data_5CIV
# 
_entry.id   5CIV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5CIV         
WWPDB D_1000211713 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5CIV 
_pdbx_database_status.recvd_initial_deposition_date   2015-07-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Taylor, J.D.'   1 
'Matthews, S.J.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_id_ASTM           JMOBAK 
_citation.journal_id_CSD            0070 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            428 
_citation.language                  ? 
_citation.page_first                554 
_citation.page_last                 560 
_citation.title                     
'Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2016.01.013 
_citation.pdbx_database_id_PubMed   26804569 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Taylor, J.D.'   1 
primary 'Taylor, G.'     2 
primary 'Hare, S.A.'     3 
primary 'Matthews, S.J.' 4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5CIV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     47.590 
_cell.length_a_esd                 ? 
_cell.length_b                     47.680 
_cell.length_b_esd                 ? 
_cell.length_c                     72.300 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5CIV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Sibling bacteriocin' 21868.219 1   ? ? 'residues 13-184' ? 
2 water   nat water                 18.015    238 ? ? ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MRGSHHHHHHGSASYEYTSKEELKKTIHAAYLLLDGEFEGIDDSQKDNRVPEVDRTPAEIIAYQLGWLHLV(MSE)GWDR
DELAGKPVI(MSE)PAPGYKWNQLGGLYQSFYAAYADLSLTELRRLFRDTERQWLDWIDTLSEEDLFTQSVRKWTGDKPN
WP(MSE)ARWIHINSAAPFKTFRAKIRKWKKHQRQA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRGSHHHHHHGSASYEYTSKEELKKTIHAAYLLLDGEFEGIDDSQKDNRVPEVDRTPAEIIAYQLGWLHLVMGWDRDELA
GKPVIMPAPGYKWNQLGGLYQSFYAAYADLSLTELRRLFRDTERQWLDWIDTLSEEDLFTQSVRKWTGDKPNWPMARWIH
INSAAPFKTFRAKIRKWKKHQRQA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  GLY n 
1 12  SER n 
1 13  ALA n 
1 14  SER n 
1 15  TYR n 
1 16  GLU n 
1 17  TYR n 
1 18  THR n 
1 19  SER n 
1 20  LYS n 
1 21  GLU n 
1 22  GLU n 
1 23  LEU n 
1 24  LYS n 
1 25  LYS n 
1 26  THR n 
1 27  ILE n 
1 28  HIS n 
1 29  ALA n 
1 30  ALA n 
1 31  TYR n 
1 32  LEU n 
1 33  LEU n 
1 34  LEU n 
1 35  ASP n 
1 36  GLY n 
1 37  GLU n 
1 38  PHE n 
1 39  GLU n 
1 40  GLY n 
1 41  ILE n 
1 42  ASP n 
1 43  ASP n 
1 44  SER n 
1 45  GLN n 
1 46  LYS n 
1 47  ASP n 
1 48  ASN n 
1 49  ARG n 
1 50  VAL n 
1 51  PRO n 
1 52  GLU n 
1 53  VAL n 
1 54  ASP n 
1 55  ARG n 
1 56  THR n 
1 57  PRO n 
1 58  ALA n 
1 59  GLU n 
1 60  ILE n 
1 61  ILE n 
1 62  ALA n 
1 63  TYR n 
1 64  GLN n 
1 65  LEU n 
1 66  GLY n 
1 67  TRP n 
1 68  LEU n 
1 69  HIS n 
1 70  LEU n 
1 71  VAL n 
1 72  MSE n 
1 73  GLY n 
1 74  TRP n 
1 75  ASP n 
1 76  ARG n 
1 77  ASP n 
1 78  GLU n 
1 79  LEU n 
1 80  ALA n 
1 81  GLY n 
1 82  LYS n 
1 83  PRO n 
1 84  VAL n 
1 85  ILE n 
1 86  MSE n 
1 87  PRO n 
1 88  ALA n 
1 89  PRO n 
1 90  GLY n 
1 91  TYR n 
1 92  LYS n 
1 93  TRP n 
1 94  ASN n 
1 95  GLN n 
1 96  LEU n 
1 97  GLY n 
1 98  GLY n 
1 99  LEU n 
1 100 TYR n 
1 101 GLN n 
1 102 SER n 
1 103 PHE n 
1 104 TYR n 
1 105 ALA n 
1 106 ALA n 
1 107 TYR n 
1 108 ALA n 
1 109 ASP n 
1 110 LEU n 
1 111 SER n 
1 112 LEU n 
1 113 THR n 
1 114 GLU n 
1 115 LEU n 
1 116 ARG n 
1 117 ARG n 
1 118 LEU n 
1 119 PHE n 
1 120 ARG n 
1 121 ASP n 
1 122 THR n 
1 123 GLU n 
1 124 ARG n 
1 125 GLN n 
1 126 TRP n 
1 127 LEU n 
1 128 ASP n 
1 129 TRP n 
1 130 ILE n 
1 131 ASP n 
1 132 THR n 
1 133 LEU n 
1 134 SER n 
1 135 GLU n 
1 136 GLU n 
1 137 ASP n 
1 138 LEU n 
1 139 PHE n 
1 140 THR n 
1 141 GLN n 
1 142 SER n 
1 143 VAL n 
1 144 ARG n 
1 145 LYS n 
1 146 TRP n 
1 147 THR n 
1 148 GLY n 
1 149 ASP n 
1 150 LYS n 
1 151 PRO n 
1 152 ASN n 
1 153 TRP n 
1 154 PRO n 
1 155 MSE n 
1 156 ALA n 
1 157 ARG n 
1 158 TRP n 
1 159 ILE n 
1 160 HIS n 
1 161 ILE n 
1 162 ASN n 
1 163 SER n 
1 164 ALA n 
1 165 ALA n 
1 166 PRO n 
1 167 PHE n 
1 168 LYS n 
1 169 THR n 
1 170 PHE n 
1 171 ARG n 
1 172 ALA n 
1 173 LYS n 
1 174 ILE n 
1 175 ARG n 
1 176 LYS n 
1 177 TRP n 
1 178 LYS n 
1 179 LYS n 
1 180 HIS n 
1 181 GLN n 
1 182 ARG n 
1 183 GLN n 
1 184 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   184 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 dfsB 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Paenibacillus dendritiformis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     130049 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pQE-30 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    D0EVD3_9BACL 
_struct_ref.pdbx_db_accession          D0EVD3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ASYEYTSKEELKKTIHAAYLLLDGEFEGIDDSQKDNRVPEVDRTPAEIIAYQLGWLHLVMGWDRDELAGKPVIMPAPGYK
WNQLGGLYQSFYAAYADLSLTELRRLFRDTERQWLDWIDTLSEEDLFTQSVRKWTGDKPNWPMARWIHINSAAPFKTFRA
KIRKWKKHQRQA
;
_struct_ref.pdbx_align_begin           2 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5CIV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 13 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 184 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             D0EVD3 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  173 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       13 
_struct_ref_seq.pdbx_auth_seq_align_end       184 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5CIV MET A 1  ? UNP D0EVD3 ? ? 'initiating methionine' 1  1  
1 5CIV ARG A 2  ? UNP D0EVD3 ? ? 'expression tag'        2  2  
1 5CIV GLY A 3  ? UNP D0EVD3 ? ? 'expression tag'        3  3  
1 5CIV SER A 4  ? UNP D0EVD3 ? ? 'expression tag'        4  4  
1 5CIV HIS A 5  ? UNP D0EVD3 ? ? 'expression tag'        5  5  
1 5CIV HIS A 6  ? UNP D0EVD3 ? ? 'expression tag'        6  6  
1 5CIV HIS A 7  ? UNP D0EVD3 ? ? 'expression tag'        7  7  
1 5CIV HIS A 8  ? UNP D0EVD3 ? ? 'expression tag'        8  8  
1 5CIV HIS A 9  ? UNP D0EVD3 ? ? 'expression tag'        9  9  
1 5CIV HIS A 10 ? UNP D0EVD3 ? ? 'expression tag'        10 10 
1 5CIV GLY A 11 ? UNP D0EVD3 ? ? 'expression tag'        11 11 
1 5CIV SER A 12 ? UNP D0EVD3 ? ? 'expression tag'        12 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5CIV 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.98 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         38 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;12% PEG 550 MME, 6% PEG 20,000, 0.1 M Sodium formate; 0.1 M Ammonium acetate; 0.1 M Sodium citrate tribasic dihydrate; 0.1 M Sodium potassium tartrate tetrahydrate; 0.1 M Sodium oxamate, 0.1 M Tris, 0.1 M Bicine
;
_exptl_crystal_grow.pdbx_pH_range   8.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-05-31 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    0.97880 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9788 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9788 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5CIV 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.38 
_reflns.d_resolution_low                 21.51 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       32427 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.72 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.1 
_reflns.pdbx_Rmerge_I_obs                0.025 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.38 
_reflns_shell.d_res_low                   1.42 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        74.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5CIV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.384 
_refine.ls_d_res_low                             21.509 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     32427 
_refine.ls_number_reflns_R_free                  1967 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.72 
_refine.ls_percent_reflns_R_free                 6.07 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1824 
_refine.ls_R_factor_R_free                       0.1988 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1814 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 19.74 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.13 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1416 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             238 
_refine_hist.number_atoms_total               1654 
_refine_hist.d_res_high                       1.384 
_refine_hist.d_res_low                        21.509 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 1458 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.022  ? 1977 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.958 ? 540  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 200  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 252  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.3843 1.4189  . . 96  1523 67.00  . . . 0.2757 . 0.2774 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4189 1.4572  . . 122 1824 81.00  . . . 0.2584 . 0.2618 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4572 1.5001  . . 136 2168 95.00  . . . 0.2324 . 0.2151 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5001 1.5485  . . 140 2179 96.00  . . . 0.2158 . 0.2043 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5485 1.6038  . . 145 2198 97.00  . . . 0.2226 . 0.1931 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6038 1.6680  . . 143 2203 98.00  . . . 0.2146 . 0.1890 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6680 1.7439  . . 143 2226 98.00  . . . 0.2049 . 0.1878 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7439 1.8358  . . 143 2258 98.00  . . . 0.2375 . 0.1933 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8358 1.9508  . . 144 2241 99.00  . . . 0.2093 . 0.1842 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9508 2.1013  . . 145 2269 99.00  . . . 0.1859 . 0.1774 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1013 2.3125  . . 150 2270 99.00  . . . 0.1957 . 0.1676 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3125 2.6466  . . 150 2324 100.00 . . . 0.2336 . 0.1780 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6466 3.3324  . . 151 2338 100.00 . . . 0.1689 . 0.1815 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3324 21.5112 . . 159 2439 99.00  . . . 0.1746 . 0.1635 . . . . . . . . . . 
# 
_struct.entry_id                     5CIV 
_struct.title                        'Sibling Lethal Factor Precursor - DfsB' 
_struct.pdbx_descriptor              'Sibling bacteriocin' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5CIV 
_struct_keywords.text            'Bacteriocin, sporulation, DUF1706, cell cycle, unknown function' 
_struct_keywords.pdbx_keywords   'UNKNOWN FUNCTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 19  ? GLU A 37  ? SER A 19  GLU A 37  1 ? 19 
HELX_P HELX_P2 AA2 ASP A 42  ? LYS A 46  ? ASP A 42  LYS A 46  5 ? 5  
HELX_P HELX_P3 AA3 THR A 56  ? GLY A 81  ? THR A 56  GLY A 81  1 ? 26 
HELX_P HELX_P4 AA4 LYS A 92  ? ASN A 94  ? LYS A 92  ASN A 94  5 ? 3  
HELX_P HELX_P5 AA5 GLN A 95  ? ALA A 108 ? GLN A 95  ALA A 108 1 ? 14 
HELX_P HELX_P6 AA6 SER A 111 ? THR A 132 ? SER A 111 THR A 132 1 ? 22 
HELX_P HELX_P7 AA7 SER A 134 ? THR A 140 ? SER A 134 THR A 140 1 ? 7  
HELX_P HELX_P8 AA8 PRO A 154 ? ILE A 161 ? PRO A 154 ILE A 161 1 ? 8  
HELX_P HELX_P9 AA9 SER A 163 ? HIS A 180 ? SER A 163 HIS A 180 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A VAL 71  C ? ? ? 1_555 A MSE 72  N ? ? A VAL 71  A MSE 72  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2 covale both ? A MSE 72  C ? ? ? 1_555 A GLY 73  N ? ? A MSE 72  A GLY 73  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale3 covale both ? A ILE 85  C ? ? ? 1_555 A MSE 86  N ? ? A ILE 85  A MSE 86  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale4 covale both ? A MSE 86  C ? ? ? 1_555 A PRO 87  N ? ? A MSE 86  A PRO 87  1_555 ? ? ? ? ? ? ? 1.342 ? 
covale5 covale both ? A PRO 154 C ? ? ? 1_555 A MSE 155 N ? ? A PRO 154 A MSE 155 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6 covale both ? A MSE 155 C ? ? ? 1_555 A ALA 156 N ? ? A MSE 155 A ALA 156 1_555 ? ? ? ? ? ? ? 1.330 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          MSE 
_struct_mon_prot_cis.label_seq_id           86 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           MSE 
_struct_mon_prot_cis.auth_seq_id            86 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    87 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     87 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.06 
# 
_atom_sites.entry_id                    5CIV 
_atom_sites.fract_transf_matrix[1][1]   0.021013 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020973 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013831 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 16  ? 44.161 29.280 33.560 1.00 46.67 ? 16  GLU A N   1 
ATOM   2    C  CA  . GLU A 1 16  ? 44.216 30.622 34.132 1.00 40.93 ? 16  GLU A CA  1 
ATOM   3    C  C   . GLU A 1 16  ? 43.142 31.525 33.537 1.00 37.33 ? 16  GLU A C   1 
ATOM   4    O  O   . GLU A 1 16  ? 42.614 31.254 32.456 1.00 39.72 ? 16  GLU A O   1 
ATOM   5    C  CB  . GLU A 1 16  ? 45.598 31.247 33.915 1.00 39.92 ? 16  GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 16  ? 46.721 30.562 34.676 1.00 47.83 ? 16  GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 16  ? 48.073 31.203 34.425 1.00 51.92 ? 16  GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 16  ? 48.497 31.254 33.250 1.00 51.48 ? 16  GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 16  ? 48.713 31.651 35.400 1.00 51.50 ? 16  GLU A OE2 1 
ATOM   10   N  N   . TYR A 1 17  ? 42.822 32.600 34.250 1.00 31.87 ? 17  TYR A N   1 
ATOM   11   C  CA  . TYR A 1 17  ? 41.830 33.559 33.784 1.00 26.78 ? 17  TYR A CA  1 
ATOM   12   C  C   . TYR A 1 17  ? 42.441 34.942 33.640 1.00 27.03 ? 17  TYR A C   1 
ATOM   13   O  O   . TYR A 1 17  ? 43.359 35.308 34.367 1.00 22.69 ? 17  TYR A O   1 
ATOM   14   C  CB  . TYR A 1 17  ? 40.637 33.603 34.736 1.00 20.69 ? 17  TYR A CB  1 
ATOM   15   C  CG  . TYR A 1 17  ? 39.884 32.295 34.780 1.00 20.20 ? 17  TYR A CG  1 
ATOM   16   C  CD1 . TYR A 1 17  ? 38.799 32.070 33.944 1.00 17.93 ? 17  TYR A CD1 1 
ATOM   17   C  CD2 . TYR A 1 17  ? 40.273 31.277 35.640 1.00 22.50 ? 17  TYR A CD2 1 
ATOM   18   C  CE1 . TYR A 1 17  ? 38.111 30.871 33.974 1.00 17.02 ? 17  TYR A CE1 1 
ATOM   19   C  CE2 . TYR A 1 17  ? 39.592 30.074 35.676 1.00 21.19 ? 17  TYR A CE2 1 
ATOM   20   C  CZ  . TYR A 1 17  ? 38.507 29.879 34.844 1.00 17.97 ? 17  TYR A CZ  1 
ATOM   21   O  OH  . TYR A 1 17  ? 37.825 28.682 34.871 1.00 19.35 ? 17  TYR A OH  1 
ATOM   22   N  N   . THR A 1 18  ? 41.920 35.709 32.696 1.00 24.08 ? 18  THR A N   1 
ATOM   23   C  CA  . THR A 1 18  ? 42.461 37.029 32.421 1.00 29.57 ? 18  THR A CA  1 
ATOM   24   C  C   . THR A 1 18  ? 41.906 38.073 33.381 1.00 29.70 ? 18  THR A C   1 
ATOM   25   O  O   . THR A 1 18  ? 42.502 39.131 33.567 1.00 27.10 ? 18  THR A O   1 
ATOM   26   C  CB  . THR A 1 18  ? 42.159 37.459 30.970 1.00 32.73 ? 18  THR A CB  1 
ATOM   27   O  OG1 . THR A 1 18  ? 42.857 38.674 30.668 1.00 36.83 ? 18  THR A OG1 1 
ATOM   28   C  CG2 . THR A 1 18  ? 40.662 37.662 30.777 1.00 25.82 ? 18  THR A CG2 1 
ATOM   29   N  N   . SER A 1 19  ? 40.772 37.773 34.005 1.00 18.38 ? 19  SER A N   1 
ATOM   30   C  CA  . SER A 1 19  ? 40.070 38.781 34.780 1.00 15.25 ? 19  SER A CA  1 
ATOM   31   C  C   . SER A 1 19  ? 38.984 38.151 35.625 1.00 15.06 ? 19  SER A C   1 
ATOM   32   O  O   . SER A 1 19  ? 38.550 37.027 35.356 1.00 15.98 ? 19  SER A O   1 
ATOM   33   C  CB  . SER A 1 19  ? 39.446 39.825 33.856 1.00 22.04 ? 19  SER A CB  1 
ATOM   34   O  OG  . SER A 1 19  ? 38.453 39.224 33.037 1.00 21.70 ? 19  SER A OG  1 
ATOM   35   N  N   . LYS A 1 20  ? 38.535 38.890 36.631 1.00 13.71 ? 20  LYS A N   1 
ATOM   36   C  CA  . LYS A 1 20  ? 37.363 38.505 37.395 1.00 17.08 ? 20  LYS A CA  1 
ATOM   37   C  C   . LYS A 1 20  ? 36.165 38.339 36.461 1.00 17.82 ? 20  LYS A C   1 
ATOM   38   O  O   . LYS A 1 20  ? 35.347 37.438 36.644 1.00 15.45 ? 20  LYS A O   1 
ATOM   39   C  CB  . LYS A 1 20  ? 37.065 39.543 38.477 1.00 16.70 ? 20  LYS A CB  1 
ATOM   40   C  CG  . LYS A 1 20  ? 35.823 39.237 39.276 1.00 20.56 ? 20  LYS A CG  1 
ATOM   41   C  CD  . LYS A 1 20  ? 35.768 40.034 40.569 1.00 21.61 ? 20  LYS A CD  1 
ATOM   42   C  CE  . LYS A 1 20  ? 35.741 41.529 40.312 1.00 23.86 ? 20  LYS A CE  1 
ATOM   43   N  NZ  . LYS A 1 20  ? 35.367 42.279 41.549 1.00 17.35 ? 20  LYS A NZ  1 
ATOM   44   N  N   . GLU A 1 21  ? 36.072 39.194 35.446 1.00 17.62 ? 21  GLU A N   1 
ATOM   45   C  CA  . GLU A 1 21  ? 34.965 39.131 34.498 1.00 18.48 ? 21  GLU A CA  1 
ATOM   46   C  C   . GLU A 1 21  ? 34.907 37.787 33.766 1.00 16.30 ? 21  GLU A C   1 
ATOM   47   O  O   . GLU A 1 21  ? 33.836 37.172 33.668 1.00 15.81 ? 21  GLU A O   1 
ATOM   48   C  CB  . GLU A 1 21  ? 35.073 40.276 33.487 1.00 20.39 ? 21  GLU A CB  1 
ATOM   49   C  CG  . GLU A 1 21  ? 34.177 40.122 32.263 1.00 28.01 ? 21  GLU A CG  1 
ATOM   50   C  CD  . GLU A 1 21  ? 34.347 41.261 31.270 1.00 35.41 ? 21  GLU A CD  1 
ATOM   51   O  OE1 . GLU A 1 21  ? 34.473 42.426 31.704 1.00 35.61 ? 21  GLU A OE1 1 
ATOM   52   O  OE2 . GLU A 1 21  ? 34.369 40.988 30.053 1.00 38.63 ? 21  GLU A OE2 1 
ATOM   53   N  N   . GLU A 1 22  ? 36.046 37.332 33.257 1.00 15.13 ? 22  GLU A N   1 
ATOM   54   C  CA  . GLU A 1 22  ? 36.114 36.070 32.537 1.00 14.56 ? 22  GLU A CA  1 
ATOM   55   C  C   . GLU A 1 22  ? 35.855 34.895 33.470 1.00 14.63 ? 22  GLU A C   1 
ATOM   56   O  O   . GLU A 1 22  ? 35.223 33.906 33.075 1.00 13.88 ? 22  GLU A O   1 
ATOM   57   C  CB  . GLU A 1 22  ? 37.474 35.898 31.852 1.00 17.80 ? 22  GLU A CB  1 
ATOM   58   C  CG  . GLU A 1 22  ? 37.581 34.607 31.051 1.00 24.49 ? 22  GLU A CG  1 
ATOM   59   C  CD  . GLU A 1 22  ? 38.926 34.431 30.370 1.00 44.82 ? 22  GLU A CD  1 
ATOM   60   O  OE1 . GLU A 1 22  ? 39.955 34.395 31.078 1.00 39.79 ? 22  GLU A OE1 1 
ATOM   61   O  OE2 . GLU A 1 22  ? 38.950 34.325 29.124 1.00 51.82 ? 22  GLU A OE2 1 
ATOM   62   N  N   . LEU A 1 23  ? 36.357 34.994 34.699 1.00 11.98 ? 23  LEU A N   1 
ATOM   63   C  CA  . LEU A 1 23  ? 36.150 33.950 35.692 1.00 12.49 ? 23  LEU A CA  1 
ATOM   64   C  C   . LEU A 1 23  ? 34.655 33.773 35.964 1.00 11.83 ? 23  LEU A C   1 
ATOM   65   O  O   . LEU A 1 23  ? 34.133 32.651 35.875 1.00 10.41 ? 23  LEU A O   1 
ATOM   66   C  CB  . LEU A 1 23  ? 36.904 34.274 36.988 1.00 12.14 ? 23  LEU A CB  1 
ATOM   67   C  CG  . LEU A 1 23  ? 36.745 33.250 38.114 1.00 11.41 ? 23  LEU A CG  1 
ATOM   68   C  CD1 . LEU A 1 23  ? 37.222 31.878 37.699 1.00 14.79 ? 23  LEU A CD1 1 
ATOM   69   C  CD2 . LEU A 1 23  ? 37.501 33.732 39.360 1.00 15.44 ? 23  LEU A CD2 1 
ATOM   70   N  N   . LYS A 1 24  ? 33.957 34.864 36.262 1.00 11.07 ? 24  LYS A N   1 
ATOM   71   C  CA  . LYS A 1 24  ? 32.518 34.785 36.498 1.00 11.25 ? 24  LYS A CA  1 
ATOM   72   C  C   . LYS A 1 24  ? 31.769 34.257 35.276 1.00 11.42 ? 24  LYS A C   1 
ATOM   73   O  O   . LYS A 1 24  ? 30.856 33.451 35.417 1.00 12.12 ? 24  LYS A O   1 
ATOM   74   C  CB  . LYS A 1 24  ? 31.956 36.148 36.897 1.00 12.83 ? 24  LYS A CB  1 
ATOM   75   C  CG  . LYS A 1 24  ? 32.406 36.628 38.271 1.00 15.51 ? 24  LYS A CG  1 
ATOM   76   C  CD  . LYS A 1 24  ? 31.804 37.993 38.584 1.00 20.37 ? 24  LYS A CD  1 
ATOM   77   C  CE  . LYS A 1 24  ? 30.289 37.905 38.680 1.00 30.51 ? 24  LYS A CE  1 
ATOM   78   N  NZ  . LYS A 1 24  ? 29.635 39.237 38.559 1.00 43.69 ? 24  LYS A NZ  1 
ATOM   79   N  N   . LYS A 1 25  ? 32.146 34.708 34.082 1.00 11.92 ? 25  LYS A N   1 
ATOM   80   C  CA  . LYS A 1 25  ? 31.457 34.305 32.855 1.00 12.42 ? 25  LYS A CA  1 
ATOM   81   C  C   . LYS A 1 25  ? 31.564 32.805 32.643 1.00 11.06 ? 25  LYS A C   1 
ATOM   82   O  O   . LYS A 1 25  ? 30.571 32.126 32.327 1.00 11.27 ? 25  LYS A O   1 
ATOM   83   C  CB  . LYS A 1 25  ? 32.042 35.044 31.646 1.00 14.08 ? 25  LYS A CB  1 
ATOM   84   C  CG  . LYS A 1 25  ? 31.494 34.588 30.301 1.00 16.60 ? 25  LYS A CG  1 
ATOM   85   C  CD  . LYS A 1 25  ? 32.249 35.248 29.141 1.00 20.80 ? 25  LYS A CD  1 
ATOM   86   C  CE  . LYS A 1 25  ? 31.815 34.661 27.803 1.00 24.76 ? 25  LYS A CE  1 
ATOM   87   N  NZ  . LYS A 1 25  ? 32.645 35.161 26.663 1.00 29.44 ? 25  LYS A NZ  1 
ATOM   88   N  N   . THR A 1 26  ? 32.775 32.291 32.821 1.00 11.79 ? 26  THR A N   1 
ATOM   89   C  CA  . THR A 1 26  ? 33.064 30.889 32.601 1.00 11.21 ? 26  THR A CA  1 
ATOM   90   C  C   . THR A 1 26  ? 32.320 30.028 33.615 1.00 10.54 ? 26  THR A C   1 
ATOM   91   O  O   . THR A 1 26  ? 31.727 29.020 33.251 1.00 9.97  ? 26  THR A O   1 
ATOM   92   C  CB  . THR A 1 26  ? 34.572 30.618 32.681 1.00 13.12 ? 26  THR A CB  1 
ATOM   93   O  OG1 . THR A 1 26  ? 35.237 31.411 31.686 1.00 16.73 ? 26  THR A OG1 1 
ATOM   94   C  CG2 . THR A 1 26  ? 34.867 29.159 32.413 1.00 15.36 ? 26  THR A CG2 1 
ATOM   95   N  N   . ILE A 1 27  ? 32.337 30.446 34.878 1.00 9.85  ? 27  ILE A N   1 
ATOM   96   C  CA  . ILE A 1 27  ? 31.633 29.717 35.928 1.00 8.79  ? 27  ILE A CA  1 
ATOM   97   C  C   . ILE A 1 27  ? 30.140 29.665 35.641 1.00 8.58  ? 27  ILE A C   1 
ATOM   98   O  O   . ILE A 1 27  ? 29.526 28.598 35.708 1.00 9.47  ? 27  ILE A O   1 
ATOM   99   C  CB  . ILE A 1 27  ? 31.846 30.361 37.313 1.00 6.99  ? 27  ILE A CB  1 
ATOM   100  C  CG1 . ILE A 1 27  ? 33.297 30.212 37.776 1.00 9.59  ? 27  ILE A CG1 1 
ATOM   101  C  CG2 . ILE A 1 27  ? 30.918 29.727 38.347 1.00 10.10 ? 27  ILE A CG2 1 
ATOM   102  C  CD1 . ILE A 1 27  ? 33.649 31.157 38.921 1.00 9.01  ? 27  ILE A CD1 1 
ATOM   103  N  N   . HIS A 1 28  ? 29.544 30.808 35.336 1.00 8.54  ? 28  HIS A N   1 
ATOM   104  C  CA  . HIS A 1 28  ? 28.100 30.836 35.188 1.00 8.54  ? 28  HIS A CA  1 
ATOM   105  C  C   . HIS A 1 28  ? 27.654 30.061 33.954 1.00 9.69  ? 28  HIS A C   1 
ATOM   106  O  O   . HIS A 1 28  ? 26.634 29.378 33.993 1.00 9.02  ? 28  HIS A O   1 
ATOM   107  C  CB  . HIS A 1 28  ? 27.563 32.259 35.129 1.00 9.51  ? 28  HIS A CB  1 
ATOM   108  C  CG  . HIS A 1 28  ? 26.105 32.346 35.448 1.00 10.71 ? 28  HIS A CG  1 
ATOM   109  N  ND1 . HIS A 1 28  ? 25.566 31.772 36.585 1.00 13.39 ? 28  HIS A ND1 1 
ATOM   110  C  CD2 . HIS A 1 28  ? 25.064 32.899 34.785 1.00 15.94 ? 28  HIS A CD2 1 
ATOM   111  C  CE1 . HIS A 1 28  ? 24.266 31.984 36.610 1.00 16.01 ? 28  HIS A CE1 1 
ATOM   112  N  NE2 . HIS A 1 28  ? 23.932 32.667 35.525 1.00 16.58 ? 28  HIS A NE2 1 
ATOM   113  N  N   . ALA A 1 29  ? 28.400 30.162 32.861 1.00 9.16  ? 29  ALA A N   1 
ATOM   114  C  CA  . ALA A 1 29  ? 28.055 29.386 31.670 1.00 9.85  ? 29  ALA A CA  1 
ATOM   115  C  C   . ALA A 1 29  ? 28.058 27.889 31.959 1.00 10.24 ? 29  ALA A C   1 
ATOM   116  O  O   . ALA A 1 29  ? 27.148 27.179 31.552 1.00 9.88  ? 29  ALA A O   1 
ATOM   117  C  CB  . ALA A 1 29  ? 29.007 29.699 30.531 1.00 12.22 ? 29  ALA A CB  1 
ATOM   118  N  N   . ALA A 1 30  ? 29.063 27.419 32.685 1.00 8.64  ? 30  ALA A N   1 
ATOM   119  C  CA  . ALA A 1 30  ? 29.182 26.005 32.992 1.00 7.23  ? 30  ALA A CA  1 
ATOM   120  C  C   . ALA A 1 30  ? 28.087 25.579 33.963 1.00 10.11 ? 30  ALA A C   1 
ATOM   121  O  O   . ALA A 1 30  ? 27.547 24.475 33.844 1.00 8.55  ? 30  ALA A O   1 
ATOM   122  C  CB  . ALA A 1 30  ? 30.555 25.695 33.563 1.00 8.51  ? 30  ALA A CB  1 
ATOM   123  N  N   . TYR A 1 31  ? 27.745 26.453 34.912 1.00 7.64  ? 31  TYR A N   1 
ATOM   124  C  CA  . TYR A 1 31  ? 26.665 26.166 35.837 1.00 7.29  ? 31  TYR A CA  1 
ATOM   125  C  C   . TYR A 1 31  ? 25.364 25.959 35.062 1.00 7.87  ? 31  TYR A C   1 
ATOM   126  O  O   . TYR A 1 31  ? 24.636 24.983 35.292 1.00 8.03  ? 31  TYR A O   1 
ATOM   127  C  CB  . TYR A 1 31  ? 26.482 27.290 36.878 1.00 7.28  ? 31  TYR A CB  1 
ATOM   128  C  CG  . TYR A 1 31  ? 25.125 27.162 37.508 1.00 7.89  ? 31  TYR A CG  1 
ATOM   129  C  CD1 . TYR A 1 31  ? 24.851 26.132 38.403 1.00 8.68  ? 31  TYR A CD1 1 
ATOM   130  C  CD2 . TYR A 1 31  ? 24.090 28.002 37.133 1.00 10.02 ? 31  TYR A CD2 1 
ATOM   131  C  CE1 . TYR A 1 31  ? 23.582 25.965 38.928 1.00 9.42  ? 31  TYR A CE1 1 
ATOM   132  C  CE2 . TYR A 1 31  ? 22.819 27.845 37.650 1.00 10.36 ? 31  TYR A CE2 1 
ATOM   133  C  CZ  . TYR A 1 31  ? 22.569 26.831 38.547 1.00 10.67 ? 31  TYR A CZ  1 
ATOM   134  O  OH  . TYR A 1 31  ? 21.281 26.684 39.041 1.00 11.87 ? 31  TYR A OH  1 
ATOM   135  N  N   . LEU A 1 32  ? 25.055 26.880 34.158 1.00 8.16  ? 32  LEU A N   1 
ATOM   136  C  CA  . LEU A 1 32  ? 23.794 26.797 33.432 1.00 8.89  ? 32  LEU A CA  1 
ATOM   137  C  C   . LEU A 1 32  ? 23.734 25.539 32.567 1.00 8.38  ? 32  LEU A C   1 
ATOM   138  O  O   . LEU A 1 32  ? 22.683 24.909 32.476 1.00 10.24 ? 32  LEU A O   1 
ATOM   139  C  CB  . LEU A 1 32  ? 23.584 28.040 32.571 1.00 9.25  ? 32  LEU A CB  1 
ATOM   140  C  CG  . LEU A 1 32  ? 23.314 29.325 33.356 1.00 9.57  ? 32  LEU A CG  1 
ATOM   141  C  CD1 . LEU A 1 32  ? 23.241 30.546 32.437 1.00 12.69 ? 32  LEU A CD1 1 
ATOM   142  C  CD2 . LEU A 1 32  ? 22.045 29.187 34.181 1.00 11.36 ? 32  LEU A CD2 1 
ATOM   143  N  N   . LEU A 1 33  ? 24.845 25.153 31.950 1.00 9.74  ? 33  LEU A N   1 
ATOM   144  C  CA  . LEU A 1 33  ? 24.840 23.932 31.142 1.00 11.62 ? 33  LEU A CA  1 
ATOM   145  C  C   . LEU A 1 33  ? 24.665 22.691 32.017 1.00 11.95 ? 33  LEU A C   1 
ATOM   146  O  O   . LEU A 1 33  ? 23.961 21.749 31.635 1.00 12.09 ? 33  LEU A O   1 
ATOM   147  C  CB  . LEU A 1 33  ? 26.111 23.829 30.299 1.00 10.99 ? 33  LEU A CB  1 
ATOM   148  C  CG  . LEU A 1 33  ? 26.179 24.832 29.140 1.00 12.65 ? 33  LEU A CG  1 
ATOM   149  C  CD1 . LEU A 1 33  ? 27.584 24.883 28.572 1.00 15.05 ? 33  LEU A CD1 1 
ATOM   150  C  CD2 . LEU A 1 33  ? 25.183 24.470 28.049 1.00 18.68 ? 33  LEU A CD2 1 
ATOM   151  N  N   . LEU A 1 34  ? 25.273 22.692 33.199 1.00 9.76  ? 34  LEU A N   1 
ATOM   152  C  CA  . LEU A 1 34  ? 25.118 21.570 34.120 1.00 8.07  ? 34  LEU A CA  1 
ATOM   153  C  C   . LEU A 1 34  ? 23.671 21.458 34.610 1.00 9.19  ? 34  LEU A C   1 
ATOM   154  O  O   . LEU A 1 34  ? 23.041 20.391 34.520 1.00 8.97  ? 34  LEU A O   1 
ATOM   155  C  CB  . LEU A 1 34  ? 26.062 21.711 35.322 1.00 9.21  ? 34  LEU A CB  1 
ATOM   156  C  CG  . LEU A 1 34  ? 25.860 20.723 36.474 1.00 6.99  ? 34  LEU A CG  1 
ATOM   157  C  CD1 . LEU A 1 34  ? 25.979 19.266 36.028 1.00 9.71  ? 34  LEU A CD1 1 
ATOM   158  C  CD2 . LEU A 1 34  ? 26.861 21.015 37.577 1.00 9.29  ? 34  LEU A CD2 1 
ATOM   159  N  N   . ASP A 1 35  ? 23.129 22.549 35.125 1.00 8.74  ? 35  ASP A N   1 
ATOM   160  C  CA  . ASP A 1 35  ? 21.776 22.472 35.654 1.00 8.75  ? 35  ASP A CA  1 
ATOM   161  C  C   . ASP A 1 35  ? 20.767 22.138 34.561 1.00 9.61  ? 35  ASP A C   1 
ATOM   162  O  O   . ASP A 1 35  ? 19.807 21.400 34.806 1.00 9.80  ? 35  ASP A O   1 
ATOM   163  C  CB  . ASP A 1 35  ? 21.362 23.765 36.349 1.00 9.49  ? 35  ASP A CB  1 
ATOM   164  C  CG  . ASP A 1 35  ? 19.974 23.653 36.962 1.00 12.31 ? 35  ASP A CG  1 
ATOM   165  O  OD1 . ASP A 1 35  ? 19.827 22.884 37.938 1.00 12.63 ? 35  ASP A OD1 1 
ATOM   166  O  OD2 . ASP A 1 35  ? 19.035 24.294 36.444 1.00 16.15 ? 35  ASP A OD2 1 
ATOM   167  N  N   . GLY A 1 36  ? 20.994 22.650 33.355 1.00 9.65  ? 36  GLY A N   1 
ATOM   168  C  CA  . GLY A 1 36  ? 20.101 22.387 32.242 1.00 11.24 ? 36  GLY A CA  1 
ATOM   169  C  C   . GLY A 1 36  ? 19.950 20.912 31.920 1.00 10.63 ? 36  GLY A C   1 
ATOM   170  O  O   . GLY A 1 36  ? 18.900 20.492 31.397 1.00 11.61 ? 36  GLY A O   1 
ATOM   171  N  N   . GLU A 1 37  ? 20.974 20.117 32.228 1.00 8.82  ? 37  GLU A N   1 
ATOM   172  C  CA  . GLU A 1 37  ? 20.904 18.683 31.957 1.00 9.91  ? 37  GLU A CA  1 
ATOM   173  C  C   . GLU A 1 37  ? 19.875 17.973 32.829 1.00 11.16 ? 37  GLU A C   1 
ATOM   174  O  O   . GLU A 1 37  ? 19.437 16.868 32.508 1.00 10.95 ? 37  GLU A O   1 
ATOM   175  C  CB  . GLU A 1 37  ? 22.259 18.008 32.166 1.00 10.12 ? 37  GLU A CB  1 
ATOM   176  C  CG  . GLU A 1 37  ? 23.394 18.498 31.276 1.00 10.72 ? 37  GLU A CG  1 
ATOM   177  C  CD  . GLU A 1 37  ? 23.230 18.149 29.803 1.00 16.73 ? 37  GLU A CD  1 
ATOM   178  O  OE1 . GLU A 1 37  ? 22.277 17.416 29.436 1.00 15.53 ? 37  GLU A OE1 1 
ATOM   179  O  OE2 . GLU A 1 37  ? 24.072 18.608 29.008 1.00 14.65 ? 37  GLU A OE2 1 
ATOM   180  N  N   . PHE A 1 38  ? 19.486 18.596 33.932 1.00 9.46  ? 38  PHE A N   1 
ATOM   181  C  CA  . PHE A 1 38  ? 18.573 17.932 34.861 1.00 10.49 ? 38  PHE A CA  1 
ATOM   182  C  C   . PHE A 1 38  ? 17.106 18.057 34.446 1.00 12.96 ? 38  PHE A C   1 
ATOM   183  O  O   . PHE A 1 38  ? 16.239 17.356 34.976 1.00 12.86 ? 38  PHE A O   1 
ATOM   184  C  CB  . PHE A 1 38  ? 18.789 18.467 36.274 1.00 11.15 ? 38  PHE A CB  1 
ATOM   185  C  CG  . PHE A 1 38  ? 20.020 17.911 36.935 1.00 10.27 ? 38  PHE A CG  1 
ATOM   186  C  CD1 . PHE A 1 38  ? 21.273 18.451 36.668 1.00 10.02 ? 38  PHE A CD1 1 
ATOM   187  C  CD2 . PHE A 1 38  ? 19.936 16.833 37.802 1.00 10.59 ? 38  PHE A CD2 1 
ATOM   188  C  CE1 . PHE A 1 38  ? 22.405 17.938 37.261 1.00 10.40 ? 38  PHE A CE1 1 
ATOM   189  C  CE2 . PHE A 1 38  ? 21.076 16.317 38.402 1.00 10.04 ? 38  PHE A CE2 1 
ATOM   190  C  CZ  . PHE A 1 38  ? 22.310 16.868 38.126 1.00 10.16 ? 38  PHE A CZ  1 
ATOM   191  N  N   . GLU A 1 39  ? 16.834 18.924 33.481 1.00 11.04 ? 39  GLU A N   1 
ATOM   192  C  CA  . GLU A 1 39  ? 15.497 18.977 32.891 1.00 14.31 ? 39  GLU A CA  1 
ATOM   193  C  C   . GLU A 1 39  ? 15.141 17.617 32.300 1.00 14.81 ? 39  GLU A C   1 
ATOM   194  O  O   . GLU A 1 39  ? 15.904 17.062 31.509 1.00 15.61 ? 39  GLU A O   1 
ATOM   195  C  CB  . GLU A 1 39  ? 15.424 20.060 31.818 1.00 15.39 ? 39  GLU A CB  1 
ATOM   196  C  CG  . GLU A 1 39  ? 15.416 21.468 32.374 1.00 23.55 ? 39  GLU A CG  1 
ATOM   197  C  CD  . GLU A 1 39  ? 14.210 21.728 33.257 1.00 34.28 ? 39  GLU A CD  1 
ATOM   198  O  OE1 . GLU A 1 39  ? 13.073 21.488 32.797 1.00 41.94 ? 39  GLU A OE1 1 
ATOM   199  O  OE2 . GLU A 1 39  ? 14.394 22.160 34.415 1.00 28.27 ? 39  GLU A OE2 1 
ATOM   200  N  N   . GLY A 1 40  ? 13.994 17.073 32.710 1.00 13.47 ? 40  GLY A N   1 
ATOM   201  C  CA  . GLY A 1 40  ? 13.571 15.764 32.252 1.00 15.44 ? 40  GLY A CA  1 
ATOM   202  C  C   . GLY A 1 40  ? 13.961 14.614 33.161 1.00 14.81 ? 40  GLY A C   1 
ATOM   203  O  O   . GLY A 1 40  ? 13.540 13.479 32.937 1.00 17.93 ? 40  GLY A O   1 
ATOM   204  N  N   . ILE A 1 41  ? 14.793 14.888 34.164 1.00 12.21 ? 41  ILE A N   1 
ATOM   205  C  CA  . ILE A 1 41  ? 15.091 13.887 35.181 1.00 12.03 ? 41  ILE A CA  1 
ATOM   206  C  C   . ILE A 1 41  ? 14.063 14.032 36.289 1.00 12.18 ? 41  ILE A C   1 
ATOM   207  O  O   . ILE A 1 41  ? 13.894 15.115 36.859 1.00 13.50 ? 41  ILE A O   1 
ATOM   208  C  CB  . ILE A 1 41  ? 16.515 14.026 35.763 1.00 10.28 ? 41  ILE A CB  1 
ATOM   209  C  CG1 . ILE A 1 41  ? 17.537 13.951 34.625 1.00 10.44 ? 41  ILE A CG1 1 
ATOM   210  C  CG2 . ILE A 1 41  ? 16.786 12.940 36.820 1.00 10.28 ? 41  ILE A CG2 1 
ATOM   211  C  CD1 . ILE A 1 41  ? 18.975 14.008 35.095 1.00 10.31 ? 41  ILE A CD1 1 
ATOM   212  N  N   . ASP A 1 42  ? 13.368 12.937 36.584 1.00 11.42 ? 42  ASP A N   1 
ATOM   213  C  CA  . ASP A 1 42  ? 12.279 12.964 37.547 1.00 13.15 ? 42  ASP A CA  1 
ATOM   214  C  C   . ASP A 1 42  ? 12.805 12.991 38.975 1.00 11.23 ? 42  ASP A C   1 
ATOM   215  O  O   . ASP A 1 42  ? 13.851 12.406 39.250 1.00 10.95 ? 42  ASP A O   1 
ATOM   216  C  CB  . ASP A 1 42  ? 11.378 11.747 37.350 1.00 12.39 ? 42  ASP A CB  1 
ATOM   217  C  CG  . ASP A 1 42  ? 10.040 11.921 38.004 1.00 15.86 ? 42  ASP A CG  1 
ATOM   218  O  OD1 . ASP A 1 42  ? 9.185  12.580 37.380 1.00 17.70 ? 42  ASP A OD1 1 
ATOM   219  O  OD2 . ASP A 1 42  ? 9.849  11.418 39.138 1.00 14.37 ? 42  ASP A OD2 1 
ATOM   220  N  N   . ASP A 1 43  ? 12.091 13.658 39.882 1.00 12.74 ? 43  ASP A N   1 
ATOM   221  C  CA  . ASP A 1 43  ? 12.427 13.610 41.313 1.00 10.30 ? 43  ASP A CA  1 
ATOM   222  C  C   . ASP A 1 43  ? 12.667 12.176 41.795 1.00 10.41 ? 43  ASP A C   1 
ATOM   223  O  O   . ASP A 1 43  ? 13.583 11.909 42.572 1.00 9.74  ? 43  ASP A O   1 
ATOM   224  C  CB  . ASP A 1 43  ? 11.315 14.224 42.182 1.00 11.76 ? 43  ASP A CB  1 
ATOM   225  C  CG  . ASP A 1 43  ? 11.332 15.744 42.204 1.00 15.87 ? 43  ASP A CG  1 
ATOM   226  O  OD1 . ASP A 1 43  ? 12.297 16.361 41.701 1.00 17.09 ? 43  ASP A OD1 1 
ATOM   227  O  OD2 . ASP A 1 43  ? 10.365 16.323 42.756 1.00 18.80 ? 43  ASP A OD2 1 
ATOM   228  N  N   . SER A 1 44  ? 11.851 11.246 41.317 1.00 10.21 ? 44  SER A N   1 
ATOM   229  C  CA  . SER A 1 44  ? 11.924 9.873  41.796 1.00 9.62  ? 44  SER A CA  1 
ATOM   230  C  C   . SER A 1 44  ? 13.198 9.166  41.383 1.00 10.03 ? 44  SER A C   1 
ATOM   231  O  O   . SER A 1 44  ? 13.493 8.096  41.906 1.00 10.58 ? 44  SER A O   1 
ATOM   232  C  CB  . SER A 1 44  ? 10.725 9.060  41.296 1.00 8.58  ? 44  SER A CB  1 
ATOM   233  O  OG  . SER A 1 44  ? 10.734 8.936  39.878 1.00 10.41 ? 44  SER A OG  1 
ATOM   234  N  N   . GLN A 1 45  ? 13.950 9.755  40.450 1.00 8.48  ? 45  GLN A N   1 
ATOM   235  C  CA  . GLN A 1 45  ? 15.159 9.113  39.924 1.00 10.01 ? 45  GLN A CA  1 
ATOM   236  C  C   . GLN A 1 45  ? 16.439 9.557  40.617 1.00 9.24  ? 45  GLN A C   1 
ATOM   237  O  O   . GLN A 1 45  ? 17.527 9.117  40.236 1.00 9.86  ? 45  GLN A O   1 
ATOM   238  C  CB  . GLN A 1 45  ? 15.315 9.383  38.424 1.00 10.09 ? 45  GLN A CB  1 
ATOM   239  C  CG  . GLN A 1 45  ? 14.218 8.777  37.575 1.00 10.05 ? 45  GLN A CG  1 
ATOM   240  C  CD  . GLN A 1 45  ? 14.387 9.104  36.107 1.00 12.80 ? 45  GLN A CD  1 
ATOM   241  O  OE1 . GLN A 1 45  ? 14.191 10.243 35.691 1.00 15.93 ? 45  GLN A OE1 1 
ATOM   242  N  NE2 . GLN A 1 45  ? 14.759 8.107  35.317 1.00 17.59 ? 45  GLN A NE2 1 
ATOM   243  N  N   . LYS A 1 46  ? 16.322 10.395 41.644 1.00 8.58  ? 46  LYS A N   1 
ATOM   244  C  CA  . LYS A 1 46  ? 17.516 11.092 42.132 1.00 9.17  ? 46  LYS A CA  1 
ATOM   245  C  C   . LYS A 1 46  ? 18.581 10.159 42.709 1.00 10.62 ? 46  LYS A C   1 
ATOM   246  O  O   . LYS A 1 46  ? 19.760 10.510 42.708 1.00 9.34  ? 46  LYS A O   1 
ATOM   247  C  CB  . LYS A 1 46  ? 17.145 12.149 43.171 1.00 9.05  ? 46  LYS A CB  1 
ATOM   248  C  CG  . LYS A 1 46  ? 16.859 11.607 44.570 1.00 10.87 ? 46  LYS A CG  1 
ATOM   249  C  CD  . LYS A 1 46  ? 16.744 12.726 45.611 1.00 13.42 ? 46  LYS A CD  1 
ATOM   250  C  CE  . LYS A 1 46  ? 16.546 12.182 47.027 1.00 15.53 ? 46  LYS A CE  1 
ATOM   251  N  NZ  . LYS A 1 46  ? 17.844 11.870 47.692 1.00 18.92 ? 46  LYS A NZ  1 
ATOM   252  N  N   . ASP A 1 47  ? 18.181 8.984  43.198 1.00 9.88  ? 47  ASP A N   1 
ATOM   253  C  CA  . ASP A 1 47  ? 19.124 8.066  43.841 1.00 9.44  ? 47  ASP A CA  1 
ATOM   254  C  C   . ASP A 1 47  ? 19.396 6.842  42.986 1.00 10.78 ? 47  ASP A C   1 
ATOM   255  O  O   . ASP A 1 47  ? 19.960 5.855  43.464 1.00 12.78 ? 47  ASP A O   1 
ATOM   256  C  CB  . ASP A 1 47  ? 18.603 7.617  45.212 1.00 10.44 ? 47  ASP A CB  1 
ATOM   257  C  CG  . ASP A 1 47  ? 18.405 8.768  46.165 1.00 14.65 ? 47  ASP A CG  1 
ATOM   258  O  OD1 . ASP A 1 47  ? 19.276 9.657  46.216 1.00 14.00 ? 47  ASP A OD1 1 
ATOM   259  O  OD2 . ASP A 1 47  ? 17.366 8.782  46.862 1.00 19.25 ? 47  ASP A OD2 1 
ATOM   260  N  N   . ASN A 1 48  ? 18.995 6.888  41.725 1.00 9.64  ? 48  ASN A N   1 
ATOM   261  C  CA  . ASN A 1 48  ? 19.182 5.734  40.856 1.00 10.41 ? 48  ASN A CA  1 
ATOM   262  C  C   . ASN A 1 48  ? 20.619 5.693  40.344 1.00 11.52 ? 48  ASN A C   1 
ATOM   263  O  O   . ASN A 1 48  ? 21.111 6.672  39.785 1.00 15.38 ? 48  ASN A O   1 
ATOM   264  C  CB  . ASN A 1 48  ? 18.178 5.754  39.688 1.00 14.74 ? 48  ASN A CB  1 
ATOM   265  C  CG  . ASN A 1 48  ? 16.734 5.474  40.135 1.00 19.96 ? 48  ASN A CG  1 
ATOM   266  O  OD1 . ASN A 1 48  ? 16.481 5.144  41.295 1.00 18.97 ? 48  ASN A OD1 1 
ATOM   267  N  ND2 . ASN A 1 48  ? 15.787 5.588  39.201 1.00 19.31 ? 48  ASN A ND2 1 
ATOM   268  N  N   . ARG A 1 49  ? 21.298 4.573  40.576 1.00 11.88 ? 49  ARG A N   1 
ATOM   269  C  CA  . ARG A 1 49  ? 22.701 4.428  40.198 1.00 13.94 ? 49  ARG A CA  1 
ATOM   270  C  C   . ARG A 1 49  ? 22.829 3.446  39.028 1.00 15.98 ? 49  ARG A C   1 
ATOM   271  O  O   . ARG A 1 49  ? 22.135 2.421  38.994 1.00 21.11 ? 49  ARG A O   1 
ATOM   272  C  CB  . ARG A 1 49  ? 23.534 3.957  41.401 1.00 15.74 ? 49  ARG A CB  1 
ATOM   273  C  CG  . ARG A 1 49  ? 25.022 4.320  41.325 1.00 18.18 ? 49  ARG A CG  1 
ATOM   274  C  CD  . ARG A 1 49  ? 25.803 3.820  42.553 1.00 20.51 ? 49  ARG A CD  1 
ATOM   275  N  NE  . ARG A 1 49  ? 25.266 4.342  43.811 1.00 22.56 ? 49  ARG A NE  1 
ATOM   276  C  CZ  . ARG A 1 49  ? 25.631 5.497  44.362 1.00 13.45 ? 49  ARG A CZ  1 
ATOM   277  N  NH1 . ARG A 1 49  ? 26.540 6.259  43.773 1.00 14.46 ? 49  ARG A NH1 1 
ATOM   278  N  NH2 . ARG A 1 49  ? 25.080 5.893  45.504 1.00 17.66 ? 49  ARG A NH2 1 
ATOM   279  N  N   . VAL A 1 50  ? 23.675 3.777  38.054 1.00 14.05 ? 50  VAL A N   1 
ATOM   280  C  CA  . VAL A 1 50  ? 24.011 2.847  36.976 1.00 14.31 ? 50  VAL A CA  1 
ATOM   281  C  C   . VAL A 1 50  ? 25.500 2.538  37.081 1.00 15.46 ? 50  VAL A C   1 
ATOM   282  O  O   . VAL A 1 50  ? 26.268 3.372  37.548 1.00 12.77 ? 50  VAL A O   1 
ATOM   283  C  CB  . VAL A 1 50  ? 23.678 3.408  35.576 1.00 14.95 ? 50  VAL A CB  1 
ATOM   284  C  CG1 . VAL A 1 50  ? 22.179 3.662  35.444 1.00 19.69 ? 50  VAL A CG1 1 
ATOM   285  C  CG2 . VAL A 1 50  ? 24.466 4.681  35.281 1.00 16.76 ? 50  VAL A CG2 1 
ATOM   286  N  N   . PRO A 1 51  ? 25.920 1.332  36.669 1.00 14.56 ? 51  PRO A N   1 
ATOM   287  C  CA  . PRO A 1 51  ? 27.333 0.959  36.843 1.00 15.82 ? 51  PRO A CA  1 
ATOM   288  C  C   . PRO A 1 51  ? 28.318 1.831  36.061 1.00 14.13 ? 51  PRO A C   1 
ATOM   289  O  O   . PRO A 1 51  ? 29.477 1.941  36.447 1.00 16.93 ? 51  PRO A O   1 
ATOM   290  C  CB  . PRO A 1 51  ? 27.376 -0.493 36.344 1.00 18.54 ? 51  PRO A CB  1 
ATOM   291  C  CG  . PRO A 1 51  ? 26.111 -0.689 35.554 1.00 18.71 ? 51  PRO A CG  1 
ATOM   292  C  CD  . PRO A 1 51  ? 25.100 0.214  36.172 1.00 19.59 ? 51  PRO A CD  1 
ATOM   293  N  N   . GLU A 1 52  ? 27.851 2.461  34.988 1.00 13.62 ? 52  GLU A N   1 
ATOM   294  C  CA  . GLU A 1 52  ? 28.719 3.246  34.118 1.00 15.76 ? 52  GLU A CA  1 
ATOM   295  C  C   . GLU A 1 52  ? 29.134 4.594  34.705 1.00 15.77 ? 52  GLU A C   1 
ATOM   296  O  O   . GLU A 1 52  ? 30.060 5.226  34.202 1.00 15.89 ? 52  GLU A O   1 
ATOM   297  C  CB  . GLU A 1 52  ? 28.032 3.483  32.769 1.00 16.23 ? 52  GLU A CB  1 
ATOM   298  C  CG  . GLU A 1 52  ? 27.809 2.224  31.931 1.00 17.80 ? 52  GLU A CG  1 
ATOM   299  C  CD  . GLU A 1 52  ? 26.553 1.449  32.308 1.00 22.16 ? 52  GLU A CD  1 
ATOM   300  O  OE1 . GLU A 1 52  ? 25.757 1.912  33.160 1.00 15.19 ? 52  GLU A OE1 1 
ATOM   301  O  OE2 . GLU A 1 52  ? 26.353 0.354  31.738 1.00 23.10 ? 52  GLU A OE2 1 
ATOM   302  N  N   . VAL A 1 53  ? 28.428 5.041  35.743 1.00 11.57 ? 53  VAL A N   1 
ATOM   303  C  CA  . VAL A 1 53  ? 28.645 6.374  36.305 1.00 12.97 ? 53  VAL A CA  1 
ATOM   304  C  C   . VAL A 1 53  ? 28.751 6.255  37.816 1.00 12.10 ? 53  VAL A C   1 
ATOM   305  O  O   . VAL A 1 53  ? 27.928 5.597  38.445 1.00 13.53 ? 53  VAL A O   1 
ATOM   306  C  CB  . VAL A 1 53  ? 27.496 7.350  35.931 1.00 11.77 ? 53  VAL A CB  1 
ATOM   307  C  CG1 . VAL A 1 53  ? 27.754 8.736  36.519 1.00 13.64 ? 53  VAL A CG1 1 
ATOM   308  C  CG2 . VAL A 1 53  ? 27.345 7.438  34.425 1.00 12.99 ? 53  VAL A CG2 1 
ATOM   309  N  N   . ASP A 1 54  ? 29.774 6.869  38.406 1.00 11.22 ? 54  ASP A N   1 
ATOM   310  C  CA  . ASP A 1 54  ? 30.028 6.618  39.820 1.00 10.34 ? 54  ASP A CA  1 
ATOM   311  C  C   . ASP A 1 54  ? 29.059 7.347  40.761 1.00 13.37 ? 54  ASP A C   1 
ATOM   312  O  O   . ASP A 1 54  ? 28.904 6.945  41.908 1.00 21.67 ? 54  ASP A O   1 
ATOM   313  C  CB  . ASP A 1 54  ? 31.496 6.944  40.193 1.00 11.60 ? 54  ASP A CB  1 
ATOM   314  C  CG  . ASP A 1 54  ? 31.946 8.360  39.813 1.00 16.25 ? 54  ASP A CG  1 
ATOM   315  O  OD1 . ASP A 1 54  ? 31.149 9.185  39.321 1.00 18.41 ? 54  ASP A OD1 1 
ATOM   316  O  OD2 . ASP A 1 54  ? 33.148 8.649  40.031 1.00 21.08 ? 54  ASP A OD2 1 
ATOM   317  N  N   . ARG A 1 55  ? 28.380 8.379  40.267 1.00 10.42 ? 55  ARG A N   1 
ATOM   318  C  CA  . ARG A 1 55  ? 27.466 9.166  41.089 1.00 11.46 ? 55  ARG A CA  1 
ATOM   319  C  C   . ARG A 1 55  ? 26.016 9.027  40.655 1.00 9.07  ? 55  ARG A C   1 
ATOM   320  O  O   . ARG A 1 55  ? 25.744 8.792  39.479 1.00 10.06 ? 55  ARG A O   1 
ATOM   321  C  CB  . ARG A 1 55  ? 27.836 10.646 41.027 1.00 13.13 ? 55  ARG A CB  1 
ATOM   322  C  CG  . ARG A 1 55  ? 29.289 10.970 41.327 1.00 17.41 ? 55  ARG A CG  1 
ATOM   323  C  CD  . ARG A 1 55  ? 29.466 11.277 42.785 1.00 17.34 ? 55  ARG A CD  1 
ATOM   324  N  NE  . ARG A 1 55  ? 29.267 10.097 43.617 1.00 16.81 ? 55  ARG A NE  1 
ATOM   325  C  CZ  . ARG A 1 55  ? 30.201 9.178  43.845 1.00 21.71 ? 55  ARG A CZ  1 
ATOM   326  N  NH1 . ARG A 1 55  ? 29.932 8.144  44.636 1.00 20.66 ? 55  ARG A NH1 1 
ATOM   327  N  NH2 . ARG A 1 55  ? 31.402 9.289  43.287 1.00 21.68 ? 55  ARG A NH2 1 
ATOM   328  N  N   . THR A 1 56  ? 25.102 9.220  41.606 1.00 8.58  ? 56  THR A N   1 
ATOM   329  C  CA  . THR A 1 56  ? 23.676 9.421  41.310 1.00 9.45  ? 56  THR A CA  1 
ATOM   330  C  C   . THR A 1 56  ? 23.421 10.891 40.989 1.00 9.58  ? 56  THR A C   1 
ATOM   331  O  O   . THR A 1 56  ? 24.253 11.738 41.300 1.00 8.44  ? 56  THR A O   1 
ATOM   332  C  CB  . THR A 1 56  ? 22.796 9.032  42.501 1.00 10.83 ? 56  THR A CB  1 
ATOM   333  O  OG1 . THR A 1 56  ? 23.140 9.868  43.617 1.00 9.36  ? 56  THR A OG1 1 
ATOM   334  C  CG2 . THR A 1 56  ? 23.015 7.576  42.895 1.00 11.61 ? 56  THR A CG2 1 
ATOM   335  N  N   . PRO A 1 57  ? 22.267 11.218 40.389 1.00 7.76  ? 57  PRO A N   1 
ATOM   336  C  CA  . PRO A 1 57  ? 21.942 12.632 40.166 1.00 7.01  ? 57  PRO A CA  1 
ATOM   337  C  C   . PRO A 1 57  ? 21.956 13.451 41.461 1.00 9.53  ? 57  PRO A C   1 
ATOM   338  O  O   . PRO A 1 57  ? 22.470 14.574 41.460 1.00 8.46  ? 57  PRO A O   1 
ATOM   339  C  CB  . PRO A 1 57  ? 20.538 12.567 39.552 1.00 7.58  ? 57  PRO A CB  1 
ATOM   340  C  CG  . PRO A 1 57  ? 20.563 11.261 38.785 1.00 8.39  ? 57  PRO A CG  1 
ATOM   341  C  CD  . PRO A 1 57  ? 21.312 10.323 39.701 1.00 9.52  ? 57  PRO A CD  1 
ATOM   342  N  N   . ALA A 1 58  ? 21.454 12.885 42.554 1.00 8.30  ? 58  ALA A N   1 
ATOM   343  C  CA  . ALA A 1 58  ? 21.468 13.581 43.832 1.00 7.33  ? 58  ALA A CA  1 
ATOM   344  C  C   . ALA A 1 58  ? 22.888 13.870 44.291 1.00 8.91  ? 58  ALA A C   1 
ATOM   345  O  O   . ALA A 1 58  ? 23.185 14.968 44.756 1.00 9.12  ? 58  ALA A O   1 
ATOM   346  C  CB  . ALA A 1 58  ? 20.732 12.770 44.900 1.00 9.54  ? 58  ALA A CB  1 
ATOM   347  N  N   . GLU A 1 59  ? 23.762 12.882 44.167 1.00 7.95  ? 59  GLU A N   1 
ATOM   348  C  CA  . GLU A 1 59  ? 25.148 13.054 44.601 1.00 7.75  ? 59  GLU A CA  1 
ATOM   349  C  C   . GLU A 1 59  ? 25.881 14.079 43.747 1.00 7.96  ? 59  GLU A C   1 
ATOM   350  O  O   . GLU A 1 59  ? 26.769 14.807 44.234 1.00 8.30  ? 59  GLU A O   1 
ATOM   351  C  CB  . GLU A 1 59  ? 25.893 11.723 44.560 1.00 7.57  ? 59  GLU A CB  1 
ATOM   352  C  CG  . GLU A 1 59  ? 25.503 10.775 45.692 1.00 10.79 ? 59  GLU A CG  1 
ATOM   353  C  CD  . GLU A 1 59  ? 26.035 9.369  45.479 1.00 12.31 ? 59  GLU A CD  1 
ATOM   354  O  OE1 . GLU A 1 59  ? 26.582 9.097  44.394 1.00 12.50 ? 59  GLU A OE1 1 
ATOM   355  O  OE2 . GLU A 1 59  ? 25.901 8.546  46.409 1.00 14.00 ? 59  GLU A OE2 1 
ATOM   356  N  N   . ILE A 1 60  ? 25.529 14.137 42.468 1.00 8.21  ? 60  ILE A N   1 
ATOM   357  C  CA  . ILE A 1 60  ? 26.167 15.075 41.559 1.00 7.39  ? 60  ILE A CA  1 
ATOM   358  C  C   . ILE A 1 60  ? 25.943 16.517 42.027 1.00 8.96  ? 60  ILE A C   1 
ATOM   359  O  O   . ILE A 1 60  ? 26.869 17.340 41.996 1.00 10.40 ? 60  ILE A O   1 
ATOM   360  C  CB  . ILE A 1 60  ? 25.668 14.859 40.119 1.00 8.91  ? 60  ILE A CB  1 
ATOM   361  C  CG1 . ILE A 1 60  ? 26.333 13.596 39.555 1.00 10.29 ? 60  ILE A CG1 1 
ATOM   362  C  CG2 . ILE A 1 60  ? 25.966 16.073 39.243 1.00 11.83 ? 60  ILE A CG2 1 
ATOM   363  C  CD1 . ILE A 1 60  ? 25.822 13.160 38.203 1.00 12.87 ? 60  ILE A CD1 1 
ATOM   364  N  N   . ILE A 1 61  ? 24.744 16.828 42.498 1.00 7.37  ? 61  ILE A N   1 
ATOM   365  C  CA  . ILE A 1 61  ? 24.472 18.172 42.986 1.00 7.36  ? 61  ILE A CA  1 
ATOM   366  C  C   . ILE A 1 61  ? 25.004 18.366 44.408 1.00 8.58  ? 61  ILE A C   1 
ATOM   367  O  O   . ILE A 1 61  ? 25.616 19.400 44.709 1.00 8.14  ? 61  ILE A O   1 
ATOM   368  C  CB  . ILE A 1 61  ? 22.961 18.485 42.926 1.00 8.16  ? 61  ILE A CB  1 
ATOM   369  C  CG1 . ILE A 1 61  ? 22.504 18.444 41.464 1.00 8.10  ? 61  ILE A CG1 1 
ATOM   370  C  CG2 . ILE A 1 61  ? 22.683 19.853 43.565 1.00 9.15  ? 61  ILE A CG2 1 
ATOM   371  C  CD1 . ILE A 1 61  ? 21.020 18.654 41.258 1.00 11.45 ? 61  ILE A CD1 1 
ATOM   372  N  N   . ALA A 1 62  ? 24.812 17.377 45.275 1.00 8.99  ? 62  ALA A N   1 
ATOM   373  C  CA  . ALA A 1 62  ? 25.292 17.482 46.653 1.00 7.96  ? 62  ALA A CA  1 
ATOM   374  C  C   . ALA A 1 62  ? 26.798 17.704 46.718 1.00 7.86  ? 62  ALA A C   1 
ATOM   375  O  O   . ALA A 1 62  ? 27.285 18.415 47.586 1.00 8.59  ? 62  ALA A O   1 
ATOM   376  C  CB  . ALA A 1 62  ? 24.916 16.237 47.438 1.00 11.03 ? 62  ALA A CB  1 
ATOM   377  N  N   . TYR A 1 63  ? 27.540 17.088 45.806 1.00 7.00  ? 63  TYR A N   1 
ATOM   378  C  CA  . TYR A 1 63  ? 28.977 17.310 45.726 1.00 9.36  ? 63  TYR A CA  1 
ATOM   379  C  C   . TYR A 1 63  ? 29.310 18.788 45.496 1.00 9.58  ? 63  TYR A C   1 
ATOM   380  O  O   . TYR A 1 63  ? 30.223 19.321 46.150 1.00 8.20  ? 63  TYR A O   1 
ATOM   381  C  CB  . TYR A 1 63  ? 29.559 16.450 44.609 1.00 8.65  ? 63  TYR A CB  1 
ATOM   382  C  CG  . TYR A 1 63  ? 31.054 16.517 44.448 1.00 8.19  ? 63  TYR A CG  1 
ATOM   383  C  CD1 . TYR A 1 63  ? 31.644 17.479 43.636 1.00 8.02  ? 63  TYR A CD1 1 
ATOM   384  C  CD2 . TYR A 1 63  ? 31.878 15.594 45.071 1.00 10.96 ? 63  TYR A CD2 1 
ATOM   385  C  CE1 . TYR A 1 63  ? 33.029 17.533 43.475 1.00 10.18 ? 63  TYR A CE1 1 
ATOM   386  C  CE2 . TYR A 1 63  ? 33.262 15.639 44.905 1.00 9.98  ? 63  TYR A CE2 1 
ATOM   387  C  CZ  . TYR A 1 63  ? 33.819 16.606 44.099 1.00 9.69  ? 63  TYR A CZ  1 
ATOM   388  O  OH  . TYR A 1 63  ? 35.184 16.657 43.933 1.00 13.59 ? 63  TYR A OH  1 
ATOM   389  N  N   . GLN A 1 64  ? 28.601 19.443 44.573 1.00 7.91  ? 64  GLN A N   1 
ATOM   390  C  CA  . GLN A 1 64  ? 28.822 20.866 44.337 1.00 7.85  ? 64  GLN A CA  1 
ATOM   391  C  C   . GLN A 1 64  ? 28.466 21.694 45.555 1.00 8.70  ? 64  GLN A C   1 
ATOM   392  O  O   . GLN A 1 64  ? 29.214 22.600 45.932 1.00 8.81  ? 64  GLN A O   1 
ATOM   393  C  CB  . GLN A 1 64  ? 28.008 21.385 43.149 1.00 7.75  ? 64  GLN A CB  1 
ATOM   394  C  CG  . GLN A 1 64  ? 27.938 20.469 41.936 1.00 9.22  ? 64  GLN A CG  1 
ATOM   395  C  CD  . GLN A 1 64  ? 29.291 20.004 41.443 1.00 8.48  ? 64  GLN A CD  1 
ATOM   396  O  OE1 . GLN A 1 64  ? 30.259 20.776 41.404 1.00 9.65  ? 64  GLN A OE1 1 
ATOM   397  N  NE2 . GLN A 1 64  ? 29.376 18.736 41.061 1.00 10.52 ? 64  GLN A NE2 1 
ATOM   398  N  N   . LEU A 1 65  ? 27.310 21.420 46.152 1.00 8.32  ? 65  LEU A N   1 
ATOM   399  C  CA  . LEU A 1 65  ? 26.885 22.157 47.340 1.00 9.64  ? 65  LEU A CA  1 
ATOM   400  C  C   . LEU A 1 65  ? 27.930 22.073 48.436 1.00 10.11 ? 65  LEU A C   1 
ATOM   401  O  O   . LEU A 1 65  ? 28.255 23.083 49.071 1.00 11.33 ? 65  LEU A O   1 
ATOM   402  C  CB  . LEU A 1 65  ? 25.547 21.626 47.856 1.00 9.40  ? 65  LEU A CB  1 
ATOM   403  C  CG  . LEU A 1 65  ? 24.347 21.869 46.938 1.00 10.41 ? 65  LEU A CG  1 
ATOM   404  C  CD1 . LEU A 1 65  ? 23.084 21.173 47.434 1.00 10.98 ? 65  LEU A CD1 1 
ATOM   405  C  CD2 . LEU A 1 65  ? 24.082 23.370 46.790 1.00 11.17 ? 65  LEU A CD2 1 
ATOM   406  N  N   . GLY A 1 66  ? 28.475 20.878 48.639 1.00 8.74  ? 66  GLY A N   1 
ATOM   407  C  CA  . GLY A 1 66  ? 29.470 20.675 49.674 1.00 8.23  ? 66  GLY A CA  1 
ATOM   408  C  C   . GLY A 1 66  ? 30.705 21.524 49.439 1.00 9.56  ? 66  GLY A C   1 
ATOM   409  O  O   . GLY A 1 66  ? 31.127 22.257 50.329 1.00 9.79  ? 66  GLY A O   1 
ATOM   410  N  N   . TRP A 1 67  ? 31.295 21.450 48.249 1.00 7.48  ? 67  TRP A N   1 
ATOM   411  C  CA  . TRP A 1 67  ? 32.528 22.191 47.994 1.00 7.33  ? 67  TRP A CA  1 
ATOM   412  C  C   . TRP A 1 67  ? 32.303 23.699 47.917 1.00 7.77  ? 67  TRP A C   1 
ATOM   413  O  O   . TRP A 1 67  ? 33.122 24.455 48.439 1.00 8.79  ? 67  TRP A O   1 
ATOM   414  C  CB  . TRP A 1 67  ? 33.216 21.688 46.714 1.00 7.35  ? 67  TRP A CB  1 
ATOM   415  C  CG  . TRP A 1 67  ? 34.048 20.474 46.944 1.00 9.46  ? 67  TRP A CG  1 
ATOM   416  C  CD1 . TRP A 1 67  ? 33.829 19.225 46.442 1.00 10.99 ? 67  TRP A CD1 1 
ATOM   417  C  CD2 . TRP A 1 67  ? 35.224 20.380 47.757 1.00 8.40  ? 67  TRP A CD2 1 
ATOM   418  N  NE1 . TRP A 1 67  ? 34.811 18.363 46.872 1.00 11.26 ? 67  TRP A NE1 1 
ATOM   419  C  CE2 . TRP A 1 67  ? 35.678 19.050 47.686 1.00 11.81 ? 67  TRP A CE2 1 
ATOM   420  C  CE3 . TRP A 1 67  ? 35.959 21.306 48.513 1.00 9.60  ? 67  TRP A CE3 1 
ATOM   421  C  CZ2 . TRP A 1 67  ? 36.822 18.611 48.353 1.00 12.22 ? 67  TRP A CZ2 1 
ATOM   422  C  CZ3 . TRP A 1 67  ? 37.096 20.869 49.174 1.00 11.09 ? 67  TRP A CZ3 1 
ATOM   423  C  CH2 . TRP A 1 67  ? 37.511 19.533 49.096 1.00 11.85 ? 67  TRP A CH2 1 
ATOM   424  N  N   . LEU A 1 68  ? 31.217 24.148 47.290 1.00 6.59  ? 68  LEU A N   1 
ATOM   425  C  CA  . LEU A 1 68  ? 30.986 25.584 47.176 1.00 7.76  ? 68  LEU A CA  1 
ATOM   426  C  C   . LEU A 1 68  ? 30.866 26.199 48.564 1.00 8.59  ? 68  LEU A C   1 
ATOM   427  O  O   . LEU A 1 68  ? 31.463 27.241 48.840 1.00 8.65  ? 68  LEU A O   1 
ATOM   428  C  CB  . LEU A 1 68  ? 29.736 25.878 46.350 1.00 7.06  ? 68  LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 68  ? 29.875 25.466 44.878 1.00 7.99  ? 68  LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 68  ? 28.497 25.425 44.222 1.00 13.18 ? 68  LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 68  ? 30.823 26.375 44.088 1.00 9.62  ? 68  LEU A CD2 1 
ATOM   432  N  N   . HIS A 1 69  ? 30.112 25.551 49.445 1.00 8.60  ? 69  HIS A N   1 
ATOM   433  C  CA  . HIS A 1 69  ? 29.949 26.086 50.787 1.00 9.11  ? 69  HIS A CA  1 
ATOM   434  C  C   . HIS A 1 69  ? 31.237 25.983 51.587 1.00 10.99 ? 69  HIS A C   1 
ATOM   435  O  O   . HIS A 1 69  ? 31.568 26.890 52.352 1.00 11.70 ? 69  HIS A O   1 
ATOM   436  C  CB  . HIS A 1 69  ? 28.787 25.392 51.494 1.00 11.09 ? 69  HIS A CB  1 
ATOM   437  C  CG  . HIS A 1 69  ? 27.450 25.904 51.056 1.00 12.69 ? 69  HIS A CG  1 
ATOM   438  N  ND1 . HIS A 1 69  ? 27.062 27.215 51.254 1.00 18.27 ? 69  HIS A ND1 1 
ATOM   439  C  CD2 . HIS A 1 69  ? 26.437 25.308 50.393 1.00 15.91 ? 69  HIS A CD2 1 
ATOM   440  C  CE1 . HIS A 1 69  ? 25.856 27.393 50.750 1.00 23.18 ? 69  HIS A CE1 1 
ATOM   441  N  NE2 . HIS A 1 69  ? 25.450 26.252 50.220 1.00 21.81 ? 69  HIS A NE2 1 
ATOM   442  N  N   . LEU A 1 70  ? 31.999 24.913 51.397 1.00 9.94  ? 70  LEU A N   1 
ATOM   443  C  CA  . LEU A 1 70  ? 33.270 24.766 52.108 1.00 11.43 ? 70  LEU A CA  1 
ATOM   444  C  C   . LEU A 1 70  ? 34.245 25.886 51.752 1.00 10.49 ? 70  LEU A C   1 
ATOM   445  O  O   . LEU A 1 70  ? 34.843 26.506 52.635 1.00 10.88 ? 70  LEU A O   1 
ATOM   446  C  CB  . LEU A 1 70  ? 33.901 23.410 51.799 1.00 14.15 ? 70  LEU A CB  1 
ATOM   447  C  CG  . LEU A 1 70  ? 34.692 22.719 52.900 1.00 25.30 ? 70  LEU A CG  1 
ATOM   448  C  CD1 . LEU A 1 70  ? 33.867 22.628 54.181 1.00 15.52 ? 70  LEU A CD1 1 
ATOM   449  C  CD2 . LEU A 1 70  ? 35.117 21.332 52.423 1.00 16.34 ? 70  LEU A CD2 1 
ATOM   450  N  N   . VAL A 1 71  ? 34.410 26.159 50.458 1.00 9.33  ? 71  VAL A N   1 
ATOM   451  C  CA  . VAL A 1 71  ? 35.399 27.142 50.027 1.00 10.68 ? 71  VAL A CA  1 
ATOM   452  C  C   . VAL A 1 71  ? 34.963 28.556 50.431 1.00 11.34 ? 71  VAL A C   1 
ATOM   453  O  O   . VAL A 1 71  ? 35.773 29.327 50.950 1.00 11.17 ? 71  VAL A O   1 
ATOM   454  C  CB  . VAL A 1 71  ? 35.659 27.059 48.510 1.00 10.44 ? 71  VAL A CB  1 
ATOM   455  C  CG1 . VAL A 1 71  ? 36.623 28.148 48.069 1.00 11.35 ? 71  VAL A CG1 1 
ATOM   456  C  CG2 . VAL A 1 71  ? 36.247 25.699 48.173 1.00 10.61 ? 71  VAL A CG2 1 
HETATM 457  N  N   . MSE A 1 72  ? 33.693 28.899 50.228 1.00 10.37 ? 72  MSE A N   1 
HETATM 458  C  CA  . MSE A 1 72  ? 33.207 30.200 50.694 1.00 11.82 ? 72  MSE A CA  1 
HETATM 459  C  C   . MSE A 1 72  ? 33.384 30.327 52.193 1.00 13.44 ? 72  MSE A C   1 
HETATM 460  O  O   . MSE A 1 72  ? 33.672 31.418 52.704 1.00 13.70 ? 72  MSE A O   1 
HETATM 461  C  CB  . MSE A 1 72  ? 31.734 30.402 50.342 1.00 13.15 ? 72  MSE A CB  1 
HETATM 462  C  CG  . MSE A 1 72  ? 31.505 30.704 48.882 1.00 11.90 ? 72  MSE A CG  1 
HETATM 463  SE SE  . MSE A 1 72  ? 29.694 31.284 48.513 0.67 11.27 ? 72  MSE A SE  1 
HETATM 464  C  CE  . MSE A 1 72  ? 28.800 29.570 48.706 1.00 16.44 ? 72  MSE A CE  1 
ATOM   465  N  N   . GLY A 1 73  ? 33.180 29.222 52.898 1.00 10.72 ? 73  GLY A N   1 
ATOM   466  C  CA  . GLY A 1 73  ? 33.381 29.188 54.335 1.00 10.55 ? 73  GLY A CA  1 
ATOM   467  C  C   . GLY A 1 73  ? 34.813 29.499 54.736 1.00 10.19 ? 73  GLY A C   1 
ATOM   468  O  O   . GLY A 1 73  ? 35.032 30.234 55.705 1.00 10.66 ? 73  GLY A O   1 
ATOM   469  N  N   . TRP A 1 74  ? 35.794 28.956 54.017 1.00 8.18  ? 74  TRP A N   1 
ATOM   470  C  CA  . TRP A 1 74  ? 37.178 29.238 54.361 1.00 10.76 ? 74  TRP A CA  1 
ATOM   471  C  C   . TRP A 1 74  ? 37.422 30.736 54.317 1.00 10.82 ? 74  TRP A C   1 
ATOM   472  O  O   . TRP A 1 74  ? 38.015 31.303 55.235 1.00 10.40 ? 74  TRP A O   1 
ATOM   473  C  CB  . TRP A 1 74  ? 38.163 28.565 53.405 1.00 11.28 ? 74  TRP A CB  1 
ATOM   474  C  CG  . TRP A 1 74  ? 38.111 27.066 53.323 1.00 10.99 ? 74  TRP A CG  1 
ATOM   475  C  CD1 . TRP A 1 74  ? 37.679 26.184 54.272 1.00 10.54 ? 74  TRP A CD1 1 
ATOM   476  C  CD2 . TRP A 1 74  ? 38.515 26.285 52.195 1.00 8.58  ? 74  TRP A CD2 1 
ATOM   477  N  NE1 . TRP A 1 74  ? 37.787 24.884 53.792 1.00 10.29 ? 74  TRP A NE1 1 
ATOM   478  C  CE2 . TRP A 1 74  ? 38.303 24.929 52.525 1.00 8.30  ? 74  TRP A CE2 1 
ATOM   479  C  CE3 . TRP A 1 74  ? 39.050 26.605 50.944 1.00 9.55  ? 74  TRP A CE3 1 
ATOM   480  C  CZ2 . TRP A 1 74  ? 38.606 23.889 51.637 1.00 8.96  ? 74  TRP A CZ2 1 
ATOM   481  C  CZ3 . TRP A 1 74  ? 39.354 25.575 50.061 1.00 10.05 ? 74  TRP A CZ3 1 
ATOM   482  C  CH2 . TRP A 1 74  ? 39.130 24.232 50.416 1.00 10.73 ? 74  TRP A CH2 1 
ATOM   483  N  N   . ASP A 1 75  ? 36.979 31.378 53.241 1.00 9.63  ? 75  ASP A N   1 
ATOM   484  C  CA  . ASP A 1 75  ? 37.278 32.790 53.050 1.00 9.96  ? 75  ASP A CA  1 
ATOM   485  C  C   . ASP A 1 75  ? 36.506 33.650 54.037 1.00 11.11 ? 75  ASP A C   1 
ATOM   486  O  O   . ASP A 1 75  ? 37.082 34.552 54.641 1.00 10.44 ? 75  ASP A O   1 
ATOM   487  C  CB  . ASP A 1 75  ? 36.962 33.233 51.618 1.00 10.07 ? 75  ASP A CB  1 
ATOM   488  C  CG  . ASP A 1 75  ? 37.761 34.449 51.209 1.00 10.04 ? 75  ASP A CG  1 
ATOM   489  O  OD1 . ASP A 1 75  ? 38.989 34.390 51.332 1.00 11.22 ? 75  ASP A OD1 1 
ATOM   490  O  OD2 . ASP A 1 75  ? 37.172 35.478 50.803 1.00 12.01 ? 75  ASP A OD2 1 
ATOM   491  N  N   . ARG A 1 76  ? 35.221 33.364 54.207 1.00 9.58  ? 76  ARG A N   1 
ATOM   492  C  CA  . ARG A 1 76  ? 34.388 34.110 55.148 1.00 12.97 ? 76  ARG A CA  1 
ATOM   493  C  C   . ARG A 1 76  ? 34.956 33.988 56.556 1.00 11.38 ? 76  ARG A C   1 
ATOM   494  O  O   . ARG A 1 76  ? 35.106 34.987 57.275 1.00 12.52 ? 76  ARG A O   1 
ATOM   495  C  CB  . ARG A 1 76  ? 32.942 33.608 55.109 1.00 13.06 ? 76  ARG A CB  1 
ATOM   496  C  CG  . ARG A 1 76  ? 31.932 34.520 55.779 1.00 21.65 ? 76  ARG A CG  1 
ATOM   497  C  CD  . ARG A 1 76  ? 30.542 33.874 55.835 1.00 24.55 ? 76  ARG A CD  1 
ATOM   498  N  NE  . ARG A 1 76  ? 29.998 33.560 54.512 1.00 29.20 ? 76  ARG A NE  1 
ATOM   499  C  CZ  . ARG A 1 76  ? 29.814 32.325 54.047 1.00 30.79 ? 76  ARG A CZ  1 
ATOM   500  N  NH1 . ARG A 1 76  ? 30.127 31.276 54.796 1.00 24.56 ? 76  ARG A NH1 1 
ATOM   501  N  NH2 . ARG A 1 76  ? 29.310 32.139 52.833 1.00 23.83 ? 76  ARG A NH2 1 
ATOM   502  N  N   . ASP A 1 77  ? 35.289 32.765 56.949 1.00 9.49  ? 77  ASP A N   1 
ATOM   503  C  CA  . ASP A 1 77  ? 35.825 32.530 58.284 1.00 8.66  ? 77  ASP A CA  1 
ATOM   504  C  C   . ASP A 1 77  ? 37.159 33.239 58.464 1.00 11.38 ? 77  ASP A C   1 
ATOM   505  O  O   . ASP A 1 77  ? 37.387 33.869 59.507 1.00 12.26 ? 77  ASP A O   1 
ATOM   506  C  CB  . ASP A 1 77  ? 35.983 31.033 58.568 1.00 10.79 ? 77  ASP A CB  1 
ATOM   507  C  CG  . ASP A 1 77  ? 34.651 30.340 58.819 1.00 12.55 ? 77  ASP A CG  1 
ATOM   508  O  OD1 . ASP A 1 77  ? 33.601 31.024 58.848 1.00 15.26 ? 77  ASP A OD1 1 
ATOM   509  O  OD2 . ASP A 1 77  ? 34.666 29.103 59.011 1.00 14.92 ? 77  ASP A OD2 1 
ATOM   510  N  N   . GLU A 1 78  ? 38.043 33.169 57.476 1.00 9.85  ? 78  GLU A N   1 
ATOM   511  C  CA  . GLU A 1 78  ? 39.344 33.798 57.655 1.00 10.69 ? 78  GLU A CA  1 
ATOM   512  C  C   . GLU A 1 78  ? 39.189 35.302 57.852 1.00 12.11 ? 78  GLU A C   1 
ATOM   513  O  O   . GLU A 1 78  ? 39.792 35.874 58.760 1.00 13.93 ? 78  GLU A O   1 
ATOM   514  C  CB  . GLU A 1 78  ? 40.273 33.523 56.477 1.00 10.45 ? 78  GLU A CB  1 
ATOM   515  C  CG  . GLU A 1 78  ? 41.613 34.243 56.632 1.00 11.18 ? 78  GLU A CG  1 
ATOM   516  C  CD  . GLU A 1 78  ? 42.653 33.805 55.621 1.00 11.64 ? 78  GLU A CD  1 
ATOM   517  O  OE1 . GLU A 1 78  ? 42.778 32.584 55.381 1.00 12.68 ? 78  GLU A OE1 1 
ATOM   518  O  OE2 . GLU A 1 78  ? 43.342 34.685 55.064 1.00 15.54 ? 78  GLU A OE2 1 
ATOM   519  N  N   . LEU A 1 79  ? 38.363 35.940 57.028 1.00 11.46 ? 79  LEU A N   1 
ATOM   520  C  CA  . LEU A 1 79  ? 38.215 37.388 57.127 1.00 14.93 ? 79  LEU A CA  1 
ATOM   521  C  C   . LEU A 1 79  ? 37.489 37.783 58.418 1.00 15.08 ? 79  LEU A C   1 
ATOM   522  O  O   . LEU A 1 79  ? 37.709 38.875 58.950 1.00 18.88 ? 79  LEU A O   1 
ATOM   523  C  CB  . LEU A 1 79  ? 37.489 37.939 55.893 1.00 16.12 ? 79  LEU A CB  1 
ATOM   524  C  CG  . LEU A 1 79  ? 38.302 37.921 54.589 1.00 22.81 ? 79  LEU A CG  1 
ATOM   525  C  CD1 . LEU A 1 79  ? 37.590 38.689 53.483 1.00 30.45 ? 79  LEU A CD1 1 
ATOM   526  C  CD2 . LEU A 1 79  ? 39.712 38.458 54.796 1.00 26.01 ? 79  LEU A CD2 1 
ATOM   527  N  N   . ALA A 1 80  ? 36.652 36.896 58.943 1.00 11.50 ? 80  ALA A N   1 
ATOM   528  C  CA  . ALA A 1 80  ? 35.895 37.217 60.154 1.00 12.35 ? 80  ALA A CA  1 
ATOM   529  C  C   . ALA A 1 80  ? 36.649 36.892 61.442 1.00 12.67 ? 80  ALA A C   1 
ATOM   530  O  O   . ALA A 1 80  ? 36.183 37.215 62.531 1.00 14.28 ? 80  ALA A O   1 
ATOM   531  C  CB  . ALA A 1 80  ? 34.553 36.500 60.148 1.00 14.87 ? 80  ALA A CB  1 
ATOM   532  N  N   . GLY A 1 81  ? 37.821 36.276 61.327 1.00 11.47 ? 81  GLY A N   1 
ATOM   533  C  CA  . GLY A 1 81  ? 38.579 35.923 62.512 1.00 12.46 ? 81  GLY A CA  1 
ATOM   534  C  C   . GLY A 1 81  ? 38.222 34.580 63.118 1.00 13.15 ? 81  GLY A C   1 
ATOM   535  O  O   . GLY A 1 81  ? 38.423 34.355 64.311 1.00 13.65 ? 81  GLY A O   1 
ATOM   536  N  N   . LYS A 1 82  ? 37.682 33.684 62.298 1.00 14.38 ? 82  LYS A N   1 
ATOM   537  C  CA  . LYS A 1 82  ? 37.479 32.300 62.698 1.00 13.73 ? 82  LYS A CA  1 
ATOM   538  C  C   . LYS A 1 82  ? 38.572 31.479 62.014 1.00 16.41 ? 82  LYS A C   1 
ATOM   539  O  O   . LYS A 1 82  ? 38.545 31.310 60.801 1.00 23.10 ? 82  LYS A O   1 
ATOM   540  C  CB  . LYS A 1 82  ? 36.083 31.805 62.301 1.00 14.61 ? 82  LYS A CB  1 
ATOM   541  C  CG  . LYS A 1 82  ? 34.911 32.547 62.974 1.00 16.40 ? 82  LYS A CG  1 
ATOM   542  C  CD  . LYS A 1 82  ? 33.605 32.382 62.171 1.00 15.78 ? 82  LYS A CD  1 
ATOM   543  C  CE  . LYS A 1 82  ? 33.117 30.940 62.198 1.00 16.84 ? 82  LYS A CE  1 
ATOM   544  N  NZ  . LYS A 1 82  ? 31.990 30.701 61.244 1.00 18.95 ? 82  LYS A NZ  1 
ATOM   545  N  N   . PRO A 1 83  ? 39.569 31.013 62.784 1.00 34.35 ? 83  PRO A N   1 
ATOM   546  C  CA  . PRO A 1 83  ? 40.591 30.135 62.196 1.00 31.23 ? 83  PRO A CA  1 
ATOM   547  C  C   . PRO A 1 83  ? 40.049 28.975 61.357 1.00 20.50 ? 83  PRO A C   1 
ATOM   548  O  O   . PRO A 1 83  ? 39.065 28.319 61.689 1.00 23.88 ? 83  PRO A O   1 
ATOM   549  C  CB  . PRO A 1 83  ? 41.344 29.638 63.425 1.00 35.55 ? 83  PRO A CB  1 
ATOM   550  C  CG  . PRO A 1 83  ? 41.344 30.867 64.294 1.00 28.17 ? 83  PRO A CG  1 
ATOM   551  C  CD  . PRO A 1 83  ? 39.988 31.511 64.106 1.00 32.06 ? 83  PRO A CD  1 
ATOM   552  N  N   . VAL A 1 84  ? 40.707 28.794 60.222 1.00 20.11 ? 84  VAL A N   1 
ATOM   553  C  CA  . VAL A 1 84  ? 40.255 27.866 59.198 1.00 14.02 ? 84  VAL A CA  1 
ATOM   554  C  C   . VAL A 1 84  ? 40.992 26.533 59.294 1.00 15.10 ? 84  VAL A C   1 
ATOM   555  O  O   . VAL A 1 84  ? 42.220 26.495 59.305 1.00 22.20 ? 84  VAL A O   1 
ATOM   556  C  CB  . VAL A 1 84  ? 40.449 28.473 57.808 1.00 14.76 ? 84  VAL A CB  1 
ATOM   557  C  CG1 . VAL A 1 84  ? 40.089 27.481 56.731 1.00 15.90 ? 84  VAL A CG1 1 
ATOM   558  C  CG2 . VAL A 1 84  ? 39.600 29.738 57.683 1.00 16.39 ? 84  VAL A CG2 1 
ATOM   559  N  N   . ILE A 1 85  ? 40.231 25.448 59.352 1.00 17.58 ? 85  ILE A N   1 
ATOM   560  C  CA  . ILE A 1 85  ? 40.810 24.110 59.290 1.00 17.35 ? 85  ILE A CA  1 
ATOM   561  C  C   . ILE A 1 85  ? 40.429 23.477 57.959 1.00 14.23 ? 85  ILE A C   1 
ATOM   562  O  O   . ILE A 1 85  ? 39.258 23.289 57.663 1.00 17.71 ? 85  ILE A O   1 
ATOM   563  C  CB  . ILE A 1 85  ? 40.338 23.229 60.452 1.00 20.88 ? 85  ILE A CB  1 
ATOM   564  C  CG1 . ILE A 1 85  ? 40.768 23.839 61.790 1.00 23.39 ? 85  ILE A CG1 1 
ATOM   565  C  CG2 . ILE A 1 85  ? 40.909 21.825 60.312 1.00 23.35 ? 85  ILE A CG2 1 
ATOM   566  C  CD1 . ILE A 1 85  ? 40.129 23.177 62.992 1.00 23.90 ? 85  ILE A CD1 1 
HETATM 567  N  N   . MSE A 1 86  ? 41.434 23.165 57.155 1.00 16.45 ? 86  MSE A N   1 
HETATM 568  C  CA  . MSE A 1 86  ? 41.167 22.678 55.809 1.00 16.16 ? 86  MSE A CA  1 
HETATM 569  C  C   . MSE A 1 86  ? 41.488 21.204 55.662 1.00 14.46 ? 86  MSE A C   1 
HETATM 570  O  O   . MSE A 1 86  ? 42.476 20.727 56.228 1.00 14.87 ? 86  MSE A O   1 
HETATM 571  C  CB  . MSE A 1 86  ? 41.953 23.489 54.792 1.00 19.47 ? 86  MSE A CB  1 
HETATM 572  C  CG  . MSE A 1 86  ? 41.401 24.889 54.605 1.00 16.60 ? 86  MSE A CG  1 
HETATM 573  SE SE  . MSE A 1 86  ? 42.793 25.904 53.795 1.00 31.08 ? 86  MSE A SE  1 
HETATM 574  C  CE  . MSE A 1 86  ? 42.581 25.160 51.995 1.00 7.66  ? 86  MSE A CE  1 
ATOM   575  N  N   . PRO A 1 87  ? 40.662 20.483 54.889 1.00 13.11 ? 87  PRO A N   1 
ATOM   576  C  CA  . PRO A 1 87  ? 39.500 21.032 54.172 1.00 13.32 ? 87  PRO A CA  1 
ATOM   577  C  C   . PRO A 1 87  ? 38.286 21.287 55.071 1.00 14.99 ? 87  PRO A C   1 
ATOM   578  O  O   . PRO A 1 87  ? 37.487 22.175 54.778 1.00 16.31 ? 87  PRO A O   1 
ATOM   579  C  CB  . PRO A 1 87  ? 39.190 19.949 53.131 1.00 15.58 ? 87  PRO A CB  1 
ATOM   580  C  CG  . PRO A 1 87  ? 39.733 18.683 53.724 1.00 14.66 ? 87  PRO A CG  1 
ATOM   581  C  CD  . PRO A 1 87  ? 40.945 19.087 54.502 1.00 13.23 ? 87  PRO A CD  1 
ATOM   582  N  N   . ALA A 1 88  ? 38.163 20.528 56.152 1.00 14.94 ? 88  ALA A N   1 
ATOM   583  C  CA  . ALA A 1 88  ? 37.030 20.664 57.065 1.00 18.39 ? 88  ALA A CA  1 
ATOM   584  C  C   . ALA A 1 88  ? 37.454 20.159 58.438 1.00 23.13 ? 88  ALA A C   1 
ATOM   585  O  O   . ALA A 1 88  ? 38.332 19.308 58.520 1.00 22.58 ? 88  ALA A O   1 
ATOM   586  C  CB  . ALA A 1 88  ? 35.826 19.898 56.543 1.00 20.78 ? 88  ALA A CB  1 
ATOM   587  N  N   . PRO A 1 89  ? 36.854 20.698 59.518 1.00 20.81 ? 89  PRO A N   1 
ATOM   588  C  CA  . PRO A 1 89  ? 37.244 20.386 60.901 1.00 26.84 ? 89  PRO A CA  1 
ATOM   589  C  C   . PRO A 1 89  ? 37.532 18.908 61.208 1.00 30.96 ? 89  PRO A C   1 
ATOM   590  O  O   . PRO A 1 89  ? 38.534 18.615 61.867 1.00 36.13 ? 89  PRO A O   1 
ATOM   591  C  CB  . PRO A 1 89  ? 36.034 20.867 61.704 1.00 26.12 ? 89  PRO A CB  1 
ATOM   592  C  CG  . PRO A 1 89  ? 35.555 22.048 60.934 1.00 28.46 ? 89  PRO A CG  1 
ATOM   593  C  CD  . PRO A 1 89  ? 35.801 21.733 59.475 1.00 24.31 ? 89  PRO A CD  1 
ATOM   594  N  N   . GLY A 1 90  ? 36.683 17.999 60.743 1.00 25.05 ? 90  GLY A N   1 
ATOM   595  C  CA  . GLY A 1 90  ? 36.854 16.587 61.054 1.00 24.20 ? 90  GLY A CA  1 
ATOM   596  C  C   . GLY A 1 90  ? 37.296 15.698 59.900 1.00 17.69 ? 90  GLY A C   1 
ATOM   597  O  O   . GLY A 1 90  ? 37.171 14.472 59.975 1.00 19.91 ? 90  GLY A O   1 
ATOM   598  N  N   . TYR A 1 91  ? 37.800 16.313 58.833 1.00 15.62 ? 91  TYR A N   1 
ATOM   599  C  CA  . TYR A 1 91  ? 38.285 15.583 57.660 1.00 14.25 ? 91  TYR A CA  1 
ATOM   600  C  C   . TYR A 1 91  ? 39.595 16.174 57.175 1.00 13.71 ? 91  TYR A C   1 
ATOM   601  O  O   . TYR A 1 91  ? 39.651 17.345 56.815 1.00 16.18 ? 91  TYR A O   1 
ATOM   602  C  CB  . TYR A 1 91  ? 37.254 15.612 56.517 1.00 15.59 ? 91  TYR A CB  1 
ATOM   603  C  CG  . TYR A 1 91  ? 35.942 14.979 56.887 1.00 14.21 ? 91  TYR A CG  1 
ATOM   604  C  CD1 . TYR A 1 91  ? 34.903 15.742 57.394 1.00 17.67 ? 91  TYR A CD1 1 
ATOM   605  C  CD2 . TYR A 1 91  ? 35.750 13.614 56.754 1.00 17.70 ? 91  TYR A CD2 1 
ATOM   606  C  CE1 . TYR A 1 91  ? 33.700 15.163 57.752 1.00 19.18 ? 91  TYR A CE1 1 
ATOM   607  C  CE2 . TYR A 1 91  ? 34.559 13.027 57.112 1.00 20.77 ? 91  TYR A CE2 1 
ATOM   608  C  CZ  . TYR A 1 91  ? 33.537 13.807 57.610 1.00 15.56 ? 91  TYR A CZ  1 
ATOM   609  O  OH  . TYR A 1 91  ? 32.349 13.220 57.968 1.00 22.17 ? 91  TYR A OH  1 
ATOM   610  N  N   . LYS A 1 92  ? 40.652 15.371 57.163 1.00 13.22 ? 92  LYS A N   1 
ATOM   611  C  CA  . LYS A 1 92  ? 41.925 15.801 56.596 1.00 14.16 ? 92  LYS A CA  1 
ATOM   612  C  C   . LYS A 1 92  ? 41.873 15.656 55.081 1.00 11.85 ? 92  LYS A C   1 
ATOM   613  O  O   . LYS A 1 92  ? 40.950 15.042 54.548 1.00 11.43 ? 92  LYS A O   1 
ATOM   614  C  CB  . LYS A 1 92  ? 43.093 14.985 57.158 1.00 18.03 ? 92  LYS A CB  1 
ATOM   615  C  CG  . LYS A 1 92  ? 43.163 14.947 58.680 1.00 20.91 ? 92  LYS A CG  1 
ATOM   616  C  CD  . LYS A 1 92  ? 44.154 15.959 59.206 1.00 22.21 ? 92  LYS A CD  1 
ATOM   617  C  CE  . LYS A 1 92  ? 44.354 15.797 60.703 1.00 24.60 ? 92  LYS A CE  1 
ATOM   618  N  NZ  . LYS A 1 92  ? 45.247 16.848 61.273 1.00 37.90 ? 92  LYS A NZ  1 
ATOM   619  N  N   . TRP A 1 93  ? 42.870 16.210 54.397 1.00 11.43 ? 93  TRP A N   1 
ATOM   620  C  CA  . TRP A 1 93  ? 42.952 16.100 52.941 1.00 10.77 ? 93  TRP A CA  1 
ATOM   621  C  C   . TRP A 1 93  ? 43.023 14.643 52.494 1.00 14.12 ? 93  TRP A C   1 
ATOM   622  O  O   . TRP A 1 93  ? 42.611 14.320 51.384 1.00 15.42 ? 93  TRP A O   1 
ATOM   623  C  CB  . TRP A 1 93  ? 44.148 16.883 52.397 1.00 13.16 ? 93  TRP A CB  1 
ATOM   624  C  CG  . TRP A 1 93  ? 43.875 18.361 52.265 1.00 10.95 ? 93  TRP A CG  1 
ATOM   625  C  CD1 . TRP A 1 93  ? 44.449 19.371 52.980 1.00 12.39 ? 93  TRP A CD1 1 
ATOM   626  C  CD2 . TRP A 1 93  ? 42.949 18.982 51.361 1.00 9.38  ? 93  TRP A CD2 1 
ATOM   627  N  NE1 . TRP A 1 93  ? 43.942 20.586 52.576 1.00 13.84 ? 93  TRP A NE1 1 
ATOM   628  C  CE2 . TRP A 1 93  ? 43.024 20.374 51.580 1.00 12.89 ? 93  TRP A CE2 1 
ATOM   629  C  CE3 . TRP A 1 93  ? 42.068 18.496 50.382 1.00 12.11 ? 93  TRP A CE3 1 
ATOM   630  C  CZ2 . TRP A 1 93  ? 42.247 21.288 50.863 1.00 11.81 ? 93  TRP A CZ2 1 
ATOM   631  C  CZ3 . TRP A 1 93  ? 41.301 19.408 49.663 1.00 11.22 ? 93  TRP A CZ3 1 
ATOM   632  C  CH2 . TRP A 1 93  ? 41.395 20.789 49.915 1.00 11.97 ? 93  TRP A CH2 1 
ATOM   633  N  N   . ASN A 1 94  ? 43.526 13.762 53.359 1.00 15.24 ? 94  ASN A N   1 
ATOM   634  C  CA  . ASN A 1 94  ? 43.604 12.332 53.043 1.00 14.16 ? 94  ASN A CA  1 
ATOM   635  C  C   . ASN A 1 94  ? 42.302 11.583 53.296 1.00 16.86 ? 94  ASN A C   1 
ATOM   636  O  O   . ASN A 1 94  ? 42.225 10.363 53.096 1.00 19.16 ? 94  ASN A O   1 
ATOM   637  C  CB  . ASN A 1 94  ? 44.742 11.682 53.842 1.00 14.44 ? 94  ASN A CB  1 
ATOM   638  C  CG  . ASN A 1 94  ? 46.096 12.051 53.305 1.00 18.01 ? 94  ASN A CG  1 
ATOM   639  O  OD1 . ASN A 1 94  ? 46.256 12.246 52.101 1.00 21.06 ? 94  ASN A OD1 1 
ATOM   640  N  ND2 . ASN A 1 94  ? 47.081 12.178 54.193 1.00 16.14 ? 94  ASN A ND2 1 
ATOM   641  N  N   . GLN A 1 95  ? 41.274 12.312 53.729 1.00 13.14 ? 95  GLN A N   1 
ATOM   642  C  CA  . GLN A 1 95  ? 39.973 11.711 54.006 1.00 12.79 ? 95  GLN A CA  1 
ATOM   643  C  C   . GLN A 1 95  ? 38.864 12.271 53.108 1.00 12.38 ? 95  GLN A C   1 
ATOM   644  O  O   . GLN A 1 95  ? 37.740 12.470 53.558 1.00 14.27 ? 95  GLN A O   1 
ATOM   645  C  CB  . GLN A 1 95  ? 39.596 11.916 55.472 1.00 13.19 ? 95  GLN A CB  1 
ATOM   646  C  CG  . GLN A 1 95  ? 40.583 11.293 56.437 1.00 13.94 ? 95  GLN A CG  1 
ATOM   647  C  CD  . GLN A 1 95  ? 40.261 11.639 57.869 1.00 15.47 ? 95  GLN A CD  1 
ATOM   648  O  OE1 . GLN A 1 95  ? 40.438 12.774 58.297 1.00 14.84 ? 95  GLN A OE1 1 
ATOM   649  N  NE2 . GLN A 1 95  ? 39.765 10.664 58.614 1.00 20.17 ? 95  GLN A NE2 1 
ATOM   650  N  N   . LEU A 1 96  ? 39.184 12.515 51.840 1.00 15.64 ? 96  LEU A N   1 
ATOM   651  C  CA  . LEU A 1 96  ? 38.202 13.085 50.917 1.00 13.56 ? 96  LEU A CA  1 
ATOM   652  C  C   . LEU A 1 96  ? 37.002 12.170 50.703 1.00 19.15 ? 96  LEU A C   1 
ATOM   653  O  O   . LEU A 1 96  ? 35.881 12.645 50.544 1.00 16.40 ? 96  LEU A O   1 
ATOM   654  C  CB  . LEU A 1 96  ? 38.852 13.406 49.572 1.00 14.36 ? 96  LEU A CB  1 
ATOM   655  C  CG  . LEU A 1 96  ? 39.861 14.554 49.576 1.00 17.76 ? 96  LEU A CG  1 
ATOM   656  C  CD1 . LEU A 1 96  ? 40.466 14.750 48.193 1.00 25.52 ? 96  LEU A CD1 1 
ATOM   657  C  CD2 . LEU A 1 96  ? 39.231 15.849 50.073 1.00 19.26 ? 96  LEU A CD2 1 
ATOM   658  N  N   . GLY A 1 97  ? 37.235 10.862 50.705 1.00 19.80 ? 97  GLY A N   1 
ATOM   659  C  CA  . GLY A 1 97  ? 36.155 9.904  50.546 1.00 21.02 ? 97  GLY A CA  1 
ATOM   660  C  C   . GLY A 1 97  ? 35.077 10.101 51.590 1.00 18.95 ? 97  GLY A C   1 
ATOM   661  O  O   . GLY A 1 97  ? 33.882 10.157 51.272 1.00 19.87 ? 97  GLY A O   1 
ATOM   662  N  N   . GLY A 1 98  ? 35.501 10.226 52.845 1.00 18.73 ? 98  GLY A N   1 
ATOM   663  C  CA  . GLY A 1 98  ? 34.588 10.479 53.943 1.00 16.88 ? 98  GLY A CA  1 
ATOM   664  C  C   . GLY A 1 98  ? 33.931 11.848 53.853 1.00 12.88 ? 98  GLY A C   1 
ATOM   665  O  O   . GLY A 1 98  ? 32.751 12.000 54.183 1.00 16.62 ? 98  GLY A O   1 
ATOM   666  N  N   . LEU A 1 99  ? 34.706 12.838 53.417 1.00 14.97 ? 99  LEU A N   1 
ATOM   667  C  CA  . LEU A 1 99  ? 34.181 14.192 53.274 1.00 13.52 ? 99  LEU A CA  1 
ATOM   668  C  C   . LEU A 1 99  ? 33.032 14.184 52.271 1.00 13.87 ? 99  LEU A C   1 
ATOM   669  O  O   . LEU A 1 99  ? 31.974 14.743 52.539 1.00 14.92 ? 99  LEU A O   1 
ATOM   670  C  CB  . LEU A 1 99  ? 35.273 15.168 52.837 1.00 15.21 ? 99  LEU A CB  1 
ATOM   671  C  CG  . LEU A 1 99  ? 34.822 16.624 52.673 1.00 12.48 ? 99  LEU A CG  1 
ATOM   672  C  CD1 . LEU A 1 99  ? 34.336 17.201 53.998 1.00 15.64 ? 99  LEU A CD1 1 
ATOM   673  C  CD2 . LEU A 1 99  ? 35.954 17.455 52.103 1.00 14.73 ? 99  LEU A CD2 1 
ATOM   674  N  N   . TYR A 1 100 ? 33.239 13.524 51.131 1.00 16.88 ? 100 TYR A N   1 
ATOM   675  C  CA  . TYR A 1 100 ? 32.202 13.466 50.097 1.00 18.19 ? 100 TYR A CA  1 
ATOM   676  C  C   . TYR A 1 100 ? 30.954 12.782 50.617 1.00 17.67 ? 100 TYR A C   1 
ATOM   677  O  O   . TYR A 1 100 ? 29.844 13.227 50.345 1.00 15.17 ? 100 TYR A O   1 
ATOM   678  C  CB  . TYR A 1 100 ? 32.695 12.742 48.843 1.00 15.01 ? 100 TYR A CB  1 
ATOM   679  C  CG  . TYR A 1 100 ? 33.890 13.386 48.196 1.00 15.24 ? 100 TYR A CG  1 
ATOM   680  C  CD1 . TYR A 1 100 ? 34.222 14.707 48.469 1.00 18.46 ? 100 TYR A CD1 1 
ATOM   681  C  CD2 . TYR A 1 100 ? 34.703 12.674 47.327 1.00 17.15 ? 100 TYR A CD2 1 
ATOM   682  C  CE1 . TYR A 1 100 ? 35.320 15.293 47.895 1.00 16.01 ? 100 TYR A CE1 1 
ATOM   683  C  CE2 . TYR A 1 100 ? 35.800 13.254 46.745 1.00 20.97 ? 100 TYR A CE2 1 
ATOM   684  C  CZ  . TYR A 1 100 ? 36.105 14.571 47.030 1.00 16.00 ? 100 TYR A CZ  1 
ATOM   685  O  OH  . TYR A 1 100 ? 37.209 15.136 46.437 1.00 25.78 ? 100 TYR A OH  1 
ATOM   686  N  N   . GLN A 1 101 ? 31.123 11.701 51.370 1.00 16.82 ? 101 GLN A N   1 
ATOM   687  C  CA  . GLN A 1 101 ? 29.968 11.024 51.939 1.00 16.91 ? 101 GLN A CA  1 
ATOM   688  C  C   . GLN A 1 101 ? 29.209 11.944 52.890 1.00 16.39 ? 101 GLN A C   1 
ATOM   689  O  O   . GLN A 1 101 ? 27.986 11.880 52.975 1.00 18.17 ? 101 GLN A O   1 
ATOM   690  C  CB  . GLN A 1 101 ? 30.382 9.731  52.653 1.00 23.41 ? 101 GLN A CB  1 
ATOM   691  C  CG  . GLN A 1 101 ? 30.760 8.595  51.701 1.00 25.28 ? 101 GLN A CG  1 
ATOM   692  C  CD  . GLN A 1 101 ? 29.649 8.249  50.715 1.00 27.64 ? 101 GLN A CD  1 
ATOM   693  O  OE1 . GLN A 1 101 ? 28.481 8.139  51.087 1.00 33.50 ? 101 GLN A OE1 1 
ATOM   694  N  NE2 . GLN A 1 101 ? 30.014 8.084  49.446 1.00 20.71 ? 101 GLN A NE2 1 
ATOM   695  N  N   . SER A 1 102 ? 29.928 12.815 53.598 1.00 16.32 ? 102 SER A N   1 
ATOM   696  C  CA  . SER A 1 102 ? 29.261 13.751 54.489 1.00 17.55 ? 102 SER A CA  1 
ATOM   697  C  C   . SER A 1 102 ? 28.447 14.757 53.667 1.00 13.55 ? 102 SER A C   1 
ATOM   698  O  O   . SER A 1 102 ? 27.384 15.187 54.103 1.00 14.33 ? 102 SER A O   1 
ATOM   699  C  CB  . SER A 1 102 ? 30.261 14.471 55.408 1.00 17.23 ? 102 SER A CB  1 
ATOM   700  O  OG  . SER A 1 102 ? 31.004 15.473 54.734 1.00 19.27 ? 102 SER A OG  1 
ATOM   701  N  N   . PHE A 1 103 ? 28.939 15.112 52.478 1.00 12.61 ? 103 PHE A N   1 
ATOM   702  C  CA  . PHE A 1 103 ? 28.169 15.981 51.585 1.00 12.10 ? 103 PHE A CA  1 
ATOM   703  C  C   . PHE A 1 103 ? 26.855 15.314 51.182 1.00 15.11 ? 103 PHE A C   1 
ATOM   704  O  O   . PHE A 1 103 ? 25.786 15.919 51.243 1.00 14.87 ? 103 PHE A O   1 
ATOM   705  C  CB  . PHE A 1 103 ? 28.940 16.323 50.307 1.00 11.53 ? 103 PHE A CB  1 
ATOM   706  C  CG  . PHE A 1 103 ? 30.174 17.177 50.499 1.00 11.47 ? 103 PHE A CG  1 
ATOM   707  C  CD1 . PHE A 1 103 ? 30.402 17.899 51.666 1.00 12.26 ? 103 PHE A CD1 1 
ATOM   708  C  CD2 . PHE A 1 103 ? 31.101 17.272 49.471 1.00 12.64 ? 103 PHE A CD2 1 
ATOM   709  C  CE1 . PHE A 1 103 ? 31.555 18.684 51.793 1.00 12.57 ? 103 PHE A CE1 1 
ATOM   710  C  CE2 . PHE A 1 103 ? 32.244 18.053 49.594 1.00 12.58 ? 103 PHE A CE2 1 
ATOM   711  C  CZ  . PHE A 1 103 ? 32.468 18.757 50.748 1.00 12.22 ? 103 PHE A CZ  1 
ATOM   712  N  N   . TYR A 1 104 ? 26.952 14.065 50.739 1.00 14.72 ? 104 TYR A N   1 
ATOM   713  C  CA  . TYR A 1 104 ? 25.777 13.328 50.284 1.00 13.43 ? 104 TYR A CA  1 
ATOM   714  C  C   . TYR A 1 104 ? 24.776 13.162 51.425 1.00 17.25 ? 104 TYR A C   1 
ATOM   715  O  O   . TYR A 1 104 ? 23.567 13.311 51.234 1.00 19.76 ? 104 TYR A O   1 
ATOM   716  C  CB  . TYR A 1 104 ? 26.179 11.957 49.719 1.00 13.92 ? 104 TYR A CB  1 
ATOM   717  C  CG  . TYR A 1 104 ? 27.279 12.002 48.676 1.00 13.82 ? 104 TYR A CG  1 
ATOM   718  C  CD1 . TYR A 1 104 ? 27.450 13.113 47.858 1.00 13.06 ? 104 TYR A CD1 1 
ATOM   719  C  CD2 . TYR A 1 104 ? 28.160 10.935 48.520 1.00 16.03 ? 104 TYR A CD2 1 
ATOM   720  C  CE1 . TYR A 1 104 ? 28.458 13.154 46.917 1.00 13.10 ? 104 TYR A CE1 1 
ATOM   721  C  CE2 . TYR A 1 104 ? 29.169 10.969 47.581 1.00 15.28 ? 104 TYR A CE2 1 
ATOM   722  C  CZ  . TYR A 1 104 ? 29.320 12.082 46.781 1.00 14.62 ? 104 TYR A CZ  1 
ATOM   723  O  OH  . TYR A 1 104 ? 30.332 12.124 45.849 1.00 17.98 ? 104 TYR A OH  1 
ATOM   724  N  N   . ALA A 1 105 ? 25.280 12.868 52.621 1.00 17.01 ? 105 ALA A N   1 
ATOM   725  C  CA  . ALA A 1 105 ? 24.408 12.691 53.774 1.00 18.65 ? 105 ALA A CA  1 
ATOM   726  C  C   . ALA A 1 105 ? 23.673 13.976 54.131 1.00 16.62 ? 105 ALA A C   1 
ATOM   727  O  O   . ALA A 1 105 ? 22.500 13.942 54.501 1.00 20.99 ? 105 ALA A O   1 
ATOM   728  C  CB  . ALA A 1 105 ? 25.206 12.197 54.969 1.00 21.28 ? 105 ALA A CB  1 
ATOM   729  N  N   . ALA A 1 106 ? 24.370 15.106 54.012 1.00 17.43 ? 106 ALA A N   1 
ATOM   730  C  CA  . ALA A 1 106 ? 23.828 16.397 54.426 1.00 15.14 ? 106 ALA A CA  1 
ATOM   731  C  C   . ALA A 1 106 ? 22.613 16.816 53.599 1.00 16.64 ? 106 ALA A C   1 
ATOM   732  O  O   . ALA A 1 106 ? 21.716 17.496 54.100 1.00 19.38 ? 106 ALA A O   1 
ATOM   733  C  CB  . ALA A 1 106 ? 24.911 17.466 54.345 1.00 20.83 ? 106 ALA A CB  1 
ATOM   734  N  N   . TYR A 1 107 ? 22.577 16.401 52.334 1.00 16.97 ? 107 TYR A N   1 
ATOM   735  C  CA  . TYR A 1 107 ? 21.515 16.826 51.429 1.00 15.75 ? 107 TYR A CA  1 
ATOM   736  C  C   . TYR A 1 107 ? 20.609 15.683 50.966 1.00 17.64 ? 107 TYR A C   1 
ATOM   737  O  O   . TYR A 1 107 ? 19.764 15.878 50.093 1.00 16.37 ? 107 TYR A O   1 
ATOM   738  C  CB  . TYR A 1 107 ? 22.128 17.523 50.209 1.00 17.09 ? 107 TYR A CB  1 
ATOM   739  C  CG  . TYR A 1 107 ? 22.976 18.706 50.585 1.00 13.19 ? 107 TYR A CG  1 
ATOM   740  C  CD1 . TYR A 1 107 ? 22.389 19.888 51.023 1.00 16.56 ? 107 TYR A CD1 1 
ATOM   741  C  CD2 . TYR A 1 107 ? 24.364 18.648 50.520 1.00 13.72 ? 107 TYR A CD2 1 
ATOM   742  C  CE1 . TYR A 1 107 ? 23.157 20.977 51.381 1.00 16.27 ? 107 TYR A CE1 1 
ATOM   743  C  CE2 . TYR A 1 107 ? 25.142 19.738 50.885 1.00 14.96 ? 107 TYR A CE2 1 
ATOM   744  C  CZ  . TYR A 1 107 ? 24.531 20.899 51.307 1.00 15.42 ? 107 TYR A CZ  1 
ATOM   745  O  OH  . TYR A 1 107 ? 25.304 21.987 51.668 1.00 23.05 ? 107 TYR A OH  1 
ATOM   746  N  N   . ALA A 1 108 ? 20.761 14.503 51.564 1.00 18.77 ? 108 ALA A N   1 
ATOM   747  C  CA  . ALA A 1 108 ? 20.057 13.308 51.091 1.00 18.51 ? 108 ALA A CA  1 
ATOM   748  C  C   . ALA A 1 108 ? 18.531 13.391 51.201 1.00 20.35 ? 108 ALA A C   1 
ATOM   749  O  O   . ALA A 1 108 ? 17.815 12.652 50.522 1.00 19.17 ? 108 ALA A O   1 
ATOM   750  C  CB  . ALA A 1 108 ? 20.556 12.082 51.844 1.00 20.23 ? 108 ALA A CB  1 
ATOM   751  N  N   . ASP A 1 109 ? 18.038 14.288 52.046 1.00 20.74 ? 109 ASP A N   1 
ATOM   752  C  CA  . ASP A 1 109 ? 16.604 14.410 52.275 1.00 22.37 ? 109 ASP A CA  1 
ATOM   753  C  C   . ASP A 1 109 ? 15.883 15.277 51.237 1.00 17.28 ? 109 ASP A C   1 
ATOM   754  O  O   . ASP A 1 109 ? 14.656 15.221 51.117 1.00 24.19 ? 109 ASP A O   1 
ATOM   755  C  CB  . ASP A 1 109 ? 16.345 14.974 53.676 1.00 27.51 ? 109 ASP A CB  1 
ATOM   756  C  CG  . ASP A 1 109 ? 16.937 16.356 53.871 1.00 33.70 ? 109 ASP A CG  1 
ATOM   757  O  OD1 . ASP A 1 109 ? 18.140 16.547 53.580 1.00 35.98 ? 109 ASP A OD1 1 
ATOM   758  O  OD2 . ASP A 1 109 ? 16.195 17.258 54.315 1.00 46.91 ? 109 ASP A OD2 1 
ATOM   759  N  N   . LEU A 1 110 ? 16.637 16.084 50.497 1.00 17.11 ? 110 LEU A N   1 
ATOM   760  C  CA  . LEU A 1 110 ? 16.025 17.028 49.564 1.00 14.41 ? 110 LEU A CA  1 
ATOM   761  C  C   . LEU A 1 110 ? 15.589 16.336 48.286 1.00 14.10 ? 110 LEU A C   1 
ATOM   762  O  O   . LEU A 1 110 ? 16.286 15.456 47.783 1.00 14.07 ? 110 LEU A O   1 
ATOM   763  C  CB  . LEU A 1 110 ? 16.996 18.168 49.235 1.00 17.32 ? 110 LEU A CB  1 
ATOM   764  C  CG  . LEU A 1 110 ? 17.470 19.053 50.394 1.00 21.22 ? 110 LEU A CG  1 
ATOM   765  C  CD1 . LEU A 1 110 ? 18.400 20.140 49.881 1.00 21.03 ? 110 LEU A CD1 1 
ATOM   766  C  CD2 . LEU A 1 110 ? 16.288 19.659 51.147 1.00 25.20 ? 110 LEU A CD2 1 
ATOM   767  N  N   . SER A 1 111 ? 14.441 16.740 47.752 1.00 11.64 ? 111 SER A N   1 
ATOM   768  C  CA  . SER A 1 111 ? 14.034 16.286 46.431 1.00 12.38 ? 111 SER A CA  1 
ATOM   769  C  C   . SER A 1 111 ? 14.998 16.834 45.384 1.00 10.23 ? 111 SER A C   1 
ATOM   770  O  O   . SER A 1 111 ? 15.726 17.804 45.637 1.00 10.68 ? 111 SER A O   1 
ATOM   771  C  CB  . SER A 1 111 ? 12.603 16.721 46.104 1.00 14.61 ? 111 SER A CB  1 
ATOM   772  O  OG  . SER A 1 111 ? 12.531 18.119 45.841 1.00 13.74 ? 111 SER A OG  1 
ATOM   773  N  N   . LEU A 1 112 ? 15.008 16.220 44.213 1.00 11.27 ? 112 LEU A N   1 
ATOM   774  C  CA  . LEU A 1 112 ? 15.855 16.719 43.145 1.00 10.59 ? 112 LEU A CA  1 
ATOM   775  C  C   . LEU A 1 112 ? 15.513 18.170 42.803 1.00 10.09 ? 112 LEU A C   1 
ATOM   776  O  O   . LEU A 1 112 ? 16.411 18.977 42.536 1.00 10.00 ? 112 LEU A O   1 
ATOM   777  C  CB  . LEU A 1 112 ? 15.716 15.832 41.916 1.00 12.10 ? 112 LEU A CB  1 
ATOM   778  C  CG  . LEU A 1 112 ? 16.693 16.095 40.776 1.00 12.07 ? 112 LEU A CG  1 
ATOM   779  C  CD1 . LEU A 1 112 ? 18.114 16.042 41.295 1.00 13.59 ? 112 LEU A CD1 1 
ATOM   780  C  CD2 . LEU A 1 112 ? 16.511 15.064 39.684 1.00 14.17 ? 112 LEU A CD2 1 
ATOM   781  N  N   . THR A 1 113 ? 14.230 18.509 42.846 1.00 10.76 ? 113 THR A N   1 
ATOM   782  C  CA  . THR A 1 113 ? 13.795 19.872 42.569 1.00 11.50 ? 113 THR A CA  1 
ATOM   783  C  C   . THR A 1 113 ? 14.333 20.837 43.632 1.00 11.47 ? 113 THR A C   1 
ATOM   784  O  O   . THR A 1 113 ? 14.818 21.931 43.314 1.00 11.63 ? 113 THR A O   1 
ATOM   785  C  CB  . THR A 1 113 ? 12.253 19.932 42.479 1.00 14.94 ? 113 THR A CB  1 
ATOM   786  O  OG1 . THR A 1 113 ? 11.823 19.178 41.336 1.00 17.83 ? 113 THR A OG1 1 
ATOM   787  C  CG2 . THR A 1 113 ? 11.767 21.360 42.335 1.00 15.80 ? 113 THR A CG2 1 
ATOM   788  N  N   . GLU A 1 114 ? 14.276 20.426 44.893 1.00 11.46 ? 114 GLU A N   1 
ATOM   789  C  CA  . GLU A 1 114 ? 14.804 21.224 45.989 1.00 10.93 ? 114 GLU A CA  1 
ATOM   790  C  C   . GLU A 1 114 ? 16.324 21.365 45.903 1.00 10.92 ? 114 GLU A C   1 
ATOM   791  O  O   . GLU A 1 114 ? 16.875 22.432 46.198 1.00 11.68 ? 114 GLU A O   1 
ATOM   792  C  CB  . GLU A 1 114 ? 14.416 20.606 47.340 1.00 14.54 ? 114 GLU A CB  1 
ATOM   793  C  CG  . GLU A 1 114 ? 12.924 20.710 47.650 1.00 16.37 ? 114 GLU A CG  1 
ATOM   794  C  CD  . GLU A 1 114 ? 12.502 19.906 48.874 1.00 24.04 ? 114 GLU A CD  1 
ATOM   795  O  OE1 . GLU A 1 114 ? 13.114 18.856 49.164 1.00 19.77 ? 114 GLU A OE1 1 
ATOM   796  O  OE2 . GLU A 1 114 ? 11.547 20.334 49.557 1.00 35.14 ? 114 GLU A OE2 1 
ATOM   797  N  N   . LEU A 1 115 ? 17.003 20.286 45.516 1.00 9.65  ? 115 LEU A N   1 
ATOM   798  C  CA  . LEU A 1 115 ? 18.450 20.322 45.324 1.00 9.77  ? 115 LEU A CA  1 
ATOM   799  C  C   . LEU A 1 115 ? 18.833 21.344 44.264 1.00 9.04  ? 115 LEU A C   1 
ATOM   800  O  O   . LEU A 1 115 ? 19.787 22.106 44.428 1.00 8.97  ? 115 LEU A O   1 
ATOM   801  C  CB  . LEU A 1 115 ? 18.984 18.946 44.906 1.00 9.83  ? 115 LEU A CB  1 
ATOM   802  C  CG  . LEU A 1 115 ? 19.207 17.893 45.988 1.00 15.70 ? 115 LEU A CG  1 
ATOM   803  C  CD1 . LEU A 1 115 ? 19.559 16.562 45.330 1.00 12.66 ? 115 LEU A CD1 1 
ATOM   804  C  CD2 . LEU A 1 115 ? 20.318 18.334 46.949 1.00 15.23 ? 115 LEU A CD2 1 
ATOM   805  N  N   . ARG A 1 116 ? 18.094 21.348 43.160 1.00 8.01  ? 116 ARG A N   1 
ATOM   806  C  CA  . ARG A 1 116 ? 18.389 22.277 42.078 1.00 7.83  ? 116 ARG A CA  1 
ATOM   807  C  C   . ARG A 1 116 ? 18.152 23.714 42.528 1.00 9.16  ? 116 ARG A C   1 
ATOM   808  O  O   . ARG A 1 116 ? 18.902 24.612 42.135 1.00 8.81  ? 116 ARG A O   1 
ATOM   809  C  CB  . ARG A 1 116 ? 17.557 21.945 40.836 1.00 9.42  ? 116 ARG A CB  1 
ATOM   810  C  CG  . ARG A 1 116 ? 17.988 20.636 40.180 1.00 10.62 ? 116 ARG A CG  1 
ATOM   811  C  CD  . ARG A 1 116 ? 17.171 20.320 38.949 1.00 10.60 ? 116 ARG A CD  1 
ATOM   812  N  NE  . ARG A 1 116 ? 17.384 21.313 37.899 1.00 10.81 ? 116 ARG A NE  1 
ATOM   813  C  CZ  . ARG A 1 116 ? 16.603 21.450 36.834 1.00 12.70 ? 116 ARG A CZ  1 
ATOM   814  N  NH1 . ARG A 1 116 ? 15.551 20.653 36.668 1.00 12.35 ? 116 ARG A NH1 1 
ATOM   815  N  NH2 . ARG A 1 116 ? 16.866 22.392 35.938 1.00 12.40 ? 116 ARG A NH2 1 
ATOM   816  N  N   . ARG A 1 117 ? 17.145 23.952 43.369 1.00 8.87  ? 117 ARG A N   1 
ATOM   817  C  CA  . ARG A 1 117 ? 16.922 25.316 43.832 1.00 8.96  ? 117 ARG A CA  1 
ATOM   818  C  C   . ARG A 1 117 ? 18.050 25.748 44.776 1.00 10.39 ? 117 ARG A C   1 
ATOM   819  O  O   . ARG A 1 117 ? 18.550 26.871 44.679 1.00 10.20 ? 117 ARG A O   1 
ATOM   820  C  CB  . ARG A 1 117 ? 15.562 25.448 44.520 1.00 12.09 ? 117 ARG A CB  1 
ATOM   821  C  CG  . ARG A 1 117 ? 15.373 26.812 45.120 1.00 20.94 ? 117 ARG A CG  1 
ATOM   822  C  CD  . ARG A 1 117 ? 13.987 26.953 45.748 1.00 36.63 ? 117 ARG A CD  1 
ATOM   823  N  NE  . ARG A 1 117 ? 13.296 25.664 45.806 1.00 48.51 ? 117 ARG A NE  1 
ATOM   824  C  CZ  . ARG A 1 117 ? 13.283 24.816 46.826 1.00 46.23 ? 117 ARG A CZ  1 
ATOM   825  N  NH1 . ARG A 1 117 ? 13.915 25.113 47.936 1.00 45.35 ? 117 ARG A NH1 1 
ATOM   826  N  NH2 . ARG A 1 117 ? 12.589 23.692 46.718 1.00 46.69 ? 117 ARG A NH2 1 
ATOM   827  N  N   . LEU A 1 118 ? 18.477 24.860 45.671 1.00 8.80  ? 118 LEU A N   1 
ATOM   828  C  CA  . LEU A 1 118 ? 19.568 25.189 46.584 1.00 9.61  ? 118 LEU A CA  1 
ATOM   829  C  C   . LEU A 1 118 ? 20.868 25.437 45.810 1.00 9.91  ? 118 LEU A C   1 
ATOM   830  O  O   . LEU A 1 118 ? 21.633 26.341 46.133 1.00 10.08 ? 118 LEU A O   1 
ATOM   831  C  CB  . LEU A 1 118 ? 19.763 24.084 47.618 1.00 10.12 ? 118 LEU A CB  1 
ATOM   832  C  CG  . LEU A 1 118 ? 20.799 24.346 48.712 1.00 15.75 ? 118 LEU A CG  1 
ATOM   833  C  CD1 . LEU A 1 118 ? 20.603 25.715 49.359 1.00 16.62 ? 118 LEU A CD1 1 
ATOM   834  C  CD2 . LEU A 1 118 ? 20.722 23.243 49.748 1.00 16.41 ? 118 LEU A CD2 1 
ATOM   835  N  N   . PHE A 1 119 ? 21.111 24.627 44.786 1.00 8.29  ? 119 PHE A N   1 
ATOM   836  C  CA  . PHE A 1 119 ? 22.302 24.772 43.947 1.00 9.41  ? 119 PHE A CA  1 
ATOM   837  C  C   . PHE A 1 119 ? 22.268 26.119 43.211 1.00 8.19  ? 119 PHE A C   1 
ATOM   838  O  O   . PHE A 1 119 ? 23.284 26.828 43.149 1.00 8.58  ? 119 PHE A O   1 
ATOM   839  C  CB  . PHE A 1 119 ? 22.384 23.586 42.975 1.00 7.78  ? 119 PHE A CB  1 
ATOM   840  C  CG  . PHE A 1 119 ? 23.657 23.514 42.144 1.00 7.38  ? 119 PHE A CG  1 
ATOM   841  C  CD1 . PHE A 1 119 ? 24.814 24.191 42.484 1.00 9.18  ? 119 PHE A CD1 1 
ATOM   842  C  CD2 . PHE A 1 119 ? 23.660 22.738 40.996 1.00 9.96  ? 119 PHE A CD2 1 
ATOM   843  C  CE1 . PHE A 1 119 ? 25.960 24.087 41.677 1.00 9.12  ? 119 PHE A CE1 1 
ATOM   844  C  CE2 . PHE A 1 119 ? 24.793 22.630 40.198 1.00 9.40  ? 119 PHE A CE2 1 
ATOM   845  C  CZ  . PHE A 1 119 ? 25.944 23.309 40.538 1.00 8.08  ? 119 PHE A CZ  1 
ATOM   846  N  N   . ARG A 1 120 ? 21.102 26.494 42.695 1.00 8.06  ? 120 ARG A N   1 
ATOM   847  C  CA  . ARG A 1 120 ? 20.957 27.775 42.019 1.00 9.66  ? 120 ARG A CA  1 
ATOM   848  C  C   . ARG A 1 120 ? 21.281 28.943 42.960 1.00 11.66 ? 120 ARG A C   1 
ATOM   849  O  O   . ARG A 1 120 ? 22.042 29.852 42.611 1.00 10.49 ? 120 ARG A O   1 
ATOM   850  C  CB  . ARG A 1 120 ? 19.542 27.913 41.462 1.00 10.98 ? 120 ARG A CB  1 
ATOM   851  C  CG  . ARG A 1 120 ? 19.348 29.122 40.565 1.00 16.78 ? 120 ARG A CG  1 
ATOM   852  C  CD  . ARG A 1 120 ? 17.880 29.322 40.258 1.00 23.88 ? 120 ARG A CD  1 
ATOM   853  N  NE  . ARG A 1 120 ? 17.116 29.533 41.486 1.00 34.82 ? 120 ARG A NE  1 
ATOM   854  C  CZ  . ARG A 1 120 ? 15.811 29.300 41.605 1.00 44.19 ? 120 ARG A CZ  1 
ATOM   855  N  NH1 . ARG A 1 120 ? 15.119 28.837 40.570 1.00 45.48 ? 120 ARG A NH1 1 
ATOM   856  N  NH2 . ARG A 1 120 ? 15.200 29.524 42.761 1.00 43.56 ? 120 ARG A NH2 1 
ATOM   857  N  N   . ASP A 1 121 ? 20.729 28.906 44.165 1.00 9.44  ? 121 ASP A N   1 
ATOM   858  C  CA  . ASP A 1 121 ? 20.980 29.964 45.133 1.00 10.56 ? 121 ASP A CA  1 
ATOM   859  C  C   . ASP A 1 121 ? 22.441 29.979 45.574 1.00 10.11 ? 121 ASP A C   1 
ATOM   860  O  O   . ASP A 1 121 ? 23.024 31.043 45.786 1.00 10.91 ? 121 ASP A O   1 
ATOM   861  C  CB  . ASP A 1 121 ? 20.054 29.812 46.341 1.00 11.06 ? 121 ASP A CB  1 
ATOM   862  C  CG  . ASP A 1 121 ? 18.587 30.046 45.987 1.00 16.46 ? 121 ASP A CG  1 
ATOM   863  O  OD1 . ASP A 1 121 ? 18.304 30.647 44.924 1.00 20.05 ? 121 ASP A OD1 1 
ATOM   864  O  OD2 . ASP A 1 121 ? 17.718 29.619 46.772 1.00 23.46 ? 121 ASP A OD2 1 
ATOM   865  N  N   . THR A 1 122 ? 23.038 28.801 45.689 1.00 8.33  ? 122 THR A N   1 
ATOM   866  C  CA  . THR A 1 122 ? 24.416 28.681 46.144 1.00 9.99  ? 122 THR A CA  1 
ATOM   867  C  C   . THR A 1 122 ? 25.385 29.177 45.069 1.00 8.00  ? 122 THR A C   1 
ATOM   868  O  O   . THR A 1 122 ? 26.373 29.847 45.378 1.00 8.47  ? 122 THR A O   1 
ATOM   869  C  CB  . THR A 1 122 ? 24.747 27.230 46.526 1.00 8.82  ? 122 THR A CB  1 
ATOM   870  O  OG1 . THR A 1 122 ? 23.916 26.837 47.619 1.00 11.62 ? 122 THR A OG1 1 
ATOM   871  C  CG2 . THR A 1 122 ? 26.186 27.109 46.971 1.00 11.47 ? 122 THR A CG2 1 
ATOM   872  N  N   . GLU A 1 123 ? 25.093 28.891 43.804 1.00 8.40  ? 123 GLU A N   1 
ATOM   873  C  CA  . GLU A 1 123 ? 25.954 29.375 42.727 1.00 8.59  ? 123 GLU A CA  1 
ATOM   874  C  C   . GLU A 1 123 ? 25.852 30.911 42.627 1.00 8.33  ? 123 GLU A C   1 
ATOM   875  O  O   . GLU A 1 123 ? 26.839 31.588 42.317 1.00 9.34  ? 123 GLU A O   1 
ATOM   876  C  CB  . GLU A 1 123 ? 25.586 28.690 41.409 1.00 9.24  ? 123 GLU A CB  1 
ATOM   877  C  CG  . GLU A 1 123 ? 26.595 28.918 40.283 1.00 12.35 ? 123 GLU A CG  1 
ATOM   878  C  CD  . GLU A 1 123 ? 26.193 30.063 39.384 1.00 12.91 ? 123 GLU A CD  1 
ATOM   879  O  OE1 . GLU A 1 123 ? 25.144 30.697 39.651 1.00 13.57 ? 123 GLU A OE1 1 
ATOM   880  O  OE2 . GLU A 1 123 ? 26.927 30.330 38.404 1.00 12.66 ? 123 GLU A OE2 1 
ATOM   881  N  N   . ARG A 1 124 ? 24.681 31.463 42.936 1.00 9.33  ? 124 ARG A N   1 
ATOM   882  C  CA  . ARG A 1 124 ? 24.535 32.913 42.976 1.00 9.90  ? 124 ARG A CA  1 
ATOM   883  C  C   . ARG A 1 124 ? 25.373 33.496 44.122 1.00 10.10 ? 124 ARG A C   1 
ATOM   884  O  O   . ARG A 1 124 ? 26.045 34.520 43.957 1.00 9.59  ? 124 ARG A O   1 
ATOM   885  C  CB  . ARG A 1 124 ? 23.063 33.297 43.140 1.00 11.87 ? 124 ARG A CB  1 
ATOM   886  C  CG  . ARG A 1 124 ? 22.824 34.794 43.168 1.00 16.57 ? 124 ARG A CG  1 
ATOM   887  C  CD  . ARG A 1 124 ? 23.272 35.446 41.874 1.00 26.84 ? 124 ARG A CD  1 
ATOM   888  N  NE  . ARG A 1 124 ? 23.122 36.899 41.913 1.00 43.62 ? 124 ARG A NE  1 
ATOM   889  C  CZ  . ARG A 1 124 ? 24.141 37.745 41.818 1.00 48.54 ? 124 ARG A CZ  1 
ATOM   890  N  NH1 . ARG A 1 124 ? 25.375 37.270 41.683 1.00 42.11 ? 124 ARG A NH1 1 
ATOM   891  N  NH2 . ARG A 1 124 ? 23.940 39.059 41.858 1.00 47.84 ? 124 ARG A NH2 1 
ATOM   892  N  N   . GLN A 1 125 ? 25.356 32.831 45.270 1.00 9.28  ? 125 GLN A N   1 
ATOM   893  C  CA  . GLN A 1 125 ? 26.170 33.248 46.413 1.00 10.19 ? 125 GLN A CA  1 
ATOM   894  C  C   . GLN A 1 125 ? 27.648 33.237 46.047 1.00 11.10 ? 125 GLN A C   1 
ATOM   895  O  O   . GLN A 1 125 ? 28.408 34.130 46.420 1.00 8.72  ? 125 GLN A O   1 
ATOM   896  C  CB  . GLN A 1 125 ? 25.932 32.335 47.618 1.00 11.34 ? 125 GLN A CB  1 
ATOM   897  C  CG  . GLN A 1 125 ? 24.555 32.461 48.254 1.00 14.04 ? 125 GLN A CG  1 
ATOM   898  C  CD  . GLN A 1 125 ? 24.437 31.639 49.522 1.00 25.53 ? 125 GLN A CD  1 
ATOM   899  O  OE1 . GLN A 1 125 ? 24.801 30.466 49.550 1.00 23.81 ? 125 GLN A OE1 1 
ATOM   900  N  NE2 . GLN A 1 125 ? 23.931 32.257 50.584 1.00 42.56 ? 125 GLN A NE2 1 
ATOM   901  N  N   . TRP A 1 126 ? 28.046 32.215 45.303 1.00 8.41  ? 126 TRP A N   1 
ATOM   902  C  CA  . TRP A 1 126 ? 29.418 32.074 44.827 1.00 7.91  ? 126 TRP A CA  1 
ATOM   903  C  C   . TRP A 1 126 ? 29.833 33.260 43.950 1.00 8.12  ? 126 TRP A C   1 
ATOM   904  O  O   . TRP A 1 126 ? 30.887 33.856 44.166 1.00 8.84  ? 126 TRP A O   1 
ATOM   905  C  CB  . TRP A 1 126 ? 29.525 30.762 44.054 1.00 8.63  ? 126 TRP A CB  1 
ATOM   906  C  CG  . TRP A 1 126 ? 30.874 30.290 43.588 1.00 6.42  ? 126 TRP A CG  1 
ATOM   907  C  CD1 . TRP A 1 126 ? 31.353 30.318 42.306 1.00 9.04  ? 126 TRP A CD1 1 
ATOM   908  C  CD2 . TRP A 1 126 ? 31.857 29.606 44.368 1.00 7.95  ? 126 TRP A CD2 1 
ATOM   909  N  NE1 . TRP A 1 126 ? 32.590 29.732 42.254 1.00 8.80  ? 126 TRP A NE1 1 
ATOM   910  C  CE2 . TRP A 1 126 ? 32.923 29.283 43.506 1.00 6.55  ? 126 TRP A CE2 1 
ATOM   911  C  CE3 . TRP A 1 126 ? 31.938 29.235 45.715 1.00 8.82  ? 126 TRP A CE3 1 
ATOM   912  C  CZ2 . TRP A 1 126 ? 34.053 28.603 43.945 1.00 7.36  ? 126 TRP A CZ2 1 
ATOM   913  C  CZ3 . TRP A 1 126 ? 33.060 28.570 46.151 1.00 8.37  ? 126 TRP A CZ3 1 
ATOM   914  C  CH2 . TRP A 1 126 ? 34.107 28.257 45.264 1.00 7.44  ? 126 TRP A CH2 1 
ATOM   915  N  N   . LEU A 1 127 ? 29.017 33.607 42.963 1.00 8.57  ? 127 LEU A N   1 
ATOM   916  C  CA  . LEU A 1 127 ? 29.326 34.735 42.087 1.00 8.84  ? 127 LEU A CA  1 
ATOM   917  C  C   . LEU A 1 127 ? 29.295 36.047 42.859 1.00 11.05 ? 127 LEU A C   1 
ATOM   918  O  O   . LEU A 1 127 ? 30.129 36.918 42.619 1.00 11.00 ? 127 LEU A O   1 
ATOM   919  C  CB  . LEU A 1 127 ? 28.351 34.786 40.908 1.00 11.17 ? 127 LEU A CB  1 
ATOM   920  C  CG  . LEU A 1 127 ? 28.434 33.572 39.995 1.00 12.52 ? 127 LEU A CG  1 
ATOM   921  C  CD1 . LEU A 1 127 ? 27.374 33.654 38.910 1.00 18.33 ? 127 LEU A CD1 1 
ATOM   922  C  CD2 . LEU A 1 127 ? 29.817 33.443 39.398 1.00 16.16 ? 127 LEU A CD2 1 
ATOM   923  N  N   . ASP A 1 128 ? 28.356 36.178 43.797 1.00 10.42 ? 128 ASP A N   1 
ATOM   924  C  CA  . ASP A 1 128 ? 28.297 37.365 44.662 1.00 11.30 ? 128 ASP A CA  1 
ATOM   925  C  C   . ASP A 1 128 ? 29.567 37.541 45.481 1.00 11.90 ? 128 ASP A C   1 
ATOM   926  O  O   . ASP A 1 128 ? 30.069 38.662 45.625 1.00 12.93 ? 128 ASP A O   1 
ATOM   927  C  CB  . ASP A 1 128 ? 27.100 37.311 45.623 1.00 13.82 ? 128 ASP A CB  1 
ATOM   928  C  CG  . ASP A 1 128 ? 25.780 37.631 44.951 1.00 23.04 ? 128 ASP A CG  1 
ATOM   929  O  OD1 . ASP A 1 128 ? 25.811 38.192 43.844 1.00 22.56 ? 128 ASP A OD1 1 
ATOM   930  O  OD2 . ASP A 1 128 ? 24.719 37.306 45.534 1.00 22.84 ? 128 ASP A OD2 1 
ATOM   931  N  N   . TRP A 1 129 ? 30.078 36.438 46.021 1.00 9.20  ? 129 TRP A N   1 
ATOM   932  C  CA  . TRP A 1 129 ? 31.302 36.454 46.799 1.00 9.50  ? 129 TRP A CA  1 
ATOM   933  C  C   . TRP A 1 129 ? 32.474 36.869 45.910 1.00 10.66 ? 129 TRP A C   1 
ATOM   934  O  O   . TRP A 1 129 ? 33.277 37.729 46.285 1.00 11.37 ? 129 TRP A O   1 
ATOM   935  C  CB  . TRP A 1 129 ? 31.530 35.076 47.435 1.00 8.54  ? 129 TRP A CB  1 
ATOM   936  C  CG  . TRP A 1 129 ? 32.933 34.812 47.905 1.00 10.46 ? 129 TRP A CG  1 
ATOM   937  C  CD1 . TRP A 1 129 ? 33.635 35.528 48.828 1.00 9.87  ? 129 TRP A CD1 1 
ATOM   938  C  CD2 . TRP A 1 129 ? 33.790 33.737 47.494 1.00 8.18  ? 129 TRP A CD2 1 
ATOM   939  N  NE1 . TRP A 1 129 ? 34.879 34.971 49.012 1.00 11.84 ? 129 TRP A NE1 1 
ATOM   940  C  CE2 . TRP A 1 129 ? 34.998 33.865 48.207 1.00 9.87  ? 129 TRP A CE2 1 
ATOM   941  C  CE3 . TRP A 1 129 ? 33.646 32.673 46.599 1.00 10.31 ? 129 TRP A CE3 1 
ATOM   942  C  CZ2 . TRP A 1 129 ? 36.064 32.983 48.044 1.00 9.73  ? 129 TRP A CZ2 1 
ATOM   943  C  CZ3 . TRP A 1 129 ? 34.699 31.798 46.434 1.00 10.02 ? 129 TRP A CZ3 1 
ATOM   944  C  CH2 . TRP A 1 129 ? 35.891 31.948 47.160 1.00 10.90 ? 129 TRP A CH2 1 
ATOM   945  N  N   . ILE A 1 130 ? 32.547 36.296 44.715 1.00 8.79  ? 130 ILE A N   1 
ATOM   946  C  CA  . ILE A 1 130 ? 33.618 36.628 43.783 1.00 11.01 ? 130 ILE A CA  1 
ATOM   947  C  C   . ILE A 1 130 ? 33.556 38.111 43.424 1.00 11.45 ? 130 ILE A C   1 
ATOM   948  O  O   . ILE A 1 130 ? 34.590 38.766 43.287 1.00 12.48 ? 130 ILE A O   1 
ATOM   949  C  CB  . ILE A 1 130 ? 33.535 35.754 42.509 1.00 10.73 ? 130 ILE A CB  1 
ATOM   950  C  CG1 . ILE A 1 130 ? 33.855 34.303 42.856 1.00 11.48 ? 130 ILE A CG1 1 
ATOM   951  C  CG2 . ILE A 1 130 ? 34.482 36.255 41.413 1.00 12.59 ? 130 ILE A CG2 1 
ATOM   952  C  CD1 . ILE A 1 130 ? 33.596 33.326 41.717 1.00 12.48 ? 130 ILE A CD1 1 
ATOM   953  N  N   . ASP A 1 131 ? 32.354 38.660 43.300 1.00 12.32 ? 131 ASP A N   1 
ATOM   954  C  CA  . ASP A 1 131 ? 32.229 40.082 42.980 1.00 13.43 ? 131 ASP A CA  1 
ATOM   955  C  C   . ASP A 1 131 ? 32.860 40.987 44.044 1.00 15.02 ? 131 ASP A C   1 
ATOM   956  O  O   . ASP A 1 131 ? 33.275 42.103 43.726 1.00 16.72 ? 131 ASP A O   1 
ATOM   957  C  CB  . ASP A 1 131 ? 30.760 40.461 42.769 1.00 16.97 ? 131 ASP A CB  1 
ATOM   958  C  CG  . ASP A 1 131 ? 30.369 40.461 41.305 1.00 24.21 ? 131 ASP A CG  1 
ATOM   959  O  OD1 . ASP A 1 131 ? 31.219 40.818 40.461 1.00 35.10 ? 131 ASP A OD1 1 
ATOM   960  O  OD2 . ASP A 1 131 ? 29.209 40.119 40.997 1.00 45.82 ? 131 ASP A OD2 1 
ATOM   961  N  N   . THR A 1 132 ? 32.951 40.516 45.287 1.00 12.10 ? 132 THR A N   1 
ATOM   962  C  CA  . THR A 1 132 ? 33.590 41.307 46.338 1.00 13.35 ? 132 THR A CA  1 
ATOM   963  C  C   . THR A 1 132 ? 35.120 41.258 46.314 1.00 15.06 ? 132 THR A C   1 
ATOM   964  O  O   . THR A 1 132 ? 35.775 41.986 47.068 1.00 20.29 ? 132 THR A O   1 
ATOM   965  C  CB  . THR A 1 132 ? 33.150 40.861 47.745 1.00 13.96 ? 132 THR A CB  1 
ATOM   966  O  OG1 . THR A 1 132 ? 33.693 39.569 48.042 1.00 14.71 ? 132 THR A OG1 1 
ATOM   967  C  CG2 . THR A 1 132 ? 31.637 40.832 47.866 1.00 16.32 ? 132 THR A CG2 1 
ATOM   968  N  N   . LEU A 1 133 ? 35.689 40.396 45.482 1.00 11.52 ? 133 LEU A N   1 
ATOM   969  C  CA  . LEU A 1 133 ? 37.136 40.212 45.467 1.00 12.24 ? 133 LEU A CA  1 
ATOM   970  C  C   . LEU A 1 133 ? 37.778 41.141 44.455 1.00 13.41 ? 133 LEU A C   1 
ATOM   971  O  O   . LEU A 1 133 ? 37.280 41.302 43.343 1.00 14.53 ? 133 LEU A O   1 
ATOM   972  C  CB  . LEU A 1 133 ? 37.488 38.763 45.136 1.00 12.09 ? 133 LEU A CB  1 
ATOM   973  C  CG  . LEU A 1 133 ? 36.839 37.710 46.034 1.00 12.65 ? 133 LEU A CG  1 
ATOM   974  C  CD1 . LEU A 1 133 ? 37.179 36.312 45.524 1.00 12.97 ? 133 LEU A CD1 1 
ATOM   975  C  CD2 . LEU A 1 133 ? 37.238 37.893 47.486 1.00 11.21 ? 133 LEU A CD2 1 
ATOM   976  N  N   . SER A 1 134 ? 38.900 41.740 44.834 1.00 14.34 ? 134 SER A N   1 
ATOM   977  C  CA  . SER A 1 134 ? 39.655 42.541 43.882 1.00 14.03 ? 134 SER A CA  1 
ATOM   978  C  C   . SER A 1 134 ? 40.443 41.634 42.946 1.00 13.44 ? 134 SER A C   1 
ATOM   979  O  O   . SER A 1 134 ? 40.643 40.461 43.237 1.00 12.28 ? 134 SER A O   1 
ATOM   980  C  CB  . SER A 1 134 ? 40.604 43.488 44.605 1.00 14.22 ? 134 SER A CB  1 
ATOM   981  O  OG  . SER A 1 134 ? 41.673 42.765 45.185 1.00 16.22 ? 134 SER A OG  1 
ATOM   982  N  N   . GLU A 1 135 ? 40.918 42.177 41.828 1.00 15.71 ? 135 GLU A N   1 
ATOM   983  C  CA  . GLU A 1 135 ? 41.754 41.390 40.932 1.00 16.00 ? 135 GLU A CA  1 
ATOM   984  C  C   . GLU A 1 135 ? 43.032 40.934 41.642 1.00 12.61 ? 135 GLU A C   1 
ATOM   985  O  O   . GLU A 1 135 ? 43.502 39.815 41.440 1.00 13.87 ? 135 GLU A O   1 
ATOM   986  C  CB  . GLU A 1 135 ? 42.112 42.182 39.668 1.00 18.51 ? 135 GLU A CB  1 
ATOM   987  C  CG  . GLU A 1 135 ? 40.933 42.852 38.967 1.00 23.45 ? 135 GLU A CG  1 
ATOM   988  C  CD  . GLU A 1 135 ? 40.119 41.910 38.079 1.00 25.39 ? 135 GLU A CD  1 
ATOM   989  O  OE1 . GLU A 1 135 ? 40.591 40.793 37.783 1.00 25.12 ? 135 GLU A OE1 1 
ATOM   990  O  OE2 . GLU A 1 135 ? 39.002 42.298 37.674 1.00 31.03 ? 135 GLU A OE2 1 
ATOM   991  N  N   . GLU A 1 136 ? 43.587 41.798 42.493 1.00 16.14 ? 136 GLU A N   1 
ATOM   992  C  CA  . GLU A 1 136 ? 44.765 41.426 43.267 1.00 19.19 ? 136 GLU A CA  1 
ATOM   993  C  C   . GLU A 1 136 ? 44.462 40.267 44.219 1.00 19.91 ? 136 GLU A C   1 
ATOM   994  O  O   . GLU A 1 136 ? 45.252 39.326 44.320 1.00 18.63 ? 136 GLU A O   1 
ATOM   995  C  CB  . GLU A 1 136 ? 45.309 42.637 44.038 1.00 24.74 ? 136 GLU A CB  1 
ATOM   996  C  CG  . GLU A 1 136 ? 46.593 42.352 44.807 1.00 29.26 ? 136 GLU A CG  1 
ATOM   997  C  CD  . GLU A 1 136 ? 47.208 43.599 45.432 1.00 37.45 ? 136 GLU A CD  1 
ATOM   998  O  OE1 . GLU A 1 136 ? 46.459 44.557 45.729 1.00 29.13 ? 136 GLU A OE1 1 
ATOM   999  O  OE2 . GLU A 1 136 ? 48.443 43.614 45.636 1.00 37.68 ? 136 GLU A OE2 1 
ATOM   1000 N  N   . ASP A 1 137 ? 43.310 40.316 44.895 1.00 14.28 ? 137 ASP A N   1 
ATOM   1001 C  CA  . ASP A 1 137 ? 42.896 39.219 45.772 1.00 15.20 ? 137 ASP A CA  1 
ATOM   1002 C  C   . ASP A 1 137 ? 42.837 37.909 45.022 1.00 12.14 ? 137 ASP A C   1 
ATOM   1003 O  O   . ASP A 1 137 ? 43.217 36.856 45.533 1.00 13.91 ? 137 ASP A O   1 
ATOM   1004 C  CB  . ASP A 1 137 ? 41.501 39.450 46.362 1.00 16.83 ? 137 ASP A CB  1 
ATOM   1005 C  CG  . ASP A 1 137 ? 41.431 40.613 47.316 1.00 24.60 ? 137 ASP A CG  1 
ATOM   1006 O  OD1 . ASP A 1 137 ? 42.469 40.998 47.893 1.00 21.46 ? 137 ASP A OD1 1 
ATOM   1007 O  OD2 . ASP A 1 137 ? 40.301 41.132 47.490 1.00 23.17 ? 137 ASP A OD2 1 
ATOM   1008 N  N   . LEU A 1 138 ? 42.292 37.983 43.813 1.00 12.15 ? 138 LEU A N   1 
ATOM   1009 C  CA  . LEU A 1 138 ? 42.040 36.793 43.019 1.00 12.89 ? 138 LEU A CA  1 
ATOM   1010 C  C   . LEU A 1 138 ? 43.301 36.185 42.444 1.00 12.35 ? 138 LEU A C   1 
ATOM   1011 O  O   . LEU A 1 138 ? 43.448 34.967 42.407 1.00 11.67 ? 138 LEU A O   1 
ATOM   1012 C  CB  . LEU A 1 138 ? 41.076 37.117 41.870 1.00 13.87 ? 138 LEU A CB  1 
ATOM   1013 C  CG  . LEU A 1 138 ? 39.599 37.053 42.244 1.00 13.60 ? 138 LEU A CG  1 
ATOM   1014 C  CD1 . LEU A 1 138 ? 38.748 37.693 41.157 1.00 17.09 ? 138 LEU A CD1 1 
ATOM   1015 C  CD2 . LEU A 1 138 ? 39.199 35.597 42.468 1.00 12.07 ? 138 LEU A CD2 1 
ATOM   1016 N  N   . PHE A 1 139 ? 44.219 37.034 41.990 1.00 13.14 ? 139 PHE A N   1 
ATOM   1017 C  CA  . PHE A 1 139 ? 45.259 36.547 41.097 1.00 14.00 ? 139 PHE A CA  1 
ATOM   1018 C  C   . PHE A 1 139 ? 46.692 36.655 41.627 1.00 13.98 ? 139 PHE A C   1 
ATOM   1019 O  O   . PHE A 1 139 ? 47.632 36.257 40.940 1.00 16.51 ? 139 PHE A O   1 
ATOM   1020 C  CB  . PHE A 1 139 ? 45.130 37.260 39.743 1.00 14.15 ? 139 PHE A CB  1 
ATOM   1021 C  CG  . PHE A 1 139 ? 43.827 36.963 39.040 1.00 12.36 ? 139 PHE A CG  1 
ATOM   1022 C  CD1 . PHE A 1 139 ? 43.555 35.681 38.583 1.00 14.39 ? 139 PHE A CD1 1 
ATOM   1023 C  CD2 . PHE A 1 139 ? 42.881 37.954 38.848 1.00 15.90 ? 139 PHE A CD2 1 
ATOM   1024 C  CE1 . PHE A 1 139 ? 42.347 35.396 37.940 1.00 18.02 ? 139 PHE A CE1 1 
ATOM   1025 C  CE2 . PHE A 1 139 ? 41.681 37.675 38.207 1.00 17.52 ? 139 PHE A CE2 1 
ATOM   1026 C  CZ  . PHE A 1 139 ? 41.419 36.394 37.756 1.00 18.52 ? 139 PHE A CZ  1 
ATOM   1027 N  N   . THR A 1 140 ? 46.871 37.160 42.844 1.00 14.41 ? 140 THR A N   1 
ATOM   1028 C  CA  . THR A 1 140 ? 48.208 37.111 43.455 1.00 12.78 ? 140 THR A CA  1 
ATOM   1029 C  C   . THR A 1 140 ? 48.194 36.212 44.679 1.00 13.02 ? 140 THR A C   1 
ATOM   1030 O  O   . THR A 1 140 ? 47.221 36.188 45.425 1.00 15.08 ? 140 THR A O   1 
ATOM   1031 C  CB  . THR A 1 140 ? 48.730 38.501 43.847 1.00 16.85 ? 140 THR A CB  1 
ATOM   1032 O  OG1 . THR A 1 140 ? 47.910 39.061 44.876 1.00 17.86 ? 140 THR A OG1 1 
ATOM   1033 C  CG2 . THR A 1 140 ? 48.740 39.426 42.642 1.00 17.60 ? 140 THR A CG2 1 
ATOM   1034 N  N   . GLN A 1 141 ? 49.275 35.469 44.891 1.00 15.00 ? 141 GLN A N   1 
ATOM   1035 C  CA  . GLN A 1 141 ? 49.313 34.508 45.985 1.00 15.10 ? 141 GLN A CA  1 
ATOM   1036 C  C   . GLN A 1 141 ? 49.667 35.190 47.309 1.00 14.55 ? 141 GLN A C   1 
ATOM   1037 O  O   . GLN A 1 141 ? 50.262 36.283 47.316 1.00 15.59 ? 141 GLN A O   1 
ATOM   1038 C  CB  . GLN A 1 141 ? 50.296 33.375 45.661 1.00 15.13 ? 141 GLN A CB  1 
ATOM   1039 C  CG  . GLN A 1 141 ? 50.449 32.270 46.711 1.00 17.40 ? 141 GLN A CG  1 
ATOM   1040 C  CD  . GLN A 1 141 ? 49.156 31.526 47.018 1.00 14.51 ? 141 GLN A CD  1 
ATOM   1041 O  OE1 . GLN A 1 141 ? 48.175 32.125 47.439 1.00 16.22 ? 141 GLN A OE1 1 
ATOM   1042 N  NE2 . GLN A 1 141 ? 49.169 30.205 46.846 1.00 17.52 ? 141 GLN A NE2 1 
ATOM   1043 N  N   . SER A 1 142 ? 49.226 34.565 48.401 1.00 12.97 ? 142 SER A N   1 
ATOM   1044 C  CA  . SER A 1 142 ? 49.565 34.914 49.783 1.00 12.96 ? 142 SER A CA  1 
ATOM   1045 C  C   . SER A 1 142 ? 48.805 36.128 50.303 1.00 12.97 ? 142 SER A C   1 
ATOM   1046 O  O   . SER A 1 142 ? 49.155 36.684 51.347 1.00 14.49 ? 142 SER A O   1 
ATOM   1047 C  CB  . SER A 1 142 ? 51.077 35.129 49.937 1.00 16.11 ? 142 SER A CB  1 
ATOM   1048 O  OG  . SER A 1 142 ? 51.776 33.924 49.692 1.00 19.99 ? 142 SER A OG  1 
ATOM   1049 N  N   . VAL A 1 143 ? 47.736 36.508 49.608 1.00 13.55 ? 143 VAL A N   1 
ATOM   1050 C  CA  . VAL A 1 143 ? 46.827 37.521 50.126 1.00 14.07 ? 143 VAL A CA  1 
ATOM   1051 C  C   . VAL A 1 143 ? 46.078 36.940 51.320 1.00 15.51 ? 143 VAL A C   1 
ATOM   1052 O  O   . VAL A 1 143 ? 46.035 37.544 52.397 1.00 15.11 ? 143 VAL A O   1 
ATOM   1053 C  CB  . VAL A 1 143 ? 45.831 37.993 49.058 1.00 15.29 ? 143 VAL A CB  1 
ATOM   1054 C  CG1 . VAL A 1 143 ? 44.774 38.923 49.674 1.00 16.09 ? 143 VAL A CG1 1 
ATOM   1055 C  CG2 . VAL A 1 143 ? 46.572 38.684 47.915 1.00 16.85 ? 143 VAL A CG2 1 
ATOM   1056 N  N   . ARG A 1 144 ? 45.497 35.759 51.107 1.00 14.19 ? 144 ARG A N   1 
ATOM   1057 C  CA  . ARG A 1 144 ? 44.862 34.982 52.166 1.00 13.01 ? 144 ARG A CA  1 
ATOM   1058 C  C   . ARG A 1 144 ? 45.843 33.977 52.739 1.00 11.05 ? 144 ARG A C   1 
ATOM   1059 O  O   . ARG A 1 144 ? 46.801 33.591 52.067 1.00 15.80 ? 144 ARG A O   1 
ATOM   1060 C  CB  . ARG A 1 144 ? 43.639 34.228 51.639 1.00 12.97 ? 144 ARG A CB  1 
ATOM   1061 C  CG  . ARG A 1 144 ? 42.630 35.086 50.936 1.00 12.82 ? 144 ARG A CG  1 
ATOM   1062 C  CD  . ARG A 1 144 ? 41.950 36.019 51.911 1.00 14.01 ? 144 ARG A CD  1 
ATOM   1063 N  NE  . ARG A 1 144 ? 40.661 36.420 51.372 1.00 16.00 ? 144 ARG A NE  1 
ATOM   1064 C  CZ  . ARG A 1 144 ? 40.372 37.622 50.888 1.00 17.95 ? 144 ARG A CZ  1 
ATOM   1065 N  NH1 . ARG A 1 144 ? 41.272 38.594 50.895 1.00 18.78 ? 144 ARG A NH1 1 
ATOM   1066 N  NH2 . ARG A 1 144 ? 39.163 37.848 50.397 1.00 18.18 ? 144 ARG A NH2 1 
ATOM   1067 N  N   . LYS A 1 145 ? 45.604 33.546 53.971 1.00 11.67 ? 145 LYS A N   1 
ATOM   1068 C  CA  . LYS A 1 145 ? 46.348 32.431 54.542 1.00 11.20 ? 145 LYS A CA  1 
ATOM   1069 C  C   . LYS A 1 145 ? 45.887 31.096 53.959 1.00 12.81 ? 145 LYS A C   1 
ATOM   1070 O  O   . LYS A 1 145 ? 46.707 30.216 53.709 1.00 11.92 ? 145 LYS A O   1 
ATOM   1071 C  CB  . LYS A 1 145 ? 46.207 32.398 56.069 1.00 12.82 ? 145 LYS A CB  1 
ATOM   1072 C  CG  . LYS A 1 145 ? 46.962 33.508 56.782 1.00 18.26 ? 145 LYS A CG  1 
ATOM   1073 C  CD  . LYS A 1 145 ? 46.800 33.405 58.293 1.00 19.07 ? 145 LYS A CD  1 
ATOM   1074 C  CE  . LYS A 1 145 ? 47.297 34.666 58.997 1.00 29.50 ? 145 LYS A CE  1 
ATOM   1075 N  NZ  . LYS A 1 145 ? 48.766 34.878 58.839 1.00 34.76 ? 145 LYS A NZ  1 
ATOM   1076 N  N   . TRP A 1 146 ? 44.583 30.940 53.730 1.00 11.30 ? 146 TRP A N   1 
ATOM   1077 C  CA  . TRP A 1 146 ? 44.058 29.612 53.412 1.00 10.76 ? 146 TRP A CA  1 
ATOM   1078 C  C   . TRP A 1 146 ? 44.494 29.104 52.033 1.00 9.95  ? 146 TRP A C   1 
ATOM   1079 O  O   . TRP A 1 146 ? 44.512 27.892 51.806 1.00 11.59 ? 146 TRP A O   1 
ATOM   1080 C  CB  . TRP A 1 146 ? 42.524 29.577 53.540 1.00 8.85  ? 146 TRP A CB  1 
ATOM   1081 C  CG  . TRP A 1 146 ? 41.721 30.380 52.543 1.00 9.97  ? 146 TRP A CG  1 
ATOM   1082 C  CD1 . TRP A 1 146 ? 41.155 31.614 52.742 1.00 10.22 ? 146 TRP A CD1 1 
ATOM   1083 C  CD2 . TRP A 1 146 ? 41.342 29.983 51.212 1.00 8.54  ? 146 TRP A CD2 1 
ATOM   1084 N  NE1 . TRP A 1 146 ? 40.471 32.011 51.619 1.00 10.93 ? 146 TRP A NE1 1 
ATOM   1085 C  CE2 . TRP A 1 146 ? 40.576 31.031 50.665 1.00 10.92 ? 146 TRP A CE2 1 
ATOM   1086 C  CE3 . TRP A 1 146 ? 41.592 28.847 50.426 1.00 10.44 ? 146 TRP A CE3 1 
ATOM   1087 C  CZ2 . TRP A 1 146 ? 40.056 30.985 49.375 1.00 9.31  ? 146 TRP A CZ2 1 
ATOM   1088 C  CZ3 . TRP A 1 146 ? 41.072 28.805 49.137 1.00 11.05 ? 146 TRP A CZ3 1 
ATOM   1089 C  CH2 . TRP A 1 146 ? 40.312 29.865 48.629 1.00 9.56  ? 146 TRP A CH2 1 
ATOM   1090 N  N   . THR A 1 147 ? 44.880 30.001 51.131 1.00 10.85 ? 147 THR A N   1 
ATOM   1091 C  CA  . THR A 1 147 ? 45.296 29.577 49.793 1.00 9.62  ? 147 THR A CA  1 
ATOM   1092 C  C   . THR A 1 147 ? 46.709 28.995 49.774 1.00 12.35 ? 147 THR A C   1 
ATOM   1093 O  O   . THR A 1 147 ? 47.120 28.405 48.780 1.00 12.33 ? 147 THR A O   1 
ATOM   1094 C  CB  . THR A 1 147 ? 45.252 30.729 48.791 1.00 10.52 ? 147 THR A CB  1 
ATOM   1095 O  OG1 . THR A 1 147 ? 46.062 31.802 49.282 1.00 11.27 ? 147 THR A OG1 1 
ATOM   1096 C  CG2 . THR A 1 147 ? 43.830 31.228 48.579 1.00 10.23 ? 147 THR A CG2 1 
ATOM   1097 N  N   . GLY A 1 148 ? 47.441 29.163 50.871 1.00 11.88 ? 148 GLY A N   1 
ATOM   1098 C  CA  . GLY A 1 148 ? 48.823 28.716 50.944 1.00 14.87 ? 148 GLY A CA  1 
ATOM   1099 C  C   . GLY A 1 148 ? 49.768 29.684 50.262 1.00 14.56 ? 148 GLY A C   1 
ATOM   1100 O  O   . GLY A 1 148 ? 49.390 30.805 49.926 1.00 18.05 ? 148 GLY A O   1 
ATOM   1101 N  N   . ASP A 1 149 ? 51.003 29.247 50.030 1.00 20.84 ? 149 ASP A N   1 
ATOM   1102 C  CA  . ASP A 1 149 ? 52.005 30.128 49.443 1.00 21.81 ? 149 ASP A CA  1 
ATOM   1103 C  C   . ASP A 1 149 ? 52.570 29.597 48.130 1.00 19.86 ? 149 ASP A C   1 
ATOM   1104 O  O   . ASP A 1 149 ? 53.522 30.163 47.586 1.00 22.35 ? 149 ASP A O   1 
ATOM   1105 C  CB  . ASP A 1 149 ? 53.159 30.360 50.427 1.00 27.16 ? 149 ASP A CB  1 
ATOM   1106 C  CG  . ASP A 1 149 ? 52.721 31.085 51.690 1.00 37.33 ? 149 ASP A CG  1 
ATOM   1107 O  OD1 . ASP A 1 149 ? 52.231 32.235 51.592 1.00 34.78 ? 149 ASP A OD1 1 
ATOM   1108 O  OD2 . ASP A 1 149 ? 52.883 30.507 52.787 1.00 37.96 ? 149 ASP A OD2 1 
ATOM   1109 N  N   . LYS A 1 150 ? 52.002 28.511 47.616 1.00 18.39 ? 150 LYS A N   1 
ATOM   1110 C  CA  . LYS A 1 150 ? 52.566 27.905 46.420 1.00 20.81 ? 150 LYS A CA  1 
ATOM   1111 C  C   . LYS A 1 150 ? 52.243 28.728 45.190 1.00 20.52 ? 150 LYS A C   1 
ATOM   1112 O  O   . LYS A 1 150 ? 51.127 29.230 45.046 1.00 19.70 ? 150 LYS A O   1 
ATOM   1113 C  CB  . LYS A 1 150 ? 52.058 26.478 46.235 1.00 23.13 ? 150 LYS A CB  1 
ATOM   1114 C  CG  . LYS A 1 150 ? 52.513 25.530 47.314 1.00 23.18 ? 150 LYS A CG  1 
ATOM   1115 C  CD  . LYS A 1 150 ? 52.025 24.131 47.027 1.00 33.46 ? 150 LYS A CD  1 
ATOM   1116 C  CE  . LYS A 1 150 ? 52.893 23.084 47.697 1.00 40.66 ? 150 LYS A CE  1 
ATOM   1117 N  NZ  . LYS A 1 150 ? 52.376 21.714 47.417 1.00 38.25 ? 150 LYS A NZ  1 
ATOM   1118 N  N   . PRO A 1 151 ? 53.231 28.882 44.303 1.00 25.08 ? 151 PRO A N   1 
ATOM   1119 C  CA  . PRO A 1 151 ? 52.985 29.501 43.002 1.00 26.91 ? 151 PRO A CA  1 
ATOM   1120 C  C   . PRO A 1 151 ? 51.841 28.802 42.273 1.00 19.67 ? 151 PRO A C   1 
ATOM   1121 O  O   . PRO A 1 151 ? 51.671 27.583 42.414 1.00 23.26 ? 151 PRO A O   1 
ATOM   1122 C  CB  . PRO A 1 151 ? 54.314 29.308 42.265 1.00 32.64 ? 151 PRO A CB  1 
ATOM   1123 C  CG  . PRO A 1 151 ? 55.329 29.247 43.354 1.00 31.80 ? 151 PRO A CG  1 
ATOM   1124 C  CD  . PRO A 1 151 ? 54.651 28.539 44.494 1.00 28.62 ? 151 PRO A CD  1 
ATOM   1125 N  N   . ASN A 1 152 ? 51.073 29.578 41.518 1.00 20.35 ? 152 ASN A N   1 
ATOM   1126 C  CA  . ASN A 1 152 ? 49.968 29.069 40.715 1.00 25.73 ? 152 ASN A CA  1 
ATOM   1127 C  C   . ASN A 1 152 ? 48.787 28.601 41.554 1.00 16.41 ? 152 ASN A C   1 
ATOM   1128 O  O   . ASN A 1 152 ? 47.850 28.018 41.018 1.00 17.54 ? 152 ASN A O   1 
ATOM   1129 C  CB  . ASN A 1 152 ? 50.432 27.929 39.799 1.00 24.40 ? 152 ASN A CB  1 
ATOM   1130 C  CG  . ASN A 1 152 ? 51.621 28.316 38.946 1.00 33.09 ? 152 ASN A CG  1 
ATOM   1131 O  OD1 . ASN A 1 152 ? 51.675 29.417 38.395 1.00 35.40 ? 152 ASN A OD1 1 
ATOM   1132 N  ND2 . ASN A 1 152 ? 52.585 27.412 38.835 1.00 33.20 ? 152 ASN A ND2 1 
ATOM   1133 N  N   . TRP A 1 153 ? 48.797 28.879 42.857 1.00 14.77 ? 153 TRP A N   1 
ATOM   1134 C  CA  . TRP A 1 153 ? 47.598 28.601 43.658 1.00 14.68 ? 153 TRP A CA  1 
ATOM   1135 C  C   . TRP A 1 153 ? 46.984 29.818 44.385 1.00 9.73  ? 153 TRP A C   1 
ATOM   1136 O  O   . TRP A 1 153 ? 46.618 29.713 45.564 1.00 13.71 ? 153 TRP A O   1 
ATOM   1137 C  CB  . TRP A 1 153 ? 47.899 27.484 44.658 1.00 14.14 ? 153 TRP A CB  1 
ATOM   1138 C  CG  . TRP A 1 153 ? 47.856 26.140 43.984 1.00 11.99 ? 153 TRP A CG  1 
ATOM   1139 C  CD1 . TRP A 1 153 ? 48.894 25.481 43.383 1.00 16.72 ? 153 TRP A CD1 1 
ATOM   1140 C  CD2 . TRP A 1 153 ? 46.694 25.327 43.790 1.00 12.51 ? 153 TRP A CD2 1 
ATOM   1141 N  NE1 . TRP A 1 153 ? 48.447 24.295 42.851 1.00 16.73 ? 153 TRP A NE1 1 
ATOM   1142 C  CE2 . TRP A 1 153 ? 47.105 24.176 43.088 1.00 15.38 ? 153 TRP A CE2 1 
ATOM   1143 C  CE3 . TRP A 1 153 ? 45.351 25.451 44.165 1.00 14.11 ? 153 TRP A CE3 1 
ATOM   1144 C  CZ2 . TRP A 1 153 ? 46.211 23.157 42.739 1.00 13.92 ? 153 TRP A CZ2 1 
ATOM   1145 C  CZ3 . TRP A 1 153 ? 44.466 24.435 43.821 1.00 15.97 ? 153 TRP A CZ3 1 
ATOM   1146 C  CH2 . TRP A 1 153 ? 44.901 23.302 43.114 1.00 14.57 ? 153 TRP A CH2 1 
ATOM   1147 N  N   . PRO A 1 154 ? 46.796 30.940 43.667 1.00 12.34 ? 154 PRO A N   1 
ATOM   1148 C  CA  . PRO A 1 154 ? 46.040 32.027 44.285 1.00 11.93 ? 154 PRO A CA  1 
ATOM   1149 C  C   . PRO A 1 154 ? 44.559 31.670 44.370 1.00 11.04 ? 154 PRO A C   1 
ATOM   1150 O  O   . PRO A 1 154 ? 44.159 30.598 43.901 1.00 11.46 ? 154 PRO A O   1 
ATOM   1151 C  CB  . PRO A 1 154 ? 46.253 33.183 43.324 1.00 12.57 ? 154 PRO A CB  1 
ATOM   1152 C  CG  . PRO A 1 154 ? 46.278 32.516 41.991 1.00 13.57 ? 154 PRO A CG  1 
ATOM   1153 C  CD  . PRO A 1 154 ? 47.000 31.199 42.229 1.00 11.33 ? 154 PRO A CD  1 
HETATM 1154 N  N   . MSE A 1 155 ? 43.758 32.564 44.943 1.00 9.04  ? 155 MSE A N   1 
HETATM 1155 C  CA  . MSE A 1 155 ? 42.320 32.341 45.087 1.00 8.90  ? 155 MSE A CA  1 
HETATM 1156 C  C   . MSE A 1 155 ? 41.670 31.838 43.803 1.00 9.64  ? 155 MSE A C   1 
HETATM 1157 O  O   . MSE A 1 155 ? 40.876 30.910 43.854 1.00 10.13 ? 155 MSE A O   1 
HETATM 1158 C  CB  . MSE A 1 155 ? 41.609 33.620 45.529 1.00 9.28  ? 155 MSE A CB  1 
HETATM 1159 C  CG  . MSE A 1 155 ? 41.949 34.118 46.936 1.00 11.21 ? 155 MSE A CG  1 
HETATM 1160 SE SE  . MSE A 1 155 ? 40.821 35.632 47.427 0.64 10.57 ? 155 MSE A SE  1 
HETATM 1161 C  CE  . MSE A 1 155 ? 39.237 34.604 47.846 1.00 16.23 ? 155 MSE A CE  1 
ATOM   1162 N  N   . ALA A 1 156 ? 42.008 32.436 42.664 1.00 8.28  ? 156 ALA A N   1 
ATOM   1163 C  CA  . ALA A 1 156 ? 41.340 32.083 41.413 1.00 9.33  ? 156 ALA A CA  1 
ATOM   1164 C  C   . ALA A 1 156 ? 41.479 30.608 41.072 1.00 10.30 ? 156 ALA A C   1 
ATOM   1165 O  O   . ALA A 1 156 ? 40.558 30.021 40.512 1.00 9.49  ? 156 ALA A O   1 
ATOM   1166 C  CB  . ALA A 1 156 ? 41.866 32.924 40.274 1.00 13.59 ? 156 ALA A CB  1 
ATOM   1167 N  N   . ARG A 1 157 ? 42.615 29.999 41.402 1.00 7.93  ? 157 ARG A N   1 
ATOM   1168 C  CA  . ARG A 1 157 ? 42.805 28.585 41.089 1.00 9.77  ? 157 ARG A CA  1 
ATOM   1169 C  C   . ARG A 1 157 ? 41.916 27.714 41.973 1.00 9.68  ? 157 ARG A C   1 
ATOM   1170 O  O   . ARG A 1 157 ? 41.262 26.792 41.493 1.00 9.63  ? 157 ARG A O   1 
ATOM   1171 C  CB  . ARG A 1 157 ? 44.273 28.186 41.252 1.00 12.92 ? 157 ARG A CB  1 
ATOM   1172 C  CG  . ARG A 1 157 ? 44.533 26.698 41.038 1.00 16.82 ? 157 ARG A CG  1 
ATOM   1173 C  CD  . ARG A 1 157 ? 45.329 26.474 39.770 1.00 22.76 ? 157 ARG A CD  1 
ATOM   1174 N  NE  . ARG A 1 157 ? 45.637 25.066 39.515 1.00 20.44 ? 157 ARG A NE  1 
ATOM   1175 C  CZ  . ARG A 1 157 ? 46.864 24.553 39.533 1.00 20.87 ? 157 ARG A CZ  1 
ATOM   1176 N  NH1 . ARG A 1 157 ? 47.906 25.321 39.813 1.00 19.23 ? 157 ARG A NH1 1 
ATOM   1177 N  NH2 . ARG A 1 157 ? 47.054 23.266 39.270 1.00 17.66 ? 157 ARG A NH2 1 
ATOM   1178 N  N   . TRP A 1 158 ? 41.896 28.003 43.270 1.00 8.13  ? 158 TRP A N   1 
ATOM   1179 C  CA  . TRP A 1 158 ? 41.026 27.297 44.198 1.00 7.83  ? 158 TRP A CA  1 
ATOM   1180 C  C   . TRP A 1 158 ? 39.560 27.461 43.813 1.00 6.85  ? 158 TRP A C   1 
ATOM   1181 O  O   . TRP A 1 158 ? 38.763 26.544 43.979 1.00 8.22  ? 158 TRP A O   1 
ATOM   1182 C  CB  . TRP A 1 158 ? 41.226 27.807 45.623 1.00 9.18  ? 158 TRP A CB  1 
ATOM   1183 C  CG  . TRP A 1 158 ? 42.556 27.474 46.261 1.00 7.22  ? 158 TRP A CG  1 
ATOM   1184 C  CD1 . TRP A 1 158 ? 43.685 28.250 46.280 1.00 9.89  ? 158 TRP A CD1 1 
ATOM   1185 C  CD2 . TRP A 1 158 ? 42.855 26.305 47.023 1.00 9.57  ? 158 TRP A CD2 1 
ATOM   1186 N  NE1 . TRP A 1 158 ? 44.672 27.614 46.997 1.00 9.74  ? 158 TRP A NE1 1 
ATOM   1187 C  CE2 . TRP A 1 158 ? 44.186 26.424 47.469 1.00 7.99  ? 158 TRP A CE2 1 
ATOM   1188 C  CE3 . TRP A 1 158 ? 42.123 25.165 47.373 1.00 8.58  ? 158 TRP A CE3 1 
ATOM   1189 C  CZ2 . TRP A 1 158 ? 44.797 25.439 48.253 1.00 9.28  ? 158 TRP A CZ2 1 
ATOM   1190 C  CZ3 . TRP A 1 158 ? 42.729 24.192 48.141 1.00 10.19 ? 158 TRP A CZ3 1 
ATOM   1191 C  CH2 . TRP A 1 158 ? 44.056 24.337 48.576 1.00 11.34 ? 158 TRP A CH2 1 
ATOM   1192 N  N   . ILE A 1 159 ? 39.210 28.634 43.302 1.00 6.88  ? 159 ILE A N   1 
ATOM   1193 C  CA  . ILE A 1 159 ? 37.843 28.888 42.863 1.00 7.04  ? 159 ILE A CA  1 
ATOM   1194 C  C   . ILE A 1 159 ? 37.542 28.058 41.606 1.00 7.73  ? 159 ILE A C   1 
ATOM   1195 O  O   . ILE A 1 159 ? 36.511 27.368 41.543 1.00 8.08  ? 159 ILE A O   1 
ATOM   1196 C  CB  . ILE A 1 159 ? 37.616 30.392 42.621 1.00 7.21  ? 159 ILE A CB  1 
ATOM   1197 C  CG1 . ILE A 1 159 ? 37.514 31.120 43.967 1.00 9.98  ? 159 ILE A CG1 1 
ATOM   1198 C  CG2 . ILE A 1 159 ? 36.349 30.630 41.778 1.00 9.06  ? 159 ILE A CG2 1 
ATOM   1199 C  CD1 . ILE A 1 159 ? 37.627 32.619 43.842 1.00 10.41 ? 159 ILE A CD1 1 
ATOM   1200 N  N   . HIS A 1 160 ? 38.455 28.080 40.635 1.00 7.91  ? 160 HIS A N   1 
ATOM   1201 C  CA  . HIS A 1 160 ? 38.300 27.313 39.403 1.00 8.45  ? 160 HIS A CA  1 
ATOM   1202 C  C   . HIS A 1 160 ? 38.078 25.821 39.654 1.00 7.63  ? 160 HIS A C   1 
ATOM   1203 O  O   . HIS A 1 160 ? 37.132 25.214 39.108 1.00 8.79  ? 160 HIS A O   1 
ATOM   1204 C  CB  . HIS A 1 160 ? 39.533 27.506 38.518 1.00 9.49  ? 160 HIS A CB  1 
ATOM   1205 C  CG  . HIS A 1 160 ? 39.601 26.550 37.366 1.00 12.98 ? 160 HIS A CG  1 
ATOM   1206 N  ND1 . HIS A 1 160 ? 38.917 26.758 36.189 1.00 15.33 ? 160 HIS A ND1 1 
ATOM   1207 C  CD2 . HIS A 1 160 ? 40.271 25.383 37.213 1.00 15.58 ? 160 HIS A CD2 1 
ATOM   1208 C  CE1 . HIS A 1 160 ? 39.164 25.760 35.359 1.00 13.49 ? 160 HIS A CE1 1 
ATOM   1209 N  NE2 . HIS A 1 160 ? 39.988 24.914 35.953 1.00 17.33 ? 160 HIS A NE2 1 
ATOM   1210 N  N   . ILE A 1 161 ? 38.933 25.218 40.473 1.00 9.39  ? 161 ILE A N   1 
ATOM   1211 C  CA  . ILE A 1 161 ? 38.877 23.778 40.653 1.00 8.51  ? 161 ILE A CA  1 
ATOM   1212 C  C   . ILE A 1 161 ? 37.649 23.350 41.456 1.00 7.87  ? 161 ILE A C   1 
ATOM   1213 O  O   . ILE A 1 161 ? 37.355 22.162 41.556 1.00 8.65  ? 161 ILE A O   1 
ATOM   1214 C  CB  . ILE A 1 161 ? 40.145 23.219 41.343 1.00 8.47  ? 161 ILE A CB  1 
ATOM   1215 C  CG1 . ILE A 1 161 ? 40.361 23.829 42.731 1.00 8.99  ? 161 ILE A CG1 1 
ATOM   1216 C  CG2 . ILE A 1 161 ? 41.383 23.416 40.467 1.00 13.15 ? 161 ILE A CG2 1 
ATOM   1217 C  CD1 . ILE A 1 161 ? 41.066 22.885 43.721 1.00 11.77 ? 161 ILE A CD1 1 
ATOM   1218 N  N   . ASN A 1 162 ? 36.922 24.316 42.015 1.00 7.36  ? 162 ASN A N   1 
ATOM   1219 C  CA  . ASN A 1 162 ? 35.724 23.988 42.781 1.00 7.73  ? 162 ASN A CA  1 
ATOM   1220 C  C   . ASN A 1 162 ? 34.434 24.523 42.181 1.00 6.83  ? 162 ASN A C   1 
ATOM   1221 O  O   . ASN A 1 162 ? 33.362 24.415 42.792 1.00 7.99  ? 162 ASN A O   1 
ATOM   1222 C  CB  . ASN A 1 162 ? 35.881 24.482 44.219 1.00 8.55  ? 162 ASN A CB  1 
ATOM   1223 C  CG  . ASN A 1 162 ? 36.757 23.561 45.024 1.00 7.19  ? 162 ASN A CG  1 
ATOM   1224 O  OD1 . ASN A 1 162 ? 36.383 22.415 45.275 1.00 10.03 ? 162 ASN A OD1 1 
ATOM   1225 N  ND2 . ASN A 1 162 ? 37.942 24.032 45.397 1.00 8.81  ? 162 ASN A ND2 1 
ATOM   1226 N  N   . SER A 1 163 ? 34.520 25.066 40.976 1.00 6.39  ? 163 SER A N   1 
ATOM   1227 C  CA  . SER A 1 163 ? 33.300 25.520 40.316 1.00 6.85  ? 163 SER A CA  1 
ATOM   1228 C  C   . SER A 1 163 ? 33.384 25.264 38.808 1.00 8.51  ? 163 SER A C   1 
ATOM   1229 O  O   . SER A 1 163 ? 32.878 24.249 38.346 1.00 9.05  ? 163 SER A O   1 
ATOM   1230 C  CB  . SER A 1 163 ? 33.006 26.995 40.631 1.00 7.86  ? 163 SER A CB  1 
ATOM   1231 O  OG  . SER A 1 163 ? 34.084 27.856 40.304 1.00 7.38  ? 163 SER A OG  1 
ATOM   1232 N  N   . ALA A 1 164 ? 34.039 26.149 38.053 1.00 8.22  ? 164 ALA A N   1 
ATOM   1233 C  CA  . ALA A 1 164 ? 34.124 26.001 36.596 1.00 10.03 ? 164 ALA A CA  1 
ATOM   1234 C  C   . ALA A 1 164 ? 34.547 24.597 36.174 1.00 10.24 ? 164 ALA A C   1 
ATOM   1235 O  O   . ALA A 1 164 ? 33.914 23.994 35.290 1.00 9.62  ? 164 ALA A O   1 
ATOM   1236 C  CB  . ALA A 1 164 ? 35.087 27.025 36.014 1.00 11.12 ? 164 ALA A CB  1 
ATOM   1237 N  N   . ALA A 1 165 ? 35.591 24.058 36.793 1.00 8.43  ? 165 ALA A N   1 
ATOM   1238 C  CA  . ALA A 1 165 ? 36.058 22.741 36.378 1.00 7.93  ? 165 ALA A CA  1 
ATOM   1239 C  C   . ALA A 1 165 ? 35.071 21.598 36.717 1.00 9.58  ? 165 ALA A C   1 
ATOM   1240 O  O   . ALA A 1 165 ? 34.655 20.869 35.806 1.00 8.70  ? 165 ALA A O   1 
ATOM   1241 C  CB  . ALA A 1 165 ? 37.465 22.459 36.953 1.00 8.81  ? 165 ALA A CB  1 
ATOM   1242 N  N   . PRO A 1 166 ? 34.672 21.432 37.993 1.00 8.53  ? 166 PRO A N   1 
ATOM   1243 C  CA  . PRO A 1 166 ? 33.708 20.352 38.242 1.00 10.00 ? 166 PRO A CA  1 
ATOM   1244 C  C   . PRO A 1 166 ? 32.343 20.561 37.578 1.00 9.81  ? 166 PRO A C   1 
ATOM   1245 O  O   . PRO A 1 166 ? 31.671 19.573 37.281 1.00 9.09  ? 166 PRO A O   1 
ATOM   1246 C  CB  . PRO A 1 166 ? 33.568 20.341 39.778 1.00 8.90  ? 166 PRO A CB  1 
ATOM   1247 C  CG  . PRO A 1 166 ? 34.025 21.692 40.221 1.00 9.24  ? 166 PRO A CG  1 
ATOM   1248 C  CD  . PRO A 1 166 ? 35.122 22.057 39.254 1.00 8.89  ? 166 PRO A CD  1 
ATOM   1249 N  N   . PHE A 1 167 ? 31.916 21.796 37.336 1.00 6.32  ? 167 PHE A N   1 
ATOM   1250 C  CA  . PHE A 1 167 ? 30.631 21.965 36.661 1.00 7.16  ? 167 PHE A CA  1 
ATOM   1251 C  C   . PHE A 1 167 ? 30.702 21.329 35.269 1.00 8.19  ? 167 PHE A C   1 
ATOM   1252 O  O   . PHE A 1 167 ? 29.717 20.762 34.791 1.00 8.66  ? 167 PHE A O   1 
ATOM   1253 C  CB  . PHE A 1 167 ? 30.216 23.440 36.536 1.00 7.90  ? 167 PHE A CB  1 
ATOM   1254 C  CG  . PHE A 1 167 ? 29.919 24.133 37.858 1.00 6.00  ? 167 PHE A CG  1 
ATOM   1255 C  CD1 . PHE A 1 167 ? 29.849 23.439 39.068 1.00 7.18  ? 167 PHE A CD1 1 
ATOM   1256 C  CD2 . PHE A 1 167 ? 29.710 25.499 37.872 1.00 7.16  ? 167 PHE A CD2 1 
ATOM   1257 C  CE1 . PHE A 1 167 ? 29.577 24.109 40.262 1.00 6.74  ? 167 PHE A CE1 1 
ATOM   1258 C  CE2 . PHE A 1 167 ? 29.448 26.167 39.064 1.00 7.32  ? 167 PHE A CE2 1 
ATOM   1259 C  CZ  . PHE A 1 167 ? 29.379 25.471 40.250 1.00 8.72  ? 167 PHE A CZ  1 
ATOM   1260 N  N   . LYS A 1 168 ? 31.858 21.417 34.615 1.00 7.61  ? 168 LYS A N   1 
ATOM   1261 C  CA  . LYS A 1 168 ? 32.029 20.758 33.321 1.00 9.25  ? 168 LYS A CA  1 
ATOM   1262 C  C   . LYS A 1 168 ? 32.137 19.234 33.467 1.00 8.92  ? 168 LYS A C   1 
ATOM   1263 O  O   . LYS A 1 168 ? 31.471 18.479 32.758 1.00 8.82  ? 168 LYS A O   1 
ATOM   1264 C  CB  . LYS A 1 168 ? 33.266 21.312 32.609 1.00 11.28 ? 168 LYS A CB  1 
ATOM   1265 C  CG  . LYS A 1 168 ? 33.466 20.739 31.208 1.00 16.25 ? 168 LYS A CG  1 
ATOM   1266 C  CD  . LYS A 1 168 ? 34.434 21.595 30.392 1.00 20.94 ? 168 LYS A CD  1 
ATOM   1267 C  CE  . LYS A 1 168 ? 35.829 21.605 30.994 1.00 36.75 ? 168 LYS A CE  1 
ATOM   1268 N  NZ  . LYS A 1 168 ? 36.796 22.365 30.144 1.00 40.63 ? 168 LYS A NZ  1 
ATOM   1269 N  N   . THR A 1 169 ? 32.950 18.772 34.402 1.00 7.54  ? 169 THR A N   1 
ATOM   1270 C  CA  . THR A 1 169 ? 33.132 17.344 34.598 1.00 7.13  ? 169 THR A CA  1 
ATOM   1271 C  C   . THR A 1 169 ? 31.834 16.640 34.970 1.00 8.16  ? 169 THR A C   1 
ATOM   1272 O  O   . THR A 1 169 ? 31.497 15.563 34.433 1.00 8.50  ? 169 THR A O   1 
ATOM   1273 C  CB  . THR A 1 169 ? 34.176 17.096 35.685 1.00 9.78  ? 169 THR A CB  1 
ATOM   1274 O  OG1 . THR A 1 169 ? 35.424 17.648 35.257 1.00 11.99 ? 169 THR A OG1 1 
ATOM   1275 C  CG2 . THR A 1 169 ? 34.342 15.614 35.969 1.00 11.00 ? 169 THR A CG2 1 
ATOM   1276 N  N   . PHE A 1 170 ? 31.094 17.241 35.894 1.00 8.00  ? 170 PHE A N   1 
ATOM   1277 C  CA  . PHE A 1 170 ? 29.881 16.610 36.366 1.00 7.36  ? 170 PHE A CA  1 
ATOM   1278 C  C   . PHE A 1 170 ? 28.748 16.771 35.351 1.00 7.45  ? 170 PHE A C   1 
ATOM   1279 O  O   . PHE A 1 170 ? 27.791 16.001 35.369 1.00 7.53  ? 170 PHE A O   1 
ATOM   1280 C  CB  . PHE A 1 170 ? 29.511 17.154 37.757 1.00 7.26  ? 170 PHE A CB  1 
ATOM   1281 C  CG  . PHE A 1 170 ? 30.315 16.528 38.861 1.00 7.23  ? 170 PHE A CG  1 
ATOM   1282 C  CD1 . PHE A 1 170 ? 29.746 15.587 39.692 1.00 10.47 ? 170 PHE A CD1 1 
ATOM   1283 C  CD2 . PHE A 1 170 ? 31.653 16.857 39.057 1.00 8.77  ? 170 PHE A CD2 1 
ATOM   1284 C  CE1 . PHE A 1 170 ? 30.477 14.991 40.709 1.00 12.98 ? 170 PHE A CE1 1 
ATOM   1285 C  CE2 . PHE A 1 170 ? 32.389 16.248 40.070 1.00 11.38 ? 170 PHE A CE2 1 
ATOM   1286 C  CZ  . PHE A 1 170 ? 31.799 15.322 40.890 1.00 11.65 ? 170 PHE A CZ  1 
ATOM   1287 N  N   . ARG A 1 171 ? 28.851 17.741 34.449 1.00 6.93  ? 171 ARG A N   1 
ATOM   1288 C  CA  . ARG A 1 171 ? 27.909 17.773 33.337 1.00 7.31  ? 171 ARG A CA  1 
ATOM   1289 C  C   . ARG A 1 171 ? 28.096 16.524 32.465 1.00 6.41  ? 171 ARG A C   1 
ATOM   1290 O  O   . ARG A 1 171 ? 27.115 15.906 32.017 1.00 7.17  ? 171 ARG A O   1 
ATOM   1291 C  CB  . ARG A 1 171 ? 28.065 19.028 32.489 1.00 7.84  ? 171 ARG A CB  1 
ATOM   1292 C  CG  . ARG A 1 171 ? 27.145 19.009 31.283 1.00 8.11  ? 171 ARG A CG  1 
ATOM   1293 C  CD  . ARG A 1 171 ? 27.351 20.212 30.407 1.00 14.28 ? 171 ARG A CD  1 
ATOM   1294 N  NE  . ARG A 1 171 ? 26.445 20.185 29.263 1.00 12.04 ? 171 ARG A NE  1 
ATOM   1295 C  CZ  . ARG A 1 171 ? 26.764 20.636 28.056 1.00 11.33 ? 171 ARG A CZ  1 
ATOM   1296 N  NH1 . ARG A 1 171 ? 27.963 21.144 27.823 1.00 15.59 ? 171 ARG A NH1 1 
ATOM   1297 N  NH2 . ARG A 1 171 ? 25.878 20.579 27.073 1.00 12.19 ? 171 ARG A NH2 1 
ATOM   1298 N  N   . ALA A 1 172 ? 29.342 16.149 32.206 1.00 7.61  ? 172 ALA A N   1 
ATOM   1299 C  CA  . ALA A 1 172 ? 29.580 14.926 31.456 1.00 7.42  ? 172 ALA A CA  1 
ATOM   1300 C  C   . ALA A 1 172 ? 28.989 13.722 32.190 1.00 6.60  ? 172 ALA A C   1 
ATOM   1301 O  O   . ALA A 1 172 ? 28.381 12.840 31.577 1.00 8.45  ? 172 ALA A O   1 
ATOM   1302 C  CB  . ALA A 1 172 ? 31.075 14.729 31.226 1.00 7.40  ? 172 ALA A CB  1 
ATOM   1303 N  N   . LYS A 1 173 ? 29.141 13.695 33.510 1.00 7.09  ? 173 LYS A N   1 
ATOM   1304 C  CA  . LYS A 1 173 ? 28.623 12.594 34.312 1.00 7.04  ? 173 LYS A CA  1 
ATOM   1305 C  C   . LYS A 1 173 ? 27.109 12.444 34.198 1.00 7.04  ? 173 LYS A C   1 
ATOM   1306 O  O   . LYS A 1 173 ? 26.598 11.333 34.033 1.00 7.38  ? 173 LYS A O   1 
ATOM   1307 C  CB  . LYS A 1 173 ? 28.986 12.776 35.789 1.00 11.05 ? 173 LYS A CB  1 
ATOM   1308 C  CG  . LYS A 1 173 ? 30.433 12.497 36.141 1.00 14.10 ? 173 LYS A CG  1 
ATOM   1309 C  CD  . LYS A 1 173 ? 30.624 12.622 37.656 1.00 17.14 ? 173 LYS A CD  1 
ATOM   1310 C  CE  . LYS A 1 173 ? 32.072 12.514 38.056 1.00 15.94 ? 173 LYS A CE  1 
ATOM   1311 N  NZ  . LYS A 1 173 ? 32.616 11.180 37.698 1.00 16.31 ? 173 LYS A NZ  1 
ATOM   1312 N  N   . ILE A 1 174 ? 26.382 13.548 34.328 1.00 6.32  ? 174 ILE A N   1 
ATOM   1313 C  CA  . ILE A 1 174 ? 24.928 13.449 34.298 1.00 6.91  ? 174 ILE A CA  1 
ATOM   1314 C  C   . ILE A 1 174 ? 24.459 13.130 32.878 1.00 6.67  ? 174 ILE A C   1 
ATOM   1315 O  O   . ILE A 1 174 ? 23.463 12.422 32.708 1.00 8.29  ? 174 ILE A O   1 
ATOM   1316 C  CB  . ILE A 1 174 ? 24.241 14.730 34.871 1.00 7.32  ? 174 ILE A CB  1 
ATOM   1317 C  CG1 . ILE A 1 174 ? 22.749 14.477 35.122 1.00 7.21  ? 174 ILE A CG1 1 
ATOM   1318 C  CG2 . ILE A 1 174 ? 24.440 15.940 33.983 1.00 9.88  ? 174 ILE A CG2 1 
ATOM   1319 C  CD1 . ILE A 1 174 ? 22.488 13.426 36.188 1.00 10.19 ? 174 ILE A CD1 1 
ATOM   1320 N  N   . ARG A 1 175 ? 25.173 13.601 31.861 1.00 7.15  ? 175 ARG A N   1 
ATOM   1321 C  CA  . ARG A 1 175 ? 24.820 13.239 30.482 1.00 7.13  ? 175 ARG A CA  1 
ATOM   1322 C  C   . ARG A 1 175 ? 24.998 11.738 30.248 1.00 7.86  ? 175 ARG A C   1 
ATOM   1323 O  O   . ARG A 1 175 ? 24.188 11.107 29.558 1.00 9.84  ? 175 ARG A O   1 
ATOM   1324 C  CB  . ARG A 1 175 ? 25.651 14.034 29.470 1.00 8.67  ? 175 ARG A CB  1 
ATOM   1325 C  CG  . ARG A 1 175 ? 25.268 15.501 29.378 1.00 9.47  ? 175 ARG A CG  1 
ATOM   1326 C  CD  . ARG A 1 175 ? 26.274 16.339 28.589 1.00 12.67 ? 175 ARG A CD  1 
ATOM   1327 N  NE  . ARG A 1 175 ? 26.356 15.941 27.185 1.00 14.35 ? 175 ARG A NE  1 
ATOM   1328 C  CZ  . ARG A 1 175 ? 25.596 16.442 26.218 1.00 15.74 ? 175 ARG A CZ  1 
ATOM   1329 N  NH1 . ARG A 1 175 ? 24.690 17.370 26.489 1.00 14.74 ? 175 ARG A NH1 1 
ATOM   1330 N  NH2 . ARG A 1 175 ? 25.755 16.020 24.966 1.00 16.60 ? 175 ARG A NH2 1 
ATOM   1331 N  N   . LYS A 1 176 ? 26.051 11.162 30.817 1.00 7.59  ? 176 LYS A N   1 
ATOM   1332 C  CA  . LYS A 1 176 ? 26.309 9.739  30.689 1.00 8.18  ? 176 LYS A CA  1 
ATOM   1333 C  C   . LYS A 1 176 ? 25.253 8.950  31.470 1.00 9.99  ? 176 LYS A C   1 
ATOM   1334 O  O   . LYS A 1 176 ? 24.747 7.935  30.989 1.00 11.03 ? 176 LYS A O   1 
ATOM   1335 C  CB  . LYS A 1 176 ? 27.726 9.422  31.178 1.00 9.35  ? 176 LYS A CB  1 
ATOM   1336 C  CG  . LYS A 1 176 ? 28.206 8.004  30.918 1.00 14.43 ? 176 LYS A CG  1 
ATOM   1337 C  CD  . LYS A 1 176 ? 29.678 7.879  31.308 1.00 18.65 ? 176 LYS A CD  1 
ATOM   1338 C  CE  . LYS A 1 176 ? 30.290 6.571  30.856 1.00 31.21 ? 176 LYS A CE  1 
ATOM   1339 N  NZ  . LYS A 1 176 ? 31.708 6.476  31.311 1.00 35.45 ? 176 LYS A NZ  1 
ATOM   1340 N  N   . TRP A 1 177 ? 24.901 9.425  32.665 1.00 7.85  ? 177 TRP A N   1 
ATOM   1341 C  CA  . TRP A 1 177 ? 23.831 8.811  33.438 1.00 9.03  ? 177 TRP A CA  1 
ATOM   1342 C  C   . TRP A 1 177 ? 22.540 8.798  32.611 1.00 8.24  ? 177 TRP A C   1 
ATOM   1343 O  O   . TRP A 1 177 ? 21.851 7.776  32.533 1.00 9.45  ? 177 TRP A O   1 
ATOM   1344 C  CB  . TRP A 1 177 ? 23.637 9.559  34.768 1.00 7.19  ? 177 TRP A CB  1 
ATOM   1345 C  CG  . TRP A 1 177 ? 22.568 8.977  35.641 1.00 7.30  ? 177 TRP A CG  1 
ATOM   1346 C  CD1 . TRP A 1 177 ? 22.738 8.076  36.659 1.00 8.75  ? 177 TRP A CD1 1 
ATOM   1347 C  CD2 . TRP A 1 177 ? 21.171 9.273  35.591 1.00 6.99  ? 177 TRP A CD2 1 
ATOM   1348 N  NE1 . TRP A 1 177 ? 21.521 7.782  37.234 1.00 10.33 ? 177 TRP A NE1 1 
ATOM   1349 C  CE2 . TRP A 1 177 ? 20.542 8.500  36.594 1.00 7.95  ? 177 TRP A CE2 1 
ATOM   1350 C  CE3 . TRP A 1 177 ? 20.389 10.111 34.794 1.00 7.72  ? 177 TRP A CE3 1 
ATOM   1351 C  CZ2 . TRP A 1 177 ? 19.170 8.550  36.820 1.00 9.39  ? 177 TRP A CZ2 1 
ATOM   1352 C  CZ3 . TRP A 1 177 ? 19.018 10.151 35.011 1.00 8.39  ? 177 TRP A CZ3 1 
ATOM   1353 C  CH2 . TRP A 1 177 ? 18.425 9.371  36.018 1.00 10.15 ? 177 TRP A CH2 1 
ATOM   1354 N  N   . LYS A 1 178 ? 22.211 9.919  31.976 1.00 7.60  ? 178 LYS A N   1 
ATOM   1355 C  CA  . LYS A 1 178 ? 20.986 9.975  31.176 1.00 10.31 ? 178 LYS A CA  1 
ATOM   1356 C  C   . LYS A 1 178 ? 21.046 9.014  29.997 1.00 10.75 ? 178 LYS A C   1 
ATOM   1357 O  O   . LYS A 1 178 ? 20.054 8.356  29.686 1.00 12.17 ? 178 LYS A O   1 
ATOM   1358 C  CB  . LYS A 1 178 ? 20.724 11.393 30.670 1.00 9.39  ? 178 LYS A CB  1 
ATOM   1359 C  CG  . LYS A 1 178 ? 20.270 12.333 31.766 1.00 10.74 ? 178 LYS A CG  1 
ATOM   1360 C  CD  . LYS A 1 178 ? 19.684 13.603 31.185 1.00 13.85 ? 178 LYS A CD  1 
ATOM   1361 C  CE  . LYS A 1 178 ? 20.748 14.443 30.518 1.00 15.20 ? 178 LYS A CE  1 
ATOM   1362 N  NZ  . LYS A 1 178 ? 20.168 15.740 30.067 1.00 17.26 ? 178 LYS A NZ  1 
ATOM   1363 N  N   . LYS A 1 179 ? 22.196 8.936  29.341 1.00 9.92  ? 179 LYS A N   1 
ATOM   1364 C  CA  . LYS A 1 179 ? 22.329 8.040  28.198 1.00 10.00 ? 179 LYS A CA  1 
ATOM   1365 C  C   . LYS A 1 179 ? 21.971 6.613  28.598 1.00 9.98  ? 179 LYS A C   1 
ATOM   1366 O  O   . LYS A 1 179 ? 21.206 5.923  27.901 1.00 11.09 ? 179 LYS A O   1 
ATOM   1367 C  CB  . LYS A 1 179 ? 23.751 8.090  27.631 1.00 12.36 ? 179 LYS A CB  1 
ATOM   1368 C  CG  . LYS A 1 179 ? 23.964 7.115  26.480 1.00 12.37 ? 179 LYS A CG  1 
ATOM   1369 C  CD  . LYS A 1 179 ? 25.398 7.148  25.984 1.00 16.98 ? 179 LYS A CD  1 
ATOM   1370 C  CE  . LYS A 1 179 ? 25.636 6.094  24.906 1.00 18.80 ? 179 LYS A CE  1 
ATOM   1371 N  NZ  . LYS A 1 179 ? 27.035 6.169  24.379 1.00 25.16 ? 179 LYS A NZ  1 
ATOM   1372 N  N   . HIS A 1 180 ? 22.475 6.174  29.743 1.00 9.32  ? 180 HIS A N   1 
ATOM   1373 C  CA  . HIS A 1 180 ? 22.324 4.783  30.120 1.00 11.57 ? 180 HIS A CA  1 
ATOM   1374 C  C   . HIS A 1 180 ? 20.991 4.489  30.801 1.00 13.61 ? 180 HIS A C   1 
ATOM   1375 O  O   . HIS A 1 180 ? 20.756 3.363  31.238 1.00 15.41 ? 180 HIS A O   1 
ATOM   1376 C  CB  . HIS A 1 180 ? 23.518 4.366  30.973 1.00 11.17 ? 180 HIS A CB  1 
ATOM   1377 C  CG  . HIS A 1 180 ? 24.790 4.348  30.193 1.00 13.30 ? 180 HIS A CG  1 
ATOM   1378 N  ND1 . HIS A 1 180 ? 24.893 3.703  28.977 1.00 14.64 ? 180 HIS A ND1 1 
ATOM   1379 C  CD2 . HIS A 1 180 ? 25.994 4.925  30.417 1.00 14.08 ? 180 HIS A CD2 1 
ATOM   1380 C  CE1 . HIS A 1 180 ? 26.115 3.865  28.500 1.00 16.31 ? 180 HIS A CE1 1 
ATOM   1381 N  NE2 . HIS A 1 180 ? 26.804 4.597  29.356 1.00 18.03 ? 180 HIS A NE2 1 
ATOM   1382 N  N   . GLN A 1 181 ? 20.112 5.488  30.849 1.00 10.83 ? 181 GLN A N   1 
ATOM   1383 C  CA  . GLN A 1 181 ? 18.702 5.230  31.141 1.00 11.08 ? 181 GLN A CA  1 
ATOM   1384 C  C   . GLN A 1 181 ? 18.007 4.645  29.916 1.00 13.77 ? 181 GLN A C   1 
ATOM   1385 O  O   . GLN A 1 181 ? 16.927 4.064  30.032 1.00 15.40 ? 181 GLN A O   1 
ATOM   1386 C  CB  . GLN A 1 181 ? 17.961 6.507  31.554 1.00 15.21 ? 181 GLN A CB  1 
ATOM   1387 C  CG  . GLN A 1 181 ? 18.554 7.232  32.738 1.00 16.49 ? 181 GLN A CG  1 
ATOM   1388 C  CD  . GLN A 1 181 ? 18.691 6.341  33.934 1.00 19.39 ? 181 GLN A CD  1 
ATOM   1389 O  OE1 . GLN A 1 181 ? 17.691 5.854  34.471 1.00 24.33 ? 181 GLN A OE1 1 
ATOM   1390 N  NE2 . GLN A 1 181 ? 19.923 6.097  34.355 1.00 17.81 ? 181 GLN A NE2 1 
ATOM   1391 N  N   . ARG A 1 182 ? 18.615 4.824  28.746 1.00 14.74 ? 182 ARG A N   1 
ATOM   1392 C  CA  . ARG A 1 182 ? 17.961 4.502  27.478 1.00 14.05 ? 182 ARG A CA  1 
ATOM   1393 C  C   . ARG A 1 182 ? 18.698 3.477  26.623 1.00 15.01 ? 182 ARG A C   1 
ATOM   1394 O  O   . ARG A 1 182 ? 18.070 2.768  25.826 1.00 14.22 ? 182 ARG A O   1 
ATOM   1395 C  CB  . ARG A 1 182 ? 17.778 5.773  26.640 1.00 18.99 ? 182 ARG A CB  1 
ATOM   1396 C  CG  . ARG A 1 182 ? 16.760 6.772  27.180 1.00 24.03 ? 182 ARG A CG  1 
ATOM   1397 C  CD  . ARG A 1 182 ? 15.314 6.295  27.006 1.00 26.88 ? 182 ARG A CD  1 
ATOM   1398 N  NE  . ARG A 1 182 ? 14.906 5.405  28.091 1.00 28.05 ? 182 ARG A NE  1 
ATOM   1399 C  CZ  . ARG A 1 182 ? 14.330 4.219  27.920 1.00 22.58 ? 182 ARG A CZ  1 
ATOM   1400 N  NH1 . ARG A 1 182 ? 14.063 3.765  26.700 1.00 24.40 ? 182 ARG A NH1 1 
ATOM   1401 N  NH2 . ARG A 1 182 ? 14.016 3.488  28.974 1.00 25.68 ? 182 ARG A NH2 1 
ATOM   1402 N  N   . GLN A 1 183 ? 20.020 3.414  26.752 1.00 12.55 ? 183 GLN A N   1 
ATOM   1403 C  CA  . GLN A 1 183 ? 20.805 2.603  25.828 1.00 14.52 ? 183 GLN A CA  1 
ATOM   1404 C  C   . GLN A 1 183 ? 22.194 2.278  26.349 1.00 16.38 ? 183 GLN A C   1 
ATOM   1405 O  O   . GLN A 1 183 ? 22.704 2.929  27.270 1.00 14.03 ? 183 GLN A O   1 
ATOM   1406 C  CB  . GLN A 1 183 ? 20.943 3.323  24.489 1.00 13.61 ? 183 GLN A CB  1 
ATOM   1407 C  CG  . GLN A 1 183 ? 21.794 4.580  24.611 1.00 15.83 ? 183 GLN A CG  1 
ATOM   1408 C  CD  . GLN A 1 183 ? 22.031 5.283  23.291 1.00 14.26 ? 183 GLN A CD  1 
ATOM   1409 O  OE1 . GLN A 1 183 ? 22.482 4.675  22.314 1.00 18.29 ? 183 GLN A OE1 1 
ATOM   1410 N  NE2 . GLN A 1 183 ? 21.715 6.568  23.251 1.00 12.98 ? 183 GLN A NE2 1 
ATOM   1411 N  N   . ALA A 1 184 ? 22.811 1.276  25.727 1.00 14.57 ? 184 ALA A N   1 
ATOM   1412 C  CA  . ALA A 1 184 ? 24.168 0.872  26.043 1.00 18.56 ? 184 ALA A CA  1 
ATOM   1413 C  C   . ALA A 1 184 ? 25.179 1.892  25.529 1.00 19.50 ? 184 ALA A C   1 
ATOM   1414 O  O   . ALA A 1 184 ? 24.935 2.618  24.562 1.00 21.11 ? 184 ALA A O   1 
ATOM   1415 C  CB  . ALA A 1 184 ? 24.454 -0.506 25.455 1.00 17.15 ? 184 ALA A CB  1 
ATOM   1416 O  OXT . ALA A 1 184 ? 26.271 2.016  26.078 1.00 24.13 ? 184 ALA A OXT 1 
HETATM 1417 O  O   . HOH B 2 .   ? 15.687 24.031 48.120 1.00 26.36 ? 201 HOH A O   1 
HETATM 1418 O  O   . HOH B 2 .   ? 38.596 27.328 63.700 1.00 27.33 ? 202 HOH A O   1 
HETATM 1419 O  O   . HOH B 2 .   ? 36.996 28.427 60.599 1.00 25.62 ? 203 HOH A O   1 
HETATM 1420 O  O   . HOH B 2 .   ? 13.280 13.583 52.176 1.00 21.59 ? 204 HOH A O   1 
HETATM 1421 O  O   . HOH B 2 .   ? 18.096 28.250 48.763 1.00 34.48 ? 205 HOH A O   1 
HETATM 1422 O  O   . HOH B 2 .   ? 23.655 35.640 46.990 1.00 29.64 ? 206 HOH A O   1 
HETATM 1423 O  O   . HOH B 2 .   ? 27.607 8.409  23.545 1.00 38.49 ? 207 HOH A O   1 
HETATM 1424 O  O   . HOH B 2 .   ? 16.176 5.786  36.442 1.00 25.97 ? 208 HOH A O   1 
HETATM 1425 O  O   . HOH B 2 .   ? 41.552 35.418 60.464 1.00 29.33 ? 209 HOH A O   1 
HETATM 1426 O  O   . HOH B 2 .   ? 33.420 38.816 29.274 1.00 36.38 ? 210 HOH A O   1 
HETATM 1427 O  O   . HOH B 2 .   ? 19.097 26.248 34.865 1.00 22.67 ? 211 HOH A O   1 
HETATM 1428 O  O   . HOH B 2 .   ? 51.808 27.099 51.113 1.00 31.70 ? 212 HOH A O   1 
HETATM 1429 O  O   . HOH B 2 .   ? 47.915 34.787 38.890 1.00 29.41 ? 213 HOH A O   1 
HETATM 1430 O  O   . HOH B 2 .   ? 43.802 13.247 49.386 1.00 26.03 ? 214 HOH A O   1 
HETATM 1431 O  O   . HOH B 2 .   ? 32.573 27.651 59.294 1.00 30.46 ? 215 HOH A O   1 
HETATM 1432 O  O   . HOH B 2 .   ? 43.371 37.237 55.448 1.00 25.63 ? 216 HOH A O   1 
HETATM 1433 O  O   . HOH B 2 .   ? 24.522 8.632  48.601 1.00 31.06 ? 217 HOH A O   1 
HETATM 1434 O  O   . HOH B 2 .   ? 32.152 4.354  32.925 1.00 35.23 ? 218 HOH A O   1 
HETATM 1435 O  O   . HOH B 2 .   ? 44.972 34.986 45.992 1.00 12.74 ? 219 HOH A O   1 
HETATM 1436 O  O   . HOH B 2 .   ? 28.064 29.245 52.591 1.00 29.31 ? 220 HOH A O   1 
HETATM 1437 O  O   . HOH B 2 .   ? 21.200 4.774  45.515 1.00 32.54 ? 221 HOH A O   1 
HETATM 1438 O  O   . HOH B 2 .   ? 31.007 18.607 30.171 1.00 22.89 ? 222 HOH A O   1 
HETATM 1439 O  O   . HOH B 2 .   ? 43.616 32.476 36.757 1.00 36.29 ? 223 HOH A O   1 
HETATM 1440 O  O   . HOH B 2 .   ? 15.713 1.708  25.294 1.00 17.12 ? 224 HOH A O   1 
HETATM 1441 O  O   . HOH B 2 .   ? 45.075 36.778 35.732 1.00 31.57 ? 225 HOH A O   1 
HETATM 1442 O  O   . HOH B 2 .   ? 26.642 9.176  52.677 1.00 29.16 ? 226 HOH A O   1 
HETATM 1443 O  O   . HOH B 2 .   ? 12.132 5.869  42.395 1.00 23.73 ? 227 HOH A O   1 
HETATM 1444 O  O   . HOH B 2 .   ? 32.158 10.234 46.244 1.00 29.92 ? 228 HOH A O   1 
HETATM 1445 O  O   . HOH B 2 .   ? 20.494 1.512  33.136 1.00 17.87 ? 229 HOH A O   1 
HETATM 1446 O  O   . HOH B 2 .   ? 21.892 9.227  45.883 1.00 15.22 ? 230 HOH A O   1 
HETATM 1447 O  O   . HOH B 2 .   ? 36.991 11.836 59.582 1.00 31.34 ? 231 HOH A O   1 
HETATM 1448 O  O   . HOH B 2 .   ? 37.222 41.981 35.705 1.00 23.63 ? 232 HOH A O   1 
HETATM 1449 O  O   . HOH B 2 .   ? 20.673 24.287 40.072 1.00 12.58 ? 233 HOH A O   1 
HETATM 1450 O  O   . HOH B 2 .   ? 50.559 32.194 41.806 1.00 36.22 ? 234 HOH A O   1 
HETATM 1451 O  O   . HOH B 2 .   ? 22.492 30.728 40.081 1.00 16.33 ? 235 HOH A O   1 
HETATM 1452 O  O   . HOH B 2 .   ? 31.392 38.290 33.706 1.00 22.68 ? 236 HOH A O   1 
HETATM 1453 O  O   . HOH B 2 .   ? 45.776 34.392 48.607 1.00 12.29 ? 237 HOH A O   1 
HETATM 1454 O  O   . HOH B 2 .   ? 10.074 19.211 45.693 1.00 27.09 ? 238 HOH A O   1 
HETATM 1455 O  O   . HOH B 2 .   ? 33.849 37.510 63.843 1.00 11.25 ? 239 HOH A O   1 
HETATM 1456 O  O   . HOH B 2 .   ? 28.151 35.294 48.842 1.00 18.02 ? 240 HOH A O   1 
HETATM 1457 O  O   . HOH B 2 .   ? 49.191 32.285 52.176 1.00 18.71 ? 241 HOH A O   1 
HETATM 1458 O  O   . HOH B 2 .   ? 21.314 18.259 27.058 1.00 29.83 ? 242 HOH A O   1 
HETATM 1459 O  O   . HOH B 2 .   ? 26.657 3.633  22.745 1.00 36.55 ? 243 HOH A O   1 
HETATM 1460 O  O   . HOH B 2 .   ? 31.511 10.699 56.203 1.00 27.93 ? 244 HOH A O   1 
HETATM 1461 O  O   . HOH B 2 .   ? 20.603 8.532  24.744 1.00 32.54 ? 245 HOH A O   1 
HETATM 1462 O  O   . HOH B 2 .   ? 34.238 25.126 32.850 1.00 22.27 ? 246 HOH A O   1 
HETATM 1463 O  O   . HOH B 2 .   ? 35.852 18.539 42.097 1.00 17.24 ? 247 HOH A O   1 
HETATM 1464 O  O   . HOH B 2 .   ? 9.114  18.673 43.309 1.00 30.33 ? 248 HOH A O   1 
HETATM 1465 O  O   . HOH B 2 .   ? 26.849 15.214 56.769 1.00 25.54 ? 249 HOH A O   1 
HETATM 1466 O  O   . HOH B 2 .   ? 52.489 37.080 45.974 1.00 21.35 ? 250 HOH A O   1 
HETATM 1467 O  O   . HOH B 2 .   ? 22.836 28.603 49.803 1.00 33.58 ? 251 HOH A O   1 
HETATM 1468 O  O   . HOH B 2 .   ? 21.696 33.322 46.470 1.00 21.89 ? 252 HOH A O   1 
HETATM 1469 O  O   . HOH B 2 .   ? 43.029 44.650 46.612 1.00 29.62 ? 253 HOH A O   1 
HETATM 1470 O  O   . HOH B 2 .   ? 28.216 7.259  47.065 1.00 24.75 ? 254 HOH A O   1 
HETATM 1471 O  O   . HOH B 2 .   ? 46.209 25.813 52.307 1.00 22.06 ? 255 HOH A O   1 
HETATM 1472 O  O   . HOH B 2 .   ? 34.502 26.048 55.307 1.00 13.11 ? 256 HOH A O   1 
HETATM 1473 O  O   . HOH B 2 .   ? 28.575 40.946 45.787 1.00 25.69 ? 257 HOH A O   1 
HETATM 1474 O  O   . HOH B 2 .   ? 28.895 22.433 32.624 1.00 10.02 ? 258 HOH A O   1 
HETATM 1475 O  O   . HOH B 2 .   ? 43.968 25.655 61.238 1.00 20.73 ? 259 HOH A O   1 
HETATM 1476 O  O   . HOH B 2 .   ? 30.569 14.879 59.226 1.00 25.99 ? 260 HOH A O   1 
HETATM 1477 O  O   . HOH B 2 .   ? 40.400 13.712 60.875 1.00 20.38 ? 261 HOH A O   1 
HETATM 1478 O  O   . HOH B 2 .   ? 44.532 40.703 34.540 1.00 29.03 ? 262 HOH A O   1 
HETATM 1479 O  O   . HOH B 2 .   ? 42.959 30.923 57.565 1.00 19.24 ? 263 HOH A O   1 
HETATM 1480 O  O   . HOH B 2 .   ? 8.338  14.978 44.043 1.00 15.88 ? 264 HOH A O   1 
HETATM 1481 O  O   . HOH B 2 .   ? 29.800 28.563 53.639 1.00 24.31 ? 265 HOH A O   1 
HETATM 1482 O  O   . HOH B 2 .   ? 31.345 30.656 57.309 1.00 26.21 ? 266 HOH A O   1 
HETATM 1483 O  O   . HOH B 2 .   ? 20.220 26.143 32.389 1.00 14.52 ? 267 HOH A O   1 
HETATM 1484 O  O   . HOH B 2 .   ? 15.868 7.304  43.061 1.00 10.77 ? 268 HOH A O   1 
HETATM 1485 O  O   . HOH B 2 .   ? 28.286 33.171 31.191 1.00 16.75 ? 269 HOH A O   1 
HETATM 1486 O  O   . HOH B 2 .   ? 27.575 21.321 53.098 1.00 26.21 ? 270 HOH A O   1 
HETATM 1487 O  O   . HOH B 2 .   ? 17.625 9.666  29.875 1.00 22.90 ? 271 HOH A O   1 
HETATM 1488 O  O   . HOH B 2 .   ? 36.031 27.469 57.239 1.00 13.29 ? 272 HOH A O   1 
HETATM 1489 O  O   . HOH B 2 .   ? 39.814 36.383 65.586 1.00 12.38 ? 273 HOH A O   1 
HETATM 1490 O  O   . HOH B 2 .   ? 23.000 12.173 27.293 1.00 24.69 ? 274 HOH A O   1 
HETATM 1491 O  O   . HOH B 2 .   ? 49.481 27.099 48.132 1.00 16.61 ? 275 HOH A O   1 
HETATM 1492 O  O   . HOH B 2 .   ? 13.105 16.764 38.954 1.00 22.59 ? 276 HOH A O   1 
HETATM 1493 O  O   . HOH B 2 .   ? 32.796 33.654 51.301 1.00 19.81 ? 277 HOH A O   1 
HETATM 1494 O  O   . HOH B 2 .   ? 12.214 17.257 51.257 1.00 30.40 ? 278 HOH A O   1 
HETATM 1495 O  O   . HOH B 2 .   ? 25.168 6.251  38.499 1.00 10.94 ? 279 HOH A O   1 
HETATM 1496 O  O   . HOH B 2 .   ? 34.285 7.899  42.461 1.00 31.67 ? 280 HOH A O   1 
HETATM 1497 O  O   . HOH B 2 .   ? 22.786 13.160 48.562 1.00 23.75 ? 281 HOH A O   1 
HETATM 1498 O  O   . HOH B 2 .   ? 17.587 9.528  49.540 1.00 29.52 ? 282 HOH A O   1 
HETATM 1499 O  O   . HOH B 2 .   ? 14.235 23.777 41.299 1.00 16.55 ? 283 HOH A O   1 
HETATM 1500 O  O   . HOH B 2 .   ? 21.873 34.137 50.802 1.00 40.46 ? 284 HOH A O   1 
HETATM 1501 O  O   . HOH B 2 .   ? 38.733 20.081 40.293 1.00 19.98 ? 285 HOH A O   1 
HETATM 1502 O  O   . HOH B 2 .   ? 29.008 12.214 28.923 1.00 10.75 ? 286 HOH A O   1 
HETATM 1503 O  O   . HOH B 2 .   ? 21.141 32.556 35.717 1.00 24.43 ? 287 HOH A O   1 
HETATM 1504 O  O   . HOH B 2 .   ? 16.231 14.480 30.470 1.00 30.62 ? 288 HOH A O   1 
HETATM 1505 O  O   . HOH B 2 .   ? 7.527  12.677 40.087 1.00 15.60 ? 289 HOH A O   1 
HETATM 1506 O  O   . HOH B 2 .   ? 18.965 14.447 47.810 1.00 17.94 ? 290 HOH A O   1 
HETATM 1507 O  O   . HOH B 2 .   ? 36.245 44.808 40.682 1.00 40.60 ? 291 HOH A O   1 
HETATM 1508 O  O   . HOH B 2 .   ? 30.599 21.044 28.804 1.00 25.67 ? 292 HOH A O   1 
HETATM 1509 O  O   . HOH B 2 .   ? 11.460 11.708 33.620 1.00 23.45 ? 293 HOH A O   1 
HETATM 1510 O  O   . HOH B 2 .   ? 36.291 18.038 32.605 1.00 26.84 ? 294 HOH A O   1 
HETATM 1511 O  O   . HOH B 2 .   ? 30.861 18.078 55.805 1.00 31.25 ? 295 HOH A O   1 
HETATM 1512 O  O   . HOH B 2 .   ? 31.236 28.147 62.174 1.00 34.65 ? 296 HOH A O   1 
HETATM 1513 O  O   . HOH B 2 .   ? 22.232 21.916 29.412 1.00 19.43 ? 297 HOH A O   1 
HETATM 1514 O  O   . HOH B 2 .   ? 38.303 40.470 49.801 1.00 20.37 ? 298 HOH A O   1 
HETATM 1515 O  O   . HOH B 2 .   ? 43.902 17.629 63.645 1.00 31.01 ? 299 HOH A O   1 
HETATM 1516 O  O   . HOH B 2 .   ? 29.836 34.189 50.943 1.00 35.02 ? 300 HOH A O   1 
HETATM 1517 O  O   . HOH B 2 .   ? 17.938 18.195 29.884 1.00 21.02 ? 301 HOH A O   1 
HETATM 1518 O  O   . HOH B 2 .   ? 35.506 39.689 50.225 1.00 21.87 ? 302 HOH A O   1 
HETATM 1519 O  O   . HOH B 2 .   ? 42.183 42.294 50.413 1.00 36.42 ? 303 HOH A O   1 
HETATM 1520 O  O   . HOH B 2 .   ? 40.907 18.418 59.354 1.00 27.92 ? 304 HOH A O   1 
HETATM 1521 O  O   . HOH B 2 .   ? 38.095 27.427 32.327 1.00 29.86 ? 305 HOH A O   1 
HETATM 1522 O  O   . HOH B 2 .   ? 39.925 43.836 48.318 1.00 32.10 ? 306 HOH A O   1 
HETATM 1523 O  O   . HOH B 2 .   ? 34.432 8.764  37.484 1.00 26.55 ? 307 HOH A O   1 
HETATM 1524 O  O   . HOH B 2 .   ? 29.403 36.013 53.177 1.00 32.77 ? 308 HOH A O   1 
HETATM 1525 O  O   . HOH B 2 .   ? 32.117 21.868 43.287 1.00 10.40 ? 309 HOH A O   1 
HETATM 1526 O  O   . HOH B 2 .   ? 30.106 22.062 52.996 1.00 15.09 ? 310 HOH A O   1 
HETATM 1527 O  O   . HOH B 2 .   ? 17.326 22.288 29.814 1.00 28.18 ? 311 HOH A O   1 
HETATM 1528 O  O   . HOH B 2 .   ? 40.513 22.598 34.350 1.00 37.25 ? 312 HOH A O   1 
HETATM 1529 O  O   . HOH B 2 .   ? 49.345 38.817 53.253 1.00 17.24 ? 313 HOH A O   1 
HETATM 1530 O  O   . HOH B 2 .   ? 32.246 27.656 30.782 1.00 18.73 ? 314 HOH A O   1 
HETATM 1531 O  O   . HOH B 2 .   ? 32.942 9.002  48.812 1.00 25.58 ? 315 HOH A O   1 
HETATM 1532 O  O   . HOH B 2 .   ? 20.011 2.371  41.915 1.00 25.75 ? 316 HOH A O   1 
HETATM 1533 O  O   . HOH B 2 .   ? 9.816  15.269 39.152 1.00 19.88 ? 317 HOH A O   1 
HETATM 1534 O  O   . HOH B 2 .   ? 22.744 8.952  21.990 1.00 26.49 ? 318 HOH A O   1 
HETATM 1535 O  O   . HOH B 2 .   ? 44.072 18.322 56.158 1.00 22.06 ? 319 HOH A O   1 
HETATM 1536 O  O   . HOH B 2 .   ? 35.708 14.003 42.920 1.00 23.36 ? 320 HOH A O   1 
HETATM 1537 O  O   . HOH B 2 .   ? 12.600 17.168 35.239 1.00 31.33 ? 321 HOH A O   1 
HETATM 1538 O  O   . HOH B 2 .   ? 49.627 42.958 43.077 1.00 16.30 ? 322 HOH A O   1 
HETATM 1539 O  O   . HOH B 2 .   ? 47.609 46.576 47.464 1.00 31.32 ? 323 HOH A O   1 
HETATM 1540 O  O   . HOH B 2 .   ? 7.259  14.614 38.163 1.00 23.01 ? 324 HOH A O   1 
HETATM 1541 O  O   . HOH B 2 .   ? 36.804 20.373 33.908 1.00 19.04 ? 325 HOH A O   1 
HETATM 1542 O  O   . HOH B 2 .   ? 23.020 21.119 26.876 1.00 34.47 ? 326 HOH A O   1 
HETATM 1543 O  O   . HOH B 2 .   ? 15.361 17.877 37.712 1.00 16.38 ? 327 HOH A O   1 
HETATM 1544 O  O   . HOH B 2 .   ? 43.040 40.931 35.816 1.00 29.76 ? 328 HOH A O   1 
HETATM 1545 O  O   . HOH B 2 .   ? 53.367 34.431 47.272 1.00 27.70 ? 329 HOH A O   1 
HETATM 1546 O  O   . HOH B 2 .   ? 28.009 3.073  39.951 1.00 23.21 ? 330 HOH A O   1 
HETATM 1547 O  O   . HOH B 2 .   ? 45.404 23.075 53.175 1.00 20.87 ? 331 HOH A O   1 
HETATM 1548 O  O   . HOH B 2 .   ? 38.901 39.437 61.594 1.00 23.27 ? 332 HOH A O   1 
HETATM 1549 O  O   . HOH B 2 .   ? 35.316 34.114 27.379 1.00 38.54 ? 333 HOH A O   1 
HETATM 1550 O  O   . HOH B 2 .   ? 39.642 9.190  51.118 1.00 35.31 ? 334 HOH A O   1 
HETATM 1551 O  O   . HOH B 2 .   ? 24.599 18.061 23.154 1.00 35.43 ? 335 HOH A O   1 
HETATM 1552 O  O   . HOH B 2 .   ? 41.423 11.334 50.279 1.00 30.87 ? 336 HOH A O   1 
HETATM 1553 O  O   . HOH B 2 .   ? 18.221 14.907 27.978 1.00 36.52 ? 337 HOH A O   1 
HETATM 1554 O  O   . HOH B 2 .   ? 34.059 31.694 28.958 1.00 31.13 ? 338 HOH A O   1 
HETATM 1555 O  O   . HOH B 2 .   ? 23.267 1.497  22.344 1.00 25.82 ? 339 HOH A O   1 
HETATM 1556 O  O   . HOH B 2 .   ? 35.899 23.948 56.602 1.00 20.06 ? 340 HOH A O   1 
HETATM 1557 O  O   . HOH B 2 .   ? 34.643 20.749 43.488 1.00 11.96 ? 341 HOH A O   1 
HETATM 1558 O  O   . HOH B 2 .   ? 21.213 11.350 55.311 1.00 33.02 ? 342 HOH A O   1 
HETATM 1559 O  O   . HOH B 2 .   ? 39.868 44.945 41.305 1.00 26.38 ? 343 HOH A O   1 
HETATM 1560 O  O   . HOH B 2 .   ? 16.502 3.105  34.185 1.00 28.28 ? 344 HOH A O   1 
HETATM 1561 O  O   . HOH B 2 .   ? 37.078 18.801 37.496 1.00 14.06 ? 345 HOH A O   1 
HETATM 1562 O  O   . HOH B 2 .   ? 37.937 8.922  54.051 1.00 25.33 ? 346 HOH A O   1 
HETATM 1563 O  O   . HOH B 2 .   ? 37.998 29.691 64.992 1.00 28.21 ? 347 HOH A O   1 
HETATM 1564 O  O   . HOH B 2 .   ? 32.574 11.436 41.522 1.00 19.69 ? 348 HOH A O   1 
HETATM 1565 O  O   . HOH B 2 .   ? 51.021 44.569 46.890 1.00 24.96 ? 349 HOH A O   1 
HETATM 1566 O  O   . HOH B 2 .   ? 37.525 19.873 28.593 1.00 36.42 ? 350 HOH A O   1 
HETATM 1567 O  O   . HOH B 2 .   ? 44.314 23.546 57.998 1.00 23.63 ? 351 HOH A O   1 
HETATM 1568 O  O   . HOH B 2 .   ? 49.403 13.402 52.687 1.00 28.79 ? 352 HOH A O   1 
HETATM 1569 O  O   . HOH B 2 .   ? 43.235 39.042 53.169 1.00 22.09 ? 353 HOH A O   1 
HETATM 1570 O  O   . HOH B 2 .   ? 15.033 8.240  32.276 1.00 31.49 ? 354 HOH A O   1 
HETATM 1571 O  O   . HOH B 2 .   ? 21.902 32.343 52.872 1.00 45.93 ? 355 HOH A O   1 
HETATM 1572 O  O   . HOH B 2 .   ? 21.718 14.998 47.447 1.00 21.66 ? 356 HOH A O   1 
HETATM 1573 O  O   . HOH B 2 .   ? 31.872 8.001  36.457 1.00 21.35 ? 357 HOH A O   1 
HETATM 1574 O  O   . HOH B 2 .   ? 19.162 9.105  26.806 1.00 32.30 ? 358 HOH A O   1 
HETATM 1575 O  O   . HOH B 2 .   ? 40.612 16.376 61.290 1.00 26.64 ? 359 HOH A O   1 
HETATM 1576 O  O   . HOH B 2 .   ? 34.528 13.168 60.966 1.00 38.15 ? 360 HOH A O   1 
HETATM 1577 O  O   . HOH B 2 .   ? 28.635 16.097 23.745 1.00 31.04 ? 361 HOH A O   1 
HETATM 1578 O  O   . HOH B 2 .   ? 32.417 33.927 58.928 1.00 29.62 ? 362 HOH A O   1 
HETATM 1579 O  O   . HOH B 2 .   ? 38.984 7.925  57.300 1.00 31.67 ? 363 HOH A O   1 
HETATM 1580 O  O   . HOH B 2 .   ? 53.928 32.570 45.615 1.00 31.79 ? 364 HOH A O   1 
HETATM 1581 O  O   . HOH B 2 .   ? 49.735 30.558 54.456 1.00 34.37 ? 365 HOH A O   1 
HETATM 1582 O  O   . HOH B 2 .   ? 46.807 29.853 38.694 1.00 32.22 ? 366 HOH A O   1 
HETATM 1583 O  O   . HOH B 2 .   ? 23.917 5.988  19.835 1.00 27.80 ? 367 HOH A O   1 
HETATM 1584 O  O   . HOH B 2 .   ? 27.033 41.112 43.880 1.00 34.81 ? 368 HOH A O   1 
HETATM 1585 O  O   . HOH B 2 .   ? 40.926 33.398 61.025 1.00 23.77 ? 369 HOH A O   1 
HETATM 1586 O  O   . HOH B 2 .   ? 48.476 37.202 61.049 1.00 33.04 ? 370 HOH A O   1 
HETATM 1587 O  O   . HOH B 2 .   ? 38.640 17.841 64.996 1.00 34.08 ? 371 HOH A O   1 
HETATM 1588 O  O   . HOH B 2 .   ? 31.369 3.462  30.192 1.00 33.71 ? 372 HOH A O   1 
HETATM 1589 O  O   . HOH B 2 .   ? 19.303 28.222 36.941 1.00 26.15 ? 373 HOH A O   1 
HETATM 1590 O  O   . HOH B 2 .   ? 12.094 25.051 42.820 1.00 30.27 ? 374 HOH A O   1 
HETATM 1591 O  O   . HOH B 2 .   ? 45.713 17.263 55.655 1.00 32.04 ? 375 HOH A O   1 
HETATM 1592 O  O   . HOH B 2 .   ? 43.169 19.422 59.164 1.00 31.97 ? 376 HOH A O   1 
HETATM 1593 O  O   . HOH B 2 .   ? 42.889 45.031 42.279 1.00 22.79 ? 377 HOH A O   1 
HETATM 1594 O  O   . HOH B 2 .   ? 47.265 15.297 52.942 1.00 26.51 ? 378 HOH A O   1 
HETATM 1595 O  O   . HOH B 2 .   ? 31.570 38.432 50.366 1.00 42.91 ? 379 HOH A O   1 
HETATM 1596 O  O   . HOH B 2 .   ? 34.672 24.611 28.736 1.00 34.53 ? 380 HOH A O   1 
HETATM 1597 O  O   . HOH B 2 .   ? 15.268 8.479  29.526 1.00 31.41 ? 381 HOH A O   1 
HETATM 1598 O  O   . HOH B 2 .   ? 51.940 34.694 60.085 1.00 42.60 ? 382 HOH A O   1 
HETATM 1599 O  O   . HOH B 2 .   ? 19.656 33.799 44.876 1.00 30.06 ? 383 HOH A O   1 
HETATM 1600 O  O   . HOH B 2 .   ? 28.412 4.495  46.048 1.00 39.40 ? 384 HOH A O   1 
HETATM 1601 O  O   . HOH B 2 .   ? 42.098 38.259 57.844 1.00 36.55 ? 385 HOH A O   1 
HETATM 1602 O  O   . HOH B 2 .   ? 14.559 23.220 38.735 1.00 33.50 ? 386 HOH A O   1 
HETATM 1603 O  O   . HOH B 2 .   ? 22.156 6.823  47.083 1.00 32.15 ? 387 HOH A O   1 
HETATM 1604 O  O   . HOH B 2 .   ? 30.247 26.272 29.637 1.00 25.61 ? 388 HOH A O   1 
HETATM 1605 O  O   . HOH B 2 .   ? 26.249 34.839 50.563 1.00 29.14 ? 389 HOH A O   1 
HETATM 1606 O  O   . HOH B 2 .   ? 36.696 25.110 32.285 1.00 41.71 ? 390 HOH A O   1 
HETATM 1607 O  O   . HOH B 2 .   ? 30.592 -0.093 33.797 1.00 33.56 ? 391 HOH A O   1 
HETATM 1608 O  O   . HOH B 2 .   ? 9.916  21.790 45.431 1.00 33.74 ? 392 HOH A O   1 
HETATM 1609 O  O   . HOH B 2 .   ? 36.510 10.092 57.350 1.00 32.46 ? 393 HOH A O   1 
HETATM 1610 O  O   . HOH B 2 .   ? 16.865 25.118 33.642 1.00 29.25 ? 394 HOH A O   1 
HETATM 1611 O  O   . HOH B 2 .   ? 37.447 19.875 65.055 1.00 34.27 ? 395 HOH A O   1 
HETATM 1612 O  O   . HOH B 2 .   ? 23.887 9.577  51.991 1.00 35.79 ? 396 HOH A O   1 
HETATM 1613 O  O   . HOH B 2 .   ? 35.574 18.263 64.217 1.00 37.52 ? 397 HOH A O   1 
HETATM 1614 O  O   . HOH B 2 .   ? 44.457 28.661 57.355 1.00 31.69 ? 398 HOH A O   1 
HETATM 1615 O  O   . HOH B 2 .   ? 27.593 10.215 27.610 1.00 19.62 ? 399 HOH A O   1 
HETATM 1616 O  O   . HOH B 2 .   ? 28.731 38.275 49.071 1.00 33.66 ? 400 HOH A O   1 
HETATM 1617 O  O   . HOH B 2 .   ? 23.788 35.928 49.942 1.00 36.27 ? 401 HOH A O   1 
HETATM 1618 O  O   . HOH B 2 .   ? 24.361 14.578 57.723 1.00 36.71 ? 402 HOH A O   1 
HETATM 1619 O  O   . HOH B 2 .   ? 26.574 1.015  40.459 1.00 36.78 ? 403 HOH A O   1 
HETATM 1620 O  O   . HOH B 2 .   ? 33.114 38.426 51.625 1.00 35.21 ? 404 HOH A O   1 
HETATM 1621 O  O   . HOH B 2 .   ? 25.988 30.402 53.544 1.00 37.55 ? 405 HOH A O   1 
HETATM 1622 O  O   . HOH B 2 .   ? 22.296 10.637 48.337 1.00 34.70 ? 406 HOH A O   1 
HETATM 1623 O  O   . HOH B 2 .   ? 40.085 16.284 64.473 1.00 25.91 ? 407 HOH A O   1 
HETATM 1624 O  O   . HOH B 2 .   ? 18.037 10.710 27.433 1.00 37.54 ? 408 HOH A O   1 
HETATM 1625 O  O   . HOH B 2 .   ? 14.246 24.952 37.091 1.00 35.23 ? 409 HOH A O   1 
HETATM 1626 O  O   . HOH B 2 .   ? 32.005 25.652 56.020 1.00 22.24 ? 410 HOH A O   1 
HETATM 1627 O  O   . HOH B 2 .   ? 41.984 19.891 63.173 1.00 30.21 ? 411 HOH A O   1 
HETATM 1628 O  O   . HOH B 2 .   ? 13.582 14.118 54.740 1.00 30.57 ? 412 HOH A O   1 
HETATM 1629 O  O   . HOH B 2 .   ? 30.012 24.139 54.718 1.00 22.97 ? 413 HOH A O   1 
HETATM 1630 O  O   . HOH B 2 .   ? 31.729 36.045 51.966 1.00 32.48 ? 414 HOH A O   1 
HETATM 1631 O  O   . HOH B 2 .   ? 35.102 42.861 36.572 1.00 32.82 ? 415 HOH A O   1 
HETATM 1632 O  O   . HOH B 2 .   ? 48.029 24.926 50.442 1.00 28.35 ? 416 HOH A O   1 
HETATM 1633 O  O   . HOH B 2 .   ? 12.902 17.339 56.523 1.00 45.15 ? 417 HOH A O   1 
HETATM 1634 O  O   . HOH B 2 .   ? 35.754 36.719 28.940 1.00 37.21 ? 418 HOH A O   1 
HETATM 1635 O  O   . HOH B 2 .   ? 16.776 11.676 31.410 1.00 27.12 ? 419 HOH A O   1 
HETATM 1636 O  O   . HOH B 2 .   ? 25.900 33.252 54.690 1.00 33.47 ? 420 HOH A O   1 
HETATM 1637 O  O   . HOH B 2 .   ? 25.286 9.656  23.294 1.00 36.30 ? 421 HOH A O   1 
HETATM 1638 O  O   . HOH B 2 .   ? 19.959 29.397 50.155 1.00 41.91 ? 422 HOH A O   1 
HETATM 1639 O  O   . HOH B 2 .   ? 25.827 11.478 25.816 1.00 30.86 ? 423 HOH A O   1 
HETATM 1640 O  O   . HOH B 2 .   ? 39.260 42.055 51.978 1.00 34.23 ? 424 HOH A O   1 
HETATM 1641 O  O   . HOH B 2 .   ? 12.047 9.214  32.276 1.00 24.07 ? 425 HOH A O   1 
HETATM 1642 O  O   . HOH B 2 .   ? 29.476 7.818  27.328 1.00 30.36 ? 426 HOH A O   1 
HETATM 1643 O  O   . HOH B 2 .   ? 35.539 17.366 39.436 1.00 20.14 ? 427 HOH A O   1 
HETATM 1644 O  O   . HOH B 2 .   ? 49.808 25.107 50.183 1.00 33.09 ? 428 HOH A O   1 
HETATM 1645 O  O   . HOH B 2 .   ? 30.379 36.875 50.338 1.00 36.07 ? 429 HOH A O   1 
HETATM 1646 O  O   . HOH B 2 .   ? 30.521 17.629 58.521 1.00 38.18 ? 430 HOH A O   1 
HETATM 1647 O  O   . HOH B 2 .   ? 28.796 32.405 28.298 1.00 22.31 ? 431 HOH A O   1 
HETATM 1648 O  O   . HOH B 2 .   ? 31.756 1.868  31.891 1.00 40.63 ? 432 HOH A O   1 
HETATM 1649 O  O   . HOH B 2 .   ? 50.293 47.013 47.840 1.00 21.26 ? 433 HOH A O   1 
HETATM 1650 O  O   . HOH B 2 .   ? 33.264 24.830 60.050 1.00 29.96 ? 434 HOH A O   1 
HETATM 1651 O  O   . HOH B 2 .   ? 32.803 24.851 30.597 1.00 27.10 ? 435 HOH A O   1 
HETATM 1652 O  O   . HOH B 2 .   ? 33.417 23.547 57.656 1.00 27.09 ? 436 HOH A O   1 
HETATM 1653 O  O   . HOH B 2 .   ? 31.202 20.335 55.002 1.00 27.80 ? 437 HOH A O   1 
HETATM 1654 O  O   . HOH B 2 .   ? 32.386 21.543 57.290 1.00 31.59 ? 438 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ARG 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   ?   ?   ?   A . n 
A 1 5   HIS 5   5   ?   ?   ?   A . n 
A 1 6   HIS 6   6   ?   ?   ?   A . n 
A 1 7   HIS 7   7   ?   ?   ?   A . n 
A 1 8   HIS 8   8   ?   ?   ?   A . n 
A 1 9   HIS 9   9   ?   ?   ?   A . n 
A 1 10  HIS 10  10  ?   ?   ?   A . n 
A 1 11  GLY 11  11  ?   ?   ?   A . n 
A 1 12  SER 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  SER 14  14  ?   ?   ?   A . n 
A 1 15  TYR 15  15  ?   ?   ?   A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  HIS 28  28  28  HIS HIS A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  TYR 31  31  31  TYR TYR A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TRP 67  67  67  TRP TRP A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  MSE 72  72  72  MSE MSE A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  TRP 74  74  74  TRP TRP A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  MSE 86  86  86  MSE MSE A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  TRP 93  93  93  TRP TRP A . n 
A 1 94  ASN 94  94  94  ASN ASN A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 THR 113 113 113 THR THR A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 TRP 126 126 126 TRP TRP A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 TRP 129 129 129 TRP TRP A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 TRP 153 153 153 TRP TRP A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 MSE 155 155 155 MSE MSE A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 ARG 157 157 157 ARG ARG A . n 
A 1 158 TRP 158 158 158 TRP TRP A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 HIS 160 160 160 HIS HIS A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 PRO 166 166 166 PRO PRO A . n 
A 1 167 PHE 167 167 167 PHE PHE A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 THR 169 169 169 THR THR A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 TRP 177 177 177 TRP TRP A . n 
A 1 178 LYS 178 178 178 LYS LYS A . n 
A 1 179 LYS 179 179 179 LYS LYS A . n 
A 1 180 HIS 180 180 180 HIS HIS A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 GLN 183 183 183 GLN GLN A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   201 61  HOH HOH A . 
B 2 HOH 2   202 98  HOH HOH A . 
B 2 HOH 3   203 62  HOH HOH A . 
B 2 HOH 4   204 59  HOH HOH A . 
B 2 HOH 5   205 108 HOH HOH A . 
B 2 HOH 6   206 114 HOH HOH A . 
B 2 HOH 7   207 209 HOH HOH A . 
B 2 HOH 8   208 77  HOH HOH A . 
B 2 HOH 9   209 158 HOH HOH A . 
B 2 HOH 10  210 183 HOH HOH A . 
B 2 HOH 11  211 63  HOH HOH A . 
B 2 HOH 12  212 131 HOH HOH A . 
B 2 HOH 13  213 186 HOH HOH A . 
B 2 HOH 14  214 87  HOH HOH A . 
B 2 HOH 15  215 116 HOH HOH A . 
B 2 HOH 16  216 60  HOH HOH A . 
B 2 HOH 17  217 207 HOH HOH A . 
B 2 HOH 18  218 120 HOH HOH A . 
B 2 HOH 19  219 6   HOH HOH A . 
B 2 HOH 20  220 171 HOH HOH A . 
B 2 HOH 21  221 222 HOH HOH A . 
B 2 HOH 22  222 181 HOH HOH A . 
B 2 HOH 23  223 187 HOH HOH A . 
B 2 HOH 24  224 40  HOH HOH A . 
B 2 HOH 25  225 154 HOH HOH A . 
B 2 HOH 26  226 93  HOH HOH A . 
B 2 HOH 27  227 47  HOH HOH A . 
B 2 HOH 28  228 74  HOH HOH A . 
B 2 HOH 29  229 23  HOH HOH A . 
B 2 HOH 30  230 14  HOH HOH A . 
B 2 HOH 31  231 117 HOH HOH A . 
B 2 HOH 32  232 102 HOH HOH A . 
B 2 HOH 33  233 7   HOH HOH A . 
B 2 HOH 34  234 230 HOH HOH A . 
B 2 HOH 35  235 24  HOH HOH A . 
B 2 HOH 36  236 80  HOH HOH A . 
B 2 HOH 37  237 8   HOH HOH A . 
B 2 HOH 38  238 84  HOH HOH A . 
B 2 HOH 39  239 4   HOH HOH A . 
B 2 HOH 40  240 32  HOH HOH A . 
B 2 HOH 41  241 33  HOH HOH A . 
B 2 HOH 42  242 100 HOH HOH A . 
B 2 HOH 43  243 188 HOH HOH A . 
B 2 HOH 44  244 92  HOH HOH A . 
B 2 HOH 45  245 139 HOH HOH A . 
B 2 HOH 46  246 85  HOH HOH A . 
B 2 HOH 47  247 54  HOH HOH A . 
B 2 HOH 48  248 214 HOH HOH A . 
B 2 HOH 49  249 127 HOH HOH A . 
B 2 HOH 50  250 86  HOH HOH A . 
B 2 HOH 51  251 226 HOH HOH A . 
B 2 HOH 52  252 65  HOH HOH A . 
B 2 HOH 53  253 90  HOH HOH A . 
B 2 HOH 54  254 52  HOH HOH A . 
B 2 HOH 55  255 50  HOH HOH A . 
B 2 HOH 56  256 5   HOH HOH A . 
B 2 HOH 57  257 141 HOH HOH A . 
B 2 HOH 58  258 3   HOH HOH A . 
B 2 HOH 59  259 30  HOH HOH A . 
B 2 HOH 60  260 82  HOH HOH A . 
B 2 HOH 61  261 26  HOH HOH A . 
B 2 HOH 62  262 196 HOH HOH A . 
B 2 HOH 63  263 36  HOH HOH A . 
B 2 HOH 64  264 16  HOH HOH A . 
B 2 HOH 65  265 51  HOH HOH A . 
B 2 HOH 66  266 109 HOH HOH A . 
B 2 HOH 67  267 13  HOH HOH A . 
B 2 HOH 68  268 1   HOH HOH A . 
B 2 HOH 69  269 20  HOH HOH A . 
B 2 HOH 70  270 110 HOH HOH A . 
B 2 HOH 71  271 66  HOH HOH A . 
B 2 HOH 72  272 12  HOH HOH A . 
B 2 HOH 73  273 18  HOH HOH A . 
B 2 HOH 74  274 70  HOH HOH A . 
B 2 HOH 75  275 22  HOH HOH A . 
B 2 HOH 76  276 56  HOH HOH A . 
B 2 HOH 77  277 69  HOH HOH A . 
B 2 HOH 78  278 157 HOH HOH A . 
B 2 HOH 79  279 2   HOH HOH A . 
B 2 HOH 80  280 175 HOH HOH A . 
B 2 HOH 81  281 81  HOH HOH A . 
B 2 HOH 82  282 105 HOH HOH A . 
B 2 HOH 83  283 31  HOH HOH A . 
B 2 HOH 84  284 200 HOH HOH A . 
B 2 HOH 85  285 44  HOH HOH A . 
B 2 HOH 86  286 15  HOH HOH A . 
B 2 HOH 87  287 79  HOH HOH A . 
B 2 HOH 88  288 185 HOH HOH A . 
B 2 HOH 89  289 21  HOH HOH A . 
B 2 HOH 90  290 27  HOH HOH A . 
B 2 HOH 91  291 228 HOH HOH A . 
B 2 HOH 92  292 152 HOH HOH A . 
B 2 HOH 93  293 128 HOH HOH A . 
B 2 HOH 94  294 206 HOH HOH A . 
B 2 HOH 95  295 106 HOH HOH A . 
B 2 HOH 96  296 177 HOH HOH A . 
B 2 HOH 97  297 42  HOH HOH A . 
B 2 HOH 98  298 38  HOH HOH A . 
B 2 HOH 99  299 89  HOH HOH A . 
B 2 HOH 100 300 172 HOH HOH A . 
B 2 HOH 101 301 39  HOH HOH A . 
B 2 HOH 102 302 55  HOH HOH A . 
B 2 HOH 103 303 204 HOH HOH A . 
B 2 HOH 104 304 125 HOH HOH A . 
B 2 HOH 105 305 150 HOH HOH A . 
B 2 HOH 106 306 166 HOH HOH A . 
B 2 HOH 107 307 83  HOH HOH A . 
B 2 HOH 108 308 148 HOH HOH A . 
B 2 HOH 109 309 9   HOH HOH A . 
B 2 HOH 110 310 19  HOH HOH A . 
B 2 HOH 111 311 205 HOH HOH A . 
B 2 HOH 112 312 189 HOH HOH A . 
B 2 HOH 113 313 35  HOH HOH A . 
B 2 HOH 114 314 28  HOH HOH A . 
B 2 HOH 115 315 78  HOH HOH A . 
B 2 HOH 116 316 160 HOH HOH A . 
B 2 HOH 117 317 43  HOH HOH A . 
B 2 HOH 118 318 129 HOH HOH A . 
B 2 HOH 119 319 159 HOH HOH A . 
B 2 HOH 120 320 88  HOH HOH A . 
B 2 HOH 121 321 229 HOH HOH A . 
B 2 HOH 122 322 17  HOH HOH A . 
B 2 HOH 123 323 161 HOH HOH A . 
B 2 HOH 124 324 67  HOH HOH A . 
B 2 HOH 125 325 57  HOH HOH A . 
B 2 HOH 126 326 224 HOH HOH A . 
B 2 HOH 127 327 25  HOH HOH A . 
B 2 HOH 128 328 194 HOH HOH A . 
B 2 HOH 129 329 140 HOH HOH A . 
B 2 HOH 130 330 97  HOH HOH A . 
B 2 HOH 131 331 58  HOH HOH A . 
B 2 HOH 132 332 73  HOH HOH A . 
B 2 HOH 133 333 151 HOH HOH A . 
B 2 HOH 134 334 202 HOH HOH A . 
B 2 HOH 135 335 130 HOH HOH A . 
B 2 HOH 136 336 164 HOH HOH A . 
B 2 HOH 137 337 192 HOH HOH A . 
B 2 HOH 138 338 135 HOH HOH A . 
B 2 HOH 139 339 216 HOH HOH A . 
B 2 HOH 140 340 48  HOH HOH A . 
B 2 HOH 141 341 10  HOH HOH A . 
B 2 HOH 142 342 156 HOH HOH A . 
B 2 HOH 143 343 168 HOH HOH A . 
B 2 HOH 144 344 195 HOH HOH A . 
B 2 HOH 145 345 11  HOH HOH A . 
B 2 HOH 146 346 29  HOH HOH A . 
B 2 HOH 147 347 182 HOH HOH A . 
B 2 HOH 148 348 180 HOH HOH A . 
B 2 HOH 149 349 45  HOH HOH A . 
B 2 HOH 150 350 227 HOH HOH A . 
B 2 HOH 151 351 124 HOH HOH A . 
B 2 HOH 152 352 101 HOH HOH A . 
B 2 HOH 153 353 34  HOH HOH A . 
B 2 HOH 154 354 137 HOH HOH A . 
B 2 HOH 155 355 237 HOH HOH A . 
B 2 HOH 156 356 126 HOH HOH A . 
B 2 HOH 157 357 41  HOH HOH A . 
B 2 HOH 158 358 236 HOH HOH A . 
B 2 HOH 159 359 75  HOH HOH A . 
B 2 HOH 160 360 231 HOH HOH A . 
B 2 HOH 161 361 217 HOH HOH A . 
B 2 HOH 162 362 142 HOH HOH A . 
B 2 HOH 163 363 220 HOH HOH A . 
B 2 HOH 164 364 99  HOH HOH A . 
B 2 HOH 165 365 176 HOH HOH A . 
B 2 HOH 166 366 167 HOH HOH A . 
B 2 HOH 167 367 133 HOH HOH A . 
B 2 HOH 168 368 173 HOH HOH A . 
B 2 HOH 169 369 76  HOH HOH A . 
B 2 HOH 170 370 134 HOH HOH A . 
B 2 HOH 171 371 162 HOH HOH A . 
B 2 HOH 172 372 213 HOH HOH A . 
B 2 HOH 173 373 91  HOH HOH A . 
B 2 HOH 174 374 153 HOH HOH A . 
B 2 HOH 175 375 163 HOH HOH A . 
B 2 HOH 176 376 145 HOH HOH A . 
B 2 HOH 177 377 190 HOH HOH A . 
B 2 HOH 178 378 64  HOH HOH A . 
B 2 HOH 179 379 199 HOH HOH A . 
B 2 HOH 180 380 136 HOH HOH A . 
B 2 HOH 181 381 96  HOH HOH A . 
B 2 HOH 182 382 238 HOH HOH A . 
B 2 HOH 183 383 170 HOH HOH A . 
B 2 HOH 184 384 233 HOH HOH A . 
B 2 HOH 185 385 212 HOH HOH A . 
B 2 HOH 186 386 184 HOH HOH A . 
B 2 HOH 187 387 144 HOH HOH A . 
B 2 HOH 188 388 94  HOH HOH A . 
B 2 HOH 189 389 197 HOH HOH A . 
B 2 HOH 190 390 210 HOH HOH A . 
B 2 HOH 191 391 215 HOH HOH A . 
B 2 HOH 192 392 121 HOH HOH A . 
B 2 HOH 193 393 147 HOH HOH A . 
B 2 HOH 194 394 118 HOH HOH A . 
B 2 HOH 195 395 149 HOH HOH A . 
B 2 HOH 196 396 111 HOH HOH A . 
B 2 HOH 197 397 211 HOH HOH A . 
B 2 HOH 198 398 143 HOH HOH A . 
B 2 HOH 199 399 37  HOH HOH A . 
B 2 HOH 200 400 138 HOH HOH A . 
B 2 HOH 201 401 219 HOH HOH A . 
B 2 HOH 202 402 146 HOH HOH A . 
B 2 HOH 203 403 132 HOH HOH A . 
B 2 HOH 204 404 201 HOH HOH A . 
B 2 HOH 205 405 179 HOH HOH A . 
B 2 HOH 206 406 169 HOH HOH A . 
B 2 HOH 207 407 103 HOH HOH A . 
B 2 HOH 208 408 234 HOH HOH A . 
B 2 HOH 209 409 208 HOH HOH A . 
B 2 HOH 210 410 53  HOH HOH A . 
B 2 HOH 211 411 155 HOH HOH A . 
B 2 HOH 212 412 174 HOH HOH A . 
B 2 HOH 213 413 72  HOH HOH A . 
B 2 HOH 214 414 221 HOH HOH A . 
B 2 HOH 215 415 113 HOH HOH A . 
B 2 HOH 216 416 218 HOH HOH A . 
B 2 HOH 217 417 193 HOH HOH A . 
B 2 HOH 218 418 235 HOH HOH A . 
B 2 HOH 219 419 71  HOH HOH A . 
B 2 HOH 220 420 115 HOH HOH A . 
B 2 HOH 221 421 225 HOH HOH A . 
B 2 HOH 222 422 203 HOH HOH A . 
B 2 HOH 223 423 165 HOH HOH A . 
B 2 HOH 224 424 191 HOH HOH A . 
B 2 HOH 225 425 122 HOH HOH A . 
B 2 HOH 226 426 95  HOH HOH A . 
B 2 HOH 227 427 46  HOH HOH A . 
B 2 HOH 228 428 223 HOH HOH A . 
B 2 HOH 229 429 198 HOH HOH A . 
B 2 HOH 230 430 178 HOH HOH A . 
B 2 HOH 231 431 49  HOH HOH A . 
B 2 HOH 232 432 232 HOH HOH A . 
B 2 HOH 233 433 123 HOH HOH A . 
B 2 HOH 234 434 112 HOH HOH A . 
B 2 HOH 235 435 104 HOH HOH A . 
B 2 HOH 236 436 119 HOH HOH A . 
B 2 HOH 237 437 68  HOH HOH A . 
B 2 HOH 238 438 107 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 72  A MSE 72  ? MET 'modified residue' 
2 A MSE 86  A MSE 86  ? MET 'modified residue' 
3 A MSE 155 A MSE 155 ? MET 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  9280 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-02-03 
2 'Structure model' 1 1 2016-03-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2   ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? xia2   ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 416 ? ? O A HOH 428 ? ? 1.81 
2  1 O   A HOH 379 ? ? O A HOH 429 ? ? 1.96 
3  1 O   A HOH 262 ? ? O A HOH 328 ? ? 1.98 
4  1 O   A HOH 379 ? ? O A HOH 404 ? ? 1.99 
5  1 O   A HOH 319 ? ? O A HOH 375 ? ? 2.02 
6  1 O   A HOH 358 ? ? O A HOH 408 ? ? 2.06 
7  1 NH1 A ARG 117 ? ? O A HOH 201 ? ? 2.08 
8  1 O   A HOH 220 ? ? O A HOH 265 ? ? 2.14 
9  1 O   A HOH 371 ? ? O A HOH 407 ? ? 2.19 
10 1 O   A HOH 209 ? ? O A HOH 369 ? ? 2.19 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     163 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -143.85 
_pdbx_validate_torsion.psi             -82.18 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? A MET 1  
2  1 Y 1 A ARG 2  ? A ARG 2  
3  1 Y 1 A GLY 3  ? A GLY 3  
4  1 Y 1 A SER 4  ? A SER 4  
5  1 Y 1 A HIS 5  ? A HIS 5  
6  1 Y 1 A HIS 6  ? A HIS 6  
7  1 Y 1 A HIS 7  ? A HIS 7  
8  1 Y 1 A HIS 8  ? A HIS 8  
9  1 Y 1 A HIS 9  ? A HIS 9  
10 1 Y 1 A HIS 10 ? A HIS 10 
11 1 Y 1 A GLY 11 ? A GLY 11 
12 1 Y 1 A SER 12 ? A SER 12 
13 1 Y 1 A ALA 13 ? A ALA 13 
14 1 Y 1 A SER 14 ? A SER 14 
15 1 Y 1 A TYR 15 ? A TYR 15 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#