 
ATOM   3120 C  CZ    . ARG B 1 243 ? -25.166 51.513 32.716 1.00 43.53  ? 484 ARG B CZ    1 
ATOM   3121 N  NH1   . ARG B 1 243 ? -24.485 51.722 33.835 1.00 37.59  ? 484 ARG B NH1   1 
ATOM   3122 N  NH2   . ARG B 1 243 ? -26.421 51.937 32.614 1.00 38.21  ? 484 ARG B NH2   1 
ATOM   3123 N  N     . ARG B 1 244 ? -19.531 47.622 32.634 1.00 47.35  ? 485 ARG B N     1 
ATOM   3124 C  CA    . ARG B 1 244 ? -18.715 46.519 33.125 1.00 44.80  ? 485 ARG B CA    1 
ATOM   3125 C  C     . ARG B 1 244 ? -19.575 45.288 33.374 1.00 40.47  ? 485 ARG B C     1 
ATOM   3126 O  O     . ARG B 1 244 ? -20.801 45.374 33.410 1.00 42.66  ? 485 ARG B O     1 
ATOM   3127 C  CB    . ARG B 1 244 ? -17.980 46.920 34.404 1.00 42.44  ? 485 ARG B CB    1 
ATOM   3128 C  CG    . ARG B 1 244 ? -17.331 48.293 34.335 1.00 49.04  ? 485 ARG B CG    1 
ATOM   3129 C  CD    . ARG B 1 244 ? -16.494 48.573 35.569 1.00 49.35  ? 485 ARG B CD    1 
ATOM   3130 N  NE    . ARG B 1 244 ? -15.147 48.025 35.453 1.00 51.07  ? 485 ARG B NE    1 
ATOM   3131 C  CZ    . ARG B 1 244 ? -14.066 48.759 35.212 1.00 55.03  ? 485 ARG B CZ    1 
ATOM   3132 N  NH1   . ARG B 1 244 ? -14.178 50.073 35.064 1.00 52.96  ? 485 ARG B NH1   1 
ATOM   3133 N  NH2   . ARG B 1 244 ? -12.876 48.180 35.121 1.00 55.49  ? 485 ARG B NH2   1 
ATOM   3134 N  N     . HIS B 1 245 ? -18.924 44.143 33.537 1.00 37.53  ? 486 HIS B N     1 
ATOM   3135 C  CA    . HIS B 1 245 ? -19.621 42.897 33.829 1.00 42.88  ? 486 HIS B CA    1 
ATOM   3136 C  C     . HIS B 1 245 ? -19.856 42.729 35.335 1.00 45.18  ? 486 HIS B C     1 
ATOM   3137 O  O     . HIS B 1 245 ? -18.915 42.773 36.131 1.00 45.13  ? 486 HIS B O     1 
ATOM   3138 C  CB    . HIS B 1 245 ? -18.828 41.708 33.282 1.00 47.34  ? 486 HIS B CB    1 
ATOM   3139 C  CG    . HIS B 1 245 ? -18.943 41.525 31.801 1.00 49.08  ? 486 HIS B CG    1 
ATOM   3140 N  ND1   . HIS B 1 245 ? -20.046 41.932 31.078 1.00 56.35  ? 486 HIS B ND1   1 
ATOM   3141 C  CD2   . HIS B 1 245 ? -18.089 40.985 30.901 1.00 49.59  ? 486 HIS B CD2   1 
ATOM   3142 C  CE1   . HIS B 1 245 ? -19.871 41.637 29.804 1.00 46.44  ? 486 HIS B CE1   1 
ATOM   3143 N  NE2   . HIS B 1 245 ? -18.689 41.060 29.669 1.00 47.98  ? 486 HIS B NE2   1 
ATOM   3144 N  N     . ARG B 1 246 ? -21.112 42.529 35.720 1.00 39.38  ? 487 ARG B N     1 
ATOM   3145 C  CA    . ARG B 1 246 ? -21.469 42.383 37.127 1.00 36.36  ? 487 ARG B CA    1 
ATOM   3146 C  C     . ARG B 1 246 ? -21.993 40.985 37.440 1.00 38.02  ? 487 ARG B C     1 
ATOM   3147 O  O     . ARG B 1 246 ? -22.743 40.401 36.653 1.00 36.39  ? 487 ARG B O     1 
ATOM   3148 C  CB    . ARG B 1 246 ? -22.518 43.423 37.521 1.00 35.32  ? 487 ARG B CB    1 
ATOM   3149 C  CG    . ARG B 1 246 ? -22.176 44.842 37.102 1.00 32.51  ? 487 ARG B CG    1 
ATOM   3150 C  CD    . ARG B 1 246 ? -20.797 45.243 37.585 1.00 32.28  ? 487 ARG B CD    1 
ATOM   3151 N  NE    . ARG B 1 246 ? -20.586 46.678 37.440 1.00 35.85  ? 487 ARG B NE    1 
ATOM   3152 C  CZ    . ARG B 1 246 ? -19.468 47.305 37.784 1.00 38.49  ? 487 ARG B CZ    1 
ATOM   3153 N  NH1   . ARG B 1 246 ? -18.450 46.620 38.297 1.00 35.82  ? 487 ARG B NH1   1 
ATOM   3154 N  NH2   . ARG B 1 246 ? -19.372 48.618 37.617 1.00 31.62  ? 487 ARG B NH2   1 
ATOM   3155 N  N     . ARG B 1 247 ? -21.601 40.456 38.596 1.00 39.49  ? 488 ARG B N     1 
ATOM   3156 C  CA    . ARG B 1 247 ? -22.093 39.161 39.053 1.00 34.90  ? 488 ARG B CA    1 
ATOM   3157 C  C     . ARG B 1 247 ? -23.526 39.297 39.566 1.00 35.76  ? 488 ARG B C     1 
ATOM   3158 O  O     . ARG B 1 247 ? -23.862 40.281 40.226 1.00 34.50  ? 488 ARG B O     1 
ATOM   3159 C  CB    . ARG B 1 247 ? -21.178 38.595 40.139 1.00 39.57  ? 488 ARG B CB    1 
ATOM   3160 C  CG    . ARG B 1 247 ? -19.707 38.568 39.752 1.00 36.98  ? 488 ARG B CG    1 
ATOM   3161 C  CD    . ARG B 1 247 ? -18.869 37.815 40.771 1.00 42.63  ? 488 ARG B CD    1 
ATOM   3162 N  NE    . ARG B 1 247 ? -19.011 38.365 42.115 1.00 46.72  ? 488 ARG B NE    1 
ATOM   3163 C  CZ    . ARG B 1 247 ? -18.248 39.334 42.609 1.00 44.84  ? 488 ARG B CZ    1 
ATOM   3164 N  NH1   . ARG B 1 247 ? -17.280 39.863 41.869 1.00 48.15  ? 488 ARG B NH1   1 
ATOM   3165 N  NH2   . ARG B 1 247 ? -18.452 39.777 43.843 1.00 35.24  ? 488 ARG B NH2   1 
ATOM   3166 N  N     . LEU B 1 248 ? -24.369 38.315 39.262 1.00 35.05  ? 489 LEU B N     1 
ATOM   3167 C  CA    . LEU B 1 248 ? -25.791 38.414 39.584 1.00 32.78  ? 489 LEU B CA    1 
ATOM   3168 C  C     . LEU B 1 248 ? -26.342 37.160 40.255 1.00 36.72  ? 489 LEU B C     1 
ATOM   3169 O  O     . LEU B 1 248 ? -26.237 36.064 39.714 1.00 36.20  ? 489 LEU B O     1 
ATOM   3170 C  CB    . LEU B 1 248 ? -26.594 38.703 38.318 1.00 31.37  ? 489 LEU B CB    1 
ATOM   3171 C  CG    . LEU B 1 248 ? -28.108 38.832 38.489 1.00 32.90  ? 489 LEU B CG    1 
ATOM   3172 C  CD1   . LEU B 1 248 ? -28.451 40.090 39.263 1.00 33.70  ? 489 LEU B CD1   1 
ATOM   3173 C  CD2   . LEU B 1 248 ? -28.804 38.823 37.141 1.00 30.05  ? 489 LEU B CD2   1 
ATOM   3174 N  N     . ASP B 1 249 ? -26.924 37.336 41.440 1.00 43.26  ? 490 ASP B N     1 
ATOM   3175 C  CA    . ASP B 1 249 ? -27.644 36.264 42.127 1.00 37.99  ? 490 ASP B CA    1 
ATOM   3176 C  C     . ASP B 1 249 ? -29.143 36.467 41.996 1.00 39.59  ? 490 ASP B C     1 
ATOM   3177 O  O     . ASP B 1 249 ? -29.660 37.550 42.283 1.00 39.54  ? 490 ASP B O     1 
ATOM   3178 C  CB    . ASP B 1 249 ? -27.272 36.193 43.613 1.00 47.85  ? 490 ASP B CB    1 
ATOM   3179 C  CG    . ASP B 1 249 ? -25.885 35.630 43.844 1.00 66.01  ? 490 ASP B CG    1 
ATOM   3180 O  OD1   . ASP B 1 249 ? -25.328 35.046 42.896 1.00 61.34  ? 490 ASP B OD1   1 
ATOM   3181 O  OD2   . ASP B 1 249 ? -25.360 35.754 44.975 1.00 70.62  ? 490 ASP B OD2   1 
ATOM   3182 N  N     . ILE B 1 250 ? -29.842 35.429 41.555 1.00 39.63  ? 491 ILE B N     1 
ATOM   3183 C  CA    . ILE B 1 250 ? -31.294 35.491 41.495 1.00 39.26  ? 491 ILE B CA    1 
ATOM   3184 C  C     . ILE B 1 250 ? -31.874 34.311 42.263 1.00 43.40  ? 491 ILE B C     1 
ATOM   3185 O  O     . ILE B 1 250 ? -31.441 33.171 42.092 1.00 46.57  ? 491 ILE B O     1 
ATOM   3186 C  CB    . ILE B 1 250 ? -31.822 35.494 40.043 1.00 37.01  ? 491 ILE B CB    1 
ATOM   3187 C  CG1   . ILE B 1 250 ? -31.241 36.681 39.272 1.00 34.81  ? 491 ILE B CG1   1 
ATOM   3188 C  CG2   . ILE B 1 250 ? -33.342 35.575 40.026 1.00 40.66  ? 491 ILE B CG2   1 
ATOM   3189 C  CD1   . ILE B 1 250 ? -31.928 36.957 37.949 1.00 38.66  ? 491 ILE B CD1   1 
ATOM   3190 N  N     . ILE B 1 251 ? -32.840 34.603 43.130 1.00 35.21  ? 492 ILE B N     1 
ATOM   3191 C  CA    . ILE B 1 251 ? -33.476 33.595 43.969 1.00 39.96  ? 492 ILE B CA    1 
ATOM   3192 C  C     . ILE B 1 251 ? -34.997 33.731 43.911 1.00 41.80  ? 492 ILE B C     1 
ATOM   3193 O  O     . ILE B 1 251 ? -35.533 34.813 44.113 1.00 37.02  ? 492 ILE B O     1 
ATOM   3194 C  CB    . ILE B 1 251 ? -33.012 33.698 45.444 1.00 42.62  ? 492 ILE B CB    1 
ATOM   3195 C  CG1   . ILE B 1 251 ? -31.490 33.596 45.559 1.00 49.62  ? 492 ILE B CG1   1 
ATOM   3196 C  CG2   . ILE B 1 251 ? -33.622 32.583 46.260 1.00 41.92  ? 492 ILE B CG2   1 
ATOM   3197 C  CD1   . ILE B 1 251 ? -30.827 34.968 45.625 1.00 52.79  ? 492 ILE B CD1   1 
ATOM   3198 N  N     . VAL B 1 252 ? -35.680 32.629 43.626 1.00 39.27  ? 493 VAL B N     1 
ATOM   3199 C  CA    . VAL B 1 252 ? -37.132 32.625 43.618 1.00 40.95  ? 493 VAL B CA    1 
ATOM   3200 C  C     . VAL B 1 252 ? -37.627 31.802 44.789 1.00 41.63  ? 493 VAL B C     1 
ATOM   3201 O  O     . VAL B 1 252 ? -37.301 30.617 44.898 1.00 46.85  ? 493 VAL B O     1 
ATOM   3202 C  CB    . VAL B 1 252 ? -37.705 32.060 42.312 1.00 45.70  ? 493 VAL B CB    1 
ATOM   3203 C  CG1   . VAL B 1 252 ? -39.237 31.928 42.404 1.00 40.81  ? 493 VAL B CG1   1 
ATOM   3204 C  CG2   . VAL B 1 252 ? -37.322 32.941 41.161 1.00 40.87  ? 493 VAL B CG2   1 
ATOM   3205 N  N     . VAL B 1 253 ? -38.408 32.434 45.661 1.00 40.14  ? 494 VAL B N     1 
ATOM   3206 C  CA    . VAL B 1 253 ? -38.864 31.821 46.898 1.00 38.25  ? 494 VAL B CA    1 
ATOM   3207 C  C     . VAL B 1 253 ? -40.382 31.898 46.971 1.00 40.18  ? 494 VAL B C     1 
ATOM   3208 O  O     . VAL B 1 253 ? -40.987 32.812 46.413 1.00 41.34  ? 494 VAL B O     1 
ATOM   3209 C  CB    . VAL B 1 253 ? -38.250 32.523 48.128 1.00 38.82  ? 494 VAL B CB    1 
ATOM   3210 C  CG1   . VAL B 1 253 ? -36.739 32.479 48.051 1.00 37.50  ? 494 VAL B CG1   1 
ATOM   3211 C  CG2   . VAL B 1 253 ? -38.726 33.969 48.214 1.00 34.96  ? 494 VAL B CG2   1 
ATOM   3212 N  N     . PRO B 1 254 ? -41.008 30.922 47.636 1.00 40.87  ? 495 PRO B N     1 
ATOM   3213 C  CA    . PRO B 1 254 ? -42.440 31.028 47.924 1.00 38.24  ? 495 PRO B CA    1 
ATOM   3214 C  C     . PRO B 1 254 ? -42.681 32.131 48.946 1.00 41.07  ? 495 PRO B C     1 
ATOM   3215 O  O     . PRO B 1 254 ? -41.772 32.452 49.712 1.00 45.68  ? 495 PRO B O     1 
ATOM   3216 C  CB    . PRO B 1 254 ? -42.788 29.653 48.490 1.00 43.12  ? 495 PRO B CB    1 
ATOM   3217 C  CG    . PRO B 1 254 ? -41.488 29.143 49.045 1.00 43.75  ? 495 PRO B CG    1 
ATOM   3218 C  CD    . PRO B 1 254 ? -40.431 29.658 48.123 1.00 42.49  ? 495 PRO B CD    1 
ATOM   3219 N  N     . TYR B 1 255 ? -43.880 32.701 48.962 1.00 41.66  ? 496 TYR B N     1 
ATOM   3220 C  CA    . TYR B 1 255 ? -44.181 33.811 49.861 1.00 34.92  ? 496 TYR B CA    1 
ATOM   3221 C  C     . TYR B 1 255 ? -44.080 33.403 51.328 1.00 35.54  ? 496 TYR B C     1 
ATOM   3222 O  O     . TYR B 1 255 ? -43.783 34.230 52.191 1.00 33.20  ? 496 TYR B O     1 
ATOM   3223 C  CB    . TYR B 1 255 ? -45.572 34.364 49.567 1.00 35.62  ? 496 TYR B CB    1 
ATOM   3224 C  CG    . TYR B 1 255 ? -45.759 35.796 50.001 1.00 41.09  ? 496 TYR B CG    1 
ATOM   3225 C  CD1   . TYR B 1 255 ? -44.912 36.793 49.535 1.00 43.30  ? 496 TYR B CD1   1 
ATOM   3226 C  CD2   . TYR B 1 255 ? -46.790 36.158 50.856 1.00 34.73  ? 496 TYR B CD2   1 
ATOM   3227 C  CE1   . TYR B 1 255 ? -45.075 38.108 49.920 1.00 38.26  ? 496 TYR B CE1   1 
ATOM   3228 C  CE2   . TYR B 1 255 ? -46.963 37.474 51.244 1.00 35.97  ? 496 TYR B CE2   1 
ATOM   3229 C  CZ    . TYR B 1 255 ? -46.101 38.444 50.773 1.00 38.17  ? 496 TYR B CZ    1 
ATOM   3230 O  OH    . TYR B 1 255 ? -46.261 39.756 51.154 1.00 45.35  ? 496 TYR B OH    1 
ATOM   3231 N  N     . SER B 1 256 ? -44.314 32.124 51.603 1.00 36.61  ? 497 SER B N     1 
ATOM   3232 C  CA    . SER B 1 256 ? -44.304 31.614 52.972 1.00 38.25  ? 497 SER B CA    1 
ATOM   3233 C  C     . SER B 1 256 ? -42.898 31.540 53.555 1.00 38.83  ? 497 SER B C     1 
ATOM   3234 O  O     . SER B 1 256 ? -42.725 31.322 54.752 1.00 42.14  ? 497 SER B O     1 
ATOM   3235 C  CB    . SER B 1 256 ? -44.957 30.229 53.029 1.00 46.19  ? 497 SER B CB    1 
ATOM   3236 O  OG    . SER B 1 256 ? -44.335 29.318 52.133 1.00 43.22  ? 497 SER B OG    1 
ATOM   3237 N  N     . GLU B 1 257 ? -41.892 31.706 52.706 1.00 38.12  ? 498 GLU B N     1 
ATOM   3238 C  CA    . GLU B 1 257 ? -40.512 31.669 53.164 1.00 37.28  ? 498 GLU B CA    1 
ATOM   3239 C  C     . GLU B 1 257 ? -39.852 33.023 52.976 1.00 32.07  ? 498 GLU B C     1 
ATOM   3240 O  O     . GLU B 1 257 ? -38.677 33.196 53.294 1.00 31.61  ? 498 GLU B O     1 
ATOM   3241 C  CB    . GLU B 1 257 ? -39.718 30.597 52.416 1.00 36.85  ? 498 GLU B CB    1 
ATOM   3242 C  CG    . GLU B 1 257 ? -40.252 29.189 52.564 1.00 36.99  ? 498 GLU B CG    1 
ATOM   3243 C  CD    . GLU B 1 257 ? -39.316 28.155 51.965 1.00 47.70  ? 498 GLU B CD    1 
ATOM   3244 O  OE1   . GLU B 1 257 ? -38.136 28.493 51.723 1.00 46.35  ? 498 GLU B OE1   1 
ATOM   3245 O  OE2   . GLU B 1 257 ? -39.755 27.006 51.734 1.00 52.37  ? 498 GLU B OE2   1 
ATOM   3246 N  N     . PHE B 1 258 ? -40.622 33.980 52.469 1.00 29.87  ? 499 PHE B N     1 
ATOM   3247 C  CA    . PHE B 1 258 ? -40.073 35.250 52.010 1.00 30.69  ? 499 PHE B CA    1 
ATOM   3248 C  C     . PHE B 1 258 ? -39.295 36.001 53.085 1.00 28.91  ? 499 PHE B C     1 
ATOM   3249 O  O     . PHE B 1 258 ? -38.159 36.412 52.855 1.00 31.97  ? 499 PHE B O     1 
ATOM   3250 C  CB    . PHE B 1 258 ? -41.190 36.142 51.466 1.00 33.64  ? 499 PHE B CB    1 
ATOM   3251 C  CG    . PHE B 1 258 ? -40.693 37.389 50.787 1.00 33.12  ? 499 PHE B CG    1 
ATOM   3252 C  CD1   . PHE B 1 258 ? -39.770 37.311 49.757 1.00 30.85  ? 499 PHE B CD1   1 
ATOM   3253 C  CD2   . PHE B 1 258 ? -41.154 38.635 51.173 1.00 35.13  ? 499 PHE B CD2   1 
ATOM   3254 C  CE1   . PHE B 1 258 ? -39.312 38.452 49.132 1.00 31.00  ? 499 PHE B CE1   1 
ATOM   3255 C  CE2   . PHE B 1 258 ? -40.702 39.780 50.549 1.00 34.80  ? 499 PHE B CE2   1 
ATOM   3256 C  CZ    . PHE B 1 258 ? -39.780 39.689 49.528 1.00 37.08  ? 499 PHE B CZ    1 
ATOM   3257 N  N     . ALA B 1 259 ? -39.903 36.174 54.252 1.00 30.19  ? 500 ALA B N     1 
ATOM   3258 C  CA    . ALA B 1 259 ? -39.270 36.917 55.333 1.00 23.23  ? 500 ALA B CA    1 
ATOM   3259 C  C     . ALA B 1 259 ? -37.945 36.290 55.746 1.00 27.85  ? 500 ALA B C     1 
ATOM   3260 O  O     . ALA B 1 259 ? -36.960 36.997 55.951 1.00 31.98  ? 500 ALA B O     1 
ATOM   3261 C  CB    . ALA B 1 259 ? -40.196 37.008 56.518 1.00 25.37  ? 500 ALA B CB    1 
ATOM   3262 N  N     . CYS B 1 260 ? -37.912 34.966 55.865 1.00 28.25  ? 501 CYS B N     1 
ATOM   3263 C  CA    . CYS B 1 260 ? -36.669 34.286 56.220 1.00 28.52  ? 501 CYS B CA    1 
ATOM   3264 C  C     . CYS B 1 260 ? -35.653 34.358 55.088 1.00 31.37  ? 501 CYS B C     1 
ATOM   3265 O  O     . CYS B 1 260 ? -34.446 34.430 55.329 1.00 30.30  ? 501 CYS B O     1 
ATOM   3266 C  CB    . CYS B 1 260 ? -36.933 32.831 56.596 1.00 26.94  ? 501 CYS B CB    1 
ATOM   3267 S  SG    . CYS B 1 260 ? -37.437 32.625 58.309 1.00 30.19  ? 501 CYS B SG    1 
ATOM   3268 N  N     . ALA B 1 261 ? -36.144 34.337 53.854 1.00 31.75  ? 502 ALA B N     1 
ATOM   3269 C  CA    . ALA B 1 261 ? -35.274 34.468 52.694 1.00 29.08  ? 502 ALA B CA    1 
ATOM   3270 C  C     . ALA B 1 261 ? -34.708 35.880 52.629 1.00 29.94  ? 502 ALA B C     1 
ATOM   3271 O  O     . ALA B 1 261 ? -33.516 36.069 52.389 1.00 29.78  ? 502 ALA B O     1 
ATOM   3272 C  CB    . ALA B 1 261 ? -36.022 34.134 51.421 1.00 21.55  ? 502 ALA B CB    1 
ATOM   3273 N  N     . LEU B 1 262 ? -35.570 36.868 52.851 1.00 24.80  ? 503 LEU B N     1 
ATOM   3274 C  CA    . LEU B 1 262 ? -35.160 38.263 52.792 1.00 23.93  ? 503 LEU B CA    1 
ATOM   3275 C  C     . LEU B 1 262 ? -34.094 38.555 53.840 1.00 29.69  ? 503 LEU B C     1 
ATOM   3276 O  O     . LEU B 1 262 ? -33.117 39.255 53.574 1.00 25.86  ? 503 LEU B O     1 
ATOM   3277 C  CB    . LEU B 1 262 ? -36.359 39.186 52.987 1.00 22.81  ? 503 LEU B CB    1 
ATOM   3278 C  CG    . LEU B 1 262 ? -36.229 40.556 52.322 1.00 30.64  ? 503 LEU B CG    1 
ATOM   3279 C  CD1   . LEU B 1 262 ? -35.988 40.399 50.832 1.00 31.40  ? 503 LEU B CD1   1 
ATOM   3280 C  CD2   . LEU B 1 262 ? -37.473 41.385 52.566 1.00 30.39  ? 503 LEU B CD2   1 
ATOM   3281 N  N     . LEU B 1 263 ? -34.283 37.997 55.029 1.00 31.57  ? 504 LEU B N     1 
ATOM   3282 C  CA    . LEU B 1 263 ? -33.335 38.175 56.118 1.00 25.67  ? 504 LEU B CA    1 
ATOM   3283 C  C     . LEU B 1 263 ? -31.975 37.579 55.763 1.00 25.77  ? 504 LEU B C     1 
ATOM   3284 O  O     . LEU B 1 263 ? -30.941 38.219 55.946 1.00 29.12  ? 504 LEU B O     1 
ATOM   3285 C  CB    . LEU B 1 263 ? -33.879 37.538 57.397 1.00 25.00  ? 504 LEU B CB    1 
ATOM   3286 C  CG    . LEU B 1 263 ? -33.050 37.680 58.676 1.00 24.82  ? 504 LEU B CG    1 
ATOM   3287 C  CD1   . LEU B 1 263 ? -32.927 39.140 59.109 1.00 17.53  ? 504 LEU B CD1   1 
ATOM   3288 C  CD2   . LEU B 1 263 ? -33.669 36.843 59.778 1.00 24.28  ? 504 LEU B CD2   1 
ATOM   3289 N  N     . TYR B 1 264 ? -31.987 36.358 55.244 1.00 25.26  ? 505 TYR B N     1 
ATOM   3290 C  CA    . TYR B 1 264 ? -30.757 35.639 54.935 1.00 25.95  ? 505 TYR B CA    1 
ATOM   3291 C  C     . TYR B 1 264 ? -29.970 36.307 53.815 1.00 31.35  ? 505 TYR B C     1 
ATOM   3292 O  O     . TYR B 1 264 ? -28.768 36.529 53.938 1.00 36.41  ? 505 TYR B O     1 
ATOM   3293 C  CB    . TYR B 1 264 ? -31.070 34.191 54.555 1.00 29.50  ? 505 TYR B CB    1 
ATOM   3294 C  CG    . TYR B 1 264 ? -29.853 33.356 54.237 1.00 29.12  ? 505 TYR B CG    1 
ATOM   3295 C  CD1   . TYR B 1 264 ? -29.172 32.685 55.237 1.00 33.54  ? 505 TYR B CD1   1 
ATOM   3296 C  CD2   . TYR B 1 264 ? -29.388 33.233 52.935 1.00 35.54  ? 505 TYR B CD2   1 
ATOM   3297 C  CE1   . TYR B 1 264 ? -28.057 31.920 54.954 1.00 37.13  ? 505 TYR B CE1   1 
ATOM   3298 C  CE2   . TYR B 1 264 ? -28.274 32.471 52.642 1.00 33.79  ? 505 TYR B CE2   1 
ATOM   3299 C  CZ    . TYR B 1 264 ? -27.614 31.817 53.656 1.00 37.53  ? 505 TYR B CZ    1 
ATOM   3300 O  OH    . TYR B 1 264 ? -26.504 31.055 53.374 1.00 49.72  ? 505 TYR B OH    1 
ATOM   3301 N  N     . PHE B 1 265 ? -30.644 36.626 52.718 1.00 33.56  ? 506 PHE B N     1 
ATOM   3302 C  CA    . PHE B 1 265 ? -29.951 37.185 51.567 1.00 32.35  ? 506 PHE B CA    1 
ATOM   3303 C  C     . PHE B 1 265 ? -29.634 38.668 51.746 1.00 31.25  ? 506 PHE B C     1 
ATOM   3304 O  O     . PHE B 1 265 ? -28.807 39.214 51.019 1.00 35.50  ? 506 PHE B O     1 
ATOM   3305 C  CB    . PHE B 1 265 ? -30.765 36.957 50.292 1.00 32.83  ? 506 PHE B CB    1 
ATOM   3306 C  CG    . PHE B 1 265 ? -30.845 35.511 49.887 1.00 46.26  ? 506 PHE B CG    1 
ATOM   3307 C  CD1   . PHE B 1 265 ? -29.703 34.822 49.504 1.00 46.12  ? 506 PHE B CD1   1 
ATOM   3308 C  CD2   . PHE B 1 265 ? -32.057 34.832 49.906 1.00 49.22  ? 506 PHE B CD2   1 
ATOM   3309 C  CE1   . PHE B 1 265 ? -29.769 33.482 49.141 1.00 50.49  ? 506 PHE B CE1   1 
ATOM   3310 C  CE2   . PHE B 1 265 ? -32.132 33.494 49.543 1.00 42.01  ? 506 PHE B CE2   1 
ATOM   3311 C  CZ    . PHE B 1 265 ? -30.986 32.819 49.159 1.00 49.81  ? 506 PHE B CZ    1 
ATOM   3312 N  N     . THR B 1 266 ? -30.274 39.327 52.708 1.00 25.79  ? 507 THR B N     1 
ATOM   3313 C  CA    . THR B 1 266 ? -29.892 40.701 53.007 1.00 25.39  ? 507 THR B CA    1 
ATOM   3314 C  C     . THR B 1 266 ? -28.582 40.667 53.781 1.00 25.69  ? 507 THR B C     1 
ATOM   3315 O  O     . THR B 1 266 ? -27.728 41.540 53.627 1.00 27.03  ? 507 THR B O     1 
ATOM   3316 C  CB    . THR B 1 266 ? -30.970 41.453 53.800 1.00 24.50  ? 507 THR B CB    1 
ATOM   3317 O  OG1   . THR B 1 266 ? -32.144 41.588 52.994 1.00 21.77  ? 507 THR B OG1   1 
ATOM   3318 C  CG2   . THR B 1 266 ? -30.488 42.840 54.194 1.00 20.83  ? 507 THR B CG2   1 
ATOM   3319 N  N     . GLY B 1 267 ? -28.415 39.632 54.594 1.00 24.53  ? 508 GLY B N     1 
ATOM   3320 C  CA    . GLY B 1 267 ? -27.182 39.442 55.329 1.00 22.40  ? 508 GLY B CA    1 
ATOM   3321 C  C     . GLY B 1 267 ? -27.023 40.453 56.445 1.00 25.46  ? 508 GLY B C     1 
ATOM   3322 O  O     . GLY B 1 267 ? -28.015 40.962 56.962 1.00 29.13  ? 508 GLY B O     1 
ATOM   3323 N  N     . SER B 1 268 ? -25.786 40.760 56.820 1.00 23.92  ? 509 SER B N     1 
ATOM   3324 C  CA    . SER B 1 268 ? -24.592 40.197 56.198 1.00 25.21  ? 509 SER B CA    1 
ATOM   3325 C  C     . SER B 1 268 ? -24.339 38.754 56.610 1.00 27.36  ? 509 SER B C     1 
ATOM   3326 O  O     . SER B 1 268 ? -25.091 38.190 57.397 1.00 29.48  ? 509 SER B O     1 
ATOM   3327 C  CB    . SER B 1 268 ? -23.379 41.039 56.561 1.00 25.40  ? 509 SER B CB    1 
ATOM   3328 O  OG    . SER B 1 268 ? -23.174 41.011 57.962 1.00 26.57  ? 509 SER B OG    1 
ATOM   3329 N  N     . ALA B 1 269 ? -23.276 38.166 56.072 1.00 31.59  ? 510 ALA B N     1 
ATOM   3330 C  CA    . ALA B 1 269 ? -22.910 36.795 56.403 1.00 28.85  ? 510 ALA B CA    1 
ATOM   3331 C  C     . ALA B 1 269 ? -22.661 36.638 57.898 1.00 34.61  ? 510 ALA B C     1 
ATOM   3332 O  O     . ALA B 1 269 ? -23.156 35.694 58.519 1.00 32.16  ? 510 ALA B O     1 
ATOM   3333 C  CB    . ALA B 1 269 ? -21.686 36.370 55.622 1.00 26.12  ? 510 ALA B CB    1 
ATOM   3334 N  N     . HIS B 1 270 ? -21.898 37.558 58.481 1.00 32.26  ? 511 HIS B N     1 
ATOM   3335 C  CA    . HIS B 1 270 ? -21.609 37.459 59.904 1.00 33.06  ? 511 HIS B CA    1 
ATOM   3336 C  C     . HIS B 1 270 ? -22.890 37.601 60.700 1.00 28.28  ? 511 HIS B C     1 
ATOM   3337 O  O     . HIS B 1 270 ? -23.118 36.877 61.664 1.00 28.10  ? 511 HIS B O     1 
ATOM   3338 C  CB    . HIS B 1 270 ? -20.602 38.515 60.353 1.00 30.27  ? 511 HIS B CB    1 
ATOM   3339 C  CG    . HIS B 1 270 ? -20.310 38.470 61.822 1.00 32.88  ? 511 HIS B CG    1 
ATOM   3340 N  ND1   . HIS B 1 270 ? -21.024 39.203 62.745 1.00 31.95  ? 511 HIS B ND1   1 
ATOM   3341 C  CD2   . HIS B 1 270 ? -19.395 37.765 62.529 1.00 31.47  ? 511 HIS B CD2   1 
ATOM   3342 C  CE1   . HIS B 1 270 ? -20.554 38.960 63.956 1.00 29.16  ? 511 HIS B CE1   1 
ATOM   3343 N  NE2   . HIS B 1 270 ? -19.563 38.092 63.853 1.00 28.91  ? 511 HIS B NE2   1 
ATOM   3344 N  N     . PHE B 1 271 ? -23.729 38.536 60.278 1.00 26.03  ? 512 PHE B N     1 
ATOM   3345 C  CA    . PHE B 1 271 ? -24.997 38.762 60.939 1.00 25.50  ? 512 PHE B CA    1 
ATOM   3346 C  C     . PHE B 1 271 ? -25.873 37.509 60.902 1.00 30.48  ? 512 PHE B C     1 
ATOM   3347 O  O     . PHE B 1 271 ? -26.508 37.169 61.899 1.00 28.64  ? 512 PHE B O     1 
ATOM   3348 C  CB    . PHE B 1 271 ? -25.719 39.934 60.295 1.00 24.57  ? 512 PHE B CB    1 
ATOM   3349 C  CG    . PHE B 1 271 ? -27.017 40.271 60.950 1.00 24.63  ? 512 PHE B CG    1 
ATOM   3350 C  CD1   . PHE B 1 271 ? -27.044 41.036 62.098 1.00 22.28  ? 512 PHE B CD1   1 
ATOM   3351 C  CD2   . PHE B 1 271 ? -28.212 39.827 60.414 1.00 23.01  ? 512 PHE B CD2   1 
ATOM   3352 C  CE1   . PHE B 1 271 ? -28.235 41.353 62.700 1.00 20.79  ? 512 PHE B CE1   1 
ATOM   3353 C  CE2   . PHE B 1 271 ? -29.407 40.141 61.009 1.00 19.64  ? 512 PHE B CE2   1 
ATOM   3354 C  CZ    . PHE B 1 271 ? -29.421 40.903 62.154 1.00 23.18  ? 512 PHE B CZ    1 
ATOM   3355 N  N     . ASN B 1 272 ? -25.899 36.830 59.755 1.00 27.99  ? 513 ASN B N     1 
ATOM   3356 C  CA    . ASN B 1 272 ? -26.628 35.573 59.612 1.00 22.74  ? 513 ASN B CA    1 
ATOM   3357 C  C     . ASN B 1 272 ? -26.171 34.528 60.609 1.00 29.40  ? 513 ASN B C     1 
ATOM   3358 O  O     . ASN B 1 272 ? -26.987 33.894 61.278 1.00 29.46  ? 513 ASN B O     1 
ATOM   3359 C  CB    . ASN B 1 272 ? -26.470 35.006 58.207 1.00 24.88  ? 513 ASN B CB    1 
ATOM   3360 C  CG    . ASN B 1 272 ? -27.345 35.700 57.200 1.00 28.79  ? 513 ASN B CG    1 
ATOM   3361 O  OD1   . ASN B 1 272 ? -28.290 36.402 57.558 1.00 30.20  ? 513 ASN B OD1   1 
ATOM   3362 N  ND2   . ASN B 1 272 ? -27.042 35.503 55.925 1.00 31.19  ? 513 ASN B ND2   1 
ATOM   3363 N  N     . ARG B 1 273 ? -24.859 34.340 60.689 1.00 34.05  ? 514 ARG B N     1 
ATOM   3364 C  CA    . ARG B 1 273 ? -24.288 33.376 61.616 1.00 33.22  ? 514 ARG B CA    1 
ATOM   3365 C  C     . ARG B 1 273 ? -24.664 33.758 63.034 1.00 28.09  ? 514 ARG B C     1 
ATOM   3366 O  O     . ARG B 1 273 ? -24.964 32.901 63.862 1.00 28.74  ? 514 ARG B O     1 
ATOM   3367 C  CB    . ARG B 1 273 ? -22.769 33.299 61.460 1.00 34.38  ? 514 ARG B CB    1 
ATOM   3368 C  CG    . ARG B 1 273 ? -22.327 32.968 60.048 1.00 43.85  ? 514 ARG B CG    1 
ATOM   3369 C  CD    . ARG B 1 273 ? -20.833 32.704 59.962 1.00 51.77  ? 514 ARG B CD    1 
ATOM   3370 N  NE    . ARG B 1 273 ? -20.383 32.686 58.573 1.00 58.74  ? 514 ARG B NE    1 
ATOM   3371 C  CZ    . ARG B 1 273 ? -19.770 33.705 57.979 1.00 57.83  ? 514 ARG B CZ    1 
ATOM   3372 N  NH1   . ARG B 1 273 ? -19.521 34.816 58.668 1.00 49.42  ? 514 ARG B NH1   1 
ATOM   3373 N  NH2   . ARG B 1 273 ? -19.398 33.610 56.705 1.00 42.62  ? 514 ARG B NH2   1 
ATOM   3374 N  N     . SER B 1 274 ? -24.672 35.060 63.294 1.00 30.05  ? 515 SER B N     1 
ATOM   3375 C  CA    . SER B 1 274 ? -24.993 35.577 64.614 1.00 27.19  ? 515 SER B CA    1 
ATOM   3376 C  C     . SER B 1 274 ? -26.435 35.248 64.994 1.00 29.17  ? 515 SER B C     1 
ATOM   3377 O  O     . SER B 1 274 ? -26.695 34.750 66.089 1.00 29.57  ? 515 SER B O     1 
ATOM   3378 C  CB    . SER B 1 274 ? -24.755 37.083 64.661 1.00 24.41  ? 515 SER B CB    1 
ATOM   3379 O  OG    . SER B 1 274 ? -24.820 37.567 65.987 1.00 32.26  ? 515 SER B OG    1 
ATOM   3380 N  N     . MET B 1 275 ? -27.365 35.516 64.080 1.00 27.06  ? 516 MET B N     1 
ATOM   3381 C  CA    . MET B 1 275 ? -28.778 35.218 64.300 1.00 21.52  ? 516 MET B CA    1 
ATOM   3382 C  C     . MET B 1 275 ? -29.034 33.718 64.388 1.00 28.18  ? 516 MET B C     1 
ATOM   3383 O  O     . MET B 1 275 ? -29.881 33.267 65.159 1.00 31.34  ? 516 MET B O     1 
ATOM   3384 C  CB    . MET B 1 275 ? -29.624 35.822 63.188 1.00 19.62  ? 516 MET B CB    1 
ATOM   3385 C  CG    . MET B 1 275 ? -29.497 37.315 63.105 1.00 25.72  ? 516 MET B CG    1 
ATOM   3386 S  SD    . MET B 1 275 ? -30.174 38.130 64.559 1.00 27.39  ? 516 MET B SD    1 
ATOM   3387 C  CE    . MET B 1 275 ? -31.885 38.249 64.039 1.00 34.31  ? 516 MET B CE    1 
ATOM   3388 N  N     . ARG B 1 276 ? -28.302 32.945 63.596 1.00 27.52  ? 517 ARG B N     1 
ATOM   3389 C  CA    . ARG B 1 276 ? -28.405 31.500 63.673 1.00 28.37  ? 517 ARG B CA    1 
ATOM   3390 C  C     . ARG B 1 276 ? -27.965 31.037 65.058 1.00 32.20  ? 517 ARG B C     1 
ATOM   3391 O  O     . ARG B 1 276 ? -28.495 30.066 65.589 1.00 35.50  ? 517 ARG B O     1 
ATOM   3392 C  CB    . ARG B 1 276 ? -27.563 30.832 62.583 1.00 32.44  ? 517 ARG B CB    1 
ATOM   3393 C  CG    . ARG B 1 276 ? -27.897 29.368 62.346 1.00 35.83  ? 517 ARG B CG    1 
ATOM   3394 C  CD    . ARG B 1 276 ? -27.090 28.792 61.195 1.00 44.42  ? 517 ARG B CD    1 
ATOM   3395 N  NE    . ARG B 1 276 ? -25.653 28.859 61.449 1.00 56.14  ? 517 ARG B NE    1 
ATOM   3396 C  CZ    . ARG B 1 276 ? -24.757 29.300 60.570 1.00 58.67  ? 517 ARG B CZ    1 
ATOM   3397 N  NH1   . ARG B 1 276 ? -25.147 29.715 59.369 1.00 48.34  ? 517 ARG B NH1   1 
ATOM   3398 N  NH2   . ARG B 1 276 ? -23.469 29.329 60.893 1.00 51.71  ? 517 ARG B NH2   1 
ATOM   3399 N  N     . ALA B 1 277 ? -27.006 31.746 65.649 1.00 28.48  ? 518 ALA B N     1 
ATOM   3400 C  CA    . ALA B 1 277 ? -26.513 31.396 66.976 1.00 26.81  ? 518 ALA B CA    1 
ATOM   3401 C  C     . ALA B 1 277 ? -27.546 31.731 68.041 1.00 30.24  ? 518 ALA B C     1 
ATOM   3402 O  O     . ALA B 1 277 ? -27.737 30.981 69.000 1.00 31.08  ? 518 ALA B O     1 
ATOM   3403 C  CB    . ALA B 1 277 ? -25.207 32.112 67.269 1.00 27.43  ? 518 ALA B CB    1 
ATOM   3404 N  N     . LEU B 1 278 ? -28.207 32.867 67.869 1.00 28.42  ? 519 LEU B N     1 
ATOM   3405 C  CA    . LEU B 1 278 ? -29.204 33.307 68.829 1.00 27.12  ? 519 LEU B CA    1 
ATOM   3406 C  C     . LEU B 1 278 ? -30.391 32.355 68.820 1.00 29.99  ? 519 LEU B C     1 
ATOM   3407 O  O     . LEU B 1 278 ? -30.971 32.062 69.868 1.00 25.82  ? 519 LEU B O     1 
ATOM   3408 C  CB    . LEU B 1 278 ? -29.658 34.731 68.521 1.00 23.89  ? 519 LEU B CB    1 
ATOM   3409 C  CG    . LEU B 1 278 ? -30.623 35.313 69.549 1.00 21.72  ? 519 LEU B CG    1 
ATOM   3410 C  CD1   . LEU B 1 278 ? -29.974 35.296 70.917 1.00 19.11  ? 519 LEU B CD1   1 
ATOM   3411 C  CD2   . LEU B 1 278 ? -31.046 36.720 69.159 1.00 19.46  ? 519 LEU B CD2   1 
ATOM   3412 N  N     . ALA B 1 279 ? -30.739 31.865 67.634 1.00 28.59  ? 520 ALA B N     1 
ATOM   3413 C  CA    . ALA B 1 279 ? -31.842 30.922 67.493 1.00 28.40  ? 520 ALA B CA    1 
ATOM   3414 C  C     . ALA B 1 279 ? -31.576 29.644 68.282 1.00 29.18  ? 520 ALA B C     1 
ATOM   3415 O  O     . ALA B 1 279 ? -32.486 29.071 68.873 1.00 28.13  ? 520 ALA B O     1 
ATOM   3416 C  CB    . ALA B 1 279 ? -32.084 30.599 66.030 1.00 25.95  ? 520 ALA B CB    1 
ATOM   3417 N  N     . LYS B 1 280 ? -30.321 29.208 68.300 1.00 30.31  ? 521 LYS B N     1 
ATOM   3418 C  CA    . LYS B 1 280 ? -29.959 27.996 69.022 1.00 32.25  ? 521 LYS B CA    1 
ATOM   3419 C  C     . LYS B 1 280 ? -30.099 28.136 70.541 1.00 32.65  ? 521 LYS B C     1 
ATOM   3420 O  O     . LYS B 1 280 ? -30.431 27.164 71.221 1.00 34.39  ? 521 LYS B O     1 
ATOM   3421 C  CB    . LYS B 1 280 ? -28.530 27.575 68.676 1.00 32.02  ? 521 LYS B CB    1 
ATOM   3422 C  CG    . LYS B 1 280 ? -28.413 26.804 67.372 1.00 37.20  ? 521 LYS B CG    1 
ATOM   3423 C  CD    . LYS B 1 280 ? -27.122 26.001 67.338 1.00 44.34  ? 521 LYS B CD    1 
ATOM   3424 C  CE    . LYS B 1 280 ? -26.955 25.187 68.619 1.00 45.68  ? 521 LYS B CE    1 
ATOM   3425 N  NZ    . LYS B 1 280 ? -25.968 24.078 68.473 1.00 58.61  ? 521 LYS B NZ    1 
ATOM   3426 N  N     . THR B 1 281 ? -29.850 29.329 71.077 1.00 26.76  ? 522 THR B N     1 
ATOM   3427 C  CA    . THR B 1 281 ? -29.955 29.519 72.521 1.00 24.99  ? 522 THR B CA    1 
ATOM   3428 C  C     . THR B 1 281 ? -31.411 29.421 72.961 1.00 28.72  ? 522 THR B C     1 
ATOM   3429 O  O     . THR B 1 281 ? -31.700 29.176 74.131 1.00 33.56  ? 522 THR B O     1 
ATOM   3430 C  CB    . THR B 1 281 ? -29.384 30.876 72.992 1.00 22.94  ? 522 THR B CB    1 
ATOM   3431 O  OG1   . THR B 1 281 ? -30.210 31.943 72.512 1.00 31.53  ? 522 THR B OG1   1 
ATOM   3432 C  CG2   . THR B 1 281 ? -27.958 31.072 72.515 1.00 19.27  ? 522 THR B CG2   1 
ATOM   3433 N  N     . LYS B 1 282 ? -32.326 29.617 72.019 1.00 26.79  ? 523 LYS B N     1 
ATOM   3434 C  CA    . LYS B 1 282 ? -33.746 29.511 72.312 1.00 25.38  ? 523 LYS B CA    1 
ATOM   3435 C  C     . LYS B 1 282 ? -34.290 28.166 71.852 1.00 27.56  ? 523 LYS B C     1 
ATOM   3436 O  O     . LYS B 1 282 ? -35.502 27.982 71.738 1.00 27.84  ? 523 LYS B O     1 
ATOM   3437 C  CB    . LYS B 1 282 ? -34.524 30.646 71.648 1.00 26.63  ? 523 LYS B CB    1 
ATOM   3438 C  CG    . LYS B 1 282 ? -33.954 32.028 71.918 1.00 31.38  ? 523 LYS B CG    1 
ATOM   3439 C  CD    . LYS B 1 282 ? -34.929 33.132 71.514 1.00 27.11  ? 523 LYS B CD    1 
ATOM   3440 C  CE    . LYS B 1 282 ? -36.011 33.300 72.563 1.00 27.77  ? 523 LYS B CE    1 
ATOM   3441 N  NZ    . LYS B 1 282 ? -35.428 33.657 73.888 1.00 26.21  ? 523 LYS B NZ    1 
ATOM   3442 N  N     . GLY B 1 283 ? -33.386 27.228 71.588 1.00 26.85  ? 524 GLY B N     1 
ATOM   3443 C  CA    . GLY B 1 283 ? -33.769 25.917 71.097 1.00 30.34  ? 524 GLY B CA    1 
ATOM   3444 C  C     . GLY B 1 283 ? -34.389 25.925 69.708 1.00 29.84  ? 524 GLY B C     1 
ATOM   3445 O  O     . GLY B 1 283 ? -35.036 24.961 69.306 1.00 35.20  ? 524 GLY B O     1 
ATOM   3446 N  N     . MET B 1 284 ? -34.191 27.012 68.971 1.00 28.42  ? 525 MET B N     1 
ATOM   3447 C  CA    . MET B 1 284 ? -34.741 27.137 67.627 1.00 26.16  ? 525 MET B CA    1 
ATOM   3448 C  C     . MET B 1 284 ? -33.666 26.920 66.566 1.00 27.81  ? 525 MET B C     1 
ATOM   3449 O  O     . MET B 1 284 ? -32.480 26.822 66.880 1.00 34.56  ? 525 MET B O     1 
ATOM   3450 C  CB    . MET B 1 284 ? -35.375 28.511 67.439 1.00 23.74  ? 525 MET B CB    1 
ATOM   3451 C  CG    . MET B 1 284 ? -36.397 28.884 68.486 1.00 24.21  ? 525 MET B CG    1 
ATOM   3452 S  SD    . MET B 1 284 ? -36.957 30.589 68.282 1.00 30.62  ? 525 MET B SD    1 
ATOM   3453 C  CE    . MET B 1 284 ? -38.306 30.658 69.454 1.00 26.63  ? 525 MET B CE    1 
ATOM   3454 N  N     . SER B 1 285 ? -34.080 26.849 65.307 1.00 23.97  ? 526 SER B N     1 
ATOM   3455 C  CA    . SER B 1 285 ? -33.131 26.798 64.205 1.00 24.41  ? 526 SER B CA    1 
ATOM   3456 C  C     . SER B 1 285 ? -33.588 27.721 63.084 1.00 27.44  ? 526 SER B C     1 
ATOM   3457 O  O     . SER B 1 285 ? -34.756 27.699 62.687 1.00 26.53  ? 526 SER B O     1 
ATOM   3458 C  CB    . SER B 1 285 ? -32.972 25.373 63.684 1.00 27.95  ? 526 SER B CB    1 
ATOM   3459 O  OG    . SER B 1 285 ? -34.088 25.005 62.895 1.00 40.00  ? 526 SER B OG    1 
ATOM   3460 N  N     . LEU B 1 286 ? -32.661 28.532 62.582 1.00 28.16  ? 527 LEU B N     1 
ATOM   3461 C  CA    . LEU B 1 286 ? -32.966 29.516 61.547 1.00 24.89  ? 527 LEU B CA    1 
ATOM   3462 C  C     . LEU B 1 286 ? -32.240 29.203 60.246 1.00 28.60  ? 527 LEU B C     1 
ATOM   3463 O  O     . LEU B 1 286 ? -31.040 28.915 60.242 1.00 32.23  ? 527 LEU B O     1 
ATOM   3464 C  CB    . LEU B 1 286 ? -32.588 30.916 62.022 1.00 24.16  ? 527 LEU B CB    1 
ATOM   3465 C  CG    . LEU B 1 286 ? -32.755 32.064 61.030 1.00 20.59  ? 527 LEU B CG    1 
ATOM   3466 C  CD1   . LEU B 1 286 ? -34.227 32.354 60.814 1.00 28.87  ? 527 LEU B CD1   1 
ATOM   3467 C  CD2   . LEU B 1 286 ? -32.026 33.303 61.523 1.00 15.29  ? 527 LEU B CD2   1 
ATOM   3468 N  N     . SER B 1 287 ? -32.974 29.263 59.143 1.00 25.96  ? 528 SER B N     1 
ATOM   3469 C  CA    . SER B 1 287 ? -32.403 29.014 57.827 1.00 28.59  ? 528 SER B CA    1 
ATOM   3470 C  C     . SER B 1 287 ? -32.975 30.015 56.840 1.00 28.87  ? 528 SER B C     1 
ATOM   3471 O  O     . SER B 1 287 ? -33.710 30.922 57.227 1.00 31.85  ? 528 SER B O     1 
ATOM   3472 C  CB    . SER B 1 287 ? -32.693 27.588 57.366 1.00 29.15  ? 528 SER B CB    1 
ATOM   3473 O  OG    . SER B 1 287 ? -34.082 27.393 57.154 1.00 29.11  ? 528 SER B OG    1 
ATOM   3474 N  N     . GLU B 1 288 ? -32.650 29.855 55.565 1.00 23.99  ? 529 GLU B N     1 
ATOM   3475 C  CA    . GLU B 1 288 ? -33.203 30.754 54.563 1.00 30.52  ? 529 GLU B CA    1 
ATOM   3476 C  C     . GLU B 1 288 ? -34.680 30.458 54.336 1.00 31.63  ? 529 GLU B C     1 
ATOM   3477 O  O     . GLU B 1 288 ? -35.395 31.270 53.751 1.00 30.69  ? 529 GLU B O     1 
ATOM   3478 C  CB    . GLU B 1 288 ? -32.432 30.655 53.242 1.00 35.36  ? 529 GLU B CB    1 
ATOM   3479 C  CG    . GLU B 1 288 ? -32.417 29.276 52.603 1.00 36.11  ? 529 GLU B CG    1 
ATOM   3480 C  CD    . GLU B 1 288 ? -31.290 28.397 53.126 1.00 44.54  ? 529 GLU B CD    1 
ATOM   3481 O  OE1   . GLU B 1 288 ? -30.847 28.602 54.280 1.00 36.98  ? 529 GLU B OE1   1 
ATOM   3482 O  OE2   . GLU B 1 288 ? -30.845 27.503 52.374 1.00 45.80  ? 529 GLU B OE2   1 
ATOM   3483 N  N     . HIS B 1 289 ? -35.134 29.302 54.816 1.00 33.55  ? 530 HIS B N     1 
ATOM   3484 C  CA    . HIS B 1 289 ? -36.502 28.853 54.569 1.00 33.51  ? 530 HIS B CA    1 
ATOM   3485 C  C     . HIS B 1 289 ? -37.446 29.212 55.706 1.00 34.08  ? 530 HIS B C     1 
ATOM   3486 O  O     . HIS B 1 289 ? -38.531 29.748 55.473 1.00 34.89  ? 530 HIS B O     1 
ATOM   3487 C  CB    . HIS B 1 289 ? -36.545 27.342 54.351 1.00 32.77  ? 530 HIS B CB    1 
ATOM   3488 C  CG    . HIS B 1 289 ? -35.591 26.847 53.312 1.00 33.54  ? 530 HIS B CG    1 
ATOM   3489 N  ND1   . HIS B 1 289 ? -35.865 26.902 51.963 1.00 34.95  ? 530 HIS B ND1   1 
ATOM   3490 C  CD2   . HIS B 1 289 ? -34.370 26.273 53.426 1.00 31.84  ? 530 HIS B CD2   1 
ATOM   3491 C  CE1   . HIS B 1 289 ? -34.850 26.389 51.290 1.00 41.70  ? 530 HIS B CE1   1 
ATOM   3492 N  NE2   . HIS B 1 289 ? -33.931 26.000 52.154 1.00 38.71  ? 530 HIS B NE2   1 
ATOM   3493 N  N     . ALA B 1 290 ? -37.036 28.904 56.933 1.00 31.29  ? 531 ALA B N     1 
ATOM   3494 C  CA    . ALA B 1 290 ? -37.917 29.068 58.083 1.00 32.06  ? 531 ALA B CA    1 
ATOM   3495 C  C     . ALA B 1 290 ? -37.179 29.170 59.416 1.00 32.04  ? 531 ALA B C     1 
ATOM   3496 O  O     . ALA B 1 290 ? -36.018 28.779 59.542 1.00 33.74  ? 531 ALA B O     1 
ATOM   3497 C  CB    . ALA B 1 290 ? -38.908 27.918 58.137 1.00 28.73  ? 531 ALA B CB    1 
ATOM   3498 N  N     . LEU B 1 291 ? -37.875 29.712 60.408 1.00 32.74  ? 532 LEU B N     1 
ATOM   3499 C  CA    . LEU B 1 291 ? -37.439 29.651 61.795 1.00 28.96  ? 532 LEU B CA    1 
ATOM   3500 C  C     . LEU B 1 291 ? -38.344 28.664 62.514 1.00 30.21  ? 532 LEU B C     1 
ATOM   3501 O  O     . LEU B 1 291 ? -39.567 28.798 62.474 1.00 30.45  ? 532 LEU B O     1 
ATOM   3502 C  CB    . LEU B 1 291 ? -37.497 31.029 62.456 1.00 26.60  ? 532 LEU B CB    1 
ATOM   3503 C  CG    . LEU B 1 291 ? -37.049 31.112 63.912 1.00 22.58  ? 532 LEU B CG    1 
ATOM   3504 C  CD1   . LEU B 1 291 ? -35.640 30.584 64.059 1.00 27.04  ? 532 LEU B CD1   1 
ATOM   3505 C  CD2   . LEU B 1 291 ? -37.128 32.537 64.394 1.00 26.22  ? 532 LEU B CD2   1 
ATOM   3506 N  N     . SER B 1 292 ? -37.751 27.667 63.160 1.00 32.03  ? 533 SER B N     1 
ATOM   3507 C  CA    . SER B 1 292 ? -38.543 26.590 63.740 1.00 35.91  ? 533 SER B CA    1 
ATOM   3508 C  C     . SER B 1 292 ? -38.014 26.141 65.091 1.00 36.56  ? 533 SER B C     1 
ATOM   3509 O  O     . SER B 1 292 ? -36.821 26.252 65.365 1.00 36.54  ? 533 SER B O     1 
ATOM   3510 C  CB    . SER B 1 292 ? -38.576 25.400 62.788 1.00 33.50  ? 533 SER B CB    1 
ATOM   3511 O  OG    . SER B 1 292 ? -37.266 24.900 62.592 1.00 32.38  ? 533 SER B OG    1 
ATOM   3512 N  N     . THR B 1 293 ? -38.911 25.627 65.929 1.00 37.52  ? 534 THR B N     1 
ATOM   3513 C  CA    . THR B 1 293 ? -38.526 25.059 67.216 1.00 38.37  ? 534 THR B CA    1 
ATOM   3514 C  C     . THR B 1 293 ? -38.018 23.639 67.033 1.00 43.43  ? 534 THR B C     1 
ATOM   3515 O  O     . THR B 1 293 ? -38.420 22.943 66.101 1.00 44.05  ? 534 THR B O     1 
ATOM   3516 C  CB    . THR B 1 293 ? -39.697 25.043 68.208 1.00 38.75  ? 534 THR B CB    1 
ATOM   3517 O  OG1   . THR B 1 293 ? -40.837 24.442 67.581 1.00 53.39  ? 534 THR B OG1   1 
ATOM   3518 C  CG2   . THR B 1 293 ? -40.055 26.451 68.633 1.00 30.81  ? 534 THR B CG2   1 
ATOM   3519 N  N     . ALA B 1 294 ? -37.137 23.210 67.927 1.00 46.12  ? 535 ALA B N     1 
ATOM   3520 C  CA    . ALA B 1 294 ? -36.570 21.871 67.851 1.00 51.53  ? 535 ALA B CA    1 
ATOM   3521 C  C     . ALA B 1 294 ? -37.587 20.815 68.274 1.00 64.80  ? 535 ALA B C     1 
ATOM   3522 O  O     . ALA B 1 294 ? -37.728 19.778 67.621 1.00 70.79  ? 535 ALA B O     1 
ATOM   3523 C  CB    . ALA B 1 294 ? -35.320 21.776 68.712 1.00 54.99  ? 535 ALA B CB    1 
ATOM   3524 N  N     . VAL B 1 295 ? -38.295 21.087 69.367 1.00 58.26  ? 536 VAL B N     1 
ATOM   3525 C  CA    . VAL B 1 295 ? -39.252 20.138 69.923 1.00 54.73  ? 536 VAL B CA    1 
ATOM   3526 C  C     . VAL B 1 295 ? -40.114 20.838 70.965 1.00 54.38  ? 536 VAL B C     1 
ATOM   3527 O  O     . VAL B 1 295 ? -39.827 21.971 71.343 1.00 67.03  ? 536 VAL B O     1 
ATOM   3528 C  CB    . VAL B 1 295 ? -38.540 18.925 70.560 1.00 57.97  ? 536 VAL B CB    1 
ATOM   3529 C  CG1   . VAL B 1 295 ? -38.151 19.227 72.002 1.00 51.87  ? 536 VAL B CG1   1 
ATOM   3530 C  CG2   . VAL B 1 295 ? -39.416 17.689 70.481 1.00 57.40  ? 536 VAL B CG2   1 
ATOM   3531 N  N     . VAL B 1 296 ? -41.148 20.161 71.433 1.00 50.80  ? 537 VAL B N     1 
ATOM   3532 C  CA    . VAL B 1 296 ? -42.007 20.725 72.449 1.00 49.42  ? 537 VAL B CA    1 
ATOM   3533 C  C     . VAL B 1 296 ? -42.032 19.840 73.658 1.00 50.81  ? 537 VAL B C     1 
ATOM   3534 O  O     . VAL B 1 296 ? -42.440 18.710 73.590 1.00 50.74  ? 537 VAL B O     1 
ATOM   3535 C  CB    . VAL B 1 296 ? -43.432 20.880 71.954 1.00 46.00  ? 537 VAL B CB    1 
ATOM   3536 C  CG1   . VAL B 1 296 ? -44.234 21.635 72.968 1.00 50.09  ? 537 VAL B CG1   1 
ATOM   3537 C  CG2   . VAL B 1 296 ? -43.451 21.644 70.668 1.00 43.32  ? 537 VAL B CG2   1 
ATOM   3538 N  N     . ARG B 1 297 ? -41.627 20.387 74.783 1.00 54.15  ? 538 ARG B N     1 
ATOM   3539 C  CA    . ARG B 1 297 ? -41.588 19.656 76.026 1.00 55.19  ? 538 ARG B CA    1 
ATOM   3540 C  C     . ARG B 1 297 ? -42.435 20.380 77.018 1.00 58.34  ? 538 ARG B C     1 
ATOM   3541 O  O     . ARG B 1 297 ? -42.719 21.532 76.845 1.00 64.66  ? 538 ARG B O     1 
ATOM   3542 C  CB    . ARG B 1 297 ? -40.183 19.610 76.576 1.00 53.57  ? 538 ARG B CB    1 
ATOM   3543 C  CG    . ARG B 1 297 ? -39.149 19.152 75.595 1.00 56.32  ? 538 ARG B CG    1 
ATOM   3544 C  CD    . ARG B 1 297 ? -37.853 18.874 76.295 1.00 52.47  ? 538 ARG B CD    1 
ATOM   3545 N  NE    . ARG B 1 297 ? -37.690 17.466 76.562 1.00 61.36  ? 538 ARG B NE    1 
ATOM   3546 C  CZ    . ARG B 1 297 ? -37.018 16.657 75.765 1.00 63.24  ? 538 ARG B CZ    1 
ATOM   3547 N  NH1   . ARG B 1 297 ? -36.468 17.135 74.675 1.00 57.81  ? 538 ARG B NH1   1 
ATOM   3548 N  NH2   . ARG B 1 297 ? -36.896 15.383 76.051 1.00 60.71  ? 538 ARG B NH2   1 
ATOM   3549 N  N     . ASN B 1 298 ? -42.874 19.689 78.045 1.00 58.00  ? 539 ASN B N     1 
ATOM   3550 C  CA    . ASN B 1 298 ? -43.678 20.308 79.057 1.00 55.54  ? 539 ASN B CA    1 
ATOM   3551 C  C     . ASN B 1 298 ? -42.868 20.610 80.291 1.00 64.76  ? 539 ASN B C     1 
ATOM   3552 O  O     . ASN B 1 298 ? -41.665 20.463 80.293 1.00 59.21  ? 539 ASN B O     1 
ATOM   3553 C  CB    . ASN B 1 298 ? -44.917 19.497 79.369 1.00 52.47  ? 539 ASN B CB    1 
ATOM   3554 C  CG    . ASN B 1 298 ? -44.608 18.248 80.112 1.00 58.54  ? 539 ASN B CG    1 
ATOM   3555 O  OD1   . ASN B 1 298 ? -43.474 17.981 80.428 1.00 59.22  ? 539 ASN B OD1   1 
ATOM   3556 N  ND2   . ASN B 1 298 ? -45.620 17.473 80.391 1.00 55.61  ? 539 ASN B ND2   1 
ATOM   3557 N  N     . THR B 1 299 ? -43.553 21.009 81.347 1.00 60.79  ? 540 THR B N     1 
ATOM   3558 C  CA    . THR B 1 299 ? -42.921 21.384 82.576 1.00 57.61  ? 540 THR B CA    1 
ATOM   3559 C  C     . THR B 1 299 ? -42.079 20.276 83.091 1.00 60.87  ? 540 THR B C     1 
ATOM   3560 O  O     . THR B 1 299 ? -40.999 20.508 83.572 1.00 58.26  ? 540 THR B O     1 
ATOM   3561 C  CB    . THR B 1 299 ? -43.990 21.587 83.642 1.00 66.76  ? 540 THR B CB    1 
ATOM   3562 O  OG1   . THR B 1 299 ? -44.909 22.585 83.214 1.00 73.42  ? 540 THR B OG1   1 
ATOM   3563 C  CG2   . THR B 1 299 ? -43.388 22.027 84.920 1.00 66.61  ? 540 THR B CG2   1 
ATOM   3564 N  N     . HIS B 1 300 ? -42.585 19.064 83.007 1.00 65.60  ? 541 HIS B N     1 
ATOM   3565 C  CA    . HIS B 1 300 ? -41.873 17.907 83.480 1.00 62.00  ? 541 HIS B CA    1 
ATOM   3566 C  C     . HIS B 1 300 ? -40.736 17.551 82.585 1.00 54.54  ? 541 HIS B C     1 
ATOM   3567 O  O     . HIS B 1 300 ? -39.840 16.853 82.973 1.00 55.89  ? 541 HIS B O     1 
ATOM   3568 C  CB    . HIS B 1 300 ? -42.829 16.762 83.656 1.00 60.17  ? 541 HIS B CB    1 
ATOM   3569 C  CG    . HIS B 1 300 ? -44.042 17.136 84.421 1.00 59.03  ? 541 HIS B CG    1 
ATOM   3570 N  ND1   . HIS B 1 300 ? -44.166 16.915 85.768 1.00 65.53  ? 541 HIS B ND1   1 
ATOM   3571 C  CD2   . HIS B 1 300 ? -45.171 17.764 84.039 1.00 66.04  ? 541 HIS B CD2   1 
ATOM   3572 C  CE1   . HIS B 1 300 ? -45.334 17.365 86.177 1.00 71.78  ? 541 HIS B CE1   1 
ATOM   3573 N  NE2   . HIS B 1 300 ? -45.964 17.885 85.147 1.00 61.47  ? 541 HIS B NE2   1 
ATOM   3574 N  N     . GLY B 1 301 ? -40.776 18.055 81.376 1.00 54.36  ? 542 GLY B N     1 
ATOM   3575 C  CA    . GLY B 1 301 ? -39.742 17.773 80.412 1.00 62.97  ? 542 GLY B CA    1 
ATOM   3576 C  C     . GLY B 1 301 ? -40.071 16.658 79.450 1.00 66.35  ? 542 GLY B C     1 
ATOM   3577 O  O     . GLY B 1 301 ? -39.259 16.256 78.642 1.00 63.72  ? 542 GLY B O     1 
ATOM   3578 N  N     . CYS B 1 302 ? -41.283 16.156 79.547 1.00 60.40  ? 543 CYS B N     1 
ATOM   3579 C  CA    . CYS B 1 302 ? -41.716 15.127 78.671 1.00 55.65  ? 543 CYS B CA    1 
ATOM   3580 C  C     . CYS B 1 302 ? -41.906 15.763 77.318 1.00 51.99  ? 543 CYS B C     1 
ATOM   3581 O  O     . CYS B 1 302 ? -42.313 16.882 77.244 1.00 51.04  ? 543 CYS B O     1 
ATOM   3582 C  CB    . CYS B 1 302 ? -43.012 14.529 79.204 1.00 56.53  ? 543 CYS B CB    1 
ATOM   3583 S  SG    . CYS B 1 302 ? -42.800 13.165 80.369 1.00 77.90  ? 543 CYS B SG    1 
ATOM   3584 N  N     . LYS B 1 303 ? -41.591 15.053 76.247 1.00 52.82  ? 544 LYS B N     1 
ATOM   3585 C  CA    . LYS B 1 303 ? -41.781 15.566 74.907 1.00 47.11  ? 544 LYS B CA    1 
ATOM   3586 C  C     . LYS B 1 303 ? -43.254 15.496 74.670 1.00 42.92  ? 544 LYS B C     1 
ATOM   3587 O  O     . LYS B 1 303 ? -43.875 14.556 75.044 1.00 46.59  ? 544 LYS B O     1 
ATOM   3588 C  CB    . LYS B 1 303 ? -41.034 14.734 73.907 1.00 46.44  ? 544 LYS B CB    1 
ATOM   3589 C  CG    . LYS B 1 303 ? -40.765 15.447 72.623 1.00 47.06  ? 544 LYS B CG    1 
ATOM   3590 C  CD    . LYS B 1 303 ? -40.406 14.470 71.547 1.00 46.20  ? 544 LYS B CD    1 
ATOM   3591 C  CE    . LYS B 1 303 ? -38.929 14.321 71.400 1.00 42.19  ? 544 LYS B CE    1 
ATOM   3592 N  NZ    . LYS B 1 303 ? -38.660 13.339 70.342 1.00 42.27  ? 544 LYS B NZ    1 
ATOM   3593 N  N     . VAL B 1 304 ? -43.816 16.493 74.035 1.00 41.13  ? 545 VAL B N     1 
ATOM   3594 C  CA    . VAL B 1 304 ? -45.264 16.577 73.870 1.00 44.64  ? 545 VAL B CA    1 
ATOM   3595 C  C     . VAL B 1 304 ? -45.690 16.695 72.407 1.00 48.55  ? 545 VAL B C     1 
ATOM   3596 O  O     . VAL B 1 304 ? -46.681 16.095 71.988 1.00 57.13  ? 545 VAL B O     1 
ATOM   3597 C  CB    . VAL B 1 304 ? -45.831 17.771 74.671 1.00 45.81  ? 545 VAL B CB    1 
ATOM   3598 C  CG1   . VAL B 1 304 ? -47.163 18.247 74.095 1.00 47.03  ? 545 VAL B CG1   1 
ATOM   3599 C  CG2   . VAL B 1 304 ? -45.966 17.398 76.137 1.00 38.99  ? 545 VAL B CG2   1 
ATOM   3600 N  N     . GLY B 1 305 ? -44.940 17.464 71.630 1.00 46.86  ? 546 GLY B N     1 
ATOM   3601 C  CA    . GLY B 1 305 ? -45.234 17.612 70.218 1.00 42.31  ? 546 GLY B CA    1 
ATOM   3602 C  C     . GLY B 1 305 ? -43.974 17.625 69.381 1.00 45.05  ? 546 GLY B C     1 
ATOM   3603 O  O     . GLY B 1 305 ? -42.865 17.602 69.917 1.00 52.89  ? 546 GLY B O     1 
ATOM   3604 N  N     . PRO B 1 306 ? -44.132 17.649 68.054 1.00 45.86  ? 547 PRO B N     1 
ATOM   3605 C  CA    . PRO B 1 306 ? -42.967 17.781 67.177 1.00 48.62  ? 547 PRO B CA    1 
ATOM   3606 C  C     . PRO B 1 306 ? -42.525 19.234 67.081 1.00 49.55  ? 547 PRO B C     1 
ATOM   3607 O  O     . PRO B 1 306 ? -43.258 20.124 67.521 1.00 44.91  ? 547 PRO B O     1 
ATOM   3608 C  CB    . PRO B 1 306 ? -43.487 17.275 65.833 1.00 45.51  ? 547 PRO B CB    1 
ATOM   3609 C  CG    . PRO B 1 306 ? -44.944 17.634 65.858 1.00 40.65  ? 547 PRO B CG    1 
ATOM   3610 C  CD    . PRO B 1 306 ? -45.384 17.481 67.295 1.00 43.28  ? 547 PRO B CD    1 
ATOM   3611 N  N     . GLY B 1 307 ? -41.342 19.467 66.523 1.00 53.62  ? 548 GLY B N     1 
ATOM   3612 C  CA    . GLY B 1 307 ? -40.895 20.819 66.248 1.00 49.07  ? 548 GLY B CA    1 
ATOM   3613 C  C     . GLY B 1 307 ? -41.865 21.469 65.282 1.00 47.61  ? 548 GLY B C     1 
ATOM   3614 O  O     . GLY B 1 307 ? -42.417 20.800 64.408 1.00 48.32  ? 548 GLY B O     1 
ATOM   3615 N  N     . ARG B 1 308 ? -42.096 22.766 65.440 1.00 42.17  ? 549 ARG B N     1 
ATOM   3616 C  CA    . ARG B 1 308 ? -43.035 23.450 64.564 1.00 46.54  ? 549 ARG B CA    1 
ATOM   3617 C  C     . ARG B 1 308 ? -42.395 24.654 63.880 1.00 45.39  ? 549 ARG B C     1 
ATOM   3618 O  O     . ARG B 1 308 ? -41.481 25.286 64.416 1.00 40.16  ? 549 ARG B O     1 
ATOM   3619 C  CB    . ARG B 1 308 ? -44.283 23.883 65.345 1.00 49.79  ? 549 ARG B CB    1 
ATOM   3620 C  CG    . ARG B 1 308 ? -44.194 25.255 66.008 1.00 39.87  ? 549 ARG B CG    1 
ATOM   3621 C  CD    . ARG B 1 308 ? -45.393 25.494 66.908 1.00 38.44  ? 549 ARG B CD    1 
ATOM   3622 N  NE    . ARG B 1 308 ? -45.828 26.888 66.917 1.00 27.23  ? 549 ARG B NE    1 
ATOM   3623 C  CZ    . ARG B 1 308 ? -46.744 27.381 66.090 1.00 28.22  ? 549 ARG B CZ    1 
ATOM   3624 N  NH1   . ARG B 1 308 ? -47.310 26.594 65.188 1.00 29.41  ? 549 ARG B NH1   1 
ATOM   3625 N  NH2   . ARG B 1 308 ? -47.096 28.658 66.161 1.00 29.22  ? 549 ARG B NH2   1 
ATOM   3626 N  N     . VAL B 1 309 ? -42.874 24.954 62.680 1.00 35.88  ? 550 VAL B N     1 
ATOM   3627 C  CA    . VAL B 1 309 ? -42.439 26.143 61.981 1.00 32.60  ? 550 VAL B CA    1 
ATOM   3628 C  C     . VAL B 1 309 ? -43.166 27.364 62.529 1.00 36.05  ? 550 VAL B C     1 
ATOM   3629 O  O     . VAL B 1 309 ? -44.377 27.505 62.360 1.00 38.78  ? 550 VAL B O     1 
ATOM   3630 C  CB    . VAL B 1 309 ? -42.686 26.029 60.474 1.00 37.75  ? 550 VAL B CB    1 
ATOM   3631 C  CG1   . VAL B 1 309 ? -42.376 27.350 59.787 1.00 39.14  ? 550 VAL B CG1   1 
ATOM   3632 C  CG2   . VAL B 1 309 ? -41.844 24.907 59.888 1.00 39.96  ? 550 VAL B CG2   1 
ATOM   3633 N  N     . LEU B 1 310 ? -42.424 28.234 63.202 1.00 35.22  ? 551 LEU B N     1 
ATOM   3634 C  CA    . LEU B 1 310 ? -42.972 29.490 63.696 1.00 31.54  ? 551 LEU B CA    1 
ATOM   3635 C  C     . LEU B 1 310 ? -43.344 30.385 62.522 1.00 30.27  ? 551 LEU B C     1 
ATOM   3636 O  O     . LEU B 1 310 ? -42.545 30.564 61.607 1.00 35.61  ? 551 LEU B O     1 
ATOM   3637 C  CB    . LEU B 1 310 ? -41.962 30.191 64.599 1.00 31.93  ? 551 LEU B CB    1 
ATOM   3638 C  CG    . LEU B 1 310 ? -41.323 29.284 65.648 1.00 30.14  ? 551 LEU B CG    1 
ATOM   3639 C  CD1   . LEU B 1 310 ? -40.050 29.898 66.213 1.00 31.13  ? 551 LEU B CD1   1 
ATOM   3640 C  CD2   . LEU B 1 310 ? -42.318 29.022 66.748 1.00 30.32  ? 551 LEU B CD2   1 
ATOM   3641 N  N     . PRO B 1 311 ? -44.564 30.939 62.535 1.00 31.63  ? 552 PRO B N     1 
ATOM   3642 C  CA    . PRO B 1 311 ? -45.026 31.807 61.447 1.00 30.89  ? 552 PRO B CA    1 
ATOM   3643 C  C     . PRO B 1 311 ? -44.192 33.085 61.348 1.00 37.34  ? 552 PRO B C     1 
ATOM   3644 O  O     . PRO B 1 311 ? -44.094 33.824 62.330 1.00 38.99  ? 552 PRO B O     1 
ATOM   3645 C  CB    . PRO B 1 311 ? -46.473 32.132 61.845 1.00 29.39  ? 552 PRO B CB    1 
ATOM   3646 C  CG    . PRO B 1 311 ? -46.856 31.080 62.823 1.00 28.27  ? 552 PRO B CG    1 
ATOM   3647 C  CD    . PRO B 1 311 ? -45.600 30.750 63.562 1.00 30.18  ? 552 PRO B CD    1 
ATOM   3648 N  N     . THR B 1 312 ? -43.599 33.345 60.186 1.00 30.40  ? 553 THR B N     1 
ATOM   3649 C  CA    . THR B 1 312 ? -42.771 34.536 60.017 1.00 24.35  ? 553 THR B CA    1 
ATOM   3650 C  C     . THR B 1 312 ? -43.192 35.372 58.816 1.00 24.99  ? 553 THR B C     1 
ATOM   3651 O  O     . THR B 1 312 ? -42.498 35.398 57.805 1.00 28.17  ? 553 THR B O     1 
ATOM   3652 C  CB    . THR B 1 312 ? -41.284 34.168 59.870 1.00 23.96  ? 553 THR B CB    1 
ATOM   3653 O  OG1   . THR B 1 312 ? -41.153 33.035 59.005 1.00 30.58  ? 553 THR B OG1   1 
ATOM   3654 C  CG2   . THR B 1 312 ? -40.686 33.822 61.220 1.00 27.44  ? 553 THR B CG2   1 
ATOM   3655 N  N     . PRO B 1 313 ? -44.333 36.069 58.929 1.00 28.75  ? 554 PRO B N     1 
ATOM   3656 C  CA    . PRO B 1 313 ? -44.851 36.897 57.831 1.00 27.58  ? 554 PRO B CA    1 
ATOM   3657 C  C     . PRO B 1 313 ? -43.912 38.037 57.441 1.00 23.88  ? 554 PRO B C     1 
ATOM   3658 O  O     . PRO B 1 313 ? -43.894 38.447 56.292 1.00 24.98  ? 554 PRO B O     1 
ATOM   3659 C  CB    . PRO B 1 313 ? -46.159 37.462 58.397 1.00 23.56  ? 554 PRO B CB    1 
ATOM   3660 C  CG    . PRO B 1 313 ? -46.509 36.573 59.543 1.00 29.00  ? 554 PRO B CG    1 
ATOM   3661 C  CD    . PRO B 1 313 ? -45.211 36.108 60.110 1.00 27.54  ? 554 PRO B CD    1 
ATOM   3662 N  N     . THR B 1 314 ? -43.156 38.558 58.396 1.00 29.02  ? 555 THR B N     1 
ATOM   3663 C  CA    . THR B 1 314 ? -42.273 39.686 58.125 1.00 30.95  ? 555 THR B CA    1 
ATOM   3664 C  C     . THR B 1 314 ? -40.914 39.467 58.768 1.00 26.74  ? 555 THR B C     1 
ATOM   3665 O  O     . THR B 1 314 ? -40.743 38.547 59.565 1.00 28.38  ? 555 THR B O     1 
ATOM   3666 C  CB    . THR B 1 314 ? -42.866 41.005 58.648 1.00 29.25  ? 555 THR B CB    1 
ATOM   3667 O  OG1   . THR B 1 314 ? -43.065 40.904 60.061 1.00 25.23  ? 555 THR B OG1   1 
ATOM   3668 C  CG2   . THR B 1 314 ? -44.200 41.293 57.979 1.00 28.92  ? 555 THR B CG2   1 
ATOM   3669 N  N     . GLU B 1 315 ? -39.945 40.307 58.420 1.00 26.24  ? 556 GLU B N     1 
ATOM   3670 C  CA    . GLU B 1 315 ? -38.642 40.257 59.078 1.00 28.63  ? 556 GLU B CA    1 
ATOM   3671 C  C     . GLU B 1 315 ? -38.780 40.573 60.566 1.00 27.09  ? 556 GLU B C     1 
ATOM   3672 O  O     . GLU B 1 315 ? -38.073 40.006 61.401 1.00 22.53  ? 556 GLU B O     1 
ATOM   3673 C  CB    . GLU B 1 315 ? -37.664 41.232 58.426 1.00 24.00  ? 556 GLU B CB    1 
ATOM   3674 C  CG    . GLU B 1 315 ? -37.037 40.726 57.150 1.00 21.72  ? 556 GLU B CG    1 
ATOM   3675 C  CD    . GLU B 1 315 ? -35.969 41.665 56.625 1.00 28.92  ? 556 GLU B CD    1 
ATOM   3676 O  OE1   . GLU B 1 315 ? -34.890 41.167 56.236 1.00 28.69  ? 556 GLU B OE1   1 
ATOM   3677 O  OE2   . GLU B 1 315 ? -36.205 42.896 56.596 1.00 27.21  ? 556 GLU B OE2   1 
ATOM   3678 N  N     . LYS B 1 316 ? -39.705 41.472 60.887 1.00 26.31  ? 557 LYS B N     1 
ATOM   3679 C  CA    . LYS B 1 316 ? -39.929 41.884 62.264 1.00 23.22  ? 557 LYS B CA    1 
ATOM   3680 C  C     . LYS B 1 316 ? -40.354 40.712 63.136 1.00 26.92  ? 557 LYS B C     1 
ATOM   3681 O  O     . LYS B 1 316 ? -40.082 40.691 64.340 1.00 30.78  ? 557 LYS B O     1 
ATOM   3682 C  CB    . LYS B 1 316 ? -40.979 42.995 62.334 1.00 18.70  ? 557 LYS B CB    1 
ATOM   3683 C  CG    . LYS B 1 316 ? -40.466 44.378 61.945 1.00 20.63  ? 557 LYS B CG    1 
ATOM   3684 C  CD    . LYS B 1 316 ? -41.256 45.469 62.662 1.00 28.01  ? 557 LYS B CD    1 
ATOM   3685 C  CE    . LYS B 1 316 ? -40.845 46.866 62.226 1.00 22.86  ? 557 LYS B CE    1 
ATOM   3686 N  NZ    . LYS B 1 316 ? -41.279 47.162 60.834 1.00 23.09  ? 557 LYS B NZ    1 
ATOM   3687 N  N     . ASP B 1 317 ? -41.015 39.732 62.531 1.00 24.04  ? 558 ASP B N     1 
ATOM   3688 C  CA    . ASP B 1 317 ? -41.482 38.583 63.291 1.00 26.13  ? 558 ASP B CA    1 
ATOM   3689 C  C     . ASP B 1 317 ? -40.313 37.721 63.721 1.00 26.84  ? 558 ASP B C     1 
ATOM   3690 O  O     . ASP B 1 317 ? -40.353 37.095 64.778 1.00 29.84  ? 558 ASP B O     1 
ATOM   3691 C  CB    . ASP B 1 317 ? -42.486 37.762 62.484 1.00 26.59  ? 558 ASP B CB    1 
ATOM   3692 C  CG    . ASP B 1 317 ? -43.872 38.381 62.486 1.00 34.73  ? 558 ASP B CG    1 
ATOM   3693 O  OD1   . ASP B 1 317 ? -44.565 38.268 63.521 1.00 37.58  ? 558 ASP B OD1   1 
ATOM   3694 O  OD2   . ASP B 1 317 ? -44.267 38.986 61.462 1.00 30.90  ? 558 ASP B OD2   1 
ATOM   3695 N  N     . VAL B 1 318 ? -39.263 37.697 62.910 1.00 24.00  ? 559 VAL B N     1 
ATOM   3696 C  CA    . VAL B 1 318 ? -38.093 36.902 63.253 1.00 23.35  ? 559 VAL B CA    1 
ATOM   3697 C  C     . VAL B 1 318 ? -37.388 37.519 64.452 1.00 26.55  ? 559 VAL B C     1 
ATOM   3698 O  O     . VAL B 1 318 ? -37.045 36.831 65.415 1.00 27.55  ? 559 VAL B O     1 
ATOM   3699 C  CB    . VAL B 1 318 ? -37.118 36.788 62.084 1.00 20.40  ? 559 VAL B CB    1 
ATOM   3700 C  CG1   . VAL B 1 318 ? -35.952 35.910 62.474 1.00 19.45  ? 559 VAL B CG1   1 
ATOM   3701 C  CG2   . VAL B 1 318 ? -37.828 36.220 60.866 1.00 24.75  ? 559 VAL B CG2   1 
ATOM   3702 N  N     . PHE B 1 319 ? -37.188 38.829 64.392 1.00 25.97  ? 560 PHE B N     1 
ATOM   3703 C  CA    . PHE B 1 319 ? -36.584 39.554 65.496 1.00 26.89  ? 560 PHE B CA    1 
ATOM   3704 C  C     . PHE B 1 319 ? -37.390 39.397 66.786 1.00 28.26  ? 560 PHE B C     1 
ATOM   3705 O  O     . PHE B 1 319 ? -36.821 39.249 67.868 1.00 24.61  ? 560 PHE B O     1 
ATOM   3706 C  CB    . PHE B 1 319 ? -36.437 41.028 65.130 1.00 21.66  ? 560 PHE B CB    1 
ATOM   3707 C  CG    . PHE B 1 319 ? -35.317 41.292 64.179 1.00 23.47  ? 560 PHE B CG    1 
ATOM   3708 C  CD1   . PHE B 1 319 ? -35.549 41.373 62.819 1.00 26.56  ? 560 PHE B CD1   1 
ATOM   3709 C  CD2   . PHE B 1 319 ? -34.020 41.432 64.643 1.00 25.90  ? 560 PHE B CD2   1 
ATOM   3710 C  CE1   . PHE B 1 319 ? -34.507 41.608 61.940 1.00 25.41  ? 560 PHE B CE1   1 
ATOM   3711 C  CE2   . PHE B 1 319 ? -32.974 41.662 63.768 1.00 21.77  ? 560 PHE B CE2   1 
ATOM   3712 C  CZ    . PHE B 1 319 ? -33.218 41.751 62.418 1.00 24.31  ? 560 PHE B CZ    1 
ATOM   3713 N  N     . ARG B 1 320 ? -38.713 39.421 66.666 1.00 24.86  ? 561 ARG B N     1 
ATOM   3714 C  CA    . ARG B 1 320 ? -39.570 39.272 67.833 1.00 24.73  ? 561 ARG B CA    1 
ATOM   3715 C  C     . ARG B 1 320 ? -39.402 37.891 68.453 1.00 23.96  ? 561 ARG B C     1 
ATOM   3716 O  O     . ARG B 1 320 ? -39.267 37.755 69.664 1.00 24.23  ? 561 ARG B O     1 
ATOM   3717 C  CB    . ARG B 1 320 ? -41.031 39.507 67.462 1.00 23.78  ? 561 ARG B CB    1 
ATOM   3718 C  CG    . ARG B 1 320 ? -41.995 39.095 68.543 1.00 21.86  ? 561 ARG B CG    1 
ATOM   3719 C  CD    . ARG B 1 320 ? -43.434 39.268 68.109 1.00 21.08  ? 561 ARG B CD    1 
ATOM   3720 N  NE    . ARG B 1 320 ? -43.762 38.478 66.927 1.00 26.61  ? 561 ARG B NE    1 
ATOM   3721 C  CZ    . ARG B 1 320 ? -44.092 37.189 66.952 1.00 32.09  ? 561 ARG B CZ    1 
ATOM   3722 N  NH1   . ARG B 1 320 ? -44.129 36.526 68.104 1.00 24.54  ? 561 ARG B NH1   1 
ATOM   3723 N  NH2   . ARG B 1 320 ? -44.380 36.558 65.820 1.00 32.41  ? 561 ARG B NH2   1 
ATOM   3724 N  N     . LEU B 1 321 ? -39.395 36.869 67.607 1.00 23.70  ? 562 LEU B N     1 
ATOM   3725 C  CA    . LEU B 1 321 ? -39.261 35.497 68.068 1.00 22.45  ? 562 LEU B CA    1 
ATOM   3726 C  C     . LEU B 1 321 ? -37.884 35.205 68.652 1.00 28.58  ? 562 LEU B C     1 
ATOM   3727 O  O     . LEU B 1 321 ? -37.710 34.221 69.369 1.00 33.07  ? 562 LEU B O     1 
ATOM   3728 C  CB    . LEU B 1 321 ? -39.540 34.533 66.924 1.00 26.45  ? 562 LEU B CB    1 
ATOM   3729 C  CG    . LEU B 1 321 ? -40.987 34.454 66.458 1.00 28.66  ? 562 LEU B CG    1 
ATOM   3730 C  CD1   . LEU B 1 321 ? -41.055 33.705 65.142 1.00 28.80  ? 562 LEU B CD1   1 
ATOM   3731 C  CD2   . LEU B 1 321 ? -41.828 33.769 67.520 1.00 28.36  ? 562 LEU B CD2   1 
ATOM   3732 N  N     . LEU B 1 322 ? -36.904 36.046 68.338 1.00 28.03  ? 563 LEU B N     1 
ATOM   3733 C  CA    . LEU B 1 322 ? -35.545 35.821 68.817 1.00 25.88  ? 563 LEU B CA    1 
ATOM   3734 C  C     . LEU B 1 322 ? -35.215 36.704 70.011 1.00 28.06  ? 563 LEU B C     1 
ATOM   3735 O  O     . LEU B 1 322 ? -34.122 36.619 70.569 1.00 32.25  ? 563 LEU B O     1 
ATOM   3736 C  CB    . LEU B 1 322 ? -34.540 36.055 67.696 1.00 26.51  ? 563 LEU B CB    1 
ATOM   3737 C  CG    . LEU B 1 322 ? -34.579 35.007 66.581 1.00 28.59  ? 563 LEU B CG    1 
ATOM   3738 C  CD1   . LEU B 1 322 ? -33.622 35.370 65.455 1.00 22.30  ? 563 LEU B CD1   1 
ATOM   3739 C  CD2   . LEU B 1 322 ? -34.248 33.635 67.145 1.00 26.49  ? 563 LEU B CD2   1 
ATOM   3740 N  N     . GLY B 1 323 ? -36.166 37.544 70.404 1.00 23.13  ? 564 GLY B N     1 
ATOM   3741 C  CA    . GLY B 1 323 ? -36.005 38.375 71.582 1.00 21.17  ? 564 GLY B CA    1 
ATOM   3742 C  C     . GLY B 1 323 ? -35.232 39.653 71.339 1.00 20.77  ? 564 GLY B C     1 
ATOM   3743 O  O     . GLY B 1 323 ? -34.698 40.245 72.275 1.00 25.69  ? 564 GLY B O     1 
ATOM   3744 N  N     . LEU B 1 324 ? -35.184 40.080 70.081 1.00 26.99  ? 565 LEU B N     1 
ATOM   3745 C  CA    . LEU B 1 324 ? -34.434 41.268 69.684 1.00 18.54  ? 565 LEU B CA    1 
ATOM   3746 C  C     . LEU B 1 324 ? -35.323 42.396 69.198 1.00 22.11  ? 565 LEU B C     1 
ATOM   3747 O  O     . LEU B 1 324 ? -36.325 42.158 68.514 1.00 17.97  ? 565 LEU B O     1 
ATOM   3748 C  CB    . LEU B 1 324 ? -33.446 40.931 68.571 1.00 22.05  ? 565 LEU B CB    1 
ATOM   3749 C  CG    . LEU B 1 324 ? -32.157 40.210 68.929 1.00 27.09  ? 565 LEU B CG    1 
ATOM   3750 C  CD1   . LEU B 1 324 ? -31.299 40.077 67.683 1.00 29.53  ? 565 LEU B CD1   1 
ATOM   3751 C  CD2   . LEU B 1 324 ? -31.428 40.967 70.019 1.00 26.74  ? 565 LEU B CD2   1 
ATOM   3752 N  N     . PRO B 1 325 ? -34.948 43.638 69.537 1.00 26.11  ? 566 PRO B N     1 
ATOM   3753 C  CA    . PRO B 1 325 ? -35.535 44.803 68.866 1.00 21.92  ? 566 PRO B CA    1 
ATOM   3754 C  C     . PRO B 1 325 ? -35.194 44.756 67.380 1.00 20.50  ? 566 PRO B C     1 
ATOM   3755 O  O     . PRO B 1 325 ? -34.071 44.373 67.040 1.00 15.90  ? 566 PRO B O     1 
ATOM   3756 C  CB    . PRO B 1 325 ? -34.864 45.995 69.558 1.00 12.59  ? 566 PRO B CB    1 
ATOM   3757 C  CG    . PRO B 1 325 ? -34.375 45.455 70.859 1.00 14.78  ? 566 PRO B CG    1 
ATOM   3758 C  CD    . PRO B 1 325 ? -34.013 44.024 70.607 1.00 14.30  ? 566 PRO B CD    1 
ATOM   3759 N  N     . TYR B 1 326 ? -36.142 45.119 66.519 1.00 22.54  ? 567 TYR B N     1 
ATOM   3760 C  CA    . TYR B 1 326 ? -35.921 45.080 65.077 1.00 20.33  ? 567 TYR B CA    1 
ATOM   3761 C  C     . TYR B 1 326 ? -34.668 45.861 64.690 1.00 19.77  ? 567 TYR B C     1 
ATOM   3762 O  O     . TYR B 1 326 ? -34.388 46.917 65.256 1.00 19.95  ? 567 TYR B O     1 
ATOM   3763 C  CB    . TYR B 1 326 ? -37.142 45.630 64.328 1.00 20.12  ? 567 TYR B CB    1 
ATOM   3764 C  CG    . TYR B 1 326 ? -36.971 45.669 62.823 1.00 22.14  ? 567 TYR B CG    1 
ATOM   3765 C  CD1   . TYR B 1 326 ? -36.879 44.496 62.086 1.00 20.48  ? 567 TYR B CD1   1 
ATOM   3766 C  CD2   . TYR B 1 326 ? -36.903 46.878 62.140 1.00 21.91  ? 567 TYR B CD2   1 
ATOM   3767 C  CE1   . TYR B 1 326 ? -36.716 44.522 60.713 1.00 20.52  ? 567 TYR B CE1   1 
ATOM   3768 C  CE2   . TYR B 1 326 ? -36.744 46.916 60.766 1.00 22.45  ? 567 TYR B CE2   1 
ATOM   3769 C  CZ    . TYR B 1 326 ? -36.651 45.733 60.057 1.00 24.85  ? 567 TYR B CZ    1 
ATOM   3770 O  OH    . TYR B 1 326 ? -36.493 45.758 58.688 1.00 26.63  ? 567 TYR B OH    1 
ATOM   3771 N  N     . ARG B 1 327 ? -33.903 45.320 63.748 1.00 19.61  ? 568 ARG B N     1 
ATOM   3772 C  CA    . ARG B 1 327 ? -32.737 46.016 63.218 1.00 22.47  ? 568 ARG B CA    1 
ATOM   3773 C  C     . ARG B 1 327 ? -32.900 46.293 61.735 1.00 22.41  ? 568 ARG B C     1 
ATOM   3774 O  O     . ARG B 1 327 ? -32.951 45.370 60.925 1.00 25.16  ? 568 ARG B O     1 
ATOM   3775 C  CB    . ARG B 1 327 ? -31.459 45.211 63.461 1.00 19.86  ? 568 ARG B CB    1 
ATOM   3776 C  CG    . ARG B 1 327 ? -30.956 45.299 64.884 1.00 19.11  ? 568 ARG B CG    1 
ATOM   3777 C  CD    . ARG B 1 327 ? -29.707 44.473 65.105 1.00 17.27  ? 568 ARG B CD    1 
ATOM   3778 N  NE    . ARG B 1 327 ? -29.571 44.126 66.516 1.00 29.80  ? 568 ARG B NE    1 
ATOM   3779 C  CZ    . ARG B 1 327 ? -28.484 43.591 67.062 1.00 31.04  ? 568 ARG B CZ    1 
ATOM   3780 N  NH1   . ARG B 1 327 ? -27.417 43.341 66.317 1.00 26.78  ? 568 ARG B NH1   1 
ATOM   3781 N  NH2   . ARG B 1 327 ? -28.464 43.312 68.359 1.00 35.24  ? 568 ARG B NH2   1 
ATOM   3782 N  N     . GLU B 1 328 ? -32.991 47.573 61.393 1.00 22.89  ? 569 GLU B N     1 
ATOM   3783 C  CA    . GLU B 1 328 ? -33.052 48.016 60.005 1.00 23.07  ? 569 GLU B CA    1 
ATOM   3784 C  C     . GLU B 1 328 ? -31.879 47.417 59.220 1.00 22.36  ? 569 GLU B C     1 
ATOM   3785 O  O     . GLU B 1 328 ? -30.784 47.290 59.763 1.00 23.95  ? 569 GLU B O     1 
ATOM   3786 C  CB    . GLU B 1 328 ? -33.039 49.548 59.953 1.00 18.95  ? 569 GLU B CB    1 
ATOM   3787 C  CG    . GLU B 1 328 ? -34.061 50.167 59.011 1.00 34.16  ? 569 GLU B CG    1 
ATOM   3788 C  CD    . GLU B 1 328 ? -35.498 49.827 59.376 1.00 36.37  ? 569 GLU B CD    1 
ATOM   3789 O  OE1   . GLU B 1 328 ? -36.225 49.298 58.498 1.00 38.26  ? 569 GLU B OE1   1 
ATOM   3790 O  OE2   . GLU B 1 328 ? -35.902 50.100 60.528 1.00 23.71  ? 569 GLU B OE2   1 
ATOM   3791 N  N     . PRO B 1 329 ? -32.107 47.021 57.953 1.00 24.24  ? 570 PRO B N     1 
ATOM   3792 C  CA    . PRO B 1 329 ? -31.061 46.372 57.145 1.00 22.86  ? 570 PRO B CA    1 
ATOM   3793 C  C     . PRO B 1 329 ? -29.691 47.062 57.205 1.00 23.76  ? 570 PRO B C     1 
ATOM   3794 O  O     . PRO B 1 329 ? -28.675 46.372 57.278 1.00 24.56  ? 570 PRO B O     1 
ATOM   3795 C  CB    . PRO B 1 329 ? -31.636 46.432 55.730 1.00 15.01  ? 570 PRO B CB    1 
ATOM   3796 C  CG    . PRO B 1 329 ? -33.103 46.356 55.940 1.00 15.91  ? 570 PRO B CG    1 
ATOM   3797 C  CD    . PRO B 1 329 ? -33.382 47.113 57.218 1.00 20.81  ? 570 PRO B CD    1 
ATOM   3798 N  N     . ALA B 1 330 ? -29.662 48.392 57.203 1.00 21.49  ? 571 ALA B N     1 
ATOM   3799 C  CA    . ALA B 1 330 ? -28.396 49.123 57.271 1.00 21.53  ? 571 ALA B CA    1 
ATOM   3800 C  C     . ALA B 1 330 ? -27.607 48.837 58.551 1.00 23.36  ? 571 ALA B C     1 
ATOM   3801 O  O     . ALA B 1 330 ? -26.398 49.046 58.593 1.00 26.04  ? 571 ALA B O     1 
ATOM   3802 C  CB    . ALA B 1 330 ? -28.644 50.613 57.142 1.00 24.37  ? 571 ALA B CB    1 
ATOM   3803 N  N     . GLU B 1 331 ? -28.285 48.361 59.591 1.00 25.49  ? 572 GLU B N     1 
ATOM   3804 C  CA    . GLU B 1 331 ? -27.622 48.082 60.860 1.00 19.75  ? 572 GLU B CA    1 
ATOM   3805 C  C     . GLU B 1 331 ? -27.109 46.653 60.942 1.00 21.67  ? 572 GLU B C     1 
ATOM   3806 O  O     . GLU B 1 331 ? -26.628 46.227 61.987 1.00 26.40  ? 572 GLU B O     1 
ATOM   3807 C  CB    . GLU B 1 331 ? -28.564 48.323 62.036 1.00 23.95  ? 572 GLU B CB    1 
ATOM   3808 C  CG    . GLU B 1 331 ? -29.376 49.604 61.999 1.00 29.54  ? 572 GLU B CG    1 
ATOM   3809 C  CD    . GLU B 1 331 ? -30.353 49.673 63.172 1.00 47.25  ? 572 GLU B CD    1 
ATOM   3810 O  OE1   . GLU B 1 331 ? -29.890 49.609 64.335 1.00 54.17  ? 572 GLU B OE1   1 
ATOM   3811 O  OE2   . GLU B 1 331 ? -31.581 49.768 62.939 1.00 42.30  ? 572 GLU B OE2   1 
ATOM   3812 N  N     . ARG B 1 332 ? -27.218 45.905 59.852 1.00 21.17  ? 573 ARG B N     1 
ATOM   3813 C  CA    . ARG B 1 332 ? -26.908 44.484 59.899 1.00 17.85  ? 573 ARG B CA    1 
ATOM   3814 C  C     . ARG B 1 332 ? -25.600 44.119 59.219 1.00 21.88  ? 573 ARG B C     1 
ATOM   3815 O  O     . ARG B 1 332 ? -25.470 43.028 58.664 1.00 28.33  ? 573 ARG B O     1 
ATOM   3816 C  CB    . ARG B 1 332 ? -28.032 43.680 59.252 1.00 19.54  ? 573 ARG B CB    1 
ATOM   3817 C  CG    . ARG B 1 332 ? -29.423 44.039 59.701 1.00 17.27  ? 573 ARG B CG    1 
ATOM   3818 C  CD    . ARG B 1 332 ? -30.408 43.116 59.031 1.00 17.86  ? 573 ARG B CD    1 
ATOM   3819 N  NE    . ARG B 1 332 ? -31.792 43.506 59.252 1.00 18.59  ? 573 ARG B NE    1 
ATOM   3820 C  CZ    . ARG B 1 332 ? -32.791 43.139 58.460 1.00 19.46  ? 573 ARG B CZ    1 
ATOM   3821 N  NH1   . ARG B 1 332 ? -32.540 42.388 57.394 1.00 19.13  ? 573 ARG B NH1   1 
ATOM   3822 N  NH2   . ARG B 1 332 ? -34.031 43.527 58.724 1.00 21.00  ? 573 ARG B NH2   1 
ATOM   3823 N  N     . ASP B 1 333 ? -24.623 45.012 59.240 1.00 26.86  ? 574 ASP B N     1 
ATOM   3824 C  CA    . ASP B 1 333 ? -23.387 44.702 58.534 1.00 31.13  ? 574 ASP B CA    1 
ATOM   3825 C  C     . ASP B 1 333 ? -22.539 43.756 59.371 1.00 28.29  ? 574 ASP B C     1 
ATOM   3826 O  O     . ASP B 1 333 ? -21.782 42.947 58.836 1.00 26.06  ? 574 ASP B O     1 
ATOM   3827 C  CB    . ASP B 1 333 ? -22.612 45.973 58.189 1.00 27.46  ? 574 ASP B CB    1 
ATOM   3828 C  CG    . ASP B 1 333 ? -21.902 45.868 56.855 1.00 35.36  ? 574 ASP B CG    1 
ATOM   3829 O  OD1   . ASP B 1 333 ? -21.151 44.889 56.648 1.00 44.67  ? 574 ASP B OD1   1 
ATOM   3830 O  OD2   . ASP B 1 333 ? -22.112 46.751 56.002 1.00 37.58  ? 574 ASP B OD2   1 
ATOM   3831 N  N     . TRP B 1 334 ? -22.685 43.855 60.688 1.00 27.66  ? 575 TRP B N     1 
ATOM   3832 C  CA    . TRP B 1 334 ? -21.997 42.954 61.600 1.00 29.11  ? 575 TRP B CA    1 
ATOM   3833 C  C     . TRP B 1 334 ? -22.940 42.486 62.708 1.00 30.77  ? 575 TRP B C     1 
ATOM   3834 O  O     . TRP B 1 334 ? -22.867 41.339 63.152 1.00 31.11  ? 575 TRP B O     1 
ATOM   3835 C  CB    . TRP B 1 334 ? -20.770 43.639 62.194 1.00 26.20  ? 575 TRP B CB    1 
ATOM   3836 C  CG    . TRP B 1 334 ? -19.779 42.698 62.797 1.00 25.34  ? 575 TRP B CG    1 
ATOM   3837 C  CD1   . TRP B 1 334 ? -19.548 42.490 64.126 1.00 27.33  ? 575 TRP B CD1   1 
ATOM   3838 C  CD2   . TRP B 1 334 ? -18.874 41.843 62.094 1.00 25.54  ? 575 TRP B CD2   1 
ATOM   3839 N  NE1   . TRP B 1 334 ? -18.552 41.556 64.295 1.00 25.22  ? 575 TRP B NE1   1 
ATOM   3840 C  CE2   . TRP B 1 334 ? -18.123 41.142 63.061 1.00 25.49  ? 575 TRP B CE2   1 
ATOM   3841 C  CE3   . TRP B 1 334 ? -18.624 41.599 60.739 1.00 24.78  ? 575 TRP B CE3   1 
ATOM   3842 C  CZ2   . TRP B 1 334 ? -17.145 40.214 62.718 1.00 26.19  ? 575 TRP B CZ2   1 
ATOM   3843 C  CZ3   . TRP B 1 334 ? -17.653 40.677 60.399 1.00 23.01  ? 575 TRP B CZ3   1 
ATOM   3844 C  CH2   . TRP B 1 334 ? -16.924 39.995 61.384 1.00 29.15  ? 575 TRP B CH2   1 
ATOM   3845 O  OXT   . TRP B 1 334 ? -23.801 43.236 63.177 1.00 23.05  ? 575 TRP B OXT   1 
ATOM   3846 O  "O5'" . DC  C 2 1   ? -1.555  53.039 8.373  1.00 32.40  ? 1   DC  P "O5'" 1 
ATOM   3847 C  "C5'" . DC  C 2 1   ? -1.524  54.464 8.341  1.00 29.02  ? 1   DC  P "C5'" 1 
ATOM   3848 C  "C4'" . DC  C 2 1   ? -2.825  55.020 7.799  1.00 26.11  ? 1   DC  P "C4'" 1 
ATOM   3849 O  "O4'" . DC  C 2 1   ? -3.118  54.419 6.505  1.00 26.25  ? 1   DC  P "O4'" 1 
ATOM   3850 C  "C3'" . DC  C 2 1   ? -4.049  54.758 8.668  1.00 23.68  ? 1   DC  P "C3'" 1 
ATOM   3851 O  "O3'" . DC  C 2 1   ? -4.942  55.851 8.551  1.00 32.68  ? 1   DC  P "O3'" 1 
ATOM   3852 C  "C2'" . DC  C 2 1   ? -4.632  53.494 8.048  1.00 20.50  ? 1   DC  P "C2'" 1 
ATOM   3853 C  "C1'" . DC  C 2 1   ? -4.350  53.726 6.567  1.00 27.52  ? 1   DC  P "C1'" 1 
ATOM   3854 N  N1    . DC  C 2 1   ? -4.238  52.459 5.773  1.00 24.99  ? 1   DC  P N1    1 
ATOM   3855 C  C2    . DC  C 2 1   ? -5.303  52.054 4.957  1.00 22.42  ? 1   DC  P C2    1 
ATOM   3856 O  O2    . DC  C 2 1   ? -6.318  52.755 4.895  1.00 21.82  ? 1   DC  P O2    1 
ATOM   3857 N  N3    . DC  C 2 1   ? -5.189  50.900 4.254  1.00 21.84  ? 1   DC  P N3    1 
ATOM   3858 C  C4    . DC  C 2 1   ? -4.077  50.169 4.348  1.00 23.21  ? 1   DC  P C4    1 
ATOM   3859 N  N4    . DC  C 2 1   ? -4.011  49.042 3.636  1.00 27.82  ? 1   DC  P N4    1 
ATOM   3860 C  C5    . DC  C 2 1   ? -2.985  50.561 5.176  1.00 22.16  ? 1   DC  P C5    1 
ATOM   3861 C  C6    . DC  C 2 1   ? -3.107  51.701 5.864  1.00 25.28  ? 1   DC  P C6    1 
ATOM   3862 P  P     . DA  C 2 2   ? -6.081  56.103 9.652  1.00 25.81  ? 2   DA  P P     1 
ATOM   3863 O  OP1   . DA  C 2 2   ? -6.608  57.465 9.418  1.00 28.82  ? 2   DA  P OP1   1 
ATOM   3864 O  OP2   . DA  C 2 2   ? -5.539  55.732 10.975 1.00 27.15  ? 2   DA  P OP2   1 
ATOM   3865 O  "O5'" . DA  C 2 2   ? -7.226  55.066 9.256  1.00 23.87  ? 2   DA  P "O5'" 1 
ATOM   3866 C  "C5'" . DA  C 2 2   ? -7.940  55.246 8.057  1.00 23.25  ? 2   DA  P "C5'" 1 
ATOM   3867 C  "C4'" . DA  C 2 2   ? -9.009  54.184 7.897  1.00 26.13  ? 2   DA  P "C4'" 1 
ATOM   3868 O  "O4'" . DA  C 2 2   ? -8.443  53.007 7.272  1.00 33.69  ? 2   DA  P "O4'" 1 
ATOM   3869 C  "C3'" . DA  C 2 2   ? -9.665  53.702 9.192  1.00 24.95  ? 2   DA  P "C3'" 1 
ATOM   3870 O  "O3'" . DA  C 2 2   ? -11.060 53.676 9.004  1.00 28.11  ? 2   DA  P "O3'" 1 
ATOM   3871 C  "C2'" . DA  C 2 2   ? -9.096  52.286 9.378  1.00 23.20  ? 2   DA  P "C2'" 1 
ATOM   3872 C  "C1'" . DA  C 2 2   ? -8.912  51.860 7.936  1.00 25.62  ? 2   DA  P "C1'" 1 
ATOM   3873 N  N9    . DA  C 2 2   ? -7.940  50.790 7.717  1.00 25.20  ? 2   DA  P N9    1 
ATOM   3874 C  C8    . DA  C 2 2   ? -6.678  50.683 8.239  1.00 23.54  ? 2   DA  P C8    1 
ATOM   3875 N  N7    . DA  C 2 2   ? -6.023  49.619 7.825  1.00 19.26  ? 2   DA  P N7    1 
ATOM   3876 C  C5    . DA  C 2 2   ? -6.917  48.998 6.963  1.00 22.55  ? 2   DA  P C5    1 
ATOM   3877 C  C6    . DA  C 2 2   ? -6.834  47.821 6.182  1.00 25.45  ? 2   DA  P C6    1 
ATOM   3878 N  N6    . DA  C 2 2   ? -5.760  47.022 6.155  1.00 22.41  ? 2   DA  P N6    1 
ATOM   3879 N  N1    . DA  C 2 2   ? -7.908  47.492 5.432  1.00 26.00  ? 2   DA  P N1    1 
ATOM   3880 C  C2    . DA  C 2 2   ? -8.983  48.285 5.463  1.00 25.43  ? 2   DA  P C2    1 
ATOM   3881 N  N3    . DA  C 2 2   ? -9.172  49.413 6.142  1.00 24.45  ? 2   DA  P N3    1 
ATOM   3882 C  C4    . DA  C 2 2   ? -8.094  49.714 6.880  1.00 22.56  ? 2   DA  P C4    1 
ATOM   3883 P  P     . DG  C 2 3   ? -12.061 53.574 10.253 1.00 22.33  ? 3   DG  P P     1 
ATOM   3884 O  OP1   . DG  C 2 3   ? -13.156 54.509 9.968  1.00 22.59  ? 3   DG  P OP1   1 
ATOM   3885 O  OP2   . DG  C 2 3   ? -11.296 53.692 11.514 1.00 19.44  ? 3   DG  P OP2   1 
ATOM   3886 O  "O5'" . DG  C 2 3   ? -12.650 52.105 10.117 1.00 24.21  ? 3   DG  P "O5'" 1 
ATOM   3887 C  "C5'" . DG  C 2 3   ? -13.233 51.705 8.891  1.00 23.07  ? 3   DG  P "C5'" 1 
ATOM   3888 C  "C4'" . DG  C 2 3   ? -13.294 50.195 8.798  1.00 25.59  ? 3   DG  P "C4'" 1 
ATOM   3889 O  "O4'" . DG  C 2 3   ? -11.976 49.676 8.541  1.00 27.92  ? 3   DG  P "O4'" 1 
ATOM   3890 C  "C3'" . DG  C 2 3   ? -13.766 49.477 10.073 1.00 24.11  ? 3   DG  P "C3'" 1 
ATOM   3891 O  "O3'" . DG  C 2 3   ? -15.121 49.047 9.920  1.00 25.13  ? 3   DG  P "O3'" 1 
ATOM   3892 C  "C2'" . DG  C 2 3   ? -12.798 48.286 10.221 1.00 22.28  ? 3   DG  P "C2'" 1 
ATOM   3893 C  "C1'" . DG  C 2 3   ? -11.993 48.332 8.922  1.00 26.95  ? 3   DG  P "C1'" 1 
ATOM   3894 N  N9    . DG  C 2 3   ? -10.626 47.846 9.064  1.00 24.16  ? 3   DG  P N9    1 
ATOM   3895 C  C8    . DG  C 2 3   ? -9.657  48.314 9.921  1.00 24.45  ? 3   DG  P C8    1 
ATOM   3896 N  N7    . DG  C 2 3   ? -8.529  47.661 9.836  1.00 22.31  ? 3   DG  P N7    1 
ATOM   3897 C  C5    . DG  C 2 3   ? -8.771  46.694 8.867  1.00 23.61  ? 3   DG  P C5    1 
ATOM   3898 C  C6    . DG  C 2 3   ? -7.921  45.688 8.348  1.00 24.24  ? 3   DG  P C6    1 
ATOM   3899 O  O6    . DG  C 2 3   ? -6.742  45.447 8.650  1.00 25.58  ? 3   DG  P O6    1 
ATOM   3900 N  N1    . DG  C 2 3   ? -8.565  44.921 7.376  1.00 23.35  ? 3   DG  P N1    1 
ATOM   3901 C  C2    . DG  C 2 3   ? -9.868  45.107 6.962  1.00 25.40  ? 3   DG  P C2    1 
ATOM   3902 N  N2    . DG  C 2 3   ? -10.319 44.273 6.013  1.00 24.58  ? 3   DG  P N2    1 
ATOM   3903 N  N3    . DG  C 2 3   ? -10.671 46.044 7.443  1.00 24.01  ? 3   DG  P N3    1 
ATOM   3904 C  C4    . DG  C 2 3   ? -10.059 46.798 8.385  1.00 23.69  ? 3   DG  P C4    1 
ATOM   3905 P  P     . DT  C 2 4   ? -15.838 48.145 11.048 1.00 30.87  ? 4   DT  P P     1 
ATOM   3906 O  OP1   . DT  C 2 4   ? -17.291 48.224 10.784 1.00 26.29  ? 4   DT  P OP1   1 
ATOM   3907 O  OP2   . DT  C 2 4   ? -15.320 48.501 12.391 1.00 28.15  ? 4   DT  P OP2   1 
ATOM   3908 O  "O5'" . DT  C 2 4   ? -15.355 46.660 10.709 1.00 24.90  ? 4   DT  P "O5'" 1 
ATOM   3909 C  "C5'" . DT  C 2 4   ? -15.626 46.110 9.436  1.00 24.18  ? 4   DT  P "C5'" 1 
ATOM   3910 C  "C4'" . DT  C 2 4   ? -14.884 44.804 9.244  1.00 29.65  ? 4   DT  P "C4'" 1 
ATOM   3911 O  "O4'" . DT  C 2 4   ? -13.469 45.036 9.243  1.00 31.08  ? 4   DT  P "O4'" 1 
ATOM   3912 C  "C3'" . DT  C 2 4   ? -15.086 43.776 10.347 1.00 26.59  ? 4   DT  P "C3'" 1 
ATOM   3913 O  "O3'" . DT  C 2 4   ? -16.205 42.980 10.047 1.00 29.67  ? 4   DT  P "O3'" 1 
ATOM   3914 C  "C2'" . DT  C 2 4   ? -13.796 42.946 10.301 1.00 27.84  ? 4   DT  P "C2'" 1 
ATOM   3915 C  "C1'" . DT  C 2 4   ? -12.844 43.793 9.443  1.00 28.40  ? 4   DT  P "C1'" 1 
ATOM   3916 N  N1    . DT  C 2 4   ? -11.520 44.003 10.076 1.00 22.52  ? 4   DT  P N1    1 
ATOM   3917 C  C2    . DT  C 2 4   ? -10.483 43.201 9.695  1.00 23.14  ? 4   DT  P C2    1 
ATOM   3918 O  O2    . DT  C 2 4   ? -10.596 42.335 8.846  1.00 26.25  ? 4   DT  P O2    1 
ATOM   3919 N  N3    . DT  C 2 4   ? -9.299  43.450 10.331 1.00 21.28  ? 4   DT  P N3    1 
ATOM   3920 C  C4    . DT  C 2 4   ? -9.054  44.405 11.297 1.00 24.22  ? 4   DT  P C4    1 
ATOM   3921 O  O4    . DT  C 2 4   ? -7.948  44.548 11.812 1.00 21.90  ? 4   DT  P O4    1 
ATOM   3922 C  C5    . DT  C 2 4   ? -10.197 45.218 11.665 1.00 26.27  ? 4   DT  P C5    1 
ATOM   3923 C  C7    . DT  C 2 4   ? -10.060 46.285 12.713 1.00 13.74  ? 4   DT  P C7    1 
ATOM   3924 C  C6    . DT  C 2 4   ? -11.365 44.977 11.043 1.00 24.09  ? 4   DT  P C6    1 
ATOM   3925 P  P     . DA  C 2 5   ? -16.920 42.131 11.200 1.00 33.88  ? 5   DA  P P     1 
ATOM   3926 O  OP1   . DA  C 2 5   ? -18.298 41.852 10.736 1.00 28.77  ? 5   DA  P OP1   1 
ATOM   3927 O  OP2   . DA  C 2 5   ? -16.687 42.821 12.489 1.00 38.77  ? 5   DA  P OP2   1 
ATOM   3928 O  "O5'" . DA  C 2 5   ? -16.082 40.776 11.244 1.00 31.48  ? 5   DA  P "O5'" 1 
ATOM   3929 C  "C5'" . DA  C 2 5   ? -16.097 39.909 10.141 1.00 28.89  ? 5   DA  P "C5'" 1 
ATOM   3930 C  "C4'" . DA  C 2 5   ? -15.145 38.750 10.362 1.00 35.13  ? 5   DA  P "C4'" 1 
ATOM   3931 O  "O4'" . DA  C 2 5   ? -13.803 39.146 10.002 1.00 34.93  ? 5   DA  P "O4'" 1 
ATOM   3932 C  "C3'" . DA  C 2 5   ? -15.012 38.279 11.796 1.00 33.87  ? 5   DA  P "C3'" 1 
ATOM   3933 O  "O3'" . DA  C 2 5   ? -16.116 37.424 12.152 1.00 35.42  ? 5   DA  P "O3'" 1 
ATOM   3934 C  "C2'" . DA  C 2 5   ? -13.693 37.514 11.721 1.00 35.13  ? 5   DA  P "C2'" 1 
ATOM   3935 C  "C1'" . DA  C 2 5   ? -12.875 38.374 10.743 1.00 29.63  ? 5   DA  P "C1'" 1 
ATOM   3936 N  N9    . DA  C 2 5   ? -11.944 39.282 11.406 1.00 28.21  ? 5   DA  P N9    1 
ATOM   3937 C  C8    . DA  C 2 5   ? -12.239 40.489 11.970 1.00 30.48  ? 5   DA  P C8    1 
ATOM   3938 N  N7    . DA  C 2 5   ? -11.202 41.093 12.508 1.00 30.44  ? 5   DA  P N7    1 
ATOM   3939 C  C5    . DA  C 2 5   ? -10.156 40.219 12.284 1.00 28.10  ? 5   DA  P C5    1 
ATOM   3940 C  C6    . DA  C 2 5   ? -8.790  40.276 12.615 1.00 29.55  ? 5   DA  P C6    1 
ATOM   3941 N  N6    . DA  C 2 5   ? -8.236  41.304 13.268 1.00 27.92  ? 5   DA  P N6    1 
ATOM   3942 N  N1    . DA  C 2 5   ? -8.012  39.238 12.245 1.00 28.74  ? 5   DA  P N1    1 
ATOM   3943 C  C2    . DA  C 2 5   ? -8.574  38.213 11.592 1.00 28.54  ? 5   DA  P C2    1 
ATOM   3944 N  N3    . DA  C 2 5   ? -9.847  38.047 11.227 1.00 29.38  ? 5   DA  P N3    1 
ATOM   3945 C  C4    . DA  C 2 5   ? -10.592 39.096 11.606 1.00 29.29  ? 5   DA  P C4    1 
ATOM   3946 P  P     . DC  C 2 6   ? -16.615 37.310 13.683 1.00 39.81  ? 6   DC  P P     1 
ATOM   3947 O  OP1   . DC  C 2 6   ? -17.883 36.547 13.682 1.00 44.80  ? 6   DC  P OP1   1 
ATOM   3948 O  OP2   . DC  C 2 6   ? -16.523 38.633 14.337 1.00 36.13  ? 6   DC  P OP2   1 
ATOM   3949 O  "O5'" . DC  C 2 6   ? -15.519 36.395 14.384 1.00 35.51  ? 6   DC  P "O5'" 1 
ATOM   3950 C  "C5'" . DC  C 2 6   ? -15.415 35.030 14.035 1.00 34.06  ? 6   DC  P "C5'" 1 
ATOM   3951 C  "C4'" . DC  C 2 6   ? -14.104 34.468 14.527 1.00 30.95  ? 6   DC  P "C4'" 1 
ATOM   3952 O  "O4'" . DC  C 2 6   ? -13.007 35.173 13.907 1.00 34.80  ? 6   DC  P "O4'" 1 
ATOM   3953 C  "C3'" . DC  C 2 6   ? -13.861 34.651 16.002 1.00 30.57  ? 6   DC  P "C3'" 1 
ATOM   3954 O  "O3'" . DC  C 2 6   ? -14.536 33.645 16.722 1.00 36.65  ? 6   DC  P "O3'" 1 
ATOM   3955 C  "C2'" . DC  C 2 6   ? -12.346 34.487 16.080 1.00 33.52  ? 6   DC  P "C2'" 1 
ATOM   3956 C  "C1'" . DC  C 2 6   ? -11.885 35.139 14.770 1.00 32.76  ? 6   DC  P "C1'" 1 
ATOM   3957 N  N1    . DC  C 2 6   ? -11.385 36.517 14.960 1.00 31.51  ? 6   DC  P N1    1 
ATOM   3958 C  C2    . DC  C 2 6   ? -10.033 36.721 15.247 1.00 33.95  ? 6   DC  P C2    1 
ATOM   3959 O  O2    . DC  C 2 6   ? -9.281  35.744 15.314 1.00 37.76  ? 6   DC  P O2    1 
ATOM   3960 N  N3    . DC  C 2 6   ? -9.585  37.987 15.441 1.00 30.22  ? 6   DC  P N3    1 
ATOM   3961 C  C4    . DC  C 2 6   ? -10.433 39.012 15.363 1.00 29.35  ? 6   DC  P C4    1 
ATOM   3962 N  N4    . DC  C 2 6   ? -9.947  40.237 15.559 1.00 33.55  ? 6   DC  P N4    1 
ATOM   3963 C  C5    . DC  C 2 6   ? -11.818 38.824 15.077 1.00 30.63  ? 6   DC  P C5    1 
ATOM   3964 C  C6    . DC  C 2 6   ? -12.247 37.571 14.888 1.00 32.48  ? 6   DC  P C6    1 
ATOM   3965 P  P     . DG  D 3 1   ? 1.664   38.871 20.575 1.00 51.17  ? 6   DG  T P     1 
ATOM   3966 O  OP1   . DG  D 3 1   ? 2.918   38.115 20.791 1.00 49.92  ? 6   DG  T OP1   1 
ATOM   3967 O  OP2   . DG  D 3 1   ? 1.651   40.349 20.621 1.00 65.22  ? 6   DG  T OP2   1 
ATOM   3968 O  "O5'" . DG  D 3 1   ? 1.093   38.458 19.152 1.00 49.14  ? 6   DG  T "O5'" 1 
ATOM   3969 C  "C5'" . DG  D 3 1   ? -0.227  37.981 19.033 1.00 41.51  ? 6   DG  T "C5'" 1 
ATOM   3970 C  "C4'" . DG  D 3 1   ? -0.313  36.963 17.918 1.00 41.37  ? 6   DG  T "C4'" 1 
ATOM   3971 O  "O4'" . DG  D 3 1   ? -1.691  36.819 17.503 1.00 38.38  ? 6   DG  T "O4'" 1 
ATOM   3972 C  "C3'" . DG  D 3 1   ? 0.447   37.329 16.655 1.00 41.09  ? 6   DG  T "C3'" 1 
ATOM   3973 O  "O3'" . DG  D 3 1   ? 0.823   36.134 15.961 1.00 41.96  ? 6   DG  T "O3'" 1 
ATOM   3974 C  "C2'" . DG  D 3 1   ? -0.587  38.153 15.884 1.00 33.16  ? 6   DG  T "C2'" 1 
ATOM   3975 C  "C1'" . DG  D 3 1   ? -1.893  37.446 16.249 1.00 37.82  ? 6   DG  T "C1'" 1 
ATOM   3976 N  N9    . DG  D 3 1   ? -3.042  38.335 16.385 1.00 33.99  ? 6   DG  T N9    1 
ATOM   3977 C  C8    . DG  D 3 1   ? -3.058  39.595 16.932 1.00 37.11  ? 6   DG  T C8    1 
ATOM   3978 N  N7    . DG  D 3 1   ? -4.245  40.143 16.943 1.00 32.55  ? 6   DG  T N7    1 
ATOM   3979 C  C5    . DG  D 3 1   ? -5.069  39.177 16.381 1.00 29.05  ? 6   DG  T C5    1 
ATOM   3980 C  C6    . DG  D 3 1   ? -6.461  39.200 16.137 1.00 31.14  ? 6   DG  T C6    1 
ATOM   3981 O  O6    . DG  D 3 1   ? -7.267  40.109 16.375 1.00 31.50  ? 6   DG  T O6    1 
ATOM   3982 N  N1    . DG  D 3 1   ? -6.902  38.013 15.556 1.00 31.79  ? 6   DG  T N1    1 
ATOM   3983 C  C2    . DG  D 3 1   ? -6.096  36.942 15.246 1.00 34.82  ? 6   DG  T C2    1 
ATOM   3984 N  N2    . DG  D 3 1   ? -6.703  35.884 14.683 1.00 29.91  ? 6   DG  T N2    1 
ATOM   3985 N  N3    . DG  D 3 1   ? -4.788  36.908 15.473 1.00 33.62  ? 6   DG  T N3    1 
ATOM   3986 C  C4    . DG  D 3 1   ? -4.345  38.056 16.039 1.00 30.47  ? 6   DG  T C4    1 
ATOM   3987 P  P     . DT  D 3 2   ? 1.794   36.190 14.682 1.00 43.78  ? 7   DT  T P     1 
ATOM   3988 O  OP1   . DT  D 3 2   ? 2.685   35.008 14.724 1.00 39.79  ? 7   DT  T OP1   1 
ATOM   3989 O  OP2   . DT  D 3 2   ? 2.387   37.544 14.599 1.00 42.68  ? 7   DT  T OP2   1 
ATOM   3990 O  "O5'" . DT  D 3 2   ? 0.787   36.005 13.463 1.00 32.23  ? 7   DT  T "O5'" 1 
ATOM   3991 C  "C5'" . DT  D 3 2   ? -0.039  34.866 13.418 1.00 33.11  ? 7   DT  T "C5'" 1 
ATOM   3992 C  "C4'" . DT  D 3 2   ? -1.119  35.020 12.364 1.00 38.95  ? 7   DT  T "C4'" 1 
ATOM   3993 O  "O4'" . DT  D 3 2   ? -2.144  35.922 12.835 1.00 43.79  ? 7   DT  T "O4'" 1 
ATOM   3994 C  "C3'" . DT  D 3 2   ? -0.648  35.578 11.016 1.00 32.33  ? 7   DT  T "C3'" 1 
ATOM   3995 O  "O3'" . DT  D 3 2   ? -0.907  34.623 10.000 1.00 40.61  ? 7   DT  T "O3'" 1 
ATOM   3996 C  "C2'" . DT  D 3 2   ? -1.481  36.855 10.825 1.00 31.91  ? 7   DT  T "C2'" 1 
ATOM   3997 C  "C1'" . DT  D 3 2   ? -2.676  36.588 11.726 1.00 36.43  ? 7   DT  T "C1'" 1 
ATOM   3998 N  N1    . DT  D 3 2   ? -3.367  37.820 12.198 1.00 33.75  ? 7   DT  T N1    1 
ATOM   3999 C  C2    . DT  D 3 2   ? -4.727  37.942 12.015 1.00 33.10  ? 7   DT  T C2    1 
ATOM   4000 O  O2    . DT  D 3 2   ? -5.406  37.084 11.482 1.00 36.50  ? 7   DT  T O2    1 
ATOM   4001 N  N3    . DT  D 3 2   ? -5.267  39.113 12.481 1.00 28.30  ? 7   DT  T N3    1 
ATOM   4002 C  C4    . DT  D 3 2   ? -4.595  40.152 13.100 1.00 30.74  ? 7   DT  T C4    1 
ATOM   4003 O  O4    . DT  D 3 2   ? -5.168  41.165 13.486 1.00 30.33  ? 7   DT  T O4    1 
ATOM   4004 C  C5    . DT  D 3 2   ? -3.170  39.959 13.260 1.00 31.47  ? 7   DT  T C5    1 
ATOM   4005 C  C7    . DT  D 3 2   ? -2.334  41.017 13.918 1.00 24.75  ? 7   DT  T C7    1 
ATOM   4006 C  C6    . DT  D 3 2   ? -2.632  38.816 12.806 1.00 33.31  ? 7   DT  T C6    1 
ATOM   4007 P  P     . DA  D 3 3   ? -0.428  34.884 8.491  1.00 40.20  ? 8   DA  T P     1 
ATOM   4008 O  OP1   . DA  D 3 3   ? -0.402  33.589 7.775  1.00 38.73  ? 8   DA  T OP1   1 
ATOM   4009 O  OP2   . DA  D 3 3   ? 0.794   35.719 8.546  1.00 39.29  ? 8   DA  T OP2   1 
ATOM   4010 O  "O5'" . DA  D 3 3   ? -1.627  35.723 7.876  1.00 35.79  ? 8   DA  T "O5'" 1 
ATOM   4011 C  "C5'" . DA  D 3 3   ? -2.920  35.173 7.858  1.00 34.29  ? 8   DA  T "C5'" 1 
ATOM   4012 C  "C4'" . DA  D 3 3   ? -3.885  36.138 7.215  1.00 33.01  ? 8   DA  T "C4'" 1 
ATOM   4013 O  "O4'" . DA  D 3 3   ? -4.339  37.099 8.200  1.00 35.70  ? 8   DA  T "O4'" 1 
ATOM   4014 C  "C3'" . DA  D 3 3   ? -3.301  36.961 6.055  1.00 34.44  ? 8   DA  T "C3'" 1 
ATOM   4015 O  "O3'" . DA  D 3 3   ? -4.133  36.822 4.917  1.00 38.38  ? 8   DA  T "O3'" 1 
ATOM   4016 C  "C2'" . DA  D 3 3   ? -3.321  38.394 6.589  1.00 32.37  ? 8   DA  T "C2'" 1 
ATOM   4017 C  "C1'" . DA  D 3 3   ? -4.485  38.328 7.553  1.00 35.02  ? 8   DA  T "C1'" 1 
ATOM   4018 N  N9    . DA  D 3 3   ? -4.483  39.407 8.529  1.00 32.04  ? 8   DA  T N9    1 
ATOM   4019 C  C8    . DA  D 3 3   ? -3.413  39.883 9.232  1.00 31.24  ? 8   DA  T C8    1 
ATOM   4020 N  N7    . DA  D 3 3   ? -3.706  40.894 10.018 1.00 30.95  ? 8   DA  T N7    1 
ATOM   4021 C  C5    . DA  D 3 3   ? -5.061  41.097 9.805  1.00 28.42  ? 8   DA  T C5    1 
ATOM   4022 C  C6    . DA  D 3 3   ? -5.979  42.021 10.339 1.00 25.72  ? 8   DA  T C6    1 
ATOM   4023 N  N6    . DA  D 3 3   ? -5.647  42.951 11.236 1.00 24.08  ? 8   DA  T N6    1 
ATOM   4024 N  N1    . DA  D 3 3   ? -7.258  41.949 9.915  1.00 27.83  ? 8   DA  T N1    1 
ATOM   4025 C  C2    . DA  D 3 3   ? -7.590  41.016 9.013  1.00 27.09  ? 8   DA  T C2    1 
ATOM   4026 N  N3    . DA  D 3 3   ? -6.818  40.097 8.438  1.00 28.26  ? 8   DA  T N3    1 
ATOM   4027 C  C4    . DA  D 3 3   ? -5.553  40.193 8.884  1.00 31.38  ? 8   DA  T C4    1 
ATOM   4028 P  P     . DC  D 3 4   ? -3.626  37.253 3.454  1.00 45.43  ? 9   DC  T P     1 
ATOM   4029 O  OP1   . DC  D 3 4   ? -3.499  36.013 2.659  1.00 37.54  ? 9   DC  T OP1   1 
ATOM   4030 O  OP2   . DC  D 3 4   ? -2.439  38.137 3.599  1.00 35.60  ? 9   DC  T OP2   1 
ATOM   4031 O  "O5'" . DC  D 3 4   ? -4.888  38.015 2.838  1.00 38.02  ? 9   DC  T "O5'" 1 
ATOM   4032 C  "C5'" . DC  D 3 4   ? -6.100  37.298 2.625  1.00 33.40  ? 9   DC  T "C5'" 1 
ATOM   4033 C  "C4'" . DC  D 3 4   ? -7.299  38.204 2.818  1.00 33.87  ? 9   DC  T "C4'" 1 
ATOM   4034 O  "O4'" . DC  D 3 4   ? -7.245  38.771 4.131  1.00 34.95  ? 9   DC  T "O4'" 1 
ATOM   4035 C  "C3'" . DC  D 3 4   ? -7.326  39.399 1.892  1.00 36.13  ? 9   DC  T "C3'" 1 
ATOM   4036 O  "O3'" . DC  D 3 4   ? -8.005  39.061 0.716  1.00 38.42  ? 9   DC  T "O3'" 1 
ATOM   4037 C  "C2'" . DC  D 3 4   ? -8.100  40.451 2.687  1.00 38.41  ? 9   DC  T "C2'" 1 
ATOM   4038 C  "C1'" . DC  D 3 4   ? -7.927  40.007 4.143  1.00 34.66  ? 9   DC  T "C1'" 1 
ATOM   4039 N  N1    . DC  D 3 4   ? -7.135  40.961 4.965  1.00 28.72  ? 9   DC  T N1    1 
ATOM   4040 C  C2    . DC  D 3 4   ? -7.759  42.073 5.555  1.00 33.48  ? 9   DC  T C2    1 
ATOM   4041 O  O2    . DC  D 3 4   ? -8.977  42.253 5.379  1.00 33.29  ? 9   DC  T O2    1 
ATOM   4042 N  N3    . DC  D 3 4   ? -7.006  42.925 6.305  1.00 29.28  ? 9   DC  T N3    1 
ATOM   4043 C  C4    . DC  D 3 4   ? -5.703  42.694 6.466  1.00 27.98  ? 9   DC  T C4    1 
ATOM   4044 N  N4    . DC  D 3 4   ? -5.002  43.554 7.210  1.00 25.90  ? 9   DC  T N4    1 
ATOM   4045 C  C5    . DC  D 3 4   ? -5.061  41.569 5.872  1.00 28.35  ? 9   DC  T C5    1 
ATOM   4046 C  C6    . DC  D 3 4   ? -5.806  40.739 5.142  1.00 25.81  ? 9   DC  T C6    1 
ATOM   4047 P  P     . DT  D 3 5   ? -7.679  39.837 -0.646 1.00 33.91  ? 10  DT  T P     1 
ATOM   4048 O  OP1   . DT  D 3 5   ? -8.030  38.896 -1.731 1.00 29.34  ? 10  DT  T OP1   1 
ATOM   4049 O  OP2   . DT  D 3 5   ? -6.310  40.413 -0.546 1.00 27.68  ? 10  DT  T OP2   1 
ATOM   4050 O  "O5'" . DT  D 3 5   ? -8.745  41.018 -0.652 1.00 33.64  ? 10  DT  T "O5'" 1 
ATOM   4051 C  "C5'" . DT  D 3 5   ? -10.114 40.706 -0.510 1.00 37.73  ? 10  DT  T "C5'" 1 
ATOM   4052 C  "C4'" . DT  D 3 5   ? -10.897 41.911 -0.033 1.00 38.01  ? 10  DT  T "C4'" 1 
ATOM   4053 O  "O4'" . DT  D 3 5   ? -10.292 42.447 1.174  1.00 39.32  ? 10  DT  T "O4'" 1 
ATOM   4054 C  "C3'" . DT  D 3 5   ? -10.967 43.072 -1.022 1.00 35.33  ? 10  DT  T "C3'" 1 
ATOM   4055 O  "O3'" . DT  D 3 5   ? -12.283 43.580 -1.030 1.00 41.56  ? 10  DT  T "O3'" 1 
ATOM   4056 C  "C2'" . DT  D 3 5   ? -9.971  44.083 -0.450 1.00 34.22  ? 10  DT  T "C2'" 1 
ATOM   4057 C  "C1'" . DT  D 3 5   ? -10.121 43.841 1.038  1.00 30.27  ? 10  DT  T "C1'" 1 
ATOM   4058 N  N1    . DT  D 3 5   ? -8.928  44.233 1.827  1.00 30.71  ? 10  DT  T N1    1 
ATOM   4059 C  C2    . DT  D 3 5   ? -9.047  45.183 2.826  1.00 31.77  ? 10  DT  T C2    1 
ATOM   4060 O  O2    . DT  D 3 5   ? -10.098 45.747 3.102  1.00 30.22  ? 10  DT  T O2    1 
ATOM   4061 N  N3    . DT  D 3 5   ? -7.883  45.454 3.495  1.00 22.70  ? 10  DT  T N3    1 
ATOM   4062 C  C4    . DT  D 3 5   ? -6.642  44.885 3.276  1.00 26.19  ? 10  DT  T C4    1 
ATOM   4063 O  O4    . DT  D 3 5   ? -5.654  45.198 3.931  1.00 27.31  ? 10  DT  T O4    1 
ATOM   4064 C  C5    . DT  D 3 5   ? -6.591  43.899 2.219  1.00 32.07  ? 10  DT  T C5    1 
ATOM   4065 C  C7    . DT  D 3 5   ? -5.299  43.213 1.885  1.00 25.63  ? 10  DT  T C7    1 
ATOM   4066 C  C6    . DT  D 3 5   ? -7.723  43.626 1.556  1.00 31.13  ? 10  DT  T C6    1 
ATOM   4067 P  P     . DG  D 3 6   ? -12.673 44.849 -1.926 1.00 29.25  ? 11  DG  T P     1 
ATOM   4068 O  OP1   . DG  D 3 6   ? -14.054 44.611 -2.397 1.00 33.12  ? 11  DG  T OP1   1 
ATOM   4069 O  OP2   . DG  D 3 6   ? -11.586 45.117 -2.893 1.00 29.05  ? 11  DG  T OP2   1 
ATOM   4070 O  "O5'" . DG  D 3 6   ? -12.732 46.043 -0.869 1.00 33.91  ? 11  DG  T "O5'" 1 
ATOM   4071 C  "C5'" . DG  D 3 6   ? -13.808 46.105 0.061  1.00 29.91  ? 11  DG  T "C5'" 1 
ATOM   4072 C  "C4'" . DG  D 3 6   ? -13.912 47.488 0.679  1.00 29.16  ? 11  DG  T "C4'" 1 
ATOM   4073 O  "O4'" . DG  D 3 6   ? -12.724 47.764 1.466  1.00 27.30  ? 11  DG  T "O4'" 1 
ATOM   4074 C  "C3'" . DG  D 3 6   ? -14.032 48.633 -0.314 1.00 31.52  ? 11  DG  T "C3'" 1 
ATOM   4075 O  "O3'" . DG  D 3 6   ? -14.877 49.644 0.219  1.00 36.63  ? 11  DG  T "O3'" 1 
ATOM   4076 C  "C2'" . DG  D 3 6   ? -12.589 49.115 -0.462 1.00 29.71  ? 11  DG  T "C2'" 1 
ATOM   4077 C  "C1'" . DG  D 3 6   ? -12.025 48.873 0.935  1.00 29.50  ? 11  DG  T "C1'" 1 
ATOM   4078 N  N9    . DG  D 3 6   ? -10.596 48.552 0.945  1.00 28.64  ? 11  DG  T N9    1 
ATOM   4079 C  C8    . DG  D 3 6   ? -9.966  47.582 0.204  1.00 29.86  ? 11  DG  T C8    1 
ATOM   4080 N  N7    . DG  D 3 6   ? -8.681  47.513 0.421  1.00 30.17  ? 11  DG  T N7    1 
ATOM   4081 C  C5    . DG  D 3 6   ? -8.440  48.497 1.373  1.00 24.93  ? 11  DG  T C5    1 
ATOM   4082 C  C6    . DG  D 3 6   ? -7.229  48.885 1.993  1.00 23.77  ? 11  DG  T C6    1 
ATOM   4083 O  O6    . DG  D 3 6   ? -6.096  48.417 1.821  1.00 25.76  ? 11  DG  T O6    1 
ATOM   4084 N  N1    . DG  D 3 6   ? -7.419  49.923 2.899  1.00 22.79  ? 11  DG  T N1    1 
ATOM   4085 C  C2    . DG  D 3 6   ? -8.630  50.518 3.169  1.00 27.30  ? 11  DG  T C2    1 
ATOM   4086 N  N2    . DG  D 3 6   ? -8.617  51.505 4.080  1.00 22.82  ? 11  DG  T N2    1 
ATOM   4087 N  N3    . DG  D 3 6   ? -9.778  50.161 2.596  1.00 28.89  ? 11  DG  T N3    1 
ATOM   4088 C  C4    . DG  D 3 6   ? -9.607  49.146 1.711  1.00 25.10  ? 11  DG  T C4    1 
HETATM 4089 MG MG    . MG  E 4 .   ? -18.376 49.710 12.600 1.00 31.10  ? 601 MG  A MG    1 
HETATM 4090 S  S     . SO4 F 5 .   ? -22.174 29.183 57.221 1.00 77.81  ? 601 SO4 B S     1 
HETATM 4091 O  O1    . SO4 F 5 .   ? -21.547 30.034 56.234 1.00 62.29  ? 601 SO4 B O1    1 
HETATM 4092 O  O2    . SO4 F 5 .   ? -23.516 29.715 57.246 1.00 64.31  ? 601 SO4 B O2    1 
HETATM 4093 O  O3    . SO4 F 5 .   ? -22.187 27.781 56.787 1.00 71.75  ? 601 SO4 B O3    1 
HETATM 4094 O  O4    . SO4 F 5 .   ? -21.517 29.311 58.528 1.00 55.61  ? 601 SO4 B O4    1 
HETATM 4095 MG MG    . MG  G 4 .   ? -24.319 40.898 46.994 1.00 34.45  ? 602 MG  B MG    1 
HETATM 4096 P  PG    . DGT H 6 .   ? -21.163 42.018 48.407 1.00 31.89  ? 603 DGT B PG    1 
HETATM 4097 O  O1G   . DGT H 6 .   ? -21.231 43.508 48.254 1.00 30.49  1 603 DGT B O1G   1 
HETATM 4098 O  O2G   . DGT H 6 .   ? -22.015 41.364 47.366 1.00 29.79  1 603 DGT B O2G   1 
HETATM 4099 O  O3G   . DGT H 6 .   ? -19.719 41.620 48.213 1.00 36.30  ? 603 DGT B O3G   1 
HETATM 4100 O  O3B   . DGT H 6 .   ? -21.668 41.586 49.790 1.00 45.16  ? 603 DGT B O3B   1 
HETATM 4101 P  PB    . DGT H 6 .   ? -23.071 40.888 50.048 1.00 32.51  ? 603 DGT B PB    1 
HETATM 4102 O  O1B   . DGT H 6 .   ? -23.671 41.366 51.341 1.00 36.49  1 603 DGT B O1B   1 
HETATM 4103 O  O2B   . DGT H 6 .   ? -24.093 41.143 48.955 1.00 39.18  ? 603 DGT B O2B   1 
HETATM 4104 O  O3A   . DGT H 6 .   ? -22.799 39.354 50.161 1.00 39.50  ? 603 DGT B O3A   1 
HETATM 4105 P  PA    . DGT H 6 .   ? -23.059 38.274 49.015 1.00 32.15  ? 603 DGT B PA    1 
HETATM 4106 O  O1A   . DGT H 6 .   ? -23.585 38.831 47.691 1.00 28.99  1 603 DGT B O1A   1 
HETATM 4107 O  O2A   . DGT H 6 .   ? -21.804 37.453 48.782 1.00 35.16  ? 603 DGT B O2A   1 
HETATM 4108 O  "O5'" . DGT H 6 .   ? -24.163 37.338 49.633 1.00 39.99  ? 603 DGT B "O5'" 1 
HETATM 4109 C  "C5'" . DGT H 6 .   ? -25.448 37.793 49.712 1.00 29.85  ? 603 DGT B "C5'" 1 
HETATM 4110 C  "C4'" . DGT H 6 .   ? -25.969 37.400 51.055 1.00 34.17  ? 603 DGT B "C4'" 1 
HETATM 4111 O  "O4'" . DGT H 6 .   ? -26.155 36.019 51.078 1.00 43.11  ? 603 DGT B "O4'" 1 
HETATM 4112 C  "C3'" . DGT H 6 .   ? -24.976 37.699 52.077 1.00 34.41  ? 603 DGT B "C3'" 1 
HETATM 4113 O  "O3'" . DGT H 6 .   ? -25.058 39.051 52.575 1.00 33.20  ? 603 DGT B "O3'" 1 
HETATM 4114 C  "C2'" . DGT H 6 .   ? -25.277 36.795 53.126 1.00 30.08  ? 603 DGT B "C2'" 1 
HETATM 4115 C  "C1'" . DGT H 6 .   ? -25.780 35.597 52.382 1.00 38.21  ? 603 DGT B "C1'" 1 
HETATM 4116 N  N9    . DGT H 6 .   ? -24.746 34.679 52.287 1.00 42.79  ? 603 DGT B N9    1 
HETATM 4117 C  C8    . DGT H 6 .   ? -23.968 34.433 51.207 1.00 47.07  ? 603 DGT B C8    1 
HETATM 4118 N  N7    . DGT H 6 .   ? -23.072 33.504 51.501 1.00 54.19  ? 603 DGT B N7    1 
HETATM 4119 C  C5    . DGT H 6 .   ? -23.242 33.122 52.775 1.00 50.92  ? 603 DGT B C5    1 
HETATM 4120 C  C6    . DGT H 6 .   ? -22.577 32.156 53.645 1.00 55.38  ? 603 DGT B C6    1 
HETATM 4121 O  O6    . DGT H 6 .   ? -21.671 31.511 53.233 1.00 56.69  ? 603 DGT B O6    1 
HETATM 4122 N  N1    . DGT H 6 .   ? -23.011 32.000 54.948 1.00 58.05  ? 603 DGT B N1    1 
HETATM 4123 C  C2    . DGT H 6 .   ? -24.100 32.761 55.472 1.00 47.34  ? 603 DGT B C2    1 
HETATM 4124 N  N2    . DGT H 6 .   ? -24.519 32.580 56.809 1.00 56.98  ? 603 DGT B N2    1 
HETATM 4125 N  N3    . DGT H 6 .   ? -24.736 33.667 54.675 1.00 45.33  ? 603 DGT B N3    1 
HETATM 4126 C  C4    . DGT H 6 .   ? -24.311 33.870 53.292 1.00 46.61  ? 603 DGT B C4    1 
HETATM 4127 O  O     . HOH I 7 .   ? -15.970 63.518 21.573 1.00 34.10  ? 701 HOH A O     1 
HETATM 4128 O  O     . HOH I 7 .   ? -22.120 53.705 -2.024 1.00 26.60  ? 702 HOH A O     1 
HETATM 4129 O  O     . HOH I 7 .   ? -24.619 48.405 10.246 1.00 23.68  ? 703 HOH A O     1 
HETATM 4130 O  O     . HOH I 7 .   ? -35.309 36.834 12.320 1.00 42.03  ? 704 HOH A O     1 
HETATM 4131 O  O     . HOH I 7 .   ? -26.129 39.912 12.319 1.00 34.67  ? 705 HOH A O     1 
HETATM 4132 O  O     . HOH I 7 .   ? -20.087 65.309 2.028  1.00 32.34  ? 706 HOH A O     1 
HETATM 4133 O  O     . HOH I 7 .   ? -22.758 68.444 3.053  1.00 34.32  ? 707 HOH A O     1 
HETATM 4134 O  O     . HOH I 7 .   ? -32.067 56.810 7.521  1.00 29.71  ? 708 HOH A O     1 
HETATM 4135 O  O     . HOH I 7 .   ? -12.648 18.523 16.735 1.00 34.90  ? 709 HOH A O     1 
HETATM 4136 O  O     . HOH I 7 .   ? -19.071 69.965 13.418 1.00 25.78  ? 710 HOH A O     1 
HETATM 4137 O  O     . HOH J 7 .   ? -29.661 28.541 64.615 1.00 31.45  ? 701 HOH B O     1 
HETATM 4138 O  O     . HOH J 7 .   ? -27.452 43.666 46.281 1.00 25.98  ? 702 HOH B O     1 
HETATM 4139 O  O     . HOH J 7 .   ? -26.014 43.848 63.974 1.00 32.67  ? 703 HOH B O     1 
HETATM 4140 O  O     . HOH J 7 .   ? -40.644 30.313 56.576 1.00 31.51  ? 704 HOH B O     1 
HETATM 4141 O  O     . HOH J 7 .   ? -37.996 50.223 30.251 1.00 39.60  ? 705 HOH B O     1 
HETATM 4142 O  O     . HOH J 7 .   ? -16.664 42.661 42.412 1.00 30.58  ? 706 HOH B O     1 
HETATM 4143 O  O     . HOH J 7 .   ? -39.052 42.954 67.662 1.00 25.18  ? 707 HOH B O     1 
HETATM 4144 O  O     . HOH J 7 .   ? -34.086 31.574 75.657 1.00 23.42  ? 708 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   242 ?   ?   ?   A . n 
A 1 2   GLN 2   243 ?   ?   ?   A . n 
A 1 3   PRO 3   244 ?   ?   ?   A . n 
A 1 4   SER 4   245 ?   ?   ?   A . n 
A 1 5   SER 5   246 ?   ?   ?   A . n 
A 1 6   GLN 6   247 ?   ?   ?   A . n 
A 1 7   LYS 7   248 ?   ?   ?   A . n 
A 1 8   ALA 8   249 ?   ?   ?   A . n 
A 1 9   THR 9   250 ?   ?   ?   A . n 
A 1 10  ASN 10  251 ?   ?   ?   A . n 
A 1 11  HIS 11  252 ?   ?   ?   A . n 
A 1 12  ASN 12  253 ?   ?   ?   A . n 
A 1 13  LEU 13  254 ?   ?   ?   A . n 
A 1 14  HIS 14  255 ?   ?   ?   A . n 
A 1 15  ILE 15  256 ?   ?   ?   A . n 
A 1 16  THR 16  257 ?   ?   ?   A . n 
A 1 17  GLU 17  258 ?   ?   ?   A . n 
A 1 18  LYS 18  259 ?   ?   ?   A . n 
A 1 19  LEU 19  260 ?   ?   ?   A . n 
A 1 20  GLU 20  261 ?   ?   ?   A . n 
A 1 21  VAL 21  262 ?   ?   ?   A . n 
A 1 22  LEU 22  263 ?   ?   ?   A . n 
A 1 23  ALA 23  264 ?   ?   ?   A . n 
A 1 24  LYS 24  265 ?   ?   ?   A . n 
A 1 25  ALA 25  266 ?   ?   ?   A . n 
A 1 26  TYR 26  267 ?   ?   ?   A . n 
A 1 27  SER 27  268 ?   ?   ?   A . n 
A 1 28  VAL 28  269 ?   ?   ?   A . n 
A 1 29  GLN 29  270 ?   ?   ?   A . n 
A 1 30  GLY 30  271 ?   ?   ?   A . n 
A 1 31  ASP 31  272 ?   ?   ?   A . n 
A 1 32  LYS 32  273 ?   ?   ?   A . n 
A 1 33  TRP 33  274 ?   ?   ?   A . n 
A 1 34  ARG 34  275 ?   ?   ?   A . n 
A 1 35  ALA 35  276 ?   ?   ?   A . n 
A 1 36  LEU 36  277 ?   ?   ?   A . n 
A 1 37  GLY 37  278 ?   ?   ?   A . n 
A 1 38  TYR 38  279 ?   ?   ?   A . n 
A 1 39  ALA 39  280 ?   ?   ?   A . n 
A 1 40  LYS 40  281 ?   ?   ?   A . n 
A 1 41  ALA 41  282 ?   ?   ?   A . n 
A 1 42  ILE 42  283 ?   ?   ?   A . n 
A 1 43  ASN 43  284 ?   ?   ?   A . n 
A 1 44  ALA 44  285 ?   ?   ?   A . n 
A 1 45  LEU 45  286 ?   ?   ?   A . n 
A 1 46  LYS 46  287 ?   ?   ?   A . n 
A 1 47  SER 47  288 ?   ?   ?   A . n 
A 1 48  PHE 48  289 ?   ?   ?   A . n 
A 1 49  HIS 49  290 ?   ?   ?   A . n 
A 1 50  LYS 50  291 ?   ?   ?   A . n 
A 1 51  PRO 51  292 ?   ?   ?   A . n 
A 1 52  VAL 52  293 ?   ?   ?   A . n 
A 1 53  THR 53  294 ?   ?   ?   A . n 
A 1 54  SER 54  295 ?   ?   ?   A . n 
A 1 55  TYR 55  296 ?   ?   ?   A . n 
A 1 56  GLN 56  297 ?   ?   ?   A . n 
A 1 57  GLU 57  298 ?   ?   ?   A . n 
A 1 58  ALA 58  299 ?   ?   ?   A . n 
A 1 59  CYS 59  300 ?   ?   ?   A . n 
A 1 60  SER 60  301 ?   ?   ?   A . n 
A 1 61  ILE 61  302 ?   ?   ?   A . n 
A 1 62  PRO 62  303 ?   ?   ?   A . n 
A 1 63  GLY 63  304 ?   ?   ?   A . n 
A 1 64  ILE 64  305 ?   ?   ?   A . n 
A 1 65  GLY 65  306 ?   ?   ?   A . n 
A 1 66  LYS 66  307 ?   ?   ?   A . n 
A 1 67  ARG 67  308 ?   ?   ?   A . n 
A 1 68  MET 68  309 ?   ?   ?   A . n 
A 1 69  ALA 69  310 ?   ?   ?   A . n 
A 1 70  GLU 70  311 ?   ?   ?   A . n 
A 1 71  LYS 71  312 ?   ?   ?   A . n 
A 1 72  ILE 72  313 ?   ?   ?   A . n 
A 1 73  ILE 73  314 ?   ?   ?   A . n 
A 1 74  GLU 74  315 ?   ?   ?   A . n 
A 1 75  ILE 75  316 ?   ?   ?   A . n 
A 1 76  LEU 76  317 ?   ?   ?   A . n 
A 1 77  GLU 77  318 ?   ?   ?   A . n 
A 1 78  SER 78  319 ?   ?   ?   A . n 
A 1 79  GLY 79  320 ?   ?   ?   A . n 
A 1 80  HIS 80  321 ?   ?   ?   A . n 
A 1 81  LEU 81  322 ?   ?   ?   A . n 
A 1 82  ARG 82  323 ?   ?   ?   A . n 
A 1 83  LYS 83  324 ?   ?   ?   A . n 
A 1 84  LEU 84  325 ?   ?   ?   A . n 
A 1 85  ASP 85  326 ?   ?   ?   A . n 
A 1 86  HIS 86  327 ?   ?   ?   A . n 
A 1 87  ILE 87  328 ?   ?   ?   A . n 
A 1 88  SER 88  329 ?   ?   ?   A . n 
A 1 89  GLU 89  330 330 GLU GLU A . n 
A 1 90  SER 90  331 331 SER SER A . n 
A 1 91  VAL 91  332 332 VAL VAL A . n 
A 1 92  PRO 92  333 333 PRO PRO A . n 
A 1 93  VAL 93  334 334 VAL VAL A . n 
A 1 94  LEU 94  335 335 LEU LEU A . n 
A 1 95  GLU 95  336 336 GLU GLU A . n 
A 1 96  LEU 96  337 337 LEU LEU A . n 
A 1 97  PHE 97  338 338 PHE PHE A . n 
A 1 98  SER 98  339 339 SER SER A . n 
A 1 99  ASN 99  340 340 ASN ASN A . n 
A 1 100 ILE 100 341 341 ILE ILE A . n 
A 1 101 TRP 101 342 342 TRP TRP A . n 
A 1 102 GLY 102 343 343 GLY GLY A . n 
A 1 103 ALA 103 344 344 ALA ALA A . n 
A 1 104 GLY 104 345 345 GLY GLY A . n 
A 1 105 THR 105 346 346 THR THR A . n 
A 1 106 LYS 106 347 347 LYS LYS A . n 
A 1 107 THR 107 348 348 THR THR A . n 
A 1 108 ALA 108 349 349 ALA ALA A . n 
A 1 109 GLN 109 350 350 GLN GLN A . n 
A 1 110 MET 110 351 351 MET MET A . n 
A 1 111 TRP 111 352 352 TRP TRP A . n 
A 1 112 TYR 112 353 353 TYR TYR A . n 
A 1 113 GLN 113 354 354 GLN GLN A . n 
A 1 114 GLN 114 355 355 GLN GLN A . n 
A 1 115 GLY 115 356 356 GLY GLY A . n 
A 1 116 PHE 116 357 357 PHE PHE A . n 
A 1 117 ARG 117 358 358 ARG ARG A . n 
A 1 118 SER 118 359 359 SER SER A . n 
A 1 119 LEU 119 360 360 LEU LEU A . n 
A 1 120 GLU 120 361 361 GLU GLU A . n 
A 1 121 ASP 121 362 362 ASP ASP A . n 
A 1 122 ILE 122 363 363 ILE ILE A . n 
A 1 123 ARG 123 364 364 ARG ARG A . n 
A 1 124 SER 124 365 365 SER SER A . n 
A 1 125 GLN 125 366 366 GLN GLN A . n 
A 1 126 ALA 126 367 367 ALA ALA A . n 
A 1 127 SER 127 368 368 SER SER A . n 
A 1 128 LEU 128 369 369 LEU LEU A . n 
A 1 129 THR 129 370 370 THR THR A . n 
A 1 130 THR 130 371 371 THR THR A . n 
A 1 131 GLN 131 372 372 GLN GLN A . n 
A 1 132 GLN 132 373 373 GLN GLN A . n 
A 1 133 ALA 133 374 374 ALA ALA A . n 
A 1 134 ILE 134 375 375 ILE ILE A . n 
A 1 135 GLY 135 376 376 GLY GLY A . n 
A 1 136 LEU 136 377 377 LEU LEU A . n 
A 1 137 LYS 137 378 378 LYS LYS A . n 
A 1 138 HIS 138 379 379 HIS HIS A . n 
A 1 139 TYR 139 380 380 TYR TYR A . n 
A 1 140 SER 140 381 381 SER SER A . n 
A 1 141 ASP 141 382 382 ASP ASP A . n 
A 1 142 PHE 142 383 383 PHE PHE A . n 
A 1 143 LEU 143 384 384 LEU LEU A . n 
A 1 144 GLU 144 385 385 GLU GLU A . n 
A 1 145 ARG 145 386 386 ARG ARG A . n 
A 1 146 MET 146 387 387 MET MET A . n 
A 1 147 PRO 147 388 388 PRO PRO A . n 
A 1 148 ARG 148 389 389 ARG ARG A . n 
A 1 149 GLU 149 390 390 GLU GLU A . n 
A 1 150 GLU 150 391 391 GLU GLU A . n 
A 1 151 ALA 151 392 392 ALA ALA A . n 
A 1 152 THR 152 393 393 THR THR A . n 
A 1 153 GLU 153 394 394 GLU GLU A . n 
A 1 154 ILE 154 395 395 ILE ILE A . n 
A 1 155 GLU 155 396 396 GLU GLU A . n 
A 1 156 GLN 156 397 397 GLN GLN A . n 
A 1 157 THR 157 398 398 THR THR A . n 
A 1 158 VAL 158 399 399 VAL VAL A . n 
A 1 159 GLN 159 400 400 GLN GLN A . n 
A 1 160 LYS 160 401 401 LYS LYS A . n 
A 1 161 ALA 161 402 402 ALA ALA A . n 
A 1 162 ALA 162 403 403 ALA ALA A . n 
A 1 163 GLN 163 404 404 GLN GLN A . n 
A 1 164 ALA 164 405 405 ALA ALA A . n 
A 1 165 PHE 165 406 406 PHE PHE A . n 
A 1 166 ASN 166 407 407 ASN ASN A . n 
A 1 167 SER 167 408 408 SER SER A . n 
A 1 168 GLY 168 409 409 GLY GLY A . n 
A 1 169 LEU 169 410 410 LEU LEU A . n 
A 1 170 LEU 170 411 411 LEU LEU A . n 
A 1 171 CYS 171 412 412 CYS CYS A . n 
A 1 172 VAL 172 413 413 VAL VAL A . n 
A 1 173 ALA 173 414 414 ALA ALA A . n 
A 1 174 CYS 174 415 415 CYS CYS A . n 
A 1 175 GLY 175 416 416 GLY GLY A . n 
A 1 176 SER 176 417 417 SER SER A . n 
A 1 177 TYR 177 418 418 TYR TYR A . n 
A 1 178 ARG 178 419 419 ARG ARG A . n 
A 1 179 ARG 179 420 420 ARG ARG A . n 
A 1 180 GLY 180 421 421 GLY GLY A . n 
A 1 181 LYS 181 422 422 LYS LYS A . n 
A 1 182 ALA 182 423 423 ALA ALA A . n 
A 1 183 THR 183 424 424 THR THR A . n 
A 1 184 CYS 184 425 425 CYS CYS A . n 
A 1 185 GLY 185 426 426 GLY GLY A . n 
A 1 186 ASP 186 427 427 ASP ASP A . n 
A 1 187 VAL 187 428 428 VAL VAL A . n 
A 1 188 ASP 188 429 429 ASP ASP A . n 
A 1 189 VAL 189 430 430 VAL VAL A . n 
A 1 190 ALA 190 431 431 ALA ALA A . n 
A 1 191 ILE 191 432 432 ILE ILE A . n 
A 1 192 THR 192 433 433 THR THR A . n 
A 1 193 HIS 193 434 434 HIS HIS A . n 
A 1 194 PRO 194 435 435 PRO PRO A . n 
A 1 195 ASP 195 436 436 ASP ASP A . n 
A 1 196 GLY 196 437 437 GLY GLY A . n 
A 1 197 ARG 197 438 438 ARG ARG A . n 
A 1 198 SER 198 439 439 SER SER A . n 
A 1 199 HIS 199 440 440 HIS HIS A . n 
A 1 200 ARG 200 441 441 ARG ARG A . n 
A 1 201 GLY 201 442 442 GLY GLY A . n 
A 1 202 ILE 202 443 443 ILE ILE A . n 
A 1 203 PHE 203 444 444 PHE PHE A . n 
A 1 204 SER 204 445 445 SER SER A . n 
A 1 205 ARG 205 446 446 ARG ARG A . n 
A 1 206 LEU 206 447 447 LEU LEU A . n 
A 1 207 LEU 207 448 448 LEU LEU A . n 
A 1 208 ASP 208 449 449 ASP ASP A . n 
A 1 209 SER 209 450 450 SER SER A . n 
A 1 210 LEU 210 451 451 LEU LEU A . n 
A 1 211 ARG 211 452 452 ARG ARG A . n 
A 1 212 GLN 212 453 453 GLN GLN A . n 
A 1 213 GLU 213 454 454 GLU GLU A . n 
A 1 214 GLY 214 455 455 GLY GLY A . n 
A 1 215 PHE 215 456 456 PHE PHE A . n 
A 1 216 LEU 216 457 457 LEU LEU A . n 
A 1 217 THR 217 458 458 THR THR A . n 
A 1 218 ASP 218 459 459 ASP ASP A . n 
A 1 219 ASP 219 460 460 ASP ASP A . n 
A 1 220 LEU 220 461 461 LEU LEU A . n 
A 1 221 VAL 221 462 462 VAL VAL A . n 
A 1 222 SER 222 463 463 SER SER A . n 
A 1 223 GLN 223 464 464 GLN GLN A . n 
A 1 224 GLU 224 465 465 GLU GLU A . n 
A 1 225 GLU 225 466 466 GLU GLU A . n 
A 1 226 ASN 226 467 467 ASN ASN A . n 
A 1 227 GLY 227 468 468 GLY GLY A . n 
A 1 228 GLN 228 469 469 GLN GLN A . n 
A 1 229 GLN 229 470 470 GLN GLN A . n 
A 1 230 GLN 230 471 471 GLN GLN A . n 
A 1 231 LYS 231 472 472 LYS LYS A . n 
A 1 232 TYR 232 473 473 TYR TYR A . n 
A 1 233 LEU 233 474 474 LEU LEU A . n 
A 1 234 GLY 234 475 475 GLY GLY A . n 
A 1 235 VAL 235 476 476 VAL VAL A . n 
A 1 236 CYS 236 477 477 CYS CYS A . n 
A 1 237 ARG 237 478 478 ARG ARG A . n 
A 1 238 LEU 238 479 479 LEU LEU A . n 
A 1 239 PRO 239 480 480 PRO PRO A . n 
A 1 240 GLY 240 481 481 GLY GLY A . n 
A 1 241 PRO 241 482 482 PRO PRO A . n 
A 1 242 GLY 242 483 483 GLY GLY A . n 
A 1 243 ARG 243 484 484 ARG ARG A . n 
A 1 244 ARG 244 485 485 ARG ARG A . n 
A 1 245 HIS 245 486 486 HIS HIS A . n 
A 1 246 ARG 246 487 487 ARG ARG A . n 
A 1 247 ARG 247 488 488 ARG ARG A . n 
A 1 248 LEU 248 489 489 LEU LEU A . n 
A 1 249 ASP 249 490 490 ASP ASP A . n 
A 1 250 ILE 250 491 491 ILE ILE A . n 
A 1 251 ILE 251 492 492 ILE ILE A . n 
A 1 252 VAL 252 493 493 VAL VAL A . n 
A 1 253 VAL 253 494 494 VAL VAL A . n 
A 1 254 PRO 254 495 495 PRO PRO A . n 
A 1 255 TYR 255 496 496 TYR TYR A . n 
A 1 256 SER 256 497 497 SER SER A . n 
A 1 257 GLU 257 498 498 GLU GLU A . n 
A 1 258 PHE 258 499 499 PHE PHE A . n 
A 1 259 ALA 259 500 500 ALA ALA A . n 
A 1 260 CYS 260 501 501 CYS CYS A . n 
A 1 261 ALA 261 502 502 ALA ALA A . n 
A 1 262 LEU 262 503 503 LEU LEU A . n 
A 1 263 LEU 263 504 504 LEU LEU A . n 
A 1 264 TYR 264 505 505 TYR TYR A . n 
A 1 265 PHE 265 506 506 PHE PHE A . n 
A 1 266 THR 266 507 507 THR THR A . n 
A 1 267 GLY 267 508 508 GLY GLY A . n 
A 1 268 SER 268 509 509 SER SER A . n 
A 1 269 ALA 269 510 510 ALA ALA A . n 
A 1 270 HIS 270 511 511 HIS HIS A . n 
A 1 271 PHE 271 512 512 PHE PHE A . n 
A 1 272 ASN 272 513 513 ASN ASN A . n 
A 1 273 ARG 273 514 514 ARG ARG A . n 
A 1 274 SER 274 515 515 SER SER A . n 
A 1 275 MET 275 516 516 MET MET A . n 
A 1 276 ARG 276 517 517 ARG ARG A . n 
A 1 277 ALA 277 518 518 ALA ALA A . n 
A 1 278 LEU 278 519 519 LEU LEU A . n 
A 1 279 ALA 279 520 520 ALA ALA A . n 
A 1 280 LYS 280 521 521 LYS LYS A . n 
A 1 281 THR 281 522 522 THR THR A . n 
A 1 282 LYS 282 523 523 LYS LYS A . n 
A 1 283 GLY 283 524 524 GLY GLY A . n 
A 1 284 MET 284 525 525 MET MET A . n 
A 1 285 SER 285 526 526 SER SER A . n 
A 1 286 LEU 286 527 527 LEU LEU A . n 
A 1 287 SER 287 528 528 SER SER A . n 
A 1 288 GLU 288 529 529 GLU GLU A . n 
A 1 289 HIS 289 530 530 HIS HIS A . n 
A 1 290 ALA 290 531 531 ALA ALA A . n 
A 1 291 LEU 291 532 532 LEU LEU A . n 
A 1 292 SER 292 533 533 SER SER A . n 
A 1 293 THR 293 534 534 THR THR A . n 
A 1 294 ALA 294 535 535 ALA ALA A . n 
A 1 295 VAL 295 536 536 VAL VAL A . n 
A 1 296 VAL 296 537 537 VAL VAL A . n 
A 1 297 ARG 297 538 538 ARG ARG A . n 
A 1 298 ASN 298 539 539 ASN ASN A . n 
A 1 299 THR 299 540 540 THR THR A . n 
A 1 300 HIS 300 541 541 HIS HIS A . n 
A 1 301 GLY 301 542 542 GLY GLY A . n 
A 1 302 CYS 302 543 543 CYS CYS A . n 
A 1 303 LYS 303 544 544 LYS LYS A . n 
A 1 304 VAL 304 545 545 VAL VAL A . n 
A 1 305 GLY 305 546 546 GLY GLY A . n 
A 1 306 PRO 306 547 547 PRO PRO A . n 
A 1 307 GLY 307 548 548 GLY GLY A . n 
A 1 308 ARG 308 549 549 ARG ARG A . n 
A 1 309 VAL 309 550 550 VAL VAL A . n 
A 1 310 LEU 310 551 551 LEU LEU A . n 
A 1 311 PRO 311 552 552 PRO PRO A . n 
A 1 312 THR 312 553 553 THR THR A . n 
A 1 313 PRO 313 554 554 PRO PRO A . n 
A 1 314 THR 314 555 555 THR THR A . n 
A 1 315 GLU 315 556 556 GLU GLU A . n 
A 1 316 LYS 316 557 557 LYS LYS A . n 
A 1 317 ASP 317 558 558 ASP ASP A . n 
A 1 318 VAL 318 559 559 VAL VAL A . n 
A 1 319 PHE 319 560 560 PHE PHE A . n 
A 1 320 ARG 320 561 561 ARG ARG A . n 
A 1 321 LEU 321 562 562 LEU LEU A . n 
A 1 322 LEU 322 563 563 LEU LEU A . n 
A 1 323 GLY 323 564 564 GLY GLY A . n 
A 1 324 LEU 324 565 565 LEU LEU A . n 
A 1 325 PRO 325 566 566 PRO PRO A . n 
A 1 326 TYR 326 567 567 TYR TYR A . n 
A 1 327 ARG 327 568 568 ARG ARG A . n 
A 1 328 GLU 328 569 569 GLU GLU A . n 
A 1 329 PRO 329 570 570 PRO PRO A . n 
A 1 330 ALA 330 571 571 ALA ALA A . n 
A 1 331 GLU 331 572 572 GLU GLU A . n 
A 1 332 ARG 332 573 573 ARG ARG A . n 
A 1 333 ASP 333 574 574 ASP ASP A . n 
A 1 334 TRP 334 575 575 TRP TRP A . n 
B 1 1   ALA 1   242 ?   ?   ?   B . n 
B 1 2   GLN 2   243 ?   ?   ?   B . n 
B 1 3   PRO 3   244 ?   ?   ?   B . n 
B 1 4   SER 4   245 ?   ?   ?   B . n 
B 1 5   SER 5   246 ?   ?   ?   B . n 
B 1 6   GLN 6   247 ?   ?   ?   B . n 
B 1 7   LYS 7   248 ?   ?   ?   B . n 
B 1 8   ALA 8   249 ?   ?   ?   B . n 
B 1 9   THR 9   250 ?   ?   ?   B . n 
B 1 10  ASN 10  251 ?   ?   ?   B . n 
B 1 11  HIS 11  252 ?   ?   ?   B . n 
B 1 12  ASN 12  253 ?   ?   ?   B . n 
B 1 13  LEU 13  254 ?   ?   ?   B . n 
B 1 14  HIS 14  255 ?   ?   ?   B . n 
B 1 15  ILE 15  256 ?   ?   ?   B . n 
B 1 16  THR 16  257 ?   ?   ?   B . n 
B 1 17  GLU 17  258 ?   ?   ?   B . n 
B 1 18  LYS 18  259 ?   ?   ?   B . n 
B 1 19  LEU 19  260 ?   ?   ?   B . n 
B 1 20  GLU 20  261 ?   ?   ?   B . n 
B 1 21  VAL 21  262 ?   ?   ?   B . n 
B 1 22  LEU 22  263 ?   ?   ?   B . n 
B 1 23  ALA 23  264 ?   ?   ?   B . n 
B 1 24  LYS 24  265 ?   ?   ?   B . n 
B 1 25  ALA 25  266 ?   ?   ?   B . n 
B 1 26  TYR 26  267 ?   ?   ?   B . n 
B 1 27  SER 27  268 ?   ?   ?   B . n 
B 1 28  VAL 28  269 ?   ?   ?   B . n 
B 1 29  GLN 29  270 ?   ?   ?   B . n 
B 1 30  GLY 30  271 ?   ?   ?   B . n 
B 1 31  ASP 31  272 ?   ?   ?   B . n 
B 1 32  LYS 32  273 ?   ?   ?   B . n 
B 1 33  TRP 33  274 ?   ?   ?   B . n 
B 1 34  ARG 34  275 ?   ?   ?   B . n 
B 1 35  ALA 35  276 ?   ?   ?   B . n 
B 1 36  LEU 36  277 ?   ?   ?   B . n 
B 1 37  GLY 37  278 ?   ?   ?   B . n 
B 1 38  TYR 38  279 ?   ?   ?   B . n 
B 1 39  ALA 39  280 ?   ?   ?   B . n 
B 1 40  LYS 40  281 ?   ?   ?   B . n 
B 1 41  ALA 41  282 ?   ?   ?   B . n 
B 1 42  ILE 42  283 ?   ?   ?   B . n 
B 1 43  ASN 43  284 ?   ?   ?   B . n 
B 1 44  ALA 44  285 ?   ?   ?   B . n 
B 1 45  LEU 45  286 ?   ?   ?   B . n 
B 1 46  LYS 46  287 ?   ?   ?   B . n 
B 1 47  SER 47  288 ?   ?   ?   B . n 
B 1 48  PHE 48  289 ?   ?   ?   B . n 
B 1 49  HIS 49  290 ?   ?   ?   B . n 
B 1 50  LYS 50  291 ?   ?   ?   B . n 
B 1 51  PRO 51  292 ?   ?   ?   B . n 
B 1 52  VAL 52  293 ?   ?   ?   B . n 
B 1 53  THR 53  294 ?   ?   ?   B . n 
B 1 54  SER 54  295 ?   ?   ?   B . n 
B 1 55  TYR 55  296 ?   ?   ?   B . n 
B 1 56  GLN 56  297 ?   ?   ?   B . n 
B 1 57  GLU 57  298 ?   ?   ?   B . n 
B 1 58  ALA 58  299 ?   ?   ?   B . n 
B 1 59  CYS 59  300 ?   ?   ?   B . n 
B 1 60  SER 60  301 ?   ?   ?   B . n 
B 1 61  ILE 61  302 ?   ?   ?   B . n 
B 1 62  PRO 62  303 ?   ?   ?   B . n 
B 1 63  GLY 63  304 ?   ?   ?   B . n 
B 1 64  ILE 64  305 ?   ?   ?   B . n 
B 1 65  GLY 65  306 ?   ?   ?   B . n 
B 1 66  LYS 66  307 ?   ?   ?   B . n 
B 1 67  ARG 67  308 ?   ?   ?   B . n 
B 1 68  MET 68  309 ?   ?   ?   B . n 
B 1 69  ALA 69  310 ?   ?   ?   B . n 
B 1 70  GLU 70  311 ?   ?   ?   B . n 
B 1 71  LYS 71  312 ?   ?   ?   B . n 
B 1 72  ILE 72  313 ?   ?   ?   B . n 
B 1 73  ILE 73  314 ?   ?   ?   B . n 
B 1 74  GLU 74  315 ?   ?   ?   B . n 
B 1 75  ILE 75  316 ?   ?   ?   B . n 
B 1 76  LEU 76  317 ?   ?   ?   B . n 
B 1 77  GLU 77  318 ?   ?   ?   B . n 
B 1 78  SER 78  319 ?   ?   ?   B . n 
B 1 79  GLY 79  320 ?   ?   ?   B . n 
B 1 80  HIS 80  321 ?   ?   ?   B . n 
B 1 81  LEU 81  322 ?   ?   ?   B . n 
B 1 82  ARG 82  323 ?   ?   ?   B . n 
B 1 83  LYS 83  324 ?   ?   ?   B . n 
B 1 84  LEU 84  325 ?   ?   ?   B . n 
B 1 85  ASP 85  326 ?   ?   ?   B . n 
B 1 86  HIS 86  327 ?   ?   ?   B . n 
B 1 87  ILE 87  328 ?   ?   ?   B . n 
B 1 88  SER 88  329 ?   ?   ?   B . n 
B 1 89  GLU 89  330 ?   ?   ?   B . n 
B 1 90  SER 90  331 ?   ?   ?   B . n 
B 1 91  VAL 91  332 ?   ?   ?   B . n 
B 1 92  PRO 92  333 333 PRO PRO B . n 
B 1 93  VAL 93  334 334 VAL VAL B . n 
B 1 94  LEU 94  335 335 LEU LEU B . n 
B 1 95  GLU 95  336 336 GLU GLU B . n 
B 1 96  LEU 96  337 337 LEU LEU B . n 
B 1 97  PHE 97  338 338 PHE PHE B . n 
B 1 98  SER 98  339 339 SER SER B . n 
B 1 99  ASN 99  340 340 ASN ASN B . n 
B 1 100 ILE 100 341 341 ILE ILE B . n 
B 1 101 TRP 101 342 342 TRP TRP B . n 
B 1 102 GLY 102 343 343 GLY GLY B . n 
B 1 103 ALA 103 344 344 ALA ALA B . n 
B 1 104 GLY 104 345 345 GLY GLY B . n 
B 1 105 THR 105 346 346 THR THR B . n 
B 1 106 LYS 106 347 347 LYS LYS B . n 
B 1 107 THR 107 348 348 THR THR B . n 
B 1 108 ALA 108 349 349 ALA ALA B . n 
B 1 109 GLN 109 350 350 GLN GLN B . n 
B 1 110 MET 110 351 351 MET MET B . n 
B 1 111 TRP 111 352 352 TRP TRP B . n 
B 1 112 TYR 112 353 353 TYR TYR B . n 
B 1 113 GLN 113 354 354 GLN GLN B . n 
B 1 114 GLN 114 355 355 GLN GLN B . n 
B 1 115 GLY 115 356 356 GLY GLY B . n 
B 1 116 PHE 116 357 357 PHE PHE B . n 
B 1 117 ARG 117 358 358 ARG ARG B . n 
B 1 118 SER 118 359 359 SER SER B . n 
B 1 119 LEU 119 360 360 LEU LEU B . n 
B 1 120 GLU 120 361 361 GLU GLU B . n 
B 1 121 ASP 121 362 362 ASP ASP B . n 
B 1 122 ILE 122 363 363 ILE ILE B . n 
B 1 123 ARG 123 364 364 ARG ARG B . n 
B 1 124 SER 124 365 365 SER SER B . n 
B 1 125 GLN 125 366 366 GLN GLN B . n 
B 1 126 ALA 126 367 367 ALA ALA B . n 
B 1 127 SER 127 368 368 SER SER B . n 
B 1 128 LEU 128 369 369 LEU LEU B . n 
B 1 129 THR 129 370 370 THR THR B . n 
B 1 130 THR 130 371 371 THR THR B . n 
B 1 131 GLN 131 372 372 GLN GLN B . n 
B 1 132 GLN 132 373 373 GLN GLN B . n 
B 1 133 ALA 133 374 374 ALA ALA B . n 
B 1 134 ILE 134 375 375 ILE ILE B . n 
B 1 135 GLY 135 376 376 GLY GLY B . n 
B 1 136 LEU 136 377 377 LEU LEU B . n 
B 1 137 LYS 137 378 378 LYS LYS B . n 
B 1 138 HIS 138 379 379 HIS HIS B . n 
B 1 139 TYR 139 380 380 TYR TYR B . n 
B 1 140 SER 140 381 381 SER SER B . n 
B 1 141 ASP 141 382 382 ASP ASP B . n 
B 1 142 PHE 142 383 383 PHE PHE B . n 
B 1 143 LEU 143 384 384 LEU LEU B . n 
B 1 144 GLU 144 385 385 GLU GLU B . n 
B 1 145 ARG 145 386 386 ARG ARG B . n 
B 1 146 MET 146 387 387 MET MET B . n 
B 1 147 PRO 147 388 388 PRO PRO B . n 
B 1 148 ARG 148 389 389 ARG ARG B . n 
B 1 149 GLU 149 390 390 GLU GLU B . n 
B 1 150 GLU 150 391 391 GLU GLU B . n 
B 1 151 ALA 151 392 392 ALA ALA B . n 
B 1 152 THR 152 393 393 THR THR B . n 
B 1 153 GLU 153 394 394 GLU GLU B . n 
B 1 154 ILE 154 395 395 ILE ILE B . n 
B 1 155 GLU 155 396 396 GLU GLU B . n 
B 1 156 GLN 156 397 397 GLN GLN B . n 
B 1 157 THR 157 398 398 THR THR B . n 
B 1 158 VAL 158 399 399 VAL VAL B . n 
B 1 159 GLN 159 400 400 GLN GLN B . n 
B 1 160 LYS 160 401 401 LYS LYS B . n 
B 1 161 ALA 161 402 402 ALA ALA B . n 
B 1 162 ALA 162 403 403 ALA ALA B . n 
B 1 163 GLN 163 404 404 GLN GLN B . n 
B 1 164 ALA 164 405 405 ALA ALA B . n 
B 1 165 PHE 165 406 406 PHE PHE B . n 
B 1 166 ASN 166 407 407 ASN ASN B . n 
B 1 167 SER 167 408 408 SER SER B . n 
B 1 168 GLY 168 409 409 GLY GLY B . n 
B 1 169 LEU 169 410 410 LEU LEU B . n 
B 1 170 LEU 170 411 411 LEU LEU B . n 
B 1 171 CYS 171 412 412 CYS CYS B . n 
B 1 172 VAL 172 413 413 VAL VAL B . n 
B 1 173 ALA 173 414 414 ALA ALA B . n 
B 1 174 CYS 174 415 415 CYS CYS B . n 
B 1 175 GLY 175 416 416 GLY GLY B . n 
B 1 176 SER 176 417 417 SER SER B . n 
B 1 177 TYR 177 418 418 TYR TYR B . n 
B 1 178 ARG 178 419 419 ARG ARG B . n 
B 1 179 ARG 179 420 420 ARG ARG B . n 
B 1 180 GLY 180 421 421 GLY GLY B . n 
B 1 181 LYS 181 422 422 LYS LYS B . n 
B 1 182 ALA 182 423 423 ALA ALA B . n 
B 1 183 THR 183 424 424 THR THR B . n 
B 1 184 CYS 184 425 425 CYS CYS B . n 
B 1 185 GLY 185 426 426 GLY GLY B . n 
B 1 186 ASP 186 427 427 ASP ASP B . n 
B 1 187 VAL 187 428 428 VAL VAL B . n 
B 1 188 ASP 188 429 429 ASP ASP B . n 
B 1 189 VAL 189 430 430 VAL VAL B . n 
B 1 190 ALA 190 431 431 ALA ALA B . n 
B 1 191 ILE 191 432 432 ILE ILE B . n 
B 1 192 THR 192 433 433 THR THR B . n 
B 1 193 HIS 193 434 434 HIS HIS B . n 
B 1 194 PRO 194 435 435 PRO PRO B . n 
B 1 195 ASP 195 436 436 ASP ASP B . n 
B 1 196 GLY 196 437 437 GLY GLY B . n 
B 1 197 ARG 197 438 438 ARG ARG B . n 
B 1 198 SER 198 439 439 SER SER B . n 
B 1 199 HIS 199 440 440 HIS HIS B . n 
B 1 200 ARG 200 441 441 ARG ARG B . n 
B 1 201 GLY 201 442 442 GLY GLY B . n 
B 1 202 ILE 202 443 443 ILE ILE B . n 
B 1 203 PHE 203 444 444 PHE PHE B . n 
B 1 204 SER 204 445 445 SER SER B . n 
B 1 205 ARG 205 446 446 ARG ARG B . n 
B 1 206 LEU 206 447 447 LEU LEU B . n 
B 1 207 LEU 207 448 448 LEU LEU B . n 
B 1 208 ASP 208 449 449 ASP ASP B . n 
B 1 209 SER 209 450 450 SER SER B . n 
B 1 210 LEU 210 451 451 LEU LEU B . n 
B 1 211 ARG 211 452 452 ARG ARG B . n 
B 1 212 GLN 212 453 453 GLN GLN B . n 
B 1 213 GLU 213 454 454 GLU GLU B . n 
B 1 214 GLY 214 455 455 GLY GLY B . n 
B 1 215 PHE 215 456 456 PHE PHE B . n 
B 1 216 LEU 216 457 457 LEU LEU B . n 
B 1 217 THR 217 458 458 THR THR B . n 
B 1 218 ASP 218 459 459 ASP ASP B . n 
B 1 219 ASP 219 460 460 ASP ASP B . n 
B 1 220 LEU 220 461 461 LEU LEU B . n 
B 1 221 VAL 221 462 462 VAL VAL B . n 
B 1 222 SER 222 463 463 SER SER B . n 
B 1 223 GLN 223 464 464 GLN GLN B . n 
B 1 224 GLU 224 465 465 GLU GLU B . n 
B 1 225 GLU 225 466 466 GLU GLU B . n 
B 1 226 ASN 226 467 467 ASN ASN B . n 
B 1 227 GLY 227 468 468 GLY GLY B . n 
B 1 228 GLN 228 469 469 GLN GLN B . n 
B 1 229 GLN 229 470 470 GLN GLN B . n 
B 1 230 GLN 230 471 471 GLN GLN B . n 
B 1 231 LYS 231 472 472 LYS LYS B . n 
B 1 232 TYR 232 473 473 TYR TYR B . n 
B 1 233 LEU 233 474 474 LEU LEU B . n 
B 1 234 GLY 234 475 475 GLY GLY B . n 
B 1 235 VAL 235 476 476 VAL VAL B . n 
B 1 236 CYS 236 477 477 CYS CYS B . n 
B 1 237 ARG 237 478 478 ARG ARG B . n 
B 1 238 LEU 238 479 479 LEU LEU B . n 
B 1 239 PRO 239 480 480 PRO PRO B . n 
B 1 240 GLY 240 481 481 GLY GLY B . n 
B 1 241 PRO 241 482 482 PRO PRO B . n 
B 1 242 GLY 242 483 483 GLY GLY B . n 
B 1 243 ARG 243 484 484 ARG ARG B . n 
B 1 244 ARG 244 485 485 ARG ARG B . n 
B 1 245 HIS 245 486 486 HIS HIS B . n 
B 1 246 ARG 246 487 487 ARG ARG B . n 
B 1 247 ARG 247 488 488 ARG ARG B . n 
B 1 248 LEU 248 489 489 LEU LEU B . n 
B 1 249 ASP 249 490 490 ASP ASP B . n 
B 1 250 ILE 250 491 491 ILE ILE B . n 
B 1 251 ILE 251 492 492 ILE ILE B . n 
B 1 252 VAL 252 493 493 VAL VAL B . n 
B 1 253 VAL 253 494 494 VAL VAL B . n 
B 1 254 PRO 254 495 495 PRO PRO B . n 
B 1 255 TYR 255 496 496 TYR TYR B . n 
B 1 256 SER 256 497 497 SER SER B . n 
B 1 257 GLU 257 498 498 GLU GLU B . n 
B 1 258 PHE 258 499 499 PHE PHE B . n 
B 1 259 ALA 259 500 500 ALA ALA B . n 
B 1 260 CYS 260 501 501 CYS CYS B . n 
B 1 261 ALA 261 502 502 ALA ALA B . n 
B 1 262 LEU 262 503 503 LEU LEU B . n 
B 1 263 LEU 263 504 504 LEU LEU B . n 
B 1 264 TYR 264 505 505 TYR TYR B . n 
B 1 265 PHE 265 506 506 PHE PHE B . n 
B 1 266 THR 266 507 507 THR THR B . n 
B 1 267 GLY 267 508 508 GLY GLY B . n 
B 1 268 SER 268 509 509 SER SER B . n 
B 1 269 ALA 269 510 510 ALA ALA B . n 
B 1 270 HIS 270 511 511 HIS HIS B . n 
B 1 271 PHE 271 512 512 PHE PHE B . n 
B 1 272 ASN 272 513 513 ASN ASN B . n 
B 1 273 ARG 273 514 514 ARG ARG B . n 
B 1 274 SER 274 515 515 SER SER B . n 
B 1 275 MET 275 516 516 MET MET B . n 
B 1 276 ARG 276 517 517 ARG ARG B . n 
B 1 277 ALA 277 518 518 ALA ALA B . n 
B 1 278 LEU 278 519 519 LEU LEU B . n 
B 1 279 ALA 279 520 520 ALA ALA B . n 
B 1 280 LYS 280 521 521 LYS LYS B . n 
B 1 281 THR 281 522 522 THR THR B . n 
B 1 282 LYS 282 523 523 LYS LYS B . n 
B 1 283 GLY 283 524 524 GLY GLY B . n 
B 1 284 MET 284 525 525 MET MET B . n 
B 1 285 SER 285 526 526 SER SER B . n 
B 1 286 LEU 286 527 527 LEU LEU B . n 
B 1 287 SER 287 528 528 SER SER B . n 
B 1 288 GLU 288 529 529 GLU GLU B . n 
B 1 289 HIS 289 530 530 HIS HIS B . n 
B 1 290 ALA 290 531 531 ALA ALA B . n 
B 1 291 LEU 291 532 532 LEU LEU B . n 
B 1 292 SER 292 533 533 SER SER B . n 
B 1 293 THR 293 534 534 THR THR B . n 
B 1 294 ALA 294 535 535 ALA ALA B . n 
B 1 295 VAL 295 536 536 VAL VAL B . n 
B 1 296 VAL 296 537 537 VAL VAL B . n 
B 1 297 ARG 297 538 538 ARG ARG B . n 
B 1 298 ASN 298 539 539 ASN ASN B . n 
B 1 299 THR 299 540 540 THR THR B . n 
B 1 300 HIS 300 541 541 HIS HIS B . n 
B 1 301 GLY 301 542 542 GLY GLY B . n 
B 1 302 CYS 302 543 543 CYS CYS B . n 
B 1 303 LYS 303 544 544 LYS LYS B . n 
B 1 304 VAL 304 545 545 VAL VAL B . n 
B 1 305 GLY 305 546 546 GLY GLY B . n 
B 1 306 PRO 306 547 547 PRO PRO B . n 
B 1 307 GLY 307 548 548 GLY GLY B . n 
B 1 308 ARG 308 549 549 ARG ARG B . n 
B 1 309 VAL 309 550 550 VAL VAL B . n 
B 1 310 LEU 310 551 551 LEU LEU B . n 
B 1 311 PRO 311 552 552 PRO PRO B . n 
B 1 312 THR 312 553 553 THR THR B . n 
B 1 313 PRO 313 554 554 PRO PRO B . n 
B 1 314 THR 314 555 555 THR THR B . n 
B 1 315 GLU 315 556 556 GLU GLU B . n 
B 1 316 LYS 316 557 557 LYS LYS B . n 
B 1 317 ASP 317 558 558 ASP ASP B . n 
B 1 318 VAL 318 559 559 VAL VAL B . n 
B 1 319 PHE 319 560 560 PHE PHE B . n 
B 1 320 ARG 320 561 561 ARG ARG B . n 
B 1 321 LEU 321 562 562 LEU LEU B . n 
B 1 322 LEU 322 563 563 LEU LEU B . n 
B 1 323 GLY 323 564 564 GLY GLY B . n 
B 1 324 LEU 324 565 565 LEU LEU B . n 
B 1 325 PRO 325 566 566 PRO PRO B . n 
B 1 326 TYR 326 567 567 TYR TYR B . n 
B 1 327 ARG 327 568 568 ARG ARG B . n 
B 1 328 GLU 328 569 569 GLU GLU B . n 
B 1 329 PRO 329 570 570 PRO PRO B . n 
B 1 330 ALA 330 571 571 ALA ALA B . n 
B 1 331 GLU 331 572 572 GLU GLU B . n 
B 1 332 ARG 332 573 573 ARG ARG B . n 
B 1 333 ASP 333 574 574 ASP ASP B . n 
B 1 334 TRP 334 575 575 TRP TRP B . n 
C 2 1   DC  1   1   1   DC  DC  P . n 
C 2 2   DA  2   2   2   DA  DA  P . n 
C 2 3   DG  3   3   3   DG  DG  P . n 
C 2 4   DT  4   4   4   DT  DT  P . n 
C 2 5   DA  5   5   5   DA  DA  P . n 
C 2 6   DC  6   6   6   DC  DC  P . n 
D 3 1   DG  1   6   6   DG  DG  T . n 
D 3 2   DT  2   7   7   DT  DT  T . n 
D 3 3   DA  3   8   8   DA  DA  T . n 
D 3 4   DC  4   9   9   DC  DC  T . n 
D 3 5   DT  5   10  10  DT  DT  T . n 
D 3 6   DG  6   11  11  DG  DG  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 MG  1  601 601 MG  MG  A . 
F 5 SO4 1  601 601 SO4 SO4 B . 
G 4 MG  1  602 602 MG  MG  B . 
H 6 DGT 1  603 603 DGT DGT B . 
I 7 HOH 1  701 1   HOH HOH A . 
I 7 HOH 2  702 2   HOH HOH A . 
I 7 HOH 3  703 4   HOH HOH A . 
I 7 HOH 4  704 3   HOH HOH A . 
I 7 HOH 5  705 5   HOH HOH A . 
I 7 HOH 6  706 6   HOH HOH A . 
I 7 HOH 7  707 8   HOH HOH A . 
I 7 HOH 8  708 7   HOH HOH A . 
I 7 HOH 9  709 9   HOH HOH A . 
I 7 HOH 10 710 10  HOH HOH A . 
J 7 HOH 1  701 11  HOH HOH B . 
J 7 HOH 2  702 12  HOH HOH B . 
J 7 HOH 3  703 15  HOH HOH B . 
J 7 HOH 4  704 13  HOH HOH B . 
J 7 HOH 5  705 14  HOH HOH B . 
J 7 HOH 6  706 16  HOH HOH B . 
J 7 HOH 7  707 17  HOH HOH B . 
J 7 HOH 8  708 18  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric  3 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,I 
2 1 B,F,G,H,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2920  ? 
1 MORE         -21   ? 
1 'SSA (A^2)'  12660 ? 
2 'ABSA (A^2)' 1010  ? 
2 MORE         -21   ? 
2 'SSA (A^2)'  12430 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A SER 98  ? A SER 339 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O   ? A ILE 100 ? A ILE 341 ? 1_555 86.3  ? 
2  O   ? A SER 98  ? A SER 339 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O   ? A ALA 103 ? A ALA 344 ? 1_555 83.6  ? 
3  O   ? A ILE 100 ? A ILE 341 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O   ? A ALA 103 ? A ALA 344 ? 1_555 82.0  ? 
4  O   ? A SER 98  ? A SER 339 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OP1 ? C DT  4   ? P DT  4   ? 1_555 174.0 ? 
5  O   ? A ILE 100 ? A ILE 341 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OP1 ? C DT  4   ? P DT  4   ? 1_555 87.7  ? 
6  O   ? A ALA 103 ? A ALA 344 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OP1 ? C DT  4   ? P DT  4   ? 1_555 94.8  ? 
7  OD1 ? B ASP 186 ? B ASP 427 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 OD1 ? B ASP 188 ? B ASP 429 ? 1_555 98.7  ? 
8  OD1 ? B ASP 186 ? B ASP 427 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 O2G ? H DGT .   ? B DGT 603 ? 1_555 73.9  ? 
9  OD1 ? B ASP 188 ? B ASP 429 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 O2G ? H DGT .   ? B DGT 603 ? 1_555 165.3 ? 
10 OD1 ? B ASP 186 ? B ASP 427 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 O2B ? H DGT .   ? B DGT 603 ? 1_555 143.6 ? 
11 OD1 ? B ASP 188 ? B ASP 429 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 O2B ? H DGT .   ? B DGT 603 ? 1_555 109.4 ? 
12 O2G ? H DGT .   ? B DGT 603 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 O2B ? H DGT .   ? B DGT 603 ? 1_555 73.2  ? 
13 OD1 ? B ASP 186 ? B ASP 427 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 O1A ? H DGT .   ? B DGT 603 ? 1_555 82.0  ? 
14 OD1 ? B ASP 188 ? B ASP 429 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 O1A ? H DGT .   ? B DGT 603 ? 1_555 86.8  ? 
15 O2G ? H DGT .   ? B DGT 603 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 O1A ? H DGT .   ? B DGT 603 ? 1_555 79.6  ? 
16 O2B ? H DGT .   ? B DGT 603 ? 1_555 MG ? G MG . ? B MG 602 ? 1_555 O1A ? H DGT .   ? B DGT 603 ? 1_555 77.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-02-24 
2 'Structure model' 1 1 2016-03-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        5 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .        6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CD1 B LEU 335 ? ? OE1 B GLN 350 ? ? 1.66 
2 1 OG  B SER 417 ? ? O1G B DGT 603 ? ? 2.12 
3 1 O   B ARG 517 ? ? O   B HOH 701 ? ? 2.15 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    CYS 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     415 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -115.92 
_pdbx_validate_torsion.psi             -152.81 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A ALA 242 ? A ALA 1  
2   1 Y 1 A GLN 243 ? A GLN 2  
3   1 Y 1 A PRO 244 ? A PRO 3  
4   1 Y 1 A SER 245 ? A SER 4  
5   1 Y 1 A SER 246 ? A SER 5  
6   1 Y 1 A GLN 247 ? A GLN 6  
7   1 Y 1 A LYS 248 ? A LYS 7  
8   1 Y 1 A ALA 249 ? A ALA 8  
9   1 Y 1 A THR 250 ? A THR 9  
10  1 Y 1 A ASN 251 ? A ASN 10 
11  1 Y 1 A HIS 252 ? A HIS 11 
12  1 Y 1 A ASN 253 ? A ASN 12 
13  1 Y 1 A LEU 254 ? A LEU 13 
14  1 Y 1 A HIS 255 ? A HIS 14 
15  1 Y 1 A ILE 256 ? A ILE 15 
16  1 Y 1 A THR 257 ? A THR 16 
17  1 Y 1 A GLU 258 ? A GLU 17 
18  1 Y 1 A LYS 259 ? A LYS 18 
19  1 Y 1 A LEU 260 ? A LEU 19 
20  1 Y 1 A GLU 261 ? A GLU 20 
21  1 Y 1 A VAL 262 ? A VAL 21 
22  1 Y 1 A LEU 263 ? A LEU 22 
23  1 Y 1 A ALA 264 ? A ALA 23 
24  1 Y 1 A LYS 265 ? A LYS 24 
25  1 Y 1 A ALA 266 ? A ALA 25 
26  1 Y 1 A TYR 267 ? A TYR 26 
27  1 Y 1 A SER 268 ? A SER 27 
28  1 Y 1 A VAL 269 ? A VAL 28 
29  1 Y 1 A GLN 270 ? A GLN 29 
30  1 Y 1 A GLY 271 ? A GLY 30 
31  1 Y 1 A ASP 272 ? A ASP 31 
32  1 Y 1 A LYS 273 ? A LYS 32 
33  1 Y 1 A TRP 274 ? A TRP 33 
34  1 Y 1 A ARG 275 ? A ARG 34 
35  1 Y 1 A ALA 276 ? A ALA 35 
36  1 Y 1 A LEU 277 ? A LEU 36 
37  1 Y 1 A GLY 278 ? A GLY 37 
38  1 Y 1 A TYR 279 ? A TYR 38 
39  1 Y 1 A ALA 280 ? A ALA 39 
40  1 Y 1 A LYS 281 ? A LYS 40 
41  1 Y 1 A ALA 282 ? A ALA 41 
42  1 Y 1 A ILE 283 ? A ILE 42 
43  1 Y 1 A ASN 284 ? A ASN 43 
44  1 Y 1 A ALA 285 ? A ALA 44 
45  1 Y 1 A LEU 286 ? A LEU 45 
46  1 Y 1 A LYS 287 ? A LYS 46 
47  1 Y 1 A SER 288 ? A SER 47 
48  1 Y 1 A PHE 289 ? A PHE 48 
49  1 Y 1 A HIS 290 ? A HIS 49 
50  1 Y 1 A LYS 291 ? A LYS 50 
51  1 Y 1 A PRO 292 ? A PRO 51 
52  1 Y 1 A VAL 293 ? A VAL 52 
53  1 Y 1 A THR 294 ? A THR 53 
54  1 Y 1 A SER 295 ? A SER 54 
55  1 Y 1 A TYR 296 ? A TYR 55 
56  1 Y 1 A GLN 297 ? A GLN 56 
57  1 Y 1 A GLU 298 ? A GLU 57 
58  1 Y 1 A ALA 299 ? A ALA 58 
59  1 Y 1 A CYS 300 ? A CYS 59 
60  1 Y 1 A SER 301 ? A SER 60 
61  1 Y 1 A ILE 302 ? A ILE 61 
62  1 Y 1 A PRO 303 ? A PRO 62 
63  1 Y 1 A GLY 304 ? A GLY 63 
64  1 Y 1 A ILE 305 ? A ILE 64 
65  1 Y 1 A GLY 306 ? A GLY 65 
66  1 Y 1 A LYS 307 ? A LYS 66 
67  1 Y 1 A ARG 308 ? A ARG 67 
68  1 Y 1 A MET 309 ? A MET 68 
69  1 Y 1 A ALA 310 ? A ALA 69 
70  1 Y 1 A GLU 311 ? A GLU 70 
71  1 Y 1 A LYS 312 ? A LYS 71 
72  1 Y 1 A ILE 313 ? A ILE 72 
73  1 Y 1 A ILE 314 ? A ILE 73 
74  1 Y 1 A GLU 315 ? A GLU 74 
75  1 Y 1 A ILE 316 ? A ILE 75 
76  1 Y 1 A LEU 317 ? A LEU 76 
77  1 Y 1 A GLU 318 ? A GLU 77 
78  1 Y 1 A SER 319 ? A SER 78 
79  1 Y 1 A GLY 320 ? A GLY 79 
80  1 Y 1 A HIS 321 ? A HIS 80 
81  1 Y 1 A LEU 322 ? A LEU 81 
82  1 Y 1 A ARG 323 ? A ARG 82 
83  1 Y 1 A LYS 324 ? A LYS 83 
84  1 Y 1 A LEU 325 ? A LEU 84 
85  1 Y 1 A ASP 326 ? A ASP 85 
86  1 Y 1 A HIS 327 ? A HIS 86 
87  1 Y 1 A ILE 328 ? A ILE 87 
88  1 Y 1 A SER 329 ? A SER 88 
89  1 Y 1 B ALA 242 ? B ALA 1  
90  1 Y 1 B GLN 243 ? B GLN 2  
91  1 Y 1 B PRO 244 ? B PRO 3  
92  1 Y 1 B SER 245 ? B SER 4  
93  1 Y 1 B SER 246 ? B SER 5  
94  1 Y 1 B GLN 247 ? B GLN 6  
95  1 Y 1 B LYS 248 ? B LYS 7  
96  1 Y 1 B ALA 249 ? B ALA 8  
97  1 Y 1 B THR 250 ? B THR 9  
98  1 Y 1 B ASN 251 ? B ASN 10 
99  1 Y 1 B HIS 252 ? B HIS 11 
100 1 Y 1 B ASN 253 ? B ASN 12 
101 1 Y 1 B LEU 254 ? B LEU 13 
102 1 Y 1 B HIS 255 ? B HIS 14 
103 1 Y 1 B ILE 256 ? B ILE 15 
104 1 Y 1 B THR 257 ? B THR 16 
105 1 Y 1 B GLU 258 ? B GLU 17 
106 1 Y 1 B LYS 259 ? B LYS 18 
107 1 Y 1 B LEU 260 ? B LEU 19 
108 1 Y 1 B GLU 261 ? B GLU 20 
109 1 Y 1 B VAL 262 ? B VAL 21 
110 1 Y 1 B LEU 263 ? B LEU 22 
111 1 Y 1 B ALA 264 ? B ALA 23 
112 1 Y 1 B LYS 265 ? B LYS 24 
113 1 Y 1 B ALA 266 ? B ALA 25 
114 1 Y 1 B TYR 267 ? B TYR 26 
115 1 Y 1 B SER 268 ? B SER 27 
116 1 Y 1 B VAL 269 ? B VAL 28 
117 1 Y 1 B GLN 270 ? B GLN 29 
118 1 Y 1 B GLY 271 ? B GLY 30 
119 1 Y 1 B ASP 272 ? B ASP 31 
120 1 Y 1 B LYS 273 ? B LYS 32 
121 1 Y 1 B TRP 274 ? B TRP 33 
122 1 Y 1 B ARG 275 ? B ARG 34 
123 1 Y 1 B ALA 276 ? B ALA 35 
124 1 Y 1 B LEU 277 ? B LEU 36 
125 1 Y 1 B GLY 278 ? B GLY 37 
126 1 Y 1 B TYR 279 ? B TYR 38 
127 1 Y 1 B ALA 280 ? B ALA 39 
128 1 Y 1 B LYS 281 ? B LYS 40 
129 1 Y 1 B ALA 282 ? B ALA 41 
130 1 Y 1 B ILE 283 ? B ILE 42 
131 1 Y 1 B ASN 284 ? B ASN 43 
132 1 Y 1 B ALA 285 ? B ALA 44 
133 1 Y 1 B LEU 286 ? B LEU 45 
134 1 Y 1 B LYS 287 ? B LYS 46 
135 1 Y 1 B SER 288 ? B SER 47 
136 1 Y 1 B PHE 289 ? B PHE 48 
137 1 Y 1 B HIS 290 ? B HIS 49 
138 1 Y 1 B LYS 291 ? B LYS 50 
139 1 Y 1 B PRO 292 ? B PRO 51 
140 1 Y 1 B VAL 293 ? B VAL 52 
141 1 Y 1 B THR 294 ? B THR 53 
142 1 Y 1 B SER 295 ? B SER 54 
143 1 Y 1 B TYR 296 ? B TYR 55 
144 1 Y 1 B GLN 297 ? B GLN 56 
145 1 Y 1 B GLU 298 ? B GLU 57 
146 1 Y 1 B ALA 299 ? B ALA 58 
147 1 Y 1 B CYS 300 ? B CYS 59 
148 1 Y 1 B SER 301 ? B SER 60 
149 1 Y 1 B ILE 302 ? B ILE 61 
150 1 Y 1 B PRO 303 ? B PRO 62 
151 1 Y 1 B GLY 304 ? B GLY 63 
152 1 Y 1 B ILE 305 ? B ILE 64 
153 1 Y 1 B GLY 306 ? B GLY 65 
154 1 Y 1 B LYS 307 ? B LYS 66 
155 1 Y 1 B ARG 308 ? B ARG 67 
156 1 Y 1 B MET 309 ? B MET 68 
157 1 Y 1 B ALA 310 ? B ALA 69 
158 1 Y 1 B GLU 311 ? B GLU 70 
159 1 Y 1 B LYS 312 ? B LYS 71 
160 1 Y 1 B ILE 313 ? B ILE 72 
161 1 Y 1 B ILE 314 ? B ILE 73 
162 1 Y 1 B GLU 315 ? B GLU 74 
163 1 Y 1 B ILE 316 ? B ILE 75 
164 1 Y 1 B LEU 317 ? B LEU 76 
165 1 Y 1 B GLU 318 ? B GLU 77 
166 1 Y 1 B SER 319 ? B SER 78 
167 1 Y 1 B GLY 320 ? B GLY 79 
168 1 Y 1 B HIS 321 ? B HIS 80 
169 1 Y 1 B LEU 322 ? B LEU 81 
170 1 Y 1 B ARG 323 ? B ARG 82 
171 1 Y 1 B LYS 324 ? B LYS 83 
172 1 Y 1 B LEU 325 ? B LEU 84 
173 1 Y 1 B ASP 326 ? B ASP 85 
174 1 Y 1 B HIS 327 ? B HIS 86 
175 1 Y 1 B ILE 328 ? B ILE 87 
176 1 Y 1 B SER 329 ? B SER 88 
177 1 Y 1 B GLU 330 ? B GLU 89 
178 1 Y 1 B SER 331 ? B SER 90 
179 1 Y 1 B VAL 332 ? B VAL 91 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5CHG 'double helix'        
5CHG 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DC 1 1_555 D DG 6 1_555 0.112  -0.223 -0.096 4.406   -15.992 0.159  1 P_DC1:DG11_T P 1 ? T 11 ? 19 1 
1 C DA 2 1_555 D DT 5 1_555 0.154  -0.139 0.015  -11.188 -10.541 -2.264 2 P_DA2:DT10_T P 2 ? T 10 ? 20 1 
1 C DG 3 1_555 D DC 4 1_555 -0.406 -0.272 0.211  4.684   -9.391  3.753  3 P_DG3:DC9_T  P 3 ? T 9  ? 19 1 
1 C DT 4 1_555 D DA 3 1_555 -0.315 -0.344 -0.172 -0.363  -2.807  4.499  4 P_DT4:DA8_T  P 4 ? T 8  ? 20 1 
1 C DA 5 1_555 D DT 2 1_555 -0.002 -0.163 0.207  -1.721  -1.929  4.386  5 P_DA5:DT7_T  P 5 ? T 7  ? 20 1 
1 C DC 6 1_555 D DG 1 1_555 0.481  -0.402 0.147  3.915   17.431  2.922  6 P_DC6:DG6_T  P 6 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DC 1 1_555 D DG 6 1_555 C DA 2 1_555 D DT 5 1_555 0.429  -0.465 3.760 3.122  0.664  40.357 -0.757 -0.217 3.774 0.961  -4.517 
40.477 1 PP_DC1DA2:DT10DG11_TT P 1 ? T 11 ? P 2 ? T 10 ? 
1 C DA 2 1_555 D DT 5 1_555 C DG 3 1_555 D DC 4 1_555 0.683  -0.427 3.006 -3.152 2.695  27.748 -1.454 -2.079 2.858 5.580  6.527  
28.050 2 PP_DA2DG3:DC9DT10_TT  P 2 ? T 10 ? P 3 ? T 9  ? 
1 C DG 3 1_555 D DC 4 1_555 C DT 4 1_555 D DA 3 1_555 0.965  -0.696 3.389 4.244  -1.180 33.815 -0.989 -0.933 3.502 -2.017 -7.258 
34.092 3 PP_DG3DT4:DA8DC9_TT   P 3 ? T 9  ? P 4 ? T 8  ? 
1 C DT 4 1_555 D DA 3 1_555 C DA 5 1_555 D DT 2 1_555 -0.747 -0.704 3.372 -2.175 15.112 30.340 -3.626 0.933  2.768 26.845 3.863  
33.885 4 PP_DT4DA5:DT7DA8_TT   P 4 ? T 8  ? P 5 ? T 7  ? 
1 C DA 5 1_555 D DT 2 1_555 C DC 6 1_555 D DG 1 1_555 0.090  -0.521 3.367 0.881  12.315 26.062 -3.798 0.015  2.837 25.561 -1.830 
28.793 5 PP_DA5DC6:DG6DT7_TT   P 5 ? T 7  ? P 6 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 'SULFATE ION'                       SO4 
6 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
7 water                               HOH 
#